data_4ECQ
# 
_entry.id   4ECQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ECQ         
NDB   NA1700       
RCSB  RCSB071452   
WWPDB D_1000071452 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ECQ 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ECQ 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ECQ 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ?                                     ? 
4 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
5 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
6 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
7 water       nat water                                                18.015    444 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ECQ       4ECQ   2 ? ? ? 
3 PDB 4ECQ       4ECQ   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ECQ A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ECQ T 1 ? 12  ? 4ECQ   1 ? 12  ? 1 12  
3 3 4ECQ P 1 ? 9   ? 4ECQ   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ECQ GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ECQ PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ECQ HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ECQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-08-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ECQ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   72821 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.058 
_reflns.pdbx_netI_over_sigmaI        17.8 
_reflns.B_iso_Wilson_estimate        15.980 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.50 
_reflns_shell.d_res_low                   1.53 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.618 
_reflns_shell.meanI_over_sigI_obs         1.4 
_reflns_shell.pdbx_redundancy             2.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ECQ 
_refine.ls_number_reflns_obs                     72699 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.05 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.012 
_refine.ls_d_res_high                            1.500 
_refine.ls_percent_reflns_obs                    99.57 
_refine.ls_R_factor_obs                          0.1747 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1725 
_refine.ls_R_factor_R_free                       0.2005 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.74 
_refine.ls_number_reflns_R_free                  5626 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               27.2700 
_refine.aniso_B[1][1]                            -0.0362 
_refine.aniso_B[2][2]                            -0.0362 
_refine.aniso_B[3][3]                            0.0724 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.346 
_refine.solvent_model_param_bsol                 43.637 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.18 
_refine.overall_FOM_work_R_set                   0.8811 
_refine.B_iso_max                                153.670 
_refine.B_iso_min                                4.490 
_refine.pdbx_overall_phase_error                 19.4900 
_refine.occupancy_max                            1.200 
_refine.occupancy_min                            0.100 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             444 
_refine_hist.number_atoms_total               4246 
_refine_hist.d_res_high                       1.500 
_refine_hist.d_res_low                        24.012 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4116 0.006  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5664 1.126  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     631  0.066  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      656  0.005  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1633 18.175 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.5000 1.5171  30 98.0000  2202 . 0.2708 0.2876 . 186 . 2388 . 'X-RAY DIFFRACTION' . 
1.5171 1.5349  30 100.0000 2218 . 0.2593 0.3058 . 186 . 2404 . 'X-RAY DIFFRACTION' . 
1.5349 1.5536  30 100.0000 2262 . 0.2398 0.2474 . 167 . 2429 . 'X-RAY DIFFRACTION' . 
1.5536 1.5733  30 100.0000 2255 . 0.2314 0.2618 . 175 . 2430 . 'X-RAY DIFFRACTION' . 
1.5733 1.5940  30 100.0000 2251 . 0.2235 0.2880 . 190 . 2441 . 'X-RAY DIFFRACTION' . 
1.5940 1.6158  30 100.0000 2201 . 0.2198 0.2392 . 187 . 2388 . 'X-RAY DIFFRACTION' . 
1.6158 1.6389  30 100.0000 2197 . 0.2087 0.2323 . 212 . 2409 . 'X-RAY DIFFRACTION' . 
1.6389 1.6633  30 100.0000 2252 . 0.2034 0.2378 . 187 . 2439 . 'X-RAY DIFFRACTION' . 
1.6633 1.6893  30 100.0000 2247 . 0.2057 0.2381 . 193 . 2440 . 'X-RAY DIFFRACTION' . 
1.6893 1.7170  30 100.0000 2219 . 0.1892 0.2277 . 194 . 2413 . 'X-RAY DIFFRACTION' . 
1.7170 1.7466  30 100.0000 2248 . 0.1823 0.1959 . 183 . 2431 . 'X-RAY DIFFRACTION' . 
1.7466 1.7784  30 100.0000 2200 . 0.1802 0.2233 . 205 . 2405 . 'X-RAY DIFFRACTION' . 
1.7784 1.8126  30 100.0000 2262 . 0.1851 0.2288 . 189 . 2451 . 'X-RAY DIFFRACTION' . 
1.8126 1.8496  30 100.0000 2196 . 0.1723 0.2119 . 191 . 2387 . 'X-RAY DIFFRACTION' . 
1.8496 1.8898  30 100.0000 2230 . 0.1678 0.2067 . 211 . 2441 . 'X-RAY DIFFRACTION' . 
1.8898 1.9337  30 100.0000 2252 . 0.1664 0.2224 . 176 . 2428 . 'X-RAY DIFFRACTION' . 
1.9337 1.9820  30 100.0000 2269 . 0.1649 0.1910 . 177 . 2446 . 'X-RAY DIFFRACTION' . 
1.9820 2.0356  30 100.0000 2223 . 0.1615 0.1841 . 186 . 2409 . 'X-RAY DIFFRACTION' . 
2.0356 2.0955  30 100.0000 2247 . 0.1628 0.1761 . 190 . 2437 . 'X-RAY DIFFRACTION' . 
2.0955 2.1631  30 100.0000 2255 . 0.1555 0.2046 . 171 . 2426 . 'X-RAY DIFFRACTION' . 
2.1631 2.2403  30 100.0000 2241 . 0.1564 0.1800 . 195 . 2436 . 'X-RAY DIFFRACTION' . 
2.2403 2.3299  30 100.0000 2249 . 0.1638 0.2205 . 171 . 2420 . 'X-RAY DIFFRACTION' . 
2.3299 2.4359  30 100.0000 2246 . 0.1678 0.2072 . 191 . 2437 . 'X-RAY DIFFRACTION' . 
2.4359 2.5642  30 100.0000 2219 . 0.1826 0.2150 . 220 . 2439 . 'X-RAY DIFFRACTION' . 
2.5642 2.7246  30 99.0000  2230 . 0.1853 0.2214 . 193 . 2423 . 'X-RAY DIFFRACTION' . 
2.7246 2.9346  30 99.0000  2237 . 0.1781 0.1960 . 167 . 2404 . 'X-RAY DIFFRACTION' . 
2.9346 3.2293  30 99.0000  2262 . 0.1709 0.1930 . 181 . 2443 . 'X-RAY DIFFRACTION' . 
3.2293 3.6952  30 100.0000 2243 . 0.1464 0.1687 . 189 . 2432 . 'X-RAY DIFFRACTION' . 
3.6952 4.6500  30 99.0000  2272 . 0.1356 0.1585 . 168 . 2440 . 'X-RAY DIFFRACTION' . 
4.6500 24.0148 30 95.0000  2188 . 0.1649 0.1716 . 195 . 2383 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ECQ 
_struct.title                     'Human DNA polymerase eta- DNA ternary complex: AT crystal at pH6.8(K+ MES) with 1 Ca2+ ion' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ECQ 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A MET 17  O   ? ? ? 1_555 D CA  . CA  ? ? A MET 14  A CA  501 1_555 ? ? ? ? ? ? ?            2.286 ? 
metalc2  metalc ? ? D CA  .   CA  ? ? ? 1_555 H DTP . O3G ? ? A CA  501 P DTP 502 1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc3  metalc ? ? A ASP 118 OD1 ? ? ? 1_555 D CA  . CA  ? ? A ASP 115 A CA  501 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc4  metalc ? ? D CA  .   CA  ? ? ? 1_555 H DTP . O1B ? ? A CA  501 P DTP 502 1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc5  metalc ? ? A ASP 16  OD2 ? ? ? 1_555 D CA  . CA  ? ? A ASP 13  A CA  501 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc6  metalc ? ? D CA  .   CA  ? ? ? 1_555 H DTP . O2A ? ? A CA  501 P DTP 502 1_555 ? ? ? ? ? ? ?            2.399 ? 
hydrog1  hydrog ? ? B DA  5   N1  ? ? ? 1_555 C DT  8 N3  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6  ? ? ? 1_555 C DT  8 O4  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1  ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6  ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3  ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4  ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2  ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1  ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2  ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6  ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3  ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4  ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2  ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3  ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4  ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 0.71  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -0.59 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -5.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 501'  
AC2 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE DTP P 502' 
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 503' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 504' 
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 505' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 4  MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 4  ASP A 118 ? ASP A 115 . ? 1_555 ? 
4  AC1 4  DTP H .   ? DTP P 502 . ? 1_555 ? 
5  AC2 25 ASP A 16  ? ASP A 13  . ? 1_555 ? 
6  AC2 25 MET A 17  ? MET A 14  . ? 1_555 ? 
7  AC2 25 ASP A 18  ? ASP A 15  . ? 1_555 ? 
8  AC2 25 CYS A 19  ? CYS A 16  . ? 1_555 ? 
9  AC2 25 PHE A 20  ? PHE A 17  . ? 1_555 ? 
10 AC2 25 PHE A 21  ? PHE A 18  . ? 1_555 ? 
11 AC2 25 ILE A 51  ? ILE A 48  . ? 1_555 ? 
12 AC2 25 ALA A 52  ? ALA A 49  . ? 1_555 ? 
13 AC2 25 TYR A 55  ? TYR A 52  . ? 1_555 ? 
14 AC2 25 ARG A 58  ? ARG A 55  . ? 1_555 ? 
15 AC2 25 ARG A 64  ? ARG A 61  . ? 1_555 ? 
16 AC2 25 ASP A 118 ? ASP A 115 . ? 1_555 ? 
17 AC2 25 LYS A 234 ? LYS A 231 . ? 1_555 ? 
18 AC2 25 CA  D .   ? CA  A 501 . ? 1_555 ? 
19 AC2 25 HOH I .   ? HOH A 612 . ? 1_555 ? 
20 AC2 25 HOH I .   ? HOH A 638 . ? 1_555 ? 
21 AC2 25 HOH I .   ? HOH A 639 . ? 1_555 ? 
22 AC2 25 HOH I .   ? HOH A 733 . ? 1_555 ? 
23 AC2 25 HOH I .   ? HOH A 968 . ? 1_555 ? 
24 AC2 25 HOH I .   ? HOH A 975 . ? 1_555 ? 
25 AC2 25 HOH I .   ? HOH A 976 . ? 1_555 ? 
26 AC2 25 DT  C 8   ? DT  P 8   . ? 1_555 ? 
27 AC2 25 HOH K .   ? HOH P 110 . ? 1_555 ? 
28 AC2 25 DT  B 4   ? DT  T 4   . ? 1_555 ? 
29 AC2 25 DA  B 5   ? DA  T 5   . ? 1_555 ? 
30 AC3 9  ARG A 27  ? ARG A 24  . ? 6_545 ? 
31 AC3 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
32 AC3 9  SER A 251 ? SER A 248 . ? 1_555 ? 
33 AC3 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
34 AC3 9  GLU A 280 ? GLU A 277 . ? 1_555 ? 
35 AC3 9  HOH I .   ? HOH A 602 . ? 1_555 ? 
36 AC3 9  HOH I .   ? HOH A 644 . ? 1_555 ? 
37 AC3 9  HOH I .   ? HOH A 675 . ? 1_555 ? 
38 AC3 9  HOH I .   ? HOH A 708 . ? 1_555 ? 
39 AC4 9  GLU A 97  ? GLU A 94  . ? 1_555 ? 
40 AC4 9  ALA A 98  ? ALA A 95  . ? 1_555 ? 
41 AC4 9  GLU A 101 ? GLU A 98  . ? 1_555 ? 
42 AC4 9  ARG A 306 ? ARG A 303 . ? 5_664 ? 
43 AC4 9  HOH I .   ? HOH A 631 . ? 1_555 ? 
44 AC4 9  HOH I .   ? HOH A 637 . ? 1_555 ? 
45 AC4 9  HOH I .   ? HOH A 736 . ? 5_664 ? 
46 AC4 9  HOH I .   ? HOH A 807 . ? 5_664 ? 
47 AC4 9  HOH I .   ? HOH A 821 . ? 5_664 ? 
48 AC5 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
49 AC5 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
50 AC5 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
51 AC5 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
52 AC5 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
53 AC5 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
54 AC5 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
55 AC5 10 HOH I .   ? HOH A 670 . ? 1_555 ? 
56 AC5 10 HOH I .   ? HOH A 800 . ? 5_664 ? 
57 AC5 10 HOH I .   ? HOH A 835 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ECQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ECQ 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 66.056 -34.087 -3.529  1.00 70.56  ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.452 -33.930 -3.895  1.00 48.90  ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.668 -33.065 -5.125  1.00 44.71  ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.304 -31.889 -5.132  1.00 48.05  ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.261 -33.651 -6.178  1.00 46.90  ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.636 -32.963 -7.423  1.00 37.99  ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.449 -32.491 -8.266  1.00 54.21  ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.652 -31.796 -9.264  1.00 59.34  ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.427 -34.033 -8.188  1.00 60.67  ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.920 -35.333 -7.652  1.00 57.81  ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.636 -35.076 -6.201  1.00 53.64  ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.234 -32.858 -7.872  1.00 46.97  ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.041 -32.478 -8.630  1.00 27.06  ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.098 -31.620 -7.799  1.00 46.67  ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.032 -31.224 -8.269  1.00 45.76  ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.318 -33.726 -9.139  1.00 29.66  ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.221 -34.679 -9.845  1.00 33.00  ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.947 -34.326 -10.961 1.00 35.17  ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.538 -35.970 -9.582  1.00 31.54  ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.664 -35.360 -11.364 1.00 31.13  ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.432 -36.369 -10.543 1.00 33.15  ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.502 -31.331 -6.566  1.00 49.52  ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.676 -30.546 -5.655  1.00 45.98  ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.875 -29.047 -5.878  1.00 41.03  ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.962 -28.513 -5.651  1.00 33.76  ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.994 -30.910 -4.202  1.00 84.20  ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.854 -30.639 -3.234  1.00 84.67  ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.443 -31.724 -3.528  1.00 134.15 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 62.181 -33.326 -3.214  1.00 116.24 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.820 -28.375 -6.331  1.00 40.31  ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.876 -26.935 -6.564  1.00 43.89  ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.142 -26.202 -5.257  1.00 34.80  ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.698 -26.631 -4.190  1.00 33.55  ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.585 -26.447 -7.197  1.00 58.57  ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.880 -25.099 -5.339  1.00 28.95  ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.233 -24.339 -4.145  1.00 20.06  ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.755 -22.893 -4.229  1.00 21.40  ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.998 -22.107 -3.316  1.00 24.62  ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.744 -24.362 -3.893  1.00 28.44  ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.423 -23.785 -5.015  1.00 27.78  ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.223 -25.796 -3.692  1.00 28.44  ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.070 -22.551 -5.320  1.00 22.16  ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.497 -21.220 -5.484  1.00 17.56  ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.535 -20.115 -5.405  1.00 21.21  ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.299 -19.076 -4.779  1.00 22.37  ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.683 -20.341 -6.045  1.00 18.17  ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.801 -19.399 -5.985  1.00 12.18  ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.134 -18.812 -7.354  1.00 18.92  ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.237 -18.308 -7.574  1.00 20.40  ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.031 -20.097 -5.408  1.00 15.95  ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.981 -20.297 -3.902  1.00 18.27  ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.175 -21.077 -3.406  1.00 19.47  ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.341 -22.247 -3.752  1.00 22.30  ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 69.021 -20.438 -2.605  1.00 20.43  ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.149 -18.845 -8.246  1.00 19.57  ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.319 -18.496 -9.654  1.00 19.64  ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.250 -16.996 -9.970  1.00 19.69  ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.724 -16.564 -11.018 1.00 24.95  ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.256 -19.223 -10.495 1.00 26.92  ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.843 -19.065 -9.926  1.00 34.31  ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.613 -19.447 -8.757  1.00 37.65  ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.953 -18.551 -10.645 1.00 38.80  ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.643 -16.214 -9.084  1.00 15.28  ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.448 -14.787 -9.315  1.00 11.23  ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.062 -13.978 -8.194  1.00 14.66  ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.285 -14.494 -7.101  1.00 14.05  ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.950 -14.452 -9.357  1.00 14.37  ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.148 -15.149 -10.452 1.00 17.08  ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.683 -14.746 -10.356 1.00 16.17  ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.028 -15.374 -9.209  1.00 16.20  ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.940 -14.904 -8.607  1.00 13.91  ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.421 -15.568 -7.579  1.00 15.01  ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.371 -13.768 -9.010  1.00 15.22  ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.320 -12.702 -8.468  1.00 12.21  ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.600 -11.716 -7.420  1.00 7.60   ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.459 -10.711 -7.463  1.00 14.02  ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.229 -10.087 -8.501  1.00 13.73  ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.933 -10.993 -7.636  1.00 14.07  ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.191 -9.989  -6.510  1.00 15.67  ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.081 -12.006 -7.687  1.00 14.92  ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.722 -10.585 -6.352  1.00 11.09  ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.562 -9.709  -6.270  1.00 6.20   ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.765 -8.775  -5.089  1.00 9.89   ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.191 -9.212  -4.017  1.00 11.59  ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.285 -10.519 -6.061  1.00 9.42   ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.071 -9.614  -5.823  1.00 12.72  ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.049 -11.426 -7.257  1.00 12.26  ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.473 -7.489  -5.270  1.00 11.02  ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.486 -6.554  -4.155  1.00 6.18   ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.107 -5.960  -3.971  1.00 11.07  ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.308 -5.906  -4.921  1.00 14.24  ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.495 -5.439  -4.396  1.00 12.56  ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.833 -5.501  -2.753  1.00 9.84   ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.649 -4.726  -2.447  1.00 6.18   ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.132 -3.442  -1.798  1.00 13.78  ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.871 -3.486  -0.809  1.00 14.07  ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.738 -5.508  -1.516  1.00 11.12  ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.375 -4.974  -1.043  1.00 12.87  ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.496 -4.067  0.190   1.00 15.16  ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.599 -4.257  -2.183  1.00 13.44  ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.753 -2.308  -2.385  1.00 10.81  ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.086 -1.002  -1.829  1.00 7.16   ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.828 -0.396  -1.233  1.00 14.71  ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.765 -0.403  -1.866  1.00 13.06  ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.621 -0.082  -2.931  1.00 12.51  ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 60.933 1.308   -2.379  1.00 15.24  ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.863 -0.691  -3.556  1.00 17.24  ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 58.946 0.119   -0.009  1.00 12.59  ? 13  ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.792 0.593   0.770   1.00 8.94   ? 13  ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 58.204 1.931   1.379   1.00 11.14  ? 13  ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 59.110 1.973   2.216   1.00 13.75  ? 13  ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.546 -0.457  1.862   1.00 14.03  ? 13  ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 56.254 -0.277  2.614   1.00 25.43  ? 13  ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 55.850 -1.230  3.331   1.00 29.16  ? 13  ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 55.640 0.784   2.508   1.00 18.29  ? 13  ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.558 3.028   0.978   1.00 9.07   ? 14  MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 57.927 4.347   1.505   1.00 5.59   ? 14  MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.670 4.420   3.000   1.00 11.21  ? 14  MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.694 3.873   3.497   1.00 13.27  ? 14  MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 57.152 5.453   0.794   1.00 12.02  ? 14  MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 57.217 5.368   -0.740  1.00 13.58  ? 14  MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.914 5.419   -1.367  1.00 16.55  ? 14  MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.423 7.011   -0.789  1.00 18.75  ? 14  MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.558 5.071   3.732   1.00 10.19  ? 15  ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.338 5.214   5.168   1.00 7.64   ? 15  ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.272 6.267   5.426   1.00 10.47  ? 15  ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.247 7.336   4.770   1.00 10.94  ? 15  ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.633 5.610   5.861   1.00 10.44  ? 15  ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.728 4.553   5.708   1.00 12.74  ? 15  ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.389 3.360   5.670   1.00 15.69  ? 15  ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.907 4.924   5.670   1.00 17.93  ? 15  ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.389 5.965   6.378   1.00 10.95  ? 16  CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.310 6.886   6.789   1.00 7.98   ? 16  CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.929 7.858   5.676   1.00 11.24  ? 16  CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 55.073 9.075   5.821   1.00 11.79  ? 16  CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.656 7.624   8.091   1.00 10.85  ? 16  CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 57.208 8.527   8.166   1.00 15.07  ? 16  CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.424 7.323   4.567   1.00 10.62  ? 17  PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.442 8.060   3.310   1.00 6.93   ? 17  PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.706 9.401   3.335   1.00 10.81  ? 17  PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.289 10.420  2.950   1.00 10.59  ? 17  PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.898 7.188   2.173   1.00 9.32   ? 17  PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.977 7.846   0.822   1.00 9.20   ? 17  PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 55.170 8.404   0.371   1.00 12.76  ? 17  PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.868 7.873   -0.008  1.00 12.46  ? 17  PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 55.244 9.005   -0.886  1.00 14.37  ? 17  PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.949 8.475   -1.278  1.00 13.58  ? 17  PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 54.133 9.030   -1.703  1.00 15.37  ? 17  PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.436 9.439   3.761   1.00 8.15   ? 18  PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.726 10.706  3.688   1.00 5.90   ? 18  PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.395 11.755  4.586   1.00 9.35   ? 18  PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.349 12.952  4.285   1.00 10.86  ? 18  PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.241 10.593  4.059   1.00 9.68   ? 18  PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.387 9.862   3.059   1.00 12.05  ? 18  PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 49.938 9.075   2.060   1.00 12.81  ? 18  PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 48.020 9.962   3.142   1.00 12.34  ? 18  PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 49.117 8.411   1.148   1.00 13.79  ? 18  PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 47.191 9.290   2.235   1.00 13.45  ? 18  PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.746 8.516   1.248   1.00 13.64  ? 18  PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.966 11.307  5.707   1.00 9.10   ? 19  VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.715 12.199  6.591   1.00 6.38   ? 19  VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.914 12.800  5.865   1.00 9.42   ? 19  VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 55.132 14.015  5.930   1.00 11.21  ? 19  VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 54.154 11.478  7.870   1.00 9.23   ? 19  VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 55.261 12.258  8.597   1.00 13.09  ? 19  VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.951 11.269  8.780   1.00 15.16  ? 19  VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.702 11.978  5.172   1.00 8.68   ? 20  GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.836 12.535  4.442   1.00 5.43   ? 20  GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.416 13.528  3.367   1.00 9.11   ? 20  GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 57.116 14.523  3.140   1.00 11.25  ? 20  GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.672 11.457  3.778   1.00 9.26   ? 20  GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.459 10.570  4.715   1.00 12.14  ? 20  GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.540 9.853   3.932   1.00 15.39  ? 20  GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.593 10.424  3.664   1.00 14.67  ? 20  GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.272 8.611   3.530   1.00 16.29  ? 20  GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.304 13.265  2.670   1.00 8.93   ? 21  VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.800 14.218  1.679   1.00 5.35   ? 21  VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.533 15.583  2.355   1.00 9.59   ? 21  VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.930 16.638  1.832   1.00 12.12  ? 21  VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.548 13.686  0.942   1.00 10.07  ? 21  VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.981 14.746  0.015   1.00 10.21  ? 21  VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.877 12.405  0.155   1.00 10.97  ? 21  VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.896 15.565  3.530   1.00 9.15   ? 22  GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.587 16.800  4.237   1.00 6.33   ? 22  GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.834 17.454  4.828   1.00 9.82   ? 22  GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.929 18.685  4.880   1.00 11.25  ? 22  GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.512 16.555  5.311   1.00 10.00  ? 22  GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 51.171 16.090  4.744   1.00 11.51  ? 22  GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.463 17.141  3.892   1.00 14.99  ? 22  GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.718 18.349  4.071   1.00 16.37  ? 22  GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.629 16.756  3.042   1.00 16.70  ? 22  GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.802 16.641  5.266   1.00 9.53   ? 23  GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 57.040 17.208  5.811   1.00 7.23   ? 23  GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.922 17.824  4.725   1.00 11.54  ? 23  GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.627 18.799  4.984   1.00 11.71  ? 23  GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.832 16.129  6.534   1.00 10.33  ? 23  GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 57.221 15.696  7.844   1.00 11.84  ? 23  GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.963 14.531  8.457   1.00 15.77  ? 23  GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.395 13.626  7.749   1.00 14.87  ? 23  GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 58.124 14.553  9.775   1.00 15.57  ? 23  GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.913 17.257  3.517   1.00 10.44  ? 24  ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.655 17.899  2.430   1.00 7.49   ? 24  ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 58.077 19.287  2.170   1.00 13.53  ? 24  ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.819 20.252  2.011   1.00 12.81  ? 24  ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.603 17.050  1.159   1.00 10.35  ? 24  ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 59.393 17.672  -0.006  1.00 11.16  ? 24  ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.422 16.750  -1.225  1.00 13.33  ? 24  ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 58.124 16.666  -1.885  1.00 12.08  ? 24  ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.937 16.077  -3.060  1.00 10.86  ? 24  ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.961 15.506  -3.684  1.00 11.77  ? 24  ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.733 16.057  -3.605  1.00 12.45  ? 24  ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.745 19.385  2.162   1.00 10.14  ? 25  GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 56.065 20.634  1.840   1.00 7.59   ? 25  GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 56.219 21.679  2.941   1.00 11.12  ? 25  GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 56.346 22.876  2.656   1.00 13.24  ? 25  GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.584 20.370  1.571   1.00 11.51  ? 25  GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.788 21.599  1.159   1.00 14.96  ? 25  GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 52.313 21.271  1.029   1.00 19.71  ? 25  GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.950 20.271  0.424   1.00 21.50  ? 25  GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.461 22.104  1.619   1.00 27.62  ? 25  GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 56.191 21.219  4.192   1.00 9.75   ? 26  ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 56.244 22.092  5.354   1.00 8.85   ? 26  ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.407 21.714  6.251   1.00 11.25  ? 26  ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 57.309 20.810  7.080   1.00 11.55  ? 26  ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.930 22.038  6.140   1.00 11.69  ? 26  ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.931 22.987  7.326   1.00 14.93  ? 26  ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.931 23.639  7.601   1.00 16.18  ? 26  ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.801 23.077  8.021   1.00 20.35  ? 26  ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.547 22.388  6.071   1.00 12.10  ? 27  PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.728 21.998  6.838   1.00 10.99  ? 27  PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.554 22.078  8.362   1.00 13.98  ? 27  PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 60.325 21.433  9.073   1.00 14.61  ? 27  PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.783 23.015  6.380   1.00 17.03  ? 27  PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 60.341 23.401  4.997   1.00 16.56  ? 27  PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.839 23.414  5.050   1.00 15.00  ? 27  PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.572 22.841  8.847   1.00 13.44  ? 28  HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.301 22.906  10.287  1.00 14.97  ? 28  HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.900 21.557  10.881  1.00 16.77  ? 28  HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 57.987 21.355  12.099  1.00 18.77  ? 28  HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 57.186 23.915  10.584  1.00 18.11  ? 28  HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.625 25.338  10.536  1.00 25.47  ? 28  HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 56.874 26.331  9.941   1.00 30.08  ? 28  HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.730 25.945  11.026  1.00 21.66  ? 28  HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.503 27.485  10.059  1.00 28.19  ? 28  HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.635 27.277  10.713  1.00 26.08  ? 28  HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.454 20.638  10.031  1.00 14.76  ? 29  LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 57.017 19.310  10.481  1.00 10.09  ? 29  LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 58.149 18.279  10.465  1.00 12.19  ? 29  LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 58.004 17.172  10.987  1.00 12.76  ? 29  LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.878 18.788  9.587   1.00 12.18  ? 29  LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.610 19.639  9.505   1.00 15.91  ? 29  LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.611 19.028  8.525   1.00 14.87  ? 29  LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 53.993 19.767  10.902  1.00 19.27  ? 29  LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 59.287 18.636  9.865   1.00 12.68  ? 30  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.398 17.693  9.747   1.00 11.37  ? 30  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 61.000 17.332  11.097  1.00 13.81  ? 30  ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 61.165 18.194  11.963  1.00 16.58  ? 30  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.480 18.271  8.825   1.00 12.53  ? 30  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.988 18.450  7.388   1.00 12.62  ? 30  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 61.999 19.138  6.504   1.00 15.38  ? 30  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.430 19.414  5.186   1.00 14.96  ? 30  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 62.139 19.889  4.170   1.00 17.89  ? 30  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.433 20.134  4.330   1.00 19.27  ? 30  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.558 20.127  3.003   1.00 15.56  ? 30  ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.304 16.050  11.280  1.00 16.35  ? 31  ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 61.953 15.580  12.503  1.00 17.02  ? 31  ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 61.147 15.898  13.758  1.00 21.97  ? 31  ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.704 16.242  14.811  1.00 25.09  ? 31  ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.358 16.173  12.613  1.00 23.09  ? 31  ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 64.214 15.841  11.411  1.00 26.23  ? 31  ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.403 14.671  11.076  1.00 34.33  ? 31  ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.695 16.871  10.723  1.00 29.30  ? 31  ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.830 15.791  13.635  1.00 15.92  ? 32  LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.922 16.059  14.737  1.00 14.79  ? 32  LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.953 14.907  14.841  1.00 15.02  ? 32  LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.706 14.214  13.849  1.00 15.58  ? 32  LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 58.098 17.327  14.461  1.00 18.46  ? 32  LYS A CB    1 
ATOM   278  C  CG    A LYS A 1 35  ? 58.924 18.581  14.195  0.50 20.65  ? 32  LYS A CG    1 
ATOM   279  C  CG    B LYS A 1 35  ? 58.886 18.629  14.518  0.50 21.99  ? 32  LYS A CG    1 
ATOM   280  C  CD    A LYS A 1 35  ? 59.617 19.059  15.456  0.50 26.53  ? 32  LYS A CD    1 
ATOM   281  C  CD    B LYS A 1 35  ? 58.914 19.195  15.927  0.50 25.29  ? 32  LYS A CD    1 
ATOM   282  C  CE    A LYS A 1 35  ? 60.610 20.175  15.158  0.50 29.27  ? 32  LYS A CE    1 
ATOM   283  C  CE    B LYS A 1 35  ? 59.675 20.511  15.974  0.50 29.07  ? 32  LYS A CE    1 
ATOM   284  N  NZ    A LYS A 1 35  ? 59.979 21.339  14.483  0.50 37.17  ? 32  LYS A NZ    1 
ATOM   285  N  NZ    B LYS A 1 35  ? 59.728 21.060  17.356  0.50 29.14  ? 32  LYS A NZ    1 
ATOM   286  N  N     . PRO A 1 36  ? 57.371 14.709  16.032  1.00 13.60  ? 33  PRO A N     1 
ATOM   287  C  CA    . PRO A 1 36  ? 56.215 13.820  16.122  1.00 10.74  ? 33  PRO A CA    1 
ATOM   288  C  C     . PRO A 1 36  ? 55.052 14.466  15.377  1.00 13.02  ? 33  PRO A C     1 
ATOM   289  O  O     . PRO A 1 36  ? 54.611 15.563  15.726  1.00 14.84  ? 33  PRO A O     1 
ATOM   290  C  CB    . PRO A 1 36  ? 55.917 13.772  17.620  1.00 12.41  ? 33  PRO A CB    1 
ATOM   291  C  CG    . PRO A 1 36  ? 56.498 15.043  18.186  1.00 19.75  ? 33  PRO A CG    1 
ATOM   292  C  CD    . PRO A 1 36  ? 57.693 15.361  17.317  1.00 18.37  ? 33  PRO A CD    1 
ATOM   293  N  N     A CYS A 1 37  ? 54.563 13.805  14.346  0.50 12.80  ? 34  CYS A N     1 
ATOM   294  N  N     B CYS A 1 37  ? 54.576 13.781  14.337  0.50 12.66  ? 34  CYS A N     1 
ATOM   295  C  CA    A CYS A 1 37  ? 53.460 14.382  13.619  0.50 8.72   ? 34  CYS A CA    1 
ATOM   296  C  CA    B CYS A 1 37  ? 53.664 14.362  13.353  0.50 11.72  ? 34  CYS A CA    1 
ATOM   297  C  C     A CYS A 1 37  ? 52.656 13.285  12.967  0.50 12.77  ? 34  CYS A C     1 
ATOM   298  C  C     B CYS A 1 37  ? 52.711 13.282  12.838  0.50 12.89  ? 34  CYS A C     1 
ATOM   299  O  O     A CYS A 1 37  ? 53.084 12.131  12.908  0.50 14.22  ? 34  CYS A O     1 
ATOM   300  O  O     B CYS A 1 37  ? 53.092 12.112  12.765  0.50 14.60  ? 34  CYS A O     1 
ATOM   301  C  CB    A CYS A 1 37  ? 53.970 15.401  12.590  0.50 12.96  ? 34  CYS A CB    1 
ATOM   302  C  CB    B CYS A 1 37  ? 54.498 14.945  12.197  0.50 19.36  ? 34  CYS A CB    1 
ATOM   303  S  SG    A CYS A 1 37  ? 55.109 14.731  11.347  0.50 11.46  ? 34  CYS A SG    1 
ATOM   304  S  SG    B CYS A 1 37  ? 53.621 15.727  10.808  0.50 19.16  ? 34  CYS A SG    1 
ATOM   305  N  N     . ALA A 1 38  ? 51.475 13.654  12.502  1.00 11.04  ? 35  ALA A N     1 
ATOM   306  C  CA    . ALA A 1 38  ? 50.556 12.708  11.892  1.00 7.70   ? 35  ALA A CA    1 
ATOM   307  C  C     . ALA A 1 38  ? 49.741 13.436  10.857  1.00 10.05  ? 35  ALA A C     1 
ATOM   308  O  O     . ALA A 1 38  ? 49.615 14.658  10.904  1.00 11.74  ? 35  ALA A O     1 
ATOM   309  C  CB    . ALA A 1 38  ? 49.652 12.081  12.938  1.00 13.09  ? 35  ALA A CB    1 
ATOM   310  N  N     . VAL A 1 39  ? 49.187 12.666  9.919   1.00 10.83  ? 36  VAL A N     1 
ATOM   311  C  CA    . VAL A 1 39  ? 48.261 13.198  8.934   1.00 9.04   ? 36  VAL A CA    1 
ATOM   312  C  C     . VAL A 1 39  ? 46.859 12.760  9.288   1.00 13.78  ? 36  VAL A C     1 
ATOM   313  O  O     . VAL A 1 39  ? 46.643 11.586  9.607   1.00 13.39  ? 36  VAL A O     1 
ATOM   314  C  CB    . VAL A 1 39  ? 48.618 12.683  7.547   1.00 10.62  ? 36  VAL A CB    1 
ATOM   315  C  CG1   . VAL A 1 39  ? 47.547 13.076  6.519   1.00 12.53  ? 36  VAL A CG1   1 
ATOM   316  C  CG2   . VAL A 1 39  ? 49.970 13.255  7.142   1.00 13.27  ? 36  VAL A CG2   1 
ATOM   317  N  N     . VAL A 1 40  ? 45.911 13.700  9.237   1.00 13.25  ? 37  VAL A N     1 
ATOM   318  C  CA    . VAL A 1 40  ? 44.543 13.453  9.688   1.00 12.21  ? 37  VAL A CA    1 
ATOM   319  C  C     . VAL A 1 40  ? 43.541 13.802  8.596   1.00 15.60  ? 37  VAL A C     1 
ATOM   320  O  O     . VAL A 1 40  ? 43.823 14.622  7.729   1.00 16.82  ? 37  VAL A O     1 
ATOM   321  C  CB    . VAL A 1 40  ? 44.216 14.317  10.952  1.00 15.91  ? 37  VAL A CB    1 
ATOM   322  C  CG1   A VAL A 1 40  ? 44.937 13.784  12.173  0.66 16.18  ? 37  VAL A CG1   1 
ATOM   323  C  CG1   B VAL A 1 40  ? 44.084 15.791  10.575  0.34 13.30  ? 37  VAL A CG1   1 
ATOM   324  C  CG2   A VAL A 1 40  ? 44.526 15.796  10.708  0.66 15.56  ? 37  VAL A CG2   1 
ATOM   325  C  CG2   B VAL A 1 40  ? 42.972 13.847  11.621  0.34 12.95  ? 37  VAL A CG2   1 
ATOM   326  N  N     A GLN A 1 41  ? 42.382 13.160  8.589   0.52 15.06  ? 38  GLN A N     1 
ATOM   327  N  N     B GLN A 1 41  ? 42.365 13.172  8.673   0.48 12.61  ? 38  GLN A N     1 
ATOM   328  C  CA    A GLN A 1 41  ? 41.359 13.595  7.645   0.52 11.83  ? 38  GLN A CA    1 
ATOM   329  C  CA    B GLN A 1 41  ? 41.221 13.487  7.813   0.48 12.74  ? 38  GLN A CA    1 
ATOM   330  C  C     A GLN A 1 41  ? 40.163 14.108  8.412   0.52 14.41  ? 38  GLN A C     1 
ATOM   331  C  C     B GLN A 1 41  ? 40.024 13.879  8.677   0.48 15.65  ? 38  GLN A C     1 
ATOM   332  O  O     A GLN A 1 41  ? 39.754 13.517  9.415   0.52 15.41  ? 38  GLN A O     1 
ATOM   333  O  O     B GLN A 1 41  ? 39.659 13.144  9.593   0.48 13.66  ? 38  GLN A O     1 
ATOM   334  C  CB    A GLN A 1 41  ? 40.981 12.502  6.651   0.52 18.16  ? 38  GLN A CB    1 
ATOM   335  C  CB    B GLN A 1 41  ? 40.820 12.272  6.973   0.48 18.23  ? 38  GLN A CB    1 
ATOM   336  C  CG    A GLN A 1 41  ? 40.721 11.153  7.259   0.52 18.07  ? 38  GLN A CG    1 
ATOM   337  C  CG    B GLN A 1 41  ? 41.809 11.848  5.911   0.48 21.06  ? 38  GLN A CG    1 
ATOM   338  C  CD    A GLN A 1 41  ? 40.677 10.068  6.209   0.52 22.19  ? 38  GLN A CD    1 
ATOM   339  C  CD    B GLN A 1 41  ? 41.311 10.657  5.106   0.48 19.96  ? 38  GLN A CD    1 
ATOM   340  O  OE1   A GLN A 1 41  ? 41.021 10.299  5.046   0.52 21.68  ? 38  GLN A OE1   1 
ATOM   341  O  OE1   B GLN A 1 41  ? 41.436 10.626  3.885   0.48 18.28  ? 38  GLN A OE1   1 
ATOM   342  N  NE2   A GLN A 1 41  ? 40.254 8.879   6.607   0.52 22.23  ? 38  GLN A NE2   1 
ATOM   343  N  NE2   B GLN A 1 41  ? 40.753 9.663   5.795   0.48 21.05  ? 38  GLN A NE2   1 
ATOM   344  N  N     A TYR A 1 42  ? 39.629 15.231  7.942   0.52 13.11  ? 39  TYR A N     1 
ATOM   345  N  N     B TYR A 1 42  ? 39.423 15.033  8.382   0.48 12.28  ? 39  TYR A N     1 
ATOM   346  C  CA    A TYR A 1 42  ? 38.574 15.952  8.645   0.52 10.90  ? 39  TYR A CA    1 
ATOM   347  C  CA    B TYR A 1 42  ? 38.135 15.450  8.966   0.48 11.77  ? 39  TYR A CA    1 
ATOM   348  C  C     A TYR A 1 42  ? 39.082 16.415  10.014  0.52 17.54  ? 39  TYR A C     1 
ATOM   349  C  C     B TYR A 1 42  ? 38.196 15.912  10.427  0.48 19.31  ? 39  TYR A C     1 
ATOM   350  O  O     A TYR A 1 42  ? 40.202 16.104  10.403  0.52 14.32  ? 39  TYR A O     1 
ATOM   351  O  O     B TYR A 1 42  ? 37.921 15.145  11.342  0.48 24.03  ? 39  TYR A O     1 
ATOM   352  C  CB    A TYR A 1 42  ? 37.309 15.090  8.737   0.52 13.46  ? 39  TYR A CB    1 
ATOM   353  C  CB    B TYR A 1 42  ? 37.092 14.341  8.810   0.48 15.45  ? 39  TYR A CB    1 
ATOM   354  C  CG    A TYR A 1 42  ? 36.888 14.494  7.400   0.52 14.49  ? 39  TYR A CG    1 
ATOM   355  C  CG    B TYR A 1 42  ? 36.762 13.993  7.375   0.48 14.88  ? 39  TYR A CG    1 
ATOM   356  C  CD1   A TYR A 1 42  ? 36.449 15.306  6.362   0.52 18.08  ? 39  TYR A CD1   1 
ATOM   357  C  CD1   B TYR A 1 42  ? 36.468 14.981  6.447   0.48 18.08  ? 39  TYR A CD1   1 
ATOM   358  C  CD2   A TYR A 1 42  ? 36.934 13.118  7.176   0.52 16.24  ? 39  TYR A CD2   1 
ATOM   359  C  CD2   B TYR A 1 42  ? 36.762 12.670  6.947   0.48 15.90  ? 39  TYR A CD2   1 
ATOM   360  C  CE1   A TYR A 1 42  ? 36.068 14.765  5.137   0.52 18.25  ? 39  TYR A CE1   1 
ATOM   361  C  CE1   B TYR A 1 42  ? 36.169 14.660  5.132   0.48 17.74  ? 39  TYR A CE1   1 
ATOM   362  C  CE2   A TYR A 1 42  ? 36.553 12.568  5.957   0.52 17.20  ? 39  TYR A CE2   1 
ATOM   363  C  CE2   B TYR A 1 42  ? 36.461 12.337  5.640   0.48 15.27  ? 39  TYR A CE2   1 
ATOM   364  C  CZ    A TYR A 1 42  ? 36.119 13.396  4.944   0.52 17.03  ? 39  TYR A CZ    1 
ATOM   365  C  CZ    B TYR A 1 42  ? 36.166 13.337  4.738   0.48 18.48  ? 39  TYR A CZ    1 
ATOM   366  O  OH    A TYR A 1 42  ? 35.735 12.855  3.729   0.52 16.72  ? 39  TYR A OH    1 
ATOM   367  O  OH    B TYR A 1 42  ? 35.865 13.013  3.433   0.48 16.93  ? 39  TYR A OH    1 
ATOM   368  N  N     A LYS A 1 43  ? 38.285 17.190  10.735  0.54 24.50  ? 40  LYS A N     1 
ATOM   369  N  N     B LYS A 1 43  ? 38.503 17.186  10.625  0.46 23.20  ? 40  LYS A N     1 
ATOM   370  C  CA    A LYS A 1 43  ? 38.765 17.757  12.000  0.54 24.90  ? 40  LYS A CA    1 
ATOM   371  C  CA    B LYS A 1 43  ? 38.805 17.737  11.952  0.46 25.16  ? 40  LYS A CA    1 
ATOM   372  C  C     A LYS A 1 43  ? 37.639 17.863  13.007  0.54 27.08  ? 40  LYS A C     1 
ATOM   373  C  C     B LYS A 1 43  ? 37.644 17.764  12.973  0.46 26.34  ? 40  LYS A C     1 
ATOM   374  O  O     A LYS A 1 43  ? 37.867 17.842  14.220  0.54 23.21  ? 40  LYS A O     1 
ATOM   375  O  O     B LYS A 1 43  ? 37.865 17.593  14.176  0.46 24.86  ? 40  LYS A O     1 
ATOM   376  C  CB    . LYS A 1 43  ? 39.384 19.144  11.778  1.00 36.77  ? 40  LYS A CB    1 
ATOM   377  C  CG    . LYS A 1 43  ? 40.419 19.553  12.828  1.00 43.27  ? 40  LYS A CG    1 
ATOM   378  C  CD    . LYS A 1 43  ? 41.761 18.865  12.577  1.00 43.23  ? 40  LYS A CD    1 
ATOM   379  C  CE    . LYS A 1 43  ? 42.803 19.257  13.621  1.00 45.06  ? 40  LYS A CE    1 
ATOM   380  N  NZ    . LYS A 1 43  ? 42.461 18.762  14.983  1.00 48.60  ? 40  LYS A NZ    1 
ATOM   381  N  N     . SER A 1 44  ? 36.419 17.984  12.498  1.00 25.44  ? 41  SER A N     1 
ATOM   382  C  CA    . SER A 1 44  ? 35.257 18.186  13.366  1.00 32.16  ? 41  SER A CA    1 
ATOM   383  C  C     . SER A 1 44  ? 35.008 17.086  14.397  1.00 33.95  ? 41  SER A C     1 
ATOM   384  O  O     . SER A 1 44  ? 34.753 17.373  15.566  1.00 35.52  ? 41  SER A O     1 
ATOM   385  C  CB    . SER A 1 44  ? 34.000 18.390  12.520  1.00 56.02  ? 41  SER A CB    1 
ATOM   386  O  OG    . SER A 1 44  ? 34.171 19.484  11.640  1.00 61.37  ? 41  SER A OG    1 
ATOM   387  N  N     . TRP A 1 45  ? 35.070 15.832  13.959  1.00 27.12  ? 42  TRP A N     1 
ATOM   388  C  CA    . TRP A 1 45  ? 34.796 14.702  14.840  1.00 33.51  ? 42  TRP A CA    1 
ATOM   389  C  C     . TRP A 1 45  ? 36.081 14.260  15.520  1.00 26.92  ? 42  TRP A C     1 
ATOM   390  O  O     . TRP A 1 45  ? 36.963 13.669  14.887  1.00 23.79  ? 42  TRP A O     1 
ATOM   391  C  CB    . TRP A 1 45  ? 34.166 13.540  14.059  1.00 33.30  ? 42  TRP A CB    1 
ATOM   392  C  CG    . TRP A 1 45  ? 33.710 12.373  14.908  1.00 33.11  ? 42  TRP A CG    1 
ATOM   393  C  CD1   . TRP A 1 45  ? 34.417 11.238  15.190  1.00 32.19  ? 42  TRP A CD1   1 
ATOM   394  C  CD2   . TRP A 1 45  ? 32.441 12.223  15.560  1.00 34.40  ? 42  TRP A CD2   1 
ATOM   395  N  NE1   . TRP A 1 45  ? 33.674 10.401  15.986  1.00 34.34  ? 42  TRP A NE1   1 
ATOM   396  C  CE2   . TRP A 1 45  ? 32.455 10.980  16.224  1.00 33.74  ? 42  TRP A CE2   1 
ATOM   397  C  CE3   . TRP A 1 45  ? 31.295 13.020  15.647  1.00 39.97  ? 42  TRP A CE3   1 
ATOM   398  C  CZ2   . TRP A 1 45  ? 31.371 10.517  16.969  1.00 37.75  ? 42  TRP A CZ2   1 
ATOM   399  C  CZ3   . TRP A 1 45  ? 30.217 12.557  16.387  1.00 41.62  ? 42  TRP A CZ3   1 
ATOM   400  C  CH2   . TRP A 1 45  ? 30.263 11.317  17.037  1.00 39.06  ? 42  TRP A CH2   1 
ATOM   401  N  N     . LYS A 1 46  ? 36.187 14.590  16.805  1.00 25.92  ? 43  LYS A N     1 
ATOM   402  C  CA    . LYS A 1 46  ? 37.279 14.131  17.660  1.00 22.95  ? 43  LYS A CA    1 
ATOM   403  C  C     . LYS A 1 46  ? 38.662 14.497  17.138  1.00 21.50  ? 43  LYS A C     1 
ATOM   404  O  O     . LYS A 1 46  ? 39.639 13.776  17.381  1.00 20.29  ? 43  LYS A O     1 
ATOM   405  C  CB    . LYS A 1 46  ? 37.170 12.624  17.887  1.00 27.40  ? 43  LYS A CB    1 
ATOM   406  C  CG    . LYS A 1 46  ? 35.945 12.220  18.690  1.00 30.34  ? 43  LYS A CG    1 
ATOM   407  C  CD    . LYS A 1 46  ? 35.903 10.723  18.924  1.00 37.41  ? 43  LYS A CD    1 
ATOM   408  C  CE    . LYS A 1 46  ? 34.703 10.342  19.776  1.00 46.60  ? 43  LYS A CE    1 
ATOM   409  N  NZ    . LYS A 1 46  ? 34.653 8.882   20.047  1.00 50.57  ? 43  LYS A NZ    1 
ATOM   410  N  N     . GLY A 1 47  ? 38.738 15.613  16.420  1.00 19.45  ? 44  GLY A N     1 
ATOM   411  C  CA    . GLY A 1 47  ? 40.000 16.170  15.977  1.00 18.57  ? 44  GLY A CA    1 
ATOM   412  C  C     . GLY A 1 47  ? 40.477 15.625  14.646  1.00 16.23  ? 44  GLY A C     1 
ATOM   413  O  O     . GLY A 1 47  ? 41.507 16.049  14.136  1.00 19.99  ? 44  GLY A O     1 
ATOM   414  N  N     . GLY A 1 48  ? 39.720 14.680  14.095  1.00 18.09  ? 45  GLY A N     1 
ATOM   415  C  CA    . GLY A 1 48  ? 40.079 14.057  12.833  1.00 18.65  ? 45  GLY A CA    1 
ATOM   416  C  C     . GLY A 1 48  ? 40.652 12.666  13.021  1.00 18.29  ? 45  GLY A C     1 
ATOM   417  O  O     . GLY A 1 48  ? 41.181 12.335  14.079  1.00 18.40  ? 45  GLY A O     1 
ATOM   418  N  N     . GLY A 1 49  ? 40.559 11.848  11.981  1.00 14.04  ? 46  GLY A N     1 
ATOM   419  C  CA    . GLY A 1 49  ? 41.064 10.490  12.047  1.00 11.33  ? 46  GLY A CA    1 
ATOM   420  C  C     . GLY A 1 49  ? 42.475 10.406  11.500  1.00 13.33  ? 46  GLY A C     1 
ATOM   421  O  O     . GLY A 1 49  ? 42.742 10.887  10.396  1.00 14.14  ? 46  GLY A O     1 
ATOM   422  N  N     . ILE A 1 50  ? 43.376 9.788   12.259  1.00 12.69  ? 47  ILE A N     1 
ATOM   423  C  CA    . ILE A 1 50  ? 44.763 9.689   11.842  1.00 9.69   ? 47  ILE A CA    1 
ATOM   424  C  C     . ILE A 1 50  ? 44.937 8.594   10.792  1.00 12.83  ? 47  ILE A C     1 
ATOM   425  O  O     . ILE A 1 50  ? 44.462 7.476   10.970  1.00 15.46  ? 47  ILE A O     1 
ATOM   426  C  CB    . ILE A 1 50  ? 45.659 9.428   13.061  1.00 12.09  ? 47  ILE A CB    1 
ATOM   427  C  CG1   . ILE A 1 50  ? 45.664 10.675  13.945  1.00 18.09  ? 47  ILE A CG1   1 
ATOM   428  C  CG2   . ILE A 1 50  ? 47.087 9.075   12.650  1.00 15.02  ? 47  ILE A CG2   1 
ATOM   429  C  CD1   . ILE A 1 50  ? 46.391 10.485  15.263  1.00 20.22  ? 47  ILE A CD1   1 
ATOM   430  N  N     . ILE A 1 51  ? 45.594 8.930   9.682   1.00 11.92  ? 48  ILE A N     1 
ATOM   431  C  CA    . ILE A 1 51  ? 45.870 7.939   8.651   1.00 10.12  ? 48  ILE A CA    1 
ATOM   432  C  C     . ILE A 1 51  ? 47.360 7.671   8.427   1.00 12.66  ? 48  ILE A C     1 
ATOM   433  O  O     . ILE A 1 51  ? 47.717 6.705   7.746   1.00 12.47  ? 48  ILE A O     1 
ATOM   434  C  CB    . ILE A 1 51  ? 45.189 8.289   7.313   1.00 14.61  ? 48  ILE A CB    1 
ATOM   435  C  CG1   . ILE A 1 51  ? 45.658 9.646   6.771   1.00 13.48  ? 48  ILE A CG1   1 
ATOM   436  C  CG2   . ILE A 1 51  ? 43.664 8.249   7.485   1.00 16.74  ? 48  ILE A CG2   1 
ATOM   437  C  CD1   . ILE A 1 51  ? 45.193 9.904   5.320   1.00 17.86  ? 48  ILE A CD1   1 
ATOM   438  N  N     . ALA A 1 52  ? 48.240 8.490   9.001   1.00 11.81  ? 49  ALA A N     1 
ATOM   439  C  CA    . ALA A 1 52  ? 49.688 8.245   8.889   1.00 6.78   ? 49  ALA A CA    1 
ATOM   440  C  C     . ALA A 1 52  ? 50.404 8.908   10.054  1.00 9.58   ? 49  ALA A C     1 
ATOM   441  O  O     . ALA A 1 52  ? 49.978 9.974   10.516  1.00 11.27  ? 49  ALA A O     1 
ATOM   442  C  CB    . ALA A 1 52  ? 50.233 8.763   7.546   1.00 10.84  ? 49  ALA A CB    1 
ATOM   443  N  N     . VAL A 1 53  ? 51.504 8.298   10.513  1.00 10.25  ? 50  VAL A N     1 
ATOM   444  C  CA    . VAL A 1 53  ? 52.170 8.700   11.750  1.00 7.02   ? 50  VAL A CA    1 
ATOM   445  C  C     . VAL A 1 53  ? 53.688 8.654   11.621  1.00 9.85   ? 50  VAL A C     1 
ATOM   446  O  O     . VAL A 1 53  ? 54.236 7.633   11.186  1.00 10.98  ? 50  VAL A O     1 
ATOM   447  C  CB    . VAL A 1 53  ? 51.772 7.733   12.903  1.00 11.07  ? 50  VAL A CB    1 
ATOM   448  C  CG1   . VAL A 1 53  ? 52.294 8.246   14.235  1.00 12.22  ? 50  VAL A CG1   1 
ATOM   449  C  CG2   . VAL A 1 53  ? 50.268 7.560   12.970  1.00 15.95  ? 50  VAL A CG2   1 
ATOM   450  N  N     . SER A 1 54  ? 54.368 9.741   11.990  1.00 11.06  ? 51  SER A N     1 
ATOM   451  C  CA    . SER A 1 54  ? 55.823 9.764   11.904  1.00 9.19   ? 51  SER A CA    1 
ATOM   452  C  C     . SER A 1 54  ? 56.409 8.829   12.957  1.00 12.09  ? 51  SER A C     1 
ATOM   453  O  O     . SER A 1 54  ? 55.756 8.505   13.957  1.00 12.61  ? 51  SER A O     1 
ATOM   454  C  CB    . SER A 1 54  ? 56.369 11.188  12.073  1.00 12.14  ? 51  SER A CB    1 
ATOM   455  O  OG    . SER A 1 54  ? 56.444 11.521  13.448  1.00 14.04  ? 51  SER A OG    1 
ATOM   456  N  N     . TYR A 1 55  ? 57.637 8.373   12.724  1.00 12.18  ? 52  TYR A N     1 
ATOM   457  C  CA    . TYR A 1 55  ? 58.255 7.441   13.668  1.00 11.58  ? 52  TYR A CA    1 
ATOM   458  C  C     . TYR A 1 55  ? 58.471 8.075   15.051  1.00 13.90  ? 52  TYR A C     1 
ATOM   459  O  O     . TYR A 1 55  ? 58.369 7.395   16.071  1.00 15.89  ? 52  TYR A O     1 
ATOM   460  C  CB    . TYR A 1 55  ? 59.535 6.809   13.067  1.00 13.00  ? 52  TYR A CB    1 
ATOM   461  C  CG    . TYR A 1 55  ? 59.195 5.715   12.066  1.00 12.58  ? 52  TYR A CG    1 
ATOM   462  C  CD1   . TYR A 1 55  ? 58.768 6.033   10.778  1.00 13.85  ? 52  TYR A CD1   1 
ATOM   463  C  CD2   . TYR A 1 55  ? 59.199 4.382   12.444  1.00 16.10  ? 52  TYR A CD2   1 
ATOM   464  C  CE1   . TYR A 1 55  ? 58.400 5.048   9.876   1.00 14.51  ? 52  TYR A CE1   1 
ATOM   465  C  CE2   . TYR A 1 55  ? 58.847 3.391   11.551  1.00 17.21  ? 52  TYR A CE2   1 
ATOM   466  C  CZ    . TYR A 1 55  ? 58.445 3.719   10.277  1.00 16.87  ? 52  TYR A CZ    1 
ATOM   467  O  OH    . TYR A 1 55  ? 58.088 2.700   9.408   1.00 17.64  ? 52  TYR A OH    1 
ATOM   468  N  N     . GLU A 1 56  ? 58.740 9.378   15.080  1.00 15.78  ? 53  GLU A N     1 
ATOM   469  C  CA    . GLU A 1 56  ? 58.826 10.093  16.351  1.00 13.71  ? 53  GLU A CA    1 
ATOM   470  C  C     . GLU A 1 56  ? 57.521 10.014  17.138  1.00 14.91  ? 53  GLU A C     1 
ATOM   471  O  O     . GLU A 1 56  ? 57.531 9.868   18.361  1.00 17.58  ? 53  GLU A O     1 
ATOM   472  C  CB    . GLU A 1 56  ? 59.222 11.559  16.119  1.00 16.99  ? 53  GLU A CB    1 
ATOM   473  C  CG    . GLU A 1 56  ? 60.626 11.778  15.521  1.00 24.19  ? 53  GLU A CG    1 
ATOM   474  C  CD    . GLU A 1 56  ? 60.690 11.685  13.990  1.00 28.81  ? 53  GLU A CD    1 
ATOM   475  O  OE1   . GLU A 1 56  ? 59.731 11.202  13.346  1.00 23.42  ? 53  GLU A OE1   1 
ATOM   476  O  OE2   . GLU A 1 56  ? 61.721 12.108  13.423  1.00 32.36  ? 53  GLU A OE2   1 
ATOM   477  N  N     . ALA A 1 57  ? 56.392 10.139  16.443  1.00 12.52  ? 54  ALA A N     1 
ATOM   478  C  CA    . ALA A 1 57  ? 55.088 10.041  17.091  1.00 11.82  ? 54  ALA A CA    1 
ATOM   479  C  C     . ALA A 1 57  ? 54.739 8.608   17.487  1.00 13.36  ? 54  ALA A C     1 
ATOM   480  O  O     . ALA A 1 57  ? 54.087 8.386   18.507  1.00 13.31  ? 54  ALA A O     1 
ATOM   481  C  CB    . ALA A 1 57  ? 53.989 10.630  16.186  1.00 13.89  ? 54  ALA A CB    1 
ATOM   482  N  N     . ARG A 1 58  ? 55.164 7.627   16.692  1.00 12.94  ? 55  ARG A N     1 
ATOM   483  C  CA    . ARG A 1 58  ? 54.905 6.231   17.063  1.00 12.32  ? 55  ARG A CA    1 
ATOM   484  C  C     . ARG A 1 58  ? 55.528 5.873   18.413  1.00 15.51  ? 55  ARG A C     1 
ATOM   485  O  O     . ARG A 1 58  ? 54.980 5.029   19.146  1.00 16.77  ? 55  ARG A O     1 
ATOM   486  C  CB    . ARG A 1 58  ? 55.409 5.267   15.989  1.00 12.92  ? 55  ARG A CB    1 
ATOM   487  C  CG    . ARG A 1 58  ? 54.746 5.479   14.653  1.00 15.27  ? 55  ARG A CG    1 
ATOM   488  C  CD    . ARG A 1 58  ? 55.300 4.533   13.598  1.00 14.53  ? 55  ARG A CD    1 
ATOM   489  N  NE    . ARG A 1 58  ? 54.915 4.995   12.270  1.00 13.77  ? 55  ARG A NE    1 
ATOM   490  C  CZ    . ARG A 1 58  ? 54.940 4.254   11.169  1.00 18.03  ? 55  ARG A CZ    1 
ATOM   491  N  NH1   . ARG A 1 58  ? 55.342 2.989   11.226  1.00 17.63  ? 55  ARG A NH1   1 
ATOM   492  N  NH2   . ARG A 1 58  ? 54.566 4.796   10.004  1.00 15.86  ? 55  ARG A NH2   1 
ATOM   493  N  N     . ALA A 1 59  ? 56.643 6.525   18.748  1.00 14.93  ? 56  ALA A N     1 
ATOM   494  C  CA    . ALA A 1 59  ? 57.325 6.274   20.022  1.00 14.03  ? 56  ALA A CA    1 
ATOM   495  C  C     . ALA A 1 59  ? 56.437 6.611   21.225  1.00 19.00  ? 56  ALA A C     1 
ATOM   496  O  O     . ALA A 1 59  ? 56.640 6.091   22.325  1.00 19.81  ? 56  ALA A O     1 
ATOM   497  C  CB    . ALA A 1 59  ? 58.637 7.050   20.093  1.00 17.81  ? 56  ALA A CB    1 
ATOM   498  N  N     . PHE A 1 60  ? 55.469 7.498   21.019  1.00 14.91  ? 57  PHE A N     1 
ATOM   499  C  CA    . PHE A 1 60  ? 54.510 7.867   22.062  1.00 14.41  ? 57  PHE A CA    1 
ATOM   500  C  C     . PHE A 1 60  ? 53.275 6.973   22.089  1.00 16.88  ? 57  PHE A C     1 
ATOM   501  O  O     . PHE A 1 60  ? 52.424 7.100   22.977  1.00 18.42  ? 57  PHE A O     1 
ATOM   502  C  CB    . PHE A 1 60  ? 54.041 9.312   21.856  1.00 13.56  ? 57  PHE A CB    1 
ATOM   503  C  CG    . PHE A 1 60  ? 55.085 10.346  22.154  1.00 14.86  ? 57  PHE A CG    1 
ATOM   504  C  CD1   . PHE A 1 60  ? 55.166 10.927  23.413  1.00 21.17  ? 57  PHE A CD1   1 
ATOM   505  C  CD2   . PHE A 1 60  ? 55.970 10.762  21.175  1.00 18.46  ? 57  PHE A CD2   1 
ATOM   506  C  CE1   . PHE A 1 60  ? 56.120 11.893  23.683  1.00 25.34  ? 57  PHE A CE1   1 
ATOM   507  C  CE2   . PHE A 1 60  ? 56.917 11.728  21.440  1.00 22.40  ? 57  PHE A CE2   1 
ATOM   508  C  CZ    . PHE A 1 60  ? 56.995 12.291  22.695  1.00 26.90  ? 57  PHE A CZ    1 
ATOM   509  N  N     . GLY A 1 61  ? 53.156 6.090   21.103  1.00 16.16  ? 58  GLY A N     1 
ATOM   510  C  CA    . GLY A 1 61  ? 52.009 5.199   21.004  1.00 15.07  ? 58  GLY A CA    1 
ATOM   511  C  C     . GLY A 1 61  ? 50.934 5.645   20.033  1.00 14.43  ? 58  GLY A C     1 
ATOM   512  O  O     . GLY A 1 61  ? 49.856 5.056   19.961  1.00 14.72  ? 58  GLY A O     1 
ATOM   513  N  N     . VAL A 1 62  ? 51.231 6.679   19.246  1.00 13.58  ? 59  VAL A N     1 
ATOM   514  C  CA    . VAL A 1 62  ? 50.264 7.151   18.272  1.00 11.04  ? 59  VAL A CA    1 
ATOM   515  C  C     . VAL A 1 62  ? 50.176 6.152   17.117  1.00 13.50  ? 59  VAL A C     1 
ATOM   516  O  O     . VAL A 1 62  ? 51.206 5.695   16.595  1.00 13.38  ? 59  VAL A O     1 
ATOM   517  C  CB    . VAL A 1 62  ? 50.646 8.546   17.749  1.00 13.64  ? 59  VAL A CB    1 
ATOM   518  C  CG1   . VAL A 1 62  ? 49.631 9.008   16.697  1.00 16.37  ? 59  VAL A CG1   1 
ATOM   519  C  CG2   . VAL A 1 62  ? 50.712 9.540   18.910  1.00 16.37  ? 59  VAL A CG2   1 
ATOM   520  N  N     . THR A 1 63  ? 48.945 5.830   16.713  1.00 14.19  ? 60  THR A N     1 
ATOM   521  C  CA    . THR A 1 63  ? 48.721 4.886   15.623  1.00 14.08  ? 60  THR A CA    1 
ATOM   522  C  C     . THR A 1 63  ? 47.673 5.375   14.635  1.00 16.75  ? 60  THR A C     1 
ATOM   523  O  O     . THR A 1 63  ? 46.889 6.271   14.930  1.00 18.08  ? 60  THR A O     1 
ATOM   524  C  CB    . THR A 1 63  ? 48.254 3.509   16.144  1.00 17.06  ? 60  THR A CB    1 
ATOM   525  O  OG1   . THR A 1 63  ? 46.997 3.661   16.817  1.00 21.58  ? 60  THR A OG1   1 
ATOM   526  C  CG2   . THR A 1 63  ? 49.291 2.901   17.102  1.00 17.03  ? 60  THR A CG2   1 
ATOM   527  N  N     . ARG A 1 64  ? 47.662 4.760   13.457  1.00 15.76  ? 61  ARG A N     1 
ATOM   528  C  CA    . ARG A 1 64  ? 46.567 4.902   12.510  1.00 16.27  ? 61  ARG A CA    1 
ATOM   529  C  C     . ARG A 1 64  ? 45.238 4.484   13.141  1.00 20.18  ? 61  ARG A C     1 
ATOM   530  O  O     . ARG A 1 64  ? 45.197 3.606   14.011  1.00 20.75  ? 61  ARG A O     1 
ATOM   531  C  CB    . ARG A 1 64  ? 46.879 4.051   11.270  1.00 23.12  ? 61  ARG A CB    1 
ATOM   532  C  CG    A ARG A 1 64  ? 45.765 3.937   10.242  0.50 25.47  ? 61  ARG A CG    1 
ATOM   533  C  CG    B ARG A 1 64  ? 45.827 4.117   10.179  0.50 26.44  ? 61  ARG A CG    1 
ATOM   534  C  CD    A ARG A 1 64  ? 46.281 3.233   8.985   0.50 20.48  ? 61  ARG A CD    1 
ATOM   535  C  CD    B ARG A 1 64  ? 46.465 3.982   8.802   0.50 24.46  ? 61  ARG A CD    1 
ATOM   536  N  NE    A ARG A 1 64  ? 47.405 3.963   8.398   0.50 13.83  ? 61  ARG A NE    1 
ATOM   537  N  NE    B ARG A 1 64  ? 47.497 2.950   8.764   0.50 21.88  ? 61  ARG A NE    1 
ATOM   538  C  CZ    A ARG A 1 64  ? 48.559 3.411   8.032   0.50 19.15  ? 61  ARG A CZ    1 
ATOM   539  C  CZ    B ARG A 1 64  ? 48.717 3.129   8.264   0.50 19.99  ? 61  ARG A CZ    1 
ATOM   540  N  NH1   A ARG A 1 64  ? 48.753 2.104   8.174   0.50 20.46  ? 61  ARG A NH1   1 
ATOM   541  N  NH1   B ARG A 1 64  ? 49.071 4.307   7.759   0.50 20.57  ? 61  ARG A NH1   1 
ATOM   542  N  NH2   A ARG A 1 64  ? 49.520 4.172   7.514   0.50 14.56  ? 61  ARG A NH2   1 
ATOM   543  N  NH2   B ARG A 1 64  ? 49.588 2.127   8.264   0.50 21.68  ? 61  ARG A NH2   1 
ATOM   544  N  N     . SER A 1 65  ? 44.160 5.136   12.707  1.00 18.26  ? 62  SER A N     1 
ATOM   545  C  CA    . SER A 1 65  ? 42.787 4.850   13.144  1.00 24.35  ? 62  SER A CA    1 
ATOM   546  C  C     . SER A 1 65  ? 42.418 5.589   14.429  1.00 26.52  ? 62  SER A C     1 
ATOM   547  O  O     . SER A 1 65  ? 41.249 5.711   14.783  1.00 36.40  ? 62  SER A O     1 
ATOM   548  C  CB    . SER A 1 65  ? 42.550 3.351   13.318  1.00 32.27  ? 62  SER A CB    1 
ATOM   549  O  OG    . SER A 1 65  ? 42.739 2.967   14.668  1.00 40.67  ? 62  SER A OG    1 
ATOM   550  N  N     . MET A 1 66  ? 43.426 6.088   15.120  1.00 21.78  ? 63  MET A N     1 
ATOM   551  C  CA    . MET A 1 66  ? 43.229 6.832   16.344  1.00 14.79  ? 63  MET A CA    1 
ATOM   552  C  C     . MET A 1 66  ? 42.656 8.195   15.985  1.00 17.62  ? 63  MET A C     1 
ATOM   553  O  O     . MET A 1 66  ? 43.019 8.764   14.954  1.00 17.87  ? 63  MET A O     1 
ATOM   554  C  CB    . MET A 1 66  ? 44.603 6.981   16.994  1.00 20.60  ? 63  MET A CB    1 
ATOM   555  C  CG    . MET A 1 66  ? 44.673 7.414   18.404  1.00 24.81  ? 63  MET A CG    1 
ATOM   556  S  SD    . MET A 1 66  ? 46.377 7.145   18.944  1.00 22.25  ? 63  MET A SD    1 
ATOM   557  C  CE    . MET A 1 66  ? 46.307 5.513   19.668  1.00 21.54  ? 63  MET A CE    1 
ATOM   558  N  N     . TRP A 1 67  ? 41.742 8.710   16.808  1.00 16.20  ? 64  TRP A N     1 
ATOM   559  C  CA    . TRP A 1 67  ? 41.288 10.093  16.676  1.00 12.58  ? 64  TRP A CA    1 
ATOM   560  C  C     . TRP A 1 67  ? 42.392 11.021  17.155  1.00 15.41  ? 64  TRP A C     1 
ATOM   561  O  O     . TRP A 1 67  ? 43.066 10.731  18.146  1.00 13.97  ? 64  TRP A O     1 
ATOM   562  C  CB    . TRP A 1 67  ? 40.026 10.345  17.511  1.00 16.79  ? 64  TRP A CB    1 
ATOM   563  C  CG    . TRP A 1 67  ? 38.887 9.488   17.101  1.00 19.19  ? 64  TRP A CG    1 
ATOM   564  C  CD1   . TRP A 1 67  ? 38.284 8.512   17.845  1.00 21.08  ? 64  TRP A CD1   1 
ATOM   565  C  CD2   . TRP A 1 67  ? 38.214 9.503   15.834  1.00 21.81  ? 64  TRP A CD2   1 
ATOM   566  N  NE1   . TRP A 1 67  ? 37.275 7.923   17.118  1.00 24.68  ? 64  TRP A NE1   1 
ATOM   567  C  CE2   . TRP A 1 67  ? 37.215 8.512   15.882  1.00 23.03  ? 64  TRP A CE2   1 
ATOM   568  C  CE3   . TRP A 1 67  ? 38.360 10.261  14.665  1.00 18.25  ? 64  TRP A CE3   1 
ATOM   569  C  CZ2   . TRP A 1 67  ? 36.362 8.256   14.802  1.00 24.43  ? 64  TRP A CZ2   1 
ATOM   570  C  CZ3   . TRP A 1 67  ? 37.514 10.008  13.598  1.00 21.26  ? 64  TRP A CZ3   1 
ATOM   571  C  CH2   . TRP A 1 67  ? 36.529 9.015   13.673  1.00 23.49  ? 64  TRP A CH2   1 
ATOM   572  N  N     . ALA A 1 68  ? 42.569 12.150  16.483  1.00 15.31  ? 65  ALA A N     1 
ATOM   573  C  CA    . ALA A 1 68  ? 43.622 13.070  16.882  1.00 11.80  ? 65  ALA A CA    1 
ATOM   574  C  C     . ALA A 1 68  ? 43.467 13.546  18.335  1.00 14.72  ? 65  ALA A C     1 
ATOM   575  O  O     . ALA A 1 68  ? 44.465 13.752  19.023  1.00 16.01  ? 65  ALA A O     1 
ATOM   576  C  CB    . ALA A 1 68  ? 43.697 14.254  15.917  1.00 15.39  ? 65  ALA A CB    1 
ATOM   577  N  N     . ASP A 1 69  ? 42.230 13.729  18.802  1.00 16.05  ? 66  ASP A N     1 
ATOM   578  C  CA    . ASP A 1 69  ? 42.035 14.180  20.185  1.00 15.13  ? 66  ASP A CA    1 
ATOM   579  C  C     . ASP A 1 69  ? 42.643 13.144  21.143  1.00 14.74  ? 66  ASP A C     1 
ATOM   580  O  O     . ASP A 1 69  ? 43.199 13.494  22.197  1.00 17.05  ? 66  ASP A O     1 
ATOM   581  C  CB    . ASP A 1 69  ? 40.553 14.345  20.521  1.00 19.78  ? 66  ASP A CB    1 
ATOM   582  C  CG    . ASP A 1 69  ? 39.928 15.608  19.934  1.00 24.52  ? 66  ASP A CG    1 
ATOM   583  O  OD1   . ASP A 1 69  ? 40.638 16.469  19.367  1.00 23.34  ? 66  ASP A OD1   1 
ATOM   584  O  OD2   . ASP A 1 69  ? 38.692 15.740  20.065  1.00 28.20  ? 66  ASP A OD2   1 
ATOM   585  N  N     . ASP A 1 70  ? 42.534 11.872  20.773  1.00 14.02  ? 67  ASP A N     1 
ATOM   586  C  CA    . ASP A 1 70  ? 43.074 10.799  21.605  1.00 13.00  ? 67  ASP A CA    1 
ATOM   587  C  C     . ASP A 1 70  ? 44.588 10.687  21.484  1.00 13.08  ? 67  ASP A C     1 
ATOM   588  O  O     . ASP A 1 70  ? 45.287 10.459  22.474  1.00 14.79  ? 67  ASP A O     1 
ATOM   589  C  CB    . ASP A 1 70  ? 42.368 9.482   21.285  1.00 15.76  ? 67  ASP A CB    1 
ATOM   590  C  CG    . ASP A 1 70  ? 40.878 9.533   21.616  1.00 22.31  ? 67  ASP A CG    1 
ATOM   591  O  OD1   . ASP A 1 70  ? 40.497 10.304  22.528  1.00 23.28  ? 67  ASP A OD1   1 
ATOM   592  O  OD2   . ASP A 1 70  ? 40.092 8.812   20.963  1.00 21.48  ? 67  ASP A OD2   1 
ATOM   593  N  N     . ALA A 1 71  ? 45.111 10.879  20.273  1.00 13.73  ? 68  ALA A N     1 
ATOM   594  C  CA    . ALA A 1 71  ? 46.554 10.849  20.075  1.00 11.52  ? 68  ALA A CA    1 
ATOM   595  C  C     . ALA A 1 71  ? 47.232 11.965  20.859  1.00 14.40  ? 68  ALA A C     1 
ATOM   596  O  O     . ALA A 1 71  ? 48.341 11.799  21.351  1.00 15.31  ? 68  ALA A O     1 
ATOM   597  C  CB    . ALA A 1 71  ? 46.883 10.962  18.600  1.00 15.14  ? 68  ALA A CB    1 
ATOM   598  N  N     . LYS A 1 72  ? 46.561 13.105  20.963  1.00 12.53  ? 69  LYS A N     1 
ATOM   599  C  CA    . LYS A 1 72  ? 47.075 14.216  21.756  1.00 11.33  ? 69  LYS A CA    1 
ATOM   600  C  C     . LYS A 1 72  ? 47.183 13.879  23.244  1.00 16.27  ? 69  LYS A C     1 
ATOM   601  O  O     . LYS A 1 72  ? 47.977 14.487  23.958  1.00 17.59  ? 69  LYS A O     1 
ATOM   602  C  CB    . LYS A 1 72  ? 46.182 15.451  21.572  1.00 15.41  ? 69  LYS A CB    1 
ATOM   603  C  CG    . LYS A 1 72  ? 46.485 16.257  20.294  1.00 18.81  ? 69  LYS A CG    1 
ATOM   604  C  CD    . LYS A 1 72  ? 47.770 17.073  20.491  1.00 23.96  ? 69  LYS A CD    1 
ATOM   605  C  CE    . LYS A 1 72  ? 47.962 18.151  19.432  1.00 27.92  ? 69  LYS A CE    1 
ATOM   606  N  NZ    . LYS A 1 72  ? 49.224 18.934  19.678  1.00 21.15  ? 69  LYS A NZ    1 
ATOM   607  N  N     . LYS A 1 73  ? 46.387 12.922  23.722  1.00 13.56  ? 70  LYS A N     1 
ATOM   608  C  CA    . LYS A 1 73  ? 46.503 12.514  25.124  1.00 11.89  ? 70  LYS A CA    1 
ATOM   609  C  C     . LYS A 1 73  ? 47.829 11.785  25.351  1.00 21.64  ? 70  LYS A C     1 
ATOM   610  O  O     . LYS A 1 73  ? 48.431 11.891  26.420  1.00 22.57  ? 70  LYS A O     1 
ATOM   611  C  CB    . LYS A 1 73  ? 45.316 11.642  25.521  1.00 13.84  ? 70  LYS A CB    1 
ATOM   612  C  CG    . LYS A 1 73  ? 43.985 12.323  25.293  1.00 16.03  ? 70  LYS A CG    1 
ATOM   613  C  CD    . LYS A 1 73  ? 42.811 11.385  25.494  1.00 17.43  ? 70  LYS A CD    1 
ATOM   614  C  CE    . LYS A 1 73  ? 41.505 12.132  25.226  1.00 21.06  ? 70  LYS A CE    1 
ATOM   615  N  NZ    . LYS A 1 73  ? 40.354 11.195  25.153  1.00 23.98  ? 70  LYS A NZ    1 
ATOM   616  N  N     . LEU A 1 74  ? 48.278 11.058  24.332  1.00 15.29  ? 71  LEU A N     1 
ATOM   617  C  CA    . LEU A 1 74  ? 49.544 10.323  24.402  1.00 14.01  ? 71  LEU A CA    1 
ATOM   618  C  C     . LEU A 1 74  ? 50.743 11.190  24.068  1.00 18.95  ? 71  LEU A C     1 
ATOM   619  O  O     . LEU A 1 74  ? 51.843 10.960  24.567  1.00 18.71  ? 71  LEU A O     1 
ATOM   620  C  CB    . LEU A 1 74  ? 49.524 9.149   23.418  1.00 16.55  ? 71  LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 74  ? 48.445 8.082   23.624  1.00 16.30  ? 71  LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 74  ? 48.508 7.065   22.471  1.00 18.80  ? 71  LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 74  ? 48.617 7.389   24.970  1.00 15.95  ? 71  LEU A CD2   1 
ATOM   624  N  N     . CYS A 1 75  ? 50.525 12.159  23.184  1.00 14.62  ? 72  CYS A N     1 
ATOM   625  C  CA    . CYS A 1 75  ? 51.593 12.983  22.655  1.00 11.98  ? 72  CYS A CA    1 
ATOM   626  C  C     . CYS A 1 75  ? 51.074 14.415  22.502  1.00 19.23  ? 72  CYS A C     1 
ATOM   627  O  O     . CYS A 1 75  ? 50.579 14.810  21.441  1.00 16.81  ? 72  CYS A O     1 
ATOM   628  C  CB    . CYS A 1 75  ? 52.024 12.418  21.310  1.00 14.65  ? 72  CYS A CB    1 
ATOM   629  S  SG    . CYS A 1 75  ? 53.339 13.332  20.478  1.00 20.21  ? 72  CYS A SG    1 
ATOM   630  N  N     . PRO A 1 76  ? 51.153 15.200  23.581  1.00 16.79  ? 73  PRO A N     1 
ATOM   631  C  CA    . PRO A 1 76  ? 50.564 16.540  23.596  1.00 13.97  ? 73  PRO A CA    1 
ATOM   632  C  C     . PRO A 1 76  ? 51.178 17.494  22.576  1.00 15.98  ? 73  PRO A C     1 
ATOM   633  O  O     . PRO A 1 76  ? 50.501 18.420  22.138  1.00 21.26  ? 73  PRO A O     1 
ATOM   634  C  CB    . PRO A 1 76  ? 50.851 17.030  25.027  1.00 22.51  ? 73  PRO A CB    1 
ATOM   635  C  CG    . PRO A 1 76  ? 50.997 15.791  25.827  1.00 24.31  ? 73  PRO A CG    1 
ATOM   636  C  CD    . PRO A 1 76  ? 51.623 14.778  24.912  1.00 22.45  ? 73  PRO A CD    1 
ATOM   637  N  N     . ASP A 1 77  ? 52.425 17.249  22.190  1.00 18.73  ? 74  ASP A N     1 
ATOM   638  C  CA    . ASP A 1 77  ? 53.106 18.127  21.241  1.00 18.64  ? 74  ASP A CA    1 
ATOM   639  C  C     . ASP A 1 77  ? 53.016 17.618  19.806  1.00 19.67  ? 74  ASP A C     1 
ATOM   640  O  O     . ASP A 1 77  ? 53.709 18.122  18.927  1.00 18.33  ? 74  ASP A O     1 
ATOM   641  C  CB    . ASP A 1 77  ? 54.577 18.289  21.623  1.00 25.59  ? 74  ASP A CB    1 
ATOM   642  C  CG    . ASP A 1 77  ? 54.763 18.983  22.961  1.00 37.57  ? 74  ASP A CG    1 
ATOM   643  O  OD1   . ASP A 1 77  ? 55.641 18.544  23.735  1.00 42.10  ? 74  ASP A OD1   1 
ATOM   644  O  OD2   . ASP A 1 77  ? 54.041 19.965  23.233  1.00 41.67  ? 74  ASP A OD2   1 
ATOM   645  N  N     . LEU A 1 78  ? 52.158 16.631  19.574  1.00 15.43  ? 75  LEU A N     1 
ATOM   646  C  CA    . LEU A 1 78  ? 51.964 16.059  18.240  1.00 10.16  ? 75  LEU A CA    1 
ATOM   647  C  C     . LEU A 1 78  ? 51.558 17.148  17.259  1.00 12.76  ? 75  LEU A C     1 
ATOM   648  O  O     . LEU A 1 78  ? 50.621 17.908  17.525  1.00 15.40  ? 75  LEU A O     1 
ATOM   649  C  CB    . LEU A 1 78  ? 50.853 15.002  18.311  1.00 13.39  ? 75  LEU A CB    1 
ATOM   650  C  CG    . LEU A 1 78  ? 50.481 14.296  17.002  1.00 11.90  ? 75  LEU A CG    1 
ATOM   651  C  CD1   . LEU A 1 78  ? 51.609 13.390  16.544  1.00 14.01  ? 75  LEU A CD1   1 
ATOM   652  C  CD2   . LEU A 1 78  ? 49.197 13.516  17.229  1.00 15.25  ? 75  LEU A CD2   1 
ATOM   653  N  N     . LEU A 1 79  ? 52.262 17.241  16.132  1.00 11.93  ? 76  LEU A N     1 
ATOM   654  C  CA    . LEU A 1 79  ? 51.864 18.165  15.087  1.00 9.65   ? 76  LEU A CA    1 
ATOM   655  C  C     . LEU A 1 79  ? 50.988 17.429  14.074  1.00 13.57  ? 76  LEU A C     1 
ATOM   656  O  O     . LEU A 1 79  ? 51.125 16.216  13.885  1.00 13.88  ? 76  LEU A O     1 
ATOM   657  C  CB    . LEU A 1 79  ? 53.092 18.747  14.392  1.00 11.12  ? 76  LEU A CB    1 
ATOM   658  C  CG    . LEU A 1 79  ? 54.053 19.470  15.353  1.00 12.48  ? 76  LEU A CG    1 
ATOM   659  C  CD1   . LEU A 1 79  ? 55.265 20.031  14.615  1.00 15.30  ? 76  LEU A CD1   1 
ATOM   660  C  CD2   . LEU A 1 79  ? 53.329 20.586  16.089  1.00 15.15  ? 76  LEU A CD2   1 
ATOM   661  N  N     . LEU A 1 80  ? 50.102 18.164  13.418  1.00 13.37  ? 77  LEU A N     1 
ATOM   662  C  CA    . LEU A 1 80  ? 49.152 17.565  12.491  1.00 11.27  ? 77  LEU A CA    1 
ATOM   663  C  C     . LEU A 1 80  ? 49.158 18.279  11.160  1.00 16.10  ? 77  LEU A C     1 
ATOM   664  O  O     . LEU A 1 80  ? 49.329 19.503  11.074  1.00 20.27  ? 77  LEU A O     1 
ATOM   665  C  CB    . LEU A 1 80  ? 47.738 17.582  13.076  1.00 13.88  ? 77  LEU A CB    1 
ATOM   666  C  CG    . LEU A 1 80  ? 47.537 16.803  14.371  1.00 15.83  ? 77  LEU A CG    1 
ATOM   667  C  CD1   . LEU A 1 80  ? 46.128 16.990  14.930  1.00 19.52  ? 77  LEU A CD1   1 
ATOM   668  C  CD2   . LEU A 1 80  ? 47.853 15.319  14.160  1.00 17.89  ? 77  LEU A CD2   1 
ATOM   669  N  N     . ALA A 1 81  ? 48.986 17.494  10.112  1.00 12.09  ? 78  ALA A N     1 
ATOM   670  C  CA    . ALA A 1 81  ? 48.708 18.038  8.805   1.00 8.51   ? 78  ALA A CA    1 
ATOM   671  C  C     . ALA A 1 81  ? 47.408 17.420  8.326   1.00 14.72  ? 78  ALA A C     1 
ATOM   672  O  O     . ALA A 1 81  ? 47.184 16.223  8.526   1.00 15.36  ? 78  ALA A O     1 
ATOM   673  C  CB    . ALA A 1 81  ? 49.850 17.725  7.837   1.00 13.08  ? 78  ALA A CB    1 
ATOM   674  N  N     . GLN A 1 82  ? 46.550 18.232  7.711   1.00 14.16  ? 79  GLN A N     1 
ATOM   675  C  CA    . GLN A 1 82  ? 45.216 17.783  7.279   1.00 13.47  ? 79  GLN A CA    1 
ATOM   676  C  C     . GLN A 1 82  ? 45.184 17.462  5.807   1.00 13.91  ? 79  GLN A C     1 
ATOM   677  O  O     . GLN A 1 82  ? 45.747 18.202  4.993   1.00 17.78  ? 79  GLN A O     1 
ATOM   678  C  CB    . GLN A 1 82  ? 44.168 18.879  7.527   1.00 18.01  ? 79  GLN A CB    1 
ATOM   679  C  CG    . GLN A 1 82  ? 43.847 19.111  8.969   1.00 24.91  ? 79  GLN A CG    1 
ATOM   680  C  CD    . GLN A 1 82  ? 42.821 20.206  9.142   1.00 36.08  ? 79  GLN A CD    1 
ATOM   681  O  OE1   . GLN A 1 82  ? 43.126 21.274  9.662   1.00 38.71  ? 79  GLN A OE1   1 
ATOM   682  N  NE2   . GLN A 1 82  ? 41.595 19.948  8.693   1.00 34.48  ? 79  GLN A NE2   1 
ATOM   683  N  N     . VAL A 1 83  ? 44.514 16.362  5.469   1.00 13.55  ? 80  VAL A N     1 
ATOM   684  C  CA    . VAL A 1 83  ? 44.254 16.013  4.081   1.00 10.06  ? 80  VAL A CA    1 
ATOM   685  C  C     . VAL A 1 83  ? 43.343 17.089  3.492   1.00 14.61  ? 80  VAL A C     1 
ATOM   686  O  O     . VAL A 1 83  ? 42.407 17.577  4.145   1.00 15.81  ? 80  VAL A O     1 
ATOM   687  C  CB    . VAL A 1 83  ? 43.578 14.641  3.958   1.00 12.30  ? 80  VAL A CB    1 
ATOM   688  C  CG1   . VAL A 1 83  ? 43.185 14.345  2.522   1.00 15.22  ? 80  VAL A CG1   1 
ATOM   689  C  CG2   . VAL A 1 83  ? 44.497 13.550  4.508   1.00 11.68  ? 80  VAL A CG2   1 
ATOM   690  N  N     . ARG A 1 84  ? 43.640 17.471  2.256   1.00 13.95  ? 81  ARG A N     1 
ATOM   691  C  CA    . ARG A 1 84  ? 42.863 18.483  1.545   1.00 10.26  ? 81  ARG A CA    1 
ATOM   692  C  C     . ARG A 1 84  ? 41.414 18.044  1.455   1.00 12.23  ? 81  ARG A C     1 
ATOM   693  O  O     . ARG A 1 84  ? 41.123 16.861  1.295   1.00 14.11  ? 81  ARG A O     1 
ATOM   694  C  CB    . ARG A 1 84  ? 43.441 18.623  0.137   1.00 20.17  ? 81  ARG A CB    1 
ATOM   695  C  CG    . ARG A 1 84  ? 42.672 19.565  -0.788  1.00 24.49  ? 81  ARG A CG    1 
ATOM   696  C  CD    . ARG A 1 84  ? 43.263 19.493  -2.192  1.00 37.84  ? 81  ARG A CD    1 
ATOM   697  N  NE    . ARG A 1 84  ? 42.516 20.283  -3.166  1.00 50.82  ? 81  ARG A NE    1 
ATOM   698  C  CZ    . ARG A 1 84  ? 42.638 20.147  -4.484  1.00 60.57  ? 81  ARG A CZ    1 
ATOM   699  N  NH1   . ARG A 1 84  ? 43.474 19.245  -4.986  1.00 60.23  ? 81  ARG A NH1   1 
ATOM   700  N  NH2   . ARG A 1 84  ? 41.920 20.906  -5.303  1.00 61.63  ? 81  ARG A NH2   1 
ATOM   701  N  N     . GLU A 1 85  ? 40.506 19.004  1.569   1.00 15.49  ? 82  GLU A N     1 
ATOM   702  C  CA    . GLU A 1 85  ? 39.101 18.725  1.353   1.00 14.35  ? 82  GLU A CA    1 
ATOM   703  C  C     . GLU A 1 85  ? 38.627 19.484  0.128   1.00 19.03  ? 82  GLU A C     1 
ATOM   704  O  O     . GLU A 1 85  ? 38.873 20.685  0.004   1.00 21.85  ? 82  GLU A O     1 
ATOM   705  C  CB    . GLU A 1 85  ? 38.287 19.123  2.582   1.00 21.65  ? 82  GLU A CB    1 
ATOM   706  C  CG    . GLU A 1 85  ? 38.359 18.081  3.674   1.00 28.81  ? 82  GLU A CG    1 
ATOM   707  C  CD    . GLU A 1 85  ? 37.508 18.429  4.875   1.00 38.03  ? 82  GLU A CD    1 
ATOM   708  O  OE1   . GLU A 1 85  ? 36.290 18.672  4.702   1.00 39.92  ? 82  GLU A OE1   1 
ATOM   709  O  OE2   . GLU A 1 85  ? 38.069 18.462  5.989   1.00 41.34  ? 82  GLU A OE2   1 
ATOM   710  N  N     . SER A 1 86  ? 37.961 18.776  -0.781  1.00 17.29  ? 83  SER A N     1 
ATOM   711  C  CA    . SER A 1 86  ? 37.382 19.387  -1.965  1.00 14.02  ? 83  SER A CA    1 
ATOM   712  C  C     . SER A 1 86  ? 36.025 18.766  -2.213  1.00 18.85  ? 83  SER A C     1 
ATOM   713  O  O     . SER A 1 86  ? 35.854 17.561  -2.055  1.00 19.55  ? 83  SER A O     1 
ATOM   714  C  CB    . SER A 1 86  ? 38.265 19.146  -3.188  1.00 22.75  ? 83  SER A CB    1 
ATOM   715  O  OG    . SER A 1 86  ? 39.552 19.697  -3.006  1.00 31.04  ? 83  SER A OG    1 
ATOM   716  N  N     . ARG A 1 87  ? 35.062 19.598  -2.598  1.00 24.08  ? 84  ARG A N     1 
ATOM   717  C  CA    . ARG A 1 87  ? 33.705 19.130  -2.864  1.00 22.71  ? 84  ARG A CA    1 
ATOM   718  C  C     . ARG A 1 87  ? 33.113 18.379  -1.677  1.00 22.79  ? 84  ARG A C     1 
ATOM   719  O  O     . ARG A 1 87  ? 32.307 17.464  -1.851  1.00 27.82  ? 84  ARG A O     1 
ATOM   720  C  CB    . ARG A 1 87  ? 33.662 18.279  -4.138  1.00 29.76  ? 84  ARG A CB    1 
ATOM   721  C  CG    . ARG A 1 87  ? 33.907 19.078  -5.410  1.00 34.78  ? 84  ARG A CG    1 
ATOM   722  C  CD    . ARG A 1 87  ? 33.781 18.216  -6.657  1.00 35.83  ? 84  ARG A CD    1 
ATOM   723  N  NE    . ARG A 1 87  ? 35.060 18.082  -7.349  1.00 38.74  ? 84  ARG A NE    1 
ATOM   724  C  CZ    . ARG A 1 87  ? 35.442 18.842  -8.371  1.00 42.40  ? 84  ARG A CZ    1 
ATOM   725  N  NH1   . ARG A 1 87  ? 34.635 19.788  -8.835  1.00 46.45  ? 84  ARG A NH1   1 
ATOM   726  N  NH2   . ARG A 1 87  ? 36.629 18.651  -8.933  1.00 42.52  ? 84  ARG A NH2   1 
ATOM   727  N  N     . GLY A 1 88  ? 33.526 18.767  -0.474  1.00 19.11  ? 85  GLY A N     1 
ATOM   728  C  CA    . GLY A 1 88  ? 32.985 18.210  0.750   1.00 23.93  ? 85  GLY A CA    1 
ATOM   729  C  C     . GLY A 1 88  ? 33.606 16.895  1.188   1.00 22.94  ? 85  GLY A C     1 
ATOM   730  O  O     . GLY A 1 88  ? 33.134 16.263  2.137   1.00 23.48  ? 85  GLY A O     1 
ATOM   731  N  N     . LYS A 1 89  ? 34.670 16.470  0.507   1.00 16.61  ? 86  LYS A N     1 
ATOM   732  C  CA    . LYS A 1 89  ? 35.283 15.187  0.823   1.00 15.27  ? 86  LYS A CA    1 
ATOM   733  C  C     . LYS A 1 89  ? 36.815 15.258  0.836   1.00 16.74  ? 86  LYS A C     1 
ATOM   734  O  O     . LYS A 1 89  ? 37.412 16.157  0.252   1.00 16.75  ? 86  LYS A O     1 
ATOM   735  C  CB    . LYS A 1 89  ? 34.820 14.108  -0.164  1.00 20.60  ? 86  LYS A CB    1 
ATOM   736  C  CG    . LYS A 1 89  ? 35.266 14.329  -1.591  1.00 19.59  ? 86  LYS A CG    1 
ATOM   737  C  CD    . LYS A 1 89  ? 34.778 13.225  -2.535  1.00 21.66  ? 86  LYS A CD    1 
ATOM   738  C  CE    . LYS A 1 89  ? 35.399 11.863  -2.222  1.00 18.87  ? 86  LYS A CE    1 
ATOM   739  N  NZ    . LYS A 1 89  ? 36.910 11.831  -2.283  1.00 17.18  ? 86  LYS A NZ    1 
ATOM   740  N  N     . ALA A 1 90  ? 37.442 14.307  1.515   1.00 16.83  ? 87  ALA A N     1 
ATOM   741  C  CA    . ALA A 1 90  ? 38.896 14.213  1.491   1.00 15.56  ? 87  ALA A CA    1 
ATOM   742  C  C     . ALA A 1 90  ? 39.338 13.995  0.059   1.00 17.63  ? 87  ALA A C     1 
ATOM   743  O  O     . ALA A 1 90  ? 38.688 13.273  -0.709  1.00 22.48  ? 87  ALA A O     1 
ATOM   744  C  CB    . ALA A 1 90  ? 39.381 13.074  2.375   1.00 22.95  ? 87  ALA A CB    1 
ATOM   745  N  N     . ASN A 1 91  ? 40.435 14.647  -0.311  1.00 14.51  ? 88  ASN A N     1 
ATOM   746  C  CA    . ASN A 1 91  ? 40.962 14.542  -1.661  1.00 18.09  ? 88  ASN A CA    1 
ATOM   747  C  C     . ASN A 1 91  ? 42.428 14.164  -1.586  1.00 16.80  ? 88  ASN A C     1 
ATOM   748  O  O     . ASN A 1 91  ? 43.234 14.901  -1.026  1.00 17.18  ? 88  ASN A O     1 
ATOM   749  C  CB    . ASN A 1 91  ? 40.805 15.861  -2.409  1.00 18.44  ? 88  ASN A CB    1 
ATOM   750  C  CG    . ASN A 1 91  ? 41.181 15.740  -3.866  1.00 22.04  ? 88  ASN A CG    1 
ATOM   751  O  OD1   . ASN A 1 91  ? 42.321 15.427  -4.189  1.00 18.58  ? 88  ASN A OD1   1 
ATOM   752  N  ND2   . ASN A 1 91  ? 40.219 15.976  -4.757  1.00 28.97  ? 88  ASN A ND2   1 
ATOM   753  N  N     . LEU A 1 92  ? 42.773 13.006  -2.133  1.00 12.62  ? 89  LEU A N     1 
ATOM   754  C  CA    . LEU A 1 92  ? 44.113 12.449  -1.943  1.00 11.81  ? 89  LEU A CA    1 
ATOM   755  C  C     . LEU A 1 92  ? 45.099 12.744  -3.070  1.00 13.16  ? 89  LEU A C     1 
ATOM   756  O  O     . LEU A 1 92  ? 46.154 12.112  -3.141  1.00 14.22  ? 89  LEU A O     1 
ATOM   757  C  CB    . LEU A 1 92  ? 44.015 10.932  -1.742  1.00 13.82  ? 89  LEU A CB    1 
ATOM   758  C  CG    . LEU A 1 92  ? 43.043 10.515  -0.635  1.00 15.65  ? 89  LEU A CG    1 
ATOM   759  C  CD1   . LEU A 1 92  ? 42.897 9.003   -0.565  1.00 18.67  ? 89  LEU A CD1   1 
ATOM   760  C  CD2   . LEU A 1 92  ? 43.548 11.070  0.693   1.00 18.50  ? 89  LEU A CD2   1 
ATOM   761  N  N     . THR A 1 93  ? 44.764 13.698  -3.938  1.00 13.33  ? 90  THR A N     1 
ATOM   762  C  CA    . THR A 1 93  ? 45.593 13.981  -5.108  1.00 12.32  ? 90  THR A CA    1 
ATOM   763  C  C     . THR A 1 93  ? 47.074 14.206  -4.812  1.00 12.65  ? 90  THR A C     1 
ATOM   764  O  O     . THR A 1 93  ? 47.934 13.702  -5.522  1.00 15.26  ? 90  THR A O     1 
ATOM   765  C  CB    . THR A 1 93  ? 45.025 15.173  -5.895  1.00 16.68  ? 90  THR A CB    1 
ATOM   766  O  OG1   . THR A 1 93  ? 43.698 14.850  -6.330  1.00 23.24  ? 90  THR A OG1   1 
ATOM   767  C  CG2   . THR A 1 93  ? 45.894 15.494  -7.111  1.00 16.12  ? 90  THR A CG2   1 
ATOM   768  N  N     . LYS A 1 94  ? 47.372 14.975  -3.776  1.00 12.61  ? 91  LYS A N     1 
ATOM   769  C  CA    . LYS A 1 94  ? 48.767 15.266  -3.449  1.00 12.58  ? 91  LYS A CA    1 
ATOM   770  C  C     . LYS A 1 94  ? 49.596 13.998  -3.267  1.00 13.62  ? 91  LYS A C     1 
ATOM   771  O  O     . LYS A 1 94  ? 50.758 13.943  -3.700  1.00 14.50  ? 91  LYS A O     1 
ATOM   772  C  CB    . LYS A 1 94  ? 48.843 16.142  -2.193  1.00 15.58  ? 91  LYS A CB    1 
ATOM   773  C  CG    . LYS A 1 94  ? 50.258 16.632  -1.868  1.00 16.20  ? 91  LYS A CG    1 
ATOM   774  C  CD    . LYS A 1 94  ? 50.356 17.185  -0.452  1.00 16.73  ? 91  LYS A CD    1 
ATOM   775  C  CE    . LYS A 1 94  ? 49.363 18.298  -0.214  1.00 19.27  ? 91  LYS A CE    1 
ATOM   776  N  NZ    . LYS A 1 94  ? 49.578 18.870  1.141   1.00 15.35  ? 91  LYS A NZ    1 
ATOM   777  N  N     . TYR A 1 95  ? 49.005 12.988  -2.630  1.00 11.00  ? 92  TYR A N     1 
ATOM   778  C  CA    . TYR A 1 95  ? 49.696 11.748  -2.314  1.00 8.13   ? 92  TYR A CA    1 
ATOM   779  C  C     . TYR A 1 95  ? 49.777 10.868  -3.541  1.00 12.74  ? 92  TYR A C     1 
ATOM   780  O  O     . TYR A 1 95  ? 50.789 10.212  -3.761  1.00 13.30  ? 92  TYR A O     1 
ATOM   781  C  CB    . TYR A 1 95  ? 49.018 11.019  -1.126  1.00 10.67  ? 92  TYR A CB    1 
ATOM   782  C  CG    . TYR A 1 95  ? 48.709 11.998  -0.021  1.00 10.52  ? 92  TYR A CG    1 
ATOM   783  C  CD1   . TYR A 1 95  ? 47.412 12.431  0.198   1.00 12.67  ? 92  TYR A CD1   1 
ATOM   784  C  CD2   . TYR A 1 95  ? 49.733 12.596  0.699   1.00 11.63  ? 92  TYR A CD2   1 
ATOM   785  C  CE1   . TYR A 1 95  ? 47.130 13.373  1.154   1.00 14.84  ? 92  TYR A CE1   1 
ATOM   786  C  CE2   . TYR A 1 95  ? 49.463 13.532  1.657   1.00 10.53  ? 92  TYR A CE2   1 
ATOM   787  C  CZ    . TYR A 1 95  ? 48.153 13.920  1.881   1.00 12.96  ? 92  TYR A CZ    1 
ATOM   788  O  OH    . TYR A 1 95  ? 47.828 14.883  2.813   1.00 14.71  ? 92  TYR A OH    1 
ATOM   789  N  N     . ARG A 1 96  ? 48.725 10.871  -4.365  1.00 13.08  ? 93  ARG A N     1 
ATOM   790  C  CA    . ARG A 1 96  ? 48.798 10.159  -5.641  1.00 9.66   ? 93  ARG A CA    1 
ATOM   791  C  C     . ARG A 1 96  ? 49.894 10.716  -6.556  1.00 15.74  ? 93  ARG A C     1 
ATOM   792  O  O     . ARG A 1 96  ? 50.610 9.952   -7.220  1.00 15.90  ? 93  ARG A O     1 
ATOM   793  C  CB    . ARG A 1 96  ? 47.457 10.183  -6.372  1.00 11.96  ? 93  ARG A CB    1 
ATOM   794  C  CG    . ARG A 1 96  ? 46.382 9.375   -5.674  1.00 15.23  ? 93  ARG A CG    1 
ATOM   795  C  CD    . ARG A 1 96  ? 45.169 9.083   -6.569  1.00 16.22  ? 93  ARG A CD    1 
ATOM   796  N  NE    . ARG A 1 96  ? 44.130 8.433   -5.775  1.00 22.20  ? 93  ARG A NE    1 
ATOM   797  C  CZ    . ARG A 1 96  ? 43.104 9.058   -5.197  1.00 18.55  ? 93  ARG A CZ    1 
ATOM   798  N  NH1   . ARG A 1 96  ? 42.247 8.352   -4.460  1.00 17.90  ? 93  ARG A NH1   1 
ATOM   799  N  NH2   . ARG A 1 96  ? 42.940 10.371  -5.345  1.00 16.68  ? 93  ARG A NH2   1 
ATOM   800  N  N     . GLU A 1 97  ? 50.021 12.041  -6.600  1.00 12.53  ? 94  GLU A N     1 
ATOM   801  C  CA    . GLU A 1 97  ? 51.036 12.673  -7.447  1.00 11.21  ? 94  GLU A CA    1 
ATOM   802  C  C     . GLU A 1 97  ? 52.448 12.379  -6.918  1.00 12.13  ? 94  GLU A C     1 
ATOM   803  O  O     . GLU A 1 97  ? 53.358 12.112  -7.701  1.00 13.52  ? 94  GLU A O     1 
ATOM   804  C  CB    . GLU A 1 97  ? 50.759 14.167  -7.628  1.00 15.53  ? 94  GLU A CB    1 
ATOM   805  C  CG    . GLU A 1 97  ? 49.498 14.411  -8.445  1.00 17.16  ? 94  GLU A CG    1 
ATOM   806  C  CD    . GLU A 1 97  ? 49.119 15.874  -8.568  1.00 28.19  ? 94  GLU A CD    1 
ATOM   807  O  OE1   . GLU A 1 97  ? 49.692 16.713  -7.843  1.00 37.05  ? 94  GLU A OE1   1 
ATOM   808  O  OE2   . GLU A 1 97  ? 48.233 16.180  -9.394  1.00 31.90  ? 94  GLU A OE2   1 
ATOM   809  N  N     . ALA A 1 98  ? 52.620 12.384  -5.595  1.00 12.58  ? 95  ALA A N     1 
ATOM   810  C  CA    . ALA A 1 98  ? 53.912 12.057  -4.999  1.00 9.56   ? 95  ALA A CA    1 
ATOM   811  C  C     . ALA A 1 98  ? 54.291 10.600  -5.265  1.00 12.96  ? 95  ALA A C     1 
ATOM   812  O  O     . ALA A 1 98  ? 55.467 10.266  -5.452  1.00 13.63  ? 95  ALA A O     1 
ATOM   813  C  CB    . ALA A 1 98  ? 53.883 12.331  -3.490  1.00 12.13  ? 95  ALA A CB    1 
ATOM   814  N  N     . SER A 1 99  ? 53.291 9.729   -5.275  1.00 12.48  ? 96  SER A N     1 
ATOM   815  C  CA    . SER A 1 99  ? 53.490 8.332   -5.619  1.00 8.12   ? 96  SER A CA    1 
ATOM   816  C  C     . SER A 1 99  ? 54.016 8.168   -7.039  1.00 12.08  ? 96  SER A C     1 
ATOM   817  O  O     . SER A 1 99  ? 54.949 7.394   -7.283  1.00 13.46  ? 96  SER A O     1 
ATOM   818  C  CB    . SER A 1 99  ? 52.169 7.563   -5.461  1.00 12.71  ? 96  SER A CB    1 
ATOM   819  O  OG    . SER A 1 99  ? 52.282 6.220   -5.898  1.00 16.64  ? 96  SER A OG    1 
ATOM   820  N  N     . VAL A 1 100 ? 53.422 8.897   -7.981  1.00 12.16  ? 97  VAL A N     1 
ATOM   821  C  CA    . VAL A 1 100 ? 53.925 8.862   -9.357  1.00 9.33   ? 97  VAL A CA    1 
ATOM   822  C  C     . VAL A 1 100 ? 55.401 9.284   -9.423  1.00 13.08  ? 97  VAL A C     1 
ATOM   823  O  O     . VAL A 1 100 ? 56.188 8.690   -10.159 1.00 15.22  ? 97  VAL A O     1 
ATOM   824  C  CB    . VAL A 1 100 ? 53.045 9.728   -10.267 1.00 14.17  ? 97  VAL A CB    1 
ATOM   825  C  CG1   . VAL A 1 100 ? 53.716 9.938   -11.646 1.00 16.18  ? 97  VAL A CG1   1 
ATOM   826  C  CG2   . VAL A 1 100 ? 51.650 9.087   -10.420 1.00 15.85  ? 97  VAL A CG2   1 
ATOM   827  N  N     . GLU A 1 101 ? 55.796 10.290  -8.640  1.00 11.58  ? 98  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 101 ? 57.209 10.680  -8.608  1.00 10.37  ? 98  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 101 ? 58.111 9.492   -8.307  1.00 13.67  ? 98  GLU A C     1 
ATOM   830  O  O     . GLU A 1 101 ? 59.140 9.293   -8.963  1.00 16.86  ? 98  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 101 ? 57.507 11.750  -7.545  1.00 14.23  ? 98  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 101 ? 56.924 13.135  -7.785  1.00 17.69  ? 98  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 101 ? 57.322 14.111  -6.676  1.00 17.60  ? 98  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 101 ? 58.526 14.459  -6.579  1.00 17.71  ? 98  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 101 ? 56.428 14.526  -5.903  1.00 20.73  ? 98  GLU A OE2   1 
ATOM   836  N  N     . VAL A 1 102 ? 57.738 8.703   -7.300  1.00 11.34  ? 99  VAL A N     1 
ATOM   837  C  CA    . VAL A 1 102 ? 58.588 7.625   -6.855  1.00 9.52   ? 99  VAL A CA    1 
ATOM   838  C  C     . VAL A 1 102 ? 58.535 6.456   -7.825  1.00 11.89  ? 99  VAL A C     1 
ATOM   839  O  O     . VAL A 1 102 ? 59.576 5.854   -8.132  1.00 15.42  ? 99  VAL A O     1 
ATOM   840  C  CB    . VAL A 1 102 ? 58.171 7.143   -5.454  1.00 12.27  ? 99  VAL A CB    1 
ATOM   841  C  CG1   . VAL A 1 102 ? 58.959 5.893   -5.064  1.00 18.04  ? 99  VAL A CG1   1 
ATOM   842  C  CG2   . VAL A 1 102 ? 58.375 8.271   -4.435  1.00 14.83  ? 99  VAL A CG2   1 
ATOM   843  N  N     . MET A 1 103 ? 57.332 6.126   -8.298  1.00 11.85  ? 100 MET A N     1 
ATOM   844  C  CA    . MET A 1 103 ? 57.165 5.013   -9.236  1.00 8.95   ? 100 MET A CA    1 
ATOM   845  C  C     . MET A 1 103 ? 57.931 5.275   -10.531 1.00 14.26  ? 100 MET A C     1 
ATOM   846  O  O     . MET A 1 103 ? 58.530 4.353   -11.091 1.00 14.50  ? 100 MET A O     1 
ATOM   847  C  CB    . MET A 1 103 ? 55.677 4.756   -9.535  1.00 19.87  ? 100 MET A CB    1 
ATOM   848  C  CG    A MET A 1 103 ? 54.787 4.628   -8.279  0.43 22.01  ? 100 MET A CG    1 
ATOM   849  C  CG    B MET A 1 103 ? 54.828 4.461   -8.323  0.57 21.96  ? 100 MET A CG    1 
ATOM   850  S  SD    A MET A 1 103 ? 54.351 2.948   -7.745  0.43 18.83  ? 100 MET A SD    1 
ATOM   851  S  SD    B MET A 1 103 ? 55.378 2.942   -7.544  0.57 14.89  ? 100 MET A SD    1 
ATOM   852  C  CE    A MET A 1 103 ? 53.782 3.230   -6.066  0.43 15.22  ? 100 MET A CE    1 
ATOM   853  C  CE    B MET A 1 103 ? 54.405 2.935   -6.030  0.57 14.53  ? 100 MET A CE    1 
ATOM   854  N  N     . GLU A 1 104 ? 57.968 6.526   -10.996 1.00 12.19  ? 101 GLU A N     1 
ATOM   855  C  CA    . GLU A 1 104 ? 58.707 6.818   -12.235 1.00 11.46  ? 101 GLU A CA    1 
ATOM   856  C  C     . GLU A 1 104 ? 60.217 6.664   -12.057 1.00 15.10  ? 101 GLU A C     1 
ATOM   857  O  O     . GLU A 1 104 ? 60.912 6.179   -12.965 1.00 17.75  ? 101 GLU A O     1 
ATOM   858  C  CB    . GLU A 1 104 ? 58.328 8.188   -12.796 1.00 16.04  ? 101 GLU A CB    1 
ATOM   859  C  CG    . GLU A 1 104 ? 56.903 8.216   -13.373 1.00 22.71  ? 101 GLU A CG    1 
ATOM   860  C  CD    . GLU A 1 104 ? 56.551 9.539   -14.025 1.00 35.23  ? 101 GLU A CD    1 
ATOM   861  O  OE1   . GLU A 1 104 ? 57.345 10.497  -13.895 1.00 37.20  ? 101 GLU A OE1   1 
ATOM   862  O  OE2   . GLU A 1 104 ? 55.480 9.616   -14.667 1.00 35.63  ? 101 GLU A OE2   1 
ATOM   863  N  N     . ILE A 1 105 ? 60.731 7.019   -10.882 1.00 13.24  ? 102 ILE A N     1 
ATOM   864  C  CA    . ILE A 1 105 ? 62.147 6.781   -10.601 1.00 10.91  ? 102 ILE A CA    1 
ATOM   865  C  C     . ILE A 1 105 ? 62.466 5.283   -10.568 1.00 13.91  ? 102 ILE A C     1 
ATOM   866  O  O     . ILE A 1 105 ? 63.427 4.815   -11.206 1.00 14.87  ? 102 ILE A O     1 
ATOM   867  C  CB    . ILE A 1 105 ? 62.565 7.469   -9.293  1.00 14.52  ? 102 ILE A CB    1 
ATOM   868  C  CG1   . ILE A 1 105 ? 62.471 8.988   -9.449  1.00 15.11  ? 102 ILE A CG1   1 
ATOM   869  C  CG2   . ILE A 1 105 ? 63.978 7.065   -8.892  1.00 16.92  ? 102 ILE A CG2   1 
ATOM   870  C  CD1   . ILE A 1 105 ? 62.333 9.721   -8.113  1.00 17.45  ? 102 ILE A CD1   1 
ATOM   871  N  N     . MET A 1 106 ? 61.658 4.518   -9.836  1.00 13.44  ? 103 MET A N     1 
ATOM   872  C  CA    . MET A 1 106 ? 61.867 3.073   -9.747  1.00 10.81  ? 103 MET A CA    1 
ATOM   873  C  C     . MET A 1 106 ? 61.875 2.412   -11.116 1.00 14.03  ? 103 MET A C     1 
ATOM   874  O  O     . MET A 1 106 ? 62.678 1.506   -11.373 1.00 14.12  ? 103 MET A O     1 
ATOM   875  C  CB    . MET A 1 106 ? 60.824 2.422   -8.837  1.00 14.85  ? 103 MET A CB    1 
ATOM   876  C  CG    . MET A 1 106 ? 61.049 2.758   -7.370  1.00 13.97  ? 103 MET A CG    1 
ATOM   877  S  SD    . MET A 1 106 ? 59.875 1.871   -6.330  1.00 19.81  ? 103 MET A SD    1 
ATOM   878  C  CE    . MET A 1 106 ? 58.370 2.704   -6.760  1.00 32.69  ? 103 MET A CE    1 
ATOM   879  N  N     . SER A 1 107 ? 60.981 2.863   -11.989 1.00 15.01  ? 104 SER A N     1 
ATOM   880  C  CA    . SER A 1 107 ? 60.867 2.305   -13.334 1.00 13.84  ? 104 SER A CA    1 
ATOM   881  C  C     . SER A 1 107 ? 62.138 2.471   -14.168 1.00 19.38  ? 104 SER A C     1 
ATOM   882  O  O     . SER A 1 107 ? 62.310 1.764   -15.160 1.00 20.15  ? 104 SER A O     1 
ATOM   883  C  CB    . SER A 1 107 ? 59.677 2.931   -14.071 1.00 20.88  ? 104 SER A CB    1 
ATOM   884  O  OG    . SER A 1 107 ? 58.462 2.604   -13.422 1.00 26.04  ? 104 SER A OG    1 
ATOM   885  N  N     . ARG A 1 108 ? 63.030 3.386   -13.785 1.00 16.52  ? 105 ARG A N     1 
ATOM   886  C  CA    . ARG A 1 108 ? 64.292 3.521   -14.532 1.00 17.48  ? 105 ARG A CA    1 
ATOM   887  C  C     . ARG A 1 108 ? 65.190 2.312   -14.323 1.00 17.98  ? 105 ARG A C     1 
ATOM   888  O  O     . ARG A 1 108 ? 66.021 1.984   -15.180 1.00 20.77  ? 105 ARG A O     1 
ATOM   889  C  CB    . ARG A 1 108 ? 65.073 4.778   -14.132 1.00 18.90  ? 105 ARG A CB    1 
ATOM   890  C  CG    . ARG A 1 108 ? 64.347 6.076   -14.352 1.00 19.93  ? 105 ARG A CG    1 
ATOM   891  C  CD    . ARG A 1 108 ? 65.328 7.235   -14.524 1.00 27.82  ? 105 ARG A CD    1 
ATOM   892  N  NE    . ARG A 1 108 ? 66.328 7.318   -13.462 1.00 28.25  ? 105 ARG A NE    1 
ATOM   893  C  CZ    . ARG A 1 108 ? 66.273 8.175   -12.443 1.00 23.87  ? 105 ARG A CZ    1 
ATOM   894  N  NH1   . ARG A 1 108 ? 67.233 8.179   -11.526 1.00 25.19  ? 105 ARG A NH1   1 
ATOM   895  N  NH2   . ARG A 1 108 ? 65.255 9.015   -12.339 1.00 20.62  ? 105 ARG A NH2   1 
ATOM   896  N  N     . PHE A 1 109 ? 65.027 1.651   -13.179 1.00 18.60  ? 106 PHE A N     1 
ATOM   897  C  CA    . PHE A 1 109 ? 65.914 0.562   -12.791 1.00 17.32  ? 106 PHE A CA    1 
ATOM   898  C  C     . PHE A 1 109 ? 65.408 -0.785  -13.270 1.00 22.24  ? 106 PHE A C     1 
ATOM   899  O  O     . PHE A 1 109 ? 66.190 -1.670  -13.636 1.00 25.85  ? 106 PHE A O     1 
ATOM   900  C  CB    . PHE A 1 109 ? 66.082 0.545   -11.267 1.00 16.65  ? 106 PHE A CB    1 
ATOM   901  C  CG    . PHE A 1 109 ? 66.836 1.733   -10.734 1.00 19.61  ? 106 PHE A CG    1 
ATOM   902  C  CD1   . PHE A 1 109 ? 66.207 2.954   -10.568 1.00 18.05  ? 106 PHE A CD1   1 
ATOM   903  C  CD2   . PHE A 1 109 ? 68.175 1.626   -10.399 1.00 21.50  ? 106 PHE A CD2   1 
ATOM   904  C  CE1   . PHE A 1 109 ? 66.900 4.047   -10.077 1.00 20.73  ? 106 PHE A CE1   1 
ATOM   905  C  CE2   . PHE A 1 109 ? 68.870 2.712   -9.906  1.00 19.91  ? 106 PHE A CE2   1 
ATOM   906  C  CZ    . PHE A 1 109 ? 68.236 3.930   -9.751  1.00 18.21  ? 106 PHE A CZ    1 
ATOM   907  N  N     . ALA A 1 110 ? 64.094 -0.943  -13.272 1.00 21.76  ? 107 ALA A N     1 
ATOM   908  C  CA    . ALA A 1 110 ? 63.503 -2.231  -13.585 1.00 16.62  ? 107 ALA A CA    1 
ATOM   909  C  C     . ALA A 1 110 ? 62.020 -2.106  -13.795 1.00 22.24  ? 107 ALA A C     1 
ATOM   910  O  O     . ALA A 1 110 ? 61.426 -1.074  -13.512 1.00 22.28  ? 107 ALA A O     1 
ATOM   911  C  CB    . ALA A 1 110 ? 63.782 -3.228  -12.465 1.00 25.73  ? 107 ALA A CB    1 
ATOM   912  N  N     . VAL A 1 111 ? 61.426 -3.188  -14.280 1.00 28.97  ? 108 VAL A N     1 
ATOM   913  C  CA    . VAL A 1 111 ? 59.984 -3.297  -14.371 1.00 28.07  ? 108 VAL A CA    1 
ATOM   914  C  C     . VAL A 1 111 ? 59.399 -3.371  -12.966 1.00 20.24  ? 108 VAL A C     1 
ATOM   915  O  O     . VAL A 1 111 ? 59.884 -4.139  -12.115 1.00 25.08  ? 108 VAL A O     1 
ATOM   916  C  CB    . VAL A 1 111 ? 59.579 -4.568  -15.131 1.00 47.41  ? 108 VAL A CB    1 
ATOM   917  C  CG1   . VAL A 1 111 ? 58.064 -4.701  -15.169 1.00 48.13  ? 108 VAL A CG1   1 
ATOM   918  C  CG2   . VAL A 1 111 ? 60.165 -4.550  -16.536 1.00 49.86  ? 108 VAL A CG2   1 
ATOM   919  N  N     . ILE A 1 112 ? 58.370 -2.563  -12.720 1.00 24.95  ? 109 ILE A N     1 
ATOM   920  C  CA    . ILE A 1 112 ? 57.721 -2.571  -11.415 1.00 13.19  ? 109 ILE A CA    1 
ATOM   921  C  C     . ILE A 1 112 ? 56.256 -2.959  -11.474 1.00 14.48  ? 109 ILE A C     1 
ATOM   922  O  O     . ILE A 1 112 ? 55.574 -2.797  -12.490 1.00 17.43  ? 109 ILE A O     1 
ATOM   923  C  CB    . ILE A 1 112 ? 57.844 -1.200  -10.693 1.00 20.07  ? 109 ILE A CB    1 
ATOM   924  C  CG1   . ILE A 1 112 ? 56.861 -0.180  -11.258 1.00 22.47  ? 109 ILE A CG1   1 
ATOM   925  C  CG2   . ILE A 1 112 ? 59.282 -0.694  -10.750 1.00 26.23  ? 109 ILE A CG2   1 
ATOM   926  C  CD1   . ILE A 1 112 ? 56.793 1.111   -10.434 1.00 26.19  ? 109 ILE A CD1   1 
ATOM   927  N  N     . GLU A 1 113 ? 55.793 -3.517  -10.367 1.00 12.01  ? 110 GLU A N     1 
ATOM   928  C  CA    . GLU A 1 113 ? 54.374 -3.740  -10.133 1.00 7.53   ? 110 GLU A CA    1 
ATOM   929  C  C     . GLU A 1 113 ? 53.937 -2.827  -9.003  1.00 12.68  ? 110 GLU A C     1 
ATOM   930  O  O     . GLU A 1 113 ? 54.393 -2.969  -7.868  1.00 13.88  ? 110 GLU A O     1 
ATOM   931  C  CB    . GLU A 1 113 ? 54.121 -5.198  -9.725  1.00 12.56  ? 110 GLU A CB    1 
ATOM   932  C  CG    . GLU A 1 113 ? 52.645 -5.479  -9.433  1.00 16.41  ? 110 GLU A CG    1 
ATOM   933  C  CD    . GLU A 1 113 ? 52.371 -6.897  -8.943  1.00 20.53  ? 110 GLU A CD    1 
ATOM   934  O  OE1   . GLU A 1 113 ? 51.293 -7.098  -8.343  1.00 25.66  ? 110 GLU A OE1   1 
ATOM   935  O  OE2   . GLU A 1 113 ? 53.209 -7.801  -9.154  1.00 18.66  ? 110 GLU A OE2   1 
ATOM   936  N  N     . ARG A 1 114 ? 53.056 -1.877  -9.313  1.00 13.21  ? 111 ARG A N     1 
ATOM   937  C  CA    . ARG A 1 114 ? 52.522 -0.971  -8.295  1.00 8.04   ? 111 ARG A CA    1 
ATOM   938  C  C     . ARG A 1 114 ? 51.585 -1.747  -7.395  1.00 16.61  ? 111 ARG A C     1 
ATOM   939  O  O     . ARG A 1 114 ? 50.519 -2.196  -7.829  1.00 24.29  ? 111 ARG A O     1 
ATOM   940  C  CB    . ARG A 1 114 ? 51.764 0.164   -8.971  1.00 13.23  ? 111 ARG A CB    1 
ATOM   941  C  CG    . ARG A 1 114 ? 51.167 1.173   -7.980  1.00 15.09  ? 111 ARG A CG    1 
ATOM   942  C  CD    . ARG A 1 114 ? 50.032 1.962   -8.644  1.00 17.28  ? 111 ARG A CD    1 
ATOM   943  N  NE    . ARG A 1 114 ? 49.674 3.192   -7.939  1.00 20.24  ? 111 ARG A NE    1 
ATOM   944  C  CZ    . ARG A 1 114 ? 48.715 3.284   -7.025  1.00 26.05  ? 111 ARG A CZ    1 
ATOM   945  N  NH1   . ARG A 1 114 ? 48.018 2.208   -6.672  1.00 24.33  ? 111 ARG A NH1   1 
ATOM   946  N  NH2   . ARG A 1 114 ? 48.463 4.459   -6.458  1.00 24.56  ? 111 ARG A NH2   1 
ATOM   947  N  N     . ALA A 1 115 ? 51.987 -1.917  -6.141  1.00 13.69  ? 112 ALA A N     1 
ATOM   948  C  CA    . ALA A 1 115 ? 51.226 -2.725  -5.202  1.00 11.07  ? 112 ALA A CA    1 
ATOM   949  C  C     . ALA A 1 115 ? 50.206 -1.886  -4.441  1.00 20.13  ? 112 ALA A C     1 
ATOM   950  O  O     . ALA A 1 115 ? 49.136 -2.374  -4.068  1.00 23.29  ? 112 ALA A O     1 
ATOM   951  C  CB    . ALA A 1 115 ? 52.158 -3.422  -4.232  1.00 15.85  ? 112 ALA A CB    1 
ATOM   952  N  N     . SER A 1 116 ? 50.551 -0.625  -4.216  1.00 15.45  ? 113 SER A N     1 
ATOM   953  C  CA    . SER A 1 116 ? 49.709 0.309   -3.475  1.00 12.30  ? 113 SER A CA    1 
ATOM   954  C  C     . SER A 1 116 ? 50.222 1.715   -3.752  1.00 14.40  ? 113 SER A C     1 
ATOM   955  O  O     . SER A 1 116 ? 51.164 1.902   -4.523  1.00 14.72  ? 113 SER A O     1 
ATOM   956  C  CB    . SER A 1 116 ? 49.811 0.050   -1.975  1.00 19.38  ? 113 SER A CB    1 
ATOM   957  O  OG    . SER A 1 116 ? 51.071 0.486   -1.469  1.00 20.13  ? 113 SER A OG    1 
ATOM   958  N  N     . ILE A 1 117 ? 49.628 2.708   -3.093  1.00 14.81  ? 114 ILE A N     1 
ATOM   959  C  CA    . ILE A 1 117 ? 50.053 4.090   -3.294  1.00 7.74   ? 114 ILE A CA    1 
ATOM   960  C  C     . ILE A 1 117 ? 51.549 4.297   -2.976  1.00 12.16  ? 114 ILE A C     1 
ATOM   961  O  O     . ILE A 1 117 ? 52.188 5.194   -3.529  1.00 14.62  ? 114 ILE A O     1 
ATOM   962  C  CB    . ILE A 1 117 ? 49.175 5.064   -2.472  1.00 13.49  ? 114 ILE A CB    1 
ATOM   963  C  CG1   . ILE A 1 117 ? 49.309 6.484   -3.035  1.00 17.41  ? 114 ILE A CG1   1 
ATOM   964  C  CG2   . ILE A 1 117 ? 49.501 4.976   -0.988  1.00 18.42  ? 114 ILE A CG2   1 
ATOM   965  C  CD1   . ILE A 1 117 ? 48.163 7.406   -2.656  1.00 19.45  ? 114 ILE A CD1   1 
ATOM   966  N  N     . ASP A 1 118 ? 52.119 3.470   -2.097  1.00 11.95  ? 115 ASP A N     1 
ATOM   967  C  CA    . ASP A 1 118 ? 53.519 3.694   -1.718  1.00 8.48   ? 115 ASP A CA    1 
ATOM   968  C  C     . ASP A 1 118 ? 54.404 2.455   -1.709  1.00 13.03  ? 115 ASP A C     1 
ATOM   969  O  O     . ASP A 1 118 ? 55.480 2.463   -1.091  1.00 15.38  ? 115 ASP A O     1 
ATOM   970  C  CB    . ASP A 1 118 ? 53.591 4.411   -0.378  1.00 11.65  ? 115 ASP A CB    1 
ATOM   971  C  CG    . ASP A 1 118 ? 53.476 3.468   0.782   1.00 13.86  ? 115 ASP A CG    1 
ATOM   972  O  OD1   . ASP A 1 118 ? 54.141 3.728   1.805   1.00 13.79  ? 115 ASP A OD1   1 
ATOM   973  O  OD2   . ASP A 1 118 ? 52.753 2.445   0.661   1.00 17.24  ? 115 ASP A OD2   1 
ATOM   974  N  N     . GLU A 1 119 ? 53.970 1.397   -2.396  1.00 12.36  ? 116 GLU A N     1 
ATOM   975  C  CA    . GLU A 1 119 ? 54.730 0.160   -2.468  1.00 9.70   ? 116 GLU A CA    1 
ATOM   976  C  C     . GLU A 1 119 ? 54.807 -0.318  -3.893  1.00 12.29  ? 116 GLU A C     1 
ATOM   977  O  O     . GLU A 1 119 ? 53.820 -0.260  -4.639  1.00 13.92  ? 116 GLU A O     1 
ATOM   978  C  CB    . GLU A 1 119 ? 54.045 -0.953  -1.670  1.00 14.78  ? 116 GLU A CB    1 
ATOM   979  C  CG    A GLU A 1 119 ? 53.967 -0.695  -0.170  0.50 19.26  ? 116 GLU A CG    1 
ATOM   980  C  CG    B GLU A 1 119 ? 54.018 -0.756  -0.171  0.50 19.34  ? 116 GLU A CG    1 
ATOM   981  C  CD    A GLU A 1 119 ? 53.497 -1.911  0.604   0.50 25.74  ? 116 GLU A CD    1 
ATOM   982  C  CD    B GLU A 1 119 ? 53.457 -1.970  0.532   0.50 25.84  ? 116 GLU A CD    1 
ATOM   983  O  OE1   A GLU A 1 119 ? 53.438 -3.011  0.009   0.50 25.78  ? 116 GLU A OE1   1 
ATOM   984  O  OE1   B GLU A 1 119 ? 52.340 -2.403  0.169   0.50 24.77  ? 116 GLU A OE1   1 
ATOM   985  O  OE2   A GLU A 1 119 ? 53.188 -1.767  1.806   0.50 29.48  ? 116 GLU A OE2   1 
ATOM   986  O  OE2   B GLU A 1 119 ? 54.144 -2.505  1.424   0.50 29.76  ? 116 GLU A OE2   1 
ATOM   987  N  N     . ALA A 1 120 ? 55.981 -0.805  -4.285  1.00 11.78  ? 117 ALA A N     1 
ATOM   988  C  CA    . ALA A 1 120 ? 56.118 -1.450  -5.575  1.00 7.55   ? 117 ALA A CA    1 
ATOM   989  C  C     . ALA A 1 120 ? 57.070 -2.631  -5.497  1.00 12.87  ? 117 ALA A C     1 
ATOM   990  O  O     . ALA A 1 120 ? 58.073 -2.595  -4.781  1.00 12.77  ? 117 ALA A O     1 
ATOM   991  C  CB    . ALA A 1 120 ? 56.575 -0.450  -6.630  1.00 13.23  ? 117 ALA A CB    1 
ATOM   992  N  N     . TYR A 1 121 ? 56.727 -3.700  -6.215  1.00 11.65  ? 118 TYR A N     1 
ATOM   993  C  CA    . TYR A 1 121 ? 57.636 -4.821  -6.411  1.00 7.11   ? 118 TYR A CA    1 
ATOM   994  C  C     . TYR A 1 121 ? 58.474 -4.588  -7.646  1.00 14.51  ? 118 TYR A C     1 
ATOM   995  O  O     . TYR A 1 121 ? 58.020 -3.969  -8.610  1.00 14.29  ? 118 TYR A O     1 
ATOM   996  C  CB    . TYR A 1 121 ? 56.871 -6.146  -6.538  1.00 10.46  ? 118 TYR A CB    1 
ATOM   997  C  CG    . TYR A 1 121 ? 56.125 -6.545  -5.283  1.00 11.64  ? 118 TYR A CG    1 
ATOM   998  C  CD1   . TYR A 1 121 ? 54.793 -6.196  -5.095  1.00 12.79  ? 118 TYR A CD1   1 
ATOM   999  C  CD2   . TYR A 1 121 ? 56.762 -7.280  -4.284  1.00 15.14  ? 118 TYR A CD2   1 
ATOM   1000 C  CE1   . TYR A 1 121 ? 54.110 -6.564  -3.947  1.00 14.65  ? 118 TYR A CE1   1 
ATOM   1001 C  CE2   . TYR A 1 121 ? 56.087 -7.649  -3.141  1.00 15.51  ? 118 TYR A CE2   1 
ATOM   1002 C  CZ    . TYR A 1 121 ? 54.767 -7.294  -2.977  1.00 18.01  ? 118 TYR A CZ    1 
ATOM   1003 O  OH    . TYR A 1 121 ? 54.111 -7.676  -1.828  1.00 19.47  ? 118 TYR A OH    1 
ATOM   1004 N  N     . VAL A 1 122 ? 59.692 -5.124  -7.607  1.00 12.95  ? 119 VAL A N     1 
ATOM   1005 C  CA    . VAL A 1 122 ? 60.708 -4.936  -8.624  1.00 11.97  ? 119 VAL A CA    1 
ATOM   1006 C  C     . VAL A 1 122 ? 61.259 -6.320  -8.951  1.00 14.64  ? 119 VAL A C     1 
ATOM   1007 O  O     . VAL A 1 122 ? 61.653 -7.054  -8.043  1.00 13.90  ? 119 VAL A O     1 
ATOM   1008 C  CB    . VAL A 1 122 ? 61.861 -4.102  -8.003  1.00 18.38  ? 119 VAL A CB    1 
ATOM   1009 C  CG1   . VAL A 1 122 ? 62.781 -3.588  -9.069  1.00 25.59  ? 119 VAL A CG1   1 
ATOM   1010 C  CG2   . VAL A 1 122 ? 61.294 -2.947  -7.176  1.00 24.43  ? 119 VAL A CG2   1 
ATOM   1011 N  N     . ASP A 1 123 ? 61.288 -6.712  -10.225 1.00 15.83  ? 120 ASP A N     1 
ATOM   1012 C  CA    . ASP A 1 123 ? 61.932 -7.964  -10.594 1.00 15.17  ? 120 ASP A CA    1 
ATOM   1013 C  C     . ASP A 1 123 ? 63.333 -7.619  -11.065 1.00 17.28  ? 120 ASP A C     1 
ATOM   1014 O  O     . ASP A 1 123 ? 63.519 -7.033  -12.135 1.00 20.76  ? 120 ASP A O     1 
ATOM   1015 C  CB    . ASP A 1 123 ? 61.157 -8.717  -11.684 1.00 29.12  ? 120 ASP A CB    1 
ATOM   1016 C  CG    . ASP A 1 123 ? 61.718 -10.106 -11.946 1.00 33.55  ? 120 ASP A CG    1 
ATOM   1017 O  OD1   . ASP A 1 123 ? 62.952 -10.260 -11.986 1.00 23.81  ? 120 ASP A OD1   1 
ATOM   1018 O  OD2   . ASP A 1 123 ? 60.928 -11.065 -12.098 1.00 46.50  ? 120 ASP A OD2   1 
ATOM   1019 N  N     . LEU A 1 124 ? 64.317 -7.950  -10.242 1.00 14.91  ? 121 LEU A N     1 
ATOM   1020 C  CA    . LEU A 1 124 ? 65.685 -7.534  -10.497 1.00 12.99  ? 121 LEU A CA    1 
ATOM   1021 C  C     . LEU A 1 124 ? 66.541 -8.606  -11.154 1.00 14.56  ? 121 LEU A C     1 
ATOM   1022 O  O     . LEU A 1 124 ? 67.742 -8.397  -11.333 1.00 15.70  ? 121 LEU A O     1 
ATOM   1023 C  CB    . LEU A 1 124 ? 66.346 -7.106  -9.191  1.00 17.11  ? 121 LEU A CB    1 
ATOM   1024 C  CG    . LEU A 1 124 ? 65.741 -5.885  -8.519  1.00 17.64  ? 121 LEU A CG    1 
ATOM   1025 C  CD1   . LEU A 1 124 ? 66.211 -5.810  -7.076  1.00 23.74  ? 121 LEU A CD1   1 
ATOM   1026 C  CD2   . LEU A 1 124 ? 66.147 -4.654  -9.316  1.00 23.43  ? 121 LEU A CD2   1 
ATOM   1027 N  N     . THR A 1 125 ? 65.935 -9.733  -11.526 1.00 14.99  ? 122 THR A N     1 
ATOM   1028 C  CA    . THR A 1 125 ? 66.695 -10.867 -12.045 1.00 15.91  ? 122 THR A CA    1 
ATOM   1029 C  C     . THR A 1 125 ? 67.615 -10.477 -13.204 1.00 14.50  ? 122 THR A C     1 
ATOM   1030 O  O     . THR A 1 125 ? 68.802 -10.790 -13.182 1.00 19.35  ? 122 THR A O     1 
ATOM   1031 C  CB    . THR A 1 125 ? 65.776 -12.014 -12.478 1.00 17.87  ? 122 THR A CB    1 
ATOM   1032 O  OG1   . THR A 1 125 ? 64.874 -12.330 -11.409 1.00 16.63  ? 122 THR A OG1   1 
ATOM   1033 C  CG2   . THR A 1 125 ? 66.589 -13.256 -12.848 1.00 21.22  ? 122 THR A CG2   1 
ATOM   1034 N  N     . SER A 1 126 ? 67.063 -9.788  -14.198 1.00 18.18  ? 123 SER A N     1 
ATOM   1035 C  CA    . SER A 1 126 ? 67.842 -9.411  -15.383 1.00 19.65  ? 123 SER A CA    1 
ATOM   1036 C  C     . SER A 1 126 ? 68.898 -8.343  -15.061 1.00 18.40  ? 123 SER A C     1 
ATOM   1037 O  O     . SER A 1 126 ? 70.039 -8.434  -15.520 1.00 20.69  ? 123 SER A O     1 
ATOM   1038 C  CB    . SER A 1 126 ? 66.920 -8.937  -16.508 1.00 24.86  ? 123 SER A CB    1 
ATOM   1039 O  OG    A SER A 1 126 ? 66.158 -10.007 -17.035 0.50 26.32  ? 123 SER A OG    1 
ATOM   1040 O  OG    B SER A 1 126 ? 66.226 -7.761  -16.147 0.50 23.54  ? 123 SER A OG    1 
ATOM   1041 N  N     . ALA A 1 127 ? 68.518 -7.346  -14.269 1.00 17.77  ? 124 ALA A N     1 
ATOM   1042 C  CA    . ALA A 1 127 ? 69.460 -6.308  -13.839 1.00 19.83  ? 124 ALA A CA    1 
ATOM   1043 C  C     . ALA A 1 127 ? 70.639 -6.895  -13.061 1.00 17.69  ? 124 ALA A C     1 
ATOM   1044 O  O     . ALA A 1 127 ? 71.768 -6.427  -13.175 1.00 20.66  ? 124 ALA A O     1 
ATOM   1045 C  CB    . ALA A 1 127 ? 68.750 -5.236  -13.010 1.00 20.70  ? 124 ALA A CB    1 
ATOM   1046 N  N     . VAL A 1 128 ? 70.369 -7.909  -12.245 1.00 17.37  ? 125 VAL A N     1 
ATOM   1047 C  CA    . VAL A 1 128 ? 71.430 -8.570  -11.491 1.00 17.24  ? 125 VAL A CA    1 
ATOM   1048 C  C     . VAL A 1 128 ? 72.402 -9.317  -12.403 1.00 20.66  ? 125 VAL A C     1 
ATOM   1049 O  O     . VAL A 1 128 ? 73.620 -9.252  -12.218 1.00 20.50  ? 125 VAL A O     1 
ATOM   1050 C  CB    . VAL A 1 128 ? 70.837 -9.535  -10.432 1.00 16.52  ? 125 VAL A CB    1 
ATOM   1051 C  CG1   . VAL A 1 128 ? 71.875 -10.539 -9.968  1.00 18.21  ? 125 VAL A CG1   1 
ATOM   1052 C  CG2   . VAL A 1 128 ? 70.315 -8.735  -9.254  1.00 17.31  ? 125 VAL A CG2   1 
ATOM   1053 N  N     . GLN A 1 129 ? 71.864 -10.031 -13.383 1.00 18.42  ? 126 GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 129 ? 72.711 -10.719 -14.349 1.00 29.48  ? 126 GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 129 ? 73.643 -9.722  -15.037 1.00 26.62  ? 126 GLN A C     1 
ATOM   1056 O  O     . GLN A 1 129 ? 74.844 -9.962  -15.146 1.00 25.59  ? 126 GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 129 ? 71.866 -11.473 -15.376 1.00 38.89  ? 126 GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 129 ? 71.058 -12.623 -14.783 1.00 45.20  ? 126 GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 129 ? 71.932 -13.677 -14.114 1.00 53.93  ? 126 GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 129 ? 71.863 -13.881 -12.900 1.00 51.75  ? 126 GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 129 ? 72.754 -14.356 -14.907 1.00 56.49  ? 126 GLN A NE2   1 
ATOM   1062 N  N     . GLU A 1 130 ? 73.091 -8.595  -15.477 1.00 26.33  ? 127 GLU A N     1 
ATOM   1063 C  CA    . GLU A 1 130 ? 73.893 -7.572  -16.135 1.00 36.71  ? 127 GLU A CA    1 
ATOM   1064 C  C     . GLU A 1 130 ? 75.010 -7.056  -15.226 1.00 35.99  ? 127 GLU A C     1 
ATOM   1065 O  O     . GLU A 1 130 ? 76.162 -6.944  -15.647 1.00 33.17  ? 127 GLU A O     1 
ATOM   1066 C  CB    . GLU A 1 130 ? 73.012 -6.405  -16.595 1.00 33.59  ? 127 GLU A CB    1 
ATOM   1067 C  CG    . GLU A 1 130 ? 71.956 -6.786  -17.616 1.00 47.27  ? 127 GLU A CG    1 
ATOM   1068 C  CD    . GLU A 1 130 ? 71.140 -5.589  -18.079 1.00 65.23  ? 127 GLU A CD    1 
ATOM   1069 O  OE1   . GLU A 1 130 ? 71.736 -4.512  -18.305 1.00 69.41  ? 127 GLU A OE1   1 
ATOM   1070 O  OE2   . GLU A 1 130 ? 69.904 -5.722  -18.208 1.00 70.27  ? 127 GLU A OE2   1 
ATOM   1071 N  N     . ARG A 1 131 ? 74.669 -6.743  -13.980 1.00 27.74  ? 128 ARG A N     1 
ATOM   1072 C  CA    . ARG A 1 131 ? 75.640 -6.173  -13.057 1.00 30.26  ? 128 ARG A CA    1 
ATOM   1073 C  C     . ARG A 1 131 ? 76.741 -7.175  -12.730 1.00 30.48  ? 128 ARG A C     1 
ATOM   1074 O  O     . ARG A 1 131 ? 77.906 -6.801  -12.603 1.00 30.46  ? 128 ARG A O     1 
ATOM   1075 C  CB    . ARG A 1 131 ? 74.950 -5.691  -11.780 1.00 23.51  ? 128 ARG A CB    1 
ATOM   1076 C  CG    A ARG A 1 131 ? 75.848 -4.996  -10.773 0.51 25.52  ? 128 ARG A CG    1 
ATOM   1077 C  CG    B ARG A 1 131 ? 75.913 -5.101  -10.764 0.49 26.44  ? 128 ARG A CG    1 
ATOM   1078 C  CD    A ARG A 1 131 ? 76.423 -3.703  -11.328 0.51 23.80  ? 128 ARG A CD    1 
ATOM   1079 C  CD    B ARG A 1 131 ? 76.622 -3.884  -11.340 0.49 24.62  ? 128 ARG A CD    1 
ATOM   1080 N  NE    A ARG A 1 131 ? 76.997 -2.880  -10.269 0.51 27.40  ? 128 ARG A NE    1 
ATOM   1081 N  NE    B ARG A 1 131 ? 75.647 -2.864  -11.696 0.49 20.59  ? 128 ARG A NE    1 
ATOM   1082 C  CZ    A ARG A 1 131 ? 76.302 -2.001  -9.554  0.51 21.69  ? 128 ARG A CZ    1 
ATOM   1083 C  CZ    B ARG A 1 131 ? 75.129 -2.009  -10.821 0.49 22.50  ? 128 ARG A CZ    1 
ATOM   1084 N  NH1   A ARG A 1 131 ? 76.902 -1.291  -8.608  0.51 24.74  ? 128 ARG A NH1   1 
ATOM   1085 N  NH1   B ARG A 1 131 ? 74.231 -1.116  -11.214 0.49 28.64  ? 128 ARG A NH1   1 
ATOM   1086 N  NH2   A ARG A 1 131 ? 75.007 -1.827  -9.790  0.51 21.45  ? 128 ARG A NH2   1 
ATOM   1087 N  NH2   B ARG A 1 131 ? 75.517 -2.047  -9.553  0.49 19.92  ? 128 ARG A NH2   1 
ATOM   1088 N  N     . LEU A 1 132 ? 76.368 -8.443  -12.592 1.00 26.66  ? 129 LEU A N     1 
ATOM   1089 C  CA    . LEU A 1 132 ? 77.343 -9.509  -12.360 1.00 24.80  ? 129 LEU A CA    1 
ATOM   1090 C  C     . LEU A 1 132 ? 78.362 -9.581  -13.487 1.00 34.38  ? 129 LEU A C     1 
ATOM   1091 O  O     . LEU A 1 132 ? 79.531 -9.876  -13.254 1.00 35.52  ? 129 LEU A O     1 
ATOM   1092 C  CB    . LEU A 1 132 ? 76.647 -10.862 -12.184 1.00 26.82  ? 129 LEU A CB    1 
ATOM   1093 C  CG    . LEU A 1 132 ? 76.159 -11.138 -10.759 1.00 28.61  ? 129 LEU A CG    1 
ATOM   1094 C  CD1   . LEU A 1 132 ? 75.279 -12.371 -10.706 1.00 27.16  ? 129 LEU A CD1   1 
ATOM   1095 C  CD2   . LEU A 1 132 ? 77.345 -11.274 -9.802  1.00 28.00  ? 129 LEU A CD2   1 
ATOM   1096 N  N     . GLN A 1 133 ? 77.908 -9.315  -14.708 1.00 33.03  ? 130 GLN A N     1 
ATOM   1097 C  CA    . GLN A 1 133 ? 78.791 -9.303  -15.870 1.00 48.20  ? 130 GLN A CA    1 
ATOM   1098 C  C     . GLN A 1 133 ? 79.820 -8.181  -15.779 1.00 45.34  ? 130 GLN A C     1 
ATOM   1099 O  O     . GLN A 1 133 ? 80.979 -8.370  -16.137 1.00 52.68  ? 130 GLN A O     1 
ATOM   1100 C  CB    . GLN A 1 133 ? 77.984 -9.182  -17.163 1.00 65.37  ? 130 GLN A CB    1 
ATOM   1101 C  CG    . GLN A 1 133 ? 77.141 -10.405 -17.474 1.00 70.06  ? 130 GLN A CG    1 
ATOM   1102 C  CD    . GLN A 1 133 ? 77.978 -11.659 -17.647 1.00 77.68  ? 130 GLN A CD    1 
ATOM   1103 O  OE1   . GLN A 1 133 ? 79.194 -11.588 -17.829 1.00 81.34  ? 130 GLN A OE1   1 
ATOM   1104 N  NE2   . GLN A 1 133 ? 77.328 -12.817 -17.590 1.00 78.77  ? 130 GLN A NE2   1 
ATOM   1105 N  N     . LYS A 1 134 ? 79.400 -7.016  -15.296 1.00 41.66  ? 131 LYS A N     1 
ATOM   1106 C  CA    . LYS A 1 134 ? 80.327 -5.903  -15.110 1.00 61.12  ? 131 LYS A CA    1 
ATOM   1107 C  C     . LYS A 1 134 ? 81.348 -6.204  -14.018 1.00 53.80  ? 131 LYS A C     1 
ATOM   1108 O  O     . LYS A 1 134 ? 82.538 -5.931  -14.178 1.00 58.40  ? 131 LYS A O     1 
ATOM   1109 C  CB    . LYS A 1 134 ? 79.582 -4.606  -14.784 1.00 74.73  ? 131 LYS A CB    1 
ATOM   1110 C  CG    . LYS A 1 134 ? 78.891 -3.964  -15.974 1.00 75.54  ? 131 LYS A CG    1 
ATOM   1111 C  CD    . LYS A 1 134 ? 78.470 -2.535  -15.662 1.00 77.49  ? 131 LYS A CD    1 
ATOM   1112 C  CE    . LYS A 1 134 ? 77.526 -2.479  -14.471 1.00 78.59  ? 131 LYS A CE    1 
ATOM   1113 N  NZ    . LYS A 1 134 ? 77.073 -1.090  -14.176 1.00 78.71  ? 131 LYS A NZ    1 
ATOM   1114 N  N     . LEU A 1 135 ? 80.878 -6.771  -12.910 1.00 43.17  ? 132 LEU A N     1 
ATOM   1115 C  CA    . LEU A 1 135 ? 81.742 -7.067  -11.772 1.00 68.81  ? 132 LEU A CA    1 
ATOM   1116 C  C     . LEU A 1 135 ? 82.897 -7.995  -12.141 1.00 94.78  ? 132 LEU A C     1 
ATOM   1117 O  O     . LEU A 1 135 ? 84.021 -7.811  -11.676 1.00 95.54  ? 132 LEU A O     1 
ATOM   1118 C  CB    . LEU A 1 135 ? 80.928 -7.659  -10.616 1.00 66.36  ? 132 LEU A CB    1 
ATOM   1119 C  CG    . LEU A 1 135 ? 80.303 -6.656  -9.641  1.00 64.62  ? 132 LEU A CG    1 
ATOM   1120 C  CD1   . LEU A 1 135 ? 79.622 -5.515  -10.380 1.00 64.26  ? 132 LEU A CD1   1 
ATOM   1121 C  CD2   . LEU A 1 135 ? 79.330 -7.351  -8.697  1.00 63.02  ? 132 LEU A CD2   1 
ATOM   1122 N  N     . GLN A 1 136 ? 82.615 -8.986  -12.981 1.00 94.57  ? 133 GLN A N     1 
ATOM   1123 C  CA    . GLN A 1 136 ? 83.629 -9.943  -13.417 1.00 107.82 ? 133 GLN A CA    1 
ATOM   1124 C  C     . GLN A 1 136 ? 84.427 -10.526 -12.253 1.00 93.08  ? 133 GLN A C     1 
ATOM   1125 O  O     . GLN A 1 136 ? 85.621 -10.262 -12.113 1.00 92.24  ? 133 GLN A O     1 
ATOM   1126 C  CB    . GLN A 1 136 ? 84.577 -9.307  -14.440 1.00 142.04 ? 133 GLN A CB    1 
ATOM   1127 C  CG    . GLN A 1 136 ? 83.922 -8.933  -15.764 1.00 142.35 ? 133 GLN A CG    1 
ATOM   1128 C  CD    . GLN A 1 136 ? 83.300 -10.124 -16.476 1.00 142.79 ? 133 GLN A CD    1 
ATOM   1129 O  OE1   . GLN A 1 136 ? 82.423 -10.800 -15.936 1.00 142.39 ? 133 GLN A OE1   1 
ATOM   1130 N  NE2   . GLN A 1 136 ? 83.753 -10.384 -17.697 1.00 143.32 ? 133 GLN A NE2   1 
ATOM   1131 N  N     . GLY A 1 137 ? 83.757 -11.316 -11.420 1.00 92.86  ? 134 GLY A N     1 
ATOM   1132 C  CA    . GLY A 1 137 ? 84.410 -12.005 -10.322 1.00 75.89  ? 134 GLY A CA    1 
ATOM   1133 C  C     . GLY A 1 137 ? 84.861 -11.096 -9.194  1.00 66.98  ? 134 GLY A C     1 
ATOM   1134 O  O     . GLY A 1 137 ? 85.307 -11.569 -8.149  1.00 68.59  ? 134 GLY A O     1 
ATOM   1135 N  N     . GLN A 1 138 ? 84.747 -9.790  -9.404  1.00 65.89  ? 135 GLN A N     1 
ATOM   1136 C  CA    . GLN A 1 138 ? 85.139 -8.815  -8.393  1.00 57.18  ? 135 GLN A CA    1 
ATOM   1137 C  C     . GLN A 1 138 ? 84.240 -8.914  -7.164  1.00 53.08  ? 135 GLN A C     1 
ATOM   1138 O  O     . GLN A 1 138 ? 83.018 -8.988  -7.289  1.00 48.87  ? 135 GLN A O     1 
ATOM   1139 C  CB    . GLN A 1 138 ? 85.087 -7.403  -8.975  1.00 88.62  ? 135 GLN A CB    1 
ATOM   1140 C  CG    . GLN A 1 138 ? 85.431 -6.301  -7.991  1.00 90.60  ? 135 GLN A CG    1 
ATOM   1141 C  CD    . GLN A 1 138 ? 85.350 -4.925  -8.620  1.00 92.37  ? 135 GLN A CD    1 
ATOM   1142 O  OE1   . GLN A 1 138 ? 85.177 -4.794  -9.832  1.00 92.71  ? 135 GLN A OE1   1 
ATOM   1143 N  NE2   . GLN A 1 138 ? 85.473 -3.889  -7.797  1.00 92.38  ? 135 GLN A NE2   1 
ATOM   1144 N  N     . PRO A 1 139 ? 84.848 -8.923  -5.969  1.00 54.78  ? 136 PRO A N     1 
ATOM   1145 C  CA    . PRO A 1 139 ? 84.106 -9.036  -4.709  1.00 46.20  ? 136 PRO A CA    1 
ATOM   1146 C  C     . PRO A 1 139 ? 83.214 -7.826  -4.453  1.00 39.88  ? 136 PRO A C     1 
ATOM   1147 O  O     . PRO A 1 139 ? 83.425 -6.764  -5.034  1.00 40.51  ? 136 PRO A O     1 
ATOM   1148 C  CB    . PRO A 1 139 ? 85.217 -9.107  -3.655  1.00 58.56  ? 136 PRO A CB    1 
ATOM   1149 C  CG    . PRO A 1 139 ? 86.393 -8.462  -4.299  1.00 59.40  ? 136 PRO A CG    1 
ATOM   1150 C  CD    . PRO A 1 139 ? 86.301 -8.830  -5.746  1.00 58.10  ? 136 PRO A CD    1 
ATOM   1151 N  N     . ILE A 1 140 ? 82.222 -7.993  -3.587  1.00 37.57  ? 137 ILE A N     1 
ATOM   1152 C  CA    . ILE A 1 140 ? 81.324 -6.900  -3.251  1.00 30.65  ? 137 ILE A CA    1 
ATOM   1153 C  C     . ILE A 1 140 ? 81.713 -6.301  -1.908  1.00 26.25  ? 137 ILE A C     1 
ATOM   1154 O  O     . ILE A 1 140 ? 81.783 -7.004  -0.902  1.00 26.50  ? 137 ILE A O     1 
ATOM   1155 C  CB    . ILE A 1 140 ? 79.860 -7.371  -3.222  1.00 33.88  ? 137 ILE A CB    1 
ATOM   1156 C  CG1   . ILE A 1 140 ? 79.472 -7.926  -4.597  1.00 39.99  ? 137 ILE A CG1   1 
ATOM   1157 C  CG2   . ILE A 1 140 ? 78.934 -6.230  -2.818  1.00 27.82  ? 137 ILE A CG2   1 
ATOM   1158 C  CD1   . ILE A 1 140 ? 78.130 -8.611  -4.634  1.00 41.40  ? 137 ILE A CD1   1 
ATOM   1159 N  N     . SER A 1 141 ? 81.972 -5.001  -1.907  1.00 28.78  ? 138 SER A N     1 
ATOM   1160 C  CA    . SER A 1 141 ? 82.397 -4.297  -0.703  1.00 28.16  ? 138 SER A CA    1 
ATOM   1161 C  C     . SER A 1 141 ? 81.206 -3.959  0.186   1.00 25.33  ? 138 SER A C     1 
ATOM   1162 O  O     . SER A 1 141 ? 80.127 -3.645  -0.313  1.00 21.90  ? 138 SER A O     1 
ATOM   1163 C  CB    . SER A 1 141 ? 83.148 -3.018  -1.088  1.00 33.27  ? 138 SER A CB    1 
ATOM   1164 O  OG    . SER A 1 141 ? 83.271 -2.142  0.019   1.00 36.96  ? 138 SER A OG    1 
ATOM   1165 N  N     . ALA A 1 142 ? 81.408 -4.016  1.499   1.00 22.26  ? 139 ALA A N     1 
ATOM   1166 C  CA    . ALA A 1 142 ? 80.362 -3.615  2.440   1.00 21.68  ? 139 ALA A CA    1 
ATOM   1167 C  C     . ALA A 1 142 ? 79.953 -2.156  2.221   1.00 21.37  ? 139 ALA A C     1 
ATOM   1168 O  O     . ALA A 1 142 ? 78.843 -1.748  2.572   1.00 21.80  ? 139 ALA A O     1 
ATOM   1169 C  CB    . ALA A 1 142 ? 80.817 -3.828  3.874   1.00 27.29  ? 139 ALA A CB    1 
ATOM   1170 N  N     . ASP A 1 143 ? 80.852 -1.369  1.634   1.00 23.30  ? 140 ASP A N     1 
ATOM   1171 C  CA    . ASP A 1 143 ? 80.576 0.038   1.383   1.00 24.51  ? 140 ASP A CA    1 
ATOM   1172 C  C     . ASP A 1 143 ? 79.462 0.210   0.361   1.00 24.76  ? 140 ASP A C     1 
ATOM   1173 O  O     . ASP A 1 143 ? 78.846 1.275   0.277   1.00 24.82  ? 140 ASP A O     1 
ATOM   1174 C  CB    . ASP A 1 143 ? 81.837 0.767   0.904   1.00 31.90  ? 140 ASP A CB    1 
ATOM   1175 C  CG    . ASP A 1 143 ? 82.939 0.786   1.953   1.00 46.51  ? 140 ASP A CG    1 
ATOM   1176 O  OD1   . ASP A 1 143 ? 82.634 0.581   3.149   1.00 47.70  ? 140 ASP A OD1   1 
ATOM   1177 O  OD2   . ASP A 1 143 ? 84.112 1.014   1.582   1.00 52.76  ? 140 ASP A OD2   1 
ATOM   1178 N  N     . LEU A 1 144 ? 79.208 -0.843  -0.415  1.00 22.43  ? 141 LEU A N     1 
ATOM   1179 C  CA    . LEU A 1 144 ? 78.138 -0.806  -1.399  1.00 18.08  ? 141 LEU A CA    1 
ATOM   1180 C  C     . LEU A 1 144 ? 76.776 -1.116  -0.783  1.00 19.61  ? 141 LEU A C     1 
ATOM   1181 O  O     . LEU A 1 144 ? 75.752 -0.985  -1.446  1.00 21.00  ? 141 LEU A O     1 
ATOM   1182 C  CB    . LEU A 1 144 ? 78.419 -1.781  -2.535  1.00 20.56  ? 141 LEU A CB    1 
ATOM   1183 C  CG    . LEU A 1 144 ? 79.629 -1.423  -3.404  1.00 25.31  ? 141 LEU A CG    1 
ATOM   1184 C  CD1   . LEU A 1 144 ? 79.709 -2.362  -4.597  1.00 27.86  ? 141 LEU A CD1   1 
ATOM   1185 C  CD2   . LEU A 1 144 ? 79.567 0.032   -3.855  1.00 25.40  ? 141 LEU A CD2   1 
ATOM   1186 N  N     . LEU A 1 145 ? 76.782 -1.512  0.486   1.00 18.62  ? 142 LEU A N     1 
ATOM   1187 C  CA    . LEU A 1 145 ? 75.577 -1.941  1.184   1.00 14.89  ? 142 LEU A CA    1 
ATOM   1188 C  C     . LEU A 1 145 ? 75.428 -1.222  2.524   1.00 18.23  ? 142 LEU A C     1 
ATOM   1189 O  O     . LEU A 1 145 ? 75.295 -1.866  3.564   1.00 18.82  ? 142 LEU A O     1 
ATOM   1190 C  CB    . LEU A 1 145 ? 75.629 -3.465  1.399   1.00 17.45  ? 142 LEU A CB    1 
ATOM   1191 C  CG    . LEU A 1 145 ? 75.622 -4.296  0.113   1.00 17.18  ? 142 LEU A CG    1 
ATOM   1192 C  CD1   . LEU A 1 145 ? 75.999 -5.754  0.347   1.00 18.27  ? 142 LEU A CD1   1 
ATOM   1193 C  CD2   . LEU A 1 145 ? 74.261 -4.209  -0.534  1.00 17.97  ? 142 LEU A CD2   1 
ATOM   1194 N  N     . PRO A 1 146 ? 75.437 0.123   2.502   1.00 18.93  ? 143 PRO A N     1 
ATOM   1195 C  CA    . PRO A 1 146 ? 75.494 0.908   3.740   1.00 17.33  ? 143 PRO A CA    1 
ATOM   1196 C  C     . PRO A 1 146 ? 74.235 0.884   4.608   1.00 20.74  ? 143 PRO A C     1 
ATOM   1197 O  O     . PRO A 1 146 ? 74.315 1.293   5.765   1.00 20.60  ? 143 PRO A O     1 
ATOM   1198 C  CB    . PRO A 1 146 ? 75.740 2.334   3.234   1.00 20.58  ? 143 PRO A CB    1 
ATOM   1199 C  CG    . PRO A 1 146 ? 75.130 2.346   1.864   1.00 20.82  ? 143 PRO A CG    1 
ATOM   1200 C  CD    . PRO A 1 146 ? 75.465 0.984   1.305   1.00 18.88  ? 143 PRO A CD    1 
ATOM   1201 N  N     . SER A 1 147 ? 73.106 0.412   4.086   1.00 15.23  ? 144 SER A N     1 
ATOM   1202 C  CA    . SER A 1 147 ? 71.881 0.403   4.875   1.00 11.91  ? 144 SER A CA    1 
ATOM   1203 C  C     . SER A 1 147 ? 71.207 -0.964  4.850   1.00 14.16  ? 144 SER A C     1 
ATOM   1204 O  O     . SER A 1 147 ? 70.016 -1.087  5.156   1.00 15.22  ? 144 SER A O     1 
ATOM   1205 C  CB    . SER A 1 147 ? 70.914 1.479   4.382   1.00 17.27  ? 144 SER A CB    1 
ATOM   1206 O  OG    . SER A 1 147 ? 70.471 1.222   3.059   1.00 19.52  ? 144 SER A OG    1 
ATOM   1207 N  N     . THR A 1 148 ? 71.996 -1.983  4.513   1.00 13.95  ? 145 THR A N     1 
ATOM   1208 C  CA    . THR A 1 148 ? 71.511 -3.368  4.380   1.00 11.24  ? 145 THR A CA    1 
ATOM   1209 C  C     . THR A 1 148 ? 71.721 -4.236  5.623   1.00 14.98  ? 145 THR A C     1 
ATOM   1210 O  O     . THR A 1 148 ? 72.815 -4.262  6.214   1.00 16.52  ? 145 THR A O     1 
ATOM   1211 C  CB    . THR A 1 148 ? 72.193 -4.055  3.172   1.00 15.79  ? 145 THR A CB    1 
ATOM   1212 O  OG1   . THR A 1 148 ? 71.830 -3.370  1.970   1.00 14.89  ? 145 THR A OG1   1 
ATOM   1213 C  CG2   . THR A 1 148 ? 71.771 -5.525  3.047   1.00 14.52  ? 145 THR A CG2   1 
ATOM   1214 N  N     . TYR A 1 149 ? 70.655 -4.937  6.008   1.00 13.38  ? 146 TYR A N     1 
ATOM   1215 C  CA    . TYR A 1 149 ? 70.686 -5.967  7.052   1.00 10.30  ? 146 TYR A CA    1 
ATOM   1216 C  C     . TYR A 1 149 ? 70.592 -7.322  6.393   1.00 15.52  ? 146 TYR A C     1 
ATOM   1217 O  O     . TYR A 1 149 ? 69.816 -7.501  5.459   1.00 15.67  ? 146 TYR A O     1 
ATOM   1218 C  CB    . TYR A 1 149 ? 69.472 -5.837  7.967   1.00 12.90  ? 146 TYR A CB    1 
ATOM   1219 C  CG    . TYR A 1 149 ? 69.625 -4.781  9.032   1.00 13.18  ? 146 TYR A CG    1 
ATOM   1220 C  CD1   . TYR A 1 149 ? 70.073 -5.124  10.297  1.00 17.13  ? 146 TYR A CD1   1 
ATOM   1221 C  CD2   . TYR A 1 149 ? 69.341 -3.444  8.765   1.00 17.55  ? 146 TYR A CD2   1 
ATOM   1222 C  CE1   . TYR A 1 149 ? 70.236 -4.171  11.271  1.00 18.94  ? 146 TYR A CE1   1 
ATOM   1223 C  CE2   . TYR A 1 149 ? 69.501 -2.471  9.746   1.00 19.82  ? 146 TYR A CE2   1 
ATOM   1224 C  CZ    . TYR A 1 149 ? 69.949 -2.859  11.000  1.00 20.74  ? 146 TYR A CZ    1 
ATOM   1225 O  OH    . TYR A 1 149 ? 70.117 -1.933  12.006  1.00 27.37  ? 146 TYR A OH    1 
ATOM   1226 N  N     . ILE A 1 150 ? 71.359 -8.286  6.892   1.00 11.82  ? 147 ILE A N     1 
ATOM   1227 C  CA    . ILE A 1 150 ? 71.230 -9.656  6.430   1.00 10.16  ? 147 ILE A CA    1 
ATOM   1228 C  C     . ILE A 1 150 ? 70.488 -10.451 7.502   1.00 11.97  ? 147 ILE A C     1 
ATOM   1229 O  O     . ILE A 1 150 ? 71.023 -10.706 8.575   1.00 14.28  ? 147 ILE A O     1 
ATOM   1230 C  CB    . ILE A 1 150 ? 72.593 -10.314 6.194   1.00 11.64  ? 147 ILE A CB    1 
ATOM   1231 C  CG1   . ILE A 1 150 ? 73.489 -9.431  5.311   1.00 16.26  ? 147 ILE A CG1   1 
ATOM   1232 C  CG2   . ILE A 1 150 ? 72.397 -11.717 5.579   1.00 16.40  ? 147 ILE A CG2   1 
ATOM   1233 C  CD1   . ILE A 1 150 ? 72.986 -9.229  3.862   1.00 16.90  ? 147 ILE A CD1   1 
ATOM   1234 N  N     . GLU A 1 151 ? 69.247 -10.832 7.221   1.00 12.62  ? 148 GLU A N     1 
ATOM   1235 C  CA    . GLU A 1 151 ? 68.430 -11.502 8.216   1.00 9.61   ? 148 GLU A CA    1 
ATOM   1236 C  C     . GLU A 1 151 ? 69.071 -12.809 8.650   1.00 15.81  ? 148 GLU A C     1 
ATOM   1237 O  O     . GLU A 1 151 ? 69.480 -13.613 7.807   1.00 14.13  ? 148 GLU A O     1 
ATOM   1238 C  CB    . GLU A 1 151 ? 67.038 -11.780 7.641   1.00 13.32  ? 148 GLU A CB    1 
ATOM   1239 C  CG    . GLU A 1 151 ? 66.103 -12.527 8.606   1.00 17.31  ? 148 GLU A CG    1 
ATOM   1240 C  CD    . GLU A 1 151 ? 65.914 -11.850 9.960   1.00 19.55  ? 148 GLU A CD    1 
ATOM   1241 O  OE1   . GLU A 1 151 ? 65.664 -12.580 10.947  1.00 22.02  ? 148 GLU A OE1   1 
ATOM   1242 O  OE2   . GLU A 1 151 ? 65.978 -10.606 10.046  1.00 22.35  ? 148 GLU A OE2   1 
ATOM   1243 N  N     . GLY A 1 152 ? 69.160 -13.001 9.970   1.00 13.76  ? 149 GLY A N     1 
ATOM   1244 C  CA    . GLY A 1 152 ? 69.745 -14.200 10.535  1.00 14.99  ? 149 GLY A CA    1 
ATOM   1245 C  C     . GLY A 1 152 ? 71.159 -14.006 11.047  1.00 19.11  ? 149 GLY A C     1 
ATOM   1246 O  O     . GLY A 1 152 ? 71.655 -14.825 11.820  1.00 19.91  ? 149 GLY A O     1 
ATOM   1247 N  N     . LEU A 1 153 ? 71.807 -12.927 10.625  1.00 16.56  ? 150 LEU A N     1 
ATOM   1248 C  CA    . LEU A 1 153 ? 73.190 -12.665 11.002  1.00 16.57  ? 150 LEU A CA    1 
ATOM   1249 C  C     . LEU A 1 153 ? 73.279 -11.371 11.805  1.00 19.06  ? 150 LEU A C     1 
ATOM   1250 O  O     . LEU A 1 153 ? 72.419 -10.503 11.681  1.00 18.53  ? 150 LEU A O     1 
ATOM   1251 C  CB    . LEU A 1 153 ? 74.056 -12.589 9.748   1.00 14.42  ? 150 LEU A CB    1 
ATOM   1252 C  CG    . LEU A 1 153 ? 74.118 -13.869 8.917   1.00 16.92  ? 150 LEU A CG    1 
ATOM   1253 C  CD1   . LEU A 1 153 ? 75.000 -13.659 7.705   1.00 19.71  ? 150 LEU A CD1   1 
ATOM   1254 C  CD2   . LEU A 1 153 ? 74.658 -15.026 9.766   1.00 20.08  ? 150 LEU A CD2   1 
ATOM   1255 N  N     . PRO A 1 154 ? 74.312 -11.237 12.651  1.00 18.74  ? 151 PRO A N     1 
ATOM   1256 C  CA    . PRO A 1 154 ? 75.397 -12.197 12.893  1.00 22.75  ? 151 PRO A CA    1 
ATOM   1257 C  C     . PRO A 1 154 ? 74.943 -13.385 13.734  1.00 17.26  ? 151 PRO A C     1 
ATOM   1258 O  O     . PRO A 1 154 ? 73.932 -13.308 14.428  1.00 23.11  ? 151 PRO A O     1 
ATOM   1259 C  CB    . PRO A 1 154 ? 76.413 -11.367 13.682  1.00 19.46  ? 151 PRO A CB    1 
ATOM   1260 C  CG    . PRO A 1 154 ? 75.577 -10.348 14.408  1.00 19.01  ? 151 PRO A CG    1 
ATOM   1261 C  CD    . PRO A 1 154 ? 74.454 -10.012 13.459  1.00 20.58  ? 151 PRO A CD    1 
ATOM   1262 N  N     . GLN A 1 155 ? 75.701 -14.476 13.684  1.00 20.57  ? 152 GLN A N     1 
ATOM   1263 C  CA    . GLN A 1 155 ? 75.382 -15.664 14.456  1.00 28.95  ? 152 GLN A CA    1 
ATOM   1264 C  C     . GLN A 1 155 ? 76.685 -16.334 14.850  1.00 35.41  ? 152 GLN A C     1 
ATOM   1265 O  O     . GLN A 1 155 ? 77.719 -16.081 14.234  1.00 34.60  ? 152 GLN A O     1 
ATOM   1266 C  CB    . GLN A 1 155 ? 74.546 -16.640 13.622  1.00 29.32  ? 152 GLN A CB    1 
ATOM   1267 C  CG    . GLN A 1 155 ? 74.971 -18.094 13.792  1.00 44.43  ? 152 GLN A CG    1 
ATOM   1268 C  CD    . GLN A 1 155 ? 74.884 -18.879 12.502  1.00 49.53  ? 152 GLN A CD    1 
ATOM   1269 O  OE1   . GLN A 1 155 ? 73.830 -18.934 11.872  1.00 53.75  ? 152 GLN A OE1   1 
ATOM   1270 N  NE2   . GLN A 1 155 ? 76.000 -19.480 12.093  1.00 38.01  ? 152 GLN A NE2   1 
ATOM   1271 N  N     . GLY A 1 156 ? 76.637 -17.170 15.883  1.00 33.23  ? 153 GLY A N     1 
ATOM   1272 C  CA    . GLY A 1 156 ? 77.749 -18.051 16.198  1.00 52.99  ? 153 GLY A CA    1 
ATOM   1273 C  C     . GLY A 1 156 ? 78.812 -17.450 17.094  1.00 62.95  ? 153 GLY A C     1 
ATOM   1274 O  O     . GLY A 1 156 ? 78.632 -16.362 17.639  1.00 58.49  ? 153 GLY A O     1 
ATOM   1275 N  N     . PRO A 1 157 ? 79.934 -18.170 17.253  1.00 69.99  ? 154 PRO A N     1 
ATOM   1276 C  CA    . PRO A 1 157 ? 81.065 -17.765 18.095  1.00 81.49  ? 154 PRO A CA    1 
ATOM   1277 C  C     . PRO A 1 157 ? 81.957 -16.726 17.416  1.00 77.77  ? 154 PRO A C     1 
ATOM   1278 O  O     . PRO A 1 157 ? 81.932 -16.609 16.190  1.00 77.44  ? 154 PRO A O     1 
ATOM   1279 C  CB    . PRO A 1 157 ? 81.832 -19.074 18.288  1.00 73.23  ? 154 PRO A CB    1 
ATOM   1280 C  CG    . PRO A 1 157 ? 81.552 -19.845 17.045  1.00 71.16  ? 154 PRO A CG    1 
ATOM   1281 C  CD    . PRO A 1 157 ? 80.140 -19.503 16.655  1.00 70.20  ? 154 PRO A CD    1 
ATOM   1282 N  N     . THR A 1 163 ? 80.036 -5.863  20.475  1.00 144.13 ? 160 THR A N     1 
ATOM   1283 C  CA    . THR A 1 163 ? 79.261 -4.676  20.130  1.00 138.45 ? 160 THR A CA    1 
ATOM   1284 C  C     . THR A 1 163 ? 77.841 -4.758  20.679  1.00 122.44 ? 160 THR A C     1 
ATOM   1285 O  O     . THR A 1 163 ? 77.180 -5.791  20.572  1.00 121.39 ? 160 THR A O     1 
ATOM   1286 C  CB    . THR A 1 163 ? 79.205 -4.459  18.607  1.00 138.50 ? 160 THR A CB    1 
ATOM   1287 O  OG1   . THR A 1 163 ? 78.341 -3.355  18.312  1.00 137.21 ? 160 THR A OG1   1 
ATOM   1288 C  CG2   . THR A 1 163 ? 78.683 -5.706  17.909  1.00 138.21 ? 160 THR A CG2   1 
ATOM   1289 N  N     . VAL A 1 164 ? 77.376 -3.660  21.267  1.00 122.88 ? 161 VAL A N     1 
ATOM   1290 C  CA    . VAL A 1 164 ? 76.046 -3.616  21.861  1.00 101.27 ? 161 VAL A CA    1 
ATOM   1291 C  C     . VAL A 1 164 ? 75.155 -2.587  21.170  1.00 69.27  ? 161 VAL A C     1 
ATOM   1292 O  O     . VAL A 1 164 ? 74.041 -2.316  21.622  1.00 70.65  ? 161 VAL A O     1 
ATOM   1293 C  CB    . VAL A 1 164 ? 76.113 -3.295  23.369  1.00 99.63  ? 161 VAL A CB    1 
ATOM   1294 C  CG1   . VAL A 1 164 ? 76.811 -4.418  24.120  1.00 100.24 ? 161 VAL A CG1   1 
ATOM   1295 C  CG2   . VAL A 1 164 ? 76.822 -1.969  23.601  1.00 99.26  ? 161 VAL A CG2   1 
ATOM   1296 N  N     . GLN A 1 165 ? 75.647 -2.020  20.073  1.00 65.12  ? 162 GLN A N     1 
ATOM   1297 C  CA    . GLN A 1 165 ? 74.906 -0.995  19.345  1.00 61.95  ? 162 GLN A CA    1 
ATOM   1298 C  C     . GLN A 1 165 ? 74.272 -1.545  18.069  1.00 40.66  ? 162 GLN A C     1 
ATOM   1299 O  O     . GLN A 1 165 ? 74.776 -2.494  17.466  1.00 41.57  ? 162 GLN A O     1 
ATOM   1300 C  CB    . GLN A 1 165 ? 75.813 0.189   19.016  1.00 93.01  ? 162 GLN A CB    1 
ATOM   1301 C  CG    . GLN A 1 165 ? 76.965 -0.157  18.092  1.00 95.50  ? 162 GLN A CG    1 
ATOM   1302 C  CD    . GLN A 1 165 ? 77.915 1.005   17.892  1.00 99.14  ? 162 GLN A CD    1 
ATOM   1303 O  OE1   . GLN A 1 165 ? 77.930 1.952   18.679  1.00 101.35 ? 162 GLN A OE1   1 
ATOM   1304 N  NE2   . GLN A 1 165 ? 78.713 0.941   16.832  1.00 99.03  ? 162 GLN A NE2   1 
ATOM   1305 N  N     . LYS A 1 166 ? 73.164 -0.933  17.666  1.00 36.59  ? 163 LYS A N     1 
ATOM   1306 C  CA    . LYS A 1 166 ? 72.400 -1.380  16.508  1.00 39.24  ? 163 LYS A CA    1 
ATOM   1307 C  C     . LYS A 1 166 ? 73.222 -1.414  15.218  1.00 27.37  ? 163 LYS A C     1 
ATOM   1308 O  O     . LYS A 1 166 ? 73.279 -2.443  14.541  1.00 29.19  ? 163 LYS A O     1 
ATOM   1309 C  CB    . LYS A 1 166 ? 71.162 -0.495  16.330  1.00 52.71  ? 163 LYS A CB    1 
ATOM   1310 C  CG    . LYS A 1 166 ? 70.294 -0.850  15.141  1.00 55.80  ? 163 LYS A CG    1 
ATOM   1311 C  CD    . LYS A 1 166 ? 69.009 -0.032  15.150  1.00 61.57  ? 163 LYS A CD    1 
ATOM   1312 C  CE    . LYS A 1 166 ? 69.299 1.464   15.199  1.00 64.96  ? 163 LYS A CE    1 
ATOM   1313 N  NZ    . LYS A 1 166 ? 68.050 2.280   15.246  1.00 65.40  ? 163 LYS A NZ    1 
ATOM   1314 N  N     . GLU A 1 167 ? 73.841 -0.291  14.866  1.00 30.93  ? 164 GLU A N     1 
ATOM   1315 C  CA    . GLU A 1 167 ? 74.623 -0.221  13.634  1.00 33.52  ? 164 GLU A CA    1 
ATOM   1316 C  C     . GLU A 1 167 ? 75.781 -1.213  13.685  1.00 32.11  ? 164 GLU A C     1 
ATOM   1317 O  O     . GLU A 1 167 ? 76.156 -1.798  12.671  1.00 26.95  ? 164 GLU A O     1 
ATOM   1318 C  CB    . GLU A 1 167 ? 75.136 1.201   13.383  1.00 41.66  ? 164 GLU A CB    1 
ATOM   1319 C  CG    . GLU A 1 167 ? 76.145 1.329   12.236  1.00 38.31  ? 164 GLU A CG    1 
ATOM   1320 C  CD    . GLU A 1 167 ? 75.553 1.052   10.853  1.00 39.80  ? 164 GLU A CD    1 
ATOM   1321 O  OE1   . GLU A 1 167 ? 76.341 0.980   9.884   1.00 38.63  ? 164 GLU A OE1   1 
ATOM   1322 O  OE2   . GLU A 1 167 ? 74.314 0.922   10.724  1.00 33.47  ? 164 GLU A OE2   1 
ATOM   1323 N  N     . GLY A 1 168 ? 76.342 -1.402  14.873  1.00 37.18  ? 165 GLY A N     1 
ATOM   1324 C  CA    . GLY A 1 168 ? 77.422 -2.351  15.048  1.00 35.16  ? 165 GLY A CA    1 
ATOM   1325 C  C     . GLY A 1 168 ? 76.984 -3.753  14.679  1.00 26.58  ? 165 GLY A C     1 
ATOM   1326 O  O     . GLY A 1 168 ? 77.690 -4.472  13.971  1.00 28.69  ? 165 GLY A O     1 
ATOM   1327 N  N     . MET A 1 169 ? 75.810 -4.143  15.166  1.00 25.57  ? 166 MET A N     1 
ATOM   1328 C  CA    . MET A 1 169 ? 75.242 -5.447  14.843  1.00 26.27  ? 166 MET A CA    1 
ATOM   1329 C  C     . MET A 1 169 ? 75.013 -5.587  13.336  1.00 22.46  ? 166 MET A C     1 
ATOM   1330 O  O     . MET A 1 169 ? 75.324 -6.628  12.751  1.00 24.78  ? 166 MET A O     1 
ATOM   1331 C  CB    . MET A 1 169 ? 73.928 -5.663  15.600  1.00 44.42  ? 166 MET A CB    1 
ATOM   1332 C  CG    . MET A 1 169 ? 73.479 -7.114  15.662  1.00 46.79  ? 166 MET A CG    1 
ATOM   1333 S  SD    . MET A 1 169 ? 73.693 -7.836  17.303  1.00 125.04 ? 166 MET A SD    1 
ATOM   1334 C  CE    . MET A 1 169 ? 75.329 -7.246  17.748  1.00 33.48  ? 166 MET A CE    1 
ATOM   1335 N  N     . ARG A 1 170 ? 74.477 -4.548  12.705  1.00 23.31  ? 167 ARG A N     1 
ATOM   1336 C  CA    . ARG A 1 170 ? 74.219 -4.604  11.267  1.00 20.91  ? 167 ARG A CA    1 
ATOM   1337 C  C     . ARG A 1 170 ? 75.496 -4.908  10.496  1.00 20.92  ? 167 ARG A C     1 
ATOM   1338 O  O     . ARG A 1 170 ? 75.515 -5.776  9.620   1.00 19.64  ? 167 ARG A O     1 
ATOM   1339 C  CB    . ARG A 1 170 ? 73.603 -3.298  10.760  1.00 19.12  ? 167 ARG A CB    1 
ATOM   1340 C  CG    . ARG A 1 170 ? 73.236 -3.335  9.278   1.00 17.66  ? 167 ARG A CG    1 
ATOM   1341 C  CD    . ARG A 1 170 ? 73.023 -1.941  8.713   1.00 18.09  ? 167 ARG A CD    1 
ATOM   1342 N  NE    . ARG A 1 170 ? 74.283 -1.210  8.533   1.00 20.24  ? 167 ARG A NE    1 
ATOM   1343 C  CZ    . ARG A 1 170 ? 75.104 -1.365  7.496   1.00 23.40  ? 167 ARG A CZ    1 
ATOM   1344 N  NH1   . ARG A 1 170 ? 74.821 -2.231  6.533   1.00 17.54  ? 167 ARG A NH1   1 
ATOM   1345 N  NH2   . ARG A 1 170 ? 76.217 -0.649  7.418   1.00 24.12  ? 167 ARG A NH2   1 
ATOM   1346 N  N     . LYS A 1 171 ? 76.569 -4.193  10.825  1.00 22.08  ? 168 LYS A N     1 
ATOM   1347 C  CA    . LYS A 1 171 ? 77.834 -4.392  10.137  1.00 23.59  ? 168 LYS A CA    1 
ATOM   1348 C  C     . LYS A 1 171 ? 78.420 -5.772  10.407  1.00 23.05  ? 168 LYS A C     1 
ATOM   1349 O  O     . LYS A 1 171 ? 79.014 -6.388  9.511   1.00 21.99  ? 168 LYS A O     1 
ATOM   1350 C  CB    . LYS A 1 171 ? 78.849 -3.307  10.518  1.00 27.61  ? 168 LYS A CB    1 
ATOM   1351 C  CG    . LYS A 1 171 ? 78.546 -1.924  9.946   1.00 36.68  ? 168 LYS A CG    1 
ATOM   1352 C  CD    . LYS A 1 171 ? 79.802 -1.048  10.003  1.00 46.14  ? 168 LYS A CD    1 
ATOM   1353 C  CE    . LYS A 1 171 ? 79.588 0.317   9.363   1.00 52.37  ? 168 LYS A CE    1 
ATOM   1354 N  NZ    . LYS A 1 171 ? 78.967 1.293   10.304  1.00 54.53  ? 168 LYS A NZ    1 
ATOM   1355 N  N     . GLN A 1 172 ? 78.270 -6.256  11.637  1.00 22.91  ? 169 GLN A N     1 
ATOM   1356 C  CA    . GLN A 1 172 ? 78.781 -7.578  11.981  1.00 24.13  ? 169 GLN A CA    1 
ATOM   1357 C  C     . GLN A 1 172 ? 78.119 -8.646  11.119  1.00 21.69  ? 169 GLN A C     1 
ATOM   1358 O  O     . GLN A 1 172 ? 78.784 -9.547  10.598  1.00 23.44  ? 169 GLN A O     1 
ATOM   1359 C  CB    . GLN A 1 172 ? 78.551 -7.894  13.462  1.00 35.63  ? 169 GLN A CB    1 
ATOM   1360 C  CG    . GLN A 1 172 ? 79.466 -7.146  14.414  1.00 54.21  ? 169 GLN A CG    1 
ATOM   1361 C  CD    . GLN A 1 172 ? 80.391 -8.074  15.178  1.00 71.04  ? 169 GLN A CD    1 
ATOM   1362 O  OE1   . GLN A 1 172 ? 80.401 -9.286  14.952  1.00 76.64  ? 169 GLN A OE1   1 
ATOM   1363 N  NE2   . GLN A 1 172 ? 81.174 -7.508  16.092  1.00 75.36  ? 169 GLN A NE2   1 
ATOM   1364 N  N     . GLY A 1 173 ? 76.799 -8.552  10.984  1.00 22.90  ? 170 GLY A N     1 
ATOM   1365 C  CA    . GLY A 1 173 ? 76.060 -9.500  10.173  1.00 19.92  ? 170 GLY A CA    1 
ATOM   1366 C  C     . GLY A 1 173 ? 76.439 -9.390  8.713   1.00 17.60  ? 170 GLY A C     1 
ATOM   1367 O  O     . GLY A 1 173 ? 76.612 -10.399 8.028   1.00 17.54  ? 170 GLY A O     1 
ATOM   1368 N  N     . LEU A 1 174 ? 76.571 -8.157  8.225   1.00 17.48  ? 171 LEU A N     1 
ATOM   1369 C  CA    . LEU A 1 174 ? 76.959 -7.946  6.835   1.00 17.03  ? 171 LEU A CA    1 
ATOM   1370 C  C     . LEU A 1 174 ? 78.344 -8.523  6.543   1.00 20.25  ? 171 LEU A C     1 
ATOM   1371 O  O     . LEU A 1 174 ? 78.556 -9.131  5.498   1.00 19.28  ? 171 LEU A O     1 
ATOM   1372 C  CB    . LEU A 1 174 ? 76.916 -6.457  6.475   1.00 16.73  ? 171 LEU A CB    1 
ATOM   1373 C  CG    . LEU A 1 174 ? 77.261 -6.104  5.028   1.00 17.42  ? 171 LEU A CG    1 
ATOM   1374 C  CD1   . LEU A 1 174 ? 76.291 -6.795  4.059   1.00 17.65  ? 171 LEU A CD1   1 
ATOM   1375 C  CD2   . LEU A 1 174 ? 77.269 -4.581  4.834   1.00 20.00  ? 171 LEU A CD2   1 
ATOM   1376 N  N     . PHE A 1 175 ? 79.281 -8.332  7.470   1.00 20.16  ? 172 PHE A N     1 
ATOM   1377 C  CA    . PHE A 1 175 ? 80.630 -8.866  7.302   1.00 21.93  ? 172 PHE A CA    1 
ATOM   1378 C  C     . PHE A 1 175 ? 80.615 -10.389 7.220   1.00 20.98  ? 172 PHE A C     1 
ATOM   1379 O  O     . PHE A 1 175 ? 81.275 -10.975 6.360   1.00 25.12  ? 172 PHE A O     1 
ATOM   1380 C  CB    . PHE A 1 175 ? 81.529 -8.409  8.450   1.00 22.46  ? 172 PHE A CB    1 
ATOM   1381 C  CG    . PHE A 1 175 ? 81.976 -6.980  8.340   1.00 42.28  ? 172 PHE A CG    1 
ATOM   1382 C  CD1   . PHE A 1 175 ? 82.207 -6.405  7.101   1.00 49.18  ? 172 PHE A CD1   1 
ATOM   1383 C  CD2   . PHE A 1 175 ? 82.169 -6.212  9.479   1.00 49.65  ? 172 PHE A CD2   1 
ATOM   1384 C  CE1   . PHE A 1 175 ? 82.625 -5.090  6.997   1.00 52.51  ? 172 PHE A CE1   1 
ATOM   1385 C  CE2   . PHE A 1 175 ? 82.587 -4.896  9.382   1.00 55.19  ? 172 PHE A CE2   1 
ATOM   1386 C  CZ    . PHE A 1 175 ? 82.812 -4.335  8.140   1.00 55.46  ? 172 PHE A CZ    1 
ATOM   1387 N  N     . GLN A 1 176 ? 79.864 -11.034 8.110   1.00 19.48  ? 173 GLN A N     1 
ATOM   1388 C  CA    . GLN A 1 176 ? 79.773 -12.496 8.079   1.00 19.90  ? 173 GLN A CA    1 
ATOM   1389 C  C     . GLN A 1 176 ? 79.235 -12.982 6.734   1.00 23.26  ? 173 GLN A C     1 
ATOM   1390 O  O     . GLN A 1 176 ? 79.734 -13.944 6.156   1.00 22.63  ? 173 GLN A O     1 
ATOM   1391 C  CB    . GLN A 1 176 ? 78.905 -13.035 9.231   1.00 21.09  ? 173 GLN A CB    1 
ATOM   1392 C  CG    . GLN A 1 176 ? 79.524 -12.819 10.618  1.00 22.64  ? 173 GLN A CG    1 
ATOM   1393 C  CD    . GLN A 1 176 ? 78.771 -13.529 11.730  1.00 26.57  ? 173 GLN A CD    1 
ATOM   1394 O  OE1   . GLN A 1 176 ? 77.662 -14.021 11.537  1.00 25.24  ? 173 GLN A OE1   1 
ATOM   1395 N  NE2   . GLN A 1 176 ? 79.383 -13.589 12.908  1.00 31.78  ? 173 GLN A NE2   1 
ATOM   1396 N  N     . TRP A 1 177 ? 78.204 -12.311 6.240   1.00 20.96  ? 174 TRP A N     1 
ATOM   1397 C  CA    . TRP A 1 177 ? 77.601 -12.674 4.965   1.00 16.57  ? 174 TRP A CA    1 
ATOM   1398 C  C     . TRP A 1 177 ? 78.599 -12.536 3.819   1.00 19.32  ? 174 TRP A C     1 
ATOM   1399 O  O     . TRP A 1 177 ? 78.789 -13.464 3.028   1.00 20.56  ? 174 TRP A O     1 
ATOM   1400 C  CB    . TRP A 1 177 ? 76.383 -11.775 4.714   1.00 14.71  ? 174 TRP A CB    1 
ATOM   1401 C  CG    . TRP A 1 177 ? 75.718 -11.939 3.366   1.00 15.79  ? 174 TRP A CG    1 
ATOM   1402 C  CD1   . TRP A 1 177 ? 75.818 -11.090 2.293   1.00 16.66  ? 174 TRP A CD1   1 
ATOM   1403 C  CD2   . TRP A 1 177 ? 74.824 -12.991 2.961   1.00 16.00  ? 174 TRP A CD2   1 
ATOM   1404 N  NE1   . TRP A 1 177 ? 75.050 -11.552 1.254   1.00 16.07  ? 174 TRP A NE1   1 
ATOM   1405 C  CE2   . TRP A 1 177 ? 74.426 -12.711 1.638   1.00 16.13  ? 174 TRP A CE2   1 
ATOM   1406 C  CE3   . TRP A 1 177 ? 74.321 -14.131 3.590   1.00 16.45  ? 174 TRP A CE3   1 
ATOM   1407 C  CZ2   . TRP A 1 177 ? 73.563 -13.544 0.920   1.00 16.09  ? 174 TRP A CZ2   1 
ATOM   1408 C  CZ3   . TRP A 1 177 ? 73.457 -14.960 2.881   1.00 16.90  ? 174 TRP A CZ3   1 
ATOM   1409 C  CH2   . TRP A 1 177 ? 73.081 -14.656 1.561   1.00 18.04  ? 174 TRP A CH2   1 
ATOM   1410 N  N     . LEU A 1 178 ? 79.231 -11.374 3.726   1.00 18.88  ? 175 LEU A N     1 
ATOM   1411 C  CA    . LEU A 1 178 ? 80.149 -11.126 2.624   1.00 16.78  ? 175 LEU A CA    1 
ATOM   1412 C  C     . LEU A 1 178 ? 81.359 -12.041 2.711   1.00 28.60  ? 175 LEU A C     1 
ATOM   1413 O  O     . LEU A 1 178 ? 81.883 -12.478 1.687   1.00 28.72  ? 175 LEU A O     1 
ATOM   1414 C  CB    . LEU A 1 178 ? 80.585 -9.667  2.595   1.00 21.66  ? 175 LEU A CB    1 
ATOM   1415 C  CG    . LEU A 1 178 ? 79.473 -8.658  2.288   1.00 21.25  ? 175 LEU A CG    1 
ATOM   1416 C  CD1   . LEU A 1 178 ? 79.997 -7.233  2.419   1.00 24.31  ? 175 LEU A CD1   1 
ATOM   1417 C  CD2   . LEU A 1 178 ? 78.907 -8.902  0.888   1.00 20.43  ? 175 LEU A CD2   1 
ATOM   1418 N  N     . ASP A 1 179 ? 81.794 -12.331 3.934   1.00 26.32  ? 176 ASP A N     1 
ATOM   1419 C  CA    . ASP A 1 179 ? 82.952 -13.202 4.132   1.00 34.32  ? 176 ASP A CA    1 
ATOM   1420 C  C     . ASP A 1 179 ? 82.695 -14.578 3.543   1.00 34.47  ? 176 ASP A C     1 
ATOM   1421 O  O     . ASP A 1 179 ? 83.605 -15.211 3.006   1.00 35.37  ? 176 ASP A O     1 
ATOM   1422 C  CB    . ASP A 1 179 ? 83.308 -13.334 5.617   1.00 38.51  ? 176 ASP A CB    1 
ATOM   1423 C  CG    . ASP A 1 179 ? 84.070 -12.133 6.144   1.00 52.51  ? 176 ASP A CG    1 
ATOM   1424 O  OD1   . ASP A 1 179 ? 84.676 -11.403 5.329   1.00 57.61  ? 176 ASP A OD1   1 
ATOM   1425 O  OD2   . ASP A 1 179 ? 84.068 -11.922 7.377   1.00 56.09  ? 176 ASP A OD2   1 
ATOM   1426 N  N     . SER A 1 180 ? 81.448 -15.028 3.641   1.00 26.82  ? 177 SER A N     1 
ATOM   1427 C  CA    . SER A 1 180 ? 81.059 -16.362 3.192   1.00 39.15  ? 177 SER A CA    1 
ATOM   1428 C  C     . SER A 1 180 ? 80.714 -16.439 1.709   1.00 31.82  ? 177 SER A C     1 
ATOM   1429 O  O     . SER A 1 180 ? 80.584 -17.527 1.150   1.00 41.02  ? 177 SER A O     1 
ATOM   1430 C  CB    . SER A 1 180 ? 79.864 -16.857 4.008   1.00 42.46  ? 177 SER A CB    1 
ATOM   1431 O  OG    . SER A 1 180 ? 80.153 -16.825 5.393   1.00 47.53  ? 177 SER A OG    1 
ATOM   1432 N  N     A LEU A 1 181 ? 80.536 -15.301 1.050   0.60 22.88  ? 178 LEU A N     1 
ATOM   1433 N  N     B LEU A 1 181 ? 80.561 -15.265 1.108   0.40 24.04  ? 178 LEU A N     1 
ATOM   1434 C  CA    A LEU A 1 181 ? 80.079 -15.326 -0.343  0.60 19.93  ? 178 LEU A CA    1 
ATOM   1435 C  CA    B LEU A 1 181 ? 80.303 -15.131 -0.311  0.40 22.77  ? 178 LEU A CA    1 
ATOM   1436 C  C     A LEU A 1 181 ? 81.059 -15.962 -1.328  0.60 31.50  ? 178 LEU A C     1 
ATOM   1437 C  C     B LEU A 1 181 ? 81.641 -15.072 -1.035  0.40 29.86  ? 178 LEU A C     1 
ATOM   1438 O  O     A LEU A 1 181 ? 82.272 -15.833 -1.179  0.60 33.65  ? 178 LEU A O     1 
ATOM   1439 O  O     B LEU A 1 181 ? 81.818 -15.680 -2.091  0.40 31.30  ? 178 LEU A O     1 
ATOM   1440 C  CB    A LEU A 1 181 ? 79.740 -13.916 -0.823  0.60 25.33  ? 178 LEU A CB    1 
ATOM   1441 C  CB    B LEU A 1 181 ? 79.521 -13.843 -0.564  0.40 24.57  ? 178 LEU A CB    1 
ATOM   1442 C  CG    A LEU A 1 181 ? 78.355 -13.375 -0.480  0.60 23.80  ? 178 LEU A CG    1 
ATOM   1443 C  CG    B LEU A 1 181 ? 78.844 -13.671 -1.920  0.40 22.71  ? 178 LEU A CG    1 
ATOM   1444 C  CD1   A LEU A 1 181 ? 78.196 -11.993 -1.087  0.60 18.27  ? 178 LEU A CD1   1 
ATOM   1445 C  CD1   B LEU A 1 181 ? 77.648 -14.602 -2.018  0.40 19.80  ? 178 LEU A CD1   1 
ATOM   1446 C  CD2   A LEU A 1 181 ? 77.261 -14.305 -0.987  0.60 21.13  ? 178 LEU A CD2   1 
ATOM   1447 C  CD2   B LEU A 1 181 ? 78.419 -12.221 -2.111  0.40 18.58  ? 178 LEU A CD2   1 
ATOM   1448 N  N     A GLN A 1 182 ? 80.525 -16.642 -2.339  0.60 26.11  ? 179 GLN A N     1 
ATOM   1449 N  N     B GLN A 1 182 ? 82.582 -14.338 -0.447  0.40 26.13  ? 179 GLN A N     1 
ATOM   1450 C  CA    A GLN A 1 182 ? 81.356 -17.159 -3.422  0.60 29.00  ? 179 GLN A CA    1 
ATOM   1451 C  CA    B GLN A 1 182 ? 83.930 -14.208 -0.990  0.40 18.12  ? 179 GLN A CA    1 
ATOM   1452 C  C     A GLN A 1 182 ? 81.126 -16.371 -4.711  0.60 37.39  ? 179 GLN A C     1 
ATOM   1453 C  C     B GLN A 1 182 ? 84.722 -15.511 -0.899  0.40 33.93  ? 179 GLN A C     1 
ATOM   1454 O  O     A GLN A 1 182 ? 80.294 -16.741 -5.542  0.60 36.76  ? 179 GLN A O     1 
ATOM   1455 O  O     B GLN A 1 182 ? 85.498 -15.839 -1.797  0.40 36.04  ? 179 GLN A O     1 
ATOM   1456 C  CB    A GLN A 1 182 ? 81.107 -18.649 -3.653  0.60 54.14  ? 179 GLN A CB    1 
ATOM   1457 C  CB    B GLN A 1 182 ? 84.686 -13.091 -0.262  0.40 41.34  ? 179 GLN A CB    1 
ATOM   1458 C  CG    A GLN A 1 182 ? 82.070 -19.274 -4.652  0.60 56.96  ? 179 GLN A CG    1 
ATOM   1459 C  CG    B GLN A 1 182 ? 86.183 -13.078 -0.523  0.40 43.36  ? 179 GLN A CG    1 
ATOM   1460 C  CD    A GLN A 1 182 ? 83.525 -18.956 -4.340  0.60 59.05  ? 179 GLN A CD    1 
ATOM   1461 C  CD    B GLN A 1 182 ? 86.926 -12.114 0.382   0.40 43.71  ? 179 GLN A CD    1 
ATOM   1462 O  OE1   A GLN A 1 182 ? 84.074 -17.963 -4.821  0.60 57.44  ? 179 GLN A OE1   1 
ATOM   1463 O  OE1   B GLN A 1 182 ? 86.348 -11.160 0.903   0.40 38.30  ? 179 GLN A OE1   1 
ATOM   1464 N  NE2   A GLN A 1 182 ? 84.156 -19.801 -3.531  0.60 59.99  ? 179 GLN A NE2   1 
ATOM   1465 N  NE2   B GLN A 1 182 ? 88.215 -12.364 0.580   0.40 47.14  ? 179 GLN A NE2   1 
ATOM   1466 N  N     A ILE A 1 183 ? 81.876 -15.286 -4.872  0.60 32.65  ? 180 ILE A N     1 
ATOM   1467 N  N     B ILE A 1 183 ? 84.526 -16.245 0.192   0.40 31.48  ? 180 ILE A N     1 
ATOM   1468 C  CA    A ILE A 1 183 ? 81.683 -14.372 -5.995  0.60 39.58  ? 180 ILE A CA    1 
ATOM   1469 C  CA    B ILE A 1 183 ? 85.245 -17.496 0.423   0.40 29.65  ? 180 ILE A CA    1 
ATOM   1470 C  C     A ILE A 1 183 ? 82.154 -14.970 -7.317  0.60 42.04  ? 180 ILE A C     1 
ATOM   1471 C  C     B ILE A 1 183 ? 84.625 -18.653 -0.364  0.40 25.26  ? 180 ILE A C     1 
ATOM   1472 O  O     A ILE A 1 183 ? 82.000 -14.364 -8.379  0.60 38.26  ? 180 ILE A O     1 
ATOM   1473 O  O     B ILE A 1 183 ? 85.156 -19.765 -0.377  0.40 26.78  ? 180 ILE A O     1 
ATOM   1474 C  CB    A ILE A 1 183 ? 82.381 -13.019 -5.747  0.60 45.38  ? 180 ILE A CB    1 
ATOM   1475 C  CB    B ILE A 1 183 ? 85.289 -17.842 1.933   0.40 40.41  ? 180 ILE A CB    1 
ATOM   1476 C  CG1   A ILE A 1 183 ? 83.775 -13.228 -5.151  0.60 48.89  ? 180 ILE A CG1   1 
ATOM   1477 C  CG1   B ILE A 1 183 ? 86.006 -16.739 2.712   0.40 44.13  ? 180 ILE A CG1   1 
ATOM   1478 C  CG2   A ILE A 1 183 ? 81.551 -12.166 -4.804  0.60 45.58  ? 180 ILE A CG2   1 
ATOM   1479 C  CG2   B ILE A 1 183 ? 85.988 -19.168 2.175   0.40 39.55  ? 180 ILE A CG2   1 
ATOM   1480 C  CD1   A ILE A 1 183 ? 84.774 -13.858 -6.096  0.60 52.10  ? 180 ILE A CD1   1 
ATOM   1481 C  CD1   B ILE A 1 183 ? 86.022 -16.963 4.211   0.40 45.75  ? 180 ILE A CD1   1 
ATOM   1482 N  N     A ASP A 1 184 ? 82.726 -16.166 -7.236  0.60 44.11  ? 181 ASP A N     1 
ATOM   1483 N  N     B ASP A 1 184 ? 83.502 -18.381 -1.023  0.40 22.44  ? 181 ASP A N     1 
ATOM   1484 C  CA    A ASP A 1 184 ? 83.252 -16.867 -8.398  0.60 58.39  ? 181 ASP A CA    1 
ATOM   1485 C  CA    B ASP A 1 184 ? 82.812 -19.388 -1.827  0.40 36.48  ? 181 ASP A CA    1 
ATOM   1486 C  C     A ASP A 1 184 ? 82.134 -17.470 -9.246  0.60 40.94  ? 181 ASP A C     1 
ATOM   1487 C  C     B ASP A 1 184 ? 82.096 -20.406 -0.939  0.40 20.21  ? 181 ASP A C     1 
ATOM   1488 O  O     A ASP A 1 184 ? 82.301 -17.687 -10.445 0.60 39.84  ? 181 ASP A O     1 
ATOM   1489 O  O     B ASP A 1 184 ? 82.037 -21.597 -1.257  0.40 19.40  ? 181 ASP A O     1 
ATOM   1490 C  CB    A ASP A 1 184 ? 84.212 -17.967 -7.938  0.60 88.52  ? 181 ASP A CB    1 
ATOM   1491 C  CB    B ASP A 1 184 ? 83.791 -20.088 -2.778  0.40 59.92  ? 181 ASP A CB    1 
ATOM   1492 C  CG    A ASP A 1 184 ? 84.746 -18.795 -9.085  0.60 91.35  ? 181 ASP A CG    1 
ATOM   1493 C  CG    B ASP A 1 184 ? 83.092 -20.968 -3.799  0.40 59.97  ? 181 ASP A CG    1 
ATOM   1494 O  OD1   A ASP A 1 184 ? 84.921 -18.242 -10.191 0.60 92.25  ? 181 ASP A OD1   1 
ATOM   1495 O  OD1   B ASP A 1 184 ? 82.662 -20.440 -4.846  0.40 59.82  ? 181 ASP A OD1   1 
ATOM   1496 O  OD2   A ASP A 1 184 ? 84.992 -20.003 -8.879  0.60 92.45  ? 181 ASP A OD2   1 
ATOM   1497 O  OD2   B ASP A 1 184 ? 82.981 -22.189 -3.559  0.40 59.27  ? 181 ASP A OD2   1 
ATOM   1498 N  N     A ASN A 1 185 ? 80.993 -17.731 -8.616  0.60 36.31  ? 182 ASN A N     1 
ATOM   1499 N  N     B ASN A 1 185 ? 81.555 -19.926 0.177   0.40 18.97  ? 182 ASN A N     1 
ATOM   1500 C  CA    A ASN A 1 185 ? 79.876 -18.387 -9.285  0.60 34.76  ? 182 ASN A CA    1 
ATOM   1501 C  CA    B ASN A 1 185 ? 80.817 -20.777 1.107   0.40 23.28  ? 182 ASN A CA    1 
ATOM   1502 C  C     A ASN A 1 185 ? 78.752 -17.411 -9.625  0.60 29.14  ? 182 ASN A C     1 
ATOM   1503 C  C     B ASN A 1 185 ? 79.303 -20.619 1.004   0.40 22.53  ? 182 ASN A C     1 
ATOM   1504 O  O     A ASN A 1 185 ? 78.065 -16.909 -8.737  0.60 26.65  ? 182 ASN A O     1 
ATOM   1505 O  O     B ASN A 1 185 ? 78.545 -21.313 1.691   0.40 20.06  ? 182 ASN A O     1 
ATOM   1506 C  CB    A ASN A 1 185 ? 79.351 -19.536 -8.416  0.60 29.54  ? 182 ASN A CB    1 
ATOM   1507 C  CB    B ASN A 1 185 ? 81.274 -20.531 2.544   0.40 21.95  ? 182 ASN A CB    1 
ATOM   1508 C  CG    A ASN A 1 185 ? 78.169 -20.251 -9.037  0.60 33.49  ? 182 ASN A CG    1 
ATOM   1509 C  CG    B ASN A 1 185 ? 82.690 -21.007 2.794   0.40 17.33  ? 182 ASN A CG    1 
ATOM   1510 O  OD1   A ASN A 1 185 ? 77.858 -20.064 -10.213 0.60 34.42  ? 182 ASN A OD1   1 
ATOM   1511 O  OD1   B ASN A 1 185 ? 83.198 -21.891 2.102   0.40 23.21  ? 182 ASN A OD1   1 
ATOM   1512 N  ND2   A ASN A 1 185 ? 77.504 -21.086 -8.244  0.60 36.14  ? 182 ASN A ND2   1 
ATOM   1513 N  ND2   B ASN A 1 185 ? 83.334 -20.424 3.792   0.40 19.24  ? 182 ASN A ND2   1 
ATOM   1514 N  N     A LEU A 1 186 ? 78.569 -17.147 -10.914 0.60 26.15  ? 183 LEU A N     1 
ATOM   1515 N  N     B LEU A 1 186 ? 78.868 -19.700 0.148   0.40 22.28  ? 183 LEU A N     1 
ATOM   1516 C  CA    A LEU A 1 186 ? 77.575 -16.173 -11.359 0.60 37.78  ? 183 LEU A CA    1 
ATOM   1517 C  CA    B LEU A 1 186 ? 77.449 -19.544 -0.143  0.40 21.92  ? 183 LEU A CA    1 
ATOM   1518 C  C     A LEU A 1 186 ? 76.138 -16.653 -11.164 0.60 24.29  ? 183 LEU A C     1 
ATOM   1519 C  C     B LEU A 1 186 ? 77.158 -20.046 -1.551  0.40 21.93  ? 183 LEU A C     1 
ATOM   1520 O  O     A LEU A 1 186 ? 75.206 -15.851 -11.172 0.60 28.99  ? 183 LEU A O     1 
ATOM   1521 O  O     B LEU A 1 186 ? 77.993 -20.702 -2.171  0.40 21.81  ? 183 LEU A O     1 
ATOM   1522 C  CB    A LEU A 1 186 ? 77.808 -15.790 -12.824 0.60 54.86  ? 183 LEU A CB    1 
ATOM   1523 C  CB    B LEU A 1 186 ? 76.999 -18.088 0.040   0.40 20.05  ? 183 LEU A CB    1 
ATOM   1524 C  CG    A LEU A 1 186 ? 78.898 -14.752 -13.109 0.60 57.79  ? 183 LEU A CG    1 
ATOM   1525 C  CG    B LEU A 1 186 ? 77.017 -17.608 1.498   0.40 20.59  ? 183 LEU A CG    1 
ATOM   1526 C  CD1   A LEU A 1 186 ? 80.254 -15.219 -12.601 0.60 60.18  ? 183 LEU A CD1   1 
ATOM   1527 C  CD1   B LEU A 1 186 ? 76.958 -16.095 1.615   0.40 20.88  ? 183 LEU A CD1   1 
ATOM   1528 C  CD2   A LEU A 1 186 ? 78.959 -14.437 -14.595 0.60 57.42  ? 183 LEU A CD2   1 
ATOM   1529 C  CD2   B LEU A 1 186 ? 75.907 -18.258 2.317   0.40 22.22  ? 183 LEU A CD2   1 
ATOM   1530 N  N     A THR A 1 187 ? 75.961 -17.957 -10.996 0.60 23.60  ? 184 THR A N     1 
ATOM   1531 N  N     B THR A 1 187 ? 75.970 -19.741 -2.054  0.40 21.36  ? 184 THR A N     1 
ATOM   1532 C  CA    A THR A 1 187 ? 74.627 -18.523 -10.830 0.60 29.96  ? 184 THR A CA    1 
ATOM   1533 C  CA    B THR A 1 187 ? 75.539 -20.258 -3.344  0.40 21.94  ? 184 THR A CA    1 
ATOM   1534 C  C     A THR A 1 187 ? 74.268 -18.752 -9.361  0.60 27.64  ? 184 THR A C     1 
ATOM   1535 C  C     B THR A 1 187 ? 75.456 -19.142 -4.376  0.40 23.96  ? 184 THR A C     1 
ATOM   1536 O  O     A THR A 1 187 ? 73.215 -19.306 -9.061  0.60 26.95  ? 184 THR A O     1 
ATOM   1537 O  O     B THR A 1 187 ? 75.580 -17.964 -4.043  0.40 22.88  ? 184 THR A O     1 
ATOM   1538 C  CB    A THR A 1 187 ? 74.474 -19.852 -11.596 0.60 47.93  ? 184 THR A CB    1 
ATOM   1539 C  CB    B THR A 1 187 ? 74.137 -20.835 -3.227  0.40 20.85  ? 184 THR A CB    1 
ATOM   1540 O  OG1   A THR A 1 187 ? 75.360 -20.833 -11.042 0.60 47.37  ? 184 THR A OG1   1 
ATOM   1541 O  OG1   B THR A 1 187 ? 73.247 -19.770 -2.877  0.40 14.66  ? 184 THR A OG1   1 
ATOM   1542 C  CG2   A THR A 1 187 ? 74.791 -19.657 -13.071 0.60 51.21  ? 184 THR A CG2   1 
ATOM   1543 C  CG2   B THR A 1 187 ? 74.089 -21.919 -2.154  0.40 27.56  ? 184 THR A CG2   1 
ATOM   1544 N  N     A SER A 1 188 ? 75.145 -18.327 -8.454  0.60 27.41  ? 185 SER A N     1 
ATOM   1545 N  N     B SER A 1 188 ? 75.227 -19.524 -5.628  0.40 20.09  ? 185 SER A N     1 
ATOM   1546 C  CA    A SER A 1 188 ? 74.903 -18.460 -7.016  0.60 20.23  ? 185 SER A CA    1 
ATOM   1547 C  CA    B SER A 1 188 ? 75.007 -18.561 -6.697  0.40 18.73  ? 185 SER A CA    1 
ATOM   1548 C  C     A SER A 1 188 ? 73.711 -17.610 -6.567  0.60 16.64  ? 185 SER A C     1 
ATOM   1549 C  C     B SER A 1 188 ? 73.818 -17.653 -6.375  0.40 16.36  ? 185 SER A C     1 
ATOM   1550 O  O     A SER A 1 188 ? 73.714 -16.394 -6.739  0.60 17.64  ? 185 SER A O     1 
ATOM   1551 O  O     B SER A 1 188 ? 73.926 -16.433 -6.467  0.40 17.33  ? 185 SER A O     1 
ATOM   1552 C  CB    A SER A 1 188 ? 76.154 -18.044 -6.236  0.60 22.24  ? 185 SER A CB    1 
ATOM   1553 C  CB    B SER A 1 188 ? 74.797 -19.274 -8.035  0.40 24.28  ? 185 SER A CB    1 
ATOM   1554 O  OG    A SER A 1 188 ? 75.905 -18.005 -4.840  0.60 27.74  ? 185 SER A OG    1 
ATOM   1555 O  OG    B SER A 1 188 ? 74.678 -18.341 -9.094  0.40 27.49  ? 185 SER A OG    1 
ATOM   1556 N  N     . PRO A 1 189 ? 72.673 -18.247 -5.995  1.00 16.79  ? 186 PRO A N     1 
ATOM   1557 C  CA    . PRO A 1 189 ? 71.512 -17.446 -5.583  1.00 13.87  ? 186 PRO A CA    1 
ATOM   1558 C  C     . PRO A 1 189 ? 71.855 -16.428 -4.503  1.00 15.42  ? 186 PRO A C     1 
ATOM   1559 O  O     . PRO A 1 189 ? 71.329 -15.323 -4.549  1.00 14.51  ? 186 PRO A O     1 
ATOM   1560 C  CB    . PRO A 1 189 ? 70.548 -18.488 -5.027  1.00 17.15  ? 186 PRO A CB    1 
ATOM   1561 C  CG    . PRO A 1 189 ? 70.877 -19.743 -5.819  1.00 17.45  ? 186 PRO A CG    1 
ATOM   1562 C  CD    . PRO A 1 189 ? 72.381 -19.694 -5.992  1.00 18.69  ? 186 PRO A CD    1 
ATOM   1563 N  N     . ASP A 1 190 ? 72.706 -16.782 -3.544  1.00 15.49  ? 187 ASP A N     1 
ATOM   1564 C  CA    . ASP A 1 190 ? 73.070 -15.808 -2.514  1.00 11.07  ? 187 ASP A CA    1 
ATOM   1565 C  C     . ASP A 1 190 ? 73.811 -14.615 -3.104  1.00 14.24  ? 187 ASP A C     1 
ATOM   1566 O  O     . ASP A 1 190 ? 73.617 -13.475 -2.672  1.00 15.42  ? 187 ASP A O     1 
ATOM   1567 C  CB    . ASP A 1 190 ? 73.938 -16.463 -1.425  1.00 15.08  ? 187 ASP A CB    1 
ATOM   1568 C  CG    . ASP A 1 190 ? 73.163 -17.440 -0.537  1.00 21.83  ? 187 ASP A CG    1 
ATOM   1569 O  OD1   . ASP A 1 190 ? 71.916 -17.418 -0.514  1.00 16.34  ? 187 ASP A OD1   1 
ATOM   1570 O  OD2   . ASP A 1 190 ? 73.814 -18.238 0.167   1.00 24.56  ? 187 ASP A OD2   1 
ATOM   1571 N  N     . LEU A 1 191 ? 74.683 -14.872 -4.076  1.00 14.68  ? 188 LEU A N     1 
ATOM   1572 C  CA    . LEU A 1 191 ? 75.391 -13.785 -4.737  1.00 12.38  ? 188 LEU A CA    1 
ATOM   1573 C  C     . LEU A 1 191 ? 74.409 -12.916 -5.518  1.00 13.88  ? 188 LEU A C     1 
ATOM   1574 O  O     . LEU A 1 191 ? 74.498 -11.691 -5.506  1.00 15.23  ? 188 LEU A O     1 
ATOM   1575 C  CB    . LEU A 1 191 ? 76.471 -14.332 -5.679  1.00 17.46  ? 188 LEU A CB    1 
ATOM   1576 C  CG    . LEU A 1 191 ? 77.225 -13.293 -6.522  1.00 20.16  ? 188 LEU A CG    1 
ATOM   1577 C  CD1   . LEU A 1 191 ? 77.930 -12.264 -5.658  1.00 20.83  ? 188 LEU A CD1   1 
ATOM   1578 C  CD2   . LEU A 1 191 ? 78.221 -13.986 -7.459  1.00 22.35  ? 188 LEU A CD2   1 
ATOM   1579 N  N     . GLN A 1 192 ? 73.463 -13.557 -6.194  1.00 15.35  ? 189 GLN A N     1 
ATOM   1580 C  CA    . GLN A 1 192 ? 72.452 -12.823 -6.946  1.00 13.83  ? 189 GLN A CA    1 
ATOM   1581 C  C     . GLN A 1 192 ? 71.649 -11.902 -6.035  1.00 12.77  ? 189 GLN A C     1 
ATOM   1582 O  O     . GLN A 1 192 ? 71.403 -10.742 -6.380  1.00 13.53  ? 189 GLN A O     1 
ATOM   1583 C  CB    . GLN A 1 192 ? 71.545 -13.799 -7.705  1.00 16.18  ? 189 GLN A CB    1 
ATOM   1584 C  CG    . GLN A 1 192 ? 72.294 -14.510 -8.840  1.00 17.10  ? 189 GLN A CG    1 
ATOM   1585 C  CD    . GLN A 1 192 ? 71.517 -15.640 -9.469  1.00 30.18  ? 189 GLN A CD    1 
ATOM   1586 O  OE1   . GLN A 1 192 ? 70.564 -16.153 -8.893  1.00 31.62  ? 189 GLN A OE1   1 
ATOM   1587 N  NE2   . GLN A 1 192 ? 71.935 -16.047 -10.663 1.00 38.41  ? 189 GLN A NE2   1 
ATOM   1588 N  N     . LEU A 1 193 ? 71.253 -12.396 -4.864  1.00 12.02  ? 190 LEU A N     1 
ATOM   1589 C  CA    . LEU A 1 193 ? 70.522 -11.557 -3.919  1.00 8.67   ? 190 LEU A CA    1 
ATOM   1590 C  C     . LEU A 1 193 ? 71.364 -10.369 -3.465  1.00 14.43  ? 190 LEU A C     1 
ATOM   1591 O  O     . LEU A 1 193 ? 70.842 -9.279  -3.261  1.00 14.23  ? 190 LEU A O     1 
ATOM   1592 C  CB    . LEU A 1 193 ? 70.117 -12.365 -2.690  1.00 12.67  ? 190 LEU A CB    1 
ATOM   1593 C  CG    . LEU A 1 193 ? 69.030 -13.428 -2.820  1.00 11.73  ? 190 LEU A CG    1 
ATOM   1594 C  CD1   . LEU A 1 193 ? 68.699 -14.014 -1.427  1.00 14.51  ? 190 LEU A CD1   1 
ATOM   1595 C  CD2   . LEU A 1 193 ? 67.795 -12.837 -3.452  1.00 13.21  ? 190 LEU A CD2   1 
ATOM   1596 N  N     . THR A 1 194 ? 72.658 -10.604 -3.258  1.00 14.14  ? 191 THR A N     1 
ATOM   1597 C  CA    . THR A 1 194 ? 73.562 -9.574  -2.778  1.00 10.12  ? 191 THR A CA    1 
ATOM   1598 C  C     . THR A 1 194 ? 73.694 -8.455  -3.805  1.00 14.08  ? 191 THR A C     1 
ATOM   1599 O  O     . THR A 1 194 ? 73.664 -7.272  -3.456  1.00 14.93  ? 191 THR A O     1 
ATOM   1600 C  CB    . THR A 1 194 ? 74.936 -10.170 -2.497  1.00 13.60  ? 191 THR A CB    1 
ATOM   1601 O  OG1   . THR A 1 194 ? 74.788 -11.207 -1.521  1.00 15.28  ? 191 THR A OG1   1 
ATOM   1602 C  CG2   . THR A 1 194 ? 75.897 -9.109  -1.961  1.00 14.90  ? 191 THR A CG2   1 
ATOM   1603 N  N     . VAL A 1 195 ? 73.840 -8.837  -5.070  1.00 13.42  ? 192 VAL A N     1 
ATOM   1604 C  CA    . VAL A 1 195 ? 73.881 -7.843  -6.144  1.00 16.12  ? 192 VAL A CA    1 
ATOM   1605 C  C     . VAL A 1 195 ? 72.536 -7.114  -6.242  1.00 14.09  ? 192 VAL A C     1 
ATOM   1606 O  O     . VAL A 1 195 ? 72.498 -5.898  -6.454  1.00 14.20  ? 192 VAL A O     1 
ATOM   1607 C  CB    . VAL A 1 195 ? 74.264 -8.482  -7.493  1.00 16.96  ? 192 VAL A CB    1 
ATOM   1608 C  CG1   . VAL A 1 195 ? 74.185 -7.441  -8.611  1.00 17.59  ? 192 VAL A CG1   1 
ATOM   1609 C  CG2   . VAL A 1 195 ? 75.669 -9.053  -7.416  1.00 19.09  ? 192 VAL A CG2   1 
ATOM   1610 N  N     . GLY A 1 196 ? 71.434 -7.845  -6.058  1.00 12.28  ? 193 GLY A N     1 
ATOM   1611 C  CA    . GLY A 1 196 ? 70.116 -7.228  -5.993  1.00 11.08  ? 193 GLY A CA    1 
ATOM   1612 C  C     . GLY A 1 196 ? 70.070 -6.145  -4.934  1.00 12.57  ? 193 GLY A C     1 
ATOM   1613 O  O     . GLY A 1 196 ? 69.542 -5.047  -5.148  1.00 15.48  ? 193 GLY A O     1 
ATOM   1614 N  N     . ALA A 1 197 ? 70.634 -6.451  -3.772  1.00 13.74  ? 194 ALA A N     1 
ATOM   1615 C  CA    . ALA A 1 197 ? 70.663 -5.477  -2.693  1.00 10.04  ? 194 ALA A CA    1 
ATOM   1616 C  C     . ALA A 1 197 ? 71.505 -4.243  -3.038  1.00 13.19  ? 194 ALA A C     1 
ATOM   1617 O  O     . ALA A 1 197 ? 71.144 -3.126  -2.666  1.00 13.82  ? 194 ALA A O     1 
ATOM   1618 C  CB    . ALA A 1 197 ? 71.138 -6.133  -1.395  1.00 12.71  ? 194 ALA A CB    1 
ATOM   1619 N  N     . VAL A 1 198 ? 72.612 -4.432  -3.756  1.00 12.02  ? 195 VAL A N     1 
ATOM   1620 C  CA    . VAL A 1 198 ? 73.412 -3.294  -4.216  1.00 11.99  ? 195 VAL A CA    1 
ATOM   1621 C  C     . VAL A 1 198 ? 72.590 -2.366  -5.117  1.00 15.77  ? 195 VAL A C     1 
ATOM   1622 O  O     . VAL A 1 198 ? 72.606 -1.131  -4.958  1.00 16.77  ? 195 VAL A O     1 
ATOM   1623 C  CB    . VAL A 1 198 ? 74.675 -3.772  -4.950  1.00 14.27  ? 195 VAL A CB    1 
ATOM   1624 C  CG1   . VAL A 1 198 ? 75.388 -2.593  -5.622  1.00 16.55  ? 195 VAL A CG1   1 
ATOM   1625 C  CG2   . VAL A 1 198 ? 75.599 -4.477  -3.977  1.00 17.04  ? 195 VAL A CG2   1 
ATOM   1626 N  N     . ILE A 1 199 ? 71.841 -2.971  -6.034  1.00 13.22  ? 196 ILE A N     1 
ATOM   1627 C  CA    . ILE A 1 199 ? 70.987 -2.216  -6.941  1.00 12.42  ? 196 ILE A CA    1 
ATOM   1628 C  C     . ILE A 1 199 ? 69.894 -1.476  -6.174  1.00 13.43  ? 196 ILE A C     1 
ATOM   1629 O  O     . ILE A 1 199 ? 69.599 -0.329  -6.488  1.00 13.55  ? 196 ILE A O     1 
ATOM   1630 C  CB    . ILE A 1 199 ? 70.392 -3.112  -8.035  1.00 14.11  ? 196 ILE A CB    1 
ATOM   1631 C  CG1   . ILE A 1 199 ? 71.515 -3.606  -8.955  1.00 15.71  ? 196 ILE A CG1   1 
ATOM   1632 C  CG2   . ILE A 1 199 ? 69.330 -2.338  -8.837  1.00 15.76  ? 196 ILE A CG2   1 
ATOM   1633 C  CD1   . ILE A 1 199 ? 71.108 -4.766  -9.864  1.00 17.47  ? 196 ILE A CD1   1 
ATOM   1634 N  N     . VAL A 1 200 ? 69.315 -2.123  -5.157  1.00 12.41  ? 197 VAL A N     1 
ATOM   1635 C  CA    . VAL A 1 200 ? 68.260 -1.491  -4.361  1.00 7.23   ? 197 VAL A CA    1 
ATOM   1636 C  C     . VAL A 1 200 ? 68.809 -0.332  -3.531  1.00 15.75  ? 197 VAL A C     1 
ATOM   1637 O  O     . VAL A 1 200 ? 68.128 0.681   -3.370  1.00 13.14  ? 197 VAL A O     1 
ATOM   1638 C  CB    . VAL A 1 200 ? 67.489 -2.543  -3.509  1.00 10.62  ? 197 VAL A CB    1 
ATOM   1639 C  CG1   . VAL A 1 200 ? 66.457 -1.862  -2.624  1.00 13.17  ? 197 VAL A CG1   1 
ATOM   1640 C  CG2   . VAL A 1 200 ? 66.800 -3.541  -4.431  1.00 15.67  ? 197 VAL A CG2   1 
ATOM   1641 N  N     . GLU A 1 201 ? 70.042 -0.443  -3.031  1.00 12.96  ? 198 GLU A N     1 
ATOM   1642 C  CA    . GLU A 1 201 ? 70.668 0.716   -2.384  1.00 9.70   ? 198 GLU A CA    1 
ATOM   1643 C  C     . GLU A 1 201 ? 70.696 1.895   -3.368  1.00 16.47  ? 198 GLU A C     1 
ATOM   1644 O  O     . GLU A 1 201 ? 70.410 3.044   -3.010  1.00 16.12  ? 198 GLU A O     1 
ATOM   1645 C  CB    . GLU A 1 201 ? 72.108 0.405   -1.955  1.00 13.96  ? 198 GLU A CB    1 
ATOM   1646 C  CG    . GLU A 1 201 ? 72.254 -0.613  -0.800  1.00 15.37  ? 198 GLU A CG    1 
ATOM   1647 C  CD    . GLU A 1 201 ? 72.138 -0.011  0.609   1.00 17.75  ? 198 GLU A CD    1 
ATOM   1648 O  OE1   . GLU A 1 201 ? 71.768 1.176   0.765   1.00 17.99  ? 198 GLU A OE1   1 
ATOM   1649 O  OE2   . GLU A 1 201 ? 72.437 -0.740  1.580   1.00 16.59  ? 198 GLU A OE2   1 
ATOM   1650 N  N     . GLU A 1 202 ? 71.082 1.606   -4.606  1.00 13.51  ? 199 GLU A N     1 
ATOM   1651 C  CA    . GLU A 1 202 ? 71.181 2.630   -5.643  1.00 10.33  ? 199 GLU A CA    1 
ATOM   1652 C  C     . GLU A 1 202 ? 69.806 3.240   -5.947  1.00 15.31  ? 199 GLU A C     1 
ATOM   1653 O  O     . GLU A 1 202 ? 69.652 4.474   -6.029  1.00 15.34  ? 199 GLU A O     1 
ATOM   1654 C  CB    . GLU A 1 202 ? 71.810 2.013   -6.898  1.00 14.15  ? 199 GLU A CB    1 
ATOM   1655 C  CG    . GLU A 1 202 ? 73.305 1.702   -6.739  1.00 16.30  ? 199 GLU A CG    1 
ATOM   1656 C  CD    . GLU A 1 202 ? 73.860 0.762   -7.806  1.00 23.43  ? 199 GLU A CD    1 
ATOM   1657 O  OE1   . GLU A 1 202 ? 75.077 0.497   -7.767  1.00 28.14  ? 199 GLU A OE1   1 
ATOM   1658 O  OE2   . GLU A 1 202 ? 73.103 0.296   -8.678  1.00 27.75  ? 199 GLU A OE2   1 
ATOM   1659 N  N     . MET A 1 203 ? 68.804 2.371   -6.098  1.00 12.35  ? 200 MET A N     1 
ATOM   1660 C  CA    . MET A 1 203 ? 67.436 2.817   -6.325  1.00 9.36   ? 200 MET A CA    1 
ATOM   1661 C  C     . MET A 1 203 ? 66.939 3.686   -5.171  1.00 11.99  ? 200 MET A C     1 
ATOM   1662 O  O     . MET A 1 203 ? 66.337 4.742   -5.401  1.00 13.25  ? 200 MET A O     1 
ATOM   1663 C  CB    . MET A 1 203 ? 66.497 1.619   -6.486  1.00 13.79  ? 200 MET A CB    1 
ATOM   1664 C  CG    A MET A 1 203 ? 65.075 2.017   -6.740  0.49 15.01  ? 200 MET A CG    1 
ATOM   1665 C  CG    B MET A 1 203 ? 66.865 0.614   -7.562  0.51 16.84  ? 200 MET A CG    1 
ATOM   1666 S  SD    A MET A 1 203 ? 63.953 0.611   -6.652  0.49 25.20  ? 200 MET A SD    1 
ATOM   1667 S  SD    B MET A 1 203 ? 65.574 -0.648  -7.657  0.51 18.42  ? 200 MET A SD    1 
ATOM   1668 C  CE    A MET A 1 203 ? 64.159 -0.131  -8.263  0.49 15.19  ? 200 MET A CE    1 
ATOM   1669 C  CE    B MET A 1 203 ? 64.158 0.458   -7.690  0.51 5.94   ? 200 MET A CE    1 
ATOM   1670 N  N     . ARG A 1 204 ? 67.181 3.246   -3.931  1.00 10.90  ? 201 ARG A N     1 
ATOM   1671 C  CA    . ARG A 1 204 ? 66.716 4.007   -2.770  1.00 8.21   ? 201 ARG A CA    1 
ATOM   1672 C  C     . ARG A 1 204 ? 67.428 5.359   -2.647  1.00 12.92  ? 201 ARG A C     1 
ATOM   1673 O  O     . ARG A 1 204 ? 66.804 6.360   -2.286  1.00 14.06  ? 201 ARG A O     1 
ATOM   1674 C  CB    . ARG A 1 204 ? 66.844 3.182   -1.485  1.00 12.92  ? 201 ARG A CB    1 
ATOM   1675 C  CG    . ARG A 1 204 ? 65.854 1.995   -1.473  1.00 12.40  ? 201 ARG A CG    1 
ATOM   1676 C  CD    . ARG A 1 204 ? 65.968 1.132   -0.225  1.00 15.85  ? 201 ARG A CD    1 
ATOM   1677 N  NE    . ARG A 1 204 ? 65.963 1.952   0.974   1.00 14.29  ? 201 ARG A NE    1 
ATOM   1678 C  CZ    . ARG A 1 204 ? 66.999 2.063   1.798   1.00 15.28  ? 201 ARG A CZ    1 
ATOM   1679 N  NH1   . ARG A 1 204 ? 66.932 2.867   2.853   1.00 14.87  ? 201 ARG A NH1   1 
ATOM   1680 N  NH2   . ARG A 1 204 ? 68.104 1.366   1.574   1.00 17.84  ? 201 ARG A NH2   1 
ATOM   1681 N  N     . ALA A 1 205 ? 68.723 5.396   -2.984  1.00 12.94  ? 202 ALA A N     1 
ATOM   1682 C  CA    . ALA A 1 205 ? 69.466 6.662   -2.997  1.00 10.82  ? 202 ALA A CA    1 
ATOM   1683 C  C     . ALA A 1 205 ? 68.890 7.614   -4.051  1.00 12.23  ? 202 ALA A C     1 
ATOM   1684 O  O     . ALA A 1 205 ? 68.748 8.822   -3.801  1.00 14.06  ? 202 ALA A O     1 
ATOM   1685 C  CB    . ALA A 1 205 ? 70.952 6.407   -3.255  1.00 14.40  ? 202 ALA A CB    1 
ATOM   1686 N  N     . ALA A 1 206 ? 68.540 7.077   -5.220  1.00 13.15  ? 203 ALA A N     1 
ATOM   1687 C  CA    . ALA A 1 206 ? 67.949 7.903   -6.270  1.00 11.23  ? 203 ALA A CA    1 
ATOM   1688 C  C     . ALA A 1 206 ? 66.589 8.463   -5.858  1.00 12.51  ? 203 ALA A C     1 
ATOM   1689 O  O     . ALA A 1 206 ? 66.294 9.634   -6.083  1.00 14.85  ? 203 ALA A O     1 
ATOM   1690 C  CB    . ALA A 1 206 ? 67.845 7.123   -7.579  1.00 15.11  ? 203 ALA A CB    1 
ATOM   1691 N  N     . ILE A 1 207 ? 65.758 7.625   -5.241  1.00 10.85  ? 204 ILE A N     1 
ATOM   1692 C  CA    . ILE A 1 207 ? 64.479 8.110   -4.737  1.00 8.13   ? 204 ILE A CA    1 
ATOM   1693 C  C     . ILE A 1 207 ? 64.697 9.257   -3.757  1.00 12.32  ? 204 ILE A C     1 
ATOM   1694 O  O     . ILE A 1 207 ? 64.070 10.311  -3.871  1.00 12.70  ? 204 ILE A O     1 
ATOM   1695 C  CB    . ILE A 1 207 ? 63.663 6.978   -4.085  1.00 11.47  ? 204 ILE A CB    1 
ATOM   1696 C  CG1   . ILE A 1 207 ? 63.244 5.960   -5.147  1.00 13.14  ? 204 ILE A CG1   1 
ATOM   1697 C  CG2   . ILE A 1 207 ? 62.446 7.552   -3.355  1.00 12.08  ? 204 ILE A CG2   1 
ATOM   1698 C  CD1   . ILE A 1 207 ? 62.701 4.641   -4.556  1.00 14.13  ? 204 ILE A CD1   1 
ATOM   1699 N  N     . GLU A 1 208 ? 65.595 9.068   -2.794  1.00 11.75  ? 205 GLU A N     1 
ATOM   1700 C  CA    . GLU A 1 208 ? 65.782 10.123  -1.799  1.00 8.30   ? 205 GLU A CA    1 
ATOM   1701 C  C     . GLU A 1 208 ? 66.388 11.398  -2.406  1.00 12.18  ? 205 GLU A C     1 
ATOM   1702 O  O     . GLU A 1 208 ? 65.947 12.516  -2.104  1.00 14.51  ? 205 GLU A O     1 
ATOM   1703 C  CB    . GLU A 1 208 ? 66.614 9.626   -0.619  1.00 15.86  ? 205 GLU A CB    1 
ATOM   1704 C  CG    . GLU A 1 208 ? 66.588 10.604  0.560   1.00 17.16  ? 205 GLU A CG    1 
ATOM   1705 C  CD    . GLU A 1 208 ? 67.408 10.147  1.759   1.00 19.10  ? 205 GLU A CD    1 
ATOM   1706 O  OE1   . GLU A 1 208 ? 67.430 10.894  2.761   1.00 24.25  ? 205 GLU A OE1   1 
ATOM   1707 O  OE2   . GLU A 1 208 ? 68.006 9.056   1.708   1.00 22.49  ? 205 GLU A OE2   1 
ATOM   1708 N  N     . ARG A 1 209 ? 67.389 11.239  -3.275  1.00 12.99  ? 206 ARG A N     1 
ATOM   1709 C  CA    . ARG A 1 209 ? 68.000 12.397  -3.928  1.00 9.13   ? 206 ARG A CA    1 
ATOM   1710 C  C     . ARG A 1 209 ? 66.960 13.208  -4.698  1.00 13.56  ? 206 ARG A C     1 
ATOM   1711 O  O     . ARG A 1 209 ? 66.923 14.436  -4.611  1.00 15.18  ? 206 ARG A O     1 
ATOM   1712 C  CB    . ARG A 1 209 ? 69.124 11.975  -4.887  1.00 13.04  ? 206 ARG A CB    1 
ATOM   1713 C  CG    . ARG A 1 209 ? 69.886 13.196  -5.470  1.00 19.01  ? 206 ARG A CG    1 
ATOM   1714 C  CD    . ARG A 1 209 ? 70.932 12.863  -6.537  1.00 28.14  ? 206 ARG A CD    1 
ATOM   1715 N  NE    . ARG A 1 209 ? 70.377 12.590  -7.867  1.00 32.37  ? 206 ARG A NE    1 
ATOM   1716 C  CZ    . ARG A 1 209 ? 69.988 13.523  -8.735  1.00 32.03  ? 206 ARG A CZ    1 
ATOM   1717 N  NH1   . ARG A 1 209 ? 69.512 13.170  -9.927  1.00 29.87  ? 206 ARG A NH1   1 
ATOM   1718 N  NH2   . ARG A 1 209 ? 70.063 14.809  -8.417  1.00 26.95  ? 206 ARG A NH2   1 
ATOM   1719 N  N     . GLU A 1 210 ? 66.114 12.517  -5.462  1.00 11.92  ? 207 GLU A N     1 
ATOM   1720 C  CA    . GLU A 1 210 ? 65.258 13.175  -6.444  1.00 9.62   ? 207 GLU A CA    1 
ATOM   1721 C  C     . GLU A 1 210 ? 63.874 13.555  -5.919  1.00 9.72   ? 207 GLU A C     1 
ATOM   1722 O  O     . GLU A 1 210 ? 63.176 14.338  -6.548  1.00 12.70  ? 207 GLU A O     1 
ATOM   1723 C  CB    . GLU A 1 210 ? 65.147 12.321  -7.711  1.00 13.21  ? 207 GLU A CB    1 
ATOM   1724 C  CG    . GLU A 1 210 ? 66.491 12.024  -8.332  1.00 13.86  ? 207 GLU A CG    1 
ATOM   1725 C  CD    . GLU A 1 210 ? 66.412 11.091  -9.521  1.00 23.69  ? 207 GLU A CD    1 
ATOM   1726 O  OE1   . GLU A 1 210 ? 65.371 11.070  -10.210 1.00 24.78  ? 207 GLU A OE1   1 
ATOM   1727 O  OE2   . GLU A 1 210 ? 67.405 10.379  -9.765  1.00 27.58  ? 207 GLU A OE2   1 
ATOM   1728 N  N     . THR A 1 211 ? 63.477 13.019  -4.758  1.00 12.91  ? 208 THR A N     1 
ATOM   1729 C  CA    . THR A 1 211 ? 62.188 13.393  -4.174  1.00 8.64   ? 208 THR A CA    1 
ATOM   1730 C  C     . THR A 1 211 ? 62.262 13.904  -2.748  1.00 13.03  ? 208 THR A C     1 
ATOM   1731 O  O     . THR A 1 211 ? 61.334 14.561  -2.285  1.00 14.71  ? 208 THR A O     1 
ATOM   1732 C  CB    . THR A 1 211 ? 61.187 12.207  -4.160  1.00 12.62  ? 208 THR A CB    1 
ATOM   1733 O  OG1   . THR A 1 211 ? 61.612 11.208  -3.218  1.00 12.04  ? 208 THR A OG1   1 
ATOM   1734 C  CG2   . THR A 1 211 ? 61.075 11.591  -5.536  1.00 14.51  ? 208 THR A CG2   1 
ATOM   1735 N  N     . GLY A 1 212 ? 63.334 13.578  -2.036  1.00 12.90  ? 209 GLY A N     1 
ATOM   1736 C  CA    . GLY A 1 212 ? 63.391 13.847  -0.609  1.00 11.51  ? 209 GLY A CA    1 
ATOM   1737 C  C     . GLY A 1 212 ? 62.860 12.721  0.273   1.00 16.91  ? 209 GLY A C     1 
ATOM   1738 O  O     . GLY A 1 212 ? 63.041 12.768  1.483   1.00 19.98  ? 209 GLY A O     1 
ATOM   1739 N  N     . PHE A 1 213 ? 62.225 11.702  -0.315  1.00 13.30  ? 210 PHE A N     1 
ATOM   1740 C  CA    . PHE A 1 213 ? 61.531 10.679  0.466   1.00 7.28   ? 210 PHE A CA    1 
ATOM   1741 C  C     . PHE A 1 213 ? 62.443 9.500   0.761   1.00 13.51  ? 210 PHE A C     1 
ATOM   1742 O  O     . PHE A 1 213 ? 63.181 9.038   -0.120  1.00 15.13  ? 210 PHE A O     1 
ATOM   1743 C  CB    . PHE A 1 213 ? 60.286 10.175  -0.273  1.00 9.96   ? 210 PHE A CB    1 
ATOM   1744 C  CG    . PHE A 1 213 ? 59.287 11.249  -0.638  1.00 9.83   ? 210 PHE A CG    1 
ATOM   1745 C  CD1   . PHE A 1 213 ? 58.612 11.190  -1.853  1.00 11.68  ? 210 PHE A CD1   1 
ATOM   1746 C  CD2   . PHE A 1 213 ? 59.021 12.309  0.218   1.00 11.56  ? 210 PHE A CD2   1 
ATOM   1747 C  CE1   . PHE A 1 213 ? 57.684 12.176  -2.205  1.00 11.56  ? 210 PHE A CE1   1 
ATOM   1748 C  CE2   . PHE A 1 213 ? 58.094 13.293  -0.126  1.00 12.55  ? 210 PHE A CE2   1 
ATOM   1749 C  CZ    . PHE A 1 213 ? 57.423 13.223  -1.333  1.00 11.44  ? 210 PHE A CZ    1 
ATOM   1750 N  N     . GLN A 1 214 ? 62.381 9.000   2.000   1.00 11.47  ? 211 GLN A N     1 
ATOM   1751 C  CA    . GLN A 1 214 ? 63.083 7.783   2.403   1.00 7.21   ? 211 GLN A CA    1 
ATOM   1752 C  C     . GLN A 1 214 ? 62.158 6.581   2.351   1.00 11.17  ? 211 GLN A C     1 
ATOM   1753 O  O     . GLN A 1 214 ? 60.935 6.711   2.433   1.00 12.83  ? 211 GLN A O     1 
ATOM   1754 C  CB    . GLN A 1 214 ? 63.614 7.932   3.827   1.00 14.82  ? 211 GLN A CB    1 
ATOM   1755 C  CG    . GLN A 1 214 ? 64.706 8.997   3.938   1.00 13.95  ? 211 GLN A CG    1 
ATOM   1756 C  CD    . GLN A 1 214 ? 65.303 9.103   5.323   1.00 17.99  ? 211 GLN A CD    1 
ATOM   1757 O  OE1   . GLN A 1 214 ? 64.746 8.603   6.304   1.00 18.28  ? 211 GLN A OE1   1 
ATOM   1758 N  NE2   . GLN A 1 214 ? 66.461 9.752   5.408   1.00 20.16  ? 211 GLN A NE2   1 
ATOM   1759 N  N     . CYS A 1 215 ? 62.738 5.392   2.219   1.00 10.89  ? 212 CYS A N     1 
ATOM   1760 C  CA    . CYS A 1 215 ? 61.927 4.187   2.136   1.00 6.45   ? 212 CYS A CA    1 
ATOM   1761 C  C     . CYS A 1 215 ? 62.706 3.033   2.712   1.00 11.49  ? 212 CYS A C     1 
ATOM   1762 O  O     . CYS A 1 215 ? 63.916 3.142   2.994   1.00 14.75  ? 212 CYS A O     1 
ATOM   1763 C  CB    . CYS A 1 215 ? 61.542 3.873   0.689   1.00 11.79  ? 212 CYS A CB    1 
ATOM   1764 S  SG    . CYS A 1 215 ? 62.963 3.568   -0.354  1.00 16.93  ? 212 CYS A SG    1 
ATOM   1765 N  N     . SER A 1 216 ? 62.000 1.927   2.903   1.00 11.58  ? 213 SER A N     1 
ATOM   1766 C  CA    A SER A 1 216 ? 62.618 0.663   3.283   0.90 7.02   ? 213 SER A CA    1 
ATOM   1767 C  CA    B SER A 1 216 ? 62.629 0.670   3.268   0.10 8.27   ? 213 SER A CA    1 
ATOM   1768 C  C     . SER A 1 216 ? 62.431 -0.304  2.118   1.00 12.01  ? 213 SER A C     1 
ATOM   1769 O  O     . SER A 1 216 ? 61.617 -0.073  1.219   1.00 12.54  ? 213 SER A O     1 
ATOM   1770 C  CB    A SER A 1 216 ? 61.971 0.136   4.564   0.90 13.64  ? 213 SER A CB    1 
ATOM   1771 C  CB    B SER A 1 216 ? 62.011 0.104   4.544   0.10 13.78  ? 213 SER A CB    1 
ATOM   1772 O  OG    A SER A 1 216 ? 62.170 1.072   5.628   0.90 15.63  ? 213 SER A OG    1 
ATOM   1773 O  OG    B SER A 1 216 ? 60.666 -0.270  4.326   0.10 12.69  ? 213 SER A OG    1 
ATOM   1774 N  N     . ALA A 1 217 ? 63.186 -1.391  2.116   1.00 10.46  ? 214 ALA A N     1 
ATOM   1775 C  CA    . ALA A 1 217 ? 63.042 -2.375  1.061   1.00 6.52   ? 214 ALA A CA    1 
ATOM   1776 C  C     . ALA A 1 217 ? 63.399 -3.749  1.589   1.00 11.72  ? 214 ALA A C     1 
ATOM   1777 O  O     . ALA A 1 217 ? 64.194 -3.878  2.540   1.00 10.54  ? 214 ALA A O     1 
ATOM   1778 C  CB    . ALA A 1 217 ? 63.915 -2.034  -0.114  1.00 11.24  ? 214 ALA A CB    1 
ATOM   1779 N  N     . GLY A 1 218 ? 62.795 -4.772  0.975   1.00 10.92  ? 215 GLY A N     1 
ATOM   1780 C  CA    . GLY A 1 218 ? 63.183 -6.160  1.187   1.00 5.86   ? 215 GLY A CA    1 
ATOM   1781 C  C     . GLY A 1 218 ? 63.690 -6.741  -0.122  1.00 10.26  ? 215 GLY A C     1 
ATOM   1782 O  O     . GLY A 1 218 ? 63.182 -6.398  -1.198  1.00 10.74  ? 215 GLY A O     1 
ATOM   1783 N  N     . ILE A 1 219 ? 64.716 -7.587  -0.047  1.00 10.18  ? 216 ILE A N     1 
ATOM   1784 C  CA    . ILE A 1 219 ? 65.250 -8.296  -1.208  1.00 5.14   ? 216 ILE A CA    1 
ATOM   1785 C  C     . ILE A 1 219 ? 65.249 -9.787  -0.898  1.00 9.73   ? 216 ILE A C     1 
ATOM   1786 O  O     . ILE A 1 219 ? 65.820 -10.227 0.114   1.00 11.70  ? 216 ILE A O     1 
ATOM   1787 C  CB    . ILE A 1 219 ? 66.693 -7.848  -1.530  1.00 10.77  ? 216 ILE A CB    1 
ATOM   1788 C  CG1   . ILE A 1 219 ? 66.778 -6.323  -1.723  1.00 12.86  ? 216 ILE A CG1   1 
ATOM   1789 C  CG2   . ILE A 1 219 ? 67.232 -8.549  -2.797  1.00 12.28  ? 216 ILE A CG2   1 
ATOM   1790 C  CD1   . ILE A 1 219 ? 67.130 -5.549  -0.458  1.00 16.23  ? 216 ILE A CD1   1 
ATOM   1791 N  N     . SER A 1 220 ? 64.594 -10.579 -1.749  1.00 8.28   ? 217 SER A N     1 
ATOM   1792 C  CA    . SER A 1 220 ? 64.608 -12.009 -1.618  1.00 4.49   ? 217 SER A CA    1 
ATOM   1793 C  C     . SER A 1 220 ? 64.329 -12.635 -2.978  1.00 9.79   ? 217 SER A C     1 
ATOM   1794 O  O     . SER A 1 220 ? 64.581 -12.014 -4.012  1.00 10.71  ? 217 SER A O     1 
ATOM   1795 C  CB    . SER A 1 220 ? 63.570 -12.437 -0.584  1.00 11.04  ? 217 SER A CB    1 
ATOM   1796 O  OG    . SER A 1 220 ? 63.772 -13.780 -0.207  1.00 12.34  ? 217 SER A OG    1 
ATOM   1797 N  N     . HIS A 1 221 ? 63.817 -13.864 -2.980  1.00 10.90  ? 218 HIS A N     1 
ATOM   1798 C  CA    . HIS A 1 221 ? 63.617 -14.607 -4.209  1.00 7.50   ? 218 HIS A CA    1 
ATOM   1799 C  C     . HIS A 1 221 ? 62.176 -14.588 -4.706  1.00 11.69  ? 218 HIS A C     1 
ATOM   1800 O  O     . HIS A 1 221 ? 61.890 -15.133 -5.770  1.00 13.17  ? 218 HIS A O     1 
ATOM   1801 C  CB    . HIS A 1 221 ? 64.057 -16.057 -4.029  1.00 11.08  ? 218 HIS A CB    1 
ATOM   1802 C  CG    . HIS A 1 221 ? 65.536 -16.230 -3.923  1.00 11.97  ? 218 HIS A CG    1 
ATOM   1803 N  ND1   . HIS A 1 221 ? 66.402 -15.873 -4.936  1.00 13.32  ? 218 HIS A ND1   1 
ATOM   1804 C  CD2   . HIS A 1 221 ? 66.310 -16.737 -2.927  1.00 13.91  ? 218 HIS A CD2   1 
ATOM   1805 C  CE1   . HIS A 1 221 ? 67.640 -16.156 -4.570  1.00 15.47  ? 218 HIS A CE1   1 
ATOM   1806 N  NE2   . HIS A 1 221 ? 67.613 -16.668 -3.349  1.00 14.29  ? 218 HIS A NE2   1 
ATOM   1807 N  N     . ASN A 1 222 ? 61.273 -13.969 -3.956  1.00 9.62   ? 219 ASN A N     1 
ATOM   1808 C  CA    . ASN A 1 222 ? 59.884 -13.880 -4.373  1.00 5.92   ? 219 ASN A CA    1 
ATOM   1809 C  C     . ASN A 1 222 ? 59.203 -12.734 -3.639  1.00 11.56  ? 219 ASN A C     1 
ATOM   1810 O  O     . ASN A 1 222 ? 59.788 -12.118 -2.734  1.00 12.40  ? 219 ASN A O     1 
ATOM   1811 C  CB    . ASN A 1 222 ? 59.156 -15.209 -4.126  1.00 10.67  ? 219 ASN A CB    1 
ATOM   1812 C  CG    . ASN A 1 222 ? 59.245 -15.664 -2.685  1.00 10.83  ? 219 ASN A CG    1 
ATOM   1813 O  OD1   . ASN A 1 222 ? 58.748 -14.982 -1.784  1.00 12.34  ? 219 ASN A OD1   1 
ATOM   1814 N  ND2   . ASN A 1 222 ? 59.851 -16.841 -2.463  1.00 11.69  ? 219 ASN A ND2   1 
ATOM   1815 N  N     . LYS A 1 223 ? 57.976 -12.417 -4.052  1.00 10.86  ? 220 LYS A N     1 
ATOM   1816 C  CA    . LYS A 1 223 ? 57.273 -11.258 -3.512  1.00 6.71   ? 220 LYS A CA    1 
ATOM   1817 C  C     . LYS A 1 223 ? 56.935 -11.385 -2.028  1.00 10.09  ? 220 LYS A C     1 
ATOM   1818 O  O     . LYS A 1 223 ? 57.077 -10.412 -1.268  1.00 11.38  ? 220 LYS A O     1 
ATOM   1819 C  CB    . LYS A 1 223 ? 55.992 -11.012 -4.316  1.00 11.32  ? 220 LYS A CB    1 
ATOM   1820 C  CG    . LYS A 1 223 ? 56.246 -10.537 -5.748  1.00 14.41  ? 220 LYS A CG    1 
ATOM   1821 C  CD    . LYS A 1 223 ? 55.011 -10.694 -6.647  1.00 24.12  ? 220 LYS A CD    1 
ATOM   1822 C  CE    . LYS A 1 223 ? 53.944 -9.674  -6.384  1.00 25.71  ? 220 LYS A CE    1 
ATOM   1823 N  NZ    . LYS A 1 223 ? 52.809 -9.865  -7.359  1.00 18.79  ? 220 LYS A NZ    1 
ATOM   1824 N  N     . VAL A 1 224 ? 56.467 -12.562 -1.603  1.00 11.68  ? 221 VAL A N     1 
ATOM   1825 C  CA    . VAL A 1 224 ? 56.068 -12.717 -0.205  1.00 8.39   ? 221 VAL A CA    1 
ATOM   1826 C  C     . VAL A 1 224 ? 57.262 -12.554 0.736   1.00 10.71  ? 221 VAL A C     1 
ATOM   1827 O  O     . VAL A 1 224 ? 57.174 -11.857 1.761   1.00 13.09  ? 221 VAL A O     1 
ATOM   1828 C  CB    . VAL A 1 224 ? 55.363 -14.048 0.059   1.00 12.71  ? 221 VAL A CB    1 
ATOM   1829 C  CG1   . VAL A 1 224 ? 55.285 -14.331 1.558   1.00 17.41  ? 221 VAL A CG1   1 
ATOM   1830 C  CG2   . VAL A 1 224 ? 53.976 -14.014 -0.544  1.00 15.99  ? 221 VAL A CG2   1 
ATOM   1831 N  N     . LEU A 1 225 ? 58.392 -13.165 0.387   1.00 10.78  ? 222 LEU A N     1 
ATOM   1832 C  CA    . LEU A 1 225 ? 59.587 -12.978 1.209   1.00 5.93   ? 222 LEU A CA    1 
ATOM   1833 C  C     . LEU A 1 225 ? 60.155 -11.551 1.131   1.00 9.73   ? 222 LEU A C     1 
ATOM   1834 O  O     . LEU A 1 225 ? 60.652 -11.011 2.126   1.00 11.15  ? 222 LEU A O     1 
ATOM   1835 C  CB    . LEU A 1 225 ? 60.684 -13.989 0.847   1.00 10.25  ? 222 LEU A CB    1 
ATOM   1836 C  CG    . LEU A 1 225 ? 60.429 -15.448 1.242   1.00 11.82  ? 222 LEU A CG    1 
ATOM   1837 C  CD1   . LEU A 1 225 ? 61.615 -16.336 0.818   1.00 12.76  ? 222 LEU A CD1   1 
ATOM   1838 C  CD2   . LEU A 1 225 ? 60.150 -15.558 2.740   1.00 12.41  ? 222 LEU A CD2   1 
ATOM   1839 N  N     . ALA A 1 226 ? 60.082 -10.910 -0.035  1.00 9.90   ? 223 ALA A N     1 
ATOM   1840 C  CA    . ALA A 1 226 ? 60.558 -9.537  -0.117  1.00 5.10   ? 223 ALA A CA    1 
ATOM   1841 C  C     . ALA A 1 226 ? 59.712 -8.600  0.746   1.00 10.51  ? 223 ALA A C     1 
ATOM   1842 O  O     . ALA A 1 226 ? 60.254 -7.696  1.398   1.00 11.30  ? 223 ALA A O     1 
ATOM   1843 C  CB    . ALA A 1 226 ? 60.580 -9.071  -1.557  1.00 11.70  ? 223 ALA A CB    1 
ATOM   1844 N  N     . LYS A 1 227 ? 58.389 -8.804  0.741   1.00 10.75  ? 224 LYS A N     1 
ATOM   1845 C  CA    . LYS A 1 227 ? 57.479 -8.026  1.573   1.00 7.91   ? 224 LYS A CA    1 
ATOM   1846 C  C     . LYS A 1 227 ? 57.772 -8.246  3.063   1.00 11.41  ? 224 LYS A C     1 
ATOM   1847 O  O     . LYS A 1 227 ? 57.863 -7.290  3.843   1.00 13.35  ? 224 LYS A O     1 
ATOM   1848 C  CB    . LYS A 1 227 ? 56.026 -8.374  1.225   1.00 12.68  ? 224 LYS A CB    1 
ATOM   1849 C  CG    A LYS A 1 227 ? 55.004 -7.711  2.133   0.50 16.60  ? 224 LYS A CG    1 
ATOM   1850 C  CG    B LYS A 1 227 ? 54.987 -7.731  2.136   0.50 16.66  ? 224 LYS A CG    1 
ATOM   1851 C  CD    A LYS A 1 227 ? 55.105 -6.200  2.060   0.50 20.88  ? 224 LYS A CD    1 
ATOM   1852 C  CD    B LYS A 1 227 ? 55.113 -6.221  2.134   0.50 22.40  ? 224 LYS A CD    1 
ATOM   1853 C  CE    A LYS A 1 227 ? 54.131 -5.562  3.027   0.50 26.64  ? 224 LYS A CE    1 
ATOM   1854 C  CE    B LYS A 1 227 ? 54.067 -5.586  3.035   0.50 27.89  ? 224 LYS A CE    1 
ATOM   1855 N  NZ    A LYS A 1 227 ? 52.788 -6.170  2.876   0.50 25.52  ? 224 LYS A NZ    1 
ATOM   1856 N  NZ    B LYS A 1 227 ? 54.347 -4.139  3.240   0.50 25.88  ? 224 LYS A NZ    1 
ATOM   1857 N  N     . LEU A 1 228 ? 57.953 -9.508  3.455   1.00 10.56  ? 225 LEU A N     1 
ATOM   1858 C  CA    . LEU A 1 228 ? 58.292 -9.822  4.836   1.00 7.18   ? 225 LEU A CA    1 
ATOM   1859 C  C     . LEU A 1 228 ? 59.623 -9.193  5.224   1.00 12.30  ? 225 LEU A C     1 
ATOM   1860 O  O     . LEU A 1 228 ? 59.731 -8.538  6.276   1.00 14.22  ? 225 LEU A O     1 
ATOM   1861 C  CB    . LEU A 1 228 ? 58.348 -11.337 5.020   1.00 13.15  ? 225 LEU A CB    1 
ATOM   1862 C  CG    . LEU A 1 228 ? 58.524 -11.823 6.463   1.00 14.35  ? 225 LEU A CG    1 
ATOM   1863 C  CD1   . LEU A 1 228 ? 57.278 -11.484 7.273   1.00 16.03  ? 225 LEU A CD1   1 
ATOM   1864 C  CD2   . LEU A 1 228 ? 58.792 -13.316 6.507   1.00 16.07  ? 225 LEU A CD2   1 
ATOM   1865 N  N     . ALA A 1 229 ? 60.635 -9.376  4.374   1.00 11.40  ? 226 ALA A N     1 
ATOM   1866 C  CA    . ALA A 1 229 ? 61.949 -8.776  4.592   1.00 7.85   ? 226 ALA A CA    1 
ATOM   1867 C  C     . ALA A 1 229 ? 61.870 -7.271  4.817   1.00 12.87  ? 226 ALA A C     1 
ATOM   1868 O  O     . ALA A 1 229 ? 62.533 -6.732  5.697   1.00 13.47  ? 226 ALA A O     1 
ATOM   1869 C  CB    . ALA A 1 229 ? 62.869 -9.079  3.401   1.00 11.62  ? 226 ALA A CB    1 
ATOM   1870 N  N     . CYS A 1 230 ? 61.070 -6.581  4.005   1.00 10.96  ? 227 CYS A N     1 
ATOM   1871 C  CA    . CYS A 1 230 ? 61.016 -5.134  4.064   1.00 6.32   ? 227 CYS A CA    1 
ATOM   1872 C  C     . CYS A 1 230 ? 60.642 -4.629  5.452   1.00 12.63  ? 227 CYS A C     1 
ATOM   1873 O  O     . CYS A 1 230 ? 61.218 -3.646  5.940   1.00 16.46  ? 227 CYS A O     1 
ATOM   1874 C  CB    . CYS A 1 230 ? 59.991 -4.651  3.044   1.00 10.75  ? 227 CYS A CB    1 
ATOM   1875 S  SG    . CYS A 1 230 ? 59.929 -2.837  2.888   1.00 14.09  ? 227 CYS A SG    1 
ATOM   1876 N  N     . GLY A 1 231 ? 59.702 -5.316  6.102   1.00 12.92  ? 228 GLY A N     1 
ATOM   1877 C  CA    . GLY A 1 231 ? 59.235 -4.880  7.411   1.00 11.58  ? 228 GLY A CA    1 
ATOM   1878 C  C     . GLY A 1 231 ? 60.166 -5.178  8.573   1.00 17.68  ? 228 GLY A C     1 
ATOM   1879 O  O     . GLY A 1 231 ? 59.936 -4.717  9.695   1.00 19.10  ? 228 GLY A O     1 
ATOM   1880 N  N     . LEU A 1 232 ? 61.221 -5.944  8.332   1.00 13.38  ? 229 LEU A N     1 
ATOM   1881 C  CA    . LEU A 1 232 ? 62.062 -6.387  9.440   1.00 9.91   ? 229 LEU A CA    1 
ATOM   1882 C  C     . LEU A 1 232 ? 62.936 -5.274  10.012  1.00 13.71  ? 229 LEU A C     1 
ATOM   1883 O  O     . LEU A 1 232 ? 63.303 -5.308  11.197  1.00 17.03  ? 229 LEU A O     1 
ATOM   1884 C  CB    . LEU A 1 232 ? 62.925 -7.568  8.999   1.00 14.18  ? 229 LEU A CB    1 
ATOM   1885 C  CG    . LEU A 1 232 ? 62.138 -8.831  8.620   1.00 16.99  ? 229 LEU A CG    1 
ATOM   1886 C  CD1   . LEU A 1 232 ? 63.072 -9.961  8.197   1.00 15.94  ? 229 LEU A CD1   1 
ATOM   1887 C  CD2   . LEU A 1 232 ? 61.243 -9.257  9.784   1.00 21.98  ? 229 LEU A CD2   1 
ATOM   1888 N  N     . ASN A 1 233 ? 63.286 -4.294  9.183   1.00 12.65  ? 230 ASN A N     1 
ATOM   1889 C  CA    . ASN A 1 233 ? 64.143 -3.207  9.624   1.00 10.12  ? 230 ASN A CA    1 
ATOM   1890 C  C     . ASN A 1 233 ? 63.653 -1.927  8.968   1.00 18.46  ? 230 ASN A C     1 
ATOM   1891 O  O     . ASN A 1 233 ? 64.053 -1.577  7.854   1.00 26.19  ? 230 ASN A O     1 
ATOM   1892 C  CB    . ASN A 1 233 ? 65.617 -3.488  9.298   1.00 13.16  ? 230 ASN A CB    1 
ATOM   1893 C  CG    . ASN A 1 233 ? 66.159 -4.714  10.031  1.00 14.66  ? 230 ASN A CG    1 
ATOM   1894 O  OD1   . ASN A 1 233 ? 66.500 -4.636  11.223  1.00 17.25  ? 230 ASN A OD1   1 
ATOM   1895 N  ND2   . ASN A 1 233 ? 66.276 -5.839  9.323   1.00 15.16  ? 230 ASN A ND2   1 
ATOM   1896 N  N     . LYS A 1 234 ? 62.723 -1.277  9.648   1.00 26.08  ? 231 LYS A N     1 
ATOM   1897 C  CA    . LYS A 1 234 ? 62.154 -0.018  9.194   1.00 15.70  ? 231 LYS A CA    1 
ATOM   1898 C  C     . LYS A 1 234 ? 62.443 0.960   10.306  1.00 24.65  ? 231 LYS A C     1 
ATOM   1899 O  O     . LYS A 1 234 ? 62.553 0.569   11.473  1.00 32.03  ? 231 LYS A O     1 
ATOM   1900 C  CB    . LYS A 1 234 ? 60.640 -0.153  9.008   1.00 24.49  ? 231 LYS A CB    1 
ATOM   1901 C  CG    . LYS A 1 234 ? 60.167 -0.446  7.584   1.00 26.76  ? 231 LYS A CG    1 
ATOM   1902 C  CD    . LYS A 1 234 ? 58.763 0.173   7.356   1.00 31.71  ? 231 LYS A CD    1 
ATOM   1903 C  CE    . LYS A 1 234 ? 58.306 0.165   5.883   1.00 30.86  ? 231 LYS A CE    1 
ATOM   1904 N  NZ    . LYS A 1 234 ? 58.354 1.525   5.211   1.00 19.13  ? 231 LYS A NZ    1 
ATOM   1905 N  N     . PRO A 1 235 ? 62.588 2.238   9.972   1.00 17.44  ? 232 PRO A N     1 
ATOM   1906 C  CA    . PRO A 1 235 ? 62.511 2.817   8.631   1.00 12.73  ? 232 PRO A CA    1 
ATOM   1907 C  C     . PRO A 1 235 ? 63.899 3.009   8.031   1.00 14.37  ? 232 PRO A C     1 
ATOM   1908 O  O     . PRO A 1 235 ? 64.922 2.813   8.705   1.00 17.05  ? 232 PRO A O     1 
ATOM   1909 C  CB    . PRO A 1 235 ? 61.931 4.190   8.918   1.00 17.29  ? 232 PRO A CB    1 
ATOM   1910 C  CG    . PRO A 1 235 ? 62.601 4.580   10.233  1.00 21.71  ? 232 PRO A CG    1 
ATOM   1911 C  CD    . PRO A 1 235 ? 62.724 3.279   11.009  1.00 20.86  ? 232 PRO A CD    1 
ATOM   1912 N  N     . ASN A 1 236 ? 63.921 3.411   6.762   1.00 13.08  ? 233 ASN A N     1 
ATOM   1913 C  CA    . ASN A 1 236 ? 65.157 3.833   6.097   1.00 8.81   ? 233 ASN A CA    1 
ATOM   1914 C  C     . ASN A 1 236 ? 66.260 2.785   6.058   1.00 11.18  ? 233 ASN A C     1 
ATOM   1915 O  O     . ASN A 1 236 ? 67.445 3.120   6.124   1.00 13.62  ? 233 ASN A O     1 
ATOM   1916 C  CB    . ASN A 1 236 ? 65.691 5.133   6.719   1.00 15.50  ? 233 ASN A CB    1 
ATOM   1917 C  CG    . ASN A 1 236 ? 66.708 5.829   5.830   1.00 16.64  ? 233 ASN A CG    1 
ATOM   1918 O  OD1   . ASN A 1 236 ? 66.617 5.757   4.611   1.00 17.32  ? 233 ASN A OD1   1 
ATOM   1919 N  ND2   . ASN A 1 236 ? 67.683 6.499   6.441   1.00 20.46  ? 233 ASN A ND2   1 
ATOM   1920 N  N     . ARG A 1 237 ? 65.861 1.519   5.935   1.00 10.71  ? 234 ARG A N     1 
ATOM   1921 C  CA    . ARG A 1 237 ? 66.807 0.420   5.874   1.00 7.56   ? 234 ARG A CA    1 
ATOM   1922 C  C     . ARG A 1 237 ? 66.265 -0.613  4.919   1.00 12.18  ? 234 ARG A C     1 
ATOM   1923 O  O     . ARG A 1 237 ? 65.081 -0.584  4.557   1.00 12.78  ? 234 ARG A O     1 
ATOM   1924 C  CB    . ARG A 1 237 ? 67.033 -0.211  7.259   1.00 14.57  ? 234 ARG A CB    1 
ATOM   1925 C  CG    . ARG A 1 237 ? 67.676 0.708   8.292   1.00 14.77  ? 234 ARG A CG    1 
ATOM   1926 C  CD    . ARG A 1 237 ? 69.126 1.015   7.925   1.00 19.89  ? 234 ARG A CD    1 
ATOM   1927 N  NE    . ARG A 1 237 ? 69.829 1.763   8.977   1.00 24.05  ? 234 ARG A NE    1 
ATOM   1928 C  CZ    . ARG A 1 237 ? 69.894 3.092   9.038   1.00 24.70  ? 234 ARG A CZ    1 
ATOM   1929 N  NH1   . ARG A 1 237 ? 69.299 3.843   8.115   1.00 24.30  ? 234 ARG A NH1   1 
ATOM   1930 N  NH2   . ARG A 1 237 ? 70.559 3.680   10.028  1.00 28.91  ? 234 ARG A NH2   1 
ATOM   1931 N  N     . GLN A 1 238 ? 67.137 -1.502  4.459   1.00 10.74  ? 235 GLN A N     1 
ATOM   1932 C  CA    . GLN A 1 238 ? 66.692 -2.607  3.629   1.00 6.12   ? 235 GLN A CA    1 
ATOM   1933 C  C     . GLN A 1 238 ? 67.211 -3.925  4.188   1.00 11.16  ? 235 GLN A C     1 
ATOM   1934 O  O     . GLN A 1 238 ? 68.245 -3.978  4.872   1.00 13.01  ? 235 GLN A O     1 
ATOM   1935 C  CB    . GLN A 1 238 ? 67.128 -2.428  2.174   1.00 11.12  ? 235 GLN A CB    1 
ATOM   1936 C  CG    . GLN A 1 238 ? 68.625 -2.236  1.993   1.00 13.69  ? 235 GLN A CG    1 
ATOM   1937 C  CD    . GLN A 1 238 ? 69.005 -1.965  0.535   1.00 14.29  ? 235 GLN A CD    1 
ATOM   1938 O  OE1   . GLN A 1 238 ? 68.624 -0.941  -0.056  1.00 17.01  ? 235 GLN A OE1   1 
ATOM   1939 N  NE2   . GLN A 1 238 ? 69.744 -2.889  -0.054  1.00 13.62  ? 235 GLN A NE2   1 
ATOM   1940 N  N     . THR A 1 239 ? 66.509 -5.012  3.887   1.00 10.06  ? 236 THR A N     1 
ATOM   1941 C  CA    . THR A 1 239 ? 66.812 -6.303  4.479   1.00 7.49   ? 236 THR A CA    1 
ATOM   1942 C  C     . THR A 1 239 ? 66.841 -7.370  3.401   1.00 11.50  ? 236 THR A C     1 
ATOM   1943 O  O     . THR A 1 239 ? 65.928 -7.456  2.575   1.00 12.49  ? 236 THR A O     1 
ATOM   1944 C  CB    . THR A 1 239 ? 65.772 -6.688  5.527   1.00 10.34  ? 236 THR A CB    1 
ATOM   1945 O  OG1   . THR A 1 239 ? 65.694 -5.658  6.523   1.00 13.48  ? 236 THR A OG1   1 
ATOM   1946 C  CG2   . THR A 1 239 ? 66.144 -8.001  6.234   1.00 12.81  ? 236 THR A CG2   1 
ATOM   1947 N  N     . LEU A 1 240 ? 67.893 -8.191  3.423   1.00 10.47  ? 237 LEU A N     1 
ATOM   1948 C  CA    . LEU A 1 240 ? 68.050 -9.317  2.516   1.00 6.22   ? 237 LEU A CA    1 
ATOM   1949 C  C     . LEU A 1 240 ? 67.674 -10.589 3.272   1.00 10.87  ? 237 LEU A C     1 
ATOM   1950 O  O     . LEU A 1 240 ? 68.256 -10.885 4.326   1.00 12.59  ? 237 LEU A O     1 
ATOM   1951 C  CB    . LEU A 1 240 ? 69.496 -9.377  2.036   1.00 11.57  ? 237 LEU A CB    1 
ATOM   1952 C  CG    . LEU A 1 240 ? 69.889 -10.400 0.970   1.00 11.62  ? 237 LEU A CG    1 
ATOM   1953 C  CD1   . LEU A 1 240 ? 71.216 -10.012 0.321   1.00 15.66  ? 237 LEU A CD1   1 
ATOM   1954 C  CD2   . LEU A 1 240 ? 70.009 -11.789 1.566   1.00 13.80  ? 237 LEU A CD2   1 
ATOM   1955 N  N     . VAL A 1 241 ? 66.678 -11.321 2.755   1.00 10.19  ? 238 VAL A N     1 
ATOM   1956 C  CA    . VAL A 1 241 ? 66.263 -12.609 3.299   1.00 7.93   ? 238 VAL A CA    1 
ATOM   1957 C  C     . VAL A 1 241 ? 66.647 -13.682 2.300   1.00 11.80  ? 238 VAL A C     1 
ATOM   1958 O  O     . VAL A 1 241 ? 66.067 -13.771 1.212   1.00 12.79  ? 238 VAL A O     1 
ATOM   1959 C  CB    . VAL A 1 241 ? 64.763 -12.628 3.555   1.00 11.41  ? 238 VAL A CB    1 
ATOM   1960 C  CG1   . VAL A 1 241 ? 64.229 -14.078 3.763   1.00 12.89  ? 238 VAL A CG1   1 
ATOM   1961 C  CG2   . VAL A 1 241 ? 64.450 -11.767 4.778   1.00 13.32  ? 238 VAL A CG2   1 
ATOM   1962 N  N     . SER A 1 242 ? 67.668 -14.466 2.649   1.00 10.00  ? 239 SER A N     1 
ATOM   1963 C  CA    . SER A 1 242 ? 68.138 -15.515 1.774   1.00 7.83   ? 239 SER A CA    1 
ATOM   1964 C  C     . SER A 1 242 ? 67.280 -16.766 1.916   1.00 11.50  ? 239 SER A C     1 
ATOM   1965 O  O     . SER A 1 242 ? 66.523 -16.928 2.876   1.00 11.65  ? 239 SER A O     1 
ATOM   1966 C  CB    . SER A 1 242 ? 69.579 -15.868 2.127   1.00 15.88  ? 239 SER A CB    1 
ATOM   1967 O  OG    . SER A 1 242 ? 69.607 -16.378 3.449   1.00 16.86  ? 239 SER A OG    1 
ATOM   1968 N  N     . HIS A 1 243 ? 67.391 -17.670 0.951   1.00 11.48  ? 240 HIS A N     1 
ATOM   1969 C  CA    . HIS A 1 243 ? 66.671 -18.928 1.061   1.00 7.83   ? 240 HIS A CA    1 
ATOM   1970 C  C     . HIS A 1 243 ? 67.064 -19.658 2.341   1.00 11.88  ? 240 HIS A C     1 
ATOM   1971 O  O     . HIS A 1 243 ? 66.200 -20.215 3.035   1.00 13.42  ? 240 HIS A O     1 
ATOM   1972 C  CB    . HIS A 1 243 ? 66.924 -19.815 -0.160  1.00 13.05  ? 240 HIS A CB    1 
ATOM   1973 C  CG    . HIS A 1 243 ? 66.144 -21.093 -0.141  1.00 14.16  ? 240 HIS A CG    1 
ATOM   1974 N  ND1   . HIS A 1 243 ? 64.789 -21.147 -0.371  1.00 18.41  ? 240 HIS A ND1   1 
ATOM   1975 C  CD2   . HIS A 1 243 ? 66.534 -22.366 0.114   1.00 20.48  ? 240 HIS A CD2   1 
ATOM   1976 C  CE1   . HIS A 1 243 ? 64.376 -22.400 -0.283  1.00 19.33  ? 240 HIS A CE1   1 
ATOM   1977 N  NE2   . HIS A 1 243 ? 65.419 -23.159 0.015   1.00 21.03  ? 240 HIS A NE2   1 
ATOM   1978 N  N     . GLY A 1 244 ? 68.355 -19.635 2.661   1.00 11.00  ? 241 GLY A N     1 
ATOM   1979 C  CA    . GLY A 1 244 ? 68.847 -20.355 3.826   1.00 11.74  ? 241 GLY A CA    1 
ATOM   1980 C  C     . GLY A 1 244 ? 68.362 -19.787 5.142   1.00 12.89  ? 241 GLY A C     1 
ATOM   1981 O  O     . GLY A 1 244 ? 68.332 -20.507 6.136   1.00 14.97  ? 241 GLY A O     1 
ATOM   1982 N  N     . SER A 1 245 ? 67.989 -18.506 5.157   1.00 11.10  ? 242 SER A N     1 
ATOM   1983 C  CA    . SER A 1 245 ? 67.473 -17.869 6.380   1.00 9.01   ? 242 SER A CA    1 
ATOM   1984 C  C     . SER A 1 245 ? 66.059 -18.298 6.748   1.00 11.68  ? 242 SER A C     1 
ATOM   1985 O  O     . SER A 1 245 ? 65.599 -18.046 7.863   1.00 12.78  ? 242 SER A O     1 
ATOM   1986 C  CB    . SER A 1 245 ? 67.533 -16.346 6.272   1.00 12.72  ? 242 SER A CB    1 
ATOM   1987 O  OG    . SER A 1 245 ? 66.463 -15.860 5.461   1.00 13.63  ? 242 SER A OG    1 
ATOM   1988 N  N     . VAL A 1 246 ? 65.367 -18.931 5.807   1.00 11.29  ? 243 VAL A N     1 
ATOM   1989 C  CA    . VAL A 1 246 ? 63.947 -19.216 5.983   1.00 8.34   ? 243 VAL A CA    1 
ATOM   1990 C  C     . VAL A 1 246 ? 63.588 -20.138 7.173   1.00 10.81  ? 243 VAL A C     1 
ATOM   1991 O  O     . VAL A 1 246 ? 62.711 -19.792 7.968   1.00 12.03  ? 243 VAL A O     1 
ATOM   1992 C  CB    . VAL A 1 246 ? 63.316 -19.676 4.661   1.00 12.01  ? 243 VAL A CB    1 
ATOM   1993 C  CG1   . VAL A 1 246 ? 61.878 -20.150 4.877   1.00 13.61  ? 243 VAL A CG1   1 
ATOM   1994 C  CG2   . VAL A 1 246 ? 63.337 -18.512 3.671   1.00 13.47  ? 243 VAL A CG2   1 
ATOM   1995 N  N     . PRO A 1 247 ? 64.254 -21.298 7.315   1.00 10.82  ? 244 PRO A N     1 
ATOM   1996 C  CA    . PRO A 1 247 ? 63.825 -22.161 8.424   1.00 8.50   ? 244 PRO A CA    1 
ATOM   1997 C  C     . PRO A 1 247 ? 63.874 -21.452 9.789   1.00 11.91  ? 244 PRO A C     1 
ATOM   1998 O  O     . PRO A 1 247 ? 62.917 -21.551 10.565  1.00 13.00  ? 244 PRO A O     1 
ATOM   1999 C  CB    . PRO A 1 247 ? 64.816 -23.323 8.363   1.00 11.65  ? 244 PRO A CB    1 
ATOM   2000 C  CG    . PRO A 1 247 ? 65.142 -23.432 6.862   1.00 11.48  ? 244 PRO A CG    1 
ATOM   2001 C  CD    . PRO A 1 247 ? 65.209 -21.980 6.409   1.00 11.16  ? 244 PRO A CD    1 
ATOM   2002 N  N     . GLN A 1 248 ? 64.958 -20.742 10.088  1.00 10.47  ? 245 GLN A N     1 
ATOM   2003 C  CA    . GLN A 1 248 ? 65.027 -20.066 11.377  1.00 10.94  ? 245 GLN A CA    1 
ATOM   2004 C  C     . GLN A 1 248 ? 64.012 -18.939 11.474  1.00 12.50  ? 245 GLN A C     1 
ATOM   2005 O  O     . GLN A 1 248 ? 63.303 -18.804 12.483  1.00 12.09  ? 245 GLN A O     1 
ATOM   2006 C  CB    . GLN A 1 248 ? 66.443 -19.560 11.659  1.00 14.10  ? 245 GLN A CB    1 
ATOM   2007 C  CG    . GLN A 1 248 ? 67.416 -20.700 11.982  1.00 22.26  ? 245 GLN A CG    1 
ATOM   2008 C  CD    . GLN A 1 248 ? 68.493 -20.309 12.979  1.00 32.66  ? 245 GLN A CD    1 
ATOM   2009 O  OE1   . GLN A 1 248 ? 68.218 -20.173 14.172  1.00 39.33  ? 245 GLN A OE1   1 
ATOM   2010 N  NE2   . GLN A 1 248 ? 69.733 -20.146 12.499  1.00 29.93  ? 245 GLN A NE2   1 
ATOM   2011 N  N     . LEU A 1 249 ? 63.928 -18.130 10.415  1.00 11.02  ? 246 LEU A N     1 
ATOM   2012 C  CA    . LEU A 1 249 ? 62.987 -17.014 10.381  1.00 9.33   ? 246 LEU A CA    1 
ATOM   2013 C  C     . LEU A 1 249 ? 61.550 -17.491 10.571  1.00 9.71   ? 246 LEU A C     1 
ATOM   2014 O  O     . LEU A 1 249 ? 60.771 -16.902 11.334  1.00 13.99  ? 246 LEU A O     1 
ATOM   2015 C  CB    . LEU A 1 249 ? 63.126 -16.287 9.046   1.00 13.73  ? 246 LEU A CB    1 
ATOM   2016 C  CG    . LEU A 1 249 ? 62.215 -15.080 8.860   1.00 13.55  ? 246 LEU A CG    1 
ATOM   2017 C  CD1   . LEU A 1 249 ? 62.561 -14.007 9.883   1.00 13.94  ? 246 LEU A CD1   1 
ATOM   2018 C  CD2   . LEU A 1 249 ? 62.362 -14.561 7.434   1.00 15.64  ? 246 LEU A CD2   1 
ATOM   2019 N  N     . PHE A 1 250 ? 61.186 -18.572 9.895   1.00 9.97   ? 247 PHE A N     1 
ATOM   2020 C  CA    . PHE A 1 250 ? 59.808 -19.027 9.966   1.00 8.50   ? 247 PHE A CA    1 
ATOM   2021 C  C     . PHE A 1 250 ? 59.480 -19.781 11.250  1.00 11.17  ? 247 PHE A C     1 
ATOM   2022 O  O     . PHE A 1 250 ? 58.305 -19.961 11.584  1.00 12.66  ? 247 PHE A O     1 
ATOM   2023 C  CB    . PHE A 1 250 ? 59.493 -19.901 8.752   1.00 10.56  ? 247 PHE A CB    1 
ATOM   2024 C  CG    . PHE A 1 250 ? 59.102 -19.121 7.522   1.00 10.12  ? 247 PHE A CG    1 
ATOM   2025 C  CD1   . PHE A 1 250 ? 58.564 -19.786 6.439   1.00 12.87  ? 247 PHE A CD1   1 
ATOM   2026 C  CD2   . PHE A 1 250 ? 59.262 -17.741 7.455   1.00 12.66  ? 247 PHE A CD2   1 
ATOM   2027 C  CE1   . PHE A 1 250 ? 58.184 -19.106 5.295   1.00 12.02  ? 247 PHE A CE1   1 
ATOM   2028 C  CE2   . PHE A 1 250 ? 58.877 -17.042 6.303   1.00 12.50  ? 247 PHE A CE2   1 
ATOM   2029 C  CZ    . PHE A 1 250 ? 58.332 -17.734 5.227   1.00 12.09  ? 247 PHE A CZ    1 
ATOM   2030 N  N     . SER A 1 251 ? 60.513 -20.224 11.974  1.00 9.97   ? 248 SER A N     1 
ATOM   2031 C  CA    . SER A 1 251 ? 60.299 -21.083 13.132  1.00 9.32   ? 248 SER A CA    1 
ATOM   2032 C  C     . SER A 1 251 ? 59.567 -20.366 14.267  1.00 12.30  ? 248 SER A C     1 
ATOM   2033 O  O     . SER A 1 251 ? 58.902 -21.019 15.054  1.00 12.97  ? 248 SER A O     1 
ATOM   2034 C  CB    . SER A 1 251 ? 61.620 -21.676 13.635  1.00 12.19  ? 248 SER A CB    1 
ATOM   2035 O  OG    . SER A 1 251 ? 62.409 -20.710 14.308  1.00 12.84  ? 248 SER A OG    1 
ATOM   2036 N  N     . GLN A 1 252 ? 59.665 -19.037 14.328  1.00 12.86  ? 249 GLN A N     1 
ATOM   2037 C  CA    . GLN A 1 252 ? 58.939 -18.268 15.336  1.00 11.35  ? 249 GLN A CA    1 
ATOM   2038 C  C     . GLN A 1 252 ? 58.072 -17.168 14.728  1.00 15.47  ? 249 GLN A C     1 
ATOM   2039 O  O     . GLN A 1 252 ? 57.721 -16.203 15.412  1.00 16.24  ? 249 GLN A O     1 
ATOM   2040 C  CB    . GLN A 1 252 ? 59.907 -17.625 16.317  1.00 19.08  ? 249 GLN A CB    1 
ATOM   2041 C  CG    . GLN A 1 252 ? 60.810 -18.587 17.032  1.00 21.13  ? 249 GLN A CG    1 
ATOM   2042 C  CD    . GLN A 1 252 ? 61.584 -17.874 18.112  1.00 20.07  ? 249 GLN A CD    1 
ATOM   2043 O  OE1   . GLN A 1 252 ? 61.102 -17.732 19.235  1.00 25.71  ? 249 GLN A OE1   1 
ATOM   2044 N  NE2   . GLN A 1 252 ? 62.761 -17.370 17.765  1.00 20.53  ? 249 GLN A NE2   1 
ATOM   2045 N  N     . MET A 1 253 ? 57.745 -17.303 13.448  1.00 12.18  ? 250 MET A N     1 
ATOM   2046 C  CA    . MET A 1 253 ? 57.022 -16.259 12.726  1.00 9.25   ? 250 MET A CA    1 
ATOM   2047 C  C     . MET A 1 253 ? 55.543 -16.558 12.771  1.00 11.31  ? 250 MET A C     1 
ATOM   2048 O  O     . MET A 1 253 ? 55.090 -17.542 12.202  1.00 11.97  ? 250 MET A O     1 
ATOM   2049 C  CB    . MET A 1 253 ? 57.482 -16.204 11.262  1.00 13.04  ? 250 MET A CB    1 
ATOM   2050 C  CG    . MET A 1 253 ? 56.825 -15.092 10.430  1.00 14.52  ? 250 MET A CG    1 
ATOM   2051 S  SD    . MET A 1 253 ? 57.239 -13.429 10.985  1.00 17.81  ? 250 MET A SD    1 
ATOM   2052 C  CE    . MET A 1 253 ? 58.999 -13.335 10.624  1.00 17.26  ? 250 MET A CE    1 
ATOM   2053 N  N     . PRO A 1 254 ? 54.767 -15.715 13.453  1.00 11.22  ? 251 PRO A N     1 
ATOM   2054 C  CA    . PRO A 1 254 ? 53.324 -15.944 13.442  1.00 12.08  ? 251 PRO A CA    1 
ATOM   2055 C  C     . PRO A 1 254 ? 52.785 -15.991 12.023  1.00 12.51  ? 251 PRO A C     1 
ATOM   2056 O  O     . PRO A 1 254 ? 53.178 -15.191 11.165  1.00 12.64  ? 251 PRO A O     1 
ATOM   2057 C  CB    . PRO A 1 254 ? 52.769 -14.720 14.192  1.00 13.68  ? 251 PRO A CB    1 
ATOM   2058 C  CG    . PRO A 1 254 ? 53.894 -14.297 15.060  1.00 15.46  ? 251 PRO A CG    1 
ATOM   2059 C  CD    . PRO A 1 254 ? 55.128 -14.506 14.202  1.00 12.98  ? 251 PRO A CD    1 
ATOM   2060 N  N     . ILE A 1 255 ? 51.878 -16.931 11.791  1.00 12.28  ? 252 ILE A N     1 
ATOM   2061 C  CA    . ILE A 1 255 ? 51.265 -17.128 10.491  1.00 10.73  ? 252 ILE A CA    1 
ATOM   2062 C  C     . ILE A 1 255 ? 50.674 -15.823 9.929   1.00 12.20  ? 252 ILE A C     1 
ATOM   2063 O  O     . ILE A 1 255 ? 50.814 -15.546 8.736   1.00 12.97  ? 252 ILE A O     1 
ATOM   2064 C  CB    . ILE A 1 255 ? 50.259 -18.300 10.548  1.00 13.65  ? 252 ILE A CB    1 
ATOM   2065 C  CG1   . ILE A 1 255 ? 51.048 -19.620 10.563  1.00 20.08  ? 252 ILE A CG1   1 
ATOM   2066 C  CG2   . ILE A 1 255 ? 49.278 -18.246 9.369   1.00 15.49  ? 252 ILE A CG2   1 
ATOM   2067 C  CD1   . ILE A 1 255 ? 50.300 -20.804 11.116  1.00 21.71  ? 252 ILE A CD1   1 
ATOM   2068 N  N     . ARG A 1 256 ? 50.078 -14.994 10.791  1.00 12.30  ? 253 ARG A N     1 
ATOM   2069 C  CA    . ARG A 1 256 ? 49.389 -13.801 10.313  1.00 10.52  ? 253 ARG A CA    1 
ATOM   2070 C  C     . ARG A 1 256 ? 50.334 -12.767 9.692   1.00 13.64  ? 253 ARG A C     1 
ATOM   2071 O  O     . ARG A 1 256 ? 49.871 -11.801 9.056   1.00 14.32  ? 253 ARG A O     1 
ATOM   2072 C  CB    . ARG A 1 256 ? 48.598 -13.135 11.449  1.00 16.22  ? 253 ARG A CB    1 
ATOM   2073 C  CG    . ARG A 1 256 ? 49.493 -12.592 12.554  1.00 15.41  ? 253 ARG A CG    1 
ATOM   2074 C  CD    . ARG A 1 256 ? 48.694 -11.890 13.656  1.00 18.44  ? 253 ARG A CD    1 
ATOM   2075 N  NE    . ARG A 1 256 ? 49.583 -11.432 14.725  1.00 18.20  ? 253 ARG A NE    1 
ATOM   2076 C  CZ    . ARG A 1 256 ? 49.974 -12.182 15.755  1.00 18.08  ? 253 ARG A CZ    1 
ATOM   2077 N  NH1   . ARG A 1 256 ? 49.555 -13.440 15.878  1.00 18.34  ? 253 ARG A NH1   1 
ATOM   2078 N  NH2   . ARG A 1 256 ? 50.786 -11.665 16.672  1.00 19.78  ? 253 ARG A NH2   1 
ATOM   2079 N  N     . LYS A 1 257 ? 51.639 -12.934 9.883   1.00 12.89  ? 254 LYS A N     1 
ATOM   2080 C  CA    . LYS A 1 257 ? 52.594 -11.945 9.378   1.00 10.89  ? 254 LYS A CA    1 
ATOM   2081 C  C     . LYS A 1 257 ? 52.864 -12.099 7.891   1.00 18.01  ? 254 LYS A C     1 
ATOM   2082 O  O     . LYS A 1 257 ? 53.436 -11.201 7.272   1.00 15.83  ? 254 LYS A O     1 
ATOM   2083 C  CB    . LYS A 1 257 ? 53.921 -12.023 10.130  1.00 15.20  ? 254 LYS A CB    1 
ATOM   2084 C  CG    . LYS A 1 257 ? 53.824 -11.804 11.628  1.00 17.71  ? 254 LYS A CG    1 
ATOM   2085 C  CD    . LYS A 1 257 ? 53.189 -10.471 11.978  1.00 18.52  ? 254 LYS A CD    1 
ATOM   2086 C  CE    . LYS A 1 257 ? 53.182 -10.282 13.500  1.00 25.86  ? 254 LYS A CE    1 
ATOM   2087 N  NZ    . LYS A 1 257 ? 52.679 -8.938  13.913  1.00 32.19  ? 254 LYS A NZ    1 
ATOM   2088 N  N     . ILE A 1 258 ? 52.479 -13.236 7.321   1.00 13.76  ? 255 ILE A N     1 
ATOM   2089 C  CA    . ILE A 1 258 ? 52.770 -13.510 5.913   1.00 11.14  ? 255 ILE A CA    1 
ATOM   2090 C  C     . ILE A 1 258 ? 51.631 -12.958 5.067   1.00 13.24  ? 255 ILE A C     1 
ATOM   2091 O  O     . ILE A 1 258 ? 50.447 -13.151 5.386   1.00 15.55  ? 255 ILE A O     1 
ATOM   2092 C  CB    . ILE A 1 258 ? 52.921 -15.022 5.650   1.00 13.83  ? 255 ILE A CB    1 
ATOM   2093 C  CG1   . ILE A 1 258 ? 54.318 -15.519 6.045   1.00 22.85  ? 255 ILE A CG1   1 
ATOM   2094 C  CG2   . ILE A 1 258 ? 52.685 -15.349 4.187   1.00 17.58  ? 255 ILE A CG2   1 
ATOM   2095 C  CD1   . ILE A 1 258 ? 54.723 -15.207 7.463   1.00 30.46  ? 255 ILE A CD1   1 
ATOM   2096 N  N     . ARG A 1 259 ? 51.982 -12.250 3.994   1.00 13.11  ? 256 ARG A N     1 
ATOM   2097 C  CA    . ARG A 1 259 ? 50.979 -11.591 3.172   1.00 14.12  ? 256 ARG A CA    1 
ATOM   2098 C  C     . ARG A 1 259 ? 49.933 -12.586 2.652   1.00 17.17  ? 256 ARG A C     1 
ATOM   2099 O  O     . ARG A 1 259 ? 50.288 -13.619 2.067   1.00 15.70  ? 256 ARG A O     1 
ATOM   2100 C  CB    . ARG A 1 259 ? 51.658 -10.877 2.004   1.00 19.47  ? 256 ARG A CB    1 
ATOM   2101 C  CG    . ARG A 1 259 ? 50.762 -9.862  1.311   1.00 21.46  ? 256 ARG A CG    1 
ATOM   2102 C  CD    . ARG A 1 259 ? 51.311 -9.525  -0.060  1.00 31.84  ? 256 ARG A CD    1 
ATOM   2103 N  NE    . ARG A 1 259 ? 50.883 -10.510 -1.045  1.00 43.81  ? 256 ARG A NE    1 
ATOM   2104 C  CZ    . ARG A 1 259 ? 51.490 -10.736 -2.207  1.00 52.07  ? 256 ARG A CZ    1 
ATOM   2105 N  NH1   . ARG A 1 259 ? 51.003 -11.654 -3.030  1.00 57.78  ? 256 ARG A NH1   1 
ATOM   2106 N  NH2   . ARG A 1 259 ? 52.577 -10.054 -2.547  1.00 47.09  ? 256 ARG A NH2   1 
ATOM   2107 N  N     . SER A 1 260 ? 48.661 -12.259 2.899   1.00 15.40  ? 257 SER A N     1 
ATOM   2108 C  CA    . SER A 1 260 ? 47.475 -13.040 2.516   1.00 15.16  ? 257 SER A CA    1 
ATOM   2109 C  C     . SER A 1 260 ? 46.942 -13.915 3.653   1.00 14.78  ? 257 SER A C     1 
ATOM   2110 O  O     . SER A 1 260 ? 45.822 -14.418 3.584   1.00 15.69  ? 257 SER A O     1 
ATOM   2111 C  CB    . SER A 1 260 ? 47.684 -13.860 1.230   1.00 17.90  ? 257 SER A CB    1 
ATOM   2112 O  OG    . SER A 1 260 ? 48.219 -15.147 1.494   1.00 19.58  ? 257 SER A OG    1 
ATOM   2113 N  N     . LEU A 1 261 ? 47.741 -14.061 4.705   1.00 13.33  ? 258 LEU A N     1 
ATOM   2114 C  CA    . LEU A 1 261 ? 47.350 -14.872 5.855   1.00 13.64  ? 258 LEU A CA    1 
ATOM   2115 C  C     . LEU A 1 261 ? 46.985 -14.025 7.076   1.00 13.76  ? 258 LEU A C     1 
ATOM   2116 O  O     . LEU A 1 261 ? 46.860 -14.540 8.189   1.00 13.88  ? 258 LEU A O     1 
ATOM   2117 C  CB    . LEU A 1 261 ? 48.479 -15.849 6.206   1.00 14.35  ? 258 LEU A CB    1 
ATOM   2118 C  CG    . LEU A 1 261 ? 48.818 -16.839 5.083   1.00 13.41  ? 258 LEU A CG    1 
ATOM   2119 C  CD1   . LEU A 1 261 ? 49.902 -17.779 5.552   1.00 15.48  ? 258 LEU A CD1   1 
ATOM   2120 C  CD2   . LEU A 1 261 ? 47.583 -17.631 4.623   1.00 16.00  ? 258 LEU A CD2   1 
ATOM   2121 N  N     . GLY A 1 262 ? 46.821 -12.718 6.879   1.00 14.26  ? 259 GLY A N     1 
ATOM   2122 C  CA    . GLY A 1 262 ? 46.513 -11.836 7.990   1.00 14.53  ? 259 GLY A CA    1 
ATOM   2123 C  C     . GLY A 1 262 ? 45.047 -11.775 8.393   1.00 17.80  ? 259 GLY A C     1 
ATOM   2124 O  O     . GLY A 1 262 ? 44.694 -11.055 9.337   1.00 18.32  ? 259 GLY A O     1 
ATOM   2125 N  N     . GLY A 1 263 ? 44.194 -12.515 7.683   1.00 14.54  ? 260 GLY A N     1 
ATOM   2126 C  CA    . GLY A 1 263 ? 42.762 -12.493 7.927   1.00 14.21  ? 260 GLY A CA    1 
ATOM   2127 C  C     . GLY A 1 263 ? 42.168 -13.855 8.250   1.00 18.11  ? 260 GLY A C     1 
ATOM   2128 O  O     . GLY A 1 263 ? 42.765 -14.665 8.969   1.00 17.87  ? 260 GLY A O     1 
ATOM   2129 N  N     . LYS A 1 264 ? 40.985 -14.118 7.706   1.00 20.12  ? 261 LYS A N     1 
ATOM   2130 C  CA    . LYS A 1 264 ? 40.250 -15.340 8.026   1.00 16.40  ? 261 LYS A CA    1 
ATOM   2131 C  C     . LYS A 1 264 ? 40.970 -16.634 7.633   1.00 16.62  ? 261 LYS A C     1 
ATOM   2132 O  O     . LYS A 1 264 ? 40.938 -17.619 8.384   1.00 21.06  ? 261 LYS A O     1 
ATOM   2133 C  CB    . LYS A 1 264 ? 38.851 -15.301 7.394   1.00 20.72  ? 261 LYS A CB    1 
ATOM   2134 C  CG    . LYS A 1 264 ? 37.937 -14.250 8.008   1.00 24.39  ? 261 LYS A CG    1 
ATOM   2135 C  CD    . LYS A 1 264 ? 36.583 -14.193 7.302   1.00 30.99  ? 261 LYS A CD    1 
ATOM   2136 C  CE    . LYS A 1 264 ? 35.695 -13.109 7.905   1.00 39.68  ? 261 LYS A CE    1 
ATOM   2137 N  NZ    . LYS A 1 264 ? 34.303 -13.151 7.364   1.00 41.00  ? 261 LYS A NZ    1 
ATOM   2138 N  N     . LEU A 1 265 ? 41.597 -16.659 6.457   1.00 16.46  ? 262 LEU A N     1 
ATOM   2139 C  CA    . LEU A 1 265 ? 42.299 -17.876 6.045   1.00 15.11  ? 262 LEU A CA    1 
ATOM   2140 C  C     . LEU A 1 265 ? 43.399 -18.204 7.050   1.00 15.57  ? 262 LEU A C     1 
ATOM   2141 O  O     . LEU A 1 265 ? 43.520 -19.347 7.503   1.00 18.88  ? 262 LEU A O     1 
ATOM   2142 C  CB    . LEU A 1 265 ? 42.890 -17.745 4.637   1.00 16.16  ? 262 LEU A CB    1 
ATOM   2143 C  CG    . LEU A 1 265 ? 43.816 -18.879 4.154   1.00 17.32  ? 262 LEU A CG    1 
ATOM   2144 C  CD1   . LEU A 1 265 ? 43.099 -20.235 4.157   1.00 21.29  ? 262 LEU A CD1   1 
ATOM   2145 C  CD2   . LEU A 1 265 ? 44.382 -18.592 2.773   1.00 19.26  ? 262 LEU A CD2   1 
ATOM   2146 N  N     . GLY A 1 266 ? 44.212 -17.207 7.396   1.00 15.56  ? 263 GLY A N     1 
ATOM   2147 C  CA    . GLY A 1 266 ? 45.272 -17.415 8.364   1.00 12.95  ? 263 GLY A CA    1 
ATOM   2148 C  C     . GLY A 1 266 ? 44.730 -17.892 9.704   1.00 14.51  ? 263 GLY A C     1 
ATOM   2149 O  O     . GLY A 1 266 ? 45.313 -18.783 10.336  1.00 15.24  ? 263 GLY A O     1 
ATOM   2150 N  N     . ALA A 1 267 ? 43.615 -17.309 10.138  1.00 15.89  ? 264 ALA A N     1 
ATOM   2151 C  CA    . ALA A 1 267 ? 42.996 -17.738 11.385  1.00 16.59  ? 264 ALA A CA    1 
ATOM   2152 C  C     . ALA A 1 267 ? 42.576 -19.196 11.288  1.00 14.61  ? 264 ALA A C     1 
ATOM   2153 O  O     . ALA A 1 267 ? 42.716 -19.957 12.249  1.00 16.91  ? 264 ALA A O     1 
ATOM   2154 C  CB    . ALA A 1 267 ? 41.809 -16.843 11.741  1.00 19.29  ? 264 ALA A CB    1 
ATOM   2155 N  N     . SER A 1 268 ? 42.074 -19.599 10.125  1.00 14.48  ? 265 SER A N     1 
ATOM   2156 C  CA    . SER A 1 268 ? 41.645 -20.985 9.949   1.00 16.49  ? 265 SER A CA    1 
ATOM   2157 C  C     . SER A 1 268 ? 42.827 -21.957 9.922   1.00 15.91  ? 265 SER A C     1 
ATOM   2158 O  O     . SER A 1 268 ? 42.722 -23.067 10.433  1.00 16.44  ? 265 SER A O     1 
ATOM   2159 C  CB    . SER A 1 268 ? 40.740 -21.149 8.723   1.00 21.07  ? 265 SER A CB    1 
ATOM   2160 O  OG    . SER A 1 268 ? 41.467 -21.047 7.517   1.00 29.22  ? 265 SER A OG    1 
ATOM   2161 N  N     . VAL A 1 269 ? 43.956 -21.539 9.352   1.00 14.93  ? 266 VAL A N     1 
ATOM   2162 C  CA    . VAL A 1 269 ? 45.150 -22.379 9.357   1.00 15.77  ? 266 VAL A CA    1 
ATOM   2163 C  C     . VAL A 1 269 ? 45.561 -22.680 10.801  1.00 16.11  ? 266 VAL A C     1 
ATOM   2164 O  O     . VAL A 1 269 ? 45.821 -23.827 11.177  1.00 15.52  ? 266 VAL A O     1 
ATOM   2165 C  CB    . VAL A 1 269 ? 46.319 -21.712 8.601   1.00 16.69  ? 266 VAL A CB    1 
ATOM   2166 C  CG1   . VAL A 1 269 ? 47.625 -22.464 8.863   1.00 17.95  ? 266 VAL A CG1   1 
ATOM   2167 C  CG2   . VAL A 1 269 ? 46.022 -21.643 7.105   1.00 16.84  ? 266 VAL A CG2   1 
ATOM   2168 N  N     . ILE A 1 270 ? 45.591 -21.632 11.616  1.00 14.83  ? 267 ILE A N     1 
ATOM   2169 C  CA    . ILE A 1 270 ? 45.935 -21.758 13.025  1.00 13.74  ? 267 ILE A CA    1 
ATOM   2170 C  C     . ILE A 1 270 ? 44.967 -22.686 13.764  1.00 16.50  ? 267 ILE A C     1 
ATOM   2171 O  O     . ILE A 1 270 ? 45.397 -23.579 14.511  1.00 19.75  ? 267 ILE A O     1 
ATOM   2172 C  CB    . ILE A 1 270 ? 45.956 -20.372 13.690  1.00 16.37  ? 267 ILE A CB    1 
ATOM   2173 C  CG1   . ILE A 1 270 ? 47.142 -19.560 13.162  1.00 19.51  ? 267 ILE A CG1   1 
ATOM   2174 C  CG2   . ILE A 1 270 ? 45.989 -20.503 15.208  1.00 22.10  ? 267 ILE A CG2   1 
ATOM   2175 C  CD1   . ILE A 1 270 ? 47.080 -18.085 13.495  1.00 22.95  ? 267 ILE A CD1   1 
ATOM   2176 N  N     . GLU A 1 271 ? 43.668 -22.494 13.534  1.00 15.63  ? 268 GLU A N     1 
ATOM   2177 C  CA    . GLU A 1 271 ? 42.642 -23.223 14.283  1.00 16.82  ? 268 GLU A CA    1 
ATOM   2178 C  C     . GLU A 1 271 ? 42.533 -24.683 13.866  1.00 19.07  ? 268 GLU A C     1 
ATOM   2179 O  O     . GLU A 1 271 ? 42.442 -25.582 14.716  1.00 22.01  ? 268 GLU A O     1 
ATOM   2180 C  CB    . GLU A 1 271 ? 41.282 -22.537 14.144  1.00 38.83  ? 268 GLU A CB    1 
ATOM   2181 C  CG    . GLU A 1 271 ? 40.121 -23.352 14.702  1.00 50.54  ? 268 GLU A CG    1 
ATOM   2182 C  CD    . GLU A 1 271 ? 39.115 -22.499 15.455  1.00 62.44  ? 268 GLU A CD    1 
ATOM   2183 O  OE1   . GLU A 1 271 ? 37.915 -22.540 15.108  1.00 64.32  ? 268 GLU A OE1   1 
ATOM   2184 O  OE2   . GLU A 1 271 ? 39.526 -21.791 16.400  1.00 67.19  ? 268 GLU A OE2   1 
ATOM   2185 N  N     . ILE A 1 272 ? 42.524 -24.915 12.560  1.00 17.52  ? 269 ILE A N     1 
ATOM   2186 C  CA    . ILE A 1 272 ? 42.339 -26.259 12.040  1.00 16.70  ? 269 ILE A CA    1 
ATOM   2187 C  C     . ILE A 1 272 ? 43.564 -27.132 12.304  1.00 17.08  ? 269 ILE A C     1 
ATOM   2188 O  O     . ILE A 1 272 ? 43.441 -28.302 12.682  1.00 19.89  ? 269 ILE A O     1 
ATOM   2189 C  CB    . ILE A 1 272 ? 42.019 -26.234 10.538  1.00 17.12  ? 269 ILE A CB    1 
ATOM   2190 C  CG1   . ILE A 1 272 ? 40.629 -25.640 10.308  1.00 20.80  ? 269 ILE A CG1   1 
ATOM   2191 C  CG2   . ILE A 1 272 ? 42.104 -27.633 9.963   1.00 17.26  ? 269 ILE A CG2   1 
ATOM   2192 C  CD1   . ILE A 1 272 ? 40.269 -25.483 8.836   1.00 26.82  ? 269 ILE A CD1   1 
ATOM   2193 N  N     . LEU A 1 273 ? 44.752 -26.566 12.111  1.00 17.48  ? 270 LEU A N     1 
ATOM   2194 C  CA    . LEU A 1 273 ? 45.962 -27.364 12.231  1.00 20.02  ? 270 LEU A CA    1 
ATOM   2195 C  C     . LEU A 1 273 ? 46.545 -27.359 13.636  1.00 19.61  ? 270 LEU A C     1 
ATOM   2196 O  O     . LEU A 1 273 ? 47.380 -28.198 13.966  1.00 19.07  ? 270 LEU A O     1 
ATOM   2197 C  CB    . LEU A 1 273 ? 47.013 -26.890 11.236  1.00 15.65  ? 270 LEU A CB    1 
ATOM   2198 C  CG    . LEU A 1 273 ? 46.604 -26.968 9.771   1.00 18.35  ? 270 LEU A CG    1 
ATOM   2199 C  CD1   . LEU A 1 273 ? 47.734 -26.452 8.895   1.00 18.55  ? 270 LEU A CD1   1 
ATOM   2200 C  CD2   . LEU A 1 273 ? 46.249 -28.408 9.415   1.00 23.30  ? 270 LEU A CD2   1 
ATOM   2201 N  N     . GLY A 1 274 ? 46.119 -26.402 14.453  1.00 15.55  ? 271 GLY A N     1 
ATOM   2202 C  CA    . GLY A 1 274 ? 46.608 -26.294 15.813  1.00 17.30  ? 271 GLY A CA    1 
ATOM   2203 C  C     . GLY A 1 274 ? 48.071 -25.912 15.860  1.00 19.73  ? 271 GLY A C     1 
ATOM   2204 O  O     . GLY A 1 274 ? 48.840 -26.463 16.648  1.00 21.75  ? 271 GLY A O     1 
ATOM   2205 N  N     . ILE A 1 275 ? 48.451 -24.968 15.004  1.00 15.11  ? 272 ILE A N     1 
ATOM   2206 C  CA    . ILE A 1 275 ? 49.817 -24.446 14.959  1.00 16.62  ? 272 ILE A CA    1 
ATOM   2207 C  C     . ILE A 1 275 ? 49.828 -22.925 15.144  1.00 13.36  ? 272 ILE A C     1 
ATOM   2208 O  O     . ILE A 1 275 ? 48.778 -22.295 15.099  1.00 16.75  ? 272 ILE A O     1 
ATOM   2209 C  CB    . ILE A 1 275 ? 50.517 -24.817 13.631  1.00 16.64  ? 272 ILE A CB    1 
ATOM   2210 C  CG1   . ILE A 1 275 ? 49.788 -24.203 12.426  1.00 15.85  ? 272 ILE A CG1   1 
ATOM   2211 C  CG2   . ILE A 1 275 ? 50.602 -26.333 13.494  1.00 14.95  ? 272 ILE A CG2   1 
ATOM   2212 C  CD1   . ILE A 1 275 ? 50.534 -24.426 11.083  1.00 12.99  ? 272 ILE A CD1   1 
ATOM   2213 N  N     . GLU A 1 276 ? 51.008 -22.341 15.350  1.00 13.69  ? 273 GLU A N     1 
ATOM   2214 C  CA    . GLU A 1 276 ? 51.126 -20.889 15.537  1.00 14.16  ? 273 GLU A CA    1 
ATOM   2215 C  C     . GLU A 1 276 ? 52.062 -20.233 14.520  1.00 13.27  ? 273 GLU A C     1 
ATOM   2216 O  O     . GLU A 1 276 ? 51.865 -19.077 14.140  1.00 14.72  ? 273 GLU A O     1 
ATOM   2217 C  CB    . GLU A 1 276 ? 51.629 -20.570 16.947  1.00 17.06  ? 273 GLU A CB    1 
ATOM   2218 C  CG    . GLU A 1 276 ? 50.638 -20.932 18.063  1.00 20.96  ? 273 GLU A CG    1 
ATOM   2219 C  CD    . GLU A 1 276 ? 51.254 -20.841 19.453  1.00 37.04  ? 273 GLU A CD    1 
ATOM   2220 O  OE1   . GLU A 1 276 ? 50.786 -21.562 20.364  1.00 46.34  ? 273 GLU A OE1   1 
ATOM   2221 O  OE2   . GLU A 1 276 ? 52.200 -20.048 19.638  1.00 37.80  ? 273 GLU A OE2   1 
ATOM   2222 N  N     . TYR A 1 277 ? 53.090 -20.970 14.095  1.00 12.35  ? 274 TYR A N     1 
ATOM   2223 C  CA    . TYR A 1 277 ? 54.182 -20.368 13.323  1.00 12.05  ? 274 TYR A CA    1 
ATOM   2224 C  C     . TYR A 1 277 ? 54.273 -20.937 11.907  1.00 12.43  ? 274 TYR A C     1 
ATOM   2225 O  O     . TYR A 1 277 ? 53.966 -22.103 11.657  1.00 12.91  ? 274 TYR A O     1 
ATOM   2226 C  CB    . TYR A 1 277 ? 55.523 -20.577 14.039  1.00 12.67  ? 274 TYR A CB    1 
ATOM   2227 C  CG    . TYR A 1 277 ? 55.537 -20.074 15.459  1.00 12.52  ? 274 TYR A CG    1 
ATOM   2228 C  CD1   . TYR A 1 277 ? 55.765 -20.932 16.520  1.00 13.41  ? 274 TYR A CD1   1 
ATOM   2229 C  CD2   . TYR A 1 277 ? 55.275 -18.747 15.729  1.00 13.11  ? 274 TYR A CD2   1 
ATOM   2230 C  CE1   . TYR A 1 277 ? 55.757 -20.471 17.820  1.00 15.58  ? 274 TYR A CE1   1 
ATOM   2231 C  CE2   . TYR A 1 277 ? 55.252 -18.268 17.027  1.00 17.23  ? 274 TYR A CE2   1 
ATOM   2232 C  CZ    . TYR A 1 277 ? 55.500 -19.145 18.071  1.00 18.13  ? 274 TYR A CZ    1 
ATOM   2233 O  OH    . TYR A 1 277 ? 55.491 -18.694 19.372  1.00 20.15  ? 274 TYR A OH    1 
ATOM   2234 N  N     . MET A 1 278 ? 54.734 -20.108 10.981  1.00 10.40  ? 275 MET A N     1 
ATOM   2235 C  CA    . MET A 1 278 ? 54.801 -20.500 9.579   1.00 10.21  ? 275 MET A CA    1 
ATOM   2236 C  C     . MET A 1 278 ? 55.589 -21.785 9.381   1.00 12.80  ? 275 MET A C     1 
ATOM   2237 O  O     . MET A 1 278 ? 55.198 -22.639 8.590   1.00 13.40  ? 275 MET A O     1 
ATOM   2238 C  CB    . MET A 1 278 ? 55.446 -19.367 8.773   1.00 14.93  ? 275 MET A CB    1 
ATOM   2239 C  CG    A MET A 1 278 ? 55.155 -19.418 7.276   0.70 14.28  ? 275 MET A CG    1 
ATOM   2240 C  CG    B MET A 1 278 ? 54.513 -18.249 8.438   0.30 17.74  ? 275 MET A CG    1 
ATOM   2241 S  SD    A MET A 1 278 ? 53.412 -19.281 6.820   0.70 16.02  ? 275 MET A SD    1 
ATOM   2242 S  SD    B MET A 1 278 ? 53.231 -18.805 7.311   0.30 16.44  ? 275 MET A SD    1 
ATOM   2243 C  CE    A MET A 1 278 ? 53.471 -19.678 5.075   0.70 20.33  ? 275 MET A CE    1 
ATOM   2244 C  CE    B MET A 1 278 ? 54.217 -19.481 5.976   0.30 16.30  ? 275 MET A CE    1 
ATOM   2245 N  N     . GLY A 1 279 ? 56.705 -21.925 10.097  1.00 10.97  ? 276 GLY A N     1 
ATOM   2246 C  CA    . GLY A 1 279 ? 57.543 -23.101 9.933   1.00 12.03  ? 276 GLY A CA    1 
ATOM   2247 C  C     . GLY A 1 279 ? 56.825 -24.408 10.230  1.00 14.70  ? 276 GLY A C     1 
ATOM   2248 O  O     . GLY A 1 279 ? 57.152 -25.457 9.650   1.00 15.08  ? 276 GLY A O     1 
ATOM   2249 N  N     . GLU A 1 280 ? 55.847 -24.361 11.134  1.00 11.68  ? 277 GLU A N     1 
ATOM   2250 C  CA    . GLU A 1 280 ? 55.144 -25.571 11.523  1.00 9.08   ? 277 GLU A CA    1 
ATOM   2251 C  C     . GLU A 1 280 ? 54.355 -26.169 10.371  1.00 10.78  ? 277 GLU A C     1 
ATOM   2252 O  O     . GLU A 1 280 ? 53.997 -27.352 10.415  1.00 13.15  ? 277 GLU A O     1 
ATOM   2253 C  CB    . GLU A 1 280 ? 54.197 -25.314 12.702  1.00 12.06  ? 277 GLU A CB    1 
ATOM   2254 C  CG    . GLU A 1 280 ? 54.882 -24.943 13.999  1.00 12.50  ? 277 GLU A CG    1 
ATOM   2255 C  CD    . GLU A 1 280 ? 53.881 -24.695 15.099  1.00 17.39  ? 277 GLU A CD    1 
ATOM   2256 O  OE1   . GLU A 1 280 ? 53.542 -23.522 15.311  1.00 15.40  ? 277 GLU A OE1   1 
ATOM   2257 O  OE2   . GLU A 1 280 ? 53.423 -25.667 15.741  1.00 18.70  ? 277 GLU A OE2   1 
ATOM   2258 N  N     . LEU A 1 281 ? 54.086 -25.383 9.334   1.00 12.49  ? 278 LEU A N     1 
ATOM   2259 C  CA    . LEU A 1 281 ? 53.371 -25.919 8.183   1.00 12.20  ? 278 LEU A CA    1 
ATOM   2260 C  C     . LEU A 1 281 ? 54.126 -27.004 7.437   1.00 11.99  ? 278 LEU A C     1 
ATOM   2261 O  O     . LEU A 1 281 ? 53.515 -27.744 6.666   1.00 13.06  ? 278 LEU A O     1 
ATOM   2262 C  CB    . LEU A 1 281 ? 53.012 -24.804 7.196   1.00 13.20  ? 278 LEU A CB    1 
ATOM   2263 C  CG    . LEU A 1 281 ? 51.824 -23.946 7.619   1.00 13.29  ? 278 LEU A CG    1 
ATOM   2264 C  CD1   . LEU A 1 281 ? 51.803 -22.598 6.863   1.00 15.36  ? 278 LEU A CD1   1 
ATOM   2265 C  CD2   . LEU A 1 281 ? 50.520 -24.708 7.433   1.00 14.59  ? 278 LEU A CD2   1 
ATOM   2266 N  N     . THR A 1 282 ? 55.444 -27.090 7.620   1.00 11.97  ? 279 THR A N     1 
ATOM   2267 C  CA    . THR A 1 282 ? 56.221 -28.048 6.815   1.00 10.51  ? 279 THR A CA    1 
ATOM   2268 C  C     . THR A 1 282 ? 55.856 -29.492 7.126   1.00 13.01  ? 279 THR A C     1 
ATOM   2269 O  O     . THR A 1 282 ? 56.173 -30.381 6.350   1.00 15.62  ? 279 THR A O     1 
ATOM   2270 C  CB    . THR A 1 282 ? 57.754 -27.891 6.971   1.00 13.38  ? 279 THR A CB    1 
ATOM   2271 O  OG1   . THR A 1 282 ? 58.140 -28.203 8.321   1.00 15.74  ? 279 THR A OG1   1 
ATOM   2272 C  CG2   . THR A 1 282 ? 58.226 -26.475 6.596   1.00 14.49  ? 279 THR A CG2   1 
ATOM   2273 N  N     . GLN A 1 283 ? 55.192 -29.727 8.259   1.00 13.31  ? 280 GLN A N     1 
ATOM   2274 C  CA    A GLN A 1 283 ? 54.885 -31.083 8.701   0.51 14.01  ? 280 GLN A CA    1 
ATOM   2275 C  CA    B GLN A 1 283 ? 54.905 -31.101 8.688   0.49 14.01  ? 280 GLN A CA    1 
ATOM   2276 C  C     . GLN A 1 283 ? 53.638 -31.693 8.075   1.00 20.45  ? 280 GLN A C     1 
ATOM   2277 O  O     . GLN A 1 283 ? 53.249 -32.814 8.402   1.00 27.16  ? 280 GLN A O     1 
ATOM   2278 C  CB    A GLN A 1 283 ? 54.806 -31.106 10.223  0.51 17.12  ? 280 GLN A CB    1 
ATOM   2279 C  CB    B GLN A 1 283 ? 54.829 -31.193 10.213  0.49 17.22  ? 280 GLN A CB    1 
ATOM   2280 C  CG    A GLN A 1 283 ? 56.172 -30.828 10.797  0.51 10.95  ? 280 GLN A CG    1 
ATOM   2281 C  CG    B GLN A 1 283 ? 53.636 -30.504 10.813  0.49 19.43  ? 280 GLN A CG    1 
ATOM   2282 C  CD    A GLN A 1 283 ? 57.223 -31.654 10.090  0.51 17.51  ? 280 GLN A CD    1 
ATOM   2283 C  CD    B GLN A 1 283 ? 53.970 -29.831 12.128  0.49 25.91  ? 280 GLN A CD    1 
ATOM   2284 O  OE1   A GLN A 1 283 ? 57.250 -32.882 10.218  0.51 19.19  ? 280 GLN A OE1   1 
ATOM   2285 O  OE1   B GLN A 1 283 ? 55.070 -29.987 12.653  0.49 38.14  ? 280 GLN A OE1   1 
ATOM   2286 N  NE2   A GLN A 1 283 ? 58.074 -30.993 9.311   0.51 14.22  ? 280 GLN A NE2   1 
ATOM   2287 N  NE2   B GLN A 1 283 ? 53.028 -29.066 12.656  0.49 15.11  ? 280 GLN A NE2   1 
ATOM   2288 N  N     . PHE A 1 284 ? 53.009 -30.957 7.176   1.00 14.41  ? 281 PHE A N     1 
ATOM   2289 C  CA    . PHE A 1 284 ? 51.812 -31.445 6.514   1.00 12.70  ? 281 PHE A CA    1 
ATOM   2290 C  C     . PHE A 1 284 ? 52.110 -31.748 5.050   1.00 13.61  ? 281 PHE A C     1 
ATOM   2291 O  O     . PHE A 1 284 ? 52.923 -31.061 4.426   1.00 16.84  ? 281 PHE A O     1 
ATOM   2292 C  CB    . PHE A 1 284 ? 50.705 -30.403 6.637   1.00 15.05  ? 281 PHE A CB    1 
ATOM   2293 C  CG    . PHE A 1 284 ? 50.343 -30.112 8.061   1.00 15.14  ? 281 PHE A CG    1 
ATOM   2294 C  CD1   . PHE A 1 284 ? 49.443 -30.917 8.736   1.00 18.14  ? 281 PHE A CD1   1 
ATOM   2295 C  CD2   . PHE A 1 284 ? 50.957 -29.081 8.742   1.00 14.07  ? 281 PHE A CD2   1 
ATOM   2296 C  CE1   . PHE A 1 284 ? 49.131 -30.667 10.061  1.00 20.14  ? 281 PHE A CE1   1 
ATOM   2297 C  CE2   . PHE A 1 284 ? 50.648 -28.822 10.055  1.00 14.77  ? 281 PHE A CE2   1 
ATOM   2298 C  CZ    . PHE A 1 284 ? 49.742 -29.624 10.727  1.00 21.30  ? 281 PHE A CZ    1 
ATOM   2299 N  N     . THR A 1 285 ? 51.468 -32.768 4.492   1.00 15.65  ? 282 THR A N     1 
ATOM   2300 C  CA    . THR A 1 285 ? 51.656 -33.011 3.069   1.00 14.62  ? 282 THR A CA    1 
ATOM   2301 C  C     . THR A 1 285 ? 50.874 -31.988 2.257   1.00 12.80  ? 282 THR A C     1 
ATOM   2302 O  O     . THR A 1 285 ? 49.973 -31.320 2.765   1.00 14.20  ? 282 THR A O     1 
ATOM   2303 C  CB    . THR A 1 285 ? 51.165 -34.398 2.655   1.00 14.43  ? 282 THR A CB    1 
ATOM   2304 O  OG1   . THR A 1 285 ? 49.746 -34.448 2.796   1.00 16.72  ? 282 THR A OG1   1 
ATOM   2305 C  CG2   . THR A 1 285 ? 51.806 -35.467 3.513   1.00 19.13  ? 282 THR A CG2   1 
ATOM   2306 N  N     . GLU A 1 286 ? 51.228 -31.869 0.989   1.00 14.28  ? 283 GLU A N     1 
ATOM   2307 C  CA    . GLU A 1 286 ? 50.512 -30.972 0.106   1.00 14.45  ? 283 GLU A CA    1 
ATOM   2308 C  C     . GLU A 1 286 ? 49.030 -31.340 0.049   1.00 14.31  ? 283 GLU A C     1 
ATOM   2309 O  O     . GLU A 1 286 ? 48.165 -30.458 0.089   1.00 14.73  ? 283 GLU A O     1 
ATOM   2310 C  CB    . GLU A 1 286 ? 51.149 -30.961 -1.288  1.00 14.45  ? 283 GLU A CB    1 
ATOM   2311 C  CG    . GLU A 1 286 ? 50.591 -29.883 -2.186  1.00 15.30  ? 283 GLU A CG    1 
ATOM   2312 C  CD    . GLU A 1 286 ? 51.353 -29.736 -3.481  1.00 27.01  ? 283 GLU A CD    1 
ATOM   2313 O  OE1   . GLU A 1 286 ? 52.327 -30.485 -3.697  1.00 29.41  ? 283 GLU A OE1   1 
ATOM   2314 O  OE2   . GLU A 1 286 ? 50.971 -28.857 -4.280  1.00 23.95  ? 283 GLU A OE2   1 
ATOM   2315 N  N     A SER A 1 287 ? 48.739 -32.640 -0.030  0.80 15.39  ? 284 SER A N     1 
ATOM   2316 N  N     B SER A 1 287 ? 48.743 -32.637 -0.034  0.20 15.17  ? 284 SER A N     1 
ATOM   2317 C  CA    A SER A 1 287 ? 47.348 -33.095 -0.092  0.80 17.09  ? 284 SER A CA    1 
ATOM   2318 C  CA    B SER A 1 287 ? 47.362 -33.106 -0.094  0.20 17.32  ? 284 SER A CA    1 
ATOM   2319 C  C     A SER A 1 287 ? 46.588 -32.766 1.188   0.80 15.70  ? 284 SER A C     1 
ATOM   2320 C  C     B SER A 1 287 ? 46.595 -32.770 1.182   0.20 15.60  ? 284 SER A C     1 
ATOM   2321 O  O     A SER A 1 287 ? 45.406 -32.420 1.145   0.80 16.84  ? 284 SER A O     1 
ATOM   2322 O  O     B SER A 1 287 ? 45.417 -32.416 1.127   0.20 16.41  ? 284 SER A O     1 
ATOM   2323 C  CB    A SER A 1 287 ? 47.264 -34.600 -0.382  0.80 17.13  ? 284 SER A CB    1 
ATOM   2324 C  CB    B SER A 1 287 ? 47.307 -34.612 -0.371  0.20 17.96  ? 284 SER A CB    1 
ATOM   2325 O  OG    A SER A 1 287 ? 47.896 -34.912 -1.612  0.80 21.36  ? 284 SER A OG    1 
ATOM   2326 O  OG    B SER A 1 287 ? 48.040 -35.337 0.599   0.20 15.84  ? 284 SER A OG    1 
ATOM   2327 N  N     . GLN A 1 288 ? 47.257 -32.885 2.329   1.00 14.03  ? 285 GLN A N     1 
ATOM   2328 C  CA    . GLN A 1 288 ? 46.631 -32.502 3.590   1.00 16.26  ? 285 GLN A CA    1 
ATOM   2329 C  C     . GLN A 1 288 ? 46.246 -31.028 3.556   1.00 14.51  ? 285 GLN A C     1 
ATOM   2330 O  O     . GLN A 1 288 ? 45.142 -30.649 3.939   1.00 17.18  ? 285 GLN A O     1 
ATOM   2331 C  CB    . GLN A 1 288 ? 47.568 -32.762 4.768   1.00 12.90  ? 285 GLN A CB    1 
ATOM   2332 C  CG    . GLN A 1 288 ? 47.598 -34.204 5.200   1.00 17.48  ? 285 GLN A CG    1 
ATOM   2333 C  CD    . GLN A 1 288 ? 48.540 -34.429 6.369   1.00 22.15  ? 285 GLN A CD    1 
ATOM   2334 O  OE1   . GLN A 1 288 ? 49.696 -34.011 6.339   1.00 17.76  ? 285 GLN A OE1   1 
ATOM   2335 N  NE2   . GLN A 1 288 ? 48.041 -35.079 7.414   1.00 28.60  ? 285 GLN A NE2   1 
ATOM   2336 N  N     . LEU A 1 289 ? 47.163 -30.182 3.110   1.00 13.22  ? 286 LEU A N     1 
ATOM   2337 C  CA    . LEU A 1 289 ? 46.870 -28.753 3.116   1.00 14.80  ? 286 LEU A CA    1 
ATOM   2338 C  C     . LEU A 1 289 ? 45.766 -28.420 2.114   1.00 17.28  ? 286 LEU A C     1 
ATOM   2339 O  O     . LEU A 1 289 ? 44.912 -27.565 2.370   1.00 17.70  ? 286 LEU A O     1 
ATOM   2340 C  CB    . LEU A 1 289 ? 48.128 -27.935 2.844   1.00 12.88  ? 286 LEU A CB    1 
ATOM   2341 C  CG    . LEU A 1 289 ? 49.198 -28.063 3.938   1.00 12.14  ? 286 LEU A CG    1 
ATOM   2342 C  CD1   . LEU A 1 289 ? 50.431 -27.303 3.473   1.00 14.27  ? 286 LEU A CD1   1 
ATOM   2343 C  CD2   . LEU A 1 289 ? 48.687 -27.539 5.296   1.00 14.43  ? 286 LEU A CD2   1 
ATOM   2344 N  N     . GLN A 1 290 ? 45.783 -29.097 0.971   1.00 15.40  ? 287 GLN A N     1 
ATOM   2345 C  CA    . GLN A 1 290 ? 44.747 -28.876 -0.031  1.00 19.27  ? 287 GLN A CA    1 
ATOM   2346 C  C     . GLN A 1 290 ? 43.385 -29.323 0.488   1.00 17.75  ? 287 GLN A C     1 
ATOM   2347 O  O     . GLN A 1 290 ? 42.353 -28.727 0.163   1.00 19.95  ? 287 GLN A O     1 
ATOM   2348 C  CB    . GLN A 1 290 ? 45.084 -29.631 -1.313  1.00 16.65  ? 287 GLN A CB    1 
ATOM   2349 C  CG    . GLN A 1 290 ? 46.253 -29.045 -2.077  1.00 15.57  ? 287 GLN A CG    1 
ATOM   2350 C  CD    . GLN A 1 290 ? 46.619 -29.895 -3.264  1.00 20.70  ? 287 GLN A CD    1 
ATOM   2351 O  OE1   . GLN A 1 290 ? 46.618 -31.128 -3.180  1.00 19.56  ? 287 GLN A OE1   1 
ATOM   2352 N  NE2   . GLN A 1 290 ? 46.926 -29.247 -4.384  1.00 22.85  ? 287 GLN A NE2   1 
ATOM   2353 N  N     . SER A 1 291 ? 43.374 -30.360 1.312   1.00 17.50  ? 288 SER A N     1 
ATOM   2354 C  CA    . SER A 1 291 ? 42.106 -30.845 1.836   1.00 19.47  ? 288 SER A CA    1 
ATOM   2355 C  C     . SER A 1 291 ? 41.422 -29.822 2.745   1.00 22.30  ? 288 SER A C     1 
ATOM   2356 O  O     . SER A 1 291 ? 40.196 -29.725 2.773   1.00 27.90  ? 288 SER A O     1 
ATOM   2357 C  CB    . SER A 1 291 ? 42.277 -32.171 2.572   1.00 17.94  ? 288 SER A CB    1 
ATOM   2358 O  OG    A SER A 1 291 ? 42.828 -31.980 3.874   0.59 19.38  ? 288 SER A OG    1 
ATOM   2359 O  OG    B SER A 1 291 ? 41.005 -32.689 2.889   0.41 18.22  ? 288 SER A OG    1 
ATOM   2360 N  N     . HIS A 1 292 ? 42.210 -29.055 3.488   1.00 19.28  ? 289 HIS A N     1 
ATOM   2361 C  CA    . HIS A 1 292 ? 41.636 -28.089 4.416   1.00 24.82  ? 289 HIS A CA    1 
ATOM   2362 C  C     . HIS A 1 292 ? 41.371 -26.741 3.764   1.00 23.95  ? 289 HIS A C     1 
ATOM   2363 O  O     . HIS A 1 292 ? 40.373 -26.086 4.058   1.00 23.51  ? 289 HIS A O     1 
ATOM   2364 C  CB    . HIS A 1 292 ? 42.569 -27.875 5.600   1.00 21.38  ? 289 HIS A CB    1 
ATOM   2365 C  CG    . HIS A 1 292 ? 42.667 -29.057 6.510   1.00 19.82  ? 289 HIS A CG    1 
ATOM   2366 N  ND1   . HIS A 1 292 ? 41.583 -29.561 7.194   1.00 26.05  ? 289 HIS A ND1   1 
ATOM   2367 C  CD2   . HIS A 1 292 ? 43.725 -29.827 6.858   1.00 26.12  ? 289 HIS A CD2   1 
ATOM   2368 C  CE1   . HIS A 1 292 ? 41.968 -30.591 7.925   1.00 27.05  ? 289 HIS A CE1   1 
ATOM   2369 N  NE2   . HIS A 1 292 ? 43.262 -30.777 7.735   1.00 26.67  ? 289 HIS A NE2   1 
ATOM   2370 N  N     . PHE A 1 293 ? 42.275 -26.318 2.886   1.00 19.00  ? 290 PHE A N     1 
ATOM   2371 C  CA    . PHE A 1 293 ? 42.275 -24.937 2.430   1.00 22.07  ? 290 PHE A CA    1 
ATOM   2372 C  C     . PHE A 1 293 ? 42.015 -24.781 0.935   1.00 19.73  ? 290 PHE A C     1 
ATOM   2373 O  O     . PHE A 1 293 ? 42.008 -23.666 0.412   1.00 20.40  ? 290 PHE A O     1 
ATOM   2374 C  CB    . PHE A 1 293 ? 43.587 -24.277 2.863   1.00 14.71  ? 290 PHE A CB    1 
ATOM   2375 C  CG    . PHE A 1 293 ? 43.902 -24.513 4.314   1.00 14.42  ? 290 PHE A CG    1 
ATOM   2376 C  CD1   . PHE A 1 293 ? 43.081 -23.992 5.305   1.00 17.04  ? 290 PHE A CD1   1 
ATOM   2377 C  CD2   . PHE A 1 293 ? 44.986 -25.287 4.687   1.00 17.50  ? 290 PHE A CD2   1 
ATOM   2378 C  CE1   . PHE A 1 293 ? 43.350 -24.235 6.638   1.00 17.71  ? 290 PHE A CE1   1 
ATOM   2379 C  CE2   . PHE A 1 293 ? 45.262 -25.535 6.017   1.00 17.30  ? 290 PHE A CE2   1 
ATOM   2380 C  CZ    . PHE A 1 293 ? 44.440 -25.005 6.996   1.00 17.48  ? 290 PHE A CZ    1 
ATOM   2381 N  N     . GLY A 1 294 ? 41.761 -25.896 0.256   1.00 18.17  ? 291 GLY A N     1 
ATOM   2382 C  CA    . GLY A 1 294 ? 41.517 -25.859 -1.173  1.00 23.85  ? 291 GLY A CA    1 
ATOM   2383 C  C     . GLY A 1 294 ? 42.771 -26.135 -1.975  1.00 19.97  ? 291 GLY A C     1 
ATOM   2384 O  O     . GLY A 1 294 ? 43.891 -26.003 -1.473  1.00 19.60  ? 291 GLY A O     1 
ATOM   2385 N  N     . GLU A 1 295 ? 42.583 -26.503 -3.237  1.00 19.48  ? 292 GLU A N     1 
ATOM   2386 C  CA    . GLU A 1 295 ? 43.682 -26.859 -4.121  1.00 22.86  ? 292 GLU A CA    1 
ATOM   2387 C  C     . GLU A 1 295 ? 44.715 -25.746 -4.244  1.00 16.27  ? 292 GLU A C     1 
ATOM   2388 O  O     . GLU A 1 295 ? 45.914 -25.976 -4.062  1.00 16.72  ? 292 GLU A O     1 
ATOM   2389 C  CB    . GLU A 1 295 ? 43.120 -27.195 -5.504  1.00 21.05  ? 292 GLU A CB    1 
ATOM   2390 C  CG    . GLU A 1 295 ? 44.125 -27.722 -6.490  1.00 24.37  ? 292 GLU A CG    1 
ATOM   2391 C  CD    . GLU A 1 295 ? 43.497 -27.948 -7.853  1.00 35.42  ? 292 GLU A CD    1 
ATOM   2392 O  OE1   . GLU A 1 295 ? 44.149 -27.630 -8.872  1.00 40.55  ? 292 GLU A OE1   1 
ATOM   2393 O  OE2   . GLU A 1 295 ? 42.344 -28.434 -7.899  1.00 32.09  ? 292 GLU A OE2   1 
ATOM   2394 N  N     . LYS A 1 296 ? 44.253 -24.538 -4.558  1.00 15.74  ? 293 LYS A N     1 
ATOM   2395 C  CA    . LYS A 1 296 ? 45.158 -23.420 -4.796  1.00 18.53  ? 293 LYS A CA    1 
ATOM   2396 C  C     . LYS A 1 296 ? 45.889 -23.012 -3.513  1.00 18.02  ? 293 LYS A C     1 
ATOM   2397 O  O     . LYS A 1 296 ? 47.121 -22.928 -3.487  1.00 16.54  ? 293 LYS A O     1 
ATOM   2398 C  CB    . LYS A 1 296 ? 44.389 -22.229 -5.382  1.00 22.35  ? 293 LYS A CB    1 
ATOM   2399 C  CG    . LYS A 1 296 ? 45.267 -21.090 -5.872  1.00 30.31  ? 293 LYS A CG    1 
ATOM   2400 C  CD    . LYS A 1 296 ? 44.445 -20.042 -6.615  1.00 31.86  ? 293 LYS A CD    1 
ATOM   2401 C  CE    . LYS A 1 296 ? 45.236 -18.755 -6.830  1.00 37.27  ? 293 LYS A CE    1 
ATOM   2402 N  NZ    . LYS A 1 296 ? 44.442 -17.740 -7.580  1.00 38.28  ? 293 LYS A NZ    1 
ATOM   2403 N  N     . ASN A 1 297 ? 45.129 -22.765 -2.454  1.00 17.04  ? 294 ASN A N     1 
ATOM   2404 C  CA    . ASN A 1 297 ? 45.715 -22.333 -1.183  1.00 18.75  ? 294 ASN A CA    1 
ATOM   2405 C  C     . ASN A 1 297 ? 46.639 -23.400 -0.621  1.00 15.20  ? 294 ASN A C     1 
ATOM   2406 O  O     . ASN A 1 297 ? 47.670 -23.098 -0.020  1.00 13.91  ? 294 ASN A O     1 
ATOM   2407 C  CB    . ASN A 1 297 ? 44.619 -22.085 -0.146  1.00 20.91  ? 294 ASN A CB    1 
ATOM   2408 C  CG    . ASN A 1 297 ? 43.927 -20.759 -0.324  1.00 21.94  ? 294 ASN A CG    1 
ATOM   2409 O  OD1   . ASN A 1 297 ? 44.482 -19.825 -0.895  1.00 25.90  ? 294 ASN A OD1   1 
ATOM   2410 N  ND2   . ASN A 1 297 ? 42.698 -20.662 0.185   1.00 27.07  ? 294 ASN A ND2   1 
ATOM   2411 N  N     . GLY A 1 298 ? 46.237 -24.655 -0.767  1.00 17.30  ? 295 GLY A N     1 
ATOM   2412 C  CA    . GLY A 1 298 ? 47.011 -25.749 -0.198  1.00 18.07  ? 295 GLY A CA    1 
ATOM   2413 C  C     . GLY A 1 298 ? 48.377 -25.863 -0.855  1.00 13.53  ? 295 GLY A C     1 
ATOM   2414 O  O     . GLY A 1 298 ? 49.402 -26.027 -0.171  1.00 14.67  ? 295 GLY A O     1 
ATOM   2415 N  N     . SER A 1 299 ? 48.412 -25.784 -2.183  1.00 12.77  ? 296 SER A N     1 
ATOM   2416 C  CA    . SER A 1 299 ? 49.685 -25.822 -2.889  1.00 13.39  ? 296 SER A CA    1 
ATOM   2417 C  C     . SER A 1 299 ? 50.521 -24.600 -2.550  1.00 14.67  ? 296 SER A C     1 
ATOM   2418 O  O     . SER A 1 299 ? 51.744 -24.688 -2.411  1.00 14.12  ? 296 SER A O     1 
ATOM   2419 C  CB    . SER A 1 299 ? 49.453 -25.876 -4.399  1.00 16.40  ? 296 SER A CB    1 
ATOM   2420 O  OG    . SER A 1 299 ? 48.957 -27.155 -4.756  1.00 19.27  ? 296 SER A OG    1 
ATOM   2421 N  N     . TRP A 1 300 ? 49.860 -23.451 -2.411  1.00 12.66  ? 297 TRP A N     1 
ATOM   2422 C  CA    . TRP A 1 300 ? 50.579 -22.219 -2.101  1.00 11.54  ? 297 TRP A CA    1 
ATOM   2423 C  C     . TRP A 1 300 ? 51.233 -22.305 -0.727  1.00 13.43  ? 297 TRP A C     1 
ATOM   2424 O  O     . TRP A 1 300 ? 52.404 -21.942 -0.562  1.00 13.12  ? 297 TRP A O     1 
ATOM   2425 C  CB    . TRP A 1 300 ? 49.624 -21.022 -2.185  1.00 15.09  ? 297 TRP A CB    1 
ATOM   2426 C  CG    . TRP A 1 300 ? 50.291 -19.703 -1.962  1.00 14.57  ? 297 TRP A CG    1 
ATOM   2427 C  CD1   . TRP A 1 300 ? 50.914 -18.943 -2.899  1.00 19.56  ? 297 TRP A CD1   1 
ATOM   2428 C  CD2   . TRP A 1 300 ? 50.405 -18.992 -0.721  1.00 12.36  ? 297 TRP A CD2   1 
ATOM   2429 N  NE1   . TRP A 1 300 ? 51.411 -17.797 -2.322  1.00 20.71  ? 297 TRP A NE1   1 
ATOM   2430 C  CE2   . TRP A 1 300 ? 51.112 -17.802 -0.986  1.00 16.38  ? 297 TRP A CE2   1 
ATOM   2431 C  CE3   . TRP A 1 300 ? 49.986 -19.250 0.587   1.00 17.35  ? 297 TRP A CE3   1 
ATOM   2432 C  CZ2   . TRP A 1 300 ? 51.398 -16.859 0.010   1.00 17.02  ? 297 TRP A CZ2   1 
ATOM   2433 C  CZ3   . TRP A 1 300 ? 50.269 -18.311 1.574   1.00 19.45  ? 297 TRP A CZ3   1 
ATOM   2434 C  CH2   . TRP A 1 300 ? 50.977 -17.142 1.281   1.00 15.46  ? 297 TRP A CH2   1 
ATOM   2435 N  N     . LEU A 1 301 ? 50.477 -22.797 0.250   1.00 12.81  ? 298 LEU A N     1 
ATOM   2436 C  CA    . LEU A 1 301 ? 50.990 -22.944 1.616   1.00 11.46  ? 298 LEU A CA    1 
ATOM   2437 C  C     . LEU A 1 301 ? 52.134 -23.949 1.700   1.00 12.92  ? 298 LEU A C     1 
ATOM   2438 O  O     . LEU A 1 301 ? 53.125 -23.728 2.405   1.00 12.58  ? 298 LEU A O     1 
ATOM   2439 C  CB    . LEU A 1 301 ? 49.869 -23.394 2.557   1.00 12.83  ? 298 LEU A CB    1 
ATOM   2440 C  CG    . LEU A 1 301 ? 48.815 -22.321 2.885   1.00 15.17  ? 298 LEU A CG    1 
ATOM   2441 C  CD1   . LEU A 1 301 ? 47.573 -22.958 3.524   1.00 16.23  ? 298 LEU A CD1   1 
ATOM   2442 C  CD2   . LEU A 1 301 ? 49.400 -21.258 3.800   1.00 14.86  ? 298 LEU A CD2   1 
ATOM   2443 N  N     . TYR A 1 302 ? 51.995 -25.061 0.986   1.00 11.21  ? 299 TYR A N     1 
ATOM   2444 C  CA    . TYR A 1 302 ? 53.029 -26.088 0.984   1.00 11.82  ? 299 TYR A CA    1 
ATOM   2445 C  C     . TYR A 1 302 ? 54.360 -25.510 0.509   1.00 15.31  ? 299 TYR A C     1 
ATOM   2446 O  O     . TYR A 1 302 ? 55.413 -25.731 1.126   1.00 12.21  ? 299 TYR A O     1 
ATOM   2447 C  CB    . TYR A 1 302 ? 52.612 -27.260 0.084   1.00 12.94  ? 299 TYR A CB    1 
ATOM   2448 C  CG    . TYR A 1 302 ? 53.611 -28.387 0.109   1.00 14.99  ? 299 TYR A CG    1 
ATOM   2449 C  CD1   . TYR A 1 302 ? 53.558 -29.360 1.095   1.00 13.87  ? 299 TYR A CD1   1 
ATOM   2450 C  CD2   . TYR A 1 302 ? 54.625 -28.462 -0.834  1.00 18.18  ? 299 TYR A CD2   1 
ATOM   2451 C  CE1   . TYR A 1 302 ? 54.483 -30.395 1.141   1.00 15.61  ? 299 TYR A CE1   1 
ATOM   2452 C  CE2   . TYR A 1 302 ? 55.558 -29.481 -0.795  1.00 18.32  ? 299 TYR A CE2   1 
ATOM   2453 C  CZ    . TYR A 1 302 ? 55.477 -30.450 0.196   1.00 19.86  ? 299 TYR A CZ    1 
ATOM   2454 O  OH    . TYR A 1 302 ? 56.400 -31.475 0.246   1.00 25.63  ? 299 TYR A OH    1 
ATOM   2455 N  N     . ALA A 1 303 ? 54.327 -24.764 -0.588  1.00 12.29  ? 300 ALA A N     1 
ATOM   2456 C  CA    . ALA A 1 303 ? 55.550 -24.146 -1.087  1.00 10.48  ? 300 ALA A CA    1 
ATOM   2457 C  C     . ALA A 1 303 ? 56.002 -22.964 -0.217  1.00 12.15  ? 300 ALA A C     1 
ATOM   2458 O  O     . ALA A 1 303 ? 57.198 -22.807 0.076   1.00 12.27  ? 300 ALA A O     1 
ATOM   2459 C  CB    . ALA A 1 303 ? 55.357 -23.696 -2.542  1.00 13.75  ? 300 ALA A CB    1 
ATOM   2460 N  N     . MET A 1 304 ? 55.048 -22.150 0.225   1.00 11.09  ? 301 MET A N     1 
ATOM   2461 C  CA    . MET A 1 304 ? 55.397 -20.905 0.902   1.00 7.96   ? 301 MET A CA    1 
ATOM   2462 C  C     . MET A 1 304 ? 56.106 -21.156 2.208   1.00 10.78  ? 301 MET A C     1 
ATOM   2463 O  O     . MET A 1 304 ? 57.038 -20.406 2.560   1.00 12.30  ? 301 MET A O     1 
ATOM   2464 C  CB    . MET A 1 304 ? 54.155 -20.057 1.171   1.00 12.19  ? 301 MET A CB    1 
ATOM   2465 C  CG    . MET A 1 304 ? 54.481 -18.628 1.598   1.00 15.03  ? 301 MET A CG    1 
ATOM   2466 S  SD    . MET A 1 304 ? 55.236 -17.678 0.264   1.00 16.81  ? 301 MET A SD    1 
ATOM   2467 C  CE    . MET A 1 304 ? 56.919 -17.563 0.860   1.00 19.89  ? 301 MET A CE    1 
ATOM   2468 N  N     . CYS A 1 305 ? 55.701 -22.201 2.930   1.00 11.46  ? 302 CYS A N     1 
ATOM   2469 C  CA    . CYS A 1 305 ? 56.329 -22.465 4.229   1.00 8.39   ? 302 CYS A CA    1 
ATOM   2470 C  C     . CYS A 1 305 ? 57.759 -22.954 4.089   1.00 11.25  ? 302 CYS A C     1 
ATOM   2471 O  O     . CYS A 1 305 ? 58.495 -22.999 5.077   1.00 13.03  ? 302 CYS A O     1 
ATOM   2472 C  CB    . CYS A 1 305 ? 55.520 -23.454 5.078   1.00 11.25  ? 302 CYS A CB    1 
ATOM   2473 S  SG    . CYS A 1 305 ? 55.500 -25.151 4.483   1.00 12.86  ? 302 CYS A SG    1 
ATOM   2474 N  N     . ARG A 1 306 ? 58.146 -23.292 2.862   1.00 10.43  ? 303 ARG A N     1 
ATOM   2475 C  CA    . ARG A 1 306 ? 59.514 -23.653 2.521   1.00 8.88   ? 303 ARG A CA    1 
ATOM   2476 C  C     . ARG A 1 306 ? 60.258 -22.501 1.828   1.00 12.96  ? 303 ARG A C     1 
ATOM   2477 O  O     . ARG A 1 306 ? 61.413 -22.676 1.375   1.00 16.99  ? 303 ARG A O     1 
ATOM   2478 C  CB    . ARG A 1 306 ? 59.510 -24.890 1.614   1.00 12.20  ? 303 ARG A CB    1 
ATOM   2479 C  CG    . ARG A 1 306 ? 58.963 -26.148 2.312   1.00 12.23  ? 303 ARG A CG    1 
ATOM   2480 C  CD    . ARG A 1 306 ? 58.649 -27.302 1.349   1.00 13.44  ? 303 ARG A CD    1 
ATOM   2481 N  NE    . ARG A 1 306 ? 58.446 -28.512 2.138   1.00 18.23  ? 303 ARG A NE    1 
ATOM   2482 C  CZ    . ARG A 1 306 ? 57.337 -28.778 2.820   1.00 15.84  ? 303 ARG A CZ    1 
ATOM   2483 N  NH1   . ARG A 1 306 ? 57.249 -29.877 3.556   1.00 15.50  ? 303 ARG A NH1   1 
ATOM   2484 N  NH2   . ARG A 1 306 ? 56.300 -27.953 2.755   1.00 12.94  ? 303 ARG A NH2   1 
ATOM   2485 N  N     . GLY A 1 307 ? 59.627 -21.329 1.777   1.00 10.26  ? 304 GLY A N     1 
ATOM   2486 C  CA    . GLY A 1 307 ? 60.250 -20.138 1.219   1.00 10.75  ? 304 GLY A CA    1 
ATOM   2487 C  C     . GLY A 1 307 ? 60.049 -19.972 -0.278  1.00 11.19  ? 304 GLY A C     1 
ATOM   2488 O  O     . GLY A 1 307 ? 60.724 -19.152 -0.899  1.00 13.58  ? 304 GLY A O     1 
ATOM   2489 N  N     . ILE A 1 308 ? 59.131 -20.740 -0.858  1.00 11.36  ? 305 ILE A N     1 
ATOM   2490 C  CA    . ILE A 1 308 ? 58.970 -20.807 -2.317  1.00 10.91  ? 305 ILE A CA    1 
ATOM   2491 C  C     . ILE A 1 308 ? 57.617 -20.247 -2.739  1.00 13.40  ? 305 ILE A C     1 
ATOM   2492 O  O     . ILE A 1 308 ? 56.579 -20.636 -2.198  1.00 13.79  ? 305 ILE A O     1 
ATOM   2493 C  CB    . ILE A 1 308 ? 59.068 -22.273 -2.803  1.00 14.67  ? 305 ILE A CB    1 
ATOM   2494 C  CG1   . ILE A 1 308 ? 60.432 -22.868 -2.436  1.00 17.91  ? 305 ILE A CG1   1 
ATOM   2495 C  CG2   . ILE A 1 308 ? 58.801 -22.376 -4.310  1.00 16.16  ? 305 ILE A CG2   1 
ATOM   2496 C  CD1   . ILE A 1 308 ? 60.554 -24.361 -2.745  1.00 21.91  ? 305 ILE A CD1   1 
ATOM   2497 N  N     . GLU A 1 309 ? 57.628 -19.342 -3.714  1.00 12.09  ? 306 GLU A N     1 
ATOM   2498 C  CA    . GLU A 1 309 ? 56.409 -18.708 -4.191  1.00 14.76  ? 306 GLU A CA    1 
ATOM   2499 C  C     . GLU A 1 309 ? 56.688 -18.300 -5.621  1.00 18.97  ? 306 GLU A C     1 
ATOM   2500 O  O     . GLU A 1 309 ? 57.799 -17.889 -5.932  1.00 18.10  ? 306 GLU A O     1 
ATOM   2501 C  CB    . GLU A 1 309 ? 56.106 -17.458 -3.359  1.00 21.47  ? 306 GLU A CB    1 
ATOM   2502 C  CG    . GLU A 1 309 ? 54.639 -17.135 -3.273  1.00 29.62  ? 306 GLU A CG    1 
ATOM   2503 C  CD    . GLU A 1 309 ? 54.319 -15.679 -3.540  1.00 29.20  ? 306 GLU A CD    1 
ATOM   2504 O  OE1   . GLU A 1 309 ? 55.246 -14.828 -3.616  1.00 21.08  ? 306 GLU A OE1   1 
ATOM   2505 O  OE2   . GLU A 1 309 ? 53.113 -15.390 -3.671  1.00 35.55  ? 306 GLU A OE2   1 
ATOM   2506 N  N     . HIS A 1 310 ? 55.699 -18.417 -6.499  1.00 20.65  ? 307 HIS A N     1 
ATOM   2507 C  CA    . HIS A 1 310 ? 55.961 -18.172 -7.915  1.00 17.68  ? 307 HIS A CA    1 
ATOM   2508 C  C     . HIS A 1 310 ? 55.177 -17.010 -8.515  1.00 17.17  ? 307 HIS A C     1 
ATOM   2509 O  O     . HIS A 1 310 ? 55.286 -16.763 -9.720  1.00 23.84  ? 307 HIS A O     1 
ATOM   2510 C  CB    . HIS A 1 310 ? 55.738 -19.448 -8.723  1.00 38.50  ? 307 HIS A CB    1 
ATOM   2511 C  CG    . HIS A 1 310 ? 56.638 -20.573 -8.319  1.00 44.89  ? 307 HIS A CG    1 
ATOM   2512 N  ND1   . HIS A 1 310 ? 58.012 -20.461 -8.318  1.00 43.70  ? 307 HIS A ND1   1 
ATOM   2513 C  CD2   . HIS A 1 310 ? 56.362 -21.827 -7.893  1.00 47.93  ? 307 HIS A CD2   1 
ATOM   2514 C  CE1   . HIS A 1 310 ? 58.543 -21.601 -7.914  1.00 48.86  ? 307 HIS A CE1   1 
ATOM   2515 N  NE2   . HIS A 1 310 ? 57.564 -22.447 -7.651  1.00 49.31  ? 307 HIS A NE2   1 
ATOM   2516 N  N     . ASP A 1 311 ? 54.399 -16.300 -7.703  1.00 16.81  ? 308 ASP A N     1 
ATOM   2517 C  CA    . ASP A 1 311 ? 53.605 -15.180 -8.204  1.00 14.37  ? 308 ASP A CA    1 
ATOM   2518 C  C     . ASP A 1 311 ? 54.509 -14.173 -8.910  1.00 19.44  ? 308 ASP A C     1 
ATOM   2519 O  O     . ASP A 1 311 ? 55.461 -13.656 -8.326  1.00 18.13  ? 308 ASP A O     1 
ATOM   2520 C  CB    . ASP A 1 311 ? 52.883 -14.490 -7.056  1.00 18.82  ? 308 ASP A CB    1 
ATOM   2521 C  CG    . ASP A 1 311 ? 51.933 -13.408 -7.530  1.00 28.10  ? 308 ASP A CG    1 
ATOM   2522 O  OD1   . ASP A 1 311 ? 51.826 -12.369 -6.852  1.00 37.67  ? 308 ASP A OD1   1 
ATOM   2523 O  OD2   . ASP A 1 311 ? 51.293 -13.602 -8.583  1.00 31.97  ? 308 ASP A OD2   1 
ATOM   2524 N  N     . PRO A 1 312 ? 54.227 -13.889 -10.182 1.00 15.54  ? 309 PRO A N     1 
ATOM   2525 C  CA    . PRO A 1 312 ? 55.147 -12.981 -10.867 1.00 10.16  ? 309 PRO A CA    1 
ATOM   2526 C  C     . PRO A 1 312 ? 54.978 -11.517 -10.504 1.00 12.26  ? 309 PRO A C     1 
ATOM   2527 O  O     . PRO A 1 312 ? 53.912 -11.065 -10.073 1.00 17.05  ? 309 PRO A O     1 
ATOM   2528 C  CB    . PRO A 1 312 ? 54.808 -13.197 -12.349 1.00 16.89  ? 309 PRO A CB    1 
ATOM   2529 C  CG    . PRO A 1 312 ? 53.397 -13.698 -12.343 1.00 20.04  ? 309 PRO A CG    1 
ATOM   2530 C  CD    . PRO A 1 312 ? 53.245 -14.507 -11.092 1.00 15.31  ? 309 PRO A CD    1 
ATOM   2531 N  N     . VAL A 1 313 ? 56.068 -10.762 -10.647 1.00 14.98  ? 310 VAL A N     1 
ATOM   2532 C  CA    . VAL A 1 313 ? 55.995 -9.317  -10.607 1.00 9.57   ? 310 VAL A CA    1 
ATOM   2533 C  C     . VAL A 1 313 ? 55.330 -8.889  -11.908 1.00 14.75  ? 310 VAL A C     1 
ATOM   2534 O  O     . VAL A 1 313 ? 55.891 -9.089  -12.981 1.00 17.77  ? 310 VAL A O     1 
ATOM   2535 C  CB    . VAL A 1 313 ? 57.391 -8.692  -10.507 1.00 15.30  ? 310 VAL A CB    1 
ATOM   2536 C  CG1   . VAL A 1 313 ? 57.287 -7.177  -10.514 1.00 13.31  ? 310 VAL A CG1   1 
ATOM   2537 C  CG2   . VAL A 1 313 ? 58.093 -9.170  -9.229  1.00 15.99  ? 310 VAL A CG2   1 
ATOM   2538 N  N     . LYS A 1 314 ? 54.120 -8.359  -11.809 1.00 16.61  ? 311 LYS A N     1 
ATOM   2539 C  CA    . LYS A 1 314 ? 53.374 -8.015  -13.009 1.00 13.08  ? 311 LYS A CA    1 
ATOM   2540 C  C     . LYS A 1 314 ? 53.803 -6.651  -13.525 1.00 14.20  ? 311 LYS A C     1 
ATOM   2541 O  O     . LYS A 1 314 ? 53.975 -5.711  -12.748 1.00 18.27  ? 311 LYS A O     1 
ATOM   2542 C  CB    . LYS A 1 314 ? 51.882 -8.055  -12.705 1.00 19.35  ? 311 LYS A CB    1 
ATOM   2543 C  CG    . LYS A 1 314 ? 51.451 -9.466  -12.298 1.00 27.37  ? 311 LYS A CG    1 
ATOM   2544 C  CD    . LYS A 1 314 ? 50.084 -9.515  -11.661 1.00 40.54  ? 311 LYS A CD    1 
ATOM   2545 C  CE    . LYS A 1 314 ? 49.780 -10.938 -11.210 1.00 43.67  ? 311 LYS A CE    1 
ATOM   2546 N  NZ    . LYS A 1 314 ? 50.840 -11.479 -10.297 1.00 40.85  ? 311 LYS A NZ    1 
ATOM   2547 N  N     . PRO A 1 315 ? 53.987 -6.536  -14.842 1.00 14.61  ? 312 PRO A N     1 
ATOM   2548 C  CA    . PRO A 1 315 ? 54.363 -5.247  -15.422 1.00 12.12  ? 312 PRO A CA    1 
ATOM   2549 C  C     . PRO A 1 315 ? 53.173 -4.302  -15.432 1.00 18.40  ? 312 PRO A C     1 
ATOM   2550 O  O     . PRO A 1 315 ? 52.450 -4.222  -16.431 1.00 21.48  ? 312 PRO A O     1 
ATOM   2551 C  CB    . PRO A 1 315 ? 54.773 -5.620  -16.848 1.00 19.84  ? 312 PRO A CB    1 
ATOM   2552 C  CG    . PRO A 1 315 ? 53.952 -6.839  -17.165 1.00 19.56  ? 312 PRO A CG    1 
ATOM   2553 C  CD    . PRO A 1 315 ? 53.895 -7.602  -15.859 1.00 16.46  ? 312 PRO A CD    1 
ATOM   2554 N  N     . ARG A 1 316 ? 52.975 -3.582  -14.331 1.00 15.18  ? 313 ARG A N     1 
ATOM   2555 C  CA    . ARG A 1 316 ? 51.857 -2.655  -14.206 1.00 10.64  ? 313 ARG A CA    1 
ATOM   2556 C  C     . ARG A 1 316 ? 52.213 -1.511  -13.267 1.00 18.91  ? 313 ARG A C     1 
ATOM   2557 O  O     . ARG A 1 316 ? 52.352 -1.718  -12.063 1.00 18.53  ? 313 ARG A O     1 
ATOM   2558 C  CB    A ARG A 1 316 ? 50.631 -3.399  -13.669 0.50 18.78  ? 313 ARG A CB    1 
ATOM   2559 C  CB    B ARG A 1 316 ? 50.599 -3.368  -13.721 0.50 19.61  ? 313 ARG A CB    1 
ATOM   2560 C  CG    A ARG A 1 316 ? 49.372 -2.549  -13.545 0.50 19.87  ? 313 ARG A CG    1 
ATOM   2561 C  CG    B ARG A 1 316 ? 49.381 -2.460  -13.690 0.50 20.25  ? 313 ARG A CG    1 
ATOM   2562 C  CD    A ARG A 1 316 ? 48.262 -3.286  -12.801 0.50 20.98  ? 313 ARG A CD    1 
ATOM   2563 C  CD    B ARG A 1 316 ? 48.164 -3.169  -13.142 0.50 19.93  ? 313 ARG A CD    1 
ATOM   2564 N  NE    A ARG A 1 316 ? 48.485 -3.297  -11.358 0.50 22.62  ? 313 ARG A NE    1 
ATOM   2565 N  NE    B ARG A 1 316 ? 48.406 -3.680  -11.798 0.50 19.98  ? 313 ARG A NE    1 
ATOM   2566 C  CZ    A ARG A 1 316 ? 48.747 -4.387  -10.639 0.50 25.44  ? 313 ARG A CZ    1 
ATOM   2567 C  CZ    B ARG A 1 316 ? 48.490 -2.919  -10.710 0.50 22.71  ? 313 ARG A CZ    1 
ATOM   2568 N  NH1   A ARG A 1 316 ? 48.944 -4.285  -9.331  0.50 26.56  ? 313 ARG A NH1   1 
ATOM   2569 N  NH1   B ARG A 1 316 ? 48.716 -3.479  -9.528  0.50 23.94  ? 313 ARG A NH1   1 
ATOM   2570 N  NH2   A ARG A 1 316 ? 48.807 -5.578  -11.221 0.50 28.25  ? 313 ARG A NH2   1 
ATOM   2571 N  NH2   B ARG A 1 316 ? 48.357 -1.601  -10.799 0.50 20.19  ? 313 ARG A NH2   1 
ATOM   2572 N  N     . GLN A 1 317 ? 52.347 -0.309  -13.814 1.00 17.21  ? 314 GLN A N     1 
ATOM   2573 C  CA    . GLN A 1 317 ? 52.772 0.848   -13.034 1.00 17.64  ? 314 GLN A CA    1 
ATOM   2574 C  C     . GLN A 1 317 ? 51.598 1.746   -12.648 1.00 21.36  ? 314 GLN A C     1 
ATOM   2575 O  O     . GLN A 1 317 ? 51.687 2.541   -11.702 1.00 26.19  ? 314 GLN A O     1 
ATOM   2576 C  CB    . GLN A 1 317 ? 53.787 1.647   -13.847 1.00 31.58  ? 314 GLN A CB    1 
ATOM   2577 C  CG    . GLN A 1 317 ? 54.454 2.766   -13.095 1.00 41.82  ? 314 GLN A CG    1 
ATOM   2578 C  CD    . GLN A 1 317 ? 55.500 3.466   -13.928 1.00 42.55  ? 314 GLN A CD    1 
ATOM   2579 O  OE1   . GLN A 1 317 ? 55.926 2.958   -14.971 1.00 45.31  ? 314 GLN A OE1   1 
ATOM   2580 N  NE2   . GLN A 1 317 ? 55.922 4.640   -13.479 1.00 40.69  ? 314 GLN A NE2   1 
ATOM   2581 N  N     . LEU A 1 318 ? 50.493 1.614   -13.377 1.00 16.63  ? 315 LEU A N     1 
ATOM   2582 C  CA    . LEU A 1 318 ? 49.323 2.457   -13.176 1.00 12.53  ? 315 LEU A CA    1 
ATOM   2583 C  C     . LEU A 1 318 ? 48.215 1.663   -12.504 1.00 16.04  ? 315 LEU A C     1 
ATOM   2584 O  O     . LEU A 1 318 ? 48.051 0.466   -12.768 1.00 18.38  ? 315 LEU A O     1 
ATOM   2585 C  CB    . LEU A 1 318 ? 48.794 2.924   -14.532 1.00 17.78  ? 315 LEU A CB    1 
ATOM   2586 C  CG    . LEU A 1 318 ? 49.703 3.716   -15.475 1.00 22.88  ? 315 LEU A CG    1 
ATOM   2587 C  CD1   . LEU A 1 318 ? 49.016 3.901   -16.828 1.00 21.60  ? 315 LEU A CD1   1 
ATOM   2588 C  CD2   . LEU A 1 318 ? 50.054 5.060   -14.852 1.00 23.11  ? 315 LEU A CD2   1 
ATOM   2589 N  N     . PRO A 1 319 ? 47.410 2.327   -11.662 1.00 16.59  ? 316 PRO A N     1 
ATOM   2590 C  CA    . PRO A 1 319 ? 46.237 1.657   -11.093 1.00 11.64  ? 316 PRO A CA    1 
ATOM   2591 C  C     . PRO A 1 319 ? 45.244 1.234   -12.178 1.00 16.23  ? 316 PRO A C     1 
ATOM   2592 O  O     . PRO A 1 319 ? 45.144 1.906   -13.198 1.00 19.12  ? 316 PRO A O     1 
ATOM   2593 C  CB    . PRO A 1 319 ? 45.636 2.708   -10.148 1.00 20.69  ? 316 PRO A CB    1 
ATOM   2594 C  CG    . PRO A 1 319 ? 46.242 4.001   -10.534 1.00 25.56  ? 316 PRO A CG    1 
ATOM   2595 C  CD    . PRO A 1 319 ? 47.542 3.730   -11.229 1.00 17.66  ? 316 PRO A CD    1 
ATOM   2596 N  N     . LYS A 1 320 ? 44.537 0.128   -11.949 1.00 16.95  ? 317 LYS A N     1 
ATOM   2597 C  CA    . LYS A 1 320 ? 43.575 -0.434  -12.905 1.00 12.29  ? 317 LYS A CA    1 
ATOM   2598 C  C     . LYS A 1 320 ? 42.182 0.149   -12.734 1.00 19.29  ? 317 LYS A C     1 
ATOM   2599 O  O     . LYS A 1 320 ? 41.285 -0.134  -13.530 1.00 21.34  ? 317 LYS A O     1 
ATOM   2600 C  CB    . LYS A 1 320 ? 43.420 -1.941  -12.662 1.00 32.93  ? 317 LYS A CB    1 
ATOM   2601 C  CG    . LYS A 1 320 ? 44.638 -2.800  -12.895 1.00 38.70  ? 317 LYS A CG    1 
ATOM   2602 C  CD    . LYS A 1 320 ? 44.247 -4.267  -12.746 1.00 44.25  ? 317 LYS A CD    1 
ATOM   2603 C  CE    . LYS A 1 320 ? 45.332 -5.193  -13.253 1.00 51.44  ? 317 LYS A CE    1 
ATOM   2604 N  NZ    . LYS A 1 320 ? 44.874 -6.608  -13.269 1.00 53.31  ? 317 LYS A NZ    1 
ATOM   2605 N  N     . THR A 1 321 ? 41.982 0.891   -11.651 1.00 17.65  ? 318 THR A N     1 
ATOM   2606 C  CA    . THR A 1 321 ? 40.693 1.496   -11.359 1.00 12.49  ? 318 THR A CA    1 
ATOM   2607 C  C     . THR A 1 321 ? 40.934 2.870   -10.781 1.00 18.66  ? 318 THR A C     1 
ATOM   2608 O  O     . THR A 1 321 ? 42.015 3.161   -10.248 1.00 19.67  ? 318 THR A O     1 
ATOM   2609 C  CB    . THR A 1 321 ? 39.844 0.645   -10.382 1.00 20.90  ? 318 THR A CB    1 
ATOM   2610 O  OG1   . THR A 1 321 ? 40.541 0.469   -9.140  1.00 21.47  ? 318 THR A OG1   1 
ATOM   2611 C  CG2   . THR A 1 321 ? 39.512 -0.722  -10.985 1.00 21.36  ? 318 THR A CG2   1 
ATOM   2612 N  N     . ILE A 1 322 ? 39.936 3.728   -10.934 1.00 15.98  ? 319 ILE A N     1 
ATOM   2613 C  CA    . ILE A 1 322 ? 39.978 5.061   -10.372 1.00 12.65  ? 319 ILE A CA    1 
ATOM   2614 C  C     . ILE A 1 322 ? 38.650 5.275   -9.676  1.00 16.83  ? 319 ILE A C     1 
ATOM   2615 O  O     . ILE A 1 322 ? 37.603 5.285   -10.320 1.00 18.77  ? 319 ILE A O     1 
ATOM   2616 C  CB    . ILE A 1 322 ? 40.199 6.119   -11.473 1.00 13.56  ? 319 ILE A CB    1 
ATOM   2617 C  CG1   . ILE A 1 322 ? 41.569 5.929   -12.139 1.00 19.49  ? 319 ILE A CG1   1 
ATOM   2618 C  CG2   . ILE A 1 322 ? 40.051 7.530   -10.905 1.00 19.66  ? 319 ILE A CG2   1 
ATOM   2619 C  CD1   . ILE A 1 322 ? 41.865 6.949   -13.225 1.00 20.97  ? 319 ILE A CD1   1 
ATOM   2620 N  N     . GLY A 1 323 ? 38.687 5.392   -8.352  1.00 16.56  ? 320 GLY A N     1 
ATOM   2621 C  CA    . GLY A 1 323 ? 37.470 5.451   -7.571  1.00 14.90  ? 320 GLY A CA    1 
ATOM   2622 C  C     . GLY A 1 323 ? 37.417 6.595   -6.586  1.00 15.56  ? 320 GLY A C     1 
ATOM   2623 O  O     . GLY A 1 323 ? 38.445 7.151   -6.198  1.00 17.28  ? 320 GLY A O     1 
ATOM   2624 N  N     . CYS A 1 324 ? 36.190 6.904   -6.175  1.00 15.31  ? 321 CYS A N     1 
ATOM   2625 C  CA    A CYS A 1 324 ? 35.888 8.006   -5.269  0.31 14.40  ? 321 CYS A CA    1 
ATOM   2626 C  CA    B CYS A 1 324 ? 35.885 8.007   -5.252  0.48 14.52  ? 321 CYS A CA    1 
ATOM   2627 C  CA    C CYS A 1 324 ? 35.986 7.914   -5.163  0.22 12.92  ? 321 CYS A CA    1 
ATOM   2628 C  C     . CYS A 1 324 ? 34.804 7.515   -4.305  1.00 16.12  ? 321 CYS A C     1 
ATOM   2629 O  O     . CYS A 1 324 ? 33.776 7.021   -4.770  1.00 20.44  ? 321 CYS A O     1 
ATOM   2630 C  CB    A CYS A 1 324 ? 35.337 9.168   -6.108  0.31 18.62  ? 321 CYS A CB    1 
ATOM   2631 C  CB    B CYS A 1 324 ? 35.309 9.216   -6.013  0.48 17.39  ? 321 CYS A CB    1 
ATOM   2632 C  CB    C CYS A 1 324 ? 35.788 9.298   -5.782  0.22 21.17  ? 321 CYS A CB    1 
ATOM   2633 S  SG    A CYS A 1 324 ? 35.453 10.815  -5.402  0.31 20.63  ? 321 CYS A SG    1 
ATOM   2634 S  SG    B CYS A 1 324 ? 36.380 9.989   -7.237  0.48 22.18  ? 321 CYS A SG    1 
ATOM   2635 S  SG    C CYS A 1 324 ? 34.302 9.462   -6.760  0.22 22.41  ? 321 CYS A SG    1 
ATOM   2636 N  N     . SER A 1 325 ? 34.993 7.673   -2.996  1.00 14.91  ? 322 SER A N     1 
ATOM   2637 C  CA    A SER A 1 325 ? 33.995 7.188   -2.051  0.66 13.25  ? 322 SER A CA    1 
ATOM   2638 C  CA    B SER A 1 325 ? 34.071 7.124   -2.011  0.34 15.42  ? 322 SER A CA    1 
ATOM   2639 C  C     . SER A 1 325 ? 33.899 8.089   -0.840  1.00 17.58  ? 322 SER A C     1 
ATOM   2640 O  O     . SER A 1 325 ? 34.844 8.803   -0.490  1.00 19.87  ? 322 SER A O     1 
ATOM   2641 C  CB    A SER A 1 325 ? 34.317 5.765   -1.602  0.66 24.70  ? 322 SER A CB    1 
ATOM   2642 C  CB    B SER A 1 325 ? 34.622 5.784   -1.515  0.34 23.38  ? 322 SER A CB    1 
ATOM   2643 O  OG    A SER A 1 325 ? 35.495 5.751   -0.823  0.66 19.15  ? 322 SER A OG    1 
ATOM   2644 O  OG    B SER A 1 325 ? 33.946 5.317   -0.364  0.34 21.24  ? 322 SER A OG    1 
ATOM   2645 N  N     . LYS A 1 326 ? 32.723 8.078   -0.218  1.00 15.80  ? 323 LYS A N     1 
ATOM   2646 C  CA    . LYS A 1 326 ? 32.516 8.828   1.010   1.00 13.36  ? 323 LYS A CA    1 
ATOM   2647 C  C     . LYS A 1 326 ? 31.554 8.090   1.921   1.00 17.97  ? 323 LYS A C     1 
ATOM   2648 O  O     . LYS A 1 326 ? 30.523 7.572   1.472   1.00 18.28  ? 323 LYS A O     1 
ATOM   2649 C  CB    . LYS A 1 326 ? 31.992 10.240  0.742   1.00 17.90  ? 323 LYS A CB    1 
ATOM   2650 C  CG    . LYS A 1 326 ? 31.919 11.088  2.028   1.00 19.12  ? 323 LYS A CG    1 
ATOM   2651 C  CD    . LYS A 1 326 ? 31.735 12.561  1.722   1.00 24.76  ? 323 LYS A CD    1 
ATOM   2652 C  CE    . LYS A 1 326 ? 31.516 13.359  2.997   1.00 30.08  ? 323 LYS A CE    1 
ATOM   2653 N  NZ    . LYS A 1 326 ? 32.602 13.102  3.969   1.00 34.81  ? 323 LYS A NZ    1 
ATOM   2654 N  N     . ASN A 1 327 ? 31.919 8.022   3.197   1.00 17.71  ? 324 ASN A N     1 
ATOM   2655 C  CA    . ASN A 1 327 ? 31.050 7.511   4.248   1.00 18.51  ? 324 ASN A CA    1 
ATOM   2656 C  C     . ASN A 1 327 ? 30.200 8.629   4.834   1.00 20.24  ? 324 ASN A C     1 
ATOM   2657 O  O     . ASN A 1 327 ? 30.608 9.792   4.854   1.00 19.67  ? 324 ASN A O     1 
ATOM   2658 C  CB    . ASN A 1 327 ? 31.880 6.911   5.389   1.00 23.57  ? 324 ASN A CB    1 
ATOM   2659 C  CG    . ASN A 1 327 ? 32.569 5.615   5.008   1.00 28.30  ? 324 ASN A CG    1 
ATOM   2660 O  OD1   . ASN A 1 327 ? 32.417 5.106   3.896   1.00 31.89  ? 324 ASN A OD1   1 
ATOM   2661 N  ND2   . ASN A 1 327 ? 33.351 5.078   5.937   1.00 34.00  ? 324 ASN A ND2   1 
ATOM   2662 N  N     . PHE A 1 328 ? 29.025 8.251   5.327   1.00 22.49  ? 325 PHE A N     1 
ATOM   2663 C  CA    . PHE A 1 328 ? 28.085 9.169   5.951   1.00 21.70  ? 325 PHE A CA    1 
ATOM   2664 C  C     . PHE A 1 328 ? 27.606 8.494   7.222   1.00 27.32  ? 325 PHE A C     1 
ATOM   2665 O  O     . PHE A 1 328 ? 26.518 7.922   7.260   1.00 28.19  ? 325 PHE A O     1 
ATOM   2666 C  CB    . PHE A 1 328 ? 26.927 9.454   4.993   1.00 29.08  ? 325 PHE A CB    1 
ATOM   2667 C  CG    . PHE A 1 328 ? 27.375 10.035  3.688   1.00 23.92  ? 325 PHE A CG    1 
ATOM   2668 C  CD1   . PHE A 1 328 ? 27.599 9.220   2.589   1.00 25.26  ? 325 PHE A CD1   1 
ATOM   2669 C  CD2   . PHE A 1 328 ? 27.612 11.394  3.570   1.00 23.85  ? 325 PHE A CD2   1 
ATOM   2670 C  CE1   . PHE A 1 328 ? 28.036 9.759   1.389   1.00 18.96  ? 325 PHE A CE1   1 
ATOM   2671 C  CE2   . PHE A 1 328 ? 28.046 11.942  2.384   1.00 20.85  ? 325 PHE A CE2   1 
ATOM   2672 C  CZ    . PHE A 1 328 ? 28.264 11.123  1.282   1.00 22.64  ? 325 PHE A CZ    1 
ATOM   2673 N  N     . PRO A 1 329 ? 28.446 8.543   8.264   1.00 31.44  ? 326 PRO A N     1 
ATOM   2674 C  CA    . PRO A 1 329 ? 28.260 7.778   9.499   1.00 32.31  ? 326 PRO A CA    1 
ATOM   2675 C  C     . PRO A 1 329 ? 27.188 8.347   10.417  1.00 39.69  ? 326 PRO A C     1 
ATOM   2676 O  O     . PRO A 1 329 ? 26.879 9.540   10.365  1.00 31.72  ? 326 PRO A O     1 
ATOM   2677 C  CB    . PRO A 1 329 ? 29.623 7.890   10.178  1.00 29.87  ? 326 PRO A CB    1 
ATOM   2678 C  CG    . PRO A 1 329 ? 30.147 9.214   9.718   1.00 32.49  ? 326 PRO A CG    1 
ATOM   2679 C  CD    . PRO A 1 329 ? 29.684 9.342   8.290   1.00 30.68  ? 326 PRO A CD    1 
ATOM   2680 N  N     . GLY A 1 330 ? 26.643 7.473   11.256  1.00 42.61  ? 327 GLY A N     1 
ATOM   2681 C  CA    . GLY A 1 330 ? 25.694 7.858   12.282  1.00 47.50  ? 327 GLY A CA    1 
ATOM   2682 C  C     . GLY A 1 330 ? 24.600 8.777   11.783  1.00 38.70  ? 327 GLY A C     1 
ATOM   2683 O  O     . GLY A 1 330 ? 23.854 8.438   10.862  1.00 37.44  ? 327 GLY A O     1 
ATOM   2684 N  N     . LYS A 1 331 ? 24.521 9.954   12.393  1.00 39.51  ? 328 LYS A N     1 
ATOM   2685 C  CA    . LYS A 1 331 ? 23.440 10.893  12.129  1.00 53.19  ? 328 LYS A CA    1 
ATOM   2686 C  C     . LYS A 1 331 ? 23.548 11.568  10.761  1.00 39.79  ? 328 LYS A C     1 
ATOM   2687 O  O     . LYS A 1 331 ? 22.593 12.194  10.303  1.00 40.30  ? 328 LYS A O     1 
ATOM   2688 C  CB    . LYS A 1 331 ? 23.383 11.944  13.243  1.00 103.49 ? 328 LYS A CB    1 
ATOM   2689 C  CG    . LYS A 1 331 ? 22.246 12.945  13.121  1.00 106.68 ? 328 LYS A CG    1 
ATOM   2690 C  CD    . LYS A 1 331 ? 22.170 13.838  14.351  1.00 108.52 ? 328 LYS A CD    1 
ATOM   2691 C  CE    . LYS A 1 331 ? 21.153 14.953  14.168  1.00 109.33 ? 328 LYS A CE    1 
ATOM   2692 N  NZ    . LYS A 1 331 ? 21.551 15.884  13.077  1.00 108.78 ? 328 LYS A NZ    1 
ATOM   2693 N  N     . THR A 1 332 ? 24.697 11.441  10.101  1.00 36.34  ? 329 THR A N     1 
ATOM   2694 C  CA    . THR A 1 332 ? 24.888 12.120  8.817   1.00 34.38  ? 329 THR A CA    1 
ATOM   2695 C  C     . THR A 1 332 ? 24.417 11.290  7.615   1.00 33.38  ? 329 THR A C     1 
ATOM   2696 O  O     . THR A 1 332 ? 24.500 11.743  6.476   1.00 32.79  ? 329 THR A O     1 
ATOM   2697 C  CB    . THR A 1 332 ? 26.351 12.566  8.594   1.00 35.70  ? 329 THR A CB    1 
ATOM   2698 O  OG1   . THR A 1 332 ? 27.154 11.441  8.213   1.00 34.19  ? 329 THR A OG1   1 
ATOM   2699 C  CG2   . THR A 1 332 ? 26.922 13.206  9.854   1.00 39.91  ? 329 THR A CG2   1 
ATOM   2700 N  N     . ALA A 1 333 ? 23.918 10.086  7.877   1.00 30.78  ? 330 ALA A N     1 
ATOM   2701 C  CA    . ALA A 1 333 ? 23.420 9.213   6.813   1.00 31.08  ? 330 ALA A CA    1 
ATOM   2702 C  C     . ALA A 1 333 ? 22.400 9.915   5.920   1.00 37.21  ? 330 ALA A C     1 
ATOM   2703 O  O     . ALA A 1 333 ? 21.533 10.643  6.403   1.00 41.29  ? 330 ALA A O     1 
ATOM   2704 C  CB    . ALA A 1 333 ? 22.833 7.932   7.399   1.00 35.79  ? 330 ALA A CB    1 
ATOM   2705 N  N     . LEU A 1 334 ? 22.503 9.681   4.617   1.00 30.34  ? 331 LEU A N     1 
ATOM   2706 C  CA    . LEU A 1 334 ? 21.694 10.395  3.638   1.00 27.55  ? 331 LEU A CA    1 
ATOM   2707 C  C     . LEU A 1 334 ? 20.252 9.893   3.629   1.00 32.00  ? 331 LEU A C     1 
ATOM   2708 O  O     . LEU A 1 334 ? 19.996 8.727   3.342   1.00 36.84  ? 331 LEU A O     1 
ATOM   2709 C  CB    . LEU A 1 334 ? 22.302 10.239  2.248   1.00 27.28  ? 331 LEU A CB    1 
ATOM   2710 C  CG    . LEU A 1 334 ? 23.796 10.554  2.164   1.00 24.32  ? 331 LEU A CG    1 
ATOM   2711 C  CD1   . LEU A 1 334 ? 24.251 10.480  0.713   1.00 27.02  ? 331 LEU A CD1   1 
ATOM   2712 C  CD2   . LEU A 1 334 ? 24.088 11.920  2.768   1.00 24.89  ? 331 LEU A CD2   1 
ATOM   2713 N  N     . ALA A 1 335 ? 19.316 10.787  3.925   1.00 34.74  ? 332 ALA A N     1 
ATOM   2714 C  CA    . ALA A 1 335 ? 17.926 10.394  4.151   1.00 38.51  ? 332 ALA A CA    1 
ATOM   2715 C  C     . ALA A 1 335 ? 16.942 11.051  3.187   1.00 39.63  ? 332 ALA A C     1 
ATOM   2716 O  O     . ALA A 1 335 ? 15.736 10.812  3.269   1.00 39.04  ? 332 ALA A O     1 
ATOM   2717 C  CB    . ALA A 1 335 ? 17.531 10.682  5.591   1.00 46.93  ? 332 ALA A CB    1 
ATOM   2718 N  N     . THR A 1 336 ? 17.453 11.879  2.283   1.00 34.03  ? 333 THR A N     1 
ATOM   2719 C  CA    . THR A 1 336 ? 16.624 12.491  1.256   1.00 33.74  ? 333 THR A CA    1 
ATOM   2720 C  C     . THR A 1 336 ? 17.212 12.244  -0.130  1.00 49.30  ? 333 THR A C     1 
ATOM   2721 O  O     . THR A 1 336 ? 18.419 12.045  -0.277  1.00 43.40  ? 333 THR A O     1 
ATOM   2722 C  CB    . THR A 1 336 ? 16.472 14.005  1.464   1.00 50.93  ? 333 THR A CB    1 
ATOM   2723 O  OG1   . THR A 1 336 ? 17.671 14.670  1.053   1.00 42.72  ? 333 THR A OG1   1 
ATOM   2724 C  CG2   . THR A 1 336 ? 16.183 14.322  2.928   1.00 52.30  ? 333 THR A CG2   1 
ATOM   2725 N  N     . ARG A 1 337 ? 16.352 12.258  -1.144  1.00 47.20  ? 334 ARG A N     1 
ATOM   2726 C  CA    . ARG A 1 337 ? 16.787 12.042  -2.521  1.00 35.49  ? 334 ARG A CA    1 
ATOM   2727 C  C     . ARG A 1 337 ? 17.718 13.157  -2.981  1.00 41.06  ? 334 ARG A C     1 
ATOM   2728 O  O     . ARG A 1 337 ? 18.732 12.901  -3.636  1.00 39.36  ? 334 ARG A O     1 
ATOM   2729 C  CB    . ARG A 1 337 ? 15.574 11.948  -3.448  1.00 77.56  ? 334 ARG A CB    1 
ATOM   2730 C  CG    . ARG A 1 337 ? 15.919 11.880  -4.925  1.00 82.50  ? 334 ARG A CG    1 
ATOM   2731 C  CD    . ARG A 1 337 ? 14.667 11.753  -5.778  1.00 90.18  ? 334 ARG A CD    1 
ATOM   2732 N  NE    . ARG A 1 337 ? 13.671 12.765  -5.438  1.00 98.77  ? 334 ARG A NE    1 
ATOM   2733 C  CZ    . ARG A 1 337 ? 13.726 14.033  -5.834  1.00 104.49 ? 334 ARG A CZ    1 
ATOM   2734 N  NH1   . ARG A 1 337 ? 14.738 14.452  -6.582  1.00 105.35 ? 334 ARG A NH1   1 
ATOM   2735 N  NH2   . ARG A 1 337 ? 12.774 14.884  -5.477  1.00 107.27 ? 334 ARG A NH2   1 
ATOM   2736 N  N     . GLU A 1 338 ? 17.369 14.394  -2.636  1.00 43.00  ? 335 GLU A N     1 
ATOM   2737 C  CA    . GLU A 1 338 ? 18.210 15.546  -2.948  1.00 43.76  ? 335 GLU A CA    1 
ATOM   2738 C  C     . GLU A 1 338 ? 19.620 15.367  -2.385  1.00 36.80  ? 335 GLU A C     1 
ATOM   2739 O  O     . GLU A 1 338 ? 20.610 15.660  -3.057  1.00 35.30  ? 335 GLU A O     1 
ATOM   2740 C  CB    . GLU A 1 338 ? 17.589 16.830  -2.393  1.00 95.26  ? 335 GLU A CB    1 
ATOM   2741 C  CG    . GLU A 1 338 ? 16.302 17.251  -3.084  1.00 99.28  ? 335 GLU A CG    1 
ATOM   2742 C  CD    . GLU A 1 338 ? 16.530 17.710  -4.513  1.00 100.72 ? 335 GLU A CD    1 
ATOM   2743 O  OE1   . GLU A 1 338 ? 17.703 17.896  -4.900  1.00 99.93  ? 335 GLU A OE1   1 
ATOM   2744 O  OE2   . GLU A 1 338 ? 15.535 17.887  -5.248  1.00 101.64 ? 335 GLU A OE2   1 
ATOM   2745 N  N     . GLN A 1 339 ? 19.701 14.895  -1.144  1.00 34.86  ? 336 GLN A N     1 
ATOM   2746 C  CA    . GLN A 1 339 ? 20.985 14.616  -0.508  1.00 32.06  ? 336 GLN A CA    1 
ATOM   2747 C  C     . GLN A 1 339 ? 21.784 13.587  -1.296  1.00 31.46  ? 336 GLN A C     1 
ATOM   2748 O  O     . GLN A 1 339 ? 22.965 13.793  -1.594  1.00 32.49  ? 336 GLN A O     1 
ATOM   2749 C  CB    . GLN A 1 339 ? 20.758 14.076  0.898   1.00 47.24  ? 336 GLN A CB    1 
ATOM   2750 C  CG    . GLN A 1 339 ? 21.091 15.031  2.010   1.00 42.12  ? 336 GLN A CG    1 
ATOM   2751 C  CD    . GLN A 1 339 ? 21.014 14.351  3.354   1.00 36.88  ? 336 GLN A CD    1 
ATOM   2752 O  OE1   . GLN A 1 339 ? 20.114 13.546  3.602   1.00 37.86  ? 336 GLN A OE1   1 
ATOM   2753 N  NE2   . GLN A 1 339 ? 21.970 14.649  4.225   1.00 31.88  ? 336 GLN A NE2   1 
ATOM   2754 N  N     . VAL A 1 340 ? 21.138 12.467  -1.611  1.00 30.68  ? 337 VAL A N     1 
ATOM   2755 C  CA    . VAL A 1 340 ? 21.791 11.383  -2.329  1.00 28.23  ? 337 VAL A CA    1 
ATOM   2756 C  C     . VAL A 1 340 ? 22.292 11.887  -3.672  1.00 28.08  ? 337 VAL A C     1 
ATOM   2757 O  O     . VAL A 1 340 ? 23.408 11.576  -4.088  1.00 27.27  ? 337 VAL A O     1 
ATOM   2758 C  CB    . VAL A 1 340 ? 20.839 10.190  -2.551  1.00 32.41  ? 337 VAL A CB    1 
ATOM   2759 C  CG1   . VAL A 1 340 ? 21.474 9.162   -3.479  1.00 27.09  ? 337 VAL A CG1   1 
ATOM   2760 C  CG2   . VAL A 1 340 ? 20.465 9.557   -1.224  1.00 34.00  ? 337 VAL A CG2   1 
ATOM   2761 N  N     . GLN A 1 341 ? 21.471 12.687  -4.343  1.00 33.45  ? 338 GLN A N     1 
ATOM   2762 C  CA    . GLN A 1 341 ? 21.837 13.195  -5.660  1.00 30.38  ? 338 GLN A CA    1 
ATOM   2763 C  C     . GLN A 1 341 ? 22.975 14.214  -5.604  1.00 30.74  ? 338 GLN A C     1 
ATOM   2764 O  O     . GLN A 1 341 ? 23.876 14.186  -6.439  1.00 31.16  ? 338 GLN A O     1 
ATOM   2765 C  CB    . GLN A 1 341 ? 20.612 13.755  -6.389  1.00 39.79  ? 338 GLN A CB    1 
ATOM   2766 C  CG    . GLN A 1 341 ? 19.575 12.683  -6.704  1.00 39.95  ? 338 GLN A CG    1 
ATOM   2767 C  CD    . GLN A 1 341 ? 18.351 13.226  -7.415  1.00 45.31  ? 338 GLN A CD    1 
ATOM   2768 O  OE1   . GLN A 1 341 ? 18.003 14.399  -7.280  1.00 47.15  ? 338 GLN A OE1   1 
ATOM   2769 N  NE2   . GLN A 1 341 ? 17.690 12.367  -8.184  1.00 44.64  ? 338 GLN A NE2   1 
ATOM   2770 N  N     . TRP A 1 342 ? 22.944 15.094  -4.608  1.00 26.68  ? 339 TRP A N     1 
ATOM   2771 C  CA    . TRP A 1 342 ? 23.990 16.094  -4.450  1.00 23.80  ? 339 TRP A CA    1 
ATOM   2772 C  C     . TRP A 1 342 ? 25.354 15.447  -4.216  1.00 25.08  ? 339 TRP A C     1 
ATOM   2773 O  O     . TRP A 1 342 ? 26.353 15.866  -4.803  1.00 22.97  ? 339 TRP A O     1 
ATOM   2774 C  CB    . TRP A 1 342 ? 23.660 17.057  -3.304  1.00 27.02  ? 339 TRP A CB    1 
ATOM   2775 C  CG    . TRP A 1 342 ? 24.584 18.236  -3.273  1.00 28.30  ? 339 TRP A CG    1 
ATOM   2776 C  CD1   . TRP A 1 342 ? 24.509 19.353  -4.053  1.00 36.17  ? 339 TRP A CD1   1 
ATOM   2777 C  CD2   . TRP A 1 342 ? 25.732 18.408  -2.437  1.00 25.12  ? 339 TRP A CD2   1 
ATOM   2778 N  NE1   . TRP A 1 342 ? 25.534 20.211  -3.750  1.00 31.09  ? 339 TRP A NE1   1 
ATOM   2779 C  CE2   . TRP A 1 342 ? 26.300 19.654  -2.759  1.00 28.02  ? 339 TRP A CE2   1 
ATOM   2780 C  CE3   . TRP A 1 342 ? 26.334 17.627  -1.446  1.00 22.93  ? 339 TRP A CE3   1 
ATOM   2781 C  CZ2   . TRP A 1 342 ? 27.442 20.139  -2.129  1.00 29.80  ? 339 TRP A CZ2   1 
ATOM   2782 C  CZ3   . TRP A 1 342 ? 27.459 18.110  -0.817  1.00 26.68  ? 339 TRP A CZ3   1 
ATOM   2783 C  CH2   . TRP A 1 342 ? 28.007 19.354  -1.162  1.00 29.07  ? 339 TRP A CH2   1 
ATOM   2784 N  N     . TRP A 1 343 ? 25.401 14.426  -3.364  1.00 22.28  ? 340 TRP A N     1 
ATOM   2785 C  CA    . TRP A 1 343 ? 26.673 13.770  -3.069  1.00 17.39  ? 340 TRP A CA    1 
ATOM   2786 C  C     . TRP A 1 343 ? 27.171 12.910  -4.230  1.00 18.66  ? 340 TRP A C     1 
ATOM   2787 O  O     . TRP A 1 343 ? 28.373 12.838  -4.480  1.00 21.17  ? 340 TRP A O     1 
ATOM   2788 C  CB    . TRP A 1 343 ? 26.605 12.963  -1.765  1.00 22.87  ? 340 TRP A CB    1 
ATOM   2789 C  CG    . TRP A 1 343 ? 26.723 13.821  -0.526  1.00 20.94  ? 340 TRP A CG    1 
ATOM   2790 C  CD1   . TRP A 1 343 ? 25.734 14.120  0.362   1.00 24.82  ? 340 TRP A CD1   1 
ATOM   2791 C  CD2   . TRP A 1 343 ? 27.900 14.493  -0.058  1.00 18.50  ? 340 TRP A CD2   1 
ATOM   2792 N  NE1   . TRP A 1 343 ? 26.223 14.934  1.360   1.00 24.87  ? 340 TRP A NE1   1 
ATOM   2793 C  CE2   . TRP A 1 343 ? 27.549 15.179  1.122   1.00 21.47  ? 340 TRP A CE2   1 
ATOM   2794 C  CE3   . TRP A 1 343 ? 29.216 14.579  -0.524  1.00 21.31  ? 340 TRP A CE3   1 
ATOM   2795 C  CZ2   . TRP A 1 343 ? 28.469 15.941  1.846   1.00 23.23  ? 340 TRP A CZ2   1 
ATOM   2796 C  CZ3   . TRP A 1 343 ? 30.125 15.344  0.193   1.00 21.33  ? 340 TRP A CZ3   1 
ATOM   2797 C  CH2   . TRP A 1 343 ? 29.746 16.007  1.370   1.00 23.50  ? 340 TRP A CH2   1 
ATOM   2798 N  N     . LEU A 1 344 ? 26.260 12.270  -4.958  1.00 21.89  ? 341 LEU A N     1 
ATOM   2799 C  CA    . LEU A 1 344 ? 26.686 11.520  -6.135  1.00 18.87  ? 341 LEU A CA    1 
ATOM   2800 C  C     . LEU A 1 344 ? 27.339 12.480  -7.121  1.00 24.44  ? 341 LEU A C     1 
ATOM   2801 O  O     . LEU A 1 344 ? 28.324 12.143  -7.787  1.00 19.40  ? 341 LEU A O     1 
ATOM   2802 C  CB    . LEU A 1 344 ? 25.514 10.799  -6.811  1.00 23.21  ? 341 LEU A CB    1 
ATOM   2803 C  CG    . LEU A 1 344 ? 24.982 9.537   -6.123  1.00 26.73  ? 341 LEU A CG    1 
ATOM   2804 C  CD1   . LEU A 1 344 ? 23.721 9.029   -6.827  1.00 28.60  ? 341 LEU A CD1   1 
ATOM   2805 C  CD2   . LEU A 1 344 ? 26.034 8.452   -6.056  1.00 26.86  ? 341 LEU A CD2   1 
ATOM   2806 N  N     . LEU A 1 345 ? 26.796 13.686  -7.210  1.00 24.37  ? 342 LEU A N     1 
ATOM   2807 C  CA    . LEU A 1 345 ? 27.374 14.693  -8.086  1.00 20.88  ? 342 LEU A CA    1 
ATOM   2808 C  C     . LEU A 1 345 ? 28.774 15.115  -7.618  1.00 24.75  ? 342 LEU A C     1 
ATOM   2809 O  O     . LEU A 1 345 ? 29.681 15.281  -8.428  1.00 21.50  ? 342 LEU A O     1 
ATOM   2810 C  CB    . LEU A 1 345 ? 26.453 15.914  -8.194  1.00 24.54  ? 342 LEU A CB    1 
ATOM   2811 C  CG    . LEU A 1 345 ? 26.944 17.023  -9.128  1.00 25.71  ? 342 LEU A CG    1 
ATOM   2812 C  CD1   . LEU A 1 345 ? 27.130 16.493  -10.563 1.00 24.73  ? 342 LEU A CD1   1 
ATOM   2813 C  CD2   . LEU A 1 345 ? 25.991 18.212  -9.106  1.00 31.20  ? 342 LEU A CD2   1 
ATOM   2814 N  N     . GLN A 1 346 ? 28.955 15.296  -6.314  1.00 20.01  ? 343 GLN A N     1 
ATOM   2815 C  CA    . GLN A 1 346 ? 30.264 15.675  -5.802  1.00 17.32  ? 343 GLN A CA    1 
ATOM   2816 C  C     . GLN A 1 346 ? 31.300 14.610  -6.140  1.00 21.23  ? 343 GLN A C     1 
ATOM   2817 O  O     . GLN A 1 346 ? 32.389 14.922  -6.626  1.00 18.72  ? 343 GLN A O     1 
ATOM   2818 C  CB    . GLN A 1 346 ? 30.246 15.900  -4.288  1.00 20.88  ? 343 GLN A CB    1 
ATOM   2819 C  CG    . GLN A 1 346 ? 29.192 16.910  -3.800  1.00 18.05  ? 343 GLN A CG    1 
ATOM   2820 C  CD    . GLN A 1 346 ? 29.145 18.170  -4.647  1.00 23.34  ? 343 GLN A CD    1 
ATOM   2821 O  OE1   . GLN A 1 346 ? 30.095 18.952  -4.678  1.00 25.65  ? 343 GLN A OE1   1 
ATOM   2822 N  NE2   . GLN A 1 346 ? 28.023 18.375  -5.337  1.00 25.65  ? 343 GLN A NE2   1 
ATOM   2823 N  N     . LEU A 1 347 ? 30.956 13.354  -5.869  1.00 21.71  ? 344 LEU A N     1 
ATOM   2824 C  CA    . LEU A 1 347 ? 31.842 12.238  -6.186  1.00 18.32  ? 344 LEU A CA    1 
ATOM   2825 C  C     . LEU A 1 347 ? 32.138 12.197  -7.680  1.00 18.69  ? 344 LEU A C     1 
ATOM   2826 O  O     . LEU A 1 347 ? 33.278 11.994  -8.086  1.00 17.86  ? 344 LEU A O     1 
ATOM   2827 C  CB    . LEU A 1 347 ? 31.241 10.902  -5.739  1.00 15.65  ? 344 LEU A CB    1 
ATOM   2828 C  CG    . LEU A 1 347 ? 31.262 10.613  -4.241  1.00 25.45  ? 344 LEU A CG    1 
ATOM   2829 C  CD1   . LEU A 1 347 ? 30.576 9.292   -3.944  1.00 29.19  ? 344 LEU A CD1   1 
ATOM   2830 C  CD2   . LEU A 1 347 ? 32.677 10.595  -3.741  1.00 30.42  ? 344 LEU A CD2   1 
ATOM   2831 N  N     . ALA A 1 348 ? 31.110 12.405  -8.495  1.00 20.30  ? 345 ALA A N     1 
ATOM   2832 C  CA    . ALA A 1 348 ? 31.265 12.287  -9.941  1.00 18.04  ? 345 ALA A CA    1 
ATOM   2833 C  C     . ALA A 1 348 ? 32.130 13.417  -10.505 1.00 18.55  ? 345 ALA A C     1 
ATOM   2834 O  O     . ALA A 1 348 ? 32.831 13.230  -11.503 1.00 17.67  ? 345 ALA A O     1 
ATOM   2835 C  CB    . ALA A 1 348 ? 29.897 12.259  -10.623 1.00 17.41  ? 345 ALA A CB    1 
ATOM   2836 N  N     . GLN A 1 349 ? 32.078 14.590  -9.871  1.00 18.99  ? 346 GLN A N     1 
ATOM   2837 C  CA    . GLN A 1 349 ? 32.917 15.708  -10.286 1.00 20.45  ? 346 GLN A CA    1 
ATOM   2838 C  C     . GLN A 1 349 ? 34.390 15.437  -9.991  1.00 19.22  ? 346 GLN A C     1 
ATOM   2839 O  O     . GLN A 1 349 ? 35.266 15.746  -10.801 1.00 18.36  ? 346 GLN A O     1 
ATOM   2840 C  CB    . GLN A 1 349 ? 32.454 17.015  -9.637  1.00 20.37  ? 346 GLN A CB    1 
ATOM   2841 C  CG    . GLN A 1 349 ? 31.118 17.504  -10.194 1.00 25.19  ? 346 GLN A CG    1 
ATOM   2842 C  CD    . GLN A 1 349 ? 30.586 18.750  -9.503  1.00 33.23  ? 346 GLN A CD    1 
ATOM   2843 O  OE1   . GLN A 1 349 ? 31.163 19.244  -8.535  1.00 38.10  ? 346 GLN A OE1   1 
ATOM   2844 N  NE2   . GLN A 1 349 ? 29.468 19.257  -10.003 1.00 36.05  ? 346 GLN A NE2   1 
ATOM   2845 N  N     . GLU A 1 350 ? 34.664 14.864  -8.828  1.00 15.87  ? 347 GLU A N     1 
ATOM   2846 C  CA    . GLU A 1 350 ? 36.031 14.474  -8.532  1.00 16.00  ? 347 GLU A CA    1 
ATOM   2847 C  C     . GLU A 1 350 ? 36.484 13.395  -9.513  1.00 16.22  ? 347 GLU A C     1 
ATOM   2848 O  O     . GLU A 1 350 ? 37.582 13.458  -10.054 1.00 16.83  ? 347 GLU A O     1 
ATOM   2849 C  CB    . GLU A 1 350 ? 36.193 13.979  -7.094  1.00 16.21  ? 347 GLU A CB    1 
ATOM   2850 C  CG    . GLU A 1 350 ? 37.664 13.597  -6.849  1.00 17.71  ? 347 GLU A CG    1 
ATOM   2851 C  CD    . GLU A 1 350 ? 37.955 13.002  -5.482  1.00 22.57  ? 347 GLU A CD    1 
ATOM   2852 O  OE1   . GLU A 1 350 ? 37.319 13.405  -4.488  1.00 25.29  ? 347 GLU A OE1   1 
ATOM   2853 O  OE2   . GLU A 1 350 ? 38.845 12.134  -5.403  1.00 22.97  ? 347 GLU A OE2   1 
ATOM   2854 N  N     . LEU A 1 351 ? 35.627 12.409  -9.740  1.00 16.56  ? 348 LEU A N     1 
ATOM   2855 C  CA    . LEU A 1 351 ? 35.960 11.312  -10.645 1.00 14.89  ? 348 LEU A CA    1 
ATOM   2856 C  C     . LEU A 1 351 ? 36.227 11.834  -12.060 1.00 16.72  ? 348 LEU A C     1 
ATOM   2857 O  O     . LEU A 1 351 ? 37.208 11.445  -12.705 1.00 18.19  ? 348 LEU A O     1 
ATOM   2858 C  CB    . LEU A 1 351 ? 34.843 10.265  -10.634 1.00 19.72  ? 348 LEU A CB    1 
ATOM   2859 C  CG    . LEU A 1 351 ? 35.115 8.962   -11.393 1.00 21.40  ? 348 LEU A CG    1 
ATOM   2860 C  CD1   . LEU A 1 351 ? 36.351 8.261   -10.827 1.00 23.20  ? 348 LEU A CD1   1 
ATOM   2861 C  CD2   . LEU A 1 351 ? 33.904 8.037   -11.348 1.00 22.84  ? 348 LEU A CD2   1 
ATOM   2862 N  N     . GLU A 1 352 ? 35.366 12.721  -12.553 1.00 18.03  ? 349 GLU A N     1 
ATOM   2863 C  CA    . GLU A 1 352 ? 35.583 13.296  -13.879 1.00 20.00  ? 349 GLU A CA    1 
ATOM   2864 C  C     . GLU A 1 352 ? 36.952 13.970  -13.992 1.00 17.92  ? 349 GLU A C     1 
ATOM   2865 O  O     . GLU A 1 352 ? 37.658 13.808  -14.991 1.00 19.70  ? 349 GLU A O     1 
ATOM   2866 C  CB    . GLU A 1 352 ? 34.481 14.305  -14.242 1.00 19.83  ? 349 GLU A CB    1 
ATOM   2867 C  CG    . GLU A 1 352 ? 34.727 14.970  -15.596 1.00 20.97  ? 349 GLU A CG    1 
ATOM   2868 C  CD    . GLU A 1 352 ? 33.716 16.046  -15.957 1.00 38.76  ? 349 GLU A CD    1 
ATOM   2869 O  OE1   . GLU A 1 352 ? 34.011 16.820  -16.893 1.00 48.93  ? 349 GLU A OE1   1 
ATOM   2870 O  OE2   . GLU A 1 352 ? 32.634 16.119  -15.330 1.00 37.69  ? 349 GLU A OE2   1 
ATOM   2871 N  N     . GLU A 1 353 ? 37.319 14.735  -12.969 1.00 18.89  ? 350 GLU A N     1 
ATOM   2872 C  CA    . GLU A 1 353 ? 38.585 15.451  -12.976 1.00 20.08  ? 350 GLU A CA    1 
ATOM   2873 C  C     . GLU A 1 353 ? 39.754 14.469  -13.063 1.00 19.49  ? 350 GLU A C     1 
ATOM   2874 O  O     . GLU A 1 353 ? 40.696 14.636  -13.850 1.00 19.06  ? 350 GLU A O     1 
ATOM   2875 C  CB    . GLU A 1 353 ? 38.701 16.285  -11.698 1.00 27.64  ? 350 GLU A CB    1 
ATOM   2876 C  CG    . GLU A 1 353 ? 39.843 17.280  -11.686 1.00 40.45  ? 350 GLU A CG    1 
ATOM   2877 C  CD    . GLU A 1 353 ? 39.757 18.230  -10.501 1.00 57.07  ? 350 GLU A CD    1 
ATOM   2878 O  OE1   . GLU A 1 353 ? 39.490 17.757  -9.375  1.00 62.07  ? 350 GLU A OE1   1 
ATOM   2879 O  OE2   . GLU A 1 353 ? 39.942 19.449  -10.700 1.00 62.41  ? 350 GLU A OE2   1 
ATOM   2880 N  N     . ARG A 1 354 ? 39.680 13.424  -12.254 1.00 16.78  ? 351 ARG A N     1 
ATOM   2881 C  CA    . ARG A 1 354 ? 40.740 12.428  -12.240 1.00 12.85  ? 351 ARG A CA    1 
ATOM   2882 C  C     . ARG A 1 354 ? 40.781 11.621  -13.534 1.00 16.45  ? 351 ARG A C     1 
ATOM   2883 O  O     . ARG A 1 354 ? 41.862 11.310  -14.030 1.00 17.84  ? 351 ARG A O     1 
ATOM   2884 C  CB    . ARG A 1 354 ? 40.612 11.527  -11.021 1.00 16.71  ? 351 ARG A CB    1 
ATOM   2885 C  CG    A ARG A 1 354 ? 40.965 12.262  -9.723  0.50 16.41  ? 351 ARG A CG    1 
ATOM   2886 C  CG    B ARG A 1 354 ? 40.892 12.220  -9.697  0.50 17.78  ? 351 ARG A CG    1 
ATOM   2887 C  CD    A ARG A 1 354 ? 40.428 11.543  -8.494  0.50 16.88  ? 351 ARG A CD    1 
ATOM   2888 C  CD    B ARG A 1 354 ? 40.702 11.239  -8.553  0.50 18.74  ? 351 ARG A CD    1 
ATOM   2889 N  NE    A ARG A 1 354 ? 40.978 10.197  -8.382  0.50 12.99  ? 351 ARG A NE    1 
ATOM   2890 N  NE    B ARG A 1 354 ? 41.572 10.077  -8.707  0.50 14.48  ? 351 ARG A NE    1 
ATOM   2891 C  CZ    A ARG A 1 354 ? 40.567 9.293   -7.501  0.50 13.33  ? 351 ARG A CZ    1 
ATOM   2892 C  CZ    B ARG A 1 354 ? 41.390 8.917   -8.083  0.50 16.89  ? 351 ARG A CZ    1 
ATOM   2893 N  NH1   A ARG A 1 354 ? 39.601 9.596   -6.632  0.50 12.19  ? 351 ARG A NH1   1 
ATOM   2894 N  NH1   B ARG A 1 354 ? 40.362 8.761   -7.268  0.50 21.48  ? 351 ARG A NH1   1 
ATOM   2895 N  NH2   A ARG A 1 354 ? 41.130 8.083   -7.484  0.50 8.51   ? 351 ARG A NH2   1 
ATOM   2896 N  NH2   B ARG A 1 354 ? 42.232 7.911   -8.277  0.50 21.76  ? 351 ARG A NH2   1 
ATOM   2897 N  N     . LEU A 1 355 ? 39.610 11.298  -14.083 1.00 15.88  ? 352 LEU A N     1 
ATOM   2898 C  CA    . LEU A 1 355 ? 39.560 10.519  -15.324 1.00 13.53  ? 352 LEU A CA    1 
ATOM   2899 C  C     . LEU A 1 355 ? 40.123 11.311  -16.493 1.00 17.76  ? 352 LEU A C     1 
ATOM   2900 O  O     . LEU A 1 355 ? 40.835 10.760  -17.338 1.00 20.39  ? 352 LEU A O     1 
ATOM   2901 C  CB    . LEU A 1 355 ? 38.127 10.115  -15.656 1.00 16.95  ? 352 LEU A CB    1 
ATOM   2902 C  CG    . LEU A 1 355 ? 37.592 8.956   -14.829 1.00 18.94  ? 352 LEU A CG    1 
ATOM   2903 C  CD1   . LEU A 1 355 ? 36.106 8.781   -15.090 1.00 17.18  ? 352 LEU A CD1   1 
ATOM   2904 C  CD2   . LEU A 1 355 ? 38.366 7.677   -15.162 1.00 23.06  ? 352 LEU A CD2   1 
ATOM   2905 N  N     . THR A 1 356 ? 39.774 12.594  -16.558 1.00 17.58  ? 353 THR A N     1 
ATOM   2906 C  CA    . THR A 1 356 ? 40.230 13.434  -17.657 1.00 18.38  ? 353 THR A CA    1 
ATOM   2907 C  C     . THR A 1 356 ? 41.751 13.571  -17.647 1.00 20.32  ? 353 THR A C     1 
ATOM   2908 O  O     . THR A 1 356 ? 42.397 13.474  -18.685 1.00 19.68  ? 353 THR A O     1 
ATOM   2909 C  CB    . THR A 1 356 ? 39.544 14.816  -17.649 1.00 22.40  ? 353 THR A CB    1 
ATOM   2910 O  OG1   . THR A 1 356 ? 38.137 14.638  -17.840 1.00 24.83  ? 353 THR A OG1   1 
ATOM   2911 C  CG2   . THR A 1 356 ? 40.073 15.676  -18.767 1.00 23.79  ? 353 THR A CG2   1 
ATOM   2912 N  N     . LYS A 1 357 ? 42.322 13.783  -16.466 1.00 20.27  ? 354 LYS A N     1 
ATOM   2913 C  CA    . LYS A 1 357 ? 43.768 13.831  -16.326 1.00 17.30  ? 354 LYS A CA    1 
ATOM   2914 C  C     . LYS A 1 357 ? 44.384 12.483  -16.714 1.00 19.66  ? 354 LYS A C     1 
ATOM   2915 O  O     . LYS A 1 357 ? 45.380 12.423  -17.441 1.00 20.36  ? 354 LYS A O     1 
ATOM   2916 C  CB    . LYS A 1 357 ? 44.142 14.205  -14.885 1.00 20.31  ? 354 LYS A CB    1 
ATOM   2917 C  CG    . LYS A 1 357 ? 45.636 14.192  -14.597 1.00 27.05  ? 354 LYS A CG    1 
ATOM   2918 C  CD    . LYS A 1 357 ? 46.360 15.246  -15.416 1.00 40.49  ? 354 LYS A CD    1 
ATOM   2919 C  CE    . LYS A 1 357 ? 47.501 15.880  -14.627 1.00 45.93  ? 354 LYS A CE    1 
ATOM   2920 N  NZ    . LYS A 1 357 ? 48.479 14.875  -14.123 1.00 38.48  ? 354 LYS A NZ    1 
ATOM   2921 N  N     . ASP A 1 358 ? 43.782 11.394  -16.244 1.00 16.95  ? 355 ASP A N     1 
ATOM   2922 C  CA    . ASP A 1 358 ? 44.287 10.058  -16.570 1.00 13.02  ? 355 ASP A CA    1 
ATOM   2923 C  C     . ASP A 1 358 ? 44.308 9.791   -18.076 1.00 17.76  ? 355 ASP A C     1 
ATOM   2924 O  O     . ASP A 1 358 ? 45.259 9.213   -18.584 1.00 20.02  ? 355 ASP A O     1 
ATOM   2925 C  CB    . ASP A 1 358 ? 43.464 8.983   -15.853 1.00 16.26  ? 355 ASP A CB    1 
ATOM   2926 C  CG    . ASP A 1 358 ? 43.954 7.580   -16.143 1.00 21.74  ? 355 ASP A CG    1 
ATOM   2927 O  OD1   . ASP A 1 358 ? 44.942 7.146   -15.511 1.00 20.22  ? 355 ASP A OD1   1 
ATOM   2928 O  OD2   . ASP A 1 358 ? 43.351 6.908   -17.006 1.00 19.18  ? 355 ASP A OD2   1 
ATOM   2929 N  N     . ARG A 1 359 ? 43.248 10.194  -18.780 1.00 16.29  ? 356 ARG A N     1 
ATOM   2930 C  CA    . ARG A 1 359 ? 43.165 9.991   -20.225 1.00 16.83  ? 356 ARG A CA    1 
ATOM   2931 C  C     . ARG A 1 359 ? 44.268 10.752  -20.964 1.00 18.61  ? 356 ARG A C     1 
ATOM   2932 O  O     . ARG A 1 359 ? 44.888 10.236  -21.907 1.00 21.66  ? 356 ARG A O     1 
ATOM   2933 C  CB    . ARG A 1 359 ? 41.789 10.448  -20.734 1.00 18.77  ? 356 ARG A CB    1 
ATOM   2934 C  CG    . ARG A 1 359 ? 41.534 10.193  -22.224 1.00 20.87  ? 356 ARG A CG    1 
ATOM   2935 C  CD    . ARG A 1 359 ? 40.131 10.678  -22.608 1.00 26.82  ? 356 ARG A CD    1 
ATOM   2936 N  NE    . ARG A 1 359 ? 40.024 12.134  -22.531 1.00 31.30  ? 356 ARG A NE    1 
ATOM   2937 C  CZ    . ARG A 1 359 ? 38.891 12.815  -22.354 1.00 36.11  ? 356 ARG A CZ    1 
ATOM   2938 N  NH1   . ARG A 1 359 ? 37.730 12.182  -22.221 1.00 33.83  ? 356 ARG A NH1   1 
ATOM   2939 N  NH2   . ARG A 1 359 ? 38.923 14.142  -22.306 1.00 35.97  ? 356 ARG A NH2   1 
ATOM   2940 N  N     . ASN A 1 360 ? 44.510 11.992  -20.547 1.00 18.52  ? 357 ASN A N     1 
ATOM   2941 C  CA    . ASN A 1 360 ? 45.583 12.796  -21.131 1.00 19.43  ? 357 ASN A CA    1 
ATOM   2942 C  C     . ASN A 1 360 ? 46.994 12.266  -20.833 1.00 18.54  ? 357 ASN A C     1 
ATOM   2943 O  O     . ASN A 1 360 ? 47.877 12.303  -21.702 1.00 21.55  ? 357 ASN A O     1 
ATOM   2944 C  CB    . ASN A 1 360 ? 45.466 14.248  -20.672 1.00 19.54  ? 357 ASN A CB    1 
ATOM   2945 C  CG    . ASN A 1 360 ? 44.304 14.965  -21.313 1.00 24.05  ? 357 ASN A CG    1 
ATOM   2946 O  OD1   . ASN A 1 360 ? 43.999 14.753  -22.487 1.00 30.01  ? 357 ASN A OD1   1 
ATOM   2947 N  ND2   . ASN A 1 360 ? 43.648 15.824  -20.549 1.00 27.76  ? 357 ASN A ND2   1 
ATOM   2948 N  N     . ASP A 1 361 ? 47.212 11.805  -19.602 1.00 17.63  ? 358 ASP A N     1 
ATOM   2949 C  CA    . ASP A 1 361 ? 48.530 11.309  -19.207 1.00 18.45  ? 358 ASP A CA    1 
ATOM   2950 C  C     . ASP A 1 361 ? 48.841 9.928   -19.760 1.00 19.12  ? 358 ASP A C     1 
ATOM   2951 O  O     . ASP A 1 361 ? 49.970 9.654   -20.159 1.00 21.23  ? 358 ASP A O     1 
ATOM   2952 C  CB    . ASP A 1 361 ? 48.661 11.245  -17.685 1.00 20.72  ? 358 ASP A CB    1 
ATOM   2953 C  CG    . ASP A 1 361 ? 48.705 12.619  -17.035 1.00 29.50  ? 358 ASP A CG    1 
ATOM   2954 O  OD1   . ASP A 1 361 ? 48.891 13.630  -17.755 1.00 32.68  ? 358 ASP A OD1   1 
ATOM   2955 O  OD2   . ASP A 1 361 ? 48.568 12.671  -15.788 1.00 33.12  ? 358 ASP A OD2   1 
ATOM   2956 N  N     . ASN A 1 362 ? 47.841 9.056   -19.764 1.00 18.30  ? 359 ASN A N     1 
ATOM   2957 C  CA    . ASN A 1 362 ? 48.106 7.628   -19.906 1.00 16.41  ? 359 ASN A CA    1 
ATOM   2958 C  C     . ASN A 1 362 ? 47.489 6.964   -21.133 1.00 19.73  ? 359 ASN A C     1 
ATOM   2959 O  O     . ASN A 1 362 ? 47.601 5.755   -21.295 1.00 21.45  ? 359 ASN A O     1 
ATOM   2960 C  CB    . ASN A 1 362 ? 47.694 6.897   -18.620 1.00 17.96  ? 359 ASN A CB    1 
ATOM   2961 C  CG    . ASN A 1 362 ? 48.471 7.391   -17.394 1.00 18.08  ? 359 ASN A CG    1 
ATOM   2962 O  OD1   . ASN A 1 362 ? 49.691 7.555   -17.455 1.00 18.99  ? 359 ASN A OD1   1 
ATOM   2963 N  ND2   . ASN A 1 362 ? 47.768 7.624   -16.285 1.00 20.00  ? 359 ASN A ND2   1 
ATOM   2964 N  N     . ASP A 1 363 ? 46.841 7.755   -21.986 1.00 20.41  ? 360 ASP A N     1 
ATOM   2965 C  CA    . ASP A 1 363 ? 46.340 7.254   -23.267 1.00 18.08  ? 360 ASP A CA    1 
ATOM   2966 C  C     . ASP A 1 363 ? 45.405 6.076   -23.088 1.00 22.86  ? 360 ASP A C     1 
ATOM   2967 O  O     . ASP A 1 363 ? 45.574 5.026   -23.721 1.00 23.76  ? 360 ASP A O     1 
ATOM   2968 C  CB    . ASP A 1 363 ? 47.496 6.831   -24.163 1.00 26.24  ? 360 ASP A CB    1 
ATOM   2969 C  CG    . ASP A 1 363 ? 48.378 7.989   -24.541 1.00 30.54  ? 360 ASP A CG    1 
ATOM   2970 O  OD1   . ASP A 1 363 ? 47.831 9.034   -24.954 1.00 27.56  ? 360 ASP A OD1   1 
ATOM   2971 O  OD2   . ASP A 1 363 ? 49.612 7.851   -24.416 1.00 39.33  ? 360 ASP A OD2   1 
ATOM   2972 N  N     . ARG A 1 364 ? 44.416 6.247   -22.223 1.00 19.42  ? 361 ARG A N     1 
ATOM   2973 C  CA    . ARG A 1 364 ? 43.435 5.197   -21.978 1.00 15.32  ? 361 ARG A CA    1 
ATOM   2974 C  C     . ARG A 1 364 ? 42.112 5.795   -21.547 1.00 22.58  ? 361 ARG A C     1 
ATOM   2975 O  O     . ARG A 1 364 ? 42.060 6.931   -21.065 1.00 24.01  ? 361 ARG A O     1 
ATOM   2976 C  CB    . ARG A 1 364 ? 43.954 4.213   -20.925 1.00 20.82  ? 361 ARG A CB    1 
ATOM   2977 C  CG    . ARG A 1 364 ? 44.183 4.841   -19.557 1.00 19.70  ? 361 ARG A CG    1 
ATOM   2978 C  CD    . ARG A 1 364 ? 44.674 3.812   -18.552 1.00 20.11  ? 361 ARG A CD    1 
ATOM   2979 N  NE    . ARG A 1 364 ? 44.753 4.376   -17.208 1.00 19.90  ? 361 ARG A NE    1 
ATOM   2980 C  CZ    . ARG A 1 364 ? 45.011 3.663   -16.114 1.00 21.48  ? 361 ARG A CZ    1 
ATOM   2981 N  NH1   . ARG A 1 364 ? 45.058 4.255   -14.927 1.00 19.06  ? 361 ARG A NH1   1 
ATOM   2982 N  NH2   . ARG A 1 364 ? 45.231 2.362   -16.200 1.00 21.74  ? 361 ARG A NH2   1 
ATOM   2983 N  N     . VAL A 1 365 ? 41.040 5.030   -21.722 1.00 19.27  ? 362 VAL A N     1 
ATOM   2984 C  CA    . VAL A 1 365 ? 39.719 5.461   -21.276 1.00 17.46  ? 362 VAL A CA    1 
ATOM   2985 C  C     . VAL A 1 365 ? 38.985 4.348   -20.538 1.00 21.50  ? 362 VAL A C     1 
ATOM   2986 O  O     . VAL A 1 365 ? 39.001 3.190   -20.956 1.00 23.45  ? 362 VAL A O     1 
ATOM   2987 C  CB    . VAL A 1 365 ? 38.852 5.918   -22.453 1.00 24.47  ? 362 VAL A CB    1 
ATOM   2988 C  CG1   . VAL A 1 365 ? 39.430 7.182   -23.078 1.00 33.33  ? 362 VAL A CG1   1 
ATOM   2989 C  CG2   . VAL A 1 365 ? 38.740 4.813   -23.488 1.00 25.63  ? 362 VAL A CG2   1 
ATOM   2990 N  N     . ALA A 1 366 ? 38.317 4.709   -19.450 1.00 19.50  ? 363 ALA A N     1 
ATOM   2991 C  CA    . ALA A 1 366 ? 37.489 3.769   -18.724 1.00 15.68  ? 363 ALA A CA    1 
ATOM   2992 C  C     . ALA A 1 366 ? 36.179 3.541   -19.458 1.00 23.75  ? 363 ALA A C     1 
ATOM   2993 O  O     . ALA A 1 366 ? 35.640 4.461   -20.075 1.00 30.56  ? 363 ALA A O     1 
ATOM   2994 C  CB    . ALA A 1 366 ? 37.214 4.301   -17.344 1.00 18.42  ? 363 ALA A CB    1 
ATOM   2995 N  N     . THR A 1 367 ? 35.651 2.323   -19.382 1.00 20.25  ? 364 THR A N     1 
ATOM   2996 C  CA    . THR A 1 367 ? 34.408 2.026   -20.091 1.00 16.33  ? 364 THR A CA    1 
ATOM   2997 C  C     . THR A 1 367 ? 33.278 1.541   -19.193 1.00 23.57  ? 364 THR A C     1 
ATOM   2998 O  O     . THR A 1 367 ? 32.143 1.383   -19.643 1.00 25.43  ? 364 THR A O     1 
ATOM   2999 C  CB    . THR A 1 367 ? 34.646 0.989   -21.204 1.00 20.54  ? 364 THR A CB    1 
ATOM   3000 O  OG1   . THR A 1 367 ? 34.963 -0.277  -20.612 1.00 23.97  ? 364 THR A OG1   1 
ATOM   3001 C  CG2   . THR A 1 367 ? 35.789 1.443   -22.106 1.00 24.64  ? 364 THR A CG2   1 
ATOM   3002 N  N     . GLN A 1 368 ? 33.582 1.300   -17.926 1.00 22.92  ? 365 GLN A N     1 
ATOM   3003 C  CA    . GLN A 1 368 ? 32.572 0.817   -17.002 1.00 17.85  ? 365 GLN A CA    1 
ATOM   3004 C  C     . GLN A 1 368 ? 32.555 1.683   -15.746 1.00 20.25  ? 365 GLN A C     1 
ATOM   3005 O  O     . GLN A 1 368 ? 33.604 2.047   -15.217 1.00 22.28  ? 365 GLN A O     1 
ATOM   3006 C  CB    . GLN A 1 368 ? 32.844 -0.637  -16.626 1.00 28.09  ? 365 GLN A CB    1 
ATOM   3007 C  CG    . GLN A 1 368 ? 31.733 -1.273  -15.817 1.00 36.96  ? 365 GLN A CG    1 
ATOM   3008 C  CD    . GLN A 1 368 ? 31.997 -2.734  -15.522 1.00 41.97  ? 365 GLN A CD    1 
ATOM   3009 O  OE1   . GLN A 1 368 ? 32.857 -3.069  -14.705 1.00 46.32  ? 365 GLN A OE1   1 
ATOM   3010 N  NE2   . GLN A 1 368 ? 31.260 -3.614  -16.187 1.00 39.33  ? 365 GLN A NE2   1 
ATOM   3011 N  N     . LEU A 1 369 ? 31.359 2.029   -15.290 1.00 21.38  ? 366 LEU A N     1 
ATOM   3012 C  CA    . LEU A 1 369 ? 31.201 2.752   -14.036 1.00 20.56  ? 366 LEU A CA    1 
ATOM   3013 C  C     . LEU A 1 369 ? 30.567 1.800   -13.042 1.00 23.98  ? 366 LEU A C     1 
ATOM   3014 O  O     . LEU A 1 369 ? 29.528 1.206   -13.321 1.00 24.00  ? 366 LEU A O     1 
ATOM   3015 C  CB    . LEU A 1 369 ? 30.294 3.975   -14.233 1.00 21.41  ? 366 LEU A CB    1 
ATOM   3016 C  CG    . LEU A 1 369 ? 29.997 4.823   -12.991 1.00 23.05  ? 366 LEU A CG    1 
ATOM   3017 C  CD1   . LEU A 1 369 ? 31.272 5.489   -12.471 1.00 23.44  ? 366 LEU A CD1   1 
ATOM   3018 C  CD2   . LEU A 1 369 ? 28.926 5.868   -13.283 1.00 25.27  ? 366 LEU A CD2   1 
ATOM   3019 N  N     . VAL A 1 370 ? 31.198 1.640   -11.887 1.00 20.67  ? 367 VAL A N     1 
ATOM   3020 C  CA    . VAL A 1 370 ? 30.662 0.780   -10.849 1.00 18.68  ? 367 VAL A CA    1 
ATOM   3021 C  C     . VAL A 1 370 ? 30.154 1.648   -9.711  1.00 22.96  ? 367 VAL A C     1 
ATOM   3022 O  O     . VAL A 1 370 ? 30.864 2.529   -9.231  1.00 22.53  ? 367 VAL A O     1 
ATOM   3023 C  CB    . VAL A 1 370 ? 31.742 -0.190  -10.323 1.00 19.82  ? 367 VAL A CB    1 
ATOM   3024 C  CG1   . VAL A 1 370 ? 31.197 -1.009  -9.172  1.00 28.51  ? 367 VAL A CG1   1 
ATOM   3025 C  CG2   . VAL A 1 370 ? 32.231 -1.090  -11.458 1.00 23.29  ? 367 VAL A CG2   1 
ATOM   3026 N  N     . VAL A 1 371 ? 28.915 1.411   -9.299  1.00 20.84  ? 368 VAL A N     1 
ATOM   3027 C  CA    . VAL A 1 371 ? 28.317 2.165   -8.210  1.00 18.76  ? 368 VAL A CA    1 
ATOM   3028 C  C     . VAL A 1 371 ? 28.067 1.239   -7.036  1.00 24.48  ? 368 VAL A C     1 
ATOM   3029 O  O     . VAL A 1 371 ? 27.460 0.175   -7.191  1.00 26.06  ? 368 VAL A O     1 
ATOM   3030 C  CB    . VAL A 1 371 ? 26.982 2.797   -8.645  1.00 26.78  ? 368 VAL A CB    1 
ATOM   3031 C  CG1   . VAL A 1 371 ? 26.436 3.727   -7.553  1.00 29.64  ? 368 VAL A CG1   1 
ATOM   3032 C  CG2   . VAL A 1 371 ? 27.154 3.540   -9.963  1.00 28.97  ? 368 VAL A CG2   1 
ATOM   3033 N  N     . SER A 1 372 ? 28.552 1.634   -5.865  1.00 22.27  ? 369 SER A N     1 
ATOM   3034 C  CA    . SER A 1 372 ? 28.345 0.847   -4.662  1.00 23.68  ? 369 SER A CA    1 
ATOM   3035 C  C     . SER A 1 372 ? 27.779 1.716   -3.548  1.00 21.90  ? 369 SER A C     1 
ATOM   3036 O  O     . SER A 1 372 ? 28.129 2.889   -3.421  1.00 24.47  ? 369 SER A O     1 
ATOM   3037 C  CB    . SER A 1 372 ? 29.664 0.216   -4.218  1.00 32.41  ? 369 SER A CB    1 
ATOM   3038 O  OG    . SER A 1 372 ? 29.487 -0.560  -3.048  1.00 39.14  ? 369 SER A OG    1 
ATOM   3039 N  N     . ILE A 1 373 ? 26.895 1.138   -2.745  1.00 24.12  ? 370 ILE A N     1 
ATOM   3040 C  CA    . ILE A 1 373 ? 26.349 1.846   -1.596  1.00 23.18  ? 370 ILE A CA    1 
ATOM   3041 C  C     . ILE A 1 373 ? 26.337 0.951   -0.369  1.00 26.87  ? 370 ILE A C     1 
ATOM   3042 O  O     . ILE A 1 373 ? 26.396 -0.275  -0.479  1.00 30.34  ? 370 ILE A O     1 
ATOM   3043 C  CB    . ILE A 1 373 ? 24.914 2.365   -1.856  1.00 27.86  ? 370 ILE A CB    1 
ATOM   3044 C  CG1   . ILE A 1 373 ? 23.939 1.195   -2.015  1.00 33.21  ? 370 ILE A CG1   1 
ATOM   3045 C  CG2   . ILE A 1 373 ? 24.879 3.293   -3.070  1.00 27.53  ? 370 ILE A CG2   1 
ATOM   3046 C  CD1   . ILE A 1 373 ? 22.506 1.625   -2.225  1.00 36.60  ? 370 ILE A CD1   1 
ATOM   3047 N  N     . ARG A 1 374 ? 26.266 1.575   0.800   1.00 24.35  ? 371 ARG A N     1 
ATOM   3048 C  CA    . ARG A 1 374 ? 26.008 0.850   2.033   1.00 29.21  ? 371 ARG A CA    1 
ATOM   3049 C  C     . ARG A 1 374 ? 24.728 1.391   2.644   1.00 35.48  ? 371 ARG A C     1 
ATOM   3050 O  O     . ARG A 1 374 ? 24.494 2.602   2.643   1.00 30.39  ? 371 ARG A O     1 
ATOM   3051 C  CB    . ARG A 1 374 ? 27.173 1.012   3.011   1.00 30.38  ? 371 ARG A CB    1 
ATOM   3052 C  CG    . ARG A 1 374 ? 27.133 0.053   4.190   1.00 38.22  ? 371 ARG A CG    1 
ATOM   3053 C  CD    . ARG A 1 374 ? 28.280 0.323   5.148   1.00 48.74  ? 371 ARG A CD    1 
ATOM   3054 N  NE    . ARG A 1 374 ? 28.347 -0.671  6.215   1.00 60.09  ? 371 ARG A NE    1 
ATOM   3055 C  CZ    . ARG A 1 374 ? 29.160 -0.587  7.263   1.00 67.60  ? 371 ARG A CZ    1 
ATOM   3056 N  NH1   . ARG A 1 374 ? 29.971 0.454   7.393   1.00 67.62  ? 371 ARG A NH1   1 
ATOM   3057 N  NH2   . ARG A 1 374 ? 29.156 -1.539  8.186   1.00 71.81  ? 371 ARG A NH2   1 
ATOM   3058 N  N     . VAL A 1 375 ? 23.892 0.487   3.146   1.00 33.34  ? 372 VAL A N     1 
ATOM   3059 C  CA    . VAL A 1 375 ? 22.672 0.874   3.841   1.00 39.48  ? 372 VAL A CA    1 
ATOM   3060 C  C     . VAL A 1 375 ? 22.880 0.790   5.349   1.00 39.12  ? 372 VAL A C     1 
ATOM   3061 O  O     . VAL A 1 375 ? 23.615 -0.070  5.838   1.00 37.67  ? 372 VAL A O     1 
ATOM   3062 C  CB    . VAL A 1 375 ? 21.494 -0.027  3.444   1.00 58.80  ? 372 VAL A CB    1 
ATOM   3063 C  CG1   . VAL A 1 375 ? 21.184 0.137   1.966   1.00 56.32  ? 372 VAL A CG1   1 
ATOM   3064 C  CG2   . VAL A 1 375 ? 21.808 -1.479  3.773   1.00 60.96  ? 372 VAL A CG2   1 
ATOM   3065 N  N     . GLN A 1 376 ? 22.240 1.690   6.085   1.00 36.51  ? 373 GLN A N     1 
ATOM   3066 C  CA    . GLN A 1 376 ? 22.408 1.729   7.532   1.00 38.02  ? 373 GLN A CA    1 
ATOM   3067 C  C     . GLN A 1 376 ? 21.905 0.437   8.171   1.00 42.38  ? 373 GLN A C     1 
ATOM   3068 O  O     . GLN A 1 376 ? 20.806 -0.026  7.871   1.00 45.11  ? 373 GLN A O     1 
ATOM   3069 C  CB    . GLN A 1 376 ? 21.684 2.935   8.126   1.00 50.94  ? 373 GLN A CB    1 
ATOM   3070 C  CG    . GLN A 1 376 ? 22.162 3.309   9.517   1.00 52.14  ? 373 GLN A CG    1 
ATOM   3071 C  CD    . GLN A 1 376 ? 21.784 4.726   9.887   1.00 54.35  ? 373 GLN A CD    1 
ATOM   3072 O  OE1   . GLN A 1 376 ? 20.627 5.123   9.754   1.00 53.99  ? 373 GLN A OE1   1 
ATOM   3073 N  NE2   . GLN A 1 376 ? 22.766 5.506   10.337  1.00 52.24  ? 373 GLN A NE2   1 
ATOM   3074 N  N     . GLY A 1 377 ? 22.722 -0.144  9.046   1.00 45.65  ? 374 GLY A N     1 
ATOM   3075 C  CA    . GLY A 1 377 ? 22.381 -1.401  9.687   1.00 76.35  ? 374 GLY A CA    1 
ATOM   3076 C  C     . GLY A 1 377 ? 23.212 -2.562  9.171   1.00 75.57  ? 374 GLY A C     1 
ATOM   3077 O  O     . GLY A 1 377 ? 23.523 -3.495  9.913   1.00 74.13  ? 374 GLY A O     1 
ATOM   3078 N  N     . ASP A 1 378 ? 23.575 -2.502  7.894   1.00 74.28  ? 375 ASP A N     1 
ATOM   3079 C  CA    . ASP A 1 378 ? 24.372 -3.552  7.271   1.00 55.19  ? 375 ASP A CA    1 
ATOM   3080 C  C     . ASP A 1 378 ? 25.802 -3.543  7.810   1.00 71.27  ? 375 ASP A C     1 
ATOM   3081 O  O     . ASP A 1 378 ? 26.464 -2.506  7.817   1.00 69.60  ? 375 ASP A O     1 
ATOM   3082 C  CB    . ASP A 1 378 ? 24.375 -3.382  5.749   1.00 43.18  ? 375 ASP A CB    1 
ATOM   3083 C  CG    . ASP A 1 378 ? 24.980 -4.571  5.028   1.00 48.64  ? 375 ASP A CG    1 
ATOM   3084 O  OD1   . ASP A 1 378 ? 25.881 -5.222  5.597   1.00 46.97  ? 375 ASP A OD1   1 
ATOM   3085 O  OD2   . ASP A 1 378 ? 24.551 -4.854  3.890   1.00 51.34  ? 375 ASP A OD2   1 
ATOM   3086 N  N     . LYS A 1 379 ? 26.272 -4.703  8.259   1.00 72.39  ? 376 LYS A N     1 
ATOM   3087 C  CA    . LYS A 1 379 ? 27.611 -4.816  8.832   1.00 89.69  ? 376 LYS A CA    1 
ATOM   3088 C  C     . LYS A 1 379 ? 28.693 -4.807  7.755   1.00 94.29  ? 376 LYS A C     1 
ATOM   3089 O  O     . LYS A 1 379 ? 29.829 -4.400  8.006   1.00 93.61  ? 376 LYS A O     1 
ATOM   3090 C  CB    . LYS A 1 379 ? 27.728 -6.085  9.681   1.00 118.99 ? 376 LYS A CB    1 
ATOM   3091 C  CG    . LYS A 1 379 ? 29.089 -6.272  10.336  1.00 117.43 ? 376 LYS A CG    1 
ATOM   3092 C  CD    . LYS A 1 379 ? 29.135 -7.543  11.172  1.00 116.78 ? 376 LYS A CD    1 
ATOM   3093 C  CE    . LYS A 1 379 ? 30.505 -7.744  11.798  1.00 114.52 ? 376 LYS A CE    1 
ATOM   3094 N  NZ    . LYS A 1 379 ? 31.576 -7.846  10.768  1.00 112.37 ? 376 LYS A NZ    1 
ATOM   3095 N  N     . ARG A 1 380 ? 28.333 -5.259  6.559   1.00 93.58  ? 377 ARG A N     1 
ATOM   3096 C  CA    . ARG A 1 380 ? 29.268 -5.313  5.440   1.00 63.62  ? 377 ARG A CA    1 
ATOM   3097 C  C     . ARG A 1 380 ? 29.627 -3.917  4.950   1.00 82.72  ? 377 ARG A C     1 
ATOM   3098 O  O     . ARG A 1 380 ? 28.805 -3.003  5.001   1.00 84.16  ? 377 ARG A O     1 
ATOM   3099 C  CB    . ARG A 1 380 ? 28.666 -6.110  4.286   1.00 54.29  ? 377 ARG A CB    1 
ATOM   3100 C  CG    . ARG A 1 380 ? 28.297 -7.538  4.631   1.00 52.78  ? 377 ARG A CG    1 
ATOM   3101 C  CD    . ARG A 1 380 ? 27.494 -8.152  3.504   1.00 52.27  ? 377 ARG A CD    1 
ATOM   3102 N  NE    . ARG A 1 380 ? 26.252 -7.422  3.267   1.00 50.54  ? 377 ARG A NE    1 
ATOM   3103 C  CZ    . ARG A 1 380 ? 25.451 -7.636  2.228   1.00 46.18  ? 377 ARG A CZ    1 
ATOM   3104 N  NH1   . ARG A 1 380 ? 25.768 -8.553  1.326   1.00 46.45  ? 377 ARG A NH1   1 
ATOM   3105 N  NH2   . ARG A 1 380 ? 24.338 -6.931  2.087   1.00 44.14  ? 377 ARG A NH2   1 
ATOM   3106 N  N     . LEU A 1 381 ? 30.855 -3.760  4.466   1.00 80.34  ? 378 LEU A N     1 
ATOM   3107 C  CA    . LEU A 1 381 ? 31.310 -2.478  3.943   1.00 68.57  ? 378 LEU A CA    1 
ATOM   3108 C  C     . LEU A 1 381 ? 30.486 -2.038  2.737   1.00 65.66  ? 378 LEU A C     1 
ATOM   3109 O  O     . LEU A 1 381 ? 30.182 -0.856  2.582   1.00 65.95  ? 378 LEU A O     1 
ATOM   3110 C  CB    . LEU A 1 381 ? 32.798 -2.530  3.584   1.00 93.42  ? 378 LEU A CB    1 
ATOM   3111 C  CG    . LEU A 1 381 ? 33.790 -2.396  4.743   1.00 93.02  ? 378 LEU A CG    1 
ATOM   3112 C  CD1   . LEU A 1 381 ? 33.697 -3.584  5.693   1.00 93.05  ? 378 LEU A CD1   1 
ATOM   3113 C  CD2   . LEU A 1 381 ? 35.209 -2.239  4.213   1.00 91.86  ? 378 LEU A CD2   1 
ATOM   3114 N  N     . SER A 1 382 ? 30.129 -2.992  1.884   1.00 64.88  ? 379 SER A N     1 
ATOM   3115 C  CA    . SER A 1 382 ? 29.265 -2.705  0.744   1.00 47.59  ? 379 SER A CA    1 
ATOM   3116 C  C     . SER A 1 382 ? 28.017 -3.565  0.783   1.00 47.34  ? 379 SER A C     1 
ATOM   3117 O  O     . SER A 1 382 ? 28.099 -4.782  0.953   1.00 51.31  ? 379 SER A O     1 
ATOM   3118 C  CB    . SER A 1 382 ? 29.995 -2.937  -0.579  1.00 42.32  ? 379 SER A CB    1 
ATOM   3119 O  OG    . SER A 1 382 ? 29.065 -3.000  -1.652  1.00 42.00  ? 379 SER A OG    1 
ATOM   3120 N  N     . SER A 1 383 ? 26.862 -2.930  0.611   1.00 47.34  ? 380 SER A N     1 
ATOM   3121 C  CA    . SER A 1 383 ? 25.589 -3.637  0.633   1.00 40.57  ? 380 SER A CA    1 
ATOM   3122 C  C     . SER A 1 383 ? 25.154 -4.026  -0.769  1.00 46.71  ? 380 SER A C     1 
ATOM   3123 O  O     . SER A 1 383 ? 24.484 -5.039  -0.963  1.00 45.05  ? 380 SER A O     1 
ATOM   3124 C  CB    . SER A 1 383 ? 24.502 -2.770  1.273   1.00 42.39  ? 380 SER A CB    1 
ATOM   3125 O  OG    . SER A 1 383 ? 24.855 -2.387  2.588   1.00 38.75  ? 380 SER A OG    1 
ATOM   3126 N  N     . LEU A 1 384 ? 25.534 -3.210  -1.747  1.00 45.57  ? 381 LEU A N     1 
ATOM   3127 C  CA    . LEU A 1 384 ? 25.082 -3.406  -3.114  1.00 33.16  ? 381 LEU A CA    1 
ATOM   3128 C  C     . LEU A 1 384 ? 26.032 -2.771  -4.117  1.00 31.83  ? 381 LEU A C     1 
ATOM   3129 O  O     . LEU A 1 384 ? 26.584 -1.696  -3.875  1.00 28.29  ? 381 LEU A O     1 
ATOM   3130 C  CB    . LEU A 1 384 ? 23.672 -2.837  -3.292  1.00 42.54  ? 381 LEU A CB    1 
ATOM   3131 C  CG    . LEU A 1 384 ? 23.087 -2.882  -4.705  1.00 46.29  ? 381 LEU A CG    1 
ATOM   3132 C  CD1   . LEU A 1 384 ? 21.629 -3.315  -4.682  1.00 51.00  ? 381 LEU A CD1   1 
ATOM   3133 C  CD2   . LEU A 1 384 ? 23.239 -1.539  -5.400  1.00 45.07  ? 381 LEU A CD2   1 
ATOM   3134 N  N     . ARG A 1 385 ? 26.217 -3.448  -5.244  1.00 30.16  ? 382 ARG A N     1 
ATOM   3135 C  CA    . ARG A 1 385 ? 27.094 -2.961  -6.296  1.00 29.60  ? 382 ARG A CA    1 
ATOM   3136 C  C     . ARG A 1 385 ? 26.430 -3.201  -7.648  1.00 33.66  ? 382 ARG A C     1 
ATOM   3137 O  O     . ARG A 1 385 ? 25.971 -4.308  -7.934  1.00 35.86  ? 382 ARG A O     1 
ATOM   3138 C  CB    . ARG A 1 385 ? 28.432 -3.695  -6.243  1.00 47.37  ? 382 ARG A CB    1 
ATOM   3139 C  CG    . ARG A 1 385 ? 29.580 -2.928  -6.859  1.00 54.15  ? 382 ARG A CG    1 
ATOM   3140 C  CD    . ARG A 1 385 ? 30.600 -3.862  -7.485  1.00 62.44  ? 382 ARG A CD    1 
ATOM   3141 N  NE    . ARG A 1 385 ? 30.088 -4.487  -8.701  1.00 68.89  ? 382 ARG A NE    1 
ATOM   3142 C  CZ    . ARG A 1 385 ? 30.847 -5.102  -9.602  1.00 70.81  ? 382 ARG A CZ    1 
ATOM   3143 N  NH1   . ARG A 1 385 ? 30.293 -5.641  -10.679 1.00 73.06  ? 382 ARG A NH1   1 
ATOM   3144 N  NH2   . ARG A 1 385 ? 32.160 -5.173  -9.431  1.00 70.79  ? 382 ARG A NH2   1 
ATOM   3145 N  N     . ARG A 1 386 ? 26.366 -2.162  -8.471  1.00 26.38  ? 383 ARG A N     1 
ATOM   3146 C  CA    . ARG A 1 386 ? 25.790 -2.278  -9.805  1.00 26.54  ? 383 ARG A CA    1 
ATOM   3147 C  C     . ARG A 1 386 ? 26.699 -1.584  -10.798 1.00 28.79  ? 383 ARG A C     1 
ATOM   3148 O  O     . ARG A 1 386 ? 27.375 -0.622  -10.454 1.00 28.18  ? 383 ARG A O     1 
ATOM   3149 C  CB    . ARG A 1 386 ? 24.412 -1.627  -9.855  1.00 27.86  ? 383 ARG A CB    1 
ATOM   3150 C  CG    . ARG A 1 386 ? 23.354 -2.318  -9.021  1.00 29.47  ? 383 ARG A CG    1 
ATOM   3151 C  CD    . ARG A 1 386 ? 22.942 -3.629  -9.655  1.00 29.82  ? 383 ARG A CD    1 
ATOM   3152 N  NE    . ARG A 1 386 ? 21.819 -4.229  -8.949  1.00 29.34  ? 383 ARG A NE    1 
ATOM   3153 C  CZ    . ARG A 1 386 ? 21.941 -5.107  -7.960  1.00 37.32  ? 383 ARG A CZ    1 
ATOM   3154 N  NH1   . ARG A 1 386 ? 23.146 -5.491  -7.557  1.00 38.76  ? 383 ARG A NH1   1 
ATOM   3155 N  NH2   . ARG A 1 386 ? 20.856 -5.603  -7.378  1.00 42.40  ? 383 ARG A NH2   1 
ATOM   3156 N  N     . CYS A 1 387 ? 26.719 -2.067  -12.033 1.00 29.23  ? 384 CYS A N     1 
ATOM   3157 C  CA    . CYS A 1 387 ? 27.509 -1.398  -13.055 1.00 28.76  ? 384 CYS A CA    1 
ATOM   3158 C  C     . CYS A 1 387 ? 26.654 -0.800  -14.163 1.00 31.76  ? 384 CYS A C     1 
ATOM   3159 O  O     . CYS A 1 387 ? 25.523 -1.230  -14.404 1.00 32.39  ? 384 CYS A O     1 
ATOM   3160 C  CB    . CYS A 1 387 ? 28.564 -2.342  -13.638 1.00 26.04  ? 384 CYS A CB    1 
ATOM   3161 S  SG    A CYS A 1 387 ? 27.923 -3.773  -14.546 0.53 33.33  ? 384 CYS A SG    1 
ATOM   3162 S  SG    B CYS A 1 387 ? 29.687 -3.000  -12.408 0.47 37.16  ? 384 CYS A SG    1 
ATOM   3163 N  N     . CYS A 1 388 ? 27.200 0.211   -14.827 1.00 27.95  ? 385 CYS A N     1 
ATOM   3164 C  CA    . CYS A 1 388 ? 26.612 0.698   -16.068 1.00 38.67  ? 385 CYS A CA    1 
ATOM   3165 C  C     . CYS A 1 388 ? 27.709 1.168   -17.009 1.00 36.50  ? 385 CYS A C     1 
ATOM   3166 O  O     . CYS A 1 388 ? 28.866 1.308   -16.607 1.00 30.70  ? 385 CYS A O     1 
ATOM   3167 C  CB    . CYS A 1 388 ? 25.604 1.818   -15.806 1.00 36.11  ? 385 CYS A CB    1 
ATOM   3168 S  SG    . CYS A 1 388 ? 26.305 3.288   -15.033 1.00 36.05  ? 385 CYS A SG    1 
ATOM   3169 N  N     . ALA A 1 389 ? 27.355 1.395   -18.268 1.00 34.72  ? 386 ALA A N     1 
ATOM   3170 C  CA    . ALA A 1 389 ? 28.338 1.854   -19.238 1.00 28.93  ? 386 ALA A CA    1 
ATOM   3171 C  C     . ALA A 1 389 ? 28.855 3.242   -18.873 1.00 26.63  ? 386 ALA A C     1 
ATOM   3172 O  O     . ALA A 1 389 ? 28.090 4.121   -18.465 1.00 33.48  ? 386 ALA A O     1 
ATOM   3173 C  CB    . ALA A 1 389 ? 27.752 1.847   -20.651 1.00 26.33  ? 386 ALA A CB    1 
ATOM   3174 N  N     . LEU A 1 390 ? 30.161 3.424   -19.004 1.00 24.14  ? 387 LEU A N     1 
ATOM   3175 C  CA    . LEU A 1 390 ? 30.779 4.732   -18.855 1.00 21.64  ? 387 LEU A CA    1 
ATOM   3176 C  C     . LEU A 1 390 ? 31.206 5.154   -20.258 1.00 23.80  ? 387 LEU A C     1 
ATOM   3177 O  O     . LEU A 1 390 ? 32.225 4.688   -20.770 1.00 25.66  ? 387 LEU A O     1 
ATOM   3178 C  CB    . LEU A 1 390 ? 31.991 4.639   -17.924 1.00 26.62  ? 387 LEU A CB    1 
ATOM   3179 C  CG    . LEU A 1 390 ? 32.384 5.905   -17.164 1.00 27.42  ? 387 LEU A CG    1 
ATOM   3180 C  CD1   . LEU A 1 390 ? 33.590 5.619   -16.285 1.00 23.01  ? 387 LEU A CD1   1 
ATOM   3181 C  CD2   . LEU A 1 390 ? 32.665 7.063   -18.101 1.00 31.28  ? 387 LEU A CD2   1 
ATOM   3182 N  N     . THR A 1 391 ? 30.411 6.017   -20.882 1.00 26.34  ? 388 THR A N     1 
ATOM   3183 C  CA    . THR A 1 391 ? 30.594 6.345   -22.294 1.00 31.02  ? 388 THR A CA    1 
ATOM   3184 C  C     . THR A 1 391 ? 31.071 7.779   -22.520 1.00 30.87  ? 388 THR A C     1 
ATOM   3185 O  O     . THR A 1 391 ? 31.563 8.119   -23.597 1.00 33.63  ? 388 THR A O     1 
ATOM   3186 C  CB    . THR A 1 391 ? 29.284 6.141   -23.083 1.00 41.49  ? 388 THR A CB    1 
ATOM   3187 O  OG1   . THR A 1 391 ? 28.250 6.954   -22.513 1.00 39.44  ? 388 THR A OG1   1 
ATOM   3188 C  CG2   . THR A 1 391 ? 28.851 4.684   -23.039 1.00 38.62  ? 388 THR A CG2   1 
ATOM   3189 N  N     . ARG A 1 392 ? 30.906 8.619   -21.506 1.00 30.61  ? 389 ARG A N     1 
ATOM   3190 C  CA    . ARG A 1 392 ? 31.358 9.999   -21.574 1.00 30.35  ? 389 ARG A CA    1 
ATOM   3191 C  C     . ARG A 1 392 ? 31.889 10.454  -20.220 1.00 28.01  ? 389 ARG A C     1 
ATOM   3192 O  O     . ARG A 1 392 ? 31.288 10.185  -19.182 1.00 30.58  ? 389 ARG A O     1 
ATOM   3193 C  CB    . ARG A 1 392 ? 30.226 10.925  -22.028 1.00 60.59  ? 389 ARG A CB    1 
ATOM   3194 C  CG    . ARG A 1 392 ? 29.850 10.777  -23.493 1.00 68.73  ? 389 ARG A CG    1 
ATOM   3195 C  CD    . ARG A 1 392 ? 28.770 11.770  -23.893 1.00 78.90  ? 389 ARG A CD    1 
ATOM   3196 N  NE    . ARG A 1 392 ? 29.185 13.153  -23.672 1.00 88.38  ? 389 ARG A NE    1 
ATOM   3197 C  CZ    . ARG A 1 392 ? 28.812 13.891  -22.631 1.00 95.81  ? 389 ARG A CZ    1 
ATOM   3198 N  NH1   . ARG A 1 392 ? 29.241 15.140  -22.511 1.00 97.09  ? 389 ARG A NH1   1 
ATOM   3199 N  NH2   . ARG A 1 392 ? 28.006 13.381  -21.710 1.00 99.39  ? 389 ARG A NH2   1 
ATOM   3200 N  N     . TYR A 1 393 ? 33.023 11.139  -20.245 1.00 25.72  ? 390 TYR A N     1 
ATOM   3201 C  CA    . TYR A 1 393 ? 33.591 11.726  -19.041 1.00 27.10  ? 390 TYR A CA    1 
ATOM   3202 C  C     . TYR A 1 393 ? 32.848 13.012  -18.710 1.00 34.28  ? 390 TYR A C     1 
ATOM   3203 O  O     . TYR A 1 393 ? 33.339 14.112  -18.977 1.00 33.21  ? 390 TYR A O     1 
ATOM   3204 C  CB    . TYR A 1 393 ? 35.076 12.013  -19.243 1.00 25.62  ? 390 TYR A CB    1 
ATOM   3205 C  CG    . TYR A 1 393 ? 35.973 10.791  -19.156 1.00 21.90  ? 390 TYR A CG    1 
ATOM   3206 C  CD1   . TYR A 1 393 ? 37.350 10.924  -19.195 1.00 19.27  ? 390 TYR A CD1   1 
ATOM   3207 C  CD2   . TYR A 1 393 ? 35.442 9.511   -19.025 1.00 28.74  ? 390 TYR A CD2   1 
ATOM   3208 C  CE1   . TYR A 1 393 ? 38.182 9.826   -19.102 1.00 19.16  ? 390 TYR A CE1   1 
ATOM   3209 C  CE2   . TYR A 1 393 ? 36.270 8.395   -18.935 1.00 25.76  ? 390 TYR A CE2   1 
ATOM   3210 C  CZ    . TYR A 1 393 ? 37.640 8.560   -18.974 1.00 23.15  ? 390 TYR A CZ    1 
ATOM   3211 O  OH    . TYR A 1 393 ? 38.481 7.463   -18.874 1.00 21.55  ? 390 TYR A OH    1 
ATOM   3212 N  N     . ASP A 1 394 ? 31.655 12.863  -18.141 1.00 28.71  ? 391 ASP A N     1 
ATOM   3213 C  CA    . ASP A 1 394 ? 30.817 13.998  -17.781 1.00 25.13  ? 391 ASP A CA    1 
ATOM   3214 C  C     . ASP A 1 394 ? 30.167 13.742  -16.429 1.00 21.97  ? 391 ASP A C     1 
ATOM   3215 O  O     . ASP A 1 394 ? 29.401 12.792  -16.273 1.00 28.53  ? 391 ASP A O     1 
ATOM   3216 C  CB    . ASP A 1 394 ? 29.743 14.224  -18.845 1.00 30.89  ? 391 ASP A CB    1 
ATOM   3217 C  CG    . ASP A 1 394 ? 28.834 15.382  -18.504 1.00 42.33  ? 391 ASP A CG    1 
ATOM   3218 O  OD1   . ASP A 1 394 ? 27.861 15.170  -17.753 1.00 41.17  ? 391 ASP A OD1   1 
ATOM   3219 O  OD2   . ASP A 1 394 ? 29.104 16.506  -18.976 1.00 52.61  ? 391 ASP A OD2   1 
ATOM   3220 N  N     . ALA A 1 395 ? 30.472 14.590  -15.451 1.00 23.30  ? 392 ALA A N     1 
ATOM   3221 C  CA    . ALA A 1 395 ? 30.037 14.362  -14.073 1.00 30.90  ? 392 ALA A CA    1 
ATOM   3222 C  C     . ALA A 1 395 ? 28.516 14.332  -13.877 1.00 25.85  ? 392 ALA A C     1 
ATOM   3223 O  O     . ALA A 1 395 ? 28.004 13.548  -13.076 1.00 25.02  ? 392 ALA A O     1 
ATOM   3224 C  CB    . ALA A 1 395 ? 30.687 15.381  -13.126 1.00 23.90  ? 392 ALA A CB    1 
ATOM   3225 N  N     . HIS A 1 396 ? 27.786 15.190  -14.586 1.00 27.41  ? 393 HIS A N     1 
ATOM   3226 C  CA    . HIS A 1 396 ? 26.331 15.173  -14.465 1.00 37.08  ? 393 HIS A CA    1 
ATOM   3227 C  C     . HIS A 1 396 ? 25.737 13.881  -15.009 1.00 22.73  ? 393 HIS A C     1 
ATOM   3228 O  O     . HIS A 1 396 ? 24.777 13.344  -14.451 1.00 32.53  ? 393 HIS A O     1 
ATOM   3229 C  CB    . HIS A 1 396 ? 25.699 16.400  -15.133 1.00 28.39  ? 393 HIS A CB    1 
ATOM   3230 C  CG    . HIS A 1 396 ? 25.819 17.645  -14.313 1.00 37.08  ? 393 HIS A CG    1 
ATOM   3231 N  ND1   . HIS A 1 396 ? 26.852 18.548  -14.475 1.00 42.62  ? 393 HIS A ND1   1 
ATOM   3232 C  CD2   . HIS A 1 396 ? 25.063 18.123  -13.299 1.00 41.39  ? 393 HIS A CD2   1 
ATOM   3233 C  CE1   . HIS A 1 396 ? 26.714 19.532  -13.609 1.00 41.50  ? 393 HIS A CE1   1 
ATOM   3234 N  NE2   . HIS A 1 396 ? 25.635 19.300  -12.880 1.00 44.87  ? 393 HIS A NE2   1 
ATOM   3235 N  N     . LYS A 1 397 ? 26.309 13.380  -16.098 1.00 25.48  ? 394 LYS A N     1 
ATOM   3236 C  CA    . LYS A 1 397 ? 25.854 12.121  -16.671 1.00 33.80  ? 394 LYS A CA    1 
ATOM   3237 C  C     . LYS A 1 397 ? 26.184 10.930  -15.777 1.00 26.52  ? 394 LYS A C     1 
ATOM   3238 O  O     . LYS A 1 397 ? 25.359 10.037  -15.582 1.00 28.38  ? 394 LYS A O     1 
ATOM   3239 C  CB    . LYS A 1 397 ? 26.455 11.905  -18.056 1.00 30.45  ? 394 LYS A CB    1 
ATOM   3240 C  CG    . LYS A 1 397 ? 26.139 10.532  -18.634 1.00 35.85  ? 394 LYS A CG    1 
ATOM   3241 C  CD    . LYS A 1 397 ? 26.547 10.421  -20.093 1.00 39.99  ? 394 LYS A CD    1 
ATOM   3242 C  CE    . LYS A 1 397 ? 26.294 9.015   -20.615 1.00 43.33  ? 394 LYS A CE    1 
ATOM   3243 N  NZ    . LYS A 1 397 ? 24.902 8.566   -20.321 1.00 46.34  ? 394 LYS A NZ    1 
ATOM   3244 N  N     . MET A 1 398 ? 27.397 10.913  -15.237 1.00 25.25  ? 395 MET A N     1 
ATOM   3245 C  CA    . MET A 1 398 ? 27.805 9.796   -14.399 1.00 27.89  ? 395 MET A CA    1 
ATOM   3246 C  C     . MET A 1 398 ? 26.953 9.745   -13.134 1.00 24.88  ? 395 MET A C     1 
ATOM   3247 O  O     . MET A 1 398 ? 26.569 8.672   -12.674 1.00 25.40  ? 395 MET A O     1 
ATOM   3248 C  CB    . MET A 1 398 ? 29.301 9.871   -14.071 1.00 22.12  ? 395 MET A CB    1 
ATOM   3249 C  CG    . MET A 1 398 ? 30.199 9.562   -15.267 1.00 20.38  ? 395 MET A CG    1 
ATOM   3250 S  SD    . MET A 1 398 ? 31.924 9.276   -14.837 1.00 28.82  ? 395 MET A SD    1 
ATOM   3251 C  CE    . MET A 1 398 ? 32.423 10.931  -14.354 1.00 30.77  ? 395 MET A CE    1 
ATOM   3252 N  N     . SER A 1 399 ? 26.643 10.915  -12.585 1.00 26.73  ? 396 SER A N     1 
ATOM   3253 C  CA    . SER A 1 399 ? 25.878 10.981  -11.344 1.00 26.63  ? 396 SER A CA    1 
ATOM   3254 C  C     . SER A 1 399 ? 24.405 10.635  -11.569 1.00 24.42  ? 396 SER A C     1 
ATOM   3255 O  O     . SER A 1 399 ? 23.779 9.998   -10.724 1.00 26.47  ? 396 SER A O     1 
ATOM   3256 C  CB    . SER A 1 399 ? 26.039 12.349  -10.662 1.00 32.32  ? 396 SER A CB    1 
ATOM   3257 O  OG    . SER A 1 399 ? 25.492 13.395  -11.444 1.00 37.21  ? 396 SER A OG    1 
ATOM   3258 N  N     . HIS A 1 400 ? 23.867 11.032  -12.717 1.00 27.64  ? 397 HIS A N     1 
ATOM   3259 C  CA    . HIS A 1 400 ? 22.504 10.656  -13.086 1.00 35.79  ? 397 HIS A CA    1 
ATOM   3260 C  C     . HIS A 1 400 ? 22.416 9.144   -13.322 1.00 28.64  ? 397 HIS A C     1 
ATOM   3261 O  O     . HIS A 1 400 ? 21.482 8.486   -12.867 1.00 31.68  ? 397 HIS A O     1 
ATOM   3262 C  CB    . HIS A 1 400 ? 22.060 11.417  -14.336 1.00 78.39  ? 397 HIS A CB    1 
ATOM   3263 C  CG    . HIS A 1 400 ? 20.644 11.145  -14.737 1.00 81.82  ? 397 HIS A CG    1 
ATOM   3264 N  ND1   . HIS A 1 400 ? 20.300 10.148  -15.623 1.00 82.39  ? 397 HIS A ND1   1 
ATOM   3265 C  CD2   . HIS A 1 400 ? 19.484 11.740  -14.370 1.00 84.08  ? 397 HIS A CD2   1 
ATOM   3266 C  CE1   . HIS A 1 400 ? 18.988 10.141  -15.787 1.00 84.31  ? 397 HIS A CE1   1 
ATOM   3267 N  NE2   . HIS A 1 400 ? 18.470 11.096  -15.038 1.00 85.34  ? 397 HIS A NE2   1 
ATOM   3268 N  N     . ASP A 1 401 ? 23.406 8.597   -14.023 1.00 26.73  ? 398 ASP A N     1 
ATOM   3269 C  CA    . ASP A 1 401 ? 23.450 7.166   -14.303 1.00 31.61  ? 398 ASP A CA    1 
ATOM   3270 C  C     . ASP A 1 401 ? 23.571 6.341   -13.025 1.00 25.82  ? 398 ASP A C     1 
ATOM   3271 O  O     . ASP A 1 401 ? 22.935 5.301   -12.888 1.00 30.36  ? 398 ASP A O     1 
ATOM   3272 C  CB    . ASP A 1 401 ? 24.611 6.830   -15.240 1.00 29.29  ? 398 ASP A CB    1 
ATOM   3273 C  CG    . ASP A 1 401 ? 24.383 7.319   -16.660 1.00 35.39  ? 398 ASP A CG    1 
ATOM   3274 O  OD1   . ASP A 1 401 ? 23.236 7.695   -16.998 1.00 31.38  ? 398 ASP A OD1   1 
ATOM   3275 O  OD2   . ASP A 1 401 ? 25.353 7.318   -17.446 1.00 35.90  ? 398 ASP A OD2   1 
ATOM   3276 N  N     . ALA A 1 402 ? 24.406 6.803   -12.096 1.00 27.35  ? 399 ALA A N     1 
ATOM   3277 C  CA    . ALA A 1 402 ? 24.580 6.115   -10.825 1.00 26.74  ? 399 ALA A CA    1 
ATOM   3278 C  C     . ALA A 1 402 ? 23.287 6.115   -10.027 1.00 26.39  ? 399 ALA A C     1 
ATOM   3279 O  O     . ALA A 1 402 ? 22.941 5.117   -9.401  1.00 27.71  ? 399 ALA A O     1 
ATOM   3280 C  CB    . ALA A 1 402 ? 25.706 6.765   -10.011 1.00 27.69  ? 399 ALA A CB    1 
ATOM   3281 N  N     . PHE A 1 403 ? 22.576 7.240   -10.041 1.00 26.12  ? 400 PHE A N     1 
ATOM   3282 C  CA    . PHE A 1 403 ? 21.299 7.312   -9.345  1.00 26.73  ? 400 PHE A CA    1 
ATOM   3283 C  C     . PHE A 1 403 ? 20.344 6.285   -9.942  1.00 31.92  ? 400 PHE A C     1 
ATOM   3284 O  O     . PHE A 1 403 ? 19.645 5.580   -9.221  1.00 32.27  ? 400 PHE A O     1 
ATOM   3285 C  CB    . PHE A 1 403 ? 20.692 8.713   -9.434  1.00 29.15  ? 400 PHE A CB    1 
ATOM   3286 C  CG    . PHE A 1 403 ? 19.428 8.870   -8.641  1.00 38.71  ? 400 PHE A CG    1 
ATOM   3287 C  CD1   . PHE A 1 403 ? 18.194 8.656   -9.233  1.00 45.73  ? 400 PHE A CD1   1 
ATOM   3288 C  CD2   . PHE A 1 403 ? 19.472 9.222   -7.303  1.00 39.99  ? 400 PHE A CD2   1 
ATOM   3289 C  CE1   . PHE A 1 403 ? 17.027 8.795   -8.507  1.00 49.62  ? 400 PHE A CE1   1 
ATOM   3290 C  CE2   . PHE A 1 403 ? 18.308 9.364   -6.572  1.00 51.20  ? 400 PHE A CE2   1 
ATOM   3291 C  CZ    . PHE A 1 403 ? 17.084 9.150   -7.175  1.00 50.76  ? 400 PHE A CZ    1 
ATOM   3292 N  N     . THR A 1 404 ? 20.338 6.192   -11.265 1.00 33.10  ? 401 THR A N     1 
ATOM   3293 C  CA    . THR A 1 404 ? 19.442 5.273   -11.954 1.00 37.05  ? 401 THR A CA    1 
ATOM   3294 C  C     . THR A 1 404 ? 19.657 3.827   -11.513 1.00 36.91  ? 401 THR A C     1 
ATOM   3295 O  O     . THR A 1 404 ? 18.694 3.099   -11.275 1.00 41.23  ? 401 THR A O     1 
ATOM   3296 C  CB    . THR A 1 404 ? 19.579 5.383   -13.483 1.00 37.50  ? 401 THR A CB    1 
ATOM   3297 O  OG1   . THR A 1 404 ? 19.157 6.686   -13.907 1.00 34.26  ? 401 THR A OG1   1 
ATOM   3298 C  CG2   . THR A 1 404 ? 18.714 4.338   -14.174 1.00 38.50  ? 401 THR A CG2   1 
ATOM   3299 N  N     . VAL A 1 405 ? 20.914 3.410   -11.382 1.00 31.97  ? 402 VAL A N     1 
ATOM   3300 C  CA    . VAL A 1 405 ? 21.185 2.012   -11.061 1.00 34.96  ? 402 VAL A CA    1 
ATOM   3301 C  C     . VAL A 1 405 ? 20.892 1.653   -9.603  1.00 35.22  ? 402 VAL A C     1 
ATOM   3302 O  O     . VAL A 1 405 ? 20.714 0.479   -9.285  1.00 40.60  ? 402 VAL A O     1 
ATOM   3303 C  CB    . VAL A 1 405 ? 22.622 1.586   -11.440 1.00 48.25  ? 402 VAL A CB    1 
ATOM   3304 C  CG1   . VAL A 1 405 ? 22.874 1.854   -12.915 1.00 49.84  ? 402 VAL A CG1   1 
ATOM   3305 C  CG2   . VAL A 1 405 ? 23.638 2.303   -10.580 1.00 49.57  ? 402 VAL A CG2   1 
ATOM   3306 N  N     . ILE A 1 406 ? 20.834 2.655   -8.726  1.00 36.40  ? 403 ILE A N     1 
ATOM   3307 C  CA    . ILE A 1 406 ? 20.597 2.407   -7.304  1.00 34.55  ? 403 ILE A CA    1 
ATOM   3308 C  C     . ILE A 1 406 ? 19.239 2.901   -6.795  1.00 37.03  ? 403 ILE A C     1 
ATOM   3309 O  O     . ILE A 1 406 ? 18.851 2.608   -5.660  1.00 39.15  ? 403 ILE A O     1 
ATOM   3310 C  CB    . ILE A 1 406 ? 21.683 3.061   -6.421  1.00 39.59  ? 403 ILE A CB    1 
ATOM   3311 C  CG1   . ILE A 1 406 ? 21.539 4.585   -6.450  1.00 38.50  ? 403 ILE A CG1   1 
ATOM   3312 C  CG2   . ILE A 1 406 ? 23.061 2.619   -6.863  1.00 39.62  ? 403 ILE A CG2   1 
ATOM   3313 C  CD1   . ILE A 1 406 ? 22.235 5.292   -5.310  1.00 41.15  ? 403 ILE A CD1   1 
ATOM   3314 N  N     . LYS A 1 407 ? 18.521 3.656   -7.621  1.00 37.99  ? 404 LYS A N     1 
ATOM   3315 C  CA    . LYS A 1 407 ? 17.304 4.323   -7.160  1.00 42.41  ? 404 LYS A CA    1 
ATOM   3316 C  C     . LYS A 1 407 ? 16.244 3.347   -6.653  1.00 67.64  ? 404 LYS A C     1 
ATOM   3317 O  O     . LYS A 1 407 ? 15.437 3.689   -5.787  1.00 66.34  ? 404 LYS A O     1 
ATOM   3318 C  CB    . LYS A 1 407 ? 16.726 5.224   -8.256  1.00 73.76  ? 404 LYS A CB    1 
ATOM   3319 C  CG    . LYS A 1 407 ? 16.220 4.484   -9.480  1.00 73.14  ? 404 LYS A CG    1 
ATOM   3320 C  CD    . LYS A 1 407 ? 15.688 5.458   -10.518 1.00 75.44  ? 404 LYS A CD    1 
ATOM   3321 C  CE    . LYS A 1 407 ? 15.043 4.729   -11.684 1.00 78.97  ? 404 LYS A CE    1 
ATOM   3322 N  NZ    . LYS A 1 407 ? 15.989 3.789   -12.344 1.00 79.99  ? 404 LYS A NZ    1 
ATOM   3323 N  N     . ASN A 1 408 ? 16.253 2.131   -7.187  1.00 67.00  ? 405 ASN A N     1 
ATOM   3324 C  CA    . ASN A 1 408 ? 15.275 1.122   -6.796  1.00 57.06  ? 405 ASN A CA    1 
ATOM   3325 C  C     . ASN A 1 408 ? 15.581 0.499   -5.437  1.00 64.12  ? 405 ASN A C     1 
ATOM   3326 O  O     . ASN A 1 408 ? 14.820 -0.330  -4.940  1.00 65.97  ? 405 ASN A O     1 
ATOM   3327 C  CB    . ASN A 1 408 ? 15.169 0.030   -7.862  1.00 101.72 ? 405 ASN A CB    1 
ATOM   3328 C  CG    . ASN A 1 408 ? 16.445 -0.775  -8.001  1.00 101.21 ? 405 ASN A CG    1 
ATOM   3329 O  OD1   . ASN A 1 408 ? 17.548 -0.235  -7.915  1.00 99.33  ? 405 ASN A OD1   1 
ATOM   3330 N  ND2   . ASN A 1 408 ? 16.301 -2.077  -8.213  1.00 102.65 ? 405 ASN A ND2   1 
ATOM   3331 N  N     . CYS A 1 409 ? 16.701 0.895   -4.842  1.00 58.25  ? 406 CYS A N     1 
ATOM   3332 C  CA    . CYS A 1 409 ? 17.073 0.395   -3.526  1.00 39.12  ? 406 CYS A CA    1 
ATOM   3333 C  C     . CYS A 1 409 ? 16.287 1.130   -2.452  1.00 51.86  ? 406 CYS A C     1 
ATOM   3334 O  O     . CYS A 1 409 ? 16.146 0.646   -1.330  1.00 57.36  ? 406 CYS A O     1 
ATOM   3335 C  CB    . CYS A 1 409 ? 18.574 0.575   -3.282  1.00 55.77  ? 406 CYS A CB    1 
ATOM   3336 S  SG    . CYS A 1 409 ? 19.624 -0.334  -4.425  1.00 86.17  ? 406 CYS A SG    1 
ATOM   3337 N  N     . ASN A 1 410 ? 15.779 2.305   -2.807  1.00 48.76  ? 407 ASN A N     1 
ATOM   3338 C  CA    . ASN A 1 410 ? 15.025 3.130   -1.872  1.00 33.87  ? 407 ASN A CA    1 
ATOM   3339 C  C     . ASN A 1 410 ? 13.669 2.511   -1.509  1.00 73.27  ? 407 ASN A C     1 
ATOM   3340 O  O     . ASN A 1 410 ? 12.788 2.372   -2.358  1.00 73.35  ? 407 ASN A O     1 
ATOM   3341 C  CB    . ASN A 1 410 ? 14.831 4.535   -2.448  1.00 45.06  ? 407 ASN A CB    1 
ATOM   3342 C  CG    . ASN A 1 410 ? 14.085 5.456   -1.507  1.00 45.29  ? 407 ASN A CG    1 
ATOM   3343 O  OD1   . ASN A 1 410 ? 13.826 5.111   -0.353  1.00 48.78  ? 407 ASN A OD1   1 
ATOM   3344 N  ND2   . ASN A 1 410 ? 13.739 6.643   -1.996  1.00 44.28  ? 407 ASN A ND2   1 
ATOM   3345 N  N     . THR A 1 411 ? 13.515 2.143   -0.239  1.00 70.99  ? 408 THR A N     1 
ATOM   3346 C  CA    . THR A 1 411 ? 12.285 1.533   0.260   1.00 56.56  ? 408 THR A CA    1 
ATOM   3347 C  C     . THR A 1 411 ? 11.171 2.560   0.441   1.00 94.52  ? 408 THR A C     1 
ATOM   3348 O  O     . THR A 1 411 ? 10.000 2.264   0.207   1.00 95.73  ? 408 THR A O     1 
ATOM   3349 C  CB    . THR A 1 411 ? 12.526 0.819   1.607   1.00 110.74 ? 408 THR A CB    1 
ATOM   3350 O  OG1   . THR A 1 411 ? 13.298 -0.368  1.389   1.00 109.51 ? 408 THR A OG1   1 
ATOM   3351 C  CG2   . THR A 1 411 ? 11.207 0.442   2.261   1.00 114.10 ? 408 THR A CG2   1 
ATOM   3352 N  N     . SER A 1 412 ? 11.546 3.765   0.857   1.00 94.03  ? 409 SER A N     1 
ATOM   3353 C  CA    . SER A 1 412 ? 10.584 4.827   1.139   1.00 54.63  ? 409 SER A CA    1 
ATOM   3354 C  C     . SER A 1 412 ? 9.450  4.893   0.119   1.00 110.85 ? 409 SER A C     1 
ATOM   3355 O  O     . SER A 1 412 ? 9.685  4.883   -1.089  1.00 108.98 ? 409 SER A O     1 
ATOM   3356 C  CB    . SER A 1 412 ? 11.290 6.182   1.214   1.00 89.61  ? 409 SER A CB    1 
ATOM   3357 O  OG    . SER A 1 412 ? 10.359 7.232   1.407   1.00 89.39  ? 409 SER A OG    1 
ATOM   3358 N  N     . GLY A 1 413 ? 8.220  4.958   0.618   1.00 113.80 ? 410 GLY A N     1 
ATOM   3359 C  CA    . GLY A 1 413 ? 7.058  5.126   -0.235  1.00 81.28  ? 410 GLY A CA    1 
ATOM   3360 C  C     . GLY A 1 413 ? 6.980  6.552   -0.739  1.00 140.95 ? 410 GLY A C     1 
ATOM   3361 O  O     . GLY A 1 413 ? 6.348  6.833   -1.757  1.00 141.13 ? 410 GLY A O     1 
ATOM   3362 N  N     . ILE A 1 414 ? 7.630  7.457   -0.014  1.00 140.62 ? 411 ILE A N     1 
ATOM   3363 C  CA    . ILE A 1 414 ? 7.710  8.853   -0.416  1.00 82.54  ? 411 ILE A CA    1 
ATOM   3364 C  C     . ILE A 1 414 ? 8.920  9.053   -1.320  1.00 143.75 ? 411 ILE A C     1 
ATOM   3365 O  O     . ILE A 1 414 ? 10.054 8.790   -0.920  1.00 142.24 ? 411 ILE A O     1 
ATOM   3366 C  CB    . ILE A 1 414 ? 7.838  9.781   0.805   1.00 137.25 ? 411 ILE A CB    1 
ATOM   3367 C  CG1   . ILE A 1 414 ? 6.837  9.380   1.889   1.00 138.71 ? 411 ILE A CG1   1 
ATOM   3368 C  CG2   . ILE A 1 414 ? 7.646  11.233  0.393   1.00 137.45 ? 411 ILE A CG2   1 
ATOM   3369 C  CD1   . ILE A 1 414 ? 6.947  10.202  3.154   1.00 139.10 ? 411 ILE A CD1   1 
ATOM   3370 N  N     . GLN A 1 415 ? 8.671  9.517   -2.540  1.00 144.24 ? 412 GLN A N     1 
ATOM   3371 C  CA    . GLN A 1 415 ? 9.726  9.696   -3.532  1.00 90.87  ? 412 GLN A CA    1 
ATOM   3372 C  C     . GLN A 1 415 ? 10.853 10.582  -3.006  1.00 128.49 ? 412 GLN A C     1 
ATOM   3373 O  O     . GLN A 1 415 ? 12.031 10.303  -3.229  1.00 127.27 ? 412 GLN A O     1 
ATOM   3374 C  CB    . GLN A 1 415 ? 9.146  10.302  -4.812  1.00 153.67 ? 412 GLN A CB    1 
ATOM   3375 C  CG    . GLN A 1 415 ? 10.062 10.224  -6.023  1.00 152.42 ? 412 GLN A CG    1 
ATOM   3376 C  CD    . GLN A 1 415 ? 10.045 8.857   -6.683  1.00 151.81 ? 412 GLN A CD    1 
ATOM   3377 O  OE1   . GLN A 1 415 ? 9.991  7.828   -6.010  1.00 151.46 ? 412 GLN A OE1   1 
ATOM   3378 N  NE2   . GLN A 1 415 ? 10.082 8.843   -8.011  1.00 151.66 ? 412 GLN A NE2   1 
ATOM   3379 N  N     . THR A 1 416 ? 10.479 11.648  -2.305  1.00 128.58 ? 413 THR A N     1 
ATOM   3380 C  CA    . THR A 1 416 ? 11.440 12.631  -1.813  1.00 65.97  ? 413 THR A CA    1 
ATOM   3381 C  C     . THR A 1 416 ? 12.361 12.073  -0.730  1.00 94.15  ? 413 THR A C     1 
ATOM   3382 O  O     . THR A 1 416 ? 13.495 12.529  -0.573  1.00 92.71  ? 413 THR A O     1 
ATOM   3383 C  CB    . THR A 1 416 ? 10.721 13.881  -1.264  1.00 113.05 ? 413 THR A CB    1 
ATOM   3384 O  OG1   . THR A 1 416 ? 9.907  14.456  -2.292  1.00 114.15 ? 413 THR A OG1   1 
ATOM   3385 C  CG2   . THR A 1 416 ? 11.729 14.915  -0.785  1.00 112.40 ? 413 THR A CG2   1 
ATOM   3386 N  N     . GLU A 1 417 ? 11.873 11.088  0.015   1.00 95.02  ? 414 GLU A N     1 
ATOM   3387 C  CA    . GLU A 1 417 ? 12.643 10.512  1.112   1.00 45.49  ? 414 GLU A CA    1 
ATOM   3388 C  C     . GLU A 1 417 ? 13.449 9.294   0.667   1.00 57.24  ? 414 GLU A C     1 
ATOM   3389 O  O     . GLU A 1 417 ? 13.064 8.592   -0.267  1.00 57.87  ? 414 GLU A O     1 
ATOM   3390 C  CB    . GLU A 1 417 ? 11.724 10.141  2.278   1.00 92.80  ? 414 GLU A CB    1 
ATOM   3391 C  CG    . GLU A 1 417 ? 10.839 11.281  2.749   1.00 93.78  ? 414 GLU A CG    1 
ATOM   3392 C  CD    . GLU A 1 417 ? 11.621 12.550  3.021   1.00 91.31  ? 414 GLU A CD    1 
ATOM   3393 O  OE1   . GLU A 1 417 ? 12.320 12.612  4.054   1.00 90.13  ? 414 GLU A OE1   1 
ATOM   3394 O  OE2   . GLU A 1 417 ? 11.540 13.485  2.197   1.00 91.09  ? 414 GLU A OE2   1 
ATOM   3395 N  N     . TRP A 1 418 ? 14.573 9.049   1.335   1.00 47.66  ? 415 TRP A N     1 
ATOM   3396 C  CA    . TRP A 1 418 ? 15.360 7.855   1.058   1.00 31.32  ? 415 TRP A CA    1 
ATOM   3397 C  C     . TRP A 1 418 ? 15.494 6.985   2.303   1.00 48.37  ? 415 TRP A C     1 
ATOM   3398 O  O     . TRP A 1 418 ? 15.936 7.451   3.352   1.00 43.88  ? 415 TRP A O     1 
ATOM   3399 C  CB    . TRP A 1 418 ? 16.752 8.214   0.517   1.00 35.37  ? 415 TRP A CB    1 
ATOM   3400 C  CG    . TRP A 1 418 ? 17.442 7.038   -0.110  1.00 36.83  ? 415 TRP A CG    1 
ATOM   3401 C  CD1   . TRP A 1 418 ? 17.947 5.947   0.534   1.00 38.12  ? 415 TRP A CD1   1 
ATOM   3402 C  CD2   . TRP A 1 418 ? 17.679 6.825   -1.507  1.00 37.73  ? 415 TRP A CD2   1 
ATOM   3403 N  NE1   . TRP A 1 418 ? 18.483 5.066   -0.376  1.00 40.58  ? 415 TRP A NE1   1 
ATOM   3404 C  CE2   . TRP A 1 418 ? 18.333 5.582   -1.636  1.00 39.30  ? 415 TRP A CE2   1 
ATOM   3405 C  CE3   . TRP A 1 418 ? 17.403 7.564   -2.662  1.00 42.26  ? 415 TRP A CE3   1 
ATOM   3406 C  CZ2   . TRP A 1 418 ? 18.721 5.065   -2.872  1.00 42.61  ? 415 TRP A CZ2   1 
ATOM   3407 C  CZ3   . TRP A 1 418 ? 17.788 7.047   -3.890  1.00 43.91  ? 415 TRP A CZ3   1 
ATOM   3408 C  CH2   . TRP A 1 418 ? 18.440 5.811   -3.984  1.00 44.44  ? 415 TRP A CH2   1 
ATOM   3409 N  N     . SER A 1 419 ? 15.114 5.718   2.179   1.00 51.11  ? 416 SER A N     1 
ATOM   3410 C  CA    . SER A 1 419 ? 15.223 4.778   3.288   1.00 39.66  ? 416 SER A CA    1 
ATOM   3411 C  C     . SER A 1 419 ? 15.484 3.360   2.782   1.00 60.75  ? 416 SER A C     1 
ATOM   3412 O  O     . SER A 1 419 ? 15.006 2.985   1.716   1.00 57.25  ? 416 SER A O     1 
ATOM   3413 C  CB    . SER A 1 419 ? 13.956 4.809   4.146   1.00 81.65  ? 416 SER A CB    1 
ATOM   3414 O  OG    . SER A 1 419 ? 12.813 4.489   3.374   1.00 83.63  ? 416 SER A OG    1 
ATOM   3415 N  N     . PRO A 1 420 ? 16.271 2.580   3.539   1.00 61.31  ? 417 PRO A N     1 
ATOM   3416 C  CA    . PRO A 1 420 ? 16.954 3.077   4.737   1.00 43.38  ? 417 PRO A CA    1 
ATOM   3417 C  C     . PRO A 1 420 ? 18.066 4.035   4.333   1.00 39.18  ? 417 PRO A C     1 
ATOM   3418 O  O     . PRO A 1 420 ? 18.576 3.924   3.217   1.00 47.81  ? 417 PRO A O     1 
ATOM   3419 C  CB    . PRO A 1 420 ? 17.543 1.807   5.355   1.00 67.28  ? 417 PRO A CB    1 
ATOM   3420 C  CG    . PRO A 1 420 ? 17.709 0.877   4.206   1.00 64.93  ? 417 PRO A CG    1 
ATOM   3421 C  CD    . PRO A 1 420 ? 16.557 1.157   3.290   1.00 62.55  ? 417 PRO A CD    1 
ATOM   3422 N  N     . PRO A 1 421 ? 18.427 4.974   5.220   1.00 41.91  ? 418 PRO A N     1 
ATOM   3423 C  CA    . PRO A 1 421 ? 19.459 5.974   4.922   1.00 35.73  ? 418 PRO A CA    1 
ATOM   3424 C  C     . PRO A 1 421 ? 20.752 5.338   4.417   1.00 36.74  ? 418 PRO A C     1 
ATOM   3425 O  O     . PRO A 1 421 ? 21.063 4.203   4.782   1.00 34.85  ? 418 PRO A O     1 
ATOM   3426 C  CB    . PRO A 1 421 ? 19.692 6.645   6.277   1.00 39.14  ? 418 PRO A CB    1 
ATOM   3427 C  CG    . PRO A 1 421 ? 18.395 6.482   6.996   1.00 42.46  ? 418 PRO A CG    1 
ATOM   3428 C  CD    . PRO A 1 421 ? 17.862 5.147   6.570   1.00 40.18  ? 418 PRO A CD    1 
ATOM   3429 N  N     . LEU A 1 422 ? 21.484 6.070   3.580   1.00 35.44  ? 419 LEU A N     1 
ATOM   3430 C  CA    . LEU A 1 422 ? 22.731 5.575   3.002   1.00 28.75  ? 419 LEU A CA    1 
ATOM   3431 C  C     . LEU A 1 422 ? 23.933 6.029   3.818   1.00 29.97  ? 419 LEU A C     1 
ATOM   3432 O  O     . LEU A 1 422 ? 24.069 7.211   4.142   1.00 33.02  ? 419 LEU A O     1 
ATOM   3433 C  CB    . LEU A 1 422 ? 22.872 6.036   1.547   1.00 30.42  ? 419 LEU A CB    1 
ATOM   3434 C  CG    . LEU A 1 422 ? 21.781 5.540   0.593   1.00 30.22  ? 419 LEU A CG    1 
ATOM   3435 C  CD1   . LEU A 1 422 ? 22.133 5.895   -0.852  1.00 29.18  ? 419 LEU A CD1   1 
ATOM   3436 C  CD2   . LEU A 1 422 ? 21.587 4.039   0.746   1.00 31.77  ? 419 LEU A CD2   1 
ATOM   3437 N  N     . THR A 1 423 ? 24.802 5.082   4.152   1.00 26.21  ? 420 THR A N     1 
ATOM   3438 C  CA    . THR A 1 423 ? 25.968 5.382   4.976   1.00 26.42  ? 420 THR A CA    1 
ATOM   3439 C  C     . THR A 1 423 ? 27.273 5.377   4.171   1.00 22.47  ? 420 THR A C     1 
ATOM   3440 O  O     . THR A 1 423 ? 28.343 5.607   4.729   1.00 25.34  ? 420 THR A O     1 
ATOM   3441 C  CB    . THR A 1 423 ? 26.082 4.405   6.163   1.00 32.54  ? 420 THR A CB    1 
ATOM   3442 O  OG1   . THR A 1 423 ? 26.099 3.059   5.673   1.00 34.24  ? 420 THR A OG1   1 
ATOM   3443 C  CG2   . THR A 1 423 ? 24.893 4.577   7.114   1.00 34.84  ? 420 THR A CG2   1 
ATOM   3444 N  N     . MET A 1 424 ? 27.180 5.122   2.867   1.00 21.98  ? 421 MET A N     1 
ATOM   3445 C  CA    . MET A 1 424 ? 28.355 5.163   1.984   1.00 16.70  ? 421 MET A CA    1 
ATOM   3446 C  C     . MET A 1 424 ? 27.926 5.258   0.526   1.00 24.09  ? 421 MET A C     1 
ATOM   3447 O  O     . MET A 1 424 ? 26.954 4.617   0.124   1.00 23.11  ? 421 MET A O     1 
ATOM   3448 C  CB    . MET A 1 424 ? 29.247 3.929   2.195   1.00 24.16  ? 421 MET A CB    1 
ATOM   3449 C  CG    . MET A 1 424 ? 30.533 3.887   1.348   1.00 21.93  ? 421 MET A CG    1 
ATOM   3450 S  SD    . MET A 1 424 ? 30.287 3.186   -0.301  1.00 27.02  ? 421 MET A SD    1 
ATOM   3451 C  CE    . MET A 1 424 ? 29.920 1.474   0.060   1.00 25.72  ? 421 MET A CE    1 
ATOM   3452 N  N     . LEU A 1 425 ? 28.640 6.084   -0.241  1.00 20.49  ? 422 LEU A N     1 
ATOM   3453 C  CA    . LEU A 1 425 ? 28.522 6.133   -1.695  1.00 18.13  ? 422 LEU A CA    1 
ATOM   3454 C  C     . LEU A 1 425 ? 29.905 5.927   -2.297  1.00 18.93  ? 422 LEU A C     1 
ATOM   3455 O  O     . LEU A 1 425 ? 30.906 6.422   -1.762  1.00 19.09  ? 422 LEU A O     1 
ATOM   3456 C  CB    . LEU A 1 425 ? 27.978 7.485   -2.171  1.00 20.02  ? 422 LEU A CB    1 
ATOM   3457 C  CG    . LEU A 1 425 ? 26.576 7.944   -1.769  1.00 27.30  ? 422 LEU A CG    1 
ATOM   3458 C  CD1   . LEU A 1 425 ? 26.315 9.349   -2.311  1.00 27.09  ? 422 LEU A CD1   1 
ATOM   3459 C  CD2   . LEU A 1 425 ? 25.518 6.967   -2.258  1.00 26.52  ? 422 LEU A CD2   1 
ATOM   3460 N  N     . PHE A 1 426 ? 29.957 5.217   -3.423  1.00 17.27  ? 423 PHE A N     1 
ATOM   3461 C  CA    . PHE A 1 426 ? 31.219 4.849   -4.053  1.00 14.64  ? 423 PHE A CA    1 
ATOM   3462 C  C     . PHE A 1 426 ? 31.013 4.786   -5.563  1.00 20.21  ? 423 PHE A C     1 
ATOM   3463 O  O     . PHE A 1 426 ? 30.111 4.099   -6.042  1.00 24.63  ? 423 PHE A O     1 
ATOM   3464 C  CB    . PHE A 1 426 ? 31.658 3.468   -3.534  1.00 23.51  ? 423 PHE A CB    1 
ATOM   3465 C  CG    . PHE A 1 426 ? 33.001 2.997   -4.044  1.00 27.18  ? 423 PHE A CG    1 
ATOM   3466 C  CD1   . PHE A 1 426 ? 33.364 1.666   -3.917  1.00 39.69  ? 423 PHE A CD1   1 
ATOM   3467 C  CD2   . PHE A 1 426 ? 33.908 3.876   -4.613  1.00 27.90  ? 423 PHE A CD2   1 
ATOM   3468 C  CE1   . PHE A 1 426 ? 34.593 1.216   -4.376  1.00 42.00  ? 423 PHE A CE1   1 
ATOM   3469 C  CE2   . PHE A 1 426 ? 35.143 3.430   -5.072  1.00 33.00  ? 423 PHE A CE2   1 
ATOM   3470 C  CZ    . PHE A 1 426 ? 35.482 2.101   -4.952  1.00 34.39  ? 423 PHE A CZ    1 
ATOM   3471 N  N     . LEU A 1 427 ? 31.834 5.528   -6.303  1.00 15.23  ? 424 LEU A N     1 
ATOM   3472 C  CA    . LEU A 1 427 ? 31.851 5.471   -7.757  1.00 14.65  ? 424 LEU A CA    1 
ATOM   3473 C  C     . LEU A 1 427 ? 33.230 5.038   -8.193  1.00 16.78  ? 424 LEU A C     1 
ATOM   3474 O  O     . LEU A 1 427 ? 34.227 5.592   -7.743  1.00 19.66  ? 424 LEU A O     1 
ATOM   3475 C  CB    . LEU A 1 427 ? 31.566 6.842   -8.364  1.00 21.43  ? 424 LEU A CB    1 
ATOM   3476 C  CG    . LEU A 1 427 ? 30.215 7.471   -8.047  1.00 26.05  ? 424 LEU A CG    1 
ATOM   3477 C  CD1   . LEU A 1 427 ? 30.103 8.843   -8.717  1.00 27.70  ? 424 LEU A CD1   1 
ATOM   3478 C  CD2   . LEU A 1 427 ? 29.089 6.548   -8.490  1.00 25.38  ? 424 LEU A CD2   1 
ATOM   3479 N  N     . CYS A 1 428 ? 33.296 4.063   -9.091  1.00 17.47  ? 425 CYS A N     1 
ATOM   3480 C  CA    . CYS A 1 428 ? 34.586 3.568   -9.546  1.00 13.98  ? 425 CYS A CA    1 
ATOM   3481 C  C     . CYS A 1 428 ? 34.577 3.357   -11.057 1.00 21.21  ? 425 CYS A C     1 
ATOM   3482 O  O     . CYS A 1 428 ? 33.675 2.702   -11.586 1.00 23.20  ? 425 CYS A O     1 
ATOM   3483 C  CB    . CYS A 1 428 ? 34.922 2.254   -8.842  1.00 19.40  ? 425 CYS A CB    1 
ATOM   3484 S  SG    . CYS A 1 428 ? 36.603 1.642   -9.152  1.00 25.92  ? 425 CYS A SG    1 
ATOM   3485 N  N     . ALA A 1 429 ? 35.569 3.928   -11.740 1.00 16.60  ? 426 ALA A N     1 
ATOM   3486 C  CA    . ALA A 1 429 ? 35.736 3.747   -13.173 1.00 13.59  ? 426 ALA A CA    1 
ATOM   3487 C  C     . ALA A 1 429 ? 36.675 2.578   -13.400 1.00 19.22  ? 426 ALA A C     1 
ATOM   3488 O  O     . ALA A 1 429 ? 37.744 2.493   -12.779 1.00 18.00  ? 426 ALA A O     1 
ATOM   3489 C  CB    . ALA A 1 429 ? 36.305 5.019   -13.817 1.00 20.38  ? 426 ALA A CB    1 
ATOM   3490 N  N     . THR A 1 430 ? 36.277 1.681   -14.297 1.00 19.95  ? 427 THR A N     1 
ATOM   3491 C  CA    . THR A 1 430 ? 37.015 0.438   -14.520 1.00 17.87  ? 427 THR A CA    1 
ATOM   3492 C  C     . THR A 1 430 ? 36.990 0.055   -15.993 1.00 22.21  ? 427 THR A C     1 
ATOM   3493 O  O     . THR A 1 430 ? 36.379 0.744   -16.807 1.00 20.62  ? 427 THR A O     1 
ATOM   3494 C  CB    . THR A 1 430 ? 36.422 -0.724  -13.682 1.00 25.76  ? 427 THR A CB    1 
ATOM   3495 O  OG1   . THR A 1 430 ? 35.147 -1.104  -14.214 1.00 30.26  ? 427 THR A OG1   1 
ATOM   3496 C  CG2   . THR A 1 430 ? 36.236 -0.310  -12.218 1.00 27.51  ? 427 THR A CG2   1 
ATOM   3497 N  N     . LYS A 1 431 ? 37.652 -1.054  -16.331 1.00 21.31  ? 428 LYS A N     1 
ATOM   3498 C  CA    . LYS A 1 431 ? 37.683 -1.564  -17.709 1.00 17.28  ? 428 LYS A CA    1 
ATOM   3499 C  C     . LYS A 1 431 ? 38.264 -0.562  -18.715 1.00 17.90  ? 428 LYS A C     1 
ATOM   3500 O  O     . LYS A 1 431 ? 37.586 -0.122  -19.653 1.00 21.98  ? 428 LYS A O     1 
ATOM   3501 C  CB    . LYS A 1 431 ? 36.299 -2.041  -18.150 1.00 26.00  ? 428 LYS A CB    1 
ATOM   3502 C  CG    . LYS A 1 431 ? 35.742 -3.135  -17.254 1.00 36.56  ? 428 LYS A CG    1 
ATOM   3503 C  CD    . LYS A 1 431 ? 34.666 -3.952  -17.956 1.00 43.44  ? 428 LYS A CD    1 
ATOM   3504 C  CE    . LYS A 1 431 ? 34.120 -5.037  -17.036 1.00 47.70  ? 428 LYS A CE    1 
ATOM   3505 N  NZ    . LYS A 1 431 ? 35.209 -5.856  -16.429 1.00 47.54  ? 428 LYS A NZ    1 
ATOM   3506 N  N     . PHE A 1 432 ? 39.527 -0.211  -18.503 1.00 21.93  ? 429 PHE A N     1 
ATOM   3507 C  CA    . PHE A 1 432 ? 40.238 0.707   -19.387 1.00 14.64  ? 429 PHE A CA    1 
ATOM   3508 C  C     . PHE A 1 432 ? 40.537 0.076   -20.747 1.00 25.11  ? 429 PHE A C     1 
ATOM   3509 O  O     . PHE A 1 432 ? 40.821 -1.124  -20.839 1.00 26.99  ? 429 PHE A O     1 
ATOM   3510 C  CB    . PHE A 1 432 ? 41.529 1.197   -18.710 1.00 19.49  ? 429 PHE A CB    1 
ATOM   3511 C  CG    . PHE A 1 432 ? 41.292 2.188   -17.596 1.00 21.65  ? 429 PHE A CG    1 
ATOM   3512 C  CD1   . PHE A 1 432 ? 41.193 3.541   -17.866 1.00 21.50  ? 429 PHE A CD1   1 
ATOM   3513 C  CD2   . PHE A 1 432 ? 41.157 1.766   -16.284 1.00 23.70  ? 429 PHE A CD2   1 
ATOM   3514 C  CE1   . PHE A 1 432 ? 40.972 4.461   -16.855 1.00 20.97  ? 429 PHE A CE1   1 
ATOM   3515 C  CE2   . PHE A 1 432 ? 40.935 2.681   -15.262 1.00 26.23  ? 429 PHE A CE2   1 
ATOM   3516 C  CZ    . PHE A 1 432 ? 40.843 4.035   -15.551 1.00 22.62  ? 429 PHE A CZ    1 
ATOM   3517 N  N     . SER A 1 433 ? 40.447 0.893   -21.799 1.00 20.82  ? 430 SER A N     1 
ATOM   3518 C  CA    . SER A 1 433 ? 40.853 0.529   -23.149 1.00 16.67  ? 430 SER A CA    1 
ATOM   3519 C  C     . SER A 1 433 ? 41.799 1.612   -23.649 1.00 26.72  ? 430 SER A C     1 
ATOM   3520 O  O     . SER A 1 433 ? 41.724 2.759   -23.205 1.00 24.13  ? 430 SER A O     1 
ATOM   3521 C  CB    . SER A 1 433 ? 39.637 0.430   -24.074 1.00 34.75  ? 430 SER A CB    1 
ATOM   3522 O  OG    . SER A 1 433 ? 38.772 -0.615  -23.665 1.00 41.99  ? 430 SER A OG    1 
ATOM   3523 N  N     . ALA A 1 434 ? 42.690 1.255   -24.566 1.00 24.09  ? 431 ALA A N     1 
ATOM   3524 C  CA    . ALA A 1 434 ? 43.638 2.227   -25.092 1.00 24.80  ? 431 ALA A CA    1 
ATOM   3525 C  C     . ALA A 1 434 ? 42.903 3.327   -25.833 1.00 31.38  ? 431 ALA A C     1 
ATOM   3526 O  O     . ALA A 1 434 ? 41.881 3.080   -26.479 1.00 34.20  ? 431 ALA A O     1 
ATOM   3527 C  CB    . ALA A 1 434 ? 44.638 1.549   -26.010 1.00 34.35  ? 431 ALA A CB    1 
ATOM   3528 N  N     . SER A 1 435 ? 43.415 4.549   -25.727 1.00 25.79  ? 432 SER A N     1 
ATOM   3529 C  CA    . SER A 1 435 ? 42.838 5.682   -26.447 1.00 25.50  ? 432 SER A CA    1 
ATOM   3530 C  C     . SER A 1 435 ? 43.946 6.528   -27.057 1.00 39.48  ? 432 SER A C     1 
ATOM   3531 O  O     . SER A 1 435 ? 43.706 7.616   -27.575 1.00 38.23  ? 432 SER A O     1 
ATOM   3532 C  CB    . SER A 1 435 ? 41.983 6.536   -25.513 1.00 47.07  ? 432 SER A CB    1 
ATOM   3533 O  OG    . SER A 1 435 ? 42.786 7.168   -24.534 1.00 52.76  ? 432 SER A OG    1 
ATOM   3534 O  OXT   . SER A 1 435 ? 45.111 6.140   -27.036 1.00 41.45  ? 432 SER A OXT   1 
ATOM   3535 O  "O3'" . DC  B 2 1   ? 27.799 4.762   11.899  1.00 66.27  ? 1   DC  T "O3'" 1 
ATOM   3536 P  P     . DA  B 2 2   ? 28.179 4.436   13.426  1.00 146.97 ? 2   DA  T P     1 
ATOM   3537 O  OP1   . DA  B 2 2   ? 28.309 2.968   13.560  1.00 146.01 ? 2   DA  T OP1   1 
ATOM   3538 O  OP2   . DA  B 2 2   ? 27.239 5.174   14.298  1.00 147.91 ? 2   DA  T OP2   1 
ATOM   3539 O  "O5'" . DA  B 2 2   ? 29.623 5.102   13.602  1.00 63.97  ? 2   DA  T "O5'" 1 
ATOM   3540 C  "C5'" . DA  B 2 2   ? 30.680 4.760   12.716  1.00 59.42  ? 2   DA  T "C5'" 1 
ATOM   3541 C  "C4'" . DA  B 2 2   ? 31.946 5.499   13.103  1.00 55.21  ? 2   DA  T "C4'" 1 
ATOM   3542 O  "O4'" . DA  B 2 2   ? 31.811 6.895   12.747  1.00 51.77  ? 2   DA  T "O4'" 1 
ATOM   3543 C  "C3'" . DA  B 2 2   ? 32.260 5.474   14.595  1.00 55.05  ? 2   DA  T "C3'" 1 
ATOM   3544 O  "O3'" A DA  B 2 2   ? 33.666 5.416   14.796  0.70 52.20  ? 2   DA  T "O3'" 1 
ATOM   3545 O  "O3'" B DA  B 2 2   ? 33.666 5.416   14.795  0.30 53.12  ? 2   DA  T "O3'" 1 
ATOM   3546 C  "C2'" . DA  B 2 2   ? 31.679 6.789   15.103  1.00 54.03  ? 2   DA  T "C2'" 1 
ATOM   3547 C  "C1'" . DA  B 2 2   ? 31.909 7.701   13.904  1.00 52.00  ? 2   DA  T "C1'" 1 
ATOM   3548 N  N9    . DA  B 2 2   ? 30.921 8.767   13.796  1.00 45.33  ? 2   DA  T N9    1 
ATOM   3549 C  C8    . DA  B 2 2   ? 29.645 8.787   14.293  1.00 44.57  ? 2   DA  T C8    1 
ATOM   3550 N  N7    . DA  B 2 2   ? 28.993 9.896   14.027  1.00 42.57  ? 2   DA  T N7    1 
ATOM   3551 C  C5    . DA  B 2 2   ? 29.910 10.648  13.309  1.00 41.73  ? 2   DA  T C5    1 
ATOM   3552 C  C6    . DA  B 2 2   ? 29.838 11.929  12.734  1.00 43.10  ? 2   DA  T C6    1 
ATOM   3553 N  N6    . DA  B 2 2   ? 28.748 12.703  12.803  1.00 43.84  ? 2   DA  T N6    1 
ATOM   3554 N  N1    . DA  B 2 2   ? 30.934 12.378  12.085  1.00 40.63  ? 2   DA  T N1    1 
ATOM   3555 C  C2    . DA  B 2 2   ? 32.022 11.597  12.016  1.00 34.01  ? 2   DA  T C2    1 
ATOM   3556 N  N3    . DA  B 2 2   ? 32.209 10.378  12.518  1.00 35.70  ? 2   DA  T N3    1 
ATOM   3557 C  C4    . DA  B 2 2   ? 31.102 9.966   13.157  1.00 40.71  ? 2   DA  T C4    1 
ATOM   3558 P  P     . DT  B 2 3   ? 34.356 4.046   15.271  1.00 76.78  ? 3   DT  T P     1 
ATOM   3559 O  OP1   . DT  B 2 3   ? 33.321 3.216   15.925  1.00 79.76  ? 3   DT  T OP1   1 
ATOM   3560 O  OP2   . DT  B 2 3   ? 35.602 4.390   15.993  1.00 75.79  ? 3   DT  T OP2   1 
ATOM   3561 O  "O5'" . DT  B 2 3   ? 34.757 3.330   13.897  1.00 67.48  ? 3   DT  T "O5'" 1 
ATOM   3562 C  "C5'" . DT  B 2 3   ? 36.006 3.614   13.275  1.00 62.78  ? 3   DT  T "C5'" 1 
ATOM   3563 C  "C4'" . DT  B 2 3   ? 35.967 4.932   12.526  1.00 61.35  ? 3   DT  T "C4'" 1 
ATOM   3564 O  "O4'" . DT  B 2 3   ? 37.326 5.348   12.239  1.00 61.21  ? 3   DT  T "O4'" 1 
ATOM   3565 C  "C3'" . DT  B 2 3   ? 35.257 4.901   11.179  1.00 58.42  ? 3   DT  T "C3'" 1 
ATOM   3566 O  "O3'" . DT  B 2 3   ? 34.697 6.179   10.925  1.00 52.51  ? 3   DT  T "O3'" 1 
ATOM   3567 C  "C2'" . DT  B 2 3   ? 36.396 4.578   10.217  1.00 60.47  ? 3   DT  T "C2'" 1 
ATOM   3568 C  "C1'" . DT  B 2 3   ? 37.540 5.376   10.840  1.00 65.80  ? 3   DT  T "C1'" 1 
ATOM   3569 N  N1    . DT  B 2 3   ? 38.895 4.808   10.576  1.00 73.45  ? 3   DT  T N1    1 
ATOM   3570 C  C2    . DT  B 2 3   ? 39.901 5.624   10.094  1.00 77.29  ? 3   DT  T C2    1 
ATOM   3571 O  O2    . DT  B 2 3   ? 39.756 6.813   9.859   1.00 80.74  ? 3   DT  T O2    1 
ATOM   3572 N  N3    . DT  B 2 3   ? 41.103 4.990   9.894   1.00 75.53  ? 3   DT  T N3    1 
ATOM   3573 C  C4    . DT  B 2 3   ? 41.391 3.655   10.123  1.00 74.36  ? 3   DT  T C4    1 
ATOM   3574 O  O4    . DT  B 2 3   ? 42.505 3.182   9.912   1.00 70.80  ? 3   DT  T O4    1 
ATOM   3575 C  C5    . DT  B 2 3   ? 40.295 2.862   10.628  1.00 76.08  ? 3   DT  T C5    1 
ATOM   3576 C  C7    . DT  B 2 3   ? 40.484 1.400   10.916  1.00 77.80  ? 3   DT  T C7    1 
ATOM   3577 C  C6    . DT  B 2 3   ? 39.117 3.468   10.829  1.00 74.98  ? 3   DT  T C6    1 
ATOM   3578 P  P     . DT  B 2 4   ? 34.035 6.505   9.497   1.00 45.34  ? 4   DT  T P     1 
ATOM   3579 O  OP1   . DT  B 2 4   ? 33.261 7.762   9.630   1.00 47.56  ? 4   DT  T OP1   1 
ATOM   3580 O  OP2   . DT  B 2 4   ? 33.377 5.275   9.003   1.00 53.10  ? 4   DT  T OP2   1 
ATOM   3581 O  "O5'" . DT  B 2 4   ? 35.300 6.777   8.554   1.00 30.96  ? 4   DT  T "O5'" 1 
ATOM   3582 C  "C5'" . DT  B 2 4   ? 35.946 8.030   8.638   1.00 24.80  ? 4   DT  T "C5'" 1 
ATOM   3583 C  "C4'" . DT  B 2 4   ? 36.684 8.260   7.335   1.00 21.55  ? 4   DT  T "C4'" 1 
ATOM   3584 O  "O4'" . DT  B 2 4   ? 37.848 7.401   7.297   1.00 23.37  ? 4   DT  T "O4'" 1 
ATOM   3585 C  "C3'" . DT  B 2 4   ? 35.921 7.951   6.056   1.00 22.32  ? 4   DT  T "C3'" 1 
ATOM   3586 O  "O3'" . DT  B 2 4   ? 36.305 8.960   5.148   1.00 20.45  ? 4   DT  T "O3'" 1 
ATOM   3587 C  "C2'" . DT  B 2 4   ? 36.448 6.581   5.635   1.00 21.42  ? 4   DT  T "C2'" 1 
ATOM   3588 C  "C1'" . DT  B 2 4   ? 37.898 6.714   6.064   1.00 22.42  ? 4   DT  T "C1'" 1 
ATOM   3589 N  N1    . DT  B 2 4   ? 38.613 5.454   6.367   1.00 20.83  ? 4   DT  T N1    1 
ATOM   3590 C  C2    . DT  B 2 4   ? 39.938 5.423   6.027   1.00 19.11  ? 4   DT  T C2    1 
ATOM   3591 O  O2    . DT  B 2 4   ? 40.486 6.365   5.488   1.00 18.71  ? 4   DT  T O2    1 
ATOM   3592 N  N3    . DT  B 2 4   ? 40.582 4.264   6.342   1.00 18.95  ? 4   DT  T N3    1 
ATOM   3593 C  C4    . DT  B 2 4   ? 40.047 3.154   6.955   1.00 24.38  ? 4   DT  T C4    1 
ATOM   3594 O  O4    . DT  B 2 4   ? 40.729 2.162   7.190   1.00 23.01  ? 4   DT  T O4    1 
ATOM   3595 C  C5    . DT  B 2 4   ? 38.643 3.252   7.292   1.00 25.98  ? 4   DT  T C5    1 
ATOM   3596 C  C7    . DT  B 2 4   ? 37.939 2.103   7.963   1.00 28.15  ? 4   DT  T C7    1 
ATOM   3597 C  C6    . DT  B 2 4   ? 38.000 4.390   6.994   1.00 25.01  ? 4   DT  T C6    1 
ATOM   3598 P  P     . DA  B 2 5   ? 35.697 8.996   3.667   1.00 20.43  ? 5   DA  T P     1 
ATOM   3599 O  OP1   . DA  B 2 5   ? 35.372 10.398  3.350   1.00 24.81  ? 5   DA  T OP1   1 
ATOM   3600 O  OP2   . DA  B 2 5   ? 34.634 7.967   3.580   1.00 21.62  ? 5   DA  T OP2   1 
ATOM   3601 O  "O5'" . DA  B 2 5   ? 36.902 8.503   2.755   1.00 19.70  ? 5   DA  T "O5'" 1 
ATOM   3602 C  "C5'" . DA  B 2 5   ? 38.050 9.343   2.592   1.00 19.11  ? 5   DA  T "C5'" 1 
ATOM   3603 C  "C4'" . DA  B 2 5   ? 39.015 8.675   1.638   1.00 18.50  ? 5   DA  T "C4'" 1 
ATOM   3604 O  "O4'" . DA  B 2 5   ? 39.574 7.482   2.256   1.00 18.71  ? 5   DA  T "O4'" 1 
ATOM   3605 C  "C3'" . DA  B 2 5   ? 38.380 8.210   0.333   1.00 18.55  ? 5   DA  T "C3'" 1 
ATOM   3606 O  "O3'" . DA  B 2 5   ? 39.311 8.461   -0.716  1.00 17.91  ? 5   DA  T "O3'" 1 
ATOM   3607 C  "C2'" . DA  B 2 5   ? 38.197 6.712   0.557   1.00 18.75  ? 5   DA  T "C2'" 1 
ATOM   3608 C  "C1'" . DA  B 2 5   ? 39.482 6.415   1.331   1.00 19.60  ? 5   DA  T "C1'" 1 
ATOM   3609 N  N9    . DA  B 2 5   ? 39.430 5.159   2.065   1.00 18.55  ? 5   DA  T N9    1 
ATOM   3610 C  C8    . DA  B 2 5   ? 38.347 4.608   2.689   1.00 20.90  ? 5   DA  T C8    1 
ATOM   3611 N  N7    . DA  B 2 5   ? 38.616 3.465   3.286   1.00 21.84  ? 5   DA  T N7    1 
ATOM   3612 C  C5    . DA  B 2 5   ? 39.963 3.252   3.042   1.00 22.53  ? 5   DA  T C5    1 
ATOM   3613 C  C6    . DA  B 2 5   ? 40.843 2.211   3.403   1.00 20.50  ? 5   DA  T C6    1 
ATOM   3614 N  N6    . DA  B 2 5   ? 40.482 1.142   4.122   1.00 22.86  ? 5   DA  T N6    1 
ATOM   3615 N  N1    . DA  B 2 5   ? 42.117 2.330   2.986   1.00 21.38  ? 5   DA  T N1    1 
ATOM   3616 C  C2    . DA  B 2 5   ? 42.491 3.394   2.264   1.00 20.31  ? 5   DA  T C2    1 
ATOM   3617 N  N3    . DA  B 2 5   ? 41.754 4.434   1.862   1.00 18.34  ? 5   DA  T N3    1 
ATOM   3618 C  C4    . DA  B 2 5   ? 40.486 4.282   2.292   1.00 18.15  ? 5   DA  T C4    1 
ATOM   3619 P  P     . DT  B 2 6   ? 38.837 8.463   -2.252  1.00 18.11  ? 6   DT  T P     1 
ATOM   3620 O  OP1   . DT  B 2 6   ? 39.993 8.878   -3.069  1.00 20.52  ? 6   DT  T OP1   1 
ATOM   3621 O  OP2   . DT  B 2 6   ? 37.559 9.192   -2.331  1.00 18.66  ? 6   DT  T OP2   1 
ATOM   3622 O  "O5'" . DT  B 2 6   ? 38.475 6.930   -2.522  1.00 21.05  ? 6   DT  T "O5'" 1 
ATOM   3623 C  "C5'" . DT  B 2 6   ? 39.245 6.088   -3.375  1.00 20.87  ? 6   DT  T "C5'" 1 
ATOM   3624 C  "C4'" . DT  B 2 6   ? 40.527 5.560   -2.758  1.00 20.26  ? 6   DT  T "C4'" 1 
ATOM   3625 O  "O4'" . DT  B 2 6   ? 40.257 4.874   -1.516  1.00 22.15  ? 6   DT  T "O4'" 1 
ATOM   3626 C  "C3'" . DT  B 2 6   ? 41.141 4.497   -3.649  1.00 18.04  ? 6   DT  T "C3'" 1 
ATOM   3627 O  "O3'" . DT  B 2 6   ? 42.062 5.149   -4.473  1.00 18.99  ? 6   DT  T "O3'" 1 
ATOM   3628 C  "C2'" . DT  B 2 6   ? 41.834 3.519   -2.700  1.00 24.01  ? 6   DT  T "C2'" 1 
ATOM   3629 C  "C1'" . DT  B 2 6   ? 41.218 3.853   -1.349  1.00 23.02  ? 6   DT  T "C1'" 1 
ATOM   3630 N  N1    . DT  B 2 6   ? 40.551 2.726   -0.680  1.00 20.72  ? 6   DT  T N1    1 
ATOM   3631 C  C2    . DT  B 2 6   ? 41.307 1.651   -0.281  1.00 19.26  ? 6   DT  T C2    1 
ATOM   3632 O  O2    . DT  B 2 6   ? 42.500 1.550   -0.496  1.00 20.38  ? 6   DT  T O2    1 
ATOM   3633 N  N3    . DT  B 2 6   ? 40.603 0.680   0.371   1.00 20.23  ? 6   DT  T N3    1 
ATOM   3634 C  C4    . DT  B 2 6   ? 39.263 0.679   0.677   1.00 20.24  ? 6   DT  T C4    1 
ATOM   3635 O  O4    . DT  B 2 6   ? 38.738 -0.252  1.280   1.00 26.82  ? 6   DT  T O4    1 
ATOM   3636 C  C5    . DT  B 2 6   ? 38.534 1.846   0.253   1.00 19.06  ? 6   DT  T C5    1 
ATOM   3637 C  C7    . DT  B 2 6   ? 37.060 1.955   0.530   1.00 26.65  ? 6   DT  T C7    1 
ATOM   3638 C  C6    . DT  B 2 6   ? 39.202 2.806   -0.391  1.00 21.83  ? 6   DT  T C6    1 
ATOM   3639 P  P     . DG  B 2 7   ? 42.251 4.699   -6.002  1.00 20.84  ? 7   DG  T P     1 
ATOM   3640 O  OP1   . DG  B 2 7   ? 43.405 5.453   -6.549  1.00 25.93  ? 7   DG  T OP1   1 
ATOM   3641 O  OP2   . DG  B 2 7   ? 40.935 4.755   -6.670  1.00 20.45  ? 7   DG  T OP2   1 
ATOM   3642 O  "O5'" . DG  B 2 7   ? 42.567 3.128   -5.905  1.00 22.96  ? 7   DG  T "O5'" 1 
ATOM   3643 C  "C5'" . DG  B 2 7   ? 43.853 2.572   -6.059  1.00 29.37  ? 7   DG  T "C5'" 1 
ATOM   3644 C  "C4'" . DG  B 2 7   ? 43.846 1.085   -5.737  1.00 17.61  ? 7   DG  T "C4'" 1 
ATOM   3645 O  "O4'" . DG  B 2 7   ? 43.090 0.821   -4.544  1.00 22.64  ? 7   DG  T "O4'" 1 
ATOM   3646 C  "C3'" . DG  B 2 7   ? 43.250 0.136   -6.771  1.00 24.85  ? 7   DG  T "C3'" 1 
ATOM   3647 O  "O3'" . DG  B 2 7   ? 44.319 -0.363  -7.512  1.00 25.94  ? 7   DG  T "O3'" 1 
ATOM   3648 C  "C2'" . DG  B 2 7   ? 42.649 -0.990  -5.940  1.00 28.64  ? 7   DG  T "C2'" 1 
ATOM   3649 C  "C1'" . DG  B 2 7   ? 42.936 -0.568  -4.504  1.00 23.03  ? 7   DG  T "C1'" 1 
ATOM   3650 N  N9    . DG  B 2 7   ? 41.828 -0.923  -3.640  1.00 22.38  ? 7   DG  T N9    1 
ATOM   3651 C  C8    . DG  B 2 7   ? 40.626 -0.283  -3.458  1.00 23.80  ? 7   DG  T C8    1 
ATOM   3652 N  N7    . DG  B 2 7   ? 39.846 -0.901  -2.608  1.00 20.63  ? 7   DG  T N7    1 
ATOM   3653 C  C5    . DG  B 2 7   ? 40.587 -2.015  -2.214  1.00 19.80  ? 7   DG  T C5    1 
ATOM   3654 C  C6    . DG  B 2 7   ? 40.275 -3.060  -1.325  1.00 17.95  ? 7   DG  T C6    1 
ATOM   3655 O  O6    . DG  B 2 7   ? 39.246 -3.223  -0.656  1.00 21.99  ? 7   DG  T O6    1 
ATOM   3656 N  N1    . DG  B 2 7   ? 41.324 -3.986  -1.237  1.00 17.56  ? 7   DG  T N1    1 
ATOM   3657 C  C2    . DG  B 2 7   ? 42.509 -3.912  -1.922  1.00 16.91  ? 7   DG  T C2    1 
ATOM   3658 N  N2    . DG  B 2 7   ? 43.402 -4.897  -1.699  1.00 23.78  ? 7   DG  T N2    1 
ATOM   3659 N  N3    . DG  B 2 7   ? 42.812 -2.934  -2.761  1.00 21.10  ? 7   DG  T N3    1 
ATOM   3660 C  C4    . DG  B 2 7   ? 41.803 -2.037  -2.847  1.00 18.79  ? 7   DG  T C4    1 
ATOM   3661 P  P     . DA  B 2 8   ? 44.056 -1.336  -8.763  1.00 26.00  ? 8   DA  T P     1 
ATOM   3662 O  OP1   . DA  B 2 8   ? 45.124 -1.094  -9.745  1.00 31.77  ? 8   DA  T OP1   1 
ATOM   3663 O  OP2   . DA  B 2 8   ? 42.628 -1.234  -9.145  1.00 30.89  ? 8   DA  T OP2   1 
ATOM   3664 O  "O5'" . DA  B 2 8   ? 44.289 -2.796  -8.153  1.00 23.48  ? 8   DA  T "O5'" 1 
ATOM   3665 C  "C5'" . DA  B 2 8   ? 45.559 -3.099  -7.588  1.00 22.84  ? 8   DA  T "C5'" 1 
ATOM   3666 C  "C4'" . DA  B 2 8   ? 45.601 -4.574  -7.251  1.00 25.88  ? 8   DA  T "C4'" 1 
ATOM   3667 O  "O4'" . DA  B 2 8   ? 44.716 -4.806  -6.127  1.00 25.94  ? 8   DA  T "O4'" 1 
ATOM   3668 C  "C3'" . DA  B 2 8   ? 45.133 -5.484  -8.383  1.00 27.87  ? 8   DA  T "C3'" 1 
ATOM   3669 O  "O3'" . DA  B 2 8   ? 45.965 -6.626  -8.408  1.00 25.07  ? 8   DA  T "O3'" 1 
ATOM   3670 C  "C2'" . DA  B 2 8   ? 43.711 -5.849  -7.977  1.00 26.46  ? 8   DA  T "C2'" 1 
ATOM   3671 C  "C1'" . DA  B 2 8   ? 43.793 -5.821  -6.455  1.00 26.00  ? 8   DA  T "C1'" 1 
ATOM   3672 N  N9    . DA  B 2 8   ? 42.513 -5.460  -5.865  1.00 22.15  ? 8   DA  T N9    1 
ATOM   3673 C  C8    . DA  B 2 8   ? 41.713 -4.416  -6.241  1.00 25.37  ? 8   DA  T C8    1 
ATOM   3674 N  N7    . DA  B 2 8   ? 40.613 -4.317  -5.534  1.00 21.49  ? 8   DA  T N7    1 
ATOM   3675 C  C5    . DA  B 2 8   ? 40.696 -5.364  -4.640  1.00 19.09  ? 8   DA  T C5    1 
ATOM   3676 C  C6    . DA  B 2 8   ? 39.827 -5.806  -3.632  1.00 19.13  ? 8   DA  T C6    1 
ATOM   3677 N  N6    . DA  B 2 8   ? 38.658 -5.217  -3.348  1.00 20.93  ? 8   DA  T N6    1 
ATOM   3678 N  N1    . DA  B 2 8   ? 40.201 -6.884  -2.914  1.00 19.35  ? 8   DA  T N1    1 
ATOM   3679 C  C2    . DA  B 2 8   ? 41.361 -7.476  -3.202  1.00 20.23  ? 8   DA  T C2    1 
ATOM   3680 N  N3    . DA  B 2 8   ? 42.258 -7.161  -4.135  1.00 20.38  ? 8   DA  T N3    1 
ATOM   3681 C  C4    . DA  B 2 8   ? 41.865 -6.083  -4.828  1.00 19.14  ? 8   DA  T C4    1 
ATOM   3682 P  P     . DC  B 2 9   ? 45.806 -7.729  -9.570  1.00 27.91  ? 9   DC  T P     1 
ATOM   3683 O  OP1   . DC  B 2 9   ? 47.155 -8.249  -9.885  1.00 32.84  ? 9   DC  T OP1   1 
ATOM   3684 O  OP2   . DC  B 2 9   ? 44.936 -7.173  -10.624 1.00 32.11  ? 9   DC  T OP2   1 
ATOM   3685 O  "O5'" . DC  B 2 9   ? 44.969 -8.900  -8.870  1.00 23.48  ? 9   DC  T "O5'" 1 
ATOM   3686 C  "C5'" . DC  B 2 9   ? 45.516 -9.514  -7.730  1.00 24.86  ? 9   DC  T "C5'" 1 
ATOM   3687 C  "C4'" . DC  B 2 9   ? 44.444 -10.382 -7.125  1.00 29.08  ? 9   DC  T "C4'" 1 
ATOM   3688 O  "O4'" . DC  B 2 9   ? 43.383 -9.538  -6.614  1.00 31.01  ? 9   DC  T "O4'" 1 
ATOM   3689 C  "C3'" . DC  B 2 9   ? 43.794 -11.310 -8.144  1.00 28.53  ? 9   DC  T "C3'" 1 
ATOM   3690 O  "O3'" . DC  B 2 9   ? 43.733 -12.573 -7.552  1.00 32.51  ? 9   DC  T "O3'" 1 
ATOM   3691 C  "C2'" . DC  B 2 9   ? 42.398 -10.721 -8.336  1.00 26.93  ? 9   DC  T "C2'" 1 
ATOM   3692 C  "C1'" . DC  B 2 9   ? 42.166 -10.175 -6.934  1.00 29.88  ? 9   DC  T "C1'" 1 
ATOM   3693 N  N1    . DC  B 2 9   ? 41.031 -9.220  -6.850  1.00 26.65  ? 9   DC  T N1    1 
ATOM   3694 C  C2    . DC  B 2 9   ? 40.114 -9.379  -5.812  1.00 25.45  ? 9   DC  T C2    1 
ATOM   3695 O  O2    . DC  B 2 9   ? 40.285 -10.289 -4.986  1.00 24.81  ? 9   DC  T O2    1 
ATOM   3696 N  N3    . DC  B 2 9   ? 39.066 -8.524  -5.732  1.00 23.52  ? 9   DC  T N3    1 
ATOM   3697 C  C4    . DC  B 2 9   ? 38.913 -7.554  -6.632  1.00 29.25  ? 9   DC  T C4    1 
ATOM   3698 N  N4    . DC  B 2 9   ? 37.854 -6.745  -6.496  1.00 26.14  ? 9   DC  T N4    1 
ATOM   3699 C  C5    . DC  B 2 9   ? 39.835 -7.381  -7.707  1.00 28.57  ? 9   DC  T C5    1 
ATOM   3700 C  C6    . DC  B 2 9   ? 40.869 -8.233  -7.778  1.00 27.40  ? 9   DC  T C6    1 
ATOM   3701 P  P     . DG  B 2 10  ? 43.504 -13.882 -8.452  1.00 34.42  ? 10  DG  T P     1 
ATOM   3702 O  OP1   . DG  B 2 10  ? 44.803 -14.571 -8.589  1.00 45.29  ? 10  DG  T OP1   1 
ATOM   3703 O  OP2   . DG  B 2 10  ? 42.722 -13.492 -9.648  1.00 39.66  ? 10  DG  T OP2   1 
ATOM   3704 O  "O5'" . DG  B 2 10  ? 42.559 -14.779 -7.549  1.00 33.15  ? 10  DG  T "O5'" 1 
ATOM   3705 C  "C5'" . DG  B 2 10  ? 42.790 -14.854 -6.165  1.00 32.83  ? 10  DG  T "C5'" 1 
ATOM   3706 C  "C4'" . DG  B 2 10  ? 41.540 -15.438 -5.550  1.00 28.78  ? 10  DG  T "C4'" 1 
ATOM   3707 O  "O4'" . DG  B 2 10  ? 40.563 -14.387 -5.374  1.00 32.23  ? 10  DG  T "O4'" 1 
ATOM   3708 C  "C3'" . DG  B 2 10  ? 40.893 -16.509 -6.419  1.00 31.20  ? 10  DG  T "C3'" 1 
ATOM   3709 O  "O3'" . DG  B 2 10  ? 40.461 -17.555 -5.552  1.00 30.51  ? 10  DG  T "O3'" 1 
ATOM   3710 C  "C2'" . DG  B 2 10  ? 39.750 -15.757 -7.094  1.00 30.86  ? 10  DG  T "C2'" 1 
ATOM   3711 C  "C1'" . DG  B 2 10  ? 39.365 -14.725 -6.041  1.00 32.63  ? 10  DG  T "C1'" 1 
ATOM   3712 N  N9    . DG  B 2 10  ? 38.798 -13.500 -6.605  1.00 26.94  ? 10  DG  T N9    1 
ATOM   3713 C  C8    . DG  B 2 10  ? 39.363 -12.678 -7.554  1.00 27.39  ? 10  DG  T C8    1 
ATOM   3714 N  N7    . DG  B 2 10  ? 38.621 -11.650 -7.871  1.00 28.51  ? 10  DG  T N7    1 
ATOM   3715 C  C5    . DG  B 2 10  ? 37.487 -11.802 -7.086  1.00 25.21  ? 10  DG  T C5    1 
ATOM   3716 C  C6    . DG  B 2 10  ? 36.334 -10.992 -7.000  1.00 24.50  ? 10  DG  T C6    1 
ATOM   3717 O  O6    . DG  B 2 10  ? 36.082 -9.954  -7.628  1.00 27.33  ? 10  DG  T O6    1 
ATOM   3718 N  N1    . DG  B 2 10  ? 35.417 -11.500 -6.083  1.00 27.57  ? 10  DG  T N1    1 
ATOM   3719 C  C2    . DG  B 2 10  ? 35.595 -12.647 -5.342  1.00 26.45  ? 10  DG  T C2    1 
ATOM   3720 N  N2    . DG  B 2 10  ? 34.599 -12.980 -4.506  1.00 30.22  ? 10  DG  T N2    1 
ATOM   3721 N  N3    . DG  B 2 10  ? 36.678 -13.418 -5.406  1.00 28.60  ? 10  DG  T N3    1 
ATOM   3722 C  C4    . DG  B 2 10  ? 37.579 -12.933 -6.299  1.00 23.45  ? 10  DG  T C4    1 
ATOM   3723 P  P     . DC  B 2 11  ? 39.754 -18.875 -6.144  1.00 32.16  ? 11  DC  T P     1 
ATOM   3724 O  OP1   . DC  B 2 11  ? 40.215 -20.036 -5.350  1.00 35.86  ? 11  DC  T OP1   1 
ATOM   3725 O  OP2   . DC  B 2 11  ? 39.944 -18.888 -7.610  1.00 37.30  ? 11  DC  T OP2   1 
ATOM   3726 O  "O5'" . DC  B 2 11  ? 38.201 -18.612 -5.875  1.00 32.15  ? 11  DC  T "O5'" 1 
ATOM   3727 C  "C5'" . DC  B 2 11  ? 37.710 -18.261 -4.590  1.00 27.44  ? 11  DC  T "C5'" 1 
ATOM   3728 C  "C4'" . DC  B 2 11  ? 36.182 -18.286 -4.603  1.00 27.31  ? 11  DC  T "C4'" 1 
ATOM   3729 O  "O4'" . DC  B 2 11  ? 35.668 -17.049 -5.166  1.00 25.79  ? 11  DC  T "O4'" 1 
ATOM   3730 C  "C3'" . DC  B 2 11  ? 35.526 -19.403 -5.413  1.00 21.90  ? 11  DC  T "C3'" 1 
ATOM   3731 O  "O3'" . DC  B 2 11  ? 34.435 -19.913 -4.634  1.00 22.26  ? 11  DC  T "O3'" 1 
ATOM   3732 C  "C2'" . DC  B 2 11  ? 35.081 -18.704 -6.703  1.00 24.41  ? 11  DC  T "C2'" 1 
ATOM   3733 C  "C1'" . DC  B 2 11  ? 34.733 -17.313 -6.198  1.00 22.90  ? 11  DC  T "C1'" 1 
ATOM   3734 N  N1    . DC  B 2 11  ? 34.926 -16.184 -7.151  1.00 21.69  ? 11  DC  T N1    1 
ATOM   3735 C  C2    . DC  B 2 11  ? 33.903 -15.242 -7.314  1.00 20.48  ? 11  DC  T C2    1 
ATOM   3736 O  O2    . DC  B 2 11  ? 32.839 -15.372 -6.693  1.00 25.18  ? 11  DC  T O2    1 
ATOM   3737 N  N3    . DC  B 2 11  ? 34.106 -14.195 -8.158  1.00 20.19  ? 11  DC  T N3    1 
ATOM   3738 C  C4    . DC  B 2 11  ? 35.254 -14.089 -8.827  1.00 21.01  ? 11  DC  T C4    1 
ATOM   3739 N  N4    . DC  B 2 11  ? 35.395 -13.043 -9.654  1.00 19.63  ? 11  DC  T N4    1 
ATOM   3740 C  C5    . DC  B 2 11  ? 36.302 -15.042 -8.673  1.00 20.12  ? 11  DC  T C5    1 
ATOM   3741 C  C6    . DC  B 2 11  ? 36.102 -16.063 -7.825  1.00 21.24  ? 11  DC  T C6    1 
ATOM   3742 P  P     . DT  B 2 12  ? 33.660 -21.241 -5.084  1.00 25.40  ? 12  DT  T P     1 
ATOM   3743 O  OP1   . DT  B 2 12  ? 33.103 -21.884 -3.868  1.00 29.55  ? 12  DT  T OP1   1 
ATOM   3744 O  OP2   . DT  B 2 12  ? 34.533 -22.006 -6.001  1.00 28.68  ? 12  DT  T OP2   1 
ATOM   3745 O  "O5'" . DT  B 2 12  ? 32.438 -20.671 -5.935  1.00 23.97  ? 12  DT  T "O5'" 1 
ATOM   3746 C  "C5'" . DT  B 2 12  ? 31.320 -20.171 -5.214  1.00 28.76  ? 12  DT  T "C5'" 1 
ATOM   3747 C  "C4'" . DT  B 2 12  ? 30.304 -19.636 -6.190  1.00 24.38  ? 12  DT  T "C4'" 1 
ATOM   3748 O  "O4'" . DT  B 2 12  ? 30.917 -18.527 -6.891  1.00 27.18  ? 12  DT  T "O4'" 1 
ATOM   3749 C  "C3'" . DT  B 2 12  ? 29.912 -20.665 -7.245  1.00 28.26  ? 12  DT  T "C3'" 1 
ATOM   3750 O  "O3'" . DT  B 2 12  ? 28.519 -20.600 -7.504  1.00 32.93  ? 12  DT  T "O3'" 1 
ATOM   3751 C  "C2'" . DT  B 2 12  ? 30.721 -20.208 -8.452  1.00 26.22  ? 12  DT  T "C2'" 1 
ATOM   3752 C  "C1'" . DT  B 2 12  ? 30.617 -18.704 -8.256  1.00 30.18  ? 12  DT  T "C1'" 1 
ATOM   3753 N  N1    . DT  B 2 12  ? 31.558 -17.905 -9.079  1.00 36.37  ? 12  DT  T N1    1 
ATOM   3754 C  C2    . DT  B 2 12  ? 31.157 -16.653 -9.486  1.00 33.32  ? 12  DT  T C2    1 
ATOM   3755 O  O2    . DT  B 2 12  ? 30.076 -16.168 -9.202  1.00 37.25  ? 12  DT  T O2    1 
ATOM   3756 N  N3    . DT  B 2 12  ? 32.071 -15.986 -10.251 1.00 28.64  ? 12  DT  T N3    1 
ATOM   3757 C  C4    . DT  B 2 12  ? 33.318 -16.434 -10.642 1.00 24.87  ? 12  DT  T C4    1 
ATOM   3758 O  O4    . DT  B 2 12  ? 34.049 -15.734 -11.338 1.00 28.67  ? 12  DT  T O4    1 
ATOM   3759 C  C5    . DT  B 2 12  ? 33.677 -17.751 -10.176 1.00 29.67  ? 12  DT  T C5    1 
ATOM   3760 C  C7    . DT  B 2 12  ? 35.005 -18.352 -10.531 1.00 31.64  ? 12  DT  T C7    1 
ATOM   3761 C  C6    . DT  B 2 12  ? 32.790 -18.421 -9.428  1.00 30.58  ? 12  DT  T C6    1 
ATOM   3762 O  "O5'" A DA  C 3 1   ? 29.231 -7.570  -14.797 0.60 43.78  ? 1   DA  P "O5'" 1 
ATOM   3763 O  "O5'" B DA  C 3 1   ? 29.030 -8.157  -15.765 0.40 39.41  ? 1   DA  P "O5'" 1 
ATOM   3764 C  "C5'" A DA  C 3 1   ? 28.036 -7.948  -15.475 0.60 38.39  ? 1   DA  P "C5'" 1 
ATOM   3765 C  "C5'" B DA  C 3 1   ? 27.609 -8.177  -15.828 0.40 37.36  ? 1   DA  P "C5'" 1 
ATOM   3766 C  "C4'" A DA  C 3 1   ? 27.051 -8.610  -14.527 0.60 35.12  ? 1   DA  P "C4'" 1 
ATOM   3767 C  "C4'" B DA  C 3 1   ? 27.011 -8.660  -14.518 0.40 35.08  ? 1   DA  P "C4'" 1 
ATOM   3768 O  "O4'" A DA  C 3 1   ? 27.439 -9.991  -14.319 0.60 37.86  ? 1   DA  P "O4'" 1 
ATOM   3769 O  "O4'" B DA  C 3 1   ? 27.418 -10.032 -14.298 0.40 37.21  ? 1   DA  P "O4'" 1 
ATOM   3770 C  "C3'" A DA  C 3 1   ? 26.949 -7.964  -13.148 0.60 33.43  ? 1   DA  P "C3'" 1 
ATOM   3771 C  "C3'" B DA  C 3 1   ? 27.434 -7.862  -13.289 0.40 34.66  ? 1   DA  P "C3'" 1 
ATOM   3772 O  "O3'" A DA  C 3 1   ? 25.575 -7.878  -12.726 0.60 29.04  ? 1   DA  P "O3'" 1 
ATOM   3773 O  "O3'" B DA  C 3 1   ? 26.329 -7.133  -12.794 0.40 35.15  ? 1   DA  P "O3'" 1 
ATOM   3774 C  "C2'" A DA  C 3 1   ? 27.802 -8.862  -12.247 0.60 35.09  ? 1   DA  P "C2'" 1 
ATOM   3775 C  "C2'" B DA  C 3 1   ? 27.865 -8.884  -12.244 0.40 35.57  ? 1   DA  P "C2'" 1 
ATOM   3776 C  "C1'" A DA  C 3 1   ? 27.931 -10.184 -13.008 0.60 36.07  ? 1   DA  P "C1'" 1 
ATOM   3777 C  "C1'" B DA  C 3 1   ? 27.936 -10.205 -12.996 0.40 36.03  ? 1   DA  P "C1'" 1 
ATOM   3778 N  N9    . DA  C 3 1   ? 29.299 -10.703 -13.107 1.00 34.32  ? 1   DA  P N9    1 
ATOM   3779 C  C8    . DA  C 3 1   ? 30.298 -10.257 -13.930 1.00 36.00  ? 1   DA  P C8    1 
ATOM   3780 N  N7    . DA  C 3 1   ? 31.424 -10.924 -13.793 1.00 36.57  ? 1   DA  P N7    1 
ATOM   3781 C  C5    . DA  C 3 1   ? 31.138 -11.866 -12.816 1.00 30.74  ? 1   DA  P C5    1 
ATOM   3782 C  C6    . DA  C 3 1   ? 31.903 -12.882 -12.213 1.00 31.30  ? 1   DA  P C6    1 
ATOM   3783 N  N6    . DA  C 3 1   ? 33.179 -13.127 -12.523 1.00 32.06  ? 1   DA  P N6    1 
ATOM   3784 N  N1    . DA  C 3 1   ? 31.302 -13.642 -11.273 1.00 31.62  ? 1   DA  P N1    1 
ATOM   3785 C  C2    . DA  C 3 1   ? 30.023 -13.402 -10.961 1.00 22.97  ? 1   DA  P C2    1 
ATOM   3786 N  N3    A DA  C 3 1   ? 29.204 -12.475 -11.456 0.60 26.46  ? 1   DA  P N3    1 
ATOM   3787 N  N3    B DA  C 3 1   ? 29.204 -12.477 -11.457 0.40 26.32  ? 1   DA  P N3    1 
ATOM   3788 C  C4    . DA  C 3 1   ? 29.831 -11.739 -12.386 1.00 29.07  ? 1   DA  P C4    1 
ATOM   3789 P  P     A DG  C 3 2   ? 25.105 -6.700  -11.732 0.60 29.42  ? 2   DG  P P     1 
ATOM   3790 P  P     B DG  C 3 2   ? 26.522 -6.109  -11.571 0.40 32.91  ? 2   DG  P P     1 
ATOM   3791 O  OP1   A DG  C 3 2   ? 23.629 -6.677  -11.712 0.60 28.63  ? 2   DG  P OP1   1 
ATOM   3792 O  OP1   B DG  C 3 2   ? 25.312 -5.263  -11.490 0.40 35.34  ? 2   DG  P OP1   1 
ATOM   3793 O  OP2   A DG  C 3 2   ? 25.858 -5.478  -12.088 0.60 33.69  ? 2   DG  P OP2   1 
ATOM   3794 O  OP2   B DG  C 3 2   ? 27.856 -5.484  -11.708 0.40 34.99  ? 2   DG  P OP2   1 
ATOM   3795 O  "O5'" A DG  C 3 2   ? 25.611 -7.195  -10.304 0.60 32.82  ? 2   DG  P "O5'" 1 
ATOM   3796 O  "O5'" B DG  C 3 2   ? 26.568 -7.061  -10.287 0.40 34.19  ? 2   DG  P "O5'" 1 
ATOM   3797 C  "C5'" A DG  C 3 2   ? 24.865 -8.187  -9.628  0.60 30.07  ? 2   DG  P "C5'" 1 
ATOM   3798 C  "C5'" B DG  C 3 2   ? 25.404 -7.761  -9.871  0.40 31.75  ? 2   DG  P "C5'" 1 
ATOM   3799 C  "C4'" A DG  C 3 2   ? 25.685 -8.772  -8.498  0.60 27.95  ? 2   DG  P "C4'" 1 
ATOM   3800 C  "C4'" B DG  C 3 2   ? 25.734 -8.579  -8.640  0.40 28.69  ? 2   DG  P "C4'" 1 
ATOM   3801 O  "O4'" A DG  C 3 2   ? 26.900 -9.354  -9.022  0.60 27.73  ? 2   DG  P "O4'" 1 
ATOM   3802 O  "O4'" B DG  C 3 2   ? 26.862 -9.433  -8.960  0.40 27.50  ? 2   DG  P "O4'" 1 
ATOM   3803 C  "C3'" A DG  C 3 2   ? 26.112 -7.787  -7.413  0.60 29.46  ? 2   DG  P "C3'" 1 
ATOM   3804 C  "C3'" B DG  C 3 2   ? 26.138 -7.750  -7.424  0.40 29.63  ? 2   DG  P "C3'" 1 
ATOM   3805 O  "O3'" A DG  C 3 2   ? 25.500 -8.270  -6.237  0.60 32.38  ? 2   DG  P "O3'" 1 
ATOM   3806 O  "O3'" B DG  C 3 2   ? 25.509 -8.262  -6.246  0.40 31.83  ? 2   DG  P "O3'" 1 
ATOM   3807 C  "C2'" A DG  C 3 2   ? 27.638 -7.896  -7.373  0.60 28.73  ? 2   DG  P "C2'" 1 
ATOM   3808 C  "C2'" B DG  C 3 2   ? 27.660 -7.888  -7.381  0.40 28.36  ? 2   DG  P "C2'" 1 
ATOM   3809 C  "C1'" A DG  C 3 2   ? 27.881 -9.256  -8.016  0.60 26.38  ? 2   DG  P "C1'" 1 
ATOM   3810 C  "C1'" B DG  C 3 2   ? 27.883 -9.263  -8.000  0.40 26.76  ? 2   DG  P "C1'" 1 
ATOM   3811 N  N9    . DG  C 3 2   ? 29.202 -9.412  -8.619  1.00 27.56  ? 2   DG  P N9    1 
ATOM   3812 C  C8    . DG  C 3 2   ? 29.836 -8.553  -9.491  1.00 27.71  ? 2   DG  P C8    1 
ATOM   3813 N  N7    . DG  C 3 2   ? 31.018 -8.971  -9.859  1.00 26.59  ? 2   DG  P N7    1 
ATOM   3814 C  C5    . DG  C 3 2   ? 31.184 -10.188 -9.192  1.00 23.85  ? 2   DG  P C5    1 
ATOM   3815 C  C6    . DG  C 3 2   ? 32.261 -11.111 -9.189  1.00 20.88  ? 2   DG  P C6    1 
ATOM   3816 O  O6    . DG  C 3 2   ? 33.338 -11.049 -9.803  1.00 21.95  ? 2   DG  P O6    1 
ATOM   3817 N  N1    . DG  C 3 2   ? 32.001 -12.212 -8.369  1.00 21.08  ? 2   DG  P N1    1 
ATOM   3818 C  C2    . DG  C 3 2   ? 30.842 -12.386 -7.648  1.00 22.81  ? 2   DG  P C2    1 
ATOM   3819 N  N2    . DG  C 3 2   ? 30.742 -13.501 -6.906  1.00 24.12  ? 2   DG  P N2    1 
ATOM   3820 N  N3    . DG  C 3 2   ? 29.833 -11.533 -7.641  1.00 25.98  ? 2   DG  P N3    1 
ATOM   3821 C  C4    . DG  C 3 2   ? 30.070 -10.461 -8.431  1.00 27.29  ? 2   DG  P C4    1 
ATOM   3822 P  P     . DC  C 3 3   ? 25.734 -7.539  -4.826  1.00 37.67  ? 3   DC  P P     1 
ATOM   3823 O  OP1   . DC  C 3 3   ? 24.445 -7.539  -4.103  1.00 47.77  ? 3   DC  P OP1   1 
ATOM   3824 O  OP2   . DC  C 3 3   ? 26.445 -6.264  -5.071  1.00 41.89  ? 3   DC  P OP2   1 
ATOM   3825 O  "O5'" . DC  C 3 3   ? 26.751 -8.512  -4.070  1.00 42.46  ? 3   DC  P "O5'" 1 
ATOM   3826 C  "C5'" . DC  C 3 3   ? 26.471 -9.902  -3.983  1.00 43.18  ? 3   DC  P "C5'" 1 
ATOM   3827 C  "C4'" . DC  C 3 3   ? 27.644 -10.629 -3.354  1.00 41.24  ? 3   DC  P "C4'" 1 
ATOM   3828 O  "O4'" . DC  C 3 3   ? 28.702 -10.734 -4.337  1.00 38.84  ? 3   DC  P "O4'" 1 
ATOM   3829 C  "C3'" . DC  C 3 3   ? 28.238 -9.939  -2.125  1.00 40.11  ? 3   DC  P "C3'" 1 
ATOM   3830 O  "O3'" . DC  C 3 3   ? 28.234 -10.826 -1.020  1.00 40.80  ? 3   DC  P "O3'" 1 
ATOM   3831 C  "C2'" . DC  C 3 3   ? 29.666 -9.587  -2.529  1.00 40.77  ? 3   DC  P "C2'" 1 
ATOM   3832 C  "C1'" . DC  C 3 3   ? 29.938 -10.539 -3.689  1.00 40.60  ? 3   DC  P "C1'" 1 
ATOM   3833 N  N1    . DC  C 3 3   ? 30.900 -9.945  -4.646  1.00 37.05  ? 3   DC  P N1    1 
ATOM   3834 C  C2    . DC  C 3 3   ? 32.085 -10.624 -4.930  1.00 31.07  ? 3   DC  P C2    1 
ATOM   3835 O  O2    . DC  C 3 3   ? 32.292 -11.712 -4.389  1.00 34.47  ? 3   DC  P O2    1 
ATOM   3836 N  N3    . DC  C 3 3   ? 32.971 -10.068 -5.792  1.00 34.20  ? 3   DC  P N3    1 
ATOM   3837 C  C4    . DC  C 3 3   ? 32.708 -8.888  -6.349  1.00 33.12  ? 3   DC  P C4    1 
ATOM   3838 N  N4    . DC  C 3 3   ? 33.620 -8.388  -7.192  1.00 31.83  ? 3   DC  P N4    1 
ATOM   3839 C  C5    . DC  C 3 3   ? 31.501 -8.177  -6.067  1.00 36.27  ? 3   DC  P C5    1 
ATOM   3840 C  C6    . DC  C 3 3   ? 30.634 -8.734  -5.215  1.00 32.05  ? 3   DC  P C6    1 
ATOM   3841 P  P     . DG  C 3 4   ? 28.733 -10.324 0.423   1.00 40.45  ? 4   DG  P P     1 
ATOM   3842 O  OP1   . DG  C 3 4   ? 27.919 -11.014 1.450   1.00 47.58  ? 4   DG  P OP1   1 
ATOM   3843 O  OP2   . DG  C 3 4   ? 28.807 -8.844  0.399   1.00 39.86  ? 4   DG  P OP2   1 
ATOM   3844 O  "O5'" . DG  C 3 4   ? 30.236 -10.862 0.509   1.00 34.13  ? 4   DG  P "O5'" 1 
ATOM   3845 C  "C5'" . DG  C 3 4   ? 30.471 -12.237 0.279   1.00 36.44  ? 4   DG  P "C5'" 1 
ATOM   3846 C  "C4'" . DG  C 3 4   ? 31.963 -12.505 0.309   1.00 40.60  ? 4   DG  P "C4'" 1 
ATOM   3847 O  "O4'" . DG  C 3 4   ? 32.573 -11.931 -0.873  1.00 40.99  ? 4   DG  P "O4'" 1 
ATOM   3848 C  "C3'" . DG  C 3 4   ? 32.673 -11.904 1.519   1.00 39.17  ? 4   DG  P "C3'" 1 
ATOM   3849 O  "O3'" . DG  C 3 4   ? 33.375 -12.951 2.168   1.00 39.72  ? 4   DG  P "O3'" 1 
ATOM   3850 C  "C2'" . DG  C 3 4   ? 33.595 -10.835 0.936   1.00 35.10  ? 4   DG  P "C2'" 1 
ATOM   3851 C  "C1'" . DG  C 3 4   ? 33.772 -11.281 -0.510  1.00 35.89  ? 4   DG  P "C1'" 1 
ATOM   3852 N  N9    . DG  C 3 4   ? 33.990 -10.168 -1.432  1.00 30.79  ? 4   DG  P N9    1 
ATOM   3853 C  C8    . DG  C 3 4   ? 33.154 -9.105  -1.692  1.00 30.87  ? 4   DG  P C8    1 
ATOM   3854 N  N7    . DG  C 3 4   ? 33.632 -8.271  -2.578  1.00 29.05  ? 4   DG  P N7    1 
ATOM   3855 C  C5    . DG  C 3 4   ? 34.869 -8.818  -2.916  1.00 25.59  ? 4   DG  P C5    1 
ATOM   3856 C  C6    . DG  C 3 4   ? 35.849 -8.356  -3.822  1.00 24.26  ? 4   DG  P C6    1 
ATOM   3857 O  O6    . DG  C 3 4   ? 35.823 -7.338  -4.530  1.00 31.16  ? 4   DG  P O6    1 
ATOM   3858 N  N1    . DG  C 3 4   ? 36.948 -9.214  -3.869  1.00 20.39  ? 4   DG  P N1    1 
ATOM   3859 C  C2    . DG  C 3 4   ? 37.079 -10.365 -3.133  1.00 18.77  ? 4   DG  P C2    1 
ATOM   3860 N  N2    . DG  C 3 4   ? 38.214 -11.063 -3.303  1.00 21.76  ? 4   DG  P N2    1 
ATOM   3861 N  N3    . DG  C 3 4   ? 36.168 -10.811 -2.276  1.00 20.41  ? 4   DG  P N3    1 
ATOM   3862 C  C4    . DG  C 3 4   ? 35.096 -9.982  -2.224  1.00 25.26  ? 4   DG  P C4    1 
ATOM   3863 P  P     . DT  C 3 5   ? 34.166 -12.676 3.541   1.00 38.26  ? 5   DT  P P     1 
ATOM   3864 O  OP1   . DT  C 3 5   ? 34.053 -13.890 4.377   1.00 39.77  ? 5   DT  P OP1   1 
ATOM   3865 O  OP2   . DT  C 3 5   ? 33.754 -11.353 4.057   1.00 37.17  ? 5   DT  P OP2   1 
ATOM   3866 O  "O5'" . DT  C 3 5   ? 35.684 -12.502 3.064   1.00 32.08  ? 5   DT  P "O5'" 1 
ATOM   3867 C  "C5'" . DT  C 3 5   ? 36.285 -13.524 2.310   1.00 25.76  ? 5   DT  P "C5'" 1 
ATOM   3868 C  "C4'" . DT  C 3 5   ? 37.698 -13.098 1.958   1.00 22.87  ? 5   DT  P "C4'" 1 
ATOM   3869 O  "O4'" . DT  C 3 5   ? 37.653 -12.062 0.946   1.00 22.97  ? 5   DT  P "O4'" 1 
ATOM   3870 C  "C3'" . DT  C 3 5   ? 38.508 -12.537 3.122   1.00 22.63  ? 5   DT  P "C3'" 1 
ATOM   3871 O  "O3'" . DT  C 3 5   ? 39.671 -13.336 3.181   1.00 22.12  ? 5   DT  P "O3'" 1 
ATOM   3872 C  "C2'" . DT  C 3 5   ? 38.808 -11.086 2.727   1.00 18.70  ? 5   DT  P "C2'" 1 
ATOM   3873 C  "C1'" . DT  C 3 5   ? 38.701 -11.142 1.213   1.00 19.20  ? 5   DT  P "C1'" 1 
ATOM   3874 N  N1    . DT  C 3 5   ? 38.276 -9.882  0.575   1.00 19.87  ? 5   DT  P N1    1 
ATOM   3875 C  C2    . DT  C 3 5   ? 39.086 -9.311  -0.376  1.00 17.69  ? 5   DT  P C2    1 
ATOM   3876 O  O2    . DT  C 3 5   ? 40.156 -9.782  -0.710  1.00 21.45  ? 5   DT  P O2    1 
ATOM   3877 N  N3    . DT  C 3 5   ? 38.587 -8.162  -0.931  1.00 17.86  ? 5   DT  P N3    1 
ATOM   3878 C  C4    . DT  C 3 5   ? 37.387 -7.546  -0.634  1.00 16.83  ? 5   DT  P C4    1 
ATOM   3879 O  O4    . DT  C 3 5   ? 37.031 -6.505  -1.196  1.00 19.04  ? 5   DT  P O4    1 
ATOM   3880 C  C5    . DT  C 3 5   ? 36.594 -8.207  0.376   1.00 24.02  ? 5   DT  P C5    1 
ATOM   3881 C  C7    . DT  C 3 5   ? 35.273 -7.648  0.803   1.00 27.66  ? 5   DT  P C7    1 
ATOM   3882 C  C6    . DT  C 3 5   ? 37.067 -9.332  0.929   1.00 19.40  ? 5   DT  P C6    1 
ATOM   3883 P  P     . DC  C 3 6   ? 40.702 -13.201 4.406   1.00 18.79  ? 6   DC  P P     1 
ATOM   3884 O  OP1   . DC  C 3 6   ? 41.416 -14.497 4.531   1.00 21.10  ? 6   DC  P OP1   1 
ATOM   3885 O  OP2   . DC  C 3 6   ? 39.979 -12.640 5.566   1.00 23.46  ? 6   DC  P OP2   1 
ATOM   3886 O  "O5'" . DC  C 3 6   ? 41.712 -12.081 3.921   1.00 17.40  ? 6   DC  P "O5'" 1 
ATOM   3887 C  "C5'" . DC  C 3 6   ? 42.607 -12.370 2.875   1.00 15.41  ? 6   DC  P "C5'" 1 
ATOM   3888 C  "C4'" . DC  C 3 6   ? 43.371 -11.107 2.531   1.00 18.79  ? 6   DC  P "C4'" 1 
ATOM   3889 O  "O4'" . DC  C 3 6   ? 42.436 -10.214 1.882   1.00 19.32  ? 6   DC  P "O4'" 1 
ATOM   3890 C  "C3'" . DC  C 3 6   ? 43.955 -10.335 3.722   1.00 15.69  ? 6   DC  P "C3'" 1 
ATOM   3891 O  "O3'" . DC  C 3 6   ? 45.366 -10.510 3.672   1.00 16.92  ? 6   DC  P "O3'" 1 
ATOM   3892 C  "C2'" . DC  C 3 6   ? 43.542 -8.877  3.470   1.00 17.48  ? 6   DC  P "C2'" 1 
ATOM   3893 C  "C1'" . DC  C 3 6   ? 42.923 -8.912  2.069   1.00 19.32  ? 6   DC  P "C1'" 1 
ATOM   3894 N  N1    . DC  C 3 6   ? 41.804 -7.951  1.877   1.00 18.14  ? 6   DC  P N1    1 
ATOM   3895 C  C2    . DC  C 3 6   ? 41.904 -7.020  0.840   1.00 16.69  ? 6   DC  P C2    1 
ATOM   3896 O  O2    . DC  C 3 6   ? 42.905 -7.034  0.122   1.00 19.14  ? 6   DC  P O2    1 
ATOM   3897 N  N3    . DC  C 3 6   ? 40.896 -6.140  0.664   1.00 16.52  ? 6   DC  P N3    1 
ATOM   3898 C  C4    . DC  C 3 6   ? 39.829 -6.162  1.463   1.00 18.09  ? 6   DC  P C4    1 
ATOM   3899 N  N4    . DC  C 3 6   ? 38.873 -5.258  1.229   1.00 19.61  ? 6   DC  P N4    1 
ATOM   3900 C  C5    . DC  C 3 6   ? 39.697 -7.103  2.524   1.00 18.52  ? 6   DC  P C5    1 
ATOM   3901 C  C6    . DC  C 3 6   ? 40.700 -7.973  2.689   1.00 20.71  ? 6   DC  P C6    1 
ATOM   3902 P  P     . DA  C 3 7   ? 46.330 -9.782  4.737   1.00 17.35  ? 7   DA  P P     1 
ATOM   3903 O  OP1   . DA  C 3 7   ? 47.535 -10.633 4.899   1.00 18.45  ? 7   DA  P OP1   1 
ATOM   3904 O  OP2   . DA  C 3 7   ? 45.531 -9.458  5.935   1.00 18.15  ? 7   DA  P OP2   1 
ATOM   3905 O  "O5'" . DA  C 3 7   ? 46.664 -8.371  4.052   1.00 19.60  ? 7   DA  P "O5'" 1 
ATOM   3906 C  "C5'" . DA  C 3 7   ? 47.397 -8.223  2.844   1.00 24.73  ? 7   DA  P "C5'" 1 
ATOM   3907 C  "C4'" . DA  C 3 7   ? 47.219 -6.806  2.296   1.00 26.81  ? 7   DA  P "C4'" 1 
ATOM   3908 O  "O4'" . DA  C 3 7   ? 45.832 -6.592  1.955   1.00 25.11  ? 7   DA  P "O4'" 1 
ATOM   3909 C  "C3'" . DA  C 3 7   ? 47.447 -5.608  3.223   1.00 27.26  ? 7   DA  P "C3'" 1 
ATOM   3910 O  "O3'" . DA  C 3 7   ? 48.819 -5.485  3.570   1.00 28.90  ? 7   DA  P "O3'" 1 
ATOM   3911 C  "C2'" . DA  C 3 7   ? 46.864 -4.474  2.403   1.00 28.74  ? 7   DA  P "C2'" 1 
ATOM   3912 C  "C1'" . DA  C 3 7   ? 45.686 -5.189  1.777   1.00 25.21  ? 7   DA  P "C1'" 1 
ATOM   3913 N  N9    . DA  C 3 7   ? 44.386 -4.752  2.266   1.00 20.59  ? 7   DA  P N9    1 
ATOM   3914 C  C8    . DA  C 3 7   ? 43.559 -5.305  3.205   1.00 21.77  ? 7   DA  P C8    1 
ATOM   3915 N  N7    . DA  C 3 7   ? 42.442 -4.639  3.365   1.00 19.92  ? 7   DA  P N7    1 
ATOM   3916 C  C5    . DA  C 3 7   ? 42.544 -3.585  2.458   1.00 20.45  ? 7   DA  P C5    1 
ATOM   3917 C  C6    . DA  C 3 7   ? 41.691 -2.518  2.129   1.00 20.98  ? 7   DA  P C6    1 
ATOM   3918 N  N6    . DA  C 3 7   ? 40.498 -2.335  2.700   1.00 24.19  ? 7   DA  P N6    1 
ATOM   3919 N  N1    . DA  C 3 7   ? 42.110 -1.648  1.179   1.00 17.94  ? 7   DA  P N1    1 
ATOM   3920 C  C2    . DA  C 3 7   ? 43.314 -1.853  0.619   1.00 17.28  ? 7   DA  P C2    1 
ATOM   3921 N  N3    . DA  C 3 7   ? 44.202 -2.822  0.848   1.00 19.64  ? 7   DA  P N3    1 
ATOM   3922 C  C4    . DA  C 3 7   ? 43.739 -3.651  1.783   1.00 21.34  ? 7   DA  P C4    1 
ATOM   3923 P  P     A DT  C 3 8   ? 49.876 -4.765  2.591   0.50 34.14  ? 8   DT  P P     1 
ATOM   3924 P  P     B DT  C 3 8   ? 49.397 -4.124  4.210   0.50 18.52  ? 8   DT  P P     1 
ATOM   3925 O  OP1   A DT  C 3 8   ? 49.946 -5.544  1.338   0.50 38.49  ? 8   DT  P OP1   1 
ATOM   3926 O  OP1   B DT  C 3 8   ? 50.850 -4.308  4.370   0.50 19.42  ? 8   DT  P OP1   1 
ATOM   3927 O  OP2   A DT  C 3 8   ? 51.095 -4.490  3.379   0.50 33.42  ? 8   DT  P OP2   1 
ATOM   3928 O  OP2   B DT  C 3 8   ? 48.603 -3.812  5.424   0.50 20.46  ? 8   DT  P OP2   1 
ATOM   3929 O  "O5'" A DT  C 3 8   ? 49.240 -3.331  2.317   0.50 29.27  ? 8   DT  P "O5'" 1 
ATOM   3930 O  "O5'" B DT  C 3 8   ? 49.082 -2.990  3.099   0.50 26.01  ? 8   DT  P "O5'" 1 
ATOM   3931 C  "C5'" A DT  C 3 8   ? 50.105 -2.240  2.392   0.50 28.67  ? 8   DT  P "C5'" 1 
ATOM   3932 C  "C5'" B DT  C 3 8   ? 50.096 -2.348  2.297   0.50 28.12  ? 8   DT  P "C5'" 1 
ATOM   3933 C  "C4'" . DT  C 3 8   ? 49.615 -1.118  1.514   1.00 23.49  ? 8   DT  P "C4'" 1 
ATOM   3934 O  "O4'" . DT  C 3 8   ? 48.160 -1.101  1.461   1.00 17.97  ? 8   DT  P "O4'" 1 
ATOM   3935 C  "C3'" . DT  C 3 8   ? 50.076 0.239   2.043   1.00 20.39  ? 8   DT  P "C3'" 1 
ATOM   3936 O  "O3'" . DT  C 3 8   ? 50.474 1.071   0.968   1.00 26.61  ? 8   DT  P "O3'" 1 
ATOM   3937 C  "C2'" . DT  C 3 8   ? 48.819 0.777   2.727   1.00 23.97  ? 8   DT  P "C2'" 1 
ATOM   3938 C  "C1'" . DT  C 3 8   ? 47.701 0.172   1.880   1.00 21.04  ? 8   DT  P "C1'" 1 
ATOM   3939 N  N1    . DT  C 3 8   ? 46.439 -0.043  2.646   1.00 19.61  ? 8   DT  P N1    1 
ATOM   3940 C  C2    . DT  C 3 8   ? 45.417 0.864   2.503   1.00 22.91  ? 8   DT  P C2    1 
ATOM   3941 O  O2    . DT  C 3 8   ? 45.498 1.856   1.794   1.00 25.48  ? 8   DT  P O2    1 
ATOM   3942 N  N3    . DT  C 3 8   ? 44.292 0.579   3.235   1.00 20.65  ? 8   DT  P N3    1 
ATOM   3943 C  C4    . DT  C 3 8   ? 44.084 -0.492  4.079   1.00 21.97  ? 8   DT  P C4    1 
ATOM   3944 O  O4    . DT  C 3 8   ? 43.030 -0.661  4.691   1.00 24.15  ? 8   DT  P O4    1 
ATOM   3945 C  C5    . DT  C 3 8   ? 45.190 -1.405  4.181   1.00 19.76  ? 8   DT  P C5    1 
ATOM   3946 C  C7    . DT  C 3 8   ? 45.061 -2.606  5.073   1.00 19.71  ? 8   DT  P C7    1 
ATOM   3947 C  C6    . DT  C 3 8   ? 46.301 -1.145  3.471   1.00 19.93  ? 8   DT  P C6    1 
HETATM 3948 CA CA    . CA  D 4 .   ? 54.806 2.605   3.728   1.00 14.63  ? 501 CA  A CA    1 
HETATM 3949 C  C1    . GOL E 5 .   ? 60.600 -24.986 12.256  1.00 18.11  ? 503 GOL A C1    1 
HETATM 3950 O  O1    . GOL E 5 .   ? 59.205 -24.989 12.217  1.00 19.87  ? 503 GOL A O1    1 
HETATM 3951 C  C2    . GOL E 5 .   ? 61.188 -24.520 10.914  1.00 18.74  ? 503 GOL A C2    1 
HETATM 3952 O  O2    . GOL E 5 .   ? 60.739 -23.227 10.595  1.00 16.00  ? 503 GOL A O2    1 
HETATM 3953 C  C3    . GOL E 5 .   ? 60.898 -25.476 9.756   1.00 22.52  ? 503 GOL A C3    1 
HETATM 3954 O  O3    . GOL E 5 .   ? 61.621 -25.045 8.611   1.00 19.08  ? 503 GOL A O3    1 
HETATM 3955 C  C1    . GOL F 5 .   ? 54.340 16.632  -7.072  1.00 35.81  ? 504 GOL A C1    1 
HETATM 3956 O  O1    . GOL F 5 .   ? 54.063 15.280  -6.782  1.00 20.76  ? 504 GOL A O1    1 
HETATM 3957 C  C2    . GOL F 5 .   ? 54.909 16.711  -8.482  1.00 35.23  ? 504 GOL A C2    1 
HETATM 3958 O  O2    . GOL F 5 .   ? 53.946 16.235  -9.396  1.00 32.08  ? 504 GOL A O2    1 
HETATM 3959 C  C3    . GOL F 5 .   ? 55.243 18.157  -8.828  1.00 36.36  ? 504 GOL A C3    1 
HETATM 3960 O  O3    . GOL F 5 .   ? 55.795 18.177  -10.123 1.00 41.76  ? 504 GOL A O3    1 
HETATM 3961 C  C1    . GOL G 5 .   ? 54.718 28.128  4.588   1.00 33.23  ? 505 GOL A C1    1 
HETATM 3962 O  O1    . GOL G 5 .   ? 53.362 27.937  4.233   1.00 29.97  ? 505 GOL A O1    1 
HETATM 3963 C  C2    . GOL G 5 .   ? 55.126 27.190  5.723   1.00 40.58  ? 505 GOL A C2    1 
HETATM 3964 O  O2    . GOL G 5 .   ? 54.574 25.905  5.533   1.00 39.95  ? 505 GOL A O2    1 
HETATM 3965 C  C3    . GOL G 5 .   ? 56.648 27.095  5.780   1.00 36.73  ? 505 GOL A C3    1 
HETATM 3966 O  O3    . GOL G 5 .   ? 57.062 25.984  6.552   1.00 23.70  ? 505 GOL A O3    1 
HETATM 3967 P  PG    . DTP H 6 .   ? 55.267 2.646   7.267   1.00 12.59  ? 502 DTP P PG    1 
HETATM 3968 O  O1G   . DTP H 6 .   ? 54.922 1.726   8.429   1.00 14.41  ? 502 DTP P O1G   1 
HETATM 3969 O  O2G   . DTP H 6 .   ? 56.519 3.461   7.431   1.00 13.77  ? 502 DTP P O2G   1 
HETATM 3970 O  O3G   . DTP H 6 .   ? 55.152 1.975   5.924   1.00 14.95  ? 502 DTP P O3G   1 
HETATM 3971 P  PB    . DTP H 6 .   ? 53.085 4.223   6.190   1.00 12.88  ? 502 DTP P PB    1 
HETATM 3972 O  O1B   . DTP H 6 .   ? 53.798 4.361   4.873   1.00 13.02  ? 502 DTP P O1B   1 
HETATM 3973 O  O2B   . DTP H 6 .   ? 52.305 5.406   6.676   1.00 13.12  ? 502 DTP P O2B   1 
HETATM 3974 O  O3B   . DTP H 6 .   ? 54.083 3.766   7.372   1.00 12.81  ? 502 DTP P O3B   1 
HETATM 3975 P  PA    . DTP H 6 .   ? 51.499 2.120   4.907   1.00 14.12  ? 502 DTP P PA    1 
HETATM 3976 O  O1A   . DTP H 6 .   ? 50.569 1.088   5.531   1.00 16.25  ? 502 DTP P O1A   1 
HETATM 3977 O  O2A   . DTP H 6 .   ? 52.639 1.633   4.067   1.00 13.14  ? 502 DTP P O2A   1 
HETATM 3978 O  O3A   . DTP H 6 .   ? 52.039 3.011   6.162   1.00 12.69  ? 502 DTP P O3A   1 
HETATM 3979 O  "O5'" . DTP H 6 .   ? 50.550 3.102   4.065   1.00 13.22  ? 502 DTP P "O5'" 1 
HETATM 3980 C  "C5'" . DTP H 6 .   ? 51.026 4.019   3.079   1.00 12.81  ? 502 DTP P "C5'" 1 
HETATM 3981 C  "C4'" . DTP H 6 .   ? 50.101 5.229   3.082   1.00 11.23  ? 502 DTP P "C4'" 1 
HETATM 3982 O  "O4'" . DTP H 6 .   ? 48.774 4.815   2.741   1.00 14.20  ? 502 DTP P "O4'" 1 
HETATM 3983 C  "C3'" . DTP H 6 .   ? 49.976 5.868   4.462   1.00 11.88  ? 502 DTP P "C3'" 1 
HETATM 3984 O  "O3'" . DTP H 6 .   ? 50.984 6.863   4.702   1.00 13.12  ? 502 DTP P "O3'" 1 
HETATM 3985 C  "C2'" . DTP H 6 .   ? 48.575 6.462   4.412   1.00 12.35  ? 502 DTP P "C2'" 1 
HETATM 3986 C  "C1'" . DTP H 6 .   ? 47.794 5.500   3.518   1.00 13.68  ? 502 DTP P "C1'" 1 
HETATM 3987 N  N9    . DTP H 6 .   ? 47.048 4.475   4.297   1.00 13.31  ? 502 DTP P N9    1 
HETATM 3988 C  C8    . DTP H 6 .   ? 47.521 3.306   4.760   1.00 12.21  ? 502 DTP P C8    1 
HETATM 3989 N  N7    . DTP H 6 .   ? 46.519 2.651   5.406   1.00 14.56  ? 502 DTP P N7    1 
HETATM 3990 C  C5    . DTP H 6 .   ? 45.416 3.427   5.339   1.00 14.24  ? 502 DTP P C5    1 
HETATM 3991 C  C6    . DTP H 6 .   ? 44.106 3.296   5.793   1.00 19.24  ? 502 DTP P C6    1 
HETATM 3992 N  N6    . DTP H 6 .   ? 43.718 2.197   6.490   1.00 21.17  ? 502 DTP P N6    1 
HETATM 3993 N  N1    . DTP H 6 .   ? 43.225 4.291   5.547   1.00 16.31  ? 502 DTP P N1    1 
HETATM 3994 C  C2    . DTP H 6 .   ? 43.592 5.385   4.857   1.00 17.11  ? 502 DTP P C2    1 
HETATM 3995 N  N3    . DTP H 6 .   ? 44.844 5.539   4.399   1.00 16.24  ? 502 DTP P N3    1 
HETATM 3996 C  C4    . DTP H 6 .   ? 45.760 4.566   4.628   1.00 12.76  ? 502 DTP P C4    1 
HETATM 3997 O  O     . HOH I 7 .   ? 56.492 -14.049 -5.900  1.00 14.70  ? 601 HOH A O     1 
HETATM 3998 O  O     . HOH I 7 .   ? 58.012 -23.524 14.190  1.00 13.15  ? 602 HOH A O     1 
HETATM 3999 O  O     . HOH I 7 .   ? 69.243 -17.617 -1.342  1.00 14.30  ? 603 HOH A O     1 
HETATM 4000 O  O     . HOH I 7 .   ? 67.555 -20.751 8.735   1.00 13.61  ? 604 HOH A O     1 
HETATM 4001 O  O     . HOH I 7 .   ? 43.999 -14.530 5.682   1.00 15.54  ? 605 HOH A O     1 
HETATM 4002 O  O     . HOH I 7 .   ? 64.071 -3.531  6.012   1.00 14.66  ? 606 HOH A O     1 
HETATM 4003 O  O     . HOH I 7 .   ? 60.517 -18.561 -4.633  1.00 14.75  ? 607 HOH A O     1 
HETATM 4004 O  O     . HOH I 7 .   ? 67.225 -16.699 9.650   1.00 16.16  ? 608 HOH A O     1 
HETATM 4005 O  O     . HOH I 7 .   ? 69.277 -13.548 4.986   1.00 14.38  ? 609 HOH A O     1 
HETATM 4006 O  O     . HOH I 7 .   ? 59.467 9.605   10.776  1.00 14.99  ? 610 HOH A O     1 
HETATM 4007 O  O     . HOH I 7 .   ? 54.777 -11.544 3.463   1.00 14.28  ? 611 HOH A O     1 
HETATM 4008 O  O     . HOH I 7 .   ? 51.865 5.804   9.308   1.00 15.22  ? 612 HOH A O     1 
HETATM 4009 O  O     . HOH I 7 .   ? 55.619 17.455  -0.686  1.00 15.99  ? 613 HOH A O     1 
HETATM 4010 O  O     . HOH I 7 .   ? 53.909 -28.553 4.138   1.00 16.54  ? 614 HOH A O     1 
HETATM 4011 O  O     . HOH I 7 .   ? 58.605 -12.143 -11.513 1.00 17.10  ? 615 HOH A O     1 
HETATM 4012 O  O     . HOH I 7 .   ? 73.214 -7.421  8.957   1.00 16.03  ? 616 HOH A O     1 
HETATM 4013 O  O     . HOH I 7 .   ? 43.692 12.170  -7.347  1.00 21.23  ? 617 HOH A O     1 
HETATM 4014 O  O     . HOH I 7 .   ? 54.409 -9.628  5.341   1.00 17.92  ? 618 HOH A O     1 
HETATM 4015 O  O     . HOH I 7 .   ? 62.670 14.760  -9.211  1.00 15.92  ? 619 HOH A O     1 
HETATM 4016 O  O     . HOH I 7 .   ? 62.426 7.323   7.007   1.00 17.45  ? 620 HOH A O     1 
HETATM 4017 O  O     . HOH I 7 .   ? 53.827 -20.452 -2.593  1.00 17.89  ? 621 HOH A O     1 
HETATM 4018 O  O     . HOH I 7 .   ? 45.622 15.975  -1.593  1.00 16.72  ? 622 HOH A O     1 
HETATM 4019 O  O     . HOH I 7 .   ? 50.282 -17.289 15.525  1.00 17.06  ? 623 HOH A O     1 
HETATM 4020 O  O     . HOH I 7 .   ? 49.195 -15.653 13.567  1.00 19.02  ? 624 HOH A O     1 
HETATM 4021 O  O     . HOH I 7 .   ? 65.656 -22.942 3.262   1.00 15.80  ? 625 HOH A O     1 
HETATM 4022 O  O     . HOH I 7 .   ? 68.926 16.292  -4.083  1.00 17.05  ? 626 HOH A O     1 
HETATM 4023 O  O     . HOH I 7 .   ? 53.941 17.369  -3.188  1.00 20.49  ? 627 HOH A O     1 
HETATM 4024 O  O     . HOH I 7 .   ? 45.076 7.402   -10.310 1.00 20.02  ? 628 HOH A O     1 
HETATM 4025 O  O     . HOH I 7 .   ? 43.517 -33.191 -0.584  1.00 20.82  ? 629 HOH A O     1 
HETATM 4026 O  O     . HOH I 7 .   ? 46.275 16.710  1.085   1.00 15.43  ? 630 HOH A O     1 
HETATM 4027 O  O     . HOH I 7 .   ? 53.784 13.572  -10.001 1.00 20.41  ? 631 HOH A O     1 
HETATM 4028 O  O     . HOH I 7 .   ? 71.217 3.527   -0.357  1.00 19.86  ? 632 HOH A O     1 
HETATM 4029 O  O     . HOH I 7 .   ? 42.293 -22.647 -2.591  1.00 21.26  ? 633 HOH A O     1 
HETATM 4030 O  O     . HOH I 7 .   ? 70.893 16.185  -6.136  1.00 19.55  ? 634 HOH A O     1 
HETATM 4031 O  O     . HOH I 7 .   ? 65.758 -6.634  -13.815 1.00 20.61  ? 635 HOH A O     1 
HETATM 4032 O  O     . HOH I 7 .   ? 60.016 11.473  -10.367 1.00 20.33  ? 636 HOH A O     1 
HETATM 4033 O  O     . HOH I 7 .   ? 52.373 15.815  -4.739  1.00 17.82  ? 637 HOH A O     1 
HETATM 4034 O  O     . HOH I 7 .   ? 44.506 7.330   2.230   1.00 20.00  ? 638 HOH A O     1 
HETATM 4035 O  O     . HOH I 7 .   ? 52.566 1.297   9.683   1.00 18.40  ? 639 HOH A O     1 
HETATM 4036 O  O     . HOH I 7 .   ? 49.338 7.315   -7.687  1.00 23.35  ? 640 HOH A O     1 
HETATM 4037 O  O     . HOH I 7 .   ? 41.172 7.661   -18.584 1.00 18.20  ? 641 HOH A O     1 
HETATM 4038 O  O     . HOH I 7 .   ? 45.201 -14.335 10.425  1.00 17.65  ? 642 HOH A O     1 
HETATM 4039 O  O     . HOH I 7 .   ? 51.327 5.570   -8.390  1.00 23.00  ? 643 HOH A O     1 
HETATM 4040 O  O     . HOH I 7 .   ? 60.913 -23.489 6.302   1.00 21.60  ? 644 HOH A O     1 
HETATM 4041 O  O     . HOH I 7 .   ? 53.463 -28.282 15.241  1.00 22.69  ? 645 HOH A O     1 
HETATM 4042 O  O     . HOH I 7 .   ? 52.418 20.138  4.921   1.00 19.62  ? 646 HOH A O     1 
HETATM 4043 O  O     . HOH I 7 .   ? 41.094 7.044   19.073  1.00 18.67  ? 647 HOH A O     1 
HETATM 4044 O  O     . HOH I 7 .   ? 44.218 -15.192 1.342   1.00 22.04  ? 648 HOH A O     1 
HETATM 4045 O  O     . HOH I 7 .   ? 40.766 11.468  -3.587  1.00 18.03  ? 649 HOH A O     1 
HETATM 4046 O  O     . HOH I 7 .   ? 63.329 -19.060 -1.695  1.00 21.94  ? 650 HOH A O     1 
HETATM 4047 O  O     . HOH I 7 .   ? 35.116 5.651   2.019   1.00 20.08  ? 651 HOH A O     1 
HETATM 4048 O  O     . HOH I 7 .   ? 71.632 6.068   -7.195  1.00 21.21  ? 652 HOH A O     1 
HETATM 4049 O  O     . HOH I 7 .   ? 43.663 9.716   -10.036 1.00 22.30  ? 653 HOH A O     1 
HETATM 4050 O  O     . HOH I 7 .   ? 64.583 6.470   -0.623  1.00 16.98  ? 654 HOH A O     1 
HETATM 4051 O  O     . HOH I 7 .   ? 50.026 -3.163  -17.317 1.00 23.82  ? 655 HOH A O     1 
HETATM 4052 O  O     . HOH I 7 .   ? 59.374 11.113  8.526   1.00 20.46  ? 656 HOH A O     1 
HETATM 4053 O  O     . HOH I 7 .   ? 42.141 8.299   3.303   1.00 22.21  ? 657 HOH A O     1 
HETATM 4054 O  O     . HOH I 7 .   ? 65.939 -15.288 11.643  1.00 20.12  ? 658 HOH A O     1 
HETATM 4055 O  O     . HOH I 7 .   ? 68.426 -15.809 -7.707  1.00 27.22  ? 659 HOH A O     1 
HETATM 4056 O  O     . HOH I 7 .   ? 49.893 2.896   12.839  1.00 25.15  ? 660 HOH A O     1 
HETATM 4057 O  O     . HOH I 7 .   ? 57.882 -7.776  8.105   1.00 23.88  ? 661 HOH A O     1 
HETATM 4058 O  O     . HOH I 7 .   ? 70.842 -19.111 1.400   1.00 18.17  ? 662 HOH A O     1 
HETATM 4059 O  O     . HOH I 7 .   ? 49.018 6.725   -11.901 1.00 21.81  ? 663 HOH A O     1 
HETATM 4060 O  O     . HOH I 7 .   ? 44.066 11.068  -12.422 1.00 23.26  ? 664 HOH A O     1 
HETATM 4061 O  O     . HOH I 7 .   ? 49.408 8.444   -13.796 1.00 30.12  ? 665 HOH A O     1 
HETATM 4062 O  O     . HOH I 7 .   ? 48.752 -22.230 -5.690  1.00 22.09  ? 666 HOH A O     1 
HETATM 4063 O  O     . HOH I 7 .   ? 60.087 14.010  -8.753  1.00 21.78  ? 667 HOH A O     1 
HETATM 4064 O  O     . HOH I 7 .   ? 48.895 2.863   21.255  1.00 23.59  ? 668 HOH A O     1 
HETATM 4065 O  O     . HOH I 7 .   ? 69.314 4.452   3.807   1.00 26.90  ? 669 HOH A O     1 
HETATM 4066 O  O     . HOH I 7 .   ? 50.727 28.228  4.885   1.00 23.46  ? 670 HOH A O     1 
HETATM 4067 O  O     . HOH I 7 .   ? 50.565 -34.822 -0.705  1.00 22.46  ? 671 HOH A O     1 
HETATM 4068 O  O     . HOH I 7 .   ? 51.473 5.145   -11.059 1.00 23.14  ? 672 HOH A O     1 
HETATM 4069 O  O     . HOH I 7 .   ? 42.832 15.810  23.740  1.00 25.26  ? 673 HOH A O     1 
HETATM 4070 O  O     . HOH I 7 .   ? 64.134 -9.337  -14.444 1.00 22.98  ? 674 HOH A O     1 
HETATM 4071 O  O     . HOH I 7 .   ? 63.198 -26.638 6.987   1.00 19.93  ? 675 HOH A O     1 
HETATM 4072 O  O     . HOH I 7 .   ? 40.679 16.856  6.063   1.00 25.96  ? 676 HOH A O     1 
HETATM 4073 O  O     . HOH I 7 .   ? 48.545 -36.916 2.595   1.00 24.51  ? 677 HOH A O     1 
HETATM 4074 O  O     . HOH I 7 .   ? 47.226 2.521   -1.527  1.00 26.16  ? 678 HOH A O     1 
HETATM 4075 O  O     . HOH I 7 .   ? 72.242 -7.811  11.687  1.00 21.33  ? 679 HOH A O     1 
HETATM 4076 O  O     . HOH I 7 .   ? 60.560 -17.648 -7.411  1.00 27.48  ? 680 HOH A O     1 
HETATM 4077 O  O     . HOH I 7 .   ? 36.964 16.140  -4.314  1.00 27.69  ? 681 HOH A O     1 
HETATM 4078 O  O     . HOH I 7 .   ? 48.098 10.775  -9.697  1.00 27.47  ? 682 HOH A O     1 
HETATM 4079 O  O     . HOH I 7 .   ? 53.261 -33.515 -0.302  1.00 25.80  ? 683 HOH A O     1 
HETATM 4080 O  O     . HOH I 7 .   ? 33.168 10.818  5.410   1.00 26.97  ? 684 HOH A O     1 
HETATM 4081 O  O     . HOH I 7 .   ? 41.789 -30.521 -6.483  1.00 24.68  ? 685 HOH A O     1 
HETATM 4082 O  O     . HOH I 7 .   ? 58.354 -9.209  -14.152 1.00 26.31  ? 686 HOH A O     1 
HETATM 4083 O  O     . HOH I 7 .   ? 51.276 3.479   10.545  1.00 23.91  ? 687 HOH A O     1 
HETATM 4084 O  O     . HOH I 7 .   ? 63.577 12.918  -10.917 1.00 26.55  ? 688 HOH A O     1 
HETATM 4085 O  O     . HOH I 7 .   ? 59.292 4.893   16.726  1.00 24.90  ? 689 HOH A O     1 
HETATM 4086 O  O     . HOH I 7 .   ? 46.885 -0.372  -15.198 1.00 21.59  ? 690 HOH A O     1 
HETATM 4087 O  O     . HOH I 7 .   ? 65.561 5.604   2.154   1.00 23.20  ? 691 HOH A O     1 
HETATM 4088 O  O     . HOH I 7 .   ? 41.387 -23.976 -5.082  1.00 25.13  ? 692 HOH A O     1 
HETATM 4089 O  O     . HOH I 7 .   ? 53.246 -20.310 -5.035  1.00 25.84  ? 693 HOH A O     1 
HETATM 4090 O  O     . HOH I 7 .   ? 62.895 -17.113 -7.300  1.00 29.81  ? 694 HOH A O     1 
HETATM 4091 O  O     . HOH I 7 .   ? 41.404 17.038  -14.880 1.00 24.26  ? 695 HOH A O     1 
HETATM 4092 O  O     . HOH I 7 .   ? 58.687 15.303  -10.722 1.00 26.44  ? 696 HOH A O     1 
HETATM 4093 O  O     . HOH I 7 .   ? 67.533 -6.613  12.731  1.00 27.75  ? 697 HOH A O     1 
HETATM 4094 O  O     . HOH I 7 .   ? 45.124 0.471   -18.482 1.00 28.43  ? 698 HOH A O     1 
HETATM 4095 O  O     . HOH I 7 .   ? 47.839 8.071   -9.756  1.00 23.40  ? 699 HOH A O     1 
HETATM 4096 O  O     . HOH I 7 .   ? 43.095 -1.553  -25.048 1.00 28.02  ? 700 HOH A O     1 
HETATM 4097 O  O     . HOH I 7 .   ? 78.064 -0.960  5.361   1.00 24.05  ? 701 HOH A O     1 
HETATM 4098 O  O     . HOH I 7 .   ? 50.129 -8.922  12.940  1.00 26.81  ? 702 HOH A O     1 
HETATM 4099 O  O     . HOH I 7 .   ? 61.578 14.529  8.697   1.00 30.82  ? 703 HOH A O     1 
HETATM 4100 O  O     . HOH I 7 .   ? 55.748 -7.395  6.235   1.00 25.79  ? 704 HOH A O     1 
HETATM 4101 O  O     . HOH I 7 .   ? 48.362 -17.946 17.268  1.00 30.41  ? 705 HOH A O     1 
HETATM 4102 O  O     . HOH I 7 .   ? 49.073 -9.580  10.449  1.00 30.40  ? 706 HOH A O     1 
HETATM 4103 O  O     . HOH I 7 .   ? 49.784 -9.439  -8.398  1.00 28.40  ? 707 HOH A O     1 
HETATM 4104 O  O     . HOH I 7 .   ? 58.226 -27.535 11.332  1.00 20.96  ? 708 HOH A O     1 
HETATM 4105 O  O     . HOH I 7 .   ? 52.846 -12.705 -4.048  1.00 27.12  ? 709 HOH A O     1 
HETATM 4106 O  O     . HOH I 7 .   ? 47.065 -14.672 14.845  1.00 30.16  ? 710 HOH A O     1 
HETATM 4107 O  O     . HOH I 7 .   ? 65.810 -4.192  -15.143 1.00 29.09  ? 711 HOH A O     1 
HETATM 4108 O  O     . HOH I 7 .   ? 46.407 -9.778  11.103  1.00 33.47  ? 712 HOH A O     1 
HETATM 4109 O  O     . HOH I 7 .   ? 51.161 -8.842  -5.269  1.00 28.59  ? 713 HOH A O     1 
HETATM 4110 O  O     . HOH I 7 .   ? 44.949 17.021  -18.249 1.00 30.08  ? 714 HOH A O     1 
HETATM 4111 O  O     . HOH I 7 .   ? 47.469 -20.245 18.476  1.00 31.65  ? 715 HOH A O     1 
HETATM 4112 O  O     . HOH I 7 .   ? 58.586 -18.144 19.844  1.00 29.15  ? 716 HOH A O     1 
HETATM 4113 O  O     . HOH I 7 .   ? 65.686 -22.395 -7.909  1.00 30.51  ? 717 HOH A O     1 
HETATM 4114 O  O     . HOH I 7 .   ? 83.921 -5.144  2.581   1.00 33.13  ? 718 HOH A O     1 
HETATM 4115 O  O     . HOH I 7 .   ? 41.321 21.652  2.357   1.00 29.85  ? 719 HOH A O     1 
HETATM 4116 O  O     . HOH I 7 .   ? 59.840 10.503  19.828  1.00 25.25  ? 720 HOH A O     1 
HETATM 4117 O  O     . HOH I 7 .   ? 53.093 -26.542 -3.939  1.00 25.71  ? 721 HOH A O     1 
HETATM 4118 O  O     . HOH I 7 .   ? 47.968 -27.246 -7.317  1.00 32.18  ? 722 HOH A O     1 
HETATM 4119 O  O     . HOH I 7 .   ? 29.186 8.120   -18.858 1.00 28.48  ? 723 HOH A O     1 
HETATM 4120 O  O     . HOH I 7 .   ? 56.055 13.729  -11.407 1.00 26.52  ? 724 HOH A O     1 
HETATM 4121 O  O     . HOH I 7 .   ? 53.547 19.236  -1.545  1.00 22.25  ? 725 HOH A O     1 
HETATM 4122 O  O     . HOH I 7 .   ? 68.156 -14.626 -10.130 1.00 27.34  ? 726 HOH A O     1 
HETATM 4123 O  O     . HOH I 7 .   ? 49.093 12.278  -11.582 1.00 29.09  ? 727 HOH A O     1 
HETATM 4124 O  O     . HOH I 7 .   ? 61.628 8.023   9.805   1.00 28.11  ? 728 HOH A O     1 
HETATM 4125 O  O     . HOH I 7 .   ? 59.834 12.971  11.303  1.00 27.73  ? 729 HOH A O     1 
HETATM 4126 O  O     . HOH I 7 .   ? 41.092 -1.694  -16.434 1.00 35.95  ? 730 HOH A O     1 
HETATM 4127 O  O     . HOH I 7 .   ? 51.435 8.638   -15.678 1.00 31.23  ? 731 HOH A O     1 
HETATM 4128 O  O     . HOH I 7 .   ? 58.056 -14.378 -13.046 1.00 24.67  ? 732 HOH A O     1 
HETATM 4129 O  O     . HOH I 7 .   ? 46.278 0.333   6.884   1.00 29.10  ? 733 HOH A O     1 
HETATM 4130 O  O     . HOH I 7 .   ? 48.325 19.858  4.492   1.00 28.63  ? 734 HOH A O     1 
HETATM 4131 O  O     . HOH I 7 .   ? 48.319 -33.450 -3.705  1.00 28.28  ? 735 HOH A O     1 
HETATM 4132 O  O     . HOH I 7 .   ? 62.080 -25.436 4.885   1.00 31.72  ? 736 HOH A O     1 
HETATM 4133 O  O     . HOH I 7 .   ? 56.239 18.786  18.232  1.00 26.24  ? 737 HOH A O     1 
HETATM 4134 O  O     . HOH I 7 .   ? 34.753 15.193  11.278  1.00 27.18  ? 738 HOH A O     1 
HETATM 4135 O  O     . HOH I 7 .   ? 36.786 13.045  12.089  1.00 29.50  ? 739 HOH A O     1 
HETATM 4136 O  O     . HOH I 7 .   ? 61.313 20.997  11.880  1.00 27.38  ? 740 HOH A O     1 
HETATM 4137 O  O     . HOH I 7 .   ? 52.806 -18.226 -11.445 1.00 33.22  ? 741 HOH A O     1 
HETATM 4138 O  O     . HOH I 7 .   ? 54.539 15.383  23.318  1.00 34.41  ? 742 HOH A O     1 
HETATM 4139 O  O     . HOH I 7 .   ? 70.560 0.512   11.487  1.00 33.08  ? 743 HOH A O     1 
HETATM 4140 O  O     . HOH I 7 .   ? 76.727 0.893   -5.995  1.00 29.99  ? 744 HOH A O     1 
HETATM 4141 O  O     . HOH I 7 .   ? 62.238 -13.196 -13.772 1.00 35.11  ? 745 HOH A O     1 
HETATM 4142 O  O     . HOH I 7 .   ? 51.573 6.306   -19.075 1.00 29.89  ? 746 HOH A O     1 
HETATM 4143 O  O     . HOH I 7 .   ? 73.691 4.450   -1.287  1.00 39.74  ? 747 HOH A O     1 
HETATM 4144 O  O     . HOH I 7 .   ? 46.825 19.517  1.433   1.00 25.51  ? 748 HOH A O     1 
HETATM 4145 O  O     . HOH I 7 .   ? 44.530 -22.932 17.765  1.00 43.71  ? 749 HOH A O     1 
HETATM 4146 O  O     . HOH I 7 .   ? 53.574 7.410   -14.698 1.00 33.29  ? 750 HOH A O     1 
HETATM 4147 O  O     . HOH I 7 .   ? 60.115 14.327  3.329   1.00 32.24  ? 751 HOH A O     1 
HETATM 4148 O  O     . HOH I 7 .   ? 50.551 0.237   -15.976 1.00 40.12  ? 752 HOH A O     1 
HETATM 4149 O  O     . HOH I 7 .   ? 79.088 3.572   1.924   1.00 39.22  ? 753 HOH A O     1 
HETATM 4150 O  O     . HOH I 7 .   ? 75.372 0.412   -3.652  1.00 33.39  ? 754 HOH A O     1 
HETATM 4151 O  O     . HOH I 7 .   ? 62.692 11.900  5.366   1.00 43.09  ? 755 HOH A O     1 
HETATM 4152 O  O     . HOH I 7 .   ? 38.700 -17.924 10.247  1.00 27.01  ? 756 HOH A O     1 
HETATM 4153 O  O     . HOH I 7 .   ? 42.436 -19.044 14.869  1.00 25.53  ? 757 HOH A O     1 
HETATM 4154 O  O     . HOH I 7 .   ? 49.768 26.268  2.979   1.00 33.28  ? 758 HOH A O     1 
HETATM 4155 O  O     . HOH I 7 .   ? 45.138 20.738  3.759   1.00 32.83  ? 759 HOH A O     1 
HETATM 4156 O  O     . HOH I 7 .   ? 45.294 -32.726 8.537   1.00 48.00  ? 760 HOH A O     1 
HETATM 4157 O  O     . HOH I 7 .   ? 55.332 14.566  26.100  1.00 45.95  ? 761 HOH A O     1 
HETATM 4158 O  O     . HOH I 7 .   ? 47.040 16.413  25.632  1.00 29.94  ? 762 HOH A O     1 
HETATM 4159 O  O     . HOH I 7 .   ? 59.323 -18.337 -10.047 1.00 41.77  ? 763 HOH A O     1 
HETATM 4160 O  O     . HOH I 7 .   ? 44.392 15.690  26.208  1.00 31.18  ? 764 HOH A O     1 
HETATM 4161 O  O     . HOH I 7 .   ? 47.580 -16.724 -0.760  1.00 31.04  ? 765 HOH A O     1 
HETATM 4162 O  O     . HOH I 7 .   ? 57.440 -34.790 8.519   1.00 34.40  ? 766 HOH A O     1 
HETATM 4163 O  O     . HOH I 7 .   ? 54.606 -35.165 1.167   1.00 41.58  ? 767 HOH A O     1 
HETATM 4164 O  O     . HOH I 7 .   ? 46.952 16.069  -23.692 1.00 30.67  ? 768 HOH A O     1 
HETATM 4165 O  O     . HOH I 7 .   ? 34.596 19.998  -16.320 1.00 35.15  ? 769 HOH A O     1 
HETATM 4166 O  O     . HOH I 7 .   ? 47.244 -22.768 17.446  1.00 26.76  ? 770 HOH A O     1 
HETATM 4167 O  O     . HOH I 7 .   ? 37.230 15.198  -20.406 1.00 46.16  ? 771 HOH A O     1 
HETATM 4168 O  O     . HOH I 7 .   ? 53.065 -19.672 22.192  1.00 31.58  ? 772 HOH A O     1 
HETATM 4169 O  O     . HOH I 7 .   ? 51.702 -35.478 7.613   1.00 33.00  ? 773 HOH A O     1 
HETATM 4170 O  O     . HOH I 7 .   ? 53.835 6.090   -12.384 1.00 26.58  ? 774 HOH A O     1 
HETATM 4171 O  O     . HOH I 7 .   ? 42.562 13.024  -23.976 1.00 35.45  ? 775 HOH A O     1 
HETATM 4172 O  O     . HOH I 7 .   ? 72.257 -3.801  -13.847 1.00 26.23  ? 776 HOH A O     1 
HETATM 4173 O  O     . HOH I 7 .   ? 65.694 8.357   8.939   1.00 30.99  ? 777 HOH A O     1 
HETATM 4174 O  O     . HOH I 7 .   ? 56.724 -3.655  4.533   1.00 37.28  ? 778 HOH A O     1 
HETATM 4175 O  O     . HOH I 7 .   ? 49.321 -34.648 10.211  1.00 37.20  ? 779 HOH A O     1 
HETATM 4176 O  O     . HOH I 7 .   ? 69.837 -12.966 -11.515 1.00 29.43  ? 780 HOH A O     1 
HETATM 4177 O  O     . HOH I 7 .   ? 40.315 -18.344 -1.706  1.00 35.94  ? 781 HOH A O     1 
HETATM 4178 O  O     . HOH I 7 .   ? 65.365 12.866  3.036   1.00 28.70  ? 782 HOH A O     1 
HETATM 4179 O  O     . HOH I 7 .   ? 53.190 0.171   12.098  1.00 29.46  ? 783 HOH A O     1 
HETATM 4180 O  O     . HOH I 7 .   ? 58.908 4.737   23.117  1.00 31.01  ? 784 HOH A O     1 
HETATM 4181 O  O     . HOH I 7 .   ? 23.351 14.245  -9.269  1.00 34.39  ? 785 HOH A O     1 
HETATM 4182 O  O     . HOH I 7 .   ? 52.553 3.648   17.932  1.00 34.31  ? 786 HOH A O     1 
HETATM 4183 O  O     . HOH I 7 .   ? 44.208 -29.135 15.676  1.00 42.25  ? 787 HOH A O     1 
HETATM 4184 O  O     . HOH I 7 .   ? 56.764 21.587  18.111  1.00 30.80  ? 788 HOH A O     1 
HETATM 4185 O  O     . HOH I 7 .   ? 42.543 -9.047  9.654   1.00 40.26  ? 789 HOH A O     1 
HETATM 4186 O  O     . HOH I 7 .   ? 62.813 9.488   -13.511 1.00 32.36  ? 790 HOH A O     1 
HETATM 4187 O  O     . HOH I 7 .   ? 62.012 16.091  2.349   1.00 36.00  ? 791 HOH A O     1 
HETATM 4188 O  O     . HOH I 7 .   ? 24.315 16.517  3.165   1.00 31.48  ? 792 HOH A O     1 
HETATM 4189 O  O     . HOH I 7 .   ? 39.448 5.092   18.251  1.00 39.84  ? 793 HOH A O     1 
HETATM 4190 O  O     . HOH I 7 .   ? 69.215 -11.016 12.058  1.00 33.22  ? 794 HOH A O     1 
HETATM 4191 O  O     . HOH I 7 .   ? 67.462 6.514   0.902   1.00 34.35  ? 795 HOH A O     1 
HETATM 4192 O  O     . HOH I 7 .   ? 52.126 -5.984  -0.861  1.00 31.74  ? 796 HOH A O     1 
HETATM 4193 O  O     . HOH I 7 .   ? 57.299 -16.482 -11.437 1.00 28.67  ? 797 HOH A O     1 
HETATM 4194 O  O     . HOH I 7 .   ? 61.720 7.910   16.220  1.00 42.94  ? 798 HOH A O     1 
HETATM 4195 O  O     . HOH I 7 .   ? 50.792 17.641  -5.829  1.00 35.02  ? 799 HOH A O     1 
HETATM 4196 O  O     . HOH I 7 .   ? 55.663 -20.574 21.250  1.00 23.03  ? 800 HOH A O     1 
HETATM 4197 O  O     . HOH I 7 .   ? 57.736 0.040   -14.831 1.00 32.75  ? 801 HOH A O     1 
HETATM 4198 O  O     . HOH I 7 .   ? 62.950 -7.480  12.868  1.00 33.34  ? 802 HOH A O     1 
HETATM 4199 O  O     . HOH I 7 .   ? 38.961 -19.823 12.445  1.00 39.08  ? 803 HOH A O     1 
HETATM 4200 O  O     . HOH I 7 .   ? 83.161 -0.406  -3.949  1.00 44.81  ? 804 HOH A O     1 
HETATM 4201 O  O     . HOH I 7 .   ? 49.044 14.858  -22.701 1.00 27.79  ? 805 HOH A O     1 
HETATM 4202 O  O     . HOH I 7 .   ? 34.395 5.988   -21.873 1.00 34.50  ? 806 HOH A O     1 
HETATM 4203 O  O     . HOH I 7 .   ? 60.671 -28.266 8.384   1.00 35.11  ? 807 HOH A O     1 
HETATM 4204 O  O     . HOH I 7 .   ? 70.567 -6.796  13.776  1.00 38.35  ? 808 HOH A O     1 
HETATM 4205 O  O     . HOH I 7 .   ? 69.679 10.025  -8.476  1.00 26.70  ? 809 HOH A O     1 
HETATM 4206 O  O     . HOH I 7 .   ? 50.498 -13.208 -0.862  1.00 27.96  ? 810 HOH A O     1 
HETATM 4207 O  O     . HOH I 7 .   ? 61.010 9.872   6.939   1.00 33.19  ? 811 HOH A O     1 
HETATM 4208 O  O     . HOH I 7 .   ? 68.484 -26.264 -0.734  1.00 34.43  ? 812 HOH A O     1 
HETATM 4209 O  O     . HOH I 7 .   ? 47.806 16.081  -17.831 1.00 38.43  ? 813 HOH A O     1 
HETATM 4210 O  O     . HOH I 7 .   ? 56.321 1.232   13.235  1.00 32.47  ? 814 HOH A O     1 
HETATM 4211 O  O     . HOH I 7 .   ? 63.134 -23.719 3.338   1.00 29.13  ? 815 HOH A O     1 
HETATM 4212 O  O     . HOH I 7 .   ? 76.504 2.690   6.762   1.00 32.05  ? 816 HOH A O     1 
HETATM 4213 O  O     . HOH I 7 .   ? 48.374 -0.132  9.657   1.00 46.73  ? 817 HOH A O     1 
HETATM 4214 O  O     . HOH I 7 .   ? 57.774 23.452  14.115  1.00 37.58  ? 818 HOH A O     1 
HETATM 4215 O  O     . HOH I 7 .   ? 55.125 2.704   20.936  1.00 37.21  ? 819 HOH A O     1 
HETATM 4216 O  O     . HOH I 7 .   ? 34.197 15.732  18.718  1.00 39.75  ? 820 HOH A O     1 
HETATM 4217 O  O     . HOH I 7 .   ? 59.728 -31.616 3.849   1.00 30.35  ? 821 HOH A O     1 
HETATM 4218 O  O     . HOH I 7 .   ? 67.478 -8.418  9.836   1.00 26.51  ? 822 HOH A O     1 
HETATM 4219 O  O     . HOH I 7 .   ? 39.855 7.450   13.337  1.00 35.72  ? 823 HOH A O     1 
HETATM 4220 O  O     . HOH I 7 .   ? 34.697 17.589  -12.800 1.00 34.40  ? 824 HOH A O     1 
HETATM 4221 O  O     . HOH I 7 .   ? 43.863 -16.715 14.976  1.00 36.11  ? 825 HOH A O     1 
HETATM 4222 O  O     . HOH I 7 .   ? 44.777 -17.099 -0.476  1.00 33.09  ? 826 HOH A O     1 
HETATM 4223 O  O     . HOH I 7 .   ? 27.872 6.683   -17.037 1.00 32.56  ? 827 HOH A O     1 
HETATM 4224 O  O     . HOH I 7 .   ? 41.350 -3.108  -23.092 1.00 33.21  ? 828 HOH A O     1 
HETATM 4225 O  O     . HOH I 7 .   ? 50.902 -6.266  -5.589  1.00 31.33  ? 829 HOH A O     1 
HETATM 4226 O  O     . HOH I 7 .   ? 44.554 13.199  -10.736 1.00 41.80  ? 830 HOH A O     1 
HETATM 4227 O  O     . HOH I 7 .   ? 61.277 -16.044 13.701  1.00 33.00  ? 831 HOH A O     1 
HETATM 4228 O  O     . HOH I 7 .   ? 70.518 -17.269 12.321  1.00 36.29  ? 832 HOH A O     1 
HETATM 4229 O  O     . HOH I 7 .   ? 60.120 9.676   22.435  1.00 37.73  ? 833 HOH A O     1 
HETATM 4230 O  O     . HOH I 7 .   ? 46.631 -18.841 -2.349  1.00 36.22  ? 834 HOH A O     1 
HETATM 4231 O  O     . HOH I 7 .   ? 53.306 24.067  3.981   1.00 34.29  ? 835 HOH A O     1 
HETATM 4232 O  O     . HOH I 7 .   ? 66.103 -26.074 0.405   1.00 34.29  ? 836 HOH A O     1 
HETATM 4233 O  O     . HOH I 7 .   ? 65.060 19.548  1.855   1.00 27.62  ? 837 HOH A O     1 
HETATM 4234 O  O     . HOH I 7 .   ? 37.961 10.934  21.469  1.00 50.82  ? 838 HOH A O     1 
HETATM 4235 O  O     . HOH I 7 .   ? 72.965 1.998   8.186   1.00 39.08  ? 839 HOH A O     1 
HETATM 4236 O  O     . HOH I 7 .   ? 52.602 8.441   25.489  1.00 34.44  ? 840 HOH A O     1 
HETATM 4237 O  O     . HOH I 7 .   ? 69.827 -9.080  10.522  1.00 31.09  ? 841 HOH A O     1 
HETATM 4238 O  O     . HOH I 7 .   ? 68.030 10.348  7.812   1.00 42.00  ? 842 HOH A O     1 
HETATM 4239 O  O     . HOH I 7 .   ? 65.444 -34.852 -6.078  1.00 33.97  ? 843 HOH A O     1 
HETATM 4240 O  O     . HOH I 7 .   ? 39.417 18.778  18.306  1.00 32.14  ? 844 HOH A O     1 
HETATM 4241 O  O     . HOH I 7 .   ? 55.688 -32.877 4.863   1.00 36.71  ? 845 HOH A O     1 
HETATM 4242 O  O     . HOH I 7 .   ? 56.201 -3.042  7.490   1.00 31.64  ? 846 HOH A O     1 
HETATM 4243 O  O     . HOH I 7 .   ? 44.294 10.008  -24.670 1.00 28.95  ? 847 HOH A O     1 
HETATM 4244 O  O     . HOH I 7 .   ? 44.204 0.552   -21.194 1.00 40.04  ? 848 HOH A O     1 
HETATM 4245 O  O     . HOH I 7 .   ? 35.421 20.901  0.640   1.00 31.06  ? 849 HOH A O     1 
HETATM 4246 O  O     . HOH I 7 .   ? 54.039 -32.425 -2.748  1.00 37.95  ? 850 HOH A O     1 
HETATM 4247 O  O     . HOH I 7 .   ? 71.933 -19.073 13.955  1.00 36.94  ? 851 HOH A O     1 
HETATM 4248 O  O     . HOH I 7 .   ? 37.133 18.926  16.597  1.00 37.71  ? 852 HOH A O     1 
HETATM 4249 O  O     . HOH I 7 .   ? 58.141 17.820  19.862  1.00 35.72  ? 853 HOH A O     1 
HETATM 4250 O  O     . HOH I 7 .   ? 68.848 -1.439  -13.637 1.00 41.52  ? 854 HOH A O     1 
HETATM 4251 O  O     . HOH I 7 .   ? 38.281 10.715  9.597   1.00 31.57  ? 855 HOH A O     1 
HETATM 4252 O  O     . HOH I 7 .   ? 81.021 -15.716 7.697   1.00 39.84  ? 856 HOH A O     1 
HETATM 4253 O  O     . HOH I 7 .   ? 36.019 11.103  10.447  1.00 30.37  ? 857 HOH A O     1 
HETATM 4254 O  O     . HOH I 7 .   ? 42.664 5.802   21.011  1.00 36.06  ? 858 HOH A O     1 
HETATM 4255 O  O     . HOH I 7 .   ? 60.716 13.839  6.244   1.00 39.12  ? 859 HOH A O     1 
HETATM 4256 O  O     . HOH I 7 .   ? 39.042 -3.363  -20.423 1.00 33.46  ? 860 HOH A O     1 
HETATM 4257 O  O     . HOH I 7 .   ? 61.796 11.644  -12.271 1.00 31.42  ? 861 HOH A O     1 
HETATM 4258 O  O     . HOH I 7 .   ? 41.355 15.910  -22.876 1.00 26.54  ? 862 HOH A O     1 
HETATM 4259 O  O     . HOH I 7 .   ? 57.479 -18.890 22.174  1.00 30.90  ? 863 HOH A O     1 
HETATM 4260 O  O     . HOH I 7 .   ? 46.699 -30.883 12.917  1.00 43.20  ? 864 HOH A O     1 
HETATM 4261 O  O     . HOH I 7 .   ? 71.937 1.353   18.880  1.00 49.54  ? 865 HOH A O     1 
HETATM 4262 O  O     . HOH I 7 .   ? 29.805 3.699   6.275   1.00 40.74  ? 866 HOH A O     1 
HETATM 4263 O  O     . HOH I 7 .   ? 49.755 0.554   20.200  1.00 38.77  ? 867 HOH A O     1 
HETATM 4264 O  O     . HOH I 7 .   ? 81.397 -10.967 -8.688  1.00 40.73  ? 868 HOH A O     1 
HETATM 4265 O  O     . HOH I 7 .   ? 45.063 -15.105 13.109  1.00 36.91  ? 869 HOH A O     1 
HETATM 4266 O  O     . HOH I 7 .   ? 61.830 9.010   18.728  1.00 34.77  ? 870 HOH A O     1 
HETATM 4267 O  O     . HOH I 7 .   ? 81.374 3.018   -3.159  1.00 51.22  ? 871 HOH A O     1 
HETATM 4268 O  O     . HOH I 7 .   ? 39.394 0.263   -6.594  1.00 31.95  ? 872 HOH A O     1 
HETATM 4269 O  O     . HOH I 7 .   ? 67.779 1.732   12.058  1.00 44.25  ? 873 HOH A O     1 
HETATM 4270 O  O     . HOH I 7 .   ? 57.778 12.145  -12.162 1.00 33.95  ? 874 HOH A O     1 
HETATM 4271 O  O     . HOH I 7 .   ? 82.988 -3.388  -4.207  1.00 36.70  ? 875 HOH A O     1 
HETATM 4272 O  O     . HOH I 7 .   ? 48.864 13.794  28.334  1.00 34.00  ? 876 HOH A O     1 
HETATM 4273 O  O     . HOH I 7 .   ? 63.817 -3.706  13.571  1.00 45.45  ? 877 HOH A O     1 
HETATM 4274 O  O     . HOH I 7 .   ? 61.577 -31.769 -10.618 1.00 36.85  ? 878 HOH A O     1 
HETATM 4275 O  O     . HOH I 7 .   ? 68.337 -17.136 -12.147 1.00 47.44  ? 879 HOH A O     1 
HETATM 4276 O  O     . HOH I 7 .   ? 67.589 6.181   9.708   1.00 37.28  ? 880 HOH A O     1 
HETATM 4277 O  O     . HOH I 7 .   ? 53.494 -8.579  8.681   1.00 33.47  ? 881 HOH A O     1 
HETATM 4278 O  O     . HOH I 7 .   ? 67.582 -5.176  -17.133 1.00 51.34  ? 882 HOH A O     1 
HETATM 4279 O  O     . HOH I 7 .   ? 35.571 22.544  -3.344  1.00 42.67  ? 883 HOH A O     1 
HETATM 4280 O  O     . HOH I 7 .   ? 73.659 -20.824 1.056   1.00 34.77  ? 884 HOH A O     1 
HETATM 4281 O  O     . HOH I 7 .   ? 38.503 -25.392 5.889   1.00 46.03  ? 885 HOH A O     1 
HETATM 4282 O  O     . HOH I 7 .   ? 41.641 20.310  4.818   1.00 28.49  ? 886 HOH A O     1 
HETATM 4283 O  O     . HOH I 7 .   ? 63.354 -4.873  -15.682 1.00 48.40  ? 887 HOH A O     1 
HETATM 4284 O  O     . HOH I 7 .   ? 60.508 6.295   -15.598 1.00 32.96  ? 888 HOH A O     1 
HETATM 4285 O  O     . HOH I 7 .   ? 68.054 -25.903 -6.625  1.00 50.68  ? 889 HOH A O     1 
HETATM 4286 O  O     . HOH I 7 .   ? 69.740 5.385   1.042   1.00 41.07  ? 890 HOH A O     1 
HETATM 4287 O  O     . HOH I 7 .   ? 69.187 8.276   3.996   1.00 44.43  ? 891 HOH A O     1 
HETATM 4288 O  O     . HOH I 7 .   ? 46.484 2.515   -4.135  1.00 38.46  ? 892 HOH A O     1 
HETATM 4289 O  O     . HOH I 7 .   ? 20.011 10.136  8.707   1.00 42.98  ? 893 HOH A O     1 
HETATM 4290 O  O     . HOH I 7 .   ? 45.593 2.076   18.343  1.00 36.39  ? 894 HOH A O     1 
HETATM 4291 O  O     . HOH I 7 .   ? 63.619 -17.289 15.002  1.00 34.09  ? 895 HOH A O     1 
HETATM 4292 O  O     . HOH I 7 .   ? 66.538 3.927   10.703  1.00 34.90  ? 896 HOH A O     1 
HETATM 4293 O  O     . HOH I 7 .   ? 83.369 -10.732 9.669   1.00 49.62  ? 897 HOH A O     1 
HETATM 4294 O  O     . HOH I 7 .   ? 55.294 -17.493 -13.278 1.00 35.50  ? 898 HOH A O     1 
HETATM 4295 O  O     . HOH I 7 .   ? 44.544 -0.130  8.908   1.00 52.56  ? 899 HOH A O     1 
HETATM 4296 O  O     . HOH I 7 .   ? 63.986 -7.935  -18.246 1.00 47.74  ? 900 HOH A O     1 
HETATM 4297 O  O     . HOH I 7 .   ? 83.865 -8.046  0.825   1.00 45.88  ? 901 HOH A O     1 
HETATM 4298 O  O     . HOH I 7 .   ? 39.617 -2.313  -14.357 1.00 31.30  ? 902 HOH A O     1 
HETATM 4299 O  O     . HOH I 7 .   ? 52.877 -24.719 -6.045  1.00 45.01  ? 903 HOH A O     1 
HETATM 4300 O  O     . HOH I 7 .   ? 70.244 -21.838 0.634   1.00 33.07  ? 904 HOH A O     1 
HETATM 4301 O  O     . HOH I 7 .   ? 25.759 14.678  5.227   1.00 38.66  ? 905 HOH A O     1 
HETATM 4302 O  O     . HOH I 7 .   ? 38.566 -28.172 7.036   1.00 43.91  ? 906 HOH A O     1 
HETATM 4303 O  O     . HOH I 7 .   ? 61.500 1.729   14.320  1.00 42.61  ? 907 HOH A O     1 
HETATM 4304 O  O     . HOH I 7 .   ? 34.652 14.017  21.804  1.00 36.78  ? 908 HOH A O     1 
HETATM 4305 O  O     . HOH I 7 .   ? 39.991 -22.527 3.169   1.00 33.12  ? 909 HOH A O     1 
HETATM 4306 O  O     . HOH I 7 .   ? 55.623 -1.378  -14.908 1.00 35.48  ? 910 HOH A O     1 
HETATM 4307 O  O     . HOH I 7 .   ? 51.288 4.730   24.931  1.00 33.72  ? 911 HOH A O     1 
HETATM 4308 O  O     . HOH I 7 .   ? 37.491 13.899  21.878  1.00 34.73  ? 912 HOH A O     1 
HETATM 4309 O  O     . HOH I 7 .   ? 43.578 17.726  17.943  1.00 38.27  ? 913 HOH A O     1 
HETATM 4310 O  O     . HOH I 7 .   ? 64.452 -15.365 13.746  1.00 44.11  ? 914 HOH A O     1 
HETATM 4311 O  O     . HOH I 7 .   ? 56.275 -11.245 15.217  1.00 43.02  ? 915 HOH A O     1 
HETATM 4312 O  O     . HOH I 7 .   ? 40.975 -18.383 0.720   1.00 32.54  ? 916 HOH A O     1 
HETATM 4313 O  O     . HOH I 7 .   ? 50.832 5.745   -23.188 1.00 42.22  ? 917 HOH A O     1 
HETATM 4314 O  O     . HOH I 7 .   ? 61.531 16.039  4.838   1.00 38.94  ? 918 HOH A O     1 
HETATM 4315 O  O     . HOH I 7 .   ? 64.302 22.362  8.143   1.00 49.97  ? 919 HOH A O     1 
HETATM 4316 O  O     . HOH I 7 .   ? 61.883 24.220  9.914   1.00 38.39  ? 920 HOH A O     1 
HETATM 4317 O  O     . HOH I 7 .   ? 33.558 7.812   17.610  1.00 36.14  ? 921 HOH A O     1 
HETATM 4318 O  O     . HOH I 7 .   ? 31.000 21.742  -3.452  1.00 37.22  ? 922 HOH A O     1 
HETATM 4319 O  O     . HOH I 7 .   ? 45.751 11.638  -9.084  1.00 35.35  ? 923 HOH A O     1 
HETATM 4320 O  O     . HOH I 7 .   ? 47.095 14.120  -10.931 1.00 40.09  ? 924 HOH A O     1 
HETATM 4321 O  O     . HOH I 7 .   ? 43.312 15.600  -10.720 1.00 47.54  ? 925 HOH A O     1 
HETATM 4322 O  O     . HOH I 7 .   ? 66.405 3.465   -17.509 1.00 34.73  ? 926 HOH A O     1 
HETATM 4323 O  O     . HOH I 7 .   ? 66.342 -2.465  12.769  1.00 33.73  ? 927 HOH A O     1 
HETATM 4324 O  O     . HOH I 7 .   ? 82.355 -10.412 -0.889  1.00 45.73  ? 928 HOH A O     1 
HETATM 4325 O  O     . HOH I 7 .   ? 57.132 -8.976  10.489  1.00 55.28  ? 929 HOH A O     1 
HETATM 4326 O  O     . HOH I 7 .   ? 38.887 -18.977 5.827   1.00 41.53  ? 930 HOH A O     1 
HETATM 4327 O  O     . HOH I 7 .   ? 38.540 -22.745 10.600  1.00 40.79  ? 931 HOH A O     1 
HETATM 4328 O  O     . HOH I 7 .   ? 42.525 -20.835 16.855  1.00 41.30  ? 932 HOH A O     1 
HETATM 4329 O  O     . HOH I 7 .   ? 52.848 -21.639 -9.121  1.00 43.86  ? 933 HOH A O     1 
HETATM 4330 O  O     . HOH I 7 .   ? 26.205 11.057  14.420  1.00 45.66  ? 934 HOH A O     1 
HETATM 4331 O  O     . HOH I 7 .   ? 21.665 13.555  6.898   1.00 37.85  ? 935 HOH A O     1 
HETATM 4332 O  O     . HOH I 7 .   ? 22.050 11.881  -9.492  1.00 35.50  ? 936 HOH A O     1 
HETATM 4333 O  O     . HOH I 7 .   ? 30.956 1.800   -22.110 1.00 30.47  ? 937 HOH A O     1 
HETATM 4334 O  O     . HOH I 7 .   ? 19.501 -3.335  0.723   1.00 50.02  ? 938 HOH A O     1 
HETATM 4335 O  O     . HOH I 7 .   ? 33.372 11.075  8.476   1.00 41.02  ? 939 HOH A O     1 
HETATM 4336 O  O     . HOH I 7 .   ? 34.170 3.329   2.713   1.00 36.41  ? 940 HOH A O     1 
HETATM 4337 O  O     . HOH I 7 .   ? 70.048 -18.694 -9.658  1.00 41.42  ? 941 HOH A O     1 
HETATM 4338 O  O     . HOH I 7 .   ? 65.301 19.745  6.595   1.00 37.25  ? 942 HOH A O     1 
HETATM 4339 O  O     . HOH I 7 .   ? 33.720 19.461  17.178  1.00 54.25  ? 943 HOH A O     1 
HETATM 4340 O  O     . HOH I 7 .   ? 53.122 1.677   16.441  1.00 39.29  ? 944 HOH A O     1 
HETATM 4341 O  O     . HOH I 7 .   ? 51.524 13.457  -11.522 1.00 36.06  ? 945 HOH A O     1 
HETATM 4342 O  O     . HOH I 7 .   ? 71.409 9.006   -6.723  1.00 34.60  ? 946 HOH A O     1 
HETATM 4343 O  O     . HOH I 7 .   ? 79.130 1.707   4.718   1.00 41.05  ? 947 HOH A O     1 
HETATM 4344 O  O     . HOH I 7 .   ? 63.824 -11.631 12.781  1.00 51.40  ? 948 HOH A O     1 
HETATM 4345 O  O     . HOH I 7 .   ? 71.167 -12.321 14.460  1.00 43.23  ? 949 HOH A O     1 
HETATM 4346 O  O     . HOH I 7 .   ? 49.175 -23.977 19.167  1.00 46.04  ? 950 HOH A O     1 
HETATM 4347 O  O     . HOH I 7 .   ? 56.304 -33.316 2.116   1.00 36.36  ? 951 HOH A O     1 
HETATM 4348 O  O     . HOH I 7 .   ? 41.004 -29.789 12.977  1.00 37.03  ? 952 HOH A O     1 
HETATM 4349 O  O     . HOH I 7 .   ? 51.948 -17.995 -6.222  1.00 39.48  ? 953 HOH A O     1 
HETATM 4350 O  O     . HOH I 7 .   ? 50.153 -16.183 -9.422  1.00 43.86  ? 954 HOH A O     1 
HETATM 4351 O  O     . HOH I 7 .   ? 32.593 3.009   -23.843 1.00 41.71  ? 955 HOH A O     1 
HETATM 4352 O  O     . HOH I 7 .   ? 46.421 0.964   14.102  1.00 37.54  ? 956 HOH A O     1 
HETATM 4353 O  O     . HOH I 7 .   ? 38.649 13.749  24.293  1.00 40.24  ? 957 HOH A O     1 
HETATM 4354 O  O     . HOH I 7 .   ? 44.758 6.714   -2.996  1.00 34.60  ? 958 HOH A O     1 
HETATM 4355 O  O     . HOH I 7 .   ? 57.664 5.556   -15.952 1.00 39.64  ? 959 HOH A O     1 
HETATM 4356 O  O     . HOH I 7 .   ? 53.264 5.159   -17.132 1.00 38.50  ? 960 HOH A O     1 
HETATM 4357 O  O     . HOH I 7 .   ? 85.859 -4.719  -2.670  1.00 48.02  ? 961 HOH A O     1 
HETATM 4358 O  O     . HOH I 7 .   ? 54.776 -32.158 16.665  1.00 43.24  ? 962 HOH A O     1 
HETATM 4359 O  O     . HOH I 7 .   ? 42.751 17.414  -17.028 1.00 37.16  ? 963 HOH A O     1 
HETATM 4360 O  O     . HOH I 7 .   ? 48.394 3.276   -20.342 1.00 39.23  ? 964 HOH A O     1 
HETATM 4361 O  O     . HOH I 7 .   ? 47.945 16.989  28.051  1.00 33.71  ? 965 HOH A O     1 
HETATM 4362 O  O     . HOH I 7 .   ? 33.522 2.544   -0.313  1.00 36.22  ? 966 HOH A O     1 
HETATM 4363 O  O     . HOH I 7 .   ? 62.288 12.260  9.513   1.00 46.11  ? 967 HOH A O     1 
HETATM 4364 O  O     . HOH I 7 .   ? 48.441 -0.634  5.828   1.00 47.08  ? 968 HOH A O     1 
HETATM 4365 O  O     . HOH I 7 .   ? 46.140 7.348   -12.956 1.00 30.67  ? 969 HOH A O     1 
HETATM 4366 O  O     . HOH I 7 .   ? 46.447 10.438  -13.488 1.00 50.72  ? 970 HOH A O     1 
HETATM 4367 O  O     . HOH I 7 .   ? 40.897 -29.565 -2.438  1.00 32.37  ? 971 HOH A O     1 
HETATM 4368 O  O     . HOH I 7 .   ? 44.773 -33.216 -3.078  1.00 34.93  ? 972 HOH A O     1 
HETATM 4369 O  O     . HOH I 7 .   ? 44.531 -33.663 -6.616  1.00 29.67  ? 973 HOH A O     1 
HETATM 4370 O  O     . HOH I 7 .   ? 42.697 -30.102 -4.118  1.00 42.98  ? 974 HOH A O     1 
HETATM 4371 O  O     . HOH I 7 .   ? 53.485 -0.968  4.565   1.00 30.48  ? 975 HOH A O     1 
HETATM 4372 O  O     . HOH I 7 .   ? 54.493 -0.871  7.381   1.00 30.85  ? 976 HOH A O     1 
HETATM 4373 O  O     . HOH I 7 .   ? 18.094 -3.189  -6.393  1.00 50.55  ? 977 HOH A O     1 
HETATM 4374 O  O     . HOH I 7 .   ? 37.481 17.471  -6.579  1.00 39.10  ? 978 HOH A O     1 
HETATM 4375 O  O     . HOH I 7 .   ? 45.582 17.968  -3.539  1.00 29.53  ? 979 HOH A O     1 
HETATM 4376 O  O     . HOH I 7 .   ? 61.637 4.582   -17.269 1.00 40.57  ? 980 HOH A O     1 
HETATM 4377 O  O     . HOH I 7 .   ? 85.114 -9.340  7.892   1.00 52.11  ? 981 HOH A O     1 
HETATM 4378 O  O     . HOH I 7 .   ? 43.441 -15.992 -2.755  1.00 45.91  ? 982 HOH A O     1 
HETATM 4379 O  O     . HOH I 7 .   ? 61.311 7.242   22.972  1.00 49.73  ? 983 HOH A O     1 
HETATM 4380 O  O     . HOH I 7 .   ? 32.180 1.114   -6.516  1.00 38.96  ? 984 HOH A O     1 
HETATM 4381 O  O     . HOH I 7 .   ? 45.831 5.504   -5.239  1.00 29.27  ? 985 HOH A O     1 
HETATM 4382 O  O     . HOH J 7 .   ? 41.825 -20.077 -3.411  1.00 29.63  ? 101 HOH T O     1 
HETATM 4383 O  O     . HOH J 7 .   ? 35.959 11.011  0.747   1.00 25.67  ? 102 HOH T O     1 
HETATM 4384 O  O     . HOH J 7 .   ? 43.502 5.498   -9.106  1.00 23.24  ? 103 HOH T O     1 
HETATM 4385 O  O     . HOH J 7 .   ? 41.054 -3.656  -9.397  1.00 32.83  ? 104 HOH T O     1 
HETATM 4386 O  O     . HOH J 7 .   ? 37.090 -23.140 -5.497  1.00 28.09  ? 105 HOH T O     1 
HETATM 4387 O  O     . HOH J 7 .   ? 40.195 -0.457  7.794   1.00 32.72  ? 106 HOH T O     1 
HETATM 4388 O  O     . HOH J 7 .   ? 44.520 -8.618  -3.574  1.00 31.22  ? 107 HOH T O     1 
HETATM 4389 O  O     . HOH J 7 .   ? 36.451 2.365   4.549   1.00 32.52  ? 108 HOH T O     1 
HETATM 4390 O  O     . HOH J 7 .   ? 35.250 5.964   18.203  1.00 39.10  ? 109 HOH T O     1 
HETATM 4391 O  O     . HOH J 7 .   ? 38.859 2.927   -5.956  1.00 33.15  ? 110 HOH T O     1 
HETATM 4392 O  O     . HOH J 7 .   ? 37.036 -2.910  -4.388  1.00 33.43  ? 111 HOH T O     1 
HETATM 4393 O  O     . HOH J 7 .   ? 38.294 -4.142  -8.487  1.00 47.97  ? 112 HOH T O     1 
HETATM 4394 O  O     . HOH J 7 .   ? 38.887 -2.366  -6.397  1.00 39.26  ? 113 HOH T O     1 
HETATM 4395 O  O     . HOH J 7 .   ? 37.458 0.135   -2.953  1.00 33.46  ? 114 HOH T O     1 
HETATM 4396 O  O     . HOH J 7 .   ? 37.866 -12.861 -11.252 1.00 42.22  ? 115 HOH T O     1 
HETATM 4397 O  O     . HOH J 7 .   ? 42.187 -7.425  -10.656 1.00 35.20  ? 116 HOH T O     1 
HETATM 4398 O  O     . HOH J 7 .   ? 37.749 0.090   4.557   1.00 35.80  ? 117 HOH T O     1 
HETATM 4399 O  O     . HOH J 7 .   ? 42.324 -11.432 -11.699 1.00 46.10  ? 118 HOH T O     1 
HETATM 4400 O  O     . HOH J 7 .   ? 47.108 -8.604  -4.535  1.00 46.61  ? 119 HOH T O     1 
HETATM 4401 O  O     . HOH J 7 .   ? 32.765 -17.300 -2.636  1.00 41.43  ? 120 HOH T O     1 
HETATM 4402 O  O     . HOH J 7 .   ? 40.784 -22.359 -7.189  1.00 41.34  ? 121 HOH T O     1 
HETATM 4403 O  O     . HOH J 7 .   ? 30.754 5.398   8.089   1.00 50.15  ? 122 HOH T O     1 
HETATM 4404 O  O     . HOH J 7 .   ? 31.460 -16.261 -4.508  1.00 32.57  ? 123 HOH T O     1 
HETATM 4405 O  O     . HOH J 7 .   ? 47.314 -0.461  -8.369  1.00 32.94  ? 124 HOH T O     1 
HETATM 4406 O  O     . HOH J 7 .   ? 45.849 -5.021  -3.407  1.00 37.51  ? 125 HOH T O     1 
HETATM 4407 O  O     . HOH J 7 .   ? 36.698 -2.362  -1.130  1.00 34.72  ? 126 HOH T O     1 
HETATM 4408 O  O     . HOH J 7 .   ? 42.567 -11.389 -3.492  1.00 34.29  ? 127 HOH T O     1 
HETATM 4409 O  O     . HOH J 7 .   ? 39.035 -10.312 -10.126 1.00 38.35  ? 128 HOH T O     1 
HETATM 4410 O  O     . HOH J 7 .   ? 32.552 14.096  10.666  1.00 47.77  ? 129 HOH T O     1 
HETATM 4411 O  O     . HOH J 7 .   ? 28.718 4.252   9.485   1.00 47.02  ? 130 HOH T O     1 
HETATM 4412 O  O     . HOH J 7 .   ? 38.285 2.634   -3.374  1.00 35.55  ? 131 HOH T O     1 
HETATM 4413 O  O     . HOH J 7 .   ? 36.617 -8.497  -9.704  1.00 49.64  ? 132 HOH T O     1 
HETATM 4414 O  O     . HOH K 7 .   ? 49.600 -10.151 6.660   1.00 22.37  ? 101 HOH P O     1 
HETATM 4415 O  O     . HOH K 7 .   ? 51.708 -8.861  4.916   1.00 27.27  ? 102 HOH P O     1 
HETATM 4416 O  O     . HOH K 7 .   ? 42.023 -11.624 -0.903  1.00 24.39  ? 103 HOH P O     1 
HETATM 4417 O  O     . HOH K 7 .   ? 43.095 -8.955  7.045   1.00 23.47  ? 104 HOH P O     1 
HETATM 4418 O  O     . HOH K 7 .   ? 41.616 -15.714 1.825   1.00 22.13  ? 105 HOH P O     1 
HETATM 4419 O  O     . HOH K 7 .   ? 44.309 -12.899 -0.354  1.00 28.32  ? 106 HOH P O     1 
HETATM 4420 O  O     . HOH K 7 .   ? 44.901 -8.408  -1.079  1.00 30.66  ? 107 HOH P O     1 
HETATM 4421 O  O     . HOH K 7 .   ? 46.490 -2.456  -0.667  1.00 27.48  ? 108 HOH P O     1 
HETATM 4422 O  O     . HOH K 7 .   ? 40.708 -8.960  5.873   1.00 28.95  ? 109 HOH P O     1 
HETATM 4423 O  O     . HOH K 7 .   ? 46.677 3.894   0.974   1.00 31.27  ? 110 HOH P O     1 
HETATM 4424 O  O     . HOH K 7 .   ? 45.309 5.879   -0.299  1.00 31.48  ? 111 HOH P O     1 
HETATM 4425 O  O     . HOH K 7 .   ? 46.057 -10.697 -0.006  1.00 31.25  ? 112 HOH P O     1 
HETATM 4426 O  O     . HOH K 7 .   ? 36.776 -4.741  3.191   1.00 29.48  ? 113 HOH P O     1 
HETATM 4427 O  O     . HOH K 7 .   ? 40.512 -13.944 -0.108  1.00 33.57  ? 114 HOH P O     1 
HETATM 4428 O  O     . HOH K 7 .   ? 34.666 -9.235  -11.350 1.00 43.04  ? 115 HOH P O     1 
HETATM 4429 O  O     . HOH K 7 .   ? 52.662 -3.193  5.630   1.00 37.81  ? 116 HOH P O     1 
HETATM 4430 O  O     . HOH K 7 .   ? 42.118 -1.993  6.620   1.00 39.21  ? 117 HOH P O     1 
HETATM 4431 O  O     . HOH K 7 .   ? 31.405 -13.751 -3.035  1.00 42.00  ? 118 HOH P O     1 
HETATM 4432 O  O     . HOH K 7 .   ? 32.185 -7.515  -12.150 1.00 42.42  ? 119 HOH P O     1 
HETATM 4433 O  O     . HOH K 7 .   ? 40.736 -5.324  5.602   1.00 39.37  ? 120 HOH P O     1 
HETATM 4434 O  O     . HOH K 7 .   ? 33.656 -17.021 1.781   1.00 50.44  ? 121 HOH P O     1 
HETATM 4435 O  O     . HOH K 7 .   ? 46.520 -7.766  7.940   1.00 37.51  ? 122 HOH P O     1 
HETATM 4436 O  O     . HOH K 7 .   ? 38.891 -3.853  4.701   1.00 42.13  ? 123 HOH P O     1 
HETATM 4437 O  O     . HOH K 7 .   ? 44.618 -6.246  6.236   1.00 46.13  ? 124 HOH P O     1 
HETATM 4438 O  O     . HOH K 7 .   ? 38.077 -1.948  6.256   1.00 41.79  ? 125 HOH P O     1 
HETATM 4439 O  O     . HOH K 7 .   ? 49.667 -7.785  8.017   1.00 38.91  ? 126 HOH P O     1 
HETATM 4440 O  O     . HOH K 7 .   ? 51.234 -6.481  6.036   1.00 36.59  ? 127 HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 1   ? 0.9778 0.7453 0.9578 0.0317  0.0269  -0.0095 -2  GLY A N     
2    C CA    . GLY A 1   ? 0.7034 0.4729 0.6818 0.0406  0.0317  -0.0079 -2  GLY A CA    
3    C C     . GLY A 1   ? 0.6518 0.4255 0.6216 0.0438  0.0326  -0.0135 -2  GLY A C     
4    O O     . GLY A 1   ? 0.6897 0.4765 0.6594 0.0408  0.0305  -0.0132 -2  GLY A O     
5    N N     . PRO A 2   ? 0.6859 0.4480 0.6479 0.0503  0.0361  -0.0186 -1  PRO A N     
6    C CA    . PRO A 2   ? 0.5756 0.3398 0.5279 0.0553  0.0385  -0.0234 -1  PRO A CA    
7    C C     . PRO A 2   ? 0.7845 0.5477 0.7274 0.0502  0.0336  -0.0312 -1  PRO A C     
8    O O     . PRO A 2   ? 0.8516 0.6176 0.7855 0.0539  0.0352  -0.0347 -1  PRO A O     
9    C CB    . PRO A 2   ? 0.8703 0.6186 0.8162 0.0635  0.0435  -0.0271 -1  PRO A CB    
10   C CG    . PRO A 2   ? 0.8380 0.5719 0.7869 0.0600  0.0412  -0.0280 -1  PRO A CG    
11   C CD    . PRO A 2   ? 0.7771 0.5221 0.7388 0.0540  0.0386  -0.0197 -1  PRO A CD    
12   N N     . HIS A 3   ? 0.6934 0.4529 0.6385 0.0419  0.0277  -0.0334 0   HIS A N     
13   C CA    . HIS A 3   ? 0.4438 0.2026 0.3816 0.0367  0.0221  -0.0407 0   HIS A CA    
14   C C     . HIS A 3   ? 0.6848 0.4579 0.6307 0.0287  0.0177  -0.0369 0   HIS A C     
15   O O     . HIS A 3   ? 0.6737 0.4489 0.6161 0.0237  0.0125  -0.0417 0   HIS A O     
16   C CB    . HIS A 3   ? 0.4846 0.2248 0.4176 0.0341  0.0184  -0.0486 0   HIS A CB    
17   C CG    . HIS A 3   ? 0.5350 0.2592 0.4598 0.0422  0.0229  -0.0524 0   HIS A CG    
18   N ND1   . HIS A 3   ? 0.5672 0.2895 0.4796 0.0505  0.0269  -0.0562 0   HIS A ND1   
19   C CD2   . HIS A 3   ? 0.5207 0.2297 0.4479 0.0439  0.0248  -0.0526 0   HIS A CD2   
20   C CE1   . HIS A 3   ? 0.5229 0.2297 0.4301 0.0571  0.0310  -0.0589 0   HIS A CE1   
21   N NE2   . HIS A 3   ? 0.5483 0.2466 0.4645 0.0533  0.0296  -0.0569 0   HIS A NE2   
22   N N     . MET A 4   ? 0.7140 0.4971 0.6705 0.0278  0.0196  -0.0281 1   MET A N     
23   C CA    . MET A 4   ? 0.6623 0.4585 0.6263 0.0210  0.0162  -0.0239 1   MET A CA    
24   C C     . MET A 4   ? 0.5952 0.4065 0.5571 0.0224  0.0165  -0.0225 1   MET A C     
25   O O     . MET A 4   ? 0.5001 0.3186 0.4642 0.0274  0.0204  -0.0178 1   MET A O     
26   C CB    . MET A 4   ? 1.1418 0.9411 1.1163 0.0199  0.0178  -0.0153 1   MET A CB    
27   C CG    . MET A 4   ? 1.1431 0.9495 1.1245 0.0121  0.0143  -0.0120 1   MET A CG    
28   S SD    . MET A 4   ? 1.7736 1.5672 1.7565 0.0046  0.0102  -0.0176 1   MET A SD    
29   C CE    . MET A 4   ? 1.5516 1.3280 1.5368 0.0080  0.0137  -0.0156 1   MET A CE    
30   N N     . ALA A 5   ? 0.5856 0.4017 0.5442 0.0179  0.0123  -0.0264 2   ALA A N     
31   C CA    . ALA A 5   ? 0.6271 0.4567 0.5837 0.0188  0.0124  -0.0252 2   ALA A CA    
32   C C     . ALA A 5   ? 0.5046 0.3470 0.4707 0.0172  0.0132  -0.0172 2   ALA A C     
33   O O     . ALA A 5   ? 0.4862 0.3290 0.4594 0.0130  0.0119  -0.0135 2   ALA A O     
34   C CB    . ALA A 5   ? 0.8138 0.6457 0.7659 0.0141  0.0071  -0.0306 2   ALA A CB    
35   N N     . THR A 6   ? 0.4273 0.2796 0.3932 0.0207  0.0156  -0.0144 3   THR A N     
36   C CA    . THR A 6   ? 0.3081 0.1720 0.2822 0.0197  0.0159  -0.0075 3   THR A CA    
37   C C     . THR A 6   ? 0.3214 0.1970 0.2946 0.0176  0.0141  -0.0073 3   THR A C     
38   O O     . THR A 6   ? 0.3571 0.2423 0.3359 0.0168  0.0138  -0.0025 3   THR A O     
39   C CB    . THR A 6   ? 0.4122 0.2780 0.3904 0.0257  0.0201  -0.0029 3   THR A CB    
40   O OG1   . THR A 6   ? 0.4050 0.2720 0.3784 0.0307  0.0234  -0.0050 3   THR A OG1   
41   C CG2   . THR A 6   ? 0.4155 0.2699 0.3952 0.0282  0.0220  -0.0023 3   THR A CG2   
42   N N     . GLY A 7   ? 0.3340 0.2082 0.2998 0.0170  0.0125  -0.0128 4   GLY A N     
43   C CA    . GLY A 7   ? 0.2729 0.1571 0.2373 0.0152  0.0106  -0.0129 4   GLY A CA    
44   C C     . GLY A 7   ? 0.3156 0.2082 0.2822 0.0189  0.0139  -0.0088 4   GLY A C     
45   O O     . GLY A 7   ? 0.3258 0.2279 0.2963 0.0167  0.0125  -0.0059 4   GLY A O     
46   N N     . GLN A 8   ? 0.2788 0.1679 0.2437 0.0247  0.0183  -0.0085 5   GLN A N     
47   C CA    . GLN A 8   ? 0.1988 0.0957 0.1682 0.0282  0.0218  -0.0041 5   GLN A CA    
48   C C     . GLN A 8   ? 0.2869 0.1831 0.2487 0.0328  0.0254  -0.0063 5   GLN A C     
49   O O     . GLN A 8   ? 0.3030 0.2033 0.2686 0.0370  0.0299  -0.0028 5   GLN A O     
50   C CB    . GLN A 8   ? 0.2446 0.1401 0.2214 0.0317  0.0248  -0.0001 5   GLN A CB    
51   C CG    . GLN A 8   ? 0.2700 0.1692 0.2551 0.0282  0.0218  0.0040  5   GLN A CG    
52   C CD    . GLN A 8   ? 0.2836 0.1808 0.2754 0.0322  0.0243  0.0079  5   GLN A CD    
53   O OE1   . GLN A 8   ? 0.3236 0.2110 0.3128 0.0346  0.0261  0.0062  5   GLN A OE1   
54   N NE2   . GLN A 8   ? 0.2898 0.1961 0.2904 0.0330  0.0240  0.0130  5   GLN A NE2   
55   N N     . ASP A 9   ? 0.3001 0.1918 0.2518 0.0319  0.0232  -0.0116 6   ASP A N     
56   C CA    . ASP A 9   ? 0.3055 0.1941 0.2466 0.0368  0.0262  -0.0145 6   ASP A CA    
57   C C     . ASP A 9   ? 0.3033 0.2009 0.2438 0.0372  0.0271  -0.0121 6   ASP A C     
58   O O     . ASP A 9   ? 0.3726 0.2691 0.3062 0.0423  0.0314  -0.0121 6   ASP A O     
59   C CB    . ASP A 9   ? 0.4047 0.2838 0.3341 0.0359  0.0223  -0.0218 6   ASP A CB    
60   C CG    . ASP A 9   ? 0.4963 0.3790 0.4282 0.0287  0.0153  -0.0236 6   ASP A CG    
61   O OD1   . ASP A 9   ? 0.5348 0.4195 0.4761 0.0242  0.0133  -0.0212 6   ASP A OD1   
62   O OD2   . ASP A 9   ? 0.5553 0.4390 0.4799 0.0279  0.0121  -0.0270 6   ASP A OD2   
63   N N     . ARG A 10  ? 0.2425 0.1484 0.1896 0.0321  0.0233  -0.0099 7   ARG A N     
64   C CA    . ARG A 10  ? 0.1888 0.1024 0.1356 0.0319  0.0236  -0.0079 7   ARG A CA    
65   C C     . ARG A 10  ? 0.2251 0.1476 0.1842 0.0299  0.0241  -0.0023 7   ARG A C     
66   O O     . ARG A 10  ? 0.2145 0.1380 0.1813 0.0275  0.0224  -0.0005 7   ARG A O     
67   C CB    . ARG A 10  ? 0.2295 0.1448 0.1717 0.0277  0.0178  -0.0112 7   ARG A CB    
68   C CG    . ARG A 10  ? 0.2704 0.1778 0.2006 0.0288  0.0153  -0.0175 7   ARG A CG    
69   C CD    . ARG A 10  ? 0.2581 0.1693 0.1871 0.0242  0.0091  -0.0199 7   ARG A CD    
70   N NE    . ARG A 10  ? 0.2552 0.1676 0.1927 0.0183  0.0053  -0.0199 7   ARG A NE    
71   C CZ    . ARG A 10  ? 0.2226 0.1414 0.1645 0.0137  0.0012  -0.0195 7   ARG A CZ    
72   N NH1   . ARG A 10  ? 0.2339 0.1531 0.1834 0.0089  -0.0011 -0.0189 7   ARG A NH1   
73   N NH2   . ARG A 10  ? 0.2381 0.1629 0.1772 0.0141  -0.0001 -0.0193 7   ARG A NH2   
74   N N     . VAL A 11  ? 0.1916 0.1200 0.1521 0.0310  0.0261  0.0004  8   VAL A N     
75   C CA    . VAL A 11  ? 0.1271 0.0637 0.0980 0.0282  0.0248  0.0046  8   VAL A CA    
76   C C     . VAL A 11  ? 0.2084 0.1487 0.1755 0.0255  0.0216  0.0034  8   VAL A C     
77   O O     . VAL A 11  ? 0.2072 0.1470 0.1675 0.0280  0.0234  0.0027  8   VAL A O     
78   C CB    . VAL A 11  ? 0.2051 0.1458 0.1835 0.0314  0.0300  0.0092  8   VAL A CB    
79   C CG1   . VAL A 11  ? 0.2193 0.1676 0.2086 0.0279  0.0275  0.0126  8   VAL A CG1   
80   C CG2   . VAL A 11  ? 0.2155 0.1531 0.1983 0.0349  0.0338  0.0107  8   VAL A CG2   
81   N N     . VAL A 12  ? 0.1690 0.1126 0.1399 0.0209  0.0170  0.0032  9   VAL A N     
82   C CA    . VAL A 12  ? 0.1068 0.0540 0.0749 0.0185  0.0139  0.0021  9   VAL A CA    
83   C C     . VAL A 12  ? 0.1489 0.1020 0.1250 0.0161  0.0125  0.0052  9   VAL A C     
84   O O     . VAL A 12  ? 0.1682 0.1221 0.1502 0.0145  0.0112  0.0066  9   VAL A O     
85   C CB    . VAL A 12  ? 0.1495 0.0946 0.1139 0.0154  0.0097  -0.0014 9   VAL A CB    
86   C CG1   . VAL A 12  ? 0.1898 0.1400 0.1533 0.0129  0.0065  -0.0020 9   VAL A CG1   
87   C CG2   . VAL A 12  ? 0.1905 0.1288 0.1464 0.0175  0.0100  -0.0054 9   VAL A CG2   
88   N N     . ALA A 13  ? 0.1622 0.1188 0.1378 0.0162  0.0125  0.0061  10  ALA A N     
89   C CA    . ALA A 13  ? 0.0974 0.0585 0.0790 0.0139  0.0105  0.0080  10  ALA A CA    
90   C C     . ALA A 13  ? 0.1600 0.1233 0.1375 0.0122  0.0077  0.0063  10  ALA A C     
91   O O     . ALA A 13  ? 0.2024 0.1650 0.1737 0.0132  0.0077  0.0045  10  ALA A O     
92   C CB    . ALA A 13  ? 0.1757 0.1387 0.1627 0.0155  0.0132  0.0110  10  ALA A CB    
93   N N     . LEU A 14  ? 0.1422 0.1084 0.1233 0.0099  0.0052  0.0070  11  LEU A N     
94   C CA    . LEU A 14  ? 0.0958 0.0646 0.0743 0.0088  0.0032  0.0061  11  LEU A CA    
95   C C     . LEU A 14  ? 0.1902 0.1607 0.1726 0.0088  0.0030  0.0078  11  LEU A C     
96   O O     . LEU A 14  ? 0.1923 0.1630 0.1792 0.0079  0.0018  0.0088  11  LEU A O     
97   C CB    . LEU A 14  ? 0.1582 0.1280 0.1364 0.0063  0.0008  0.0051  11  LEU A CB    
98   C CG    . LEU A 14  ? 0.1796 0.1530 0.1563 0.0052  -0.0008 0.0045  11  LEU A CG    
99   C CD1   . LEU A 14  ? 0.2076 0.1825 0.1858 0.0050  -0.0016 0.0057  11  LEU A CD1   
100  C CD2   . LEU A 14  ? 0.1876 0.1625 0.1607 0.0068  -0.0006 0.0034  11  LEU A CD2   
101  N N     . VAL A 15  ? 0.1530 0.1243 0.1336 0.0101  0.0039  0.0081  12  VAL A N     
102  C CA    . VAL A 15  ? 0.1054 0.0771 0.0894 0.0101  0.0035  0.0092  12  VAL A CA    
103  C C     . VAL A 15  ? 0.2015 0.1750 0.1822 0.0097  0.0016  0.0080  12  VAL A C     
104  O O     . VAL A 15  ? 0.1816 0.1565 0.1581 0.0106  0.0018  0.0072  12  VAL A O     
105  C CB    . VAL A 15  ? 0.1732 0.1438 0.1582 0.0122  0.0067  0.0112  12  VAL A CB    
106  C CG1   . VAL A 15  ? 0.2065 0.1766 0.1959 0.0118  0.0062  0.0122  12  VAL A CG1   
107  C CG2   . VAL A 15  ? 0.2324 0.2017 0.2211 0.0132  0.0096  0.0129  12  VAL A CG2   
108  N N     . ASP A 16  ? 0.1742 0.1476 0.1567 0.0087  -0.0004 0.0077  13  ASP A N     
109  C CA    . ASP A 16  ? 0.1287 0.1035 0.1077 0.0088  -0.0017 0.0066  13  ASP A CA    
110  C C     . ASP A 16  ? 0.1568 0.1293 0.1373 0.0092  -0.0027 0.0064  13  ASP A C     
111  O O     . ASP A 16  ? 0.1894 0.1602 0.1727 0.0082  -0.0047 0.0062  13  ASP A O     
112  C CB    . ASP A 16  ? 0.1931 0.1688 0.1711 0.0073  -0.0033 0.0061  13  ASP A CB    
113  C CG    . ASP A 16  ? 0.3379 0.3158 0.3124 0.0076  -0.0035 0.0055  13  ASP A CG    
114  O OD1   . ASP A 16  ? 0.3852 0.3642 0.3587 0.0066  -0.0038 0.0058  13  ASP A OD1   
115  O OD2   . ASP A 16  ? 0.2479 0.2263 0.2208 0.0092  -0.0031 0.0051  13  ASP A OD2   
116  N N     . MET A 17  ? 0.1312 0.1033 0.1100 0.0109  -0.0017 0.0064  14  MET A N     
117  C CA    . MET A 17  ? 0.0879 0.0565 0.0681 0.0114  -0.0026 0.0059  14  MET A CA    
118  C C     . MET A 17  ? 0.1605 0.1280 0.1376 0.0111  -0.0053 0.0038  14  MET A C     
119  O O     . MET A 17  ? 0.1871 0.1572 0.1599 0.0116  -0.0051 0.0033  14  MET A O     
120  C CB    . MET A 17  ? 0.1701 0.1380 0.1484 0.0138  -0.0007 0.0065  14  MET A CB    
121  C CG    . MET A 17  ? 0.1894 0.1584 0.1682 0.0150  0.0021  0.0088  14  MET A CG    
122  S SD    . MET A 17  ? 0.2256 0.1919 0.2113 0.0139  0.0039  0.0111  14  MET A SD    
123  C CE    . MET A 17  ? 0.2536 0.2148 0.2440 0.0135  0.0032  0.0112  14  MET A CE    
124  N N     . ASP A 18  ? 0.1481 0.1117 0.1275 0.0103  -0.0078 0.0027  15  ASP A N     
125  C CA    . ASP A 18  ? 0.1182 0.0796 0.0925 0.0107  -0.0107 0.0004  15  ASP A CA    
126  C C     . ASP A 18  ? 0.1564 0.1158 0.1254 0.0133  -0.0097 -0.0011 15  ASP A C     
127  O O     . ASP A 18  ? 0.1625 0.1194 0.1337 0.0142  -0.0085 -0.0008 15  ASP A O     
128  C CB    . ASP A 18  ? 0.1536 0.1113 0.1319 0.0091  -0.0148 -0.0010 15  ASP A CB    
129  C CG    . ASP A 18  ? 0.1798 0.1400 0.1641 0.0071  -0.0159 0.0007  15  ASP A CG    
130  O OD1   . ASP A 18  ? 0.2169 0.1804 0.1989 0.0071  -0.0146 0.0019  15  ASP A OD1   
131  O OD2   . ASP A 18  ? 0.2436 0.2023 0.2355 0.0054  -0.0181 0.0008  15  ASP A OD2   
132  N N     . CYS A 19  ? 0.1466 0.1332 0.1361 0.0117  0.0049  0.0262  16  CYS A N     
133  C CA    . CYS A 19  ? 0.1109 0.0956 0.0968 0.0112  0.0048  0.0234  16  CYS A CA    
134  C C     . CYS A 19  ? 0.1547 0.1347 0.1377 0.0128  0.0052  0.0209  16  CYS A C     
135  O O     . CYS A 19  ? 0.1635 0.1416 0.1429 0.0116  0.0050  0.0197  16  CYS A O     
136  C CB    . CYS A 19  ? 0.1474 0.1341 0.1309 0.0082  0.0043  0.0239  16  CYS A CB    
137  S SG    . CYS A 19  ? 0.2009 0.1885 0.1832 0.0060  0.0038  0.0255  16  CYS A SG    
138  N N     . PHE A 20  ? 0.1473 0.1249 0.1315 0.0154  0.0056  0.0200  17  PHE A N     
139  C CA    . PHE A 20  ? 0.1029 0.0759 0.0845 0.0169  0.0059  0.0185  17  PHE A CA    
140  C C     . PHE A 20  ? 0.1547 0.1241 0.1318 0.0169  0.0055  0.0156  17  PHE A C     
141  O O     . PHE A 20  ? 0.1540 0.1207 0.1278 0.0163  0.0055  0.0153  17  PHE A O     
142  C CB    . PHE A 20  ? 0.1332 0.1042 0.1167 0.0197  0.0062  0.0178  17  PHE A CB    
143  C CG    . PHE A 20  ? 0.1343 0.1003 0.1149 0.0214  0.0064  0.0165  17  PHE A CG    
144  C CD1   . PHE A 20  ? 0.1802 0.1452 0.1593 0.0204  0.0069  0.0177  17  PHE A CD1   
145  C CD2   . PHE A 20  ? 0.1772 0.1395 0.1566 0.0237  0.0061  0.0141  17  PHE A CD2   
146  C CE1   . PHE A 20  ? 0.2035 0.1635 0.1793 0.0217  0.0073  0.0165  17  PHE A CE1   
147  C CE2   . PHE A 20  ? 0.1943 0.1514 0.1703 0.0252  0.0061  0.0130  17  PHE A CE2   
148  C CZ    . PHE A 20  ? 0.2180 0.1738 0.1920 0.0241  0.0068  0.0142  17  PHE A CZ    
149  N N     . PHE A 21  ? 0.1212 0.0906 0.0980 0.0176  0.0051  0.0135  18  PHE A N     
150  C CA    . PHE A 21  ? 0.0953 0.0610 0.0680 0.0181  0.0047  0.0106  18  PHE A CA    
151  C C     . PHE A 21  ? 0.1399 0.1059 0.1094 0.0155  0.0045  0.0110  18  PHE A C     
152  O O     . PHE A 21  ? 0.1619 0.1236 0.1271 0.0156  0.0041  0.0094  18  PHE A O     
153  C CB    . PHE A 21  ? 0.1427 0.1090 0.1161 0.0194  0.0044  0.0080  18  PHE A CB    
154  C CG    . PHE A 21  ? 0.1725 0.1375 0.1480 0.0222  0.0043  0.0068  18  PHE A CG    
155  C CD1   . PHE A 21  ? 0.1819 0.1459 0.1591 0.0233  0.0045  0.0084  18  PHE A CD1   
156  C CD2   . PHE A 21  ? 0.1760 0.1409 0.1520 0.0236  0.0039  0.0040  18  PHE A CD2   
157  C CE1   . PHE A 21  ? 0.1942 0.1567 0.1731 0.0257  0.0043  0.0072  18  PHE A CE1   
158  C CE2   . PHE A 21  ? 0.1897 0.1536 0.1678 0.0261  0.0036  0.0027  18  PHE A CE2   
159  C CZ    . PHE A 21  ? 0.1921 0.1546 0.1715 0.0271  0.0038  0.0044  18  PHE A CZ    
160  N N     . VAL A 22  ? 0.1346 0.1052 0.1059 0.0131  0.0046  0.0131  19  VAL A N     
161  C CA    . VAL A 22  ? 0.1010 0.0722 0.0695 0.0102  0.0043  0.0137  19  VAL A CA    
162  C C     . VAL A 22  ? 0.1407 0.1097 0.1075 0.0095  0.0044  0.0149  19  VAL A C     
163  O O     . VAL A 22  ? 0.1659 0.1318 0.1284 0.0083  0.0041  0.0138  19  VAL A O     
164  C CB    . VAL A 22  ? 0.1344 0.1110 0.1053 0.0079  0.0042  0.0160  19  VAL A CB    
165  C CG1   . VAL A 22  ? 0.1837 0.1614 0.1523 0.0048  0.0038  0.0173  19  VAL A CG1   
166  C CG2   . VAL A 22  ? 0.2089 0.1872 0.1799 0.0078  0.0044  0.0144  19  VAL A CG2   
167  N N     . GLN A 23  ? 0.1297 0.1002 0.0997 0.0100  0.0048  0.0170  20  GLN A N     
168  C CA    . GLN A 23  ? 0.0897 0.0584 0.0583 0.0092  0.0051  0.0180  20  GLN A CA    
169  C C     . GLN A 23  ? 0.1400 0.1022 0.1040 0.0106  0.0052  0.0158  20  GLN A C     
170  O O     . GLN A 23  ? 0.1691 0.1286 0.1296 0.0090  0.0053  0.0158  20  GLN A O     
171  C CB    . GLN A 23  ? 0.1359 0.1072 0.1089 0.0099  0.0058  0.0203  20  GLN A CB    
172  C CG    . GLN A 23  ? 0.1689 0.1464 0.1462 0.0084  0.0056  0.0231  20  GLN A CG    
173  C CD    . GLN A 23  ? 0.2081 0.1876 0.1891 0.0090  0.0063  0.0251  20  GLN A CD    
174  O OE1   . GLN A 23  ? 0.1991 0.1789 0.1795 0.0075  0.0067  0.0260  20  GLN A OE1   
175  N NE2   . GLN A 23  ? 0.2179 0.1985 0.2026 0.0113  0.0066  0.0258  20  GLN A NE2   
176  N N     . VAL A 24  ? 0.1387 0.0980 0.1025 0.0135  0.0051  0.0139  21  VAL A N     
177  C CA    . VAL A 24  ? 0.0972 0.0497 0.0562 0.0151  0.0048  0.0116  21  VAL A CA    
178  C C     . VAL A 24  ? 0.1535 0.1032 0.1077 0.0137  0.0041  0.0098  21  VAL A C     
179  O O     . VAL A 24  ? 0.1888 0.1335 0.1382 0.0130  0.0039  0.0093  21  VAL A O     
180  C CB    . VAL A 24  ? 0.1574 0.1079 0.1174 0.0185  0.0045  0.0097  21  VAL A CB    
181  C CG1   . VAL A 24  ? 0.1633 0.1066 0.1180 0.0202  0.0038  0.0073  21  VAL A CG1   
182  C CG2   . VAL A 24  ? 0.1668 0.1192 0.1309 0.0198  0.0052  0.0113  21  VAL A CG2   
183  N N     . GLU A 25  ? 0.1466 0.0992 0.1016 0.0131  0.0037  0.0090  22  GLU A N     
184  C CA    . GLU A 25  ? 0.1134 0.0634 0.0638 0.0119  0.0031  0.0071  22  GLU A CA    
185  C C     . GLU A 25  ? 0.1580 0.1087 0.1064 0.0084  0.0031  0.0088  22  GLU A C     
186  O O     . GLU A 25  ? 0.1794 0.1256 0.1225 0.0073  0.0027  0.0076  22  GLU A O     
187  C CB    . GLU A 25  ? 0.1583 0.1114 0.1103 0.0123  0.0029  0.0055  22  GLU A CB    
188  C CG    . GLU A 25  ? 0.1770 0.1293 0.1309 0.0158  0.0027  0.0033  22  GLU A CG    
189  C CD    . GLU A 25  ? 0.2248 0.1703 0.1743 0.0182  0.0018  0.0005  22  GLU A CD    
190  O OE1   . GLU A 25  ? 0.2453 0.1868 0.1898 0.0172  0.0014  -0.0005 22  GLU A OE1   
191  O OE2   . GLU A 25  ? 0.2465 0.1906 0.1974 0.0211  0.0015  -0.0009 22  GLU A OE2   
192  N N     . GLN A 26  ? 0.1512 0.1075 0.1035 0.0065  0.0036  0.0117  23  GLN A N     
193  C CA    . GLN A 26  ? 0.1221 0.0797 0.0729 0.0029  0.0035  0.0134  23  GLN A CA    
194  C C     . GLN A 26  ? 0.1788 0.1325 0.1271 0.0023  0.0039  0.0140  23  GLN A C     
195  O O     . GLN A 26  ? 0.1828 0.1347 0.1275 -0.0004 0.0037  0.0141  23  GLN A O     
196  C CB    . GLN A 26  ? 0.1573 0.1220 0.1134 0.0014  0.0036  0.0163  23  GLN A CB    
197  C CG    . GLN A 26  ? 0.1746 0.1431 0.1321 0.0008  0.0032  0.0162  23  GLN A CG    
198  C CD    . GLN A 26  ? 0.2206 0.1956 0.1831 -0.0004 0.0031  0.0192  23  GLN A CD    
199  O OE1   . GLN A 26  ? 0.2073 0.1840 0.1737 0.0009  0.0035  0.0208  23  GLN A OE1   
200  N NE2   . GLN A 26  ? 0.2171 0.1953 0.1792 -0.0028 0.0024  0.0199  23  GLN A NE2   
201  N N     . ARG A 27  ? 0.1648 0.1171 0.1147 0.0045  0.0046  0.0143  24  ARG A N     
202  C CA    . ARG A 27  ? 0.1299 0.0779 0.0767 0.0039  0.0052  0.0145  24  ARG A CA    
203  C C     . ARG A 27  ? 0.2114 0.1516 0.1510 0.0041  0.0045  0.0121  24  ARG A C     
204  O O     . ARG A 27  ? 0.2047 0.1418 0.1402 0.0017  0.0046  0.0123  24  ARG A O     
205  C CB    . ARG A 27  ? 0.1656 0.1129 0.1147 0.0066  0.0061  0.0150  24  ARG A CB    
206  C CG    . ARG A 27  ? 0.1786 0.1213 0.1242 0.0057  0.0070  0.0153  24  ARG A CG    
207  C CD    . ARG A 27  ? 0.2053 0.1477 0.1533 0.0082  0.0080  0.0158  24  ARG A CD    
208  N NE    . ARG A 27  ? 0.1918 0.1294 0.1378 0.0116  0.0073  0.0137  24  ARG A NE    
209  C CZ    . ARG A 27  ? 0.1770 0.1124 0.1234 0.0140  0.0079  0.0135  24  ARG A CZ    
210  N NH1   . ARG A 27  ? 0.1870 0.1246 0.1357 0.0133  0.0094  0.0153  24  ARG A NH1   
211  N NH2   . ARG A 27  ? 0.1991 0.1303 0.1436 0.0170  0.0069  0.0115  24  ARG A NH2   
212  N N     . GLN A 28  ? 0.1698 0.1073 0.1082 0.0069  0.0037  0.0097  25  GLN A N     
213  C CA    . GLN A 28  ? 0.1424 0.0721 0.0741 0.0078  0.0028  0.0071  25  GLN A CA    
214  C C     . GLN A 28  ? 0.1885 0.1173 0.1166 0.0051  0.0022  0.0063  25  GLN A C     
215  O O     . GLN A 28  ? 0.2197 0.1419 0.1416 0.0043  0.0017  0.0053  25  GLN A O     
216  C CB    . GLN A 28  ? 0.1923 0.1202 0.1246 0.0117  0.0020  0.0046  25  GLN A CB    
217  C CG    . GLN A 28  ? 0.2409 0.1607 0.1668 0.0134  0.0008  0.0018  25  GLN A CG    
218  C CD    . GLN A 28  ? 0.3006 0.2201 0.2281 0.0172  0.0000  -0.0007 25  GLN A CD    
219  O OE1   . GLN A 28  ? 0.3213 0.2429 0.2527 0.0193  0.0002  -0.0004 25  GLN A OE1   
220  N NE2   . GLN A 28  ? 0.4026 0.3196 0.3274 0.0181  -0.0010 -0.0034 25  GLN A NE2   
221  N N     . ASN A 29  ? 0.1680 0.1028 0.0995 0.0039  0.0021  0.0069  26  ASN A N     
222  C CA    . ASN A 29  ? 0.1578 0.0923 0.0861 0.0015  0.0015  0.0060  26  ASN A CA    
223  C C     . ASN A 29  ? 0.1852 0.1260 0.1163 -0.0022 0.0019  0.0087  26  ASN A C     
224  O O     . ASN A 29  ? 0.1854 0.1325 0.1211 -0.0024 0.0020  0.0097  26  ASN A O     
225  C CB    . ASN A 29  ? 0.1934 0.1288 0.1221 0.0034  0.0011  0.0036  26  ASN A CB    
226  C CG    . ASN A 29  ? 0.2361 0.1705 0.1608 0.0011  0.0006  0.0024  26  ASN A CG    
227  O OD1   . ASN A 29  ? 0.2531 0.1865 0.1750 -0.0022 0.0004  0.0036  26  ASN A OD1   
228  N ND2   . ASN A 29  ? 0.3046 0.2395 0.2292 0.0027  0.0003  0.0000  26  ASN A ND2   
229  N N     . PRO A 30  ? 0.1973 0.1365 0.1258 -0.0052 0.0020  0.0100  27  PRO A N     
230  C CA    . PRO A 30  ? 0.1801 0.1258 0.1119 -0.0087 0.0021  0.0126  27  PRO A CA    
231  C C     . PRO A 30  ? 0.2168 0.1660 0.1485 -0.0105 0.0013  0.0124  27  PRO A C     
232  O O     . PRO A 30  ? 0.2214 0.1769 0.1570 -0.0126 0.0012  0.0146  27  PRO A O     
233  C CB    . PRO A 30  ? 0.2592 0.2012 0.1869 -0.0117 0.0022  0.0132  27  PRO A CB    
234  C CG    . PRO A 30  ? 0.2566 0.1915 0.1809 -0.0092 0.0026  0.0119  27  PRO A CG    
235  C CD    . PRO A 30  ? 0.2385 0.1702 0.1614 -0.0056 0.0020  0.0092  27  PRO A CD    
236  N N     . HIS A 31  ? 0.2128 0.1578 0.1401 -0.0097 0.0008  0.0097  28  HIS A N     
237  C CA    . HIS A 31  ? 0.2314 0.1793 0.1581 -0.0113 0.0002  0.0091  28  HIS A CA    
238  C C     . HIS A 31  ? 0.2499 0.2047 0.1825 -0.0102 0.0005  0.0103  28  HIS A C     
239  O O     . HIS A 31  ? 0.2738 0.2325 0.2068 -0.0122 0.0001  0.0108  28  HIS A O     
240  C CB    . HIS A 31  ? 0.2750 0.2171 0.1962 -0.0100 -0.0002 0.0056  28  HIS A CB    
241  C CG    . HIS A 31  ? 0.3725 0.3081 0.2870 -0.0121 -0.0007 0.0045  28  HIS A CG    
242  N ND1   . HIS A 31  ? 0.4354 0.3630 0.3446 -0.0100 -0.0011 0.0017  28  HIS A ND1   
243  C CD2   . HIS A 31  ? 0.3251 0.2608 0.2371 -0.0162 -0.0012 0.0058  28  HIS A CD2   
244  C CE1   . HIS A 31  ? 0.4150 0.3376 0.3184 -0.0128 -0.0016 0.0014  28  HIS A CE1   
245  N NE2   . HIS A 31  ? 0.3862 0.3137 0.2912 -0.0167 -0.0017 0.0038  28  HIS A NE2   
246  N N     . LEU A 32  ? 0.2227 0.1786 0.1594 -0.0071 0.0011  0.0106  29  LEU A N     
247  C CA    . LEU A 32  ? 0.1599 0.1216 0.1020 -0.0059 0.0014  0.0116  29  LEU A CA    
248  C C     . LEU A 32  ? 0.1828 0.1502 0.1300 -0.0072 0.0015  0.0152  29  LEU A C     
249  O O     . LEU A 32  ? 0.1871 0.1594 0.1385 -0.0069 0.0015  0.0165  29  LEU A O     
250  C CB    . LEU A 32  ? 0.1864 0.1462 0.1303 -0.0019 0.0020  0.0100  29  LEU A CB    
251  C CG    . LEU A 32  ? 0.2366 0.1915 0.1766 0.0002  0.0018  0.0063  29  LEU A CG    
252  C CD1   . LEU A 32  ? 0.2229 0.1766 0.1655 0.0041  0.0021  0.0051  29  LEU A CD1   
253  C CD2   . LEU A 32  ? 0.2786 0.2359 0.2176 -0.0010 0.0018  0.0051  29  LEU A CD2   
254  N N     . ARG A 33  ? 0.1893 0.1561 0.1362 -0.0087 0.0015  0.0166  30  ARG A N     
255  C CA    . ARG A 33  ? 0.1692 0.1415 0.1214 -0.0096 0.0016  0.0197  30  ARG A CA    
256  C C     . ARG A 33  ? 0.1977 0.1756 0.1516 -0.0124 0.0006  0.0217  30  ARG A C     
257  O O     . ARG A 33  ? 0.2343 0.2114 0.1843 -0.0150 -0.0001 0.0210  30  ARG A O     
258  C CB    . ARG A 33  ? 0.1848 0.1553 0.1361 -0.0109 0.0020  0.0205  30  ARG A CB    
259  C CG    . ARG A 33  ? 0.1882 0.1532 0.1380 -0.0081 0.0029  0.0191  30  ARG A CG    
260  C CD    . ARG A 33  ? 0.2247 0.1872 0.1726 -0.0097 0.0035  0.0197  30  ARG A CD    
261  N NE    . ARG A 33  ? 0.2223 0.1787 0.1675 -0.0071 0.0043  0.0181  30  ARG A NE    
262  C CZ    . ARG A 33  ? 0.2611 0.2143 0.2043 -0.0079 0.0051  0.0185  30  ARG A CZ    
263  N NH1   . ARG A 33  ? 0.2772 0.2336 0.2215 -0.0113 0.0054  0.0202  30  ARG A NH1   
264  N NH2   . ARG A 33  ? 0.2346 0.1818 0.1749 -0.0055 0.0056  0.0170  30  ARG A NH2   
265  N N     . ASN A 34  ? 0.2262 0.2095 0.1856 -0.0117 0.0005  0.0240  31  ASN A N     
266  C CA    . ASN A 34  ? 0.2322 0.2209 0.1935 -0.0141 -0.0007 0.0262  31  ASN A CA    
267  C C     . ASN A 34  ? 0.2964 0.2845 0.2540 -0.0154 -0.0012 0.0248  31  ASN A C     
268  O O     . ASN A 34  ? 0.3357 0.3259 0.2916 -0.0184 -0.0023 0.0257  31  ASN A O     
269  C CB    . ASN A 34  ? 0.3085 0.2992 0.2698 -0.0173 -0.0014 0.0277  31  ASN A CB    
270  C CG    . ASN A 34  ? 0.3465 0.3383 0.3117 -0.0162 -0.0006 0.0289  31  ASN A CG    
271  O OD1   . ASN A 34  ? 0.4461 0.4415 0.4166 -0.0143 -0.0003 0.0306  31  ASN A OD1   
272  N ND2   . ASN A 34  ? 0.3875 0.3760 0.3498 -0.0175 0.0000  0.0280  31  ASN A ND2   
273  N N     . LYS A 35  ? 0.2209 0.2064 0.1774 -0.0130 -0.0004 0.0227  32  LYS A N     
274  C CA    . LYS A 35  ? 0.2080 0.1929 0.1611 -0.0139 -0.0005 0.0210  32  LYS A CA    
275  C C     . LYS A 35  ? 0.2092 0.1961 0.1654 -0.0117 0.0001  0.0210  32  LYS A C     
276  O O     . LYS A 35  ? 0.2152 0.2019 0.1748 -0.0090 0.0007  0.0212  32  LYS A O     
277  C CB    . LYS A 35  ? 0.2582 0.2373 0.2061 -0.0131 0.0000  0.0174  32  LYS A CB    
278  C CG    A LYS A 35  ? 0.2884 0.2640 0.2324 -0.0151 -0.0005 0.0170  32  LYS A CG    
279  C CG    B LYS A 35  ? 0.3054 0.2814 0.2488 -0.0157 -0.0006 0.0170  32  LYS A CG    
280  C CD    A LYS A 35  ? 0.3631 0.3407 0.3044 -0.0190 -0.0016 0.0179  32  LYS A CD    
281  C CD    B LYS A 35  ? 0.3483 0.3250 0.2877 -0.0187 -0.0014 0.0165  32  LYS A CD    
282  C CE    A LYS A 35  ? 0.3997 0.3745 0.3378 -0.0215 -0.0021 0.0180  32  LYS A CE    
283  C CE    B LYS A 35  ? 0.3989 0.3721 0.3336 -0.0214 -0.0021 0.0159  32  LYS A CE    
284  N NZ    A LYS A 35  ? 0.5039 0.4715 0.4369 -0.0203 -0.0016 0.0149  32  LYS A NZ    
285  N NZ    B LYS A 35  ? 0.4011 0.3747 0.3316 -0.0245 -0.0029 0.0153  32  LYS A NZ    
286  N N     . PRO A 36  ? 0.1911 0.1797 0.1458 -0.0129 0.0000  0.0206  33  PRO A N     
287  C CA    . PRO A 36  ? 0.1540 0.1435 0.1106 -0.0110 0.0009  0.0198  33  PRO A CA    
288  C C     . PRO A 36  ? 0.1848 0.1701 0.1398 -0.0084 0.0020  0.0162  33  PRO A C     
289  O O     . PRO A 36  ? 0.2102 0.1927 0.1608 -0.0090 0.0021  0.0136  33  PRO A O     
290  C CB    . PRO A 36  ? 0.1753 0.1669 0.1292 -0.0136 0.0007  0.0199  33  PRO A CB    
291  C CG    . PRO A 36  ? 0.2705 0.2604 0.2196 -0.0162 0.0000  0.0191  33  PRO A CG    
292  C CD    . PRO A 36  ? 0.2527 0.2420 0.2032 -0.0163 -0.0008 0.0206  33  PRO A CD    
293  N N     A CYS A 37  ? 0.1810 0.1658 0.1394 -0.0055 0.0026  0.0159  34  CYS A N     
294  N N     B CYS A 37  ? 0.1793 0.1641 0.1378 -0.0055 0.0026  0.0160  34  CYS A N     
295  C CA    A CYS A 37  ? 0.1311 0.1121 0.0882 -0.0029 0.0032  0.0125  34  CYS A CA    
296  C CA    B CYS A 37  ? 0.1691 0.1497 0.1266 -0.0026 0.0032  0.0129  34  CYS A CA    
297  C C     A CYS A 37  ? 0.1807 0.1628 0.1420 -0.0002 0.0039  0.0124  34  CYS A C     
298  C C     B CYS A 37  ? 0.1821 0.1640 0.1436 0.0000  0.0039  0.0124  34  CYS A C     
299  O O     A CYS A 37  ? 0.1967 0.1818 0.1618 -0.0003 0.0038  0.0150  34  CYS A O     
300  O O     B CYS A 37  ? 0.2015 0.1864 0.1668 0.0000  0.0038  0.0150  34  CYS A O     
301  C CB    A CYS A 37  ? 0.1872 0.1635 0.1419 -0.0021 0.0029  0.0117  34  CYS A CB    
302  C CB    B CYS A 37  ? 0.2672 0.2445 0.2240 -0.0019 0.0028  0.0134  34  CYS A CB    
303  S SG    A CYS A 37  ? 0.1668 0.1435 0.1252 -0.0012 0.0027  0.0146  34  CYS A SG    
304  S SG    B CYS A 37  ? 0.2673 0.2385 0.2221 0.0016  0.0031  0.0101  34  CYS A SG    
305  N N     . ALA A 38  ? 0.1598 0.1394 0.1205 0.0022  0.0044  0.0092  35  ALA A N     
306  C CA    . ALA A 38  ? 0.1158 0.0963 0.0803 0.0046  0.0050  0.0085  35  ALA A CA    
307  C C     . ALA A 38  ? 0.1474 0.1238 0.1108 0.0076  0.0049  0.0053  35  ALA A C     
308  O O     . ALA A 38  ? 0.1713 0.1443 0.1307 0.0077  0.0046  0.0032  35  ALA A O     
309  C CB    . ALA A 38  ? 0.1825 0.1668 0.1482 0.0037  0.0058  0.0078  35  ALA A CB    
310  N N     . VAL A 39  ? 0.1563 0.1324 0.1229 0.0101  0.0051  0.0050  36  VAL A N     
311  C CA    . VAL A 39  ? 0.1350 0.1075 0.1011 0.0133  0.0048  0.0019  36  VAL A CA    
312  C C     . VAL A 39  ? 0.1933 0.1684 0.1618 0.0144  0.0054  -0.0005 36  VAL A C     
313  O O     . VAL A 39  ? 0.1859 0.1648 0.1580 0.0137  0.0060  0.0009  36  VAL A O     
314  C CB    . VAL A 39  ? 0.1552 0.1255 0.1230 0.0153  0.0045  0.0031  36  VAL A CB    
315  C CG1   . VAL A 39  ? 0.1807 0.1473 0.1481 0.0187  0.0040  0.0000  36  VAL A CG1   
316  C CG2   . VAL A 39  ? 0.1905 0.1581 0.1557 0.0141  0.0041  0.0051  36  VAL A CG2   
317  N N     . VAL A 40  ? 0.1880 0.1609 0.1545 0.0161  0.0052  -0.0041 37  VAL A N     
318  C CA    . VAL A 40  ? 0.1730 0.1490 0.1419 0.0170  0.0059  -0.0068 37  VAL A CA    
319  C C     . VAL A 40  ? 0.2166 0.1897 0.1863 0.0207  0.0051  -0.0100 37  VAL A C     
320  O O     . VAL A 40  ? 0.2348 0.2028 0.2015 0.0224  0.0040  -0.0106 37  VAL A O     
321  C CB    . VAL A 40  ? 0.2206 0.1976 0.1865 0.0154  0.0065  -0.0088 37  VAL A CB    
322  C CG1   A VAL A 40  ? 0.2229 0.2036 0.1884 0.0116  0.0073  -0.0060 37  VAL A CG1   
323  C CG1   B VAL A 40  ? 0.1907 0.1624 0.1523 0.0171  0.0056  -0.0115 37  VAL A CG1   
324  C CG2   A VAL A 40  ? 0.2196 0.1912 0.1805 0.0162  0.0056  -0.0104 37  VAL A CG2   
325  C CG2   B VAL A 40  ? 0.1806 0.1621 0.1494 0.0154  0.0077  -0.0110 37  VAL A CG2   
326  N N     A GLN A 41  ? 0.2075 0.1839 0.1810 0.0220  0.0056  -0.0118 38  GLN A N     
327  N N     B GLN A 41  ? 0.1763 0.1529 0.1498 0.0218  0.0057  -0.0119 38  GLN A N     
328  C CA    A GLN A 41  ? 0.1670 0.1410 0.1413 0.0256  0.0046  -0.0151 38  GLN A CA    
329  C CA    B GLN A 41  ? 0.1780 0.1531 0.1529 0.0254  0.0048  -0.0153 38  GLN A CA    
330  C C     A GLN A 41  ? 0.1985 0.1753 0.1736 0.0262  0.0052  -0.0189 38  GLN A C     
331  C C     B GLN A 41  ? 0.2134 0.1918 0.1895 0.0257  0.0057  -0.0189 38  GLN A C     
332  O O     A GLN A 41  ? 0.2087 0.1908 0.1862 0.0242  0.0067  -0.0190 38  GLN A O     
333  O O     B GLN A 41  ? 0.1856 0.1693 0.1643 0.0236  0.0071  -0.0186 38  GLN A O     
334  C CB    A GLN A 41  ? 0.2456 0.2204 0.2241 0.0272  0.0042  -0.0146 38  GLN A CB    
335  C CB    B GLN A 41  ? 0.2455 0.2222 0.2250 0.0266  0.0047  -0.0146 38  GLN A CB    
336  C CG    A GLN A 41  ? 0.2411 0.2216 0.2239 0.0252  0.0055  -0.0132 38  GLN A CG    
337  C CG    B GLN A 41  ? 0.2828 0.2559 0.2616 0.0271  0.0039  -0.0117 38  GLN A CG    
338  C CD    A GLN A 41  ? 0.2924 0.2725 0.2783 0.0265  0.0050  -0.0119 38  GLN A CD    
339  C CD    B GLN A 41  ? 0.2670 0.2415 0.2500 0.0283  0.0037  -0.0114 38  GLN A CD    
340  O OE1   A GLN A 41  ? 0.2879 0.2635 0.2725 0.0285  0.0038  -0.0117 38  GLN A OE1   
341  O OE1   B GLN A 41  ? 0.2471 0.2178 0.2297 0.0305  0.0026  -0.0114 38  GLN A OE1   
342  N NE2   A GLN A 41  ? 0.2902 0.2746 0.2800 0.0251  0.0060  -0.0111 38  GLN A NE2   
343  N NE2   B GLN A 41  ? 0.2777 0.2574 0.2647 0.0269  0.0048  -0.0112 38  GLN A NE2   
344  N N     A TYR A 42  ? 0.1840 0.1570 0.1569 0.0291  0.0041  -0.0220 39  TYR A N     
345  N N     B TYR A 42  ? 0.1724 0.1477 0.1464 0.0283  0.0047  -0.0223 39  TYR A N     
346  C CA    A TYR A 42  ? 0.1554 0.1302 0.1284 0.0301  0.0045  -0.0260 39  TYR A CA    
347  C CA    B TYR A 42  ? 0.1643 0.1427 0.1400 0.0296  0.0053  -0.0264 39  TYR A CA    
348  C C     A TYR A 42  ? 0.2401 0.2163 0.2100 0.0269  0.0059  -0.0254 39  TYR A C     
349  C C     B TYR A 42  ? 0.2597 0.2407 0.2333 0.0269  0.0069  -0.0270 39  TYR A C     
350  O O     A TYR A 42  ? 0.2000 0.1761 0.1681 0.0240  0.0063  -0.0219 39  TYR A O     
351  O O     B TYR A 42  ? 0.3168 0.3033 0.2928 0.0245  0.0087  -0.0265 39  TYR A O     
352  C CB    A TYR A 42  ? 0.1839 0.1647 0.1630 0.0309  0.0053  -0.0281 39  TYR A CB    
353  C CB    B TYR A 42  ? 0.2071 0.1909 0.1890 0.0302  0.0060  -0.0275 39  TYR A CB    
354  C CG    A TYR A 42  ? 0.1962 0.1759 0.1784 0.0336  0.0039  -0.0283 39  TYR A CG    
355  C CG    B TYR A 42  ? 0.2000 0.1814 0.1841 0.0333  0.0042  -0.0278 39  TYR A CG    
356  C CD1   A TYR A 42  ? 0.2437 0.2187 0.2247 0.0375  0.0019  -0.0307 39  TYR A CD1   
357  C CD1   B TYR A 42  ? 0.2429 0.2191 0.2248 0.0369  0.0022  -0.0301 39  TYR A CD1   
358  C CD2   A TYR A 42  ? 0.2159 0.1989 0.2021 0.0324  0.0045  -0.0260 39  TYR A CD2   
359  C CD2   B TYR A 42  ? 0.2108 0.1947 0.1988 0.0325  0.0045  -0.0258 39  TYR A CD2   
360  C CE1   A TYR A 42  ? 0.2454 0.2191 0.2288 0.0399  0.0004  -0.0308 39  TYR A CE1   
361  C CE1   B TYR A 42  ? 0.2390 0.2127 0.2224 0.0396  0.0005  -0.0304 39  TYR A CE1   
362  C CE2   A TYR A 42  ? 0.2277 0.2093 0.2165 0.0347  0.0032  -0.0263 39  TYR A CE2   
363  C CE2   B TYR A 42  ? 0.2030 0.1846 0.1927 0.0352  0.0029  -0.0262 39  TYR A CE2   
364  C CZ    A TYR A 42  ? 0.2276 0.2047 0.2149 0.0384  0.0011  -0.0287 39  TYR A CZ    
365  C CZ    B TYR A 42  ? 0.2460 0.2226 0.2334 0.0387  0.0009  -0.0285 39  TYR A CZ    
366  O OH    A TYR A 42  ? 0.2233 0.1991 0.2129 0.0407  -0.0003 -0.0290 39  TYR A OH    
367  O OH    B TYR A 42  ? 0.2269 0.2008 0.2154 0.0413  -0.0008 -0.0289 39  TYR A OH    
368  N N     A LYS A 43  ? 0.3281 0.3055 0.2972 0.0276  0.0065  -0.0289 40  LYS A N     
369  N N     B LYS A 43  ? 0.3122 0.2887 0.2808 0.0275  0.0063  -0.0283 40  LYS A N     
370  C CA    A LYS A 43  ? 0.3344 0.3122 0.2996 0.0247  0.0076  -0.0287 40  LYS A CA    
371  C CA    B LYS A 43  ? 0.3377 0.3153 0.3029 0.0247  0.0076  -0.0285 40  LYS A CA    
372  C C     A LYS A 43  ? 0.3597 0.3424 0.3268 0.0246  0.0093  -0.0321 40  LYS A C     
373  C C     B LYS A 43  ? 0.3501 0.3331 0.3176 0.0246  0.0094  -0.0319 40  LYS A C     
374  O O     A LYS A 43  ? 0.3104 0.2957 0.2758 0.0215  0.0109  -0.0316 40  LYS A O     
375  O O     B LYS A 43  ? 0.3307 0.3168 0.2970 0.0213  0.0110  -0.0312 40  LYS A O     
376  C CB    . LYS A 43  ? 0.4891 0.4598 0.4482 0.0255  0.0062  -0.0293 40  LYS A CB    
377  C CG    . LYS A 43  ? 0.5732 0.5432 0.5276 0.0218  0.0069  -0.0273 40  LYS A CG    
378  C CD    . LYS A 43  ? 0.5729 0.5425 0.5270 0.0191  0.0066  -0.0224 40  LYS A CD    
379  C CE    . LYS A 43  ? 0.5978 0.5669 0.5475 0.0153  0.0069  -0.0204 40  LYS A CE    
380  N NZ    . LYS A 43  ? 0.6403 0.6151 0.5910 0.0127  0.0087  -0.0206 40  LYS A NZ    
381  N N     . SER A 44  ? 0.3373 0.3214 0.3079 0.0280  0.0090  -0.0358 41  SER A N     
382  C CA    . SER A 44  ? 0.4200 0.4090 0.3929 0.0284  0.0107  -0.0397 41  SER A CA    
383  C C     . SER A 44  ? 0.4392 0.4354 0.4153 0.0248  0.0133  -0.0386 41  SER A C     
384  O O     . SER A 44  ? 0.4587 0.4577 0.4333 0.0229  0.0151  -0.0401 41  SER A O     
385  C CB    . SER A 44  ? 0.7205 0.7103 0.6976 0.0329  0.0097  -0.0437 41  SER A CB    
386  O OG    . SER A 44  ? 0.7918 0.7745 0.7654 0.0363  0.0073  -0.0449 41  SER A OG    
387  N N     . TRP A 45  ? 0.3505 0.3494 0.3305 0.0238  0.0133  -0.0361 42  TRP A N     
388  C CA    . TRP A 45  ? 0.4285 0.4336 0.4113 0.0204  0.0156  -0.0349 42  TRP A CA    
389  C C     . TRP A 45  ? 0.3466 0.3507 0.3257 0.0164  0.0160  -0.0303 42  TRP A C     
390  O O     . TRP A 45  ? 0.3077 0.3094 0.2867 0.0160  0.0147  -0.0267 42  TRP A O     
391  C CB    . TRP A 45  ? 0.4228 0.4311 0.4116 0.0213  0.0154  -0.0346 42  TRP A CB    
392  C CG    . TRP A 45  ? 0.4171 0.4318 0.4091 0.0179  0.0178  -0.0338 42  TRP A CG    
393  C CD1   . TRP A 45  ? 0.4052 0.4207 0.3970 0.0146  0.0183  -0.0295 42  TRP A CD1   
394  C CD2   . TRP A 45  ? 0.4303 0.4511 0.4258 0.0175  0.0199  -0.0374 42  TRP A CD2   
395  N NE1   . TRP A 45  ? 0.4296 0.4508 0.4242 0.0120  0.0206  -0.0301 42  TRP A NE1   
396  C CE2   . TRP A 45  ? 0.4200 0.4448 0.4170 0.0135  0.0217  -0.0349 42  TRP A CE2   
397  C CE3   . TRP A 45  ? 0.4991 0.5226 0.4969 0.0200  0.0205  -0.0425 42  TRP A CE3   
398  C CZ2   . TRP A 45  ? 0.4675 0.4988 0.4679 0.0118  0.0243  -0.0373 42  TRP A CZ2   
399  C CZ3   . TRP A 45  ? 0.5164 0.5469 0.5181 0.0185  0.0231  -0.0450 42  TRP A CZ3   
400  C CH2   . TRP A 45  ? 0.4823 0.5167 0.4852 0.0142  0.0250  -0.0424 42  TRP A CH2   
401  N N     . LYS A 46  ? 0.3345 0.3402 0.3104 0.0137  0.0176  -0.0307 43  LYS A N     
402  C CA    . LYS A 46  ? 0.2980 0.3037 0.2705 0.0095  0.0180  -0.0266 43  LYS A CA    
403  C C     . LYS A 46  ? 0.2826 0.2828 0.2515 0.0095  0.0159  -0.0233 43  LYS A C     
404  O O     . LYS A 46  ? 0.2676 0.2678 0.2356 0.0068  0.0157  -0.0192 43  LYS A O     
405  C CB    . LYS A 46  ? 0.3517 0.3616 0.3277 0.0071  0.0191  -0.0240 43  LYS A CB    
406  C CG    . LYS A 46  ? 0.3861 0.4019 0.3647 0.0058  0.0216  -0.0267 43  LYS A CG    
407  C CD    . LYS A 46  ? 0.4736 0.4928 0.4549 0.0030  0.0226  -0.0238 43  LYS A CD    
408  C CE    . LYS A 46  ? 0.5873 0.6124 0.5709 0.0012  0.0254  -0.0265 43  LYS A CE    
409  N NZ    . LYS A 46  ? 0.6360 0.6639 0.6216 -0.0018 0.0264  -0.0236 43  LYS A NZ    
410  N N     . GLY A 47  ? 0.2589 0.2544 0.2258 0.0124  0.0145  -0.0252 44  GLY A N     
411  C CA    . GLY A 47  ? 0.2508 0.2409 0.2137 0.0122  0.0127  -0.0227 44  GLY A CA    
412  C C     . GLY A 47  ? 0.2212 0.2089 0.1864 0.0139  0.0111  -0.0204 44  GLY A C     
413  O O     . GLY A 47  ? 0.2712 0.2546 0.2336 0.0139  0.0098  -0.0184 44  GLY A O     
414  N N     . GLY A 48  ? 0.2421 0.2328 0.2125 0.0153  0.0114  -0.0208 45  GLY A N     
415  C CA    . GLY A 48  ? 0.2490 0.2377 0.2218 0.0170  0.0101  -0.0188 45  GLY A CA    
416  C C     . GLY A 48  ? 0.2427 0.2344 0.2179 0.0145  0.0107  -0.0149 45  GLY A C     
417  O O     . GLY A 48  ? 0.2438 0.2376 0.2175 0.0112  0.0115  -0.0128 45  GLY A O     
418  N N     . GLY A 49  ? 0.1878 0.1791 0.1664 0.0161  0.0100  -0.0139 46  GLY A N     
419  C CA    . GLY A 49  ? 0.1520 0.1456 0.1331 0.0142  0.0104  -0.0103 46  GLY A CA    
420  C C     . GLY A 49  ? 0.1790 0.1692 0.1583 0.0139  0.0092  -0.0067 46  GLY A C     
421  O O     . GLY A 49  ? 0.1909 0.1771 0.1694 0.0163  0.0080  -0.0071 46  GLY A O     
422  N N     . ILE A 50  ? 0.1706 0.1624 0.1492 0.0109  0.0095  -0.0033 47  ILE A N     
423  C CA    . ILE A 50  ? 0.1337 0.1232 0.1112 0.0105  0.0085  0.0001  47  ILE A CA    
424  C C     . ILE A 50  ? 0.1725 0.1615 0.1535 0.0120  0.0081  0.0019  47  ILE A C     
425  O O     . ILE A 50  ? 0.2038 0.1955 0.1879 0.0114  0.0087  0.0026  47  ILE A O     
426  C CB    . ILE A 50  ? 0.1639 0.1556 0.1396 0.0069  0.0088  0.0030  47  ILE A CB    
427  C CG1   . ILE A 50  ? 0.2416 0.2327 0.2129 0.0056  0.0089  0.0013  47  ILE A CG1   
428  C CG2   . ILE A 50  ? 0.2015 0.1920 0.1772 0.0064  0.0077  0.0068  47  ILE A CG2   
429  C CD1   . ILE A 50  ? 0.2686 0.2620 0.2378 0.0019  0.0091  0.0037  47  ILE A CD1   
430  N N     . ILE A 51  ? 0.1624 0.1477 0.1427 0.0138  0.0071  0.0025  48  ILE A N     
431  C CA    . ILE A 51  ? 0.1390 0.1235 0.1222 0.0153  0.0068  0.0042  48  ILE A CA    
432  C C     . ILE A 51  ? 0.1715 0.1552 0.1543 0.0144  0.0064  0.0077  48  ILE A C     
433  O O     . ILE A 51  ? 0.1683 0.1517 0.1537 0.0153  0.0062  0.0096  48  ILE A O     
434  C CB    . ILE A 51  ? 0.1968 0.1779 0.1804 0.0186  0.0062  0.0016  48  ILE A CB    
435  C CG1   . ILE A 51  ? 0.1853 0.1620 0.1649 0.0197  0.0054  0.0006  48  ILE A CG1   
436  C CG2   . ILE A 51  ? 0.2224 0.2055 0.2080 0.0196  0.0065  -0.0018 48  ILE A CG2   
437  C CD1   . ILE A 51  ? 0.2422 0.2147 0.2216 0.0230  0.0045  -0.0013 48  ILE A CD1   
438  N N     . ALA A 52  ? 0.1618 0.1451 0.1417 0.0126  0.0061  0.0087  49  ALA A N     
439  C CA    . ALA A 52  ? 0.0981 0.0815 0.0781 0.0116  0.0057  0.0121  49  ALA A CA    
440  C C     . ALA A 52  ? 0.1339 0.1188 0.1111 0.0087  0.0055  0.0131  49  ALA A C     
441  O O     . ALA A 52  ? 0.1568 0.1405 0.1308 0.0081  0.0055  0.0109  49  ALA A O     
442  C CB    . ALA A 52  ? 0.1512 0.1306 0.1302 0.0135  0.0053  0.0118  49  ALA A CB    
443  N N     . VAL A 53  ? 0.1414 0.1285 0.1197 0.0069  0.0051  0.0165  50  VAL A N     
444  C CA    . VAL A 53  ? 0.1005 0.0897 0.0766 0.0039  0.0047  0.0178  50  VAL A CA    
445  C C     . VAL A 53  ? 0.1358 0.1258 0.1126 0.0028  0.0039  0.0208  50  VAL A C     
446  O O     . VAL A 53  ? 0.1485 0.1398 0.1287 0.0037  0.0038  0.0231  50  VAL A O     
447  C CB    . VAL A 53  ? 0.1503 0.1430 0.1275 0.0021  0.0049  0.0191  50  VAL A CB    
448  C CG1   . VAL A 53  ? 0.1652 0.1597 0.1393 -0.0011 0.0045  0.0200  50  VAL A CG1   
449  C CG2   . VAL A 53  ? 0.2119 0.2046 0.1895 0.0031  0.0060  0.0163  50  VAL A CG2   
450  N N     . SER A 54  ? 0.1524 0.1418 0.1261 0.0011  0.0035  0.0207  51  SER A N     
451  C CA    . SER A 54  ? 0.1280 0.1187 0.1025 -0.0002 0.0027  0.0234  51  SER A CA    
452  C C     . SER A 54  ? 0.1626 0.1576 0.1391 -0.0021 0.0019  0.0264  51  SER A C     
453  O O     . SER A 54  ? 0.1692 0.1655 0.1446 -0.0032 0.0019  0.0263  51  SER A O     
454  C CB    . SER A 54  ? 0.1674 0.1562 0.1378 -0.0019 0.0023  0.0224  51  SER A CB    
455  O OG    . SER A 54  ? 0.1916 0.1823 0.1595 -0.0048 0.0018  0.0227  51  SER A OG    
456  N N     . TYR A 55  ? 0.1621 0.1592 0.1413 -0.0023 0.0012  0.0292  52  TYR A N     
457  C CA    . TYR A 55  ? 0.1526 0.1536 0.1338 -0.0038 0.0001  0.0322  52  TYR A CA    
458  C C     . TYR A 55  ? 0.1827 0.1851 0.1603 -0.0071 -0.0008 0.0325  52  TYR A C     
459  O O     . TYR A 55  ? 0.2072 0.2117 0.1847 -0.0084 -0.0015 0.0341  52  TYR A O     
460  C CB    . TYR A 55  ? 0.1684 0.1716 0.1540 -0.0029 -0.0005 0.0349  52  TYR A CB    
461  C CG    . TYR A 55  ? 0.1621 0.1644 0.1513 0.0002  0.0003  0.0352  52  TYR A CG    
462  C CD1   . TYR A 55  ? 0.1793 0.1783 0.1686 0.0025  0.0015  0.0331  52  TYR A CD1   
463  C CD2   . TYR A 55  ? 0.2052 0.2093 0.1972 0.0007  -0.0003 0.0374  52  TYR A CD2   
464  C CE1   . TYR A 55  ? 0.1871 0.1850 0.1793 0.0052  0.0022  0.0331  52  TYR A CE1   
465  C CE2   . TYR A 55  ? 0.2186 0.2215 0.2137 0.0035  0.0004  0.0375  52  TYR A CE2   
466  C CZ    . TYR A 55  ? 0.2152 0.2152 0.2104 0.0056  0.0016  0.0353  52  TYR A CZ    
467  O OH    . TYR A 55  ? 0.2246 0.2231 0.2225 0.0082  0.0022  0.0354  52  TYR A OH    
468  N N     . GLU A 56  ? 0.2081 0.2091 0.1824 -0.0084 -0.0009 0.0310  53  GLU A N     
469  C CA    . GLU A 56  ? 0.1830 0.1847 0.1532 -0.0116 -0.0016 0.0308  53  GLU A CA    
470  C C     . GLU A 56  ? 0.1995 0.2002 0.1669 -0.0119 -0.0009 0.0290  53  GLU A C     
471  O O     . GLU A 56  ? 0.2334 0.2359 0.1987 -0.0143 -0.0015 0.0299  53  GLU A O     
472  C CB    . GLU A 56  ? 0.2266 0.2258 0.1933 -0.0128 -0.0017 0.0291  53  GLU A CB    
473  C CG    . GLU A 56  ? 0.3165 0.3171 0.2855 -0.0134 -0.0024 0.0309  53  GLU A CG    
474  C CD    . GLU A 56  ? 0.3748 0.3734 0.3464 -0.0106 -0.0013 0.0303  53  GLU A CD    
475  O OE1   . GLU A 56  ? 0.3069 0.3036 0.2795 -0.0079 -0.0002 0.0290  53  GLU A OE1   
476  O OE2   . GLU A 56  ? 0.4193 0.4184 0.3919 -0.0112 -0.0014 0.0311  53  GLU A OE2   
477  N N     . ALA A 57  ? 0.1700 0.1681 0.1374 -0.0096 0.0005  0.0262  54  ALA A N     
478  C CA    . ALA A 57  ? 0.1620 0.1598 0.1275 -0.0098 0.0015  0.0242  54  ALA A CA    
479  C C     . ALA A 57  ? 0.1797 0.1800 0.1479 -0.0097 0.0017  0.0261  54  ALA A C     
480  O O     . ALA A 57  ? 0.1795 0.1808 0.1456 -0.0113 0.0021  0.0257  54  ALA A O     
481  C CB    . ALA A 57  ? 0.1895 0.1840 0.1545 -0.0072 0.0028  0.0206  54  ALA A CB    
482  N N     . ARG A 58  ? 0.1728 0.1737 0.1453 -0.0079 0.0014  0.0281  55  ARG A N     
483  C CA    . ARG A 58  ? 0.1636 0.1662 0.1384 -0.0079 0.0013  0.0302  55  ARG A CA    
484  C C     . ARG A 58  ? 0.2037 0.2088 0.1768 -0.0108 0.0000  0.0329  55  ARG A C     
485  O O     . ARG A 58  ? 0.2196 0.2255 0.1921 -0.0119 0.0002  0.0337  55  ARG A O     
486  C CB    . ARG A 58  ? 0.1696 0.1723 0.1491 -0.0054 0.0010  0.0320  55  ARG A CB    
487  C CG    . ARG A 58  ? 0.1997 0.1997 0.1807 -0.0024 0.0022  0.0295  55  ARG A CG    
488  C CD    . ARG A 58  ? 0.1889 0.1888 0.1742 -0.0001 0.0020  0.0313  55  ARG A CD    
489  N NE    . ARG A 58  ? 0.1801 0.1772 0.1660 0.0025  0.0029  0.0289  55  ARG A NE    
490  C CZ    . ARG A 58  ? 0.2333 0.2293 0.2224 0.0050  0.0032  0.0293  55  ARG A CZ    
491  N NH1   . ARG A 58  ? 0.2268 0.2242 0.2189 0.0054  0.0027  0.0318  55  ARG A NH1   
492  N NH2   . ARG A 58  ? 0.2069 0.1999 0.1957 0.0071  0.0039  0.0270  55  ARG A NH2   
493  N N     . ALA A 59  ? 0.1965 0.2025 0.1683 -0.0124 -0.0013 0.0341  56  ALA A N     
494  C CA    . ALA A 59  ? 0.1849 0.1932 0.1548 -0.0153 -0.0029 0.0367  56  ALA A CA    
495  C C     . ALA A 59  ? 0.2498 0.2577 0.2146 -0.0177 -0.0023 0.0352  56  ALA A C     
496  O O     . ALA A 59  ? 0.2601 0.2694 0.2231 -0.0200 -0.0033 0.0373  56  ALA A O     
497  C CB    . ALA A 59  ? 0.2325 0.2421 0.2021 -0.0166 -0.0045 0.0378  56  ALA A CB    
498  N N     . PHE A 60  ? 0.1992 0.2052 0.1619 -0.0173 -0.0006 0.0315  57  PHE A N     
499  C CA    . PHE A 60  ? 0.1945 0.2002 0.1528 -0.0193 0.0005  0.0295  57  PHE A CA    
500  C C     . PHE A 60  ? 0.2253 0.2312 0.1848 -0.0185 0.0021  0.0286  57  PHE A C     
501  O O     . PHE A 60  ? 0.2458 0.2520 0.2020 -0.0203 0.0033  0.0270  57  PHE A O     
502  C CB    . PHE A 60  ? 0.1855 0.1890 0.1409 -0.0190 0.0015  0.0257  57  PHE A CB    
503  C CG    . PHE A 60  ? 0.2030 0.2060 0.1556 -0.0208 0.0001  0.0261  57  PHE A CG    
504  C CD1   . PHE A 60  ? 0.2846 0.2878 0.2320 -0.0239 -0.0003 0.0258  57  PHE A CD1   
505  C CD2   . PHE A 60  ? 0.2481 0.2504 0.2029 -0.0195 -0.0007 0.0267  57  PHE A CD2   
506  C CE1   . PHE A 60  ? 0.3385 0.3412 0.2833 -0.0257 -0.0017 0.0261  57  PHE A CE1   
507  C CE2   . PHE A 60  ? 0.2991 0.3009 0.2512 -0.0214 -0.0020 0.0270  57  PHE A CE2   
508  C CZ    . PHE A 60  ? 0.3576 0.3596 0.3048 -0.0245 -0.0025 0.0267  57  PHE A CZ    
509  N N     . GLY A 61  ? 0.2147 0.2204 0.1788 -0.0160 0.0023  0.0294  58  GLY A N     
510  C CA    . GLY A 61  ? 0.2003 0.2062 0.1660 -0.0153 0.0038  0.0286  58  GLY A CA    
511  C C     . GLY A 61  ? 0.1922 0.1967 0.1596 -0.0127 0.0054  0.0248  58  GLY A C     
512  O O     . GLY A 61  ? 0.1952 0.2002 0.1640 -0.0122 0.0068  0.0235  58  GLY A O     
513  N N     . VAL A 62  ? 0.1819 0.1848 0.1493 -0.0110 0.0052  0.0231  59  VAL A N     
514  C CA    . VAL A 62  ? 0.1498 0.1511 0.1186 -0.0083 0.0064  0.0197  59  VAL A CA    
515  C C     . VAL A 62  ? 0.1795 0.1803 0.1530 -0.0057 0.0063  0.0206  59  VAL A C     
516  O O     . VAL A 62  ? 0.1774 0.1780 0.1529 -0.0050 0.0052  0.0233  59  VAL A O     
517  C CB    . VAL A 62  ? 0.1842 0.1831 0.1510 -0.0074 0.0060  0.0178  59  VAL A CB    
518  C CG1   . VAL A 62  ? 0.2190 0.2158 0.1871 -0.0043 0.0069  0.0143  59  VAL A CG1   
519  C CG2   . VAL A 62  ? 0.2203 0.2193 0.1822 -0.0100 0.0060  0.0167  59  VAL A CG2   
520  N N     . THR A 63  ? 0.1877 0.1885 0.1630 -0.0043 0.0076  0.0182  60  THR A N     
521  C CA    . THR A 63  ? 0.1852 0.1852 0.1645 -0.0019 0.0076  0.0188  60  THR A CA    
522  C C     . THR A 63  ? 0.2191 0.2177 0.1998 0.0008  0.0083  0.0151  60  THR A C     
523  O O     . THR A 63  ? 0.2365 0.2351 0.2154 0.0008  0.0091  0.0119  60  THR A O     
524  C CB    . THR A 63  ? 0.2218 0.2236 0.2027 -0.0032 0.0081  0.0204  60  THR A CB    
525  O OG1   . THR A 63  ? 0.2789 0.2822 0.2588 -0.0044 0.0096  0.0177  60  THR A OG1   
526  C CG2   . THR A 63  ? 0.2216 0.2244 0.2011 -0.0057 0.0070  0.0243  60  THR A CG2   
527  N N     . ARG A 64  ? 0.2060 0.2032 0.1898 0.0032  0.0081  0.0154  61  ARG A N     
528  C CA    . ARG A 64  ? 0.2122 0.2082 0.1979 0.0058  0.0086  0.0122  61  ARG A CA    
529  C C     . ARG A 64  ? 0.2605 0.2591 0.2472 0.0048  0.0098  0.0102  61  ARG A C     
530  O O     . ARG A 64  ? 0.2670 0.2677 0.2538 0.0024  0.0103  0.0121  61  ARG A O     
531  C CB    . ARG A 64  ? 0.2985 0.2928 0.2873 0.0080  0.0080  0.0136  61  ARG A CB    
532  C CG    A ARG A 64  ? 0.3280 0.3210 0.3189 0.0106  0.0083  0.0107  61  ARG A CG    
533  C CG    B ARG A 64  ? 0.3405 0.3332 0.3310 0.0108  0.0082  0.0105  61  ARG A CG    
534  C CD    A ARG A 64  ? 0.2648 0.2554 0.2578 0.0128  0.0076  0.0122  61  ARG A CD    
535  C CD    B ARG A 64  ? 0.3160 0.3056 0.3076 0.0133  0.0074  0.0113  61  ARG A CD    
536  N NE    A ARG A 64  ? 0.1820 0.1702 0.1733 0.0137  0.0069  0.0131  61  ARG A NE    
537  N NE    B ARG A 64  ? 0.2828 0.2726 0.2759 0.0127  0.0071  0.0150  61  ARG A NE    
538  C CZ    A ARG A 64  ? 0.2493 0.2369 0.2415 0.0139  0.0065  0.0161  61  ARG A CZ    
539  C CZ    B ARG A 64  ? 0.2595 0.2479 0.2522 0.0133  0.0065  0.0170  61  ARG A CZ    
540  N NH1   A ARG A 64  ? 0.2646 0.2535 0.2594 0.0134  0.0065  0.0184  61  ARG A NH1   
541  N NH1   B ARG A 64  ? 0.2683 0.2545 0.2587 0.0142  0.0062  0.0157  61  ARG A NH1   
542  N NH2   A ARG A 64  ? 0.1923 0.1781 0.1830 0.0145  0.0061  0.0166  61  ARG A NH2   
543  N NH2   B ARG A 64  ? 0.2801 0.2691 0.2746 0.0130  0.0062  0.0201  61  ARG A NH2   
544  N N     . SER A 65  ? 0.2360 0.2344 0.2232 0.0066  0.0103  0.0064  62  SER A N     
545  C CA    . SER A 65  ? 0.3118 0.3130 0.3006 0.0060  0.0116  0.0038  62  SER A CA    
546  C C     . SER A 65  ? 0.3394 0.3428 0.3254 0.0038  0.0127  0.0022  62  SER A C     
547  O O     . SER A 65  ? 0.4634 0.4693 0.4504 0.0036  0.0140  -0.0008 62  SER A O     
548  C CB    . SER A 65  ? 0.4106 0.4135 0.4020 0.0046  0.0122  0.0059  62  SER A CB    
549  O OG    . SER A 65  ? 0.5170 0.5221 0.5064 0.0011  0.0129  0.0077  62  SER A OG    
550  N N     . MET A 66  ? 0.2808 0.2835 0.2632 0.0020  0.0123  0.0041  63  MET A N     
551  C CA    . MET A 66  ? 0.1929 0.1971 0.1718 -0.0002 0.0132  0.0028  63  MET A CA    
552  C C     . MET A 66  ? 0.2297 0.2324 0.2075 0.0020  0.0132  -0.0012 63  MET A C     
553  O O     . MET A 66  ? 0.2338 0.2333 0.2117 0.0046  0.0120  -0.0016 63  MET A O     
554  C CB    . MET A 66  ? 0.2680 0.2712 0.2436 -0.0024 0.0122  0.0062  63  MET A CB    
555  C CG    . MET A 66  ? 0.3221 0.3269 0.2937 -0.0055 0.0129  0.0062  63  MET A CG    
556  S SD    . MET A 66  ? 0.2908 0.2948 0.2599 -0.0078 0.0111  0.0111  63  MET A SD    
557  C CE    . MET A 66  ? 0.2806 0.2869 0.2509 -0.0103 0.0115  0.0143  63  MET A CE    
558  N N     . TRP A 67  ? 0.2113 0.2163 0.1880 0.0012  0.0147  -0.0042 64  TRP A N     
559  C CA    . TRP A 67  ? 0.1666 0.1699 0.1414 0.0031  0.0146  -0.0080 64  TRP A CA    
560  C C     . TRP A 67  ? 0.2051 0.2057 0.1749 0.0017  0.0138  -0.0067 64  TRP A C     
561  O O     . TRP A 67  ? 0.1873 0.1890 0.1547 -0.0014 0.0140  -0.0042 64  TRP A O     
562  C CB    . TRP A 67  ? 0.2187 0.2256 0.1938 0.0024  0.0166  -0.0116 64  TRP A CB    
563  C CG    . TRP A 67  ? 0.2463 0.2564 0.2264 0.0034  0.0176  -0.0132 64  TRP A CG    
564  C CD1   . TRP A 67  ? 0.2683 0.2826 0.2501 0.0009  0.0193  -0.0129 64  TRP A CD1   
565  C CD2   . TRP A 67  ? 0.2785 0.2878 0.2625 0.0071  0.0167  -0.0154 64  TRP A CD2   
566  N NE1   . TRP A 67  ? 0.3115 0.3279 0.2984 0.0026  0.0197  -0.0147 64  TRP A NE1   
567  C CE2   . TRP A 67  ? 0.2911 0.3046 0.2795 0.0065  0.0180  -0.0163 64  TRP A CE2   
568  C CE3   . TRP A 67  ? 0.2347 0.2399 0.2186 0.0107  0.0150  -0.0166 64  TRP A CE3   
569  C CZ2   . TRP A 67  ? 0.3072 0.3212 0.3000 0.0094  0.0175  -0.0184 64  TRP A CZ2   
570  C CZ3   . TRP A 67  ? 0.2713 0.2768 0.2595 0.0136  0.0144  -0.0186 64  TRP A CZ3   
571  C CH2   . TRP A 67  ? 0.2966 0.3066 0.2893 0.0130  0.0155  -0.0196 64  TRP A CH2   
572  N N     . ALA A 68  ? 0.2056 0.2024 0.1736 0.0040  0.0127  -0.0084 65  ALA A N     
573  C CA    . ALA A 68  ? 0.1638 0.1577 0.1269 0.0026  0.0118  -0.0073 65  ALA A CA    
574  C C     . ALA A 68  ? 0.2014 0.1970 0.1608 -0.0002 0.0130  -0.0084 65  ALA A C     
575  O O     . ALA A 68  ? 0.2191 0.2140 0.1750 -0.0029 0.0124  -0.0061 65  ALA A O     
576  C CB    . ALA A 68  ? 0.2115 0.2005 0.1729 0.0055  0.0106  -0.0094 65  ALA A CB    
577  N N     . ASP A 69  ? 0.2172 0.2152 0.1773 0.0003  0.0146  -0.0119 66  ASP A N     
578  C CA    . ASP A 69  ? 0.2063 0.2059 0.1626 -0.0024 0.0159  -0.0132 66  ASP A CA    
579  C C     . ASP A 69  ? 0.2008 0.2031 0.1562 -0.0063 0.0164  -0.0094 66  ASP A C     
580  O O     . ASP A 69  ? 0.2316 0.2337 0.1825 -0.0092 0.0164  -0.0084 66  ASP A O     
581  C CB    . ASP A 69  ? 0.2636 0.2662 0.2216 -0.0013 0.0180  -0.0176 66  ASP A CB    
582  C CG    . ASP A 69  ? 0.3248 0.3245 0.2822 0.0023  0.0176  -0.0219 66  ASP A CG    
583  O OD1   . ASP A 69  ? 0.3125 0.3072 0.2671 0.0036  0.0158  -0.0216 66  ASP A OD1   
584  O OD2   . ASP A 69  ? 0.3698 0.3722 0.3295 0.0038  0.0190  -0.0257 66  ASP A OD2   
585  N N     . ASP A 70  ? 0.1895 0.1940 0.1490 -0.0064 0.0165  -0.0072 67  ASP A N     
586  C CA    . ASP A 70  ? 0.1762 0.1829 0.1350 -0.0098 0.0166  -0.0034 67  ASP A CA    
587  C C     . ASP A 70  ? 0.1785 0.1830 0.1357 -0.0108 0.0145  0.0007  67  ASP A C     
588  O O     . ASP A 70  ? 0.2008 0.2060 0.1550 -0.0140 0.0142  0.0033  67  ASP A O     
589  C CB    . ASP A 70  ? 0.2086 0.2181 0.1722 -0.0096 0.0175  -0.0027 67  ASP A CB    
590  C CG    . ASP A 70  ? 0.2899 0.3026 0.2551 -0.0093 0.0199  -0.0068 67  ASP A CG    
591  O OD1   . ASP A 70  ? 0.3031 0.3166 0.2649 -0.0106 0.0212  -0.0092 67  ASP A OD1   
592  O OD2   . ASP A 70  ? 0.2773 0.2918 0.2471 -0.0079 0.0204  -0.0077 67  ASP A OD2   
593  N N     . ALA A 71  ? 0.1869 0.1888 0.1462 -0.0082 0.0131  0.0014  68  ALA A N     
594  C CA    . ALA A 71  ? 0.1597 0.1600 0.1181 -0.0090 0.0112  0.0050  68  ALA A CA    
595  C C     . ALA A 71  ? 0.1985 0.1972 0.1516 -0.0110 0.0106  0.0047  68  ALA A C     
596  O O     . ALA A 71  ? 0.2104 0.2093 0.1618 -0.0133 0.0093  0.0079  68  ALA A O     
597  C CB    . ALA A 71  ? 0.2055 0.2031 0.1666 -0.0058 0.0101  0.0051  68  ALA A CB    
598  N N     . LYS A 72  ? 0.1762 0.1733 0.1268 -0.0101 0.0113  0.0009  69  LYS A N     
599  C CA    . LYS A 72  ? 0.1633 0.1586 0.1085 -0.0121 0.0109  0.0002  69  LYS A CA    
600  C C     . LYS A 72  ? 0.2262 0.2239 0.1681 -0.0159 0.0115  0.0014  69  LYS A C     
601  O O     . LYS A 72  ? 0.2447 0.2413 0.1822 -0.0183 0.0106  0.0023  69  LYS A O     
602  C CB    . LYS A 72  ? 0.2165 0.2092 0.1597 -0.0100 0.0117  -0.0046 69  LYS A CB    
603  C CG    . LYS A 72  ? 0.2610 0.2493 0.2044 -0.0071 0.0104  -0.0055 69  LYS A CG    
604  C CD    . LYS A 72  ? 0.3286 0.3139 0.2677 -0.0090 0.0089  -0.0038 69  LYS A CD    
605  C CE    . LYS A 72  ? 0.3810 0.3611 0.3188 -0.0067 0.0079  -0.0054 69  LYS A CE    
606  N NZ    . LYS A 72  ? 0.2976 0.2749 0.2310 -0.0091 0.0065  -0.0037 69  LYS A NZ    
607  N N     . LYS A 73  ? 0.1902 0.1912 0.1339 -0.0167 0.0130  0.0014  70  LYS A N     
608  C CA    . LYS A 73  ? 0.1695 0.1726 0.1096 -0.0205 0.0136  0.0029  70  LYS A CA    
609  C C     . LYS A 73  ? 0.2930 0.2964 0.2329 -0.0226 0.0115  0.0078  70  LYS A C     
610  O O     . LYS A 73  ? 0.3061 0.3097 0.2417 -0.0257 0.0109  0.0094  70  LYS A O     
611  C CB    . LYS A 73  ? 0.1925 0.1989 0.1346 -0.0210 0.0158  0.0017  70  LYS A CB    
612  C CG    . LYS A 73  ? 0.2197 0.2265 0.1628 -0.0188 0.0178  -0.0033 70  LYS A CG    
613  C CD    . LYS A 73  ? 0.2351 0.2457 0.1813 -0.0191 0.0200  -0.0045 70  LYS A CD    
614  C CE    . LYS A 73  ? 0.2802 0.2918 0.2281 -0.0166 0.0219  -0.0098 70  LYS A CE    
615  N NZ    . LYS A 73  ? 0.3145 0.3300 0.2667 -0.0165 0.0239  -0.0110 70  LYS A NZ    
616  N N     . LEU A 74  ? 0.2110 0.2144 0.1555 -0.0206 0.0104  0.0101  71  LEU A N     
617  C CA    . LEU A 74  ? 0.1944 0.1982 0.1396 -0.0220 0.0084  0.0147  71  LEU A CA    
618  C C     . LEU A 74  ? 0.2580 0.2600 0.2020 -0.0219 0.0065  0.0157  71  LEU A C     
619  O O     . LEU A 74  ? 0.2552 0.2579 0.1980 -0.0240 0.0047  0.0189  71  LEU A O     
620  C CB    . LEU A 74  ? 0.2245 0.2291 0.1754 -0.0198 0.0082  0.0167  71  LEU A CB    
621  C CG    . LEU A 74  ? 0.2200 0.2265 0.1728 -0.0199 0.0098  0.0163  71  LEU A CG    
622  C CD1   . LEU A 74  ? 0.2499 0.2563 0.2082 -0.0174 0.0094  0.0179  71  LEU A CD1   
623  C CD2   . LEU A 74  ? 0.2162 0.2242 0.1657 -0.0236 0.0098  0.0188  71  LEU A CD2   
624  N N     . CYS A 75  ? 0.2039 0.2034 0.1483 -0.0196 0.0067  0.0130  72  CYS A N     
625  C CA    . CYS A 75  ? 0.1715 0.1688 0.1150 -0.0194 0.0052  0.0137  72  CYS A CA    
626  C C     . CYS A 75  ? 0.2655 0.2595 0.2056 -0.0184 0.0058  0.0097  72  CYS A C     
627  O O     . CYS A 75  ? 0.2350 0.2267 0.1768 -0.0154 0.0063  0.0075  72  CYS A O     
628  C CB    . CYS A 75  ? 0.2036 0.2006 0.1522 -0.0167 0.0045  0.0153  72  CYS A CB    
629  S SG    . CYS A 75  ? 0.2750 0.2695 0.2232 -0.0164 0.0029  0.0162  72  CYS A SG    
630  N N     . PRO A 76  ? 0.2366 0.2299 0.1714 -0.0210 0.0058  0.0086  73  PRO A N     
631  C CA    . PRO A 76  ? 0.2032 0.1932 0.1343 -0.0202 0.0066  0.0045  73  PRO A CA    
632  C C     . PRO A 76  ? 0.2302 0.2161 0.1607 -0.0187 0.0054  0.0040  73  PRO A C     
633  O O     . PRO A 76  ? 0.2987 0.2813 0.2276 -0.0167 0.0060  0.0005  73  PRO A O     
634  C CB    . PRO A 76  ? 0.3132 0.3034 0.2385 -0.0239 0.0064  0.0044  73  PRO A CB    
635  C CG    . PRO A 76  ? 0.3343 0.3285 0.2607 -0.0261 0.0064  0.0075  73  PRO A CG    
636  C CD    . PRO A 76  ? 0.3085 0.3042 0.2404 -0.0247 0.0053  0.0108  73  PRO A CD    
637  N N     . ASP A 77  ? 0.2644 0.2507 0.1964 -0.0197 0.0038  0.0073  74  ASP A N     
638  C CA    . ASP A 77  ? 0.2648 0.2474 0.1961 -0.0188 0.0028  0.0071  74  ASP A CA    
639  C C     . ASP A 77  ? 0.2764 0.2584 0.2126 -0.0155 0.0030  0.0076  74  ASP A C     
640  O O     . ASP A 77  ? 0.2603 0.2397 0.1964 -0.0149 0.0022  0.0081  74  ASP A O     
641  C CB    . ASP A 77  ? 0.3530 0.3364 0.2829 -0.0220 0.0011  0.0101  74  ASP A CB    
642  C CG    . ASP A 77  ? 0.5068 0.4898 0.4310 -0.0254 0.0007  0.0095  74  ASP A CG    
643  O OD1   . ASP A 77  ? 0.5632 0.5492 0.4871 -0.0283 -0.0006 0.0124  74  ASP A OD1   
644  O OD2   . ASP A 77  ? 0.5612 0.5408 0.4811 -0.0251 0.0015  0.0060  74  ASP A OD2   
645  N N     . LEU A 78  ? 0.2207 0.2050 0.1607 -0.0135 0.0040  0.0074  75  LEU A N     
646  C CA    . LEU A 78  ? 0.1526 0.1364 0.0972 -0.0104 0.0041  0.0077  75  LEU A CA    
647  C C     . LEU A 78  ? 0.1878 0.1666 0.1306 -0.0079 0.0042  0.0047  75  LEU A C     
648  O O     . LEU A 78  ? 0.2227 0.1995 0.1628 -0.0070 0.0048  0.0013  75  LEU A O     
649  C CB    . LEU A 78  ? 0.1914 0.1781 0.1395 -0.0089 0.0054  0.0071  75  LEU A CB    
650  C CG    . LEU A 78  ? 0.1710 0.1573 0.1238 -0.0056 0.0056  0.0071  75  LEU A CG    
651  C CD1   . LEU A 78  ? 0.1960 0.1840 0.1521 -0.0060 0.0047  0.0111  75  LEU A CD1   
652  C CD2   . LEU A 78  ? 0.2117 0.2006 0.1671 -0.0046 0.0069  0.0056  75  LEU A CD2   
653  N N     . LEU A 79  ? 0.1775 0.1542 0.1216 -0.0067 0.0035  0.0060  76  LEU A N     
654  C CA    . LEU A 79  ? 0.1510 0.1224 0.0932 -0.0042 0.0034  0.0034  76  LEU A CA    
655  C C     . LEU A 79  ? 0.1993 0.1708 0.1456 -0.0006 0.0039  0.0025  76  LEU A C     
656  O O     . LEU A 79  ? 0.2005 0.1756 0.1513 -0.0004 0.0042  0.0047  76  LEU A O     
657  C CB    . LEU A 79  ? 0.1711 0.1396 0.1117 -0.0052 0.0025  0.0051  76  LEU A CB    
658  C CG    . LEU A 79  ? 0.1897 0.1582 0.1264 -0.0090 0.0018  0.0061  76  LEU A CG    
659  C CD1   . LEU A 79  ? 0.2266 0.1926 0.1621 -0.0101 0.0010  0.0077  76  LEU A CD1   
660  C CD2   . LEU A 79  ? 0.2264 0.1916 0.1578 -0.0094 0.0019  0.0028  76  LEU A CD2   
661  N N     . LEU A 80  ? 0.1986 0.1660 0.1433 0.0021  0.0040  -0.0007 77  LEU A N     
662  C CA    . LEU A 80  ? 0.1708 0.1382 0.1191 0.0055  0.0043  -0.0020 77  LEU A CA    
663  C C     . LEU A 80  ? 0.2345 0.1962 0.1811 0.0081  0.0035  -0.0032 77  LEU A C     
664  O O     . LEU A 80  ? 0.2906 0.2474 0.2323 0.0080  0.0029  -0.0047 77  LEU A O     
665  C CB    . LEU A 80  ? 0.2031 0.1722 0.1521 0.0068  0.0051  -0.0053 77  LEU A CB    
666  C CG    . LEU A 80  ? 0.2254 0.2001 0.1760 0.0044  0.0062  -0.0044 77  LEU A CG    
667  C CD1   . LEU A 80  ? 0.2715 0.2478 0.2224 0.0055  0.0073  -0.0081 77  LEU A CD1   
668  C CD2   . LEU A 80  ? 0.2485 0.2273 0.2040 0.0040  0.0064  -0.0012 77  LEU A CD2   
669  N N     . ALA A 81  ? 0.1825 0.1444 0.1326 0.0103  0.0035  -0.0025 78  ALA A N     
670  C CA    . ALA A 81  ? 0.1394 0.0958 0.0880 0.0132  0.0028  -0.0040 78  ALA A CA    
671  C C     . ALA A 81  ? 0.2165 0.1742 0.1687 0.0163  0.0029  -0.0061 78  ALA A C     
672  O O     . ALA A 81  ? 0.2215 0.1840 0.1782 0.0161  0.0036  -0.0049 78  ALA A O     
673  C CB    . ALA A 81  ? 0.1977 0.1526 0.1466 0.0128  0.0025  -0.0011 78  ALA A CB    
674  N N     . GLN A 82  ? 0.2115 0.1648 0.1616 0.0192  0.0021  -0.0093 79  GLN A N     
675  C CA    . GLN A 82  ? 0.2012 0.1558 0.1547 0.0224  0.0020  -0.0118 79  GLN A CA    
676  C C     . GLN A 82  ? 0.2076 0.1590 0.1620 0.0249  0.0011  -0.0115 79  GLN A C     
677  O O     . GLN A 82  ? 0.2599 0.2054 0.2102 0.0255  0.0002  -0.0111 79  GLN A O     
678  C CB    . GLN A 82  ? 0.2605 0.2125 0.2114 0.0244  0.0015  -0.0159 79  GLN A CB    
679  C CG    . GLN A 82  ? 0.3467 0.3024 0.2973 0.0225  0.0025  -0.0171 79  GLN A CG    
680  C CD    . GLN A 82  ? 0.4898 0.4429 0.4382 0.0249  0.0020  -0.0214 79  GLN A CD    
681  O OE1   . GLN A 82  ? 0.5258 0.4756 0.4694 0.0240  0.0018  -0.0223 79  GLN A OE1   
682  N NE2   . GLN A 82  ? 0.4679 0.4225 0.4198 0.0281  0.0018  -0.0241 79  GLN A NE2   
683  N N     . VAL A 83  ? 0.2003 0.1551 0.1595 0.0263  0.0014  -0.0116 80  VAL A N     
684  C CA    . VAL A 83  ? 0.1567 0.1086 0.1170 0.0291  0.0005  -0.0118 80  VAL A CA    
685  C C     . VAL A 83  ? 0.2170 0.1638 0.1743 0.0323  -0.0010 -0.0154 80  VAL A C     
686  O O     . VAL A 83  ? 0.2315 0.1798 0.1892 0.0332  -0.0011 -0.0183 80  VAL A O     
687  C CB    . VAL A 83  ? 0.1815 0.1383 0.1476 0.0298  0.0010  -0.0116 80  VAL A CB    
688  C CG1   . VAL A 83  ? 0.2194 0.1729 0.1862 0.0328  -0.0002 -0.0123 80  VAL A CG1   
689  C CG2   . VAL A 83  ? 0.1714 0.1325 0.1401 0.0268  0.0022  -0.0079 80  VAL A CG2   
690  N N     . ARG A 84  ? 0.2117 0.1526 0.1659 0.0340  -0.0022 -0.0151 81  ARG A N     
691  C CA    . ARG A 84  ? 0.1680 0.1030 0.1188 0.0373  -0.0040 -0.0182 81  ARG A CA    
692  C C     . ARG A 84  ? 0.1904 0.1287 0.1457 0.0401  -0.0046 -0.0212 81  ARG A C     
693  O O     . ARG A 84  ? 0.2109 0.1537 0.1713 0.0401  -0.0041 -0.0204 81  ARG A O     
694  C CB    . ARG A 84  ? 0.2968 0.2254 0.2441 0.0384  -0.0050 -0.0169 81  ARG A CB    
695  C CG    . ARG A 84  ? 0.3551 0.2768 0.2985 0.0420  -0.0072 -0.0198 81  ARG A CG    
696  C CD    . ARG A 84  ? 0.5273 0.4431 0.4674 0.0427  -0.0080 -0.0181 81  ARG A CD    
697  N NE    . ARG A 84  ? 0.6953 0.6042 0.6314 0.0463  -0.0104 -0.0206 81  ARG A NE    
698  C CZ    . ARG A 84  ? 0.8214 0.7252 0.7549 0.0478  -0.0114 -0.0200 81  ARG A CZ    
699  N NH1   . ARG A 84  ? 0.8162 0.7213 0.7510 0.0461  -0.0101 -0.0172 81  ARG A NH1   
700  N NH2   . ARG A 84  ? 0.8383 0.7356 0.7679 0.0511  -0.0139 -0.0223 81  ARG A NH2   
701  N N     . GLU A 85  ? 0.2329 0.1690 0.1866 0.0425  -0.0058 -0.0247 82  GLU A N     
702  C CA    . GLU A 85  ? 0.2161 0.1550 0.1741 0.0456  -0.0067 -0.0279 82  GLU A CA    
703  C C     . GLU A 85  ? 0.2789 0.2106 0.2334 0.0494  -0.0093 -0.0298 82  GLU A C     
704  O O     . GLU A 85  ? 0.3187 0.2440 0.2674 0.0502  -0.0104 -0.0306 82  GLU A O     
705  C CB    . GLU A 85  ? 0.3065 0.2498 0.2664 0.0456  -0.0059 -0.0307 82  GLU A CB    
706  C CG    . GLU A 85  ? 0.3929 0.3443 0.3576 0.0424  -0.0035 -0.0293 82  GLU A CG    
707  C CD    . GLU A 85  ? 0.5074 0.4635 0.4740 0.0422  -0.0025 -0.0322 82  GLU A CD    
708  O OE1   . GLU A 85  ? 0.5301 0.4875 0.4993 0.0453  -0.0033 -0.0359 82  GLU A OE1   
709  O OE2   . GLU A 85  ? 0.5490 0.5075 0.5145 0.0390  -0.0008 -0.0309 82  GLU A OE2   
710  N N     . SER A 86  ? 0.2556 0.1881 0.2133 0.0517  -0.0104 -0.0305 83  SER A N     
711  C CA    . SER A 86  ? 0.2172 0.1433 0.1721 0.0556  -0.0132 -0.0325 83  SER A CA    
712  C C     . SER A 86  ? 0.2747 0.2056 0.2357 0.0583  -0.0142 -0.0353 83  SER A C     
713  O O     . SER A 86  ? 0.2798 0.2169 0.2463 0.0570  -0.0129 -0.0344 83  SER A O     
714  C CB    . SER A 86  ? 0.3310 0.2513 0.2820 0.0553  -0.0138 -0.0298 83  SER A CB    
715  O OG    . SER A 86  ? 0.4391 0.3554 0.3848 0.0526  -0.0127 -0.0272 83  SER A OG    
716  N N     . ARG A 87  ? 0.3424 0.2703 0.3023 0.0621  -0.0166 -0.0388 84  ARG A N     
717  C CA    . ARG A 87  ? 0.3215 0.2540 0.2874 0.0650  -0.0179 -0.0419 84  ARG A CA    
718  C C     . ARG A 87  ? 0.3168 0.2593 0.2899 0.0632  -0.0155 -0.0429 84  ARG A C     
719  O O     . ARG A 87  ? 0.3766 0.3247 0.3558 0.0638  -0.0156 -0.0440 84  ARG A O     
720  C CB    . ARG A 87  ? 0.4111 0.3418 0.3778 0.0661  -0.0193 -0.0407 84  ARG A CB    
721  C CG    . ARG A 87  ? 0.4801 0.4016 0.4398 0.0682  -0.0222 -0.0403 84  ARG A CG    
722  C CD    . ARG A 87  ? 0.4934 0.4145 0.4537 0.0686  -0.0238 -0.0390 84  ARG A CD    
723  N NE    . ARG A 87  ? 0.5339 0.4495 0.4885 0.0664  -0.0231 -0.0352 84  ARG A NE    
724  C CZ    . ARG A 87  ? 0.5855 0.4929 0.5326 0.0673  -0.0252 -0.0344 84  ARG A CZ    
725  N NH1   . ARG A 87  ? 0.6391 0.5425 0.5833 0.0706  -0.0285 -0.0370 84  ARG A NH1   
726  N NH2   . ARG A 87  ? 0.5900 0.4932 0.5325 0.0651  -0.0241 -0.0311 84  ARG A NH2   
727  N N     . GLY A 88  ? 0.2697 0.2144 0.2419 0.0608  -0.0134 -0.0426 85  GLY A N     
728  C CA    . GLY A 88  ? 0.3258 0.2795 0.3038 0.0588  -0.0111 -0.0437 85  GLY A CA    
729  C C     . GLY A 88  ? 0.3105 0.2693 0.2916 0.0548  -0.0086 -0.0402 85  GLY A C     
730  O O     . GLY A 88  ? 0.3133 0.2795 0.2992 0.0529  -0.0067 -0.0409 85  GLY A O     
731  N N     . LYS A 89  ? 0.2327 0.1875 0.2109 0.0534  -0.0087 -0.0366 86  LYS A N     
732  C CA    . LYS A 89  ? 0.2134 0.1724 0.1944 0.0500  -0.0067 -0.0333 86  LYS A CA    
733  C C     . LYS A 89  ? 0.2349 0.1900 0.2112 0.0474  -0.0059 -0.0293 86  LYS A C     
734  O O     . LYS A 89  ? 0.2391 0.1874 0.2098 0.0483  -0.0071 -0.0289 86  LYS A O     
735  C CB    . LYS A 89  ? 0.2792 0.2394 0.2640 0.0512  -0.0076 -0.0331 86  LYS A CB    
736  C CG    . LYS A 89  ? 0.2703 0.2230 0.2510 0.0533  -0.0097 -0.0321 86  LYS A CG    
737  C CD    . LYS A 89  ? 0.2949 0.2488 0.2792 0.0544  -0.0106 -0.0321 86  LYS A CD    
738  C CE    . LYS A 89  ? 0.2572 0.2151 0.2446 0.0511  -0.0085 -0.0288 86  LYS A CE    
739  N NZ    . LYS A 89  ? 0.2385 0.1926 0.2215 0.0489  -0.0074 -0.0249 86  LYS A NZ    
740  N N     . ALA A 90  ? 0.2338 0.1932 0.2123 0.0440  -0.0038 -0.0265 87  ALA A N     
741  C CA    . ALA A 90  ? 0.2199 0.1766 0.1950 0.0415  -0.0031 -0.0226 87  ALA A CA    
742  C C     . ALA A 90  ? 0.2484 0.1998 0.2215 0.0431  -0.0044 -0.0213 87  ALA A C     
743  O O     . ALA A 90  ? 0.3087 0.2607 0.2848 0.0449  -0.0052 -0.0221 87  ALA A O     
744  C CB    . ALA A 90  ? 0.3103 0.2728 0.2888 0.0381  -0.0010 -0.0199 87  ALA A CB    
745  N N     . ASN A 91  ? 0.1867 0.2011 0.1637 0.0711  0.0150  0.0198  88  ASN A N     
746  C CA    . ASN A 91  ? 0.2327 0.2462 0.2085 0.0696  0.0116  0.0211  88  ASN A CA    
747  C C     . ASN A 91  ? 0.2211 0.2255 0.1919 0.0642  0.0110  0.0189  88  ASN A C     
748  O O     . ASN A 91  ? 0.2309 0.2245 0.1976 0.0643  0.0129  0.0175  88  ASN A O     
749  C CB    . ASN A 91  ? 0.2394 0.2481 0.2130 0.0755  0.0125  0.0238  88  ASN A CB    
750  C CG    . ASN A 91  ? 0.2856 0.2946 0.2572 0.0752  0.0095  0.0260  88  ASN A CG    
751  O OD1   . ASN A 91  ? 0.2452 0.2478 0.2128 0.0712  0.0089  0.0251  88  ASN A OD1   
752  N ND2   . ASN A 91  ? 0.3701 0.3867 0.3440 0.0798  0.0075  0.0290  88  ASN A ND2   
753  N N     . LEU A 92  ? 0.1663 0.1750 0.1382 0.0594  0.0081  0.0184  89  LEU A N     
754  C CA    . LEU A 92  ? 0.1594 0.1612 0.1280 0.0542  0.0077  0.0164  89  LEU A CA    
755  C C     . LEU A 92  ? 0.1797 0.1754 0.1449 0.0538  0.0070  0.0177  89  LEU A C     
756  O O     . LEU A 92  ? 0.1947 0.1868 0.1587 0.0496  0.0065  0.0166  89  LEU A O     
757  C CB    . LEU A 92  ? 0.1815 0.1905 0.1532 0.0492  0.0057  0.0150  89  LEU A CB    
758  C CG    . LEU A 92  ? 0.2009 0.2167 0.1769 0.0493  0.0070  0.0145  89  LEU A CG    
759  C CD1   . LEU A 92  ? 0.2356 0.2582 0.2156 0.0443  0.0051  0.0138  89  LEU A CD1   
760  C CD2   . LEU A 92  ? 0.2412 0.2489 0.2130 0.0500  0.0100  0.0128  89  LEU A CD2   
761  N N     . THR A 93  ? 0.1828 0.1771 0.1466 0.0586  0.0076  0.0206  90  THR A N     
762  C CA    . THR A 93  ? 0.1730 0.1620 0.1330 0.0591  0.0077  0.0229  90  THR A CA    
763  C C     . THR A 93  ? 0.1810 0.1598 0.1399 0.0557  0.0097  0.0222  90  THR A C     
764  O O     . THR A 93  ? 0.2151 0.1922 0.1725 0.0534  0.0095  0.0229  90  THR A O     
765  C CB    . THR A 93  ? 0.2293 0.2167 0.1876 0.0655  0.0088  0.0266  90  THR A CB    
766  O OG1   . THR A 93  ? 0.3082 0.3065 0.2684 0.0685  0.0060  0.0275  90  THR A OG1   
767  C CG2   . THR A 93  ? 0.2258 0.2073 0.1795 0.0665  0.0098  0.0298  90  THR A CG2   
768  N N     . LYS A 94  ? 0.1824 0.1544 0.1424 0.0556  0.0114  0.0207  91  LYS A N     
769  C CA    . LYS A 94  ? 0.1850 0.1475 0.1455 0.0521  0.0124  0.0198  91  LYS A CA    
770  C C     . LYS A 94  ? 0.1970 0.1619 0.1585 0.0466  0.0108  0.0179  91  LYS A C     
771  O O     . LYS A 94  ? 0.2092 0.1697 0.1719 0.0442  0.0116  0.0189  91  LYS A O     
772  C CB    . LYS A 94  ? 0.2253 0.1805 0.1862 0.0526  0.0132  0.0172  91  LYS A CB    
773  C CG    . LYS A 94  ? 0.2359 0.1809 0.1988 0.0491  0.0134  0.0163  91  LYS A CG    
774  C CD    . LYS A 94  ? 0.2451 0.1833 0.2071 0.0487  0.0126  0.0120  91  LYS A CD    
775  C CE    . LYS A 94  ? 0.2794 0.2141 0.2389 0.0544  0.0144  0.0121  91  LYS A CE    
776  N NZ    . LYS A 94  ? 0.2333 0.1596 0.1904 0.0543  0.0135  0.0075  91  LYS A NZ    
777  N N     . TYR A 95  ? 0.1614 0.1333 0.1233 0.0448  0.0090  0.0155  92  TYR A N     
778  C CA    . TYR A 95  ? 0.1240 0.0980 0.0869 0.0399  0.0075  0.0136  92  TYR A CA    
779  C C     . TYR A 95  ? 0.1812 0.1596 0.1432 0.0392  0.0067  0.0151  92  TYR A C     
780  O O     . TYR A 95  ? 0.1889 0.1654 0.1513 0.0361  0.0067  0.0148  92  TYR A O     
781  C CB    . TYR A 95  ? 0.1544 0.1333 0.1178 0.0385  0.0065  0.0110  92  TYR A CB    
782  C CG    . TYR A 95  ? 0.1545 0.1288 0.1165 0.0409  0.0077  0.0096  92  TYR A CG    
783  C CD1   . TYR A 95  ? 0.1803 0.1589 0.1422 0.0451  0.0088  0.0102  92  TYR A CD1   
784  C CD2   . TYR A 95  ? 0.1719 0.1372 0.1330 0.0395  0.0075  0.0078  92  TYR A CD2   
785  C CE1   . TYR A 95  ? 0.2103 0.1838 0.1699 0.0481  0.0104  0.0087  92  TYR A CE1   
786  C CE2   . TYR A 95  ? 0.1607 0.1204 0.1192 0.0421  0.0082  0.0058  92  TYR A CE2   
787  C CZ    . TYR A 95  ? 0.1906 0.1541 0.1477 0.0467  0.0100  0.0063  92  TYR A CZ    
788  O OH    . TYR A 95  ? 0.2161 0.1734 0.1695 0.0502  0.0112  0.0042  92  TYR A OH    
789  N N     . ARG A 96  ? 0.1841 0.1683 0.1448 0.0424  0.0058  0.0165  93  ARG A N     
790  C CA    . ARG A 96  ? 0.1407 0.1277 0.0986 0.0426  0.0046  0.0176  93  ARG A CA    
791  C C     . ARG A 96  ? 0.2209 0.2010 0.1759 0.0438  0.0072  0.0203  93  ARG A C     
792  O O     . ARG A 96  ? 0.2239 0.2033 0.1768 0.0423  0.0073  0.0204  93  ARG A O     
793  C CB    . ARG A 96  ? 0.1677 0.1621 0.1245 0.0462  0.0023  0.0185  93  ARG A CB    
794  C CG    . ARG A 96  ? 0.2048 0.2078 0.1661 0.0444  -0.0002 0.0163  93  ARG A CG    
795  C CD    . ARG A 96  ? 0.2143 0.2258 0.1761 0.0469  -0.0038 0.0169  93  ARG A CD    
796  N NE    . ARG A 96  ? 0.2849 0.3050 0.2537 0.0449  -0.0054 0.0155  93  ARG A NE    
797  C CZ    . ARG A 96  ? 0.2354 0.2605 0.2088 0.0478  -0.0046 0.0166  93  ARG A CZ    
798  N NH1   . ARG A 96  ? 0.2222 0.2553 0.2027 0.0456  -0.0053 0.0157  93  ARG A NH1   
799  N NH2   . ARG A 96  ? 0.2135 0.2355 0.1849 0.0529  -0.0026 0.0189  93  ARG A NH2   
800  N N     . GLU A 97  ? 0.1821 0.1566 0.1372 0.0467  0.0096  0.0228  94  GLU A N     
801  C CA    . GLU A 97  ? 0.1682 0.1359 0.1219 0.0480  0.0130  0.0263  94  GLU A CA    
802  C C     . GLU A 97  ? 0.1799 0.1428 0.1380 0.0433  0.0144  0.0254  94  GLU A C     
803  O O     . GLU A 97  ? 0.1985 0.1593 0.1558 0.0429  0.0166  0.0276  94  GLU A O     
804  C CB    . GLU A 97  ? 0.2247 0.1872 0.1783 0.0523  0.0153  0.0296  94  GLU A CB    
805  C CG    . GLU A 97  ? 0.2452 0.2127 0.1941 0.0578  0.0140  0.0315  94  GLU A CG    
806  C CD    . GLU A 97  ? 0.3866 0.3490 0.3354 0.0627  0.0163  0.0349  94  GLU A CD    
807  O OE1   . GLU A 97  ? 0.5000 0.4547 0.4528 0.0614  0.0186  0.0348  94  GLU A OE1   
808  O OE2   . GLU A 97  ? 0.4338 0.3996 0.3785 0.0679  0.0155  0.0376  94  GLU A OE2   
809  N N     . ALA A 98  ? 0.1846 0.1463 0.1470 0.0401  0.0131  0.0223  95  ALA A N     
810  C CA    . ALA A 98  ? 0.1460 0.1042 0.1131 0.0356  0.0133  0.0211  95  ALA A CA    
811  C C     . ALA A 98  ? 0.1878 0.1506 0.1542 0.0331  0.0123  0.0200  95  ALA A C     
812  O O     . ALA A 98  ? 0.1959 0.1565 0.1655 0.0309  0.0137  0.0209  95  ALA A O     
813  C CB    . ALA A 98  ? 0.1783 0.1343 0.1481 0.0334  0.0111  0.0176  95  ALA A CB    
814  N N     . SER A 99  ? 0.1807 0.1498 0.1437 0.0334  0.0099  0.0180  96  SER A N     
815  C CA    . SER A 99  ? 0.1248 0.0975 0.0864 0.0314  0.0087  0.0167  96  SER A CA    
816  C C     . SER A 99  ? 0.1766 0.1479 0.1344 0.0335  0.0109  0.0193  96  SER A C     
817  O O     . SER A 99  ? 0.1942 0.1644 0.1527 0.0318  0.0120  0.0192  96  SER A O     
818  C CB    . SER A 99  ? 0.1812 0.1608 0.1409 0.0314  0.0056  0.0145  96  SER A CB    
819  O OG    . SER A 99  ? 0.2306 0.2128 0.1888 0.0295  0.0041  0.0130  96  SER A OG    
820  N N     . VAL A 100 ? 0.1793 0.1504 0.1325 0.0379  0.0119  0.0218  97  VAL A N     
821  C CA    . VAL A 100 ? 0.1460 0.1149 0.0937 0.0409  0.0146  0.0248  97  VAL A CA    
822  C C     . VAL A 100 ? 0.1938 0.1570 0.1461 0.0399  0.0193  0.0278  97  VAL A C     
823  O O     . VAL A 100 ? 0.2220 0.1840 0.1721 0.0404  0.0218  0.0290  97  VAL A O     
824  C CB    . VAL A 100 ? 0.2092 0.1784 0.1509 0.0463  0.0148  0.0275  97  VAL A CB    
825  C CG1   . VAL A 100 ? 0.2382 0.2033 0.1732 0.0503  0.0189  0.0317  97  VAL A CG1   
826  C CG2   . VAL A 100 ? 0.2293 0.2055 0.1672 0.0474  0.0097  0.0246  97  VAL A CG2   
827  N N     . GLU A 101 ? 0.1738 0.1333 0.1330 0.0384  0.0205  0.0288  98  GLU A N     
828  C CA    . GLU A 101 ? 0.1577 0.1125 0.1240 0.0365  0.0242  0.0315  98  GLU A CA    
829  C C     . GLU A 101 ? 0.1975 0.1543 0.1674 0.0330  0.0238  0.0297  98  GLU A C     
830  O O     . GLU A 101 ? 0.2377 0.1930 0.2098 0.0334  0.0278  0.0326  98  GLU A O     
831  C CB    . GLU A 101 ? 0.2051 0.1558 0.1796 0.0341  0.0236  0.0312  98  GLU A CB    
832  C CG    . GLU A 101 ? 0.2508 0.1972 0.2241 0.0374  0.0252  0.0338  98  GLU A CG    
833  C CD    . GLU A 101 ? 0.2489 0.1898 0.2301 0.0346  0.0241  0.0325  98  GLU A CD    
834  O OE1   . GLU A 101 ? 0.2487 0.1857 0.2385 0.0318  0.0260  0.0343  98  GLU A OE1   
835  O OE2   . GLU A 101 ? 0.2893 0.2298 0.2684 0.0353  0.0213  0.0295  98  GLU A OE2   
836  N N     . VAL A 102 ? 0.1666 0.1267 0.1374 0.0300  0.0195  0.0252  99  VAL A N     
837  C CA    . VAL A 102 ? 0.1418 0.1032 0.1166 0.0268  0.0188  0.0236  99  VAL A CA    
838  C C     . VAL A 102 ? 0.1733 0.1368 0.1416 0.0285  0.0197  0.0233  99  VAL A C     
839  O O     . VAL A 102 ? 0.2174 0.1801 0.1883 0.0280  0.0222  0.0244  99  VAL A O     
840  C CB    . VAL A 102 ? 0.1752 0.1389 0.1519 0.0234  0.0141  0.0194  99  VAL A CB    
841  C CG1   . VAL A 102 ? 0.2468 0.2121 0.2266 0.0207  0.0132  0.0180  99  VAL A CG1   
842  C CG2   . VAL A 102 ? 0.2069 0.1673 0.1891 0.0219  0.0129  0.0190  99  VAL A CG2   
843  N N     . MET A 103 ? 0.1747 0.1407 0.1349 0.0306  0.0174  0.0215  100 MET A N     
844  C CA    . MET A 103 ? 0.1400 0.1071 0.0929 0.0322  0.0172  0.0203  100 MET A CA    
845  C C     . MET A 103 ? 0.2099 0.1734 0.1584 0.0362  0.0224  0.0241  100 MET A C     
846  O O     . MET A 103 ? 0.2143 0.1767 0.1597 0.0370  0.0242  0.0237  100 MET A O     
847  C CB    . MET A 103 ? 0.2794 0.2501 0.2256 0.0336  0.0131  0.0178  100 MET A CB    
848  C CG    A MET A 103 ? 0.3035 0.2782 0.2543 0.0304  0.0090  0.0149  100 MET A CG    
849  C CG    B MET A 103 ? 0.3030 0.2777 0.2536 0.0302  0.0089  0.0147  100 MET A CG    
850  S SD    A MET A 103 ? 0.2620 0.2401 0.2135 0.0266  0.0051  0.0106  100 MET A SD    
851  S SD    B MET A 103 ? 0.2121 0.1873 0.1664 0.0257  0.0074  0.0116  100 MET A SD    
852  C CE    A MET A 103 ? 0.2129 0.1940 0.1713 0.0234  0.0031  0.0095  100 MET A CE    
853  C CE    B MET A 103 ? 0.2046 0.1839 0.1638 0.0226  0.0040  0.0096  100 MET A CE    
854  N N     . GLU A 104 ? 0.1846 0.1458 0.1327 0.0390  0.0255  0.0282  101 GLU A N     
855  C CA    . GLU A 104 ? 0.1781 0.1358 0.1218 0.0433  0.0315  0.0328  101 GLU A CA    
856  C C     . GLU A 104 ? 0.2216 0.1776 0.1744 0.0414  0.0362  0.0354  101 GLU A C     
857  O O     . GLU A 104 ? 0.2571 0.2115 0.2059 0.0444  0.0408  0.0375  101 GLU A O     
858  C CB    . GLU A 104 ? 0.2377 0.1931 0.1788 0.0471  0.0339  0.0372  101 GLU A CB    
859  C CG    . GLU A 104 ? 0.3250 0.2825 0.2552 0.0507  0.0299  0.0356  101 GLU A CG    
860  C CD    . GLU A 104 ? 0.4857 0.4405 0.4123 0.0553  0.0325  0.0406  101 GLU A CD    
861  O OE1   . GLU A 104 ? 0.5097 0.4605 0.4434 0.0550  0.0374  0.0451  101 GLU A OE1   
862  O OE2   . GLU A 104 ? 0.4934 0.4500 0.4106 0.0593  0.0295  0.0401  101 GLU A OE2   
863  N N     . ILE A 105 ? 0.1939 0.1504 0.1588 0.0368  0.0349  0.0349  102 ILE A N     
864  C CA    . ILE A 105 ? 0.1609 0.1171 0.1363 0.0345  0.0382  0.0369  102 ILE A CA    
865  C C     . ILE A 105 ? 0.1990 0.1572 0.1724 0.0339  0.0371  0.0339  102 ILE A C     
866  O O     . ILE A 105 ? 0.2110 0.1685 0.1856 0.0357  0.0420  0.0364  102 ILE A O     
867  C CB    . ILE A 105 ? 0.2024 0.1587 0.1906 0.0296  0.0354  0.0363  102 ILE A CB    
868  C CG1   . ILE A 105 ? 0.2100 0.1627 0.2014 0.0305  0.0376  0.0399  102 ILE A CG1   
869  C CG2   . ILE A 105 ? 0.2284 0.1858 0.2286 0.0269  0.0371  0.0377  102 ILE A CG2   
870  C CD1   . ILE A 105 ? 0.2374 0.1890 0.2364 0.0264  0.0329  0.0373  102 ILE A CD1   
871  N N     . MET A 106 ? 0.1933 0.1537 0.1638 0.0315  0.0312  0.0288  103 MET A N     
872  C CA    . MET A 106 ? 0.1603 0.1217 0.1288 0.0307  0.0299  0.0257  103 MET A CA    
873  C C     . MET A 106 ? 0.2054 0.1645 0.1631 0.0354  0.0332  0.0261  103 MET A C     
874  O O     . MET A 106 ? 0.2067 0.1648 0.1650 0.0362  0.0358  0.0260  103 MET A O     
875  C CB    . MET A 106 ? 0.2113 0.1751 0.1778 0.0276  0.0235  0.0208  103 MET A CB    
876  C CG    . MET A 106 ? 0.1965 0.1618 0.1726 0.0234  0.0205  0.0200  103 MET A CG    
877  S SD    . MET A 106 ? 0.2704 0.2384 0.2437 0.0205  0.0144  0.0152  103 MET A SD    
878  C CE    . MET A 106 ? 0.4355 0.4049 0.4018 0.0225  0.0129  0.0146  103 MET A CE    
879  N N     . SER A 107 ? 0.2216 0.1797 0.1690 0.0389  0.0331  0.0263  104 SER A N     
880  C CA    . SER A 107 ? 0.2120 0.1673 0.1465 0.0440  0.0354  0.0261  104 SER A CA    
881  C C     . SER A 107 ? 0.2830 0.2354 0.2179 0.0478  0.0436  0.0311  104 SER A C     
882  O O     . SER A 107 ? 0.2972 0.2466 0.2217 0.0522  0.0462  0.0305  104 SER A O     
883  C CB    . SER A 107 ? 0.3048 0.2600 0.2286 0.0473  0.0331  0.0259  104 SER A CB    
884  O OG    . SER A 107 ? 0.3691 0.3277 0.2926 0.0443  0.0258  0.0213  104 SER A OG    
885  N N     . ARG A 108 ? 0.2426 0.1956 0.1896 0.0464  0.0477  0.0360  105 ARG A N     
886  C CA    . ARG A 108 ? 0.2543 0.2055 0.2043 0.0498  0.0563  0.0415  105 ARG A CA    
887  C C     . ARG A 108 ? 0.2589 0.2107 0.2134 0.0491  0.0577  0.0400  105 ARG A C     
888  O O     . ARG A 108 ? 0.2958 0.2457 0.2477 0.0535  0.0647  0.0431  105 ARG A O     
889  C CB    . ARG A 108 ? 0.2671 0.2192 0.2318 0.0476  0.0600  0.0473  105 ARG A CB    
890  C CG    . ARG A 108 ? 0.2817 0.2322 0.2436 0.0487  0.0598  0.0498  105 ARG A CG    
891  C CD    . ARG A 108 ? 0.3780 0.3272 0.3517 0.0487  0.0667  0.0571  105 ARG A CD    
892  N NE    . ARG A 108 ? 0.3764 0.3283 0.3688 0.0430  0.0659  0.0575  105 ARG A NE    
893  C CZ    . ARG A 108 ? 0.3172 0.2693 0.3206 0.0381  0.0618  0.0568  105 ARG A CZ    
894  N NH1   . ARG A 108 ? 0.3276 0.2821 0.3472 0.0332  0.0605  0.0568  105 ARG A NH1   
895  N NH2   . ARG A 108 ? 0.2787 0.2284 0.2764 0.0384  0.0588  0.0558  105 ARG A NH2   
896  N N     . PHE A 109 ? 0.2639 0.2182 0.2247 0.0440  0.0516  0.0355  106 PHE A N     
897  C CA    . PHE A 109 ? 0.2453 0.2004 0.2124 0.0430  0.0525  0.0345  106 PHE A CA    
898  C C     . PHE A 109 ? 0.3129 0.2649 0.2672 0.0453  0.0505  0.0295  106 PHE A C     
899  O O     . PHE A 109 ? 0.3594 0.3096 0.3132 0.0478  0.0543  0.0296  106 PHE A O     
900  C CB    . PHE A 109 ? 0.2310 0.1899 0.2115 0.0368  0.0470  0.0328  106 PHE A CB    
901  C CG    . PHE A 109 ? 0.2630 0.2243 0.2579 0.0342  0.0486  0.0372  106 PHE A CG    
902  C CD1   . PHE A 109 ? 0.2433 0.2042 0.2383 0.0329  0.0468  0.0380  106 PHE A CD1   
903  C CD2   . PHE A 109 ? 0.2813 0.2452 0.2906 0.0331  0.0515  0.0404  106 PHE A CD2   
904  C CE1   . PHE A 109 ? 0.2723 0.2343 0.2809 0.0303  0.0479  0.0416  106 PHE A CE1   
905  C CE2   . PHE A 109 ? 0.2556 0.2216 0.2795 0.0302  0.0521  0.0441  106 PHE A CE2   
906  C CZ    . PHE A 109 ? 0.2347 0.1992 0.2580 0.0286  0.0503  0.0445  106 PHE A CZ    
907  N N     . ALA A 110 ? 0.3103 0.2616 0.2549 0.0444  0.0445  0.0249  107 ALA A N     
908  C CA    . ALA A 110 ? 0.2497 0.1979 0.1839 0.0453  0.0411  0.0194  107 ALA A CA    
909  C C     . ALA A 110 ? 0.3241 0.2724 0.2486 0.0448  0.0350  0.0156  107 ALA A C     
910  O O     . ALA A 110 ? 0.3227 0.2741 0.2496 0.0434  0.0331  0.0171  107 ALA A O     
911  C CB    . ALA A 110 ? 0.3617 0.3112 0.3046 0.0409  0.0378  0.0168  107 ALA A CB    
912  N N     . VAL A 111 ? 0.4138 0.3588 0.3281 0.0459  0.0316  0.0105  108 VAL A N     
913  C CA    . VAL A 111 ? 0.4043 0.3503 0.3118 0.0445  0.0246  0.0062  108 VAL A CA    
914  C C     . VAL A 111 ? 0.2999 0.2508 0.2186 0.0380  0.0194  0.0047  108 VAL A C     
915  O O     . VAL A 111 ? 0.3586 0.3094 0.2848 0.0348  0.0191  0.0038  108 VAL A O     
916  C CB    . VAL A 111 ? 0.6548 0.5956 0.5507 0.0463  0.0216  0.0006  108 VAL A CB    
917  C CG1   . VAL A 111 ? 0.6648 0.6077 0.5563 0.0441  0.0135  -0.0039 108 VAL A CG1   
918  C CG2   . VAL A 111 ? 0.6924 0.6274 0.5748 0.0537  0.0270  0.0017  108 VAL A CG2   
919  N N     . ILE A 112 ? 0.3579 0.3129 0.2772 0.0367  0.0158  0.0048  109 ILE A N     
920  C CA    . ILE A 112 ? 0.2043 0.1639 0.1329 0.0313  0.0115  0.0036  109 ILE A CA    
921  C C     . ILE A 112 ? 0.2209 0.1831 0.1461 0.0297  0.0051  -0.0003 109 ILE A C     
922  O O     . ILE A 112 ? 0.2614 0.2232 0.1776 0.0328  0.0031  -0.0016 109 ILE A O     
923  C CB    . ILE A 112 ? 0.2877 0.2508 0.2240 0.0303  0.0130  0.0076  109 ILE A CB    
924  C CG1   . ILE A 112 ? 0.3191 0.2843 0.2502 0.0328  0.0115  0.0084  109 ILE A CG1   
925  C CG2   . ILE A 112 ? 0.3649 0.3259 0.3060 0.0318  0.0190  0.0118  109 ILE A CG2   
926  C CD1   . ILE A 112 ? 0.3629 0.3306 0.3015 0.0316  0.0123  0.0114  109 ILE A CD1   
927  N N     . GLU A 113 ? 0.1862 0.1512 0.1190 0.0249  0.0020  -0.0020 110 GLU A N     
928  C CA    . GLU A 113 ? 0.1277 0.0969 0.0616 0.0224  -0.0035 -0.0047 110 GLU A CA    
929  C C     . GLU A 113 ? 0.1884 0.1631 0.1303 0.0203  -0.0036 -0.0022 110 GLU A C     
930  O O     . GLU A 113 ? 0.2012 0.1763 0.1500 0.0175  -0.0024 -0.0012 110 GLU A O     
931  C CB    . GLU A 113 ? 0.1909 0.1587 0.1276 0.0186  -0.0065 -0.0082 110 GLU A CB    
932  C CG    . GLU A 113 ? 0.2368 0.2097 0.1772 0.0154  -0.0119 -0.0104 110 GLU A CG    
933  C CD    . GLU A 113 ? 0.2880 0.2591 0.2328 0.0110  -0.0144 -0.0133 110 GLU A CD    
934  O OE1   . GLU A 113 ? 0.3490 0.3253 0.3007 0.0075  -0.0176 -0.0137 110 GLU A OE1   
935  O OE2   . GLU A 113 ? 0.2674 0.2320 0.2096 0.0112  -0.0129 -0.0147 110 GLU A OE2   
936  N N     . ARG A 114 ? 0.1943 0.1729 0.1347 0.0222  -0.0052 -0.0014 111 ARG A N     
937  C CA    . ARG A 114 ? 0.1251 0.1083 0.0720 0.0210  -0.0052 0.0006  111 ARG A CA    
938  C C     . ARG A 114 ? 0.2302 0.2178 0.1833 0.0169  -0.0084 -0.0013 111 ARG A C     
939  O O     . ARG A 114 ? 0.3264 0.3175 0.2792 0.0163  -0.0124 -0.0034 111 ARG A O     
940  C CB    . ARG A 114 ? 0.1911 0.1771 0.1345 0.0247  -0.0060 0.0021  111 ARG A CB    
941  C CG    . ARG A 114 ? 0.2112 0.2014 0.1606 0.0243  -0.0057 0.0039  111 ARG A CG    
942  C CD    . ARG A 114 ? 0.2383 0.2328 0.1853 0.0277  -0.0079 0.0047  111 ARG A CD    
943  N NE    . ARG A 114 ? 0.2739 0.2703 0.2247 0.0290  -0.0063 0.0071  111 ARG A NE    
944  C CZ    . ARG A 114 ? 0.3438 0.3456 0.3005 0.0277  -0.0076 0.0067  111 ARG A CZ    
945  N NH1   . ARG A 114 ? 0.3190 0.3254 0.2799 0.0244  -0.0105 0.0045  111 ARG A NH1   
946  N NH2   . ARG A 114 ? 0.3241 0.3263 0.2828 0.0298  -0.0057 0.0087  111 ARG A NH2   
947  N N     . ALA A 115 ? 0.1913 0.1788 0.1501 0.0142  -0.0068 -0.0004 112 ALA A N     
948  C CA    . ALA A 115 ? 0.1550 0.1460 0.1196 0.0105  -0.0087 -0.0013 112 ALA A CA    
949  C C     . ALA A 115 ? 0.2664 0.2633 0.2351 0.0107  -0.0089 0.0001  112 ALA A C     
950  O O     . ALA A 115 ? 0.3031 0.3050 0.2766 0.0086  -0.0107 -0.0004 112 ALA A O     
951  C CB    . ALA A 115 ? 0.2158 0.2032 0.1831 0.0081  -0.0068 -0.0007 112 ALA A CB    
952  N N     . SER A 116 ? 0.2078 0.2040 0.1752 0.0132  -0.0067 0.0020  113 SER A N     
953  C CA    . SER A 116 ? 0.1656 0.1661 0.1358 0.0144  -0.0062 0.0034  113 SER A CA    
954  C C     . SER A 116 ? 0.1942 0.1916 0.1612 0.0179  -0.0042 0.0049  113 SER A C     
955  O O     . SER A 116 ? 0.2010 0.1938 0.1646 0.0191  -0.0031 0.0054  113 SER A O     
956  C CB    . SER A 116 ? 0.2541 0.2546 0.2277 0.0122  -0.0047 0.0039  113 SER A CB    
957  O OG    . SER A 116 ? 0.2661 0.2609 0.2378 0.0125  -0.0030 0.0045  113 SER A OG    
958  N N     . ILE A 117 ? 0.1983 0.1976 0.1668 0.0196  -0.0033 0.0060  114 ILE A N     
959  C CA    . ILE A 117 ? 0.1108 0.1064 0.0770 0.0228  -0.0014 0.0075  114 ILE A CA    
960  C C     . ILE A 117 ? 0.1691 0.1578 0.1350 0.0217  0.0003  0.0078  114 ILE A C     
961  O O     . ILE A 117 ? 0.2021 0.1868 0.1667 0.0236  0.0019  0.0093  114 ILE A O     
962  C CB    . ILE A 117 ? 0.1823 0.1802 0.1501 0.0250  -0.0006 0.0081  114 ILE A CB    
963  C CG1   . ILE A 117 ? 0.2339 0.2282 0.1994 0.0289  0.0008  0.0098  114 ILE A CG1   
964  C CG2   . ILE A 117 ? 0.2450 0.2408 0.2140 0.0232  0.0004  0.0073  114 ILE A CG2   
965  C CD1   . ILE A 117 ? 0.2584 0.2558 0.2248 0.0323  0.0013  0.0105  114 ILE A CD1   
966  N N     . ASP A 118 ? 0.1662 0.1539 0.1340 0.0186  0.0000  0.0068  115 ASP A N     
967  C CA    . ASP A 118 ? 0.1237 0.1060 0.0926 0.0175  0.0009  0.0071  115 ASP A CA    
968  C C     . ASP A 118 ? 0.1812 0.1625 0.1515 0.0149  0.0006  0.0066  115 ASP A C     
969  O O     . ASP A 118 ? 0.2112 0.1894 0.1839 0.0136  0.0007  0.0068  115 ASP A O     
970  C CB    . ASP A 118 ? 0.1643 0.1446 0.1340 0.0173  0.0007  0.0065  115 ASP A CB    
971  C CG    . ASP A 118 ? 0.1916 0.1734 0.1615 0.0152  -0.0004 0.0054  115 ASP A CG    
972  O OD1   . ASP A 118 ? 0.1919 0.1704 0.1617 0.0145  -0.0012 0.0047  115 ASP A OD1   
973  O OD2   . ASP A 118 ? 0.2329 0.2189 0.2031 0.0141  -0.0008 0.0053  115 ASP A OD2   
974  N N     . GLU A 119 ? 0.1724 0.1559 0.1414 0.0143  -0.0001 0.0059  116 GLU A N     
975  C CA    . GLU A 119 ? 0.1390 0.1207 0.1088 0.0123  -0.0002 0.0053  116 GLU A CA    
976  C C     . GLU A 119 ? 0.1732 0.1540 0.1396 0.0137  0.0002  0.0049  116 GLU A C     
977  O O     . GLU A 119 ? 0.1941 0.1774 0.1575 0.0149  -0.0011 0.0041  116 GLU A O     
978  C CB    . GLU A 119 ? 0.2020 0.1863 0.1732 0.0097  -0.0018 0.0042  116 GLU A CB    
979  C CG    A GLU A 119 ? 0.2581 0.2429 0.2309 0.0088  -0.0019 0.0047  116 GLU A CG    
980  C CG    B GLU A 119 ? 0.2591 0.2437 0.2319 0.0087  -0.0019 0.0047  116 GLU A CG    
981  C CD    A GLU A 119 ? 0.3392 0.3256 0.3134 0.0065  -0.0025 0.0047  116 GLU A CD    
982  C CD    B GLU A 119 ? 0.3403 0.3268 0.3146 0.0064  -0.0025 0.0046  116 GLU A CD    
983  O OE1   A GLU A 119 ? 0.3394 0.3256 0.3145 0.0050  -0.0030 0.0040  116 GLU A OE1   
984  O OE1   B GLU A 119 ? 0.3252 0.3154 0.3005 0.0057  -0.0031 0.0041  116 GLU A OE1   
985  O OE2   A GLU A 119 ? 0.3862 0.3735 0.3603 0.0063  -0.0023 0.0053  116 GLU A OE2   
986  O OE2   B GLU A 119 ? 0.3905 0.3748 0.3654 0.0053  -0.0026 0.0052  116 GLU A OE2   
987  N N     . ALA A 120 ? 0.1680 0.1452 0.1345 0.0138  0.0019  0.0054  117 ALA A N     
988  C CA    . ALA A 120 ? 0.1166 0.0919 0.0784 0.0155  0.0026  0.0045  117 ALA A CA    
989  C C     . ALA A 120 ? 0.1845 0.1566 0.1477 0.0144  0.0035  0.0040  117 ALA A C     
990  O O     . ALA A 120 ? 0.1820 0.1531 0.1502 0.0135  0.0048  0.0055  117 ALA A O     
991  C CB    . ALA A 120 ? 0.1903 0.1637 0.1487 0.0191  0.0055  0.0067  117 ALA A CB    
992  N N     . TYR A 121 ? 0.1711 0.1415 0.1300 0.0145  0.0024  0.0016  118 TYR A N     
993  C CA    . TYR A 121 ? 0.1151 0.0813 0.0739 0.0145  0.0039  0.0009  118 TYR A CA    
994  C C     . TYR A 121 ? 0.2116 0.1743 0.1654 0.0186  0.0075  0.0019  118 TYR A C     
995  O O     . TYR A 121 ? 0.2108 0.1736 0.1584 0.0214  0.0078  0.0018  118 TYR A O     
996  C CB    . TYR A 121 ? 0.1588 0.1233 0.1154 0.0126  0.0009  -0.0025 118 TYR A CB    
997  C CG    . TYR A 121 ? 0.1708 0.1384 0.1331 0.0086  -0.0017 -0.0026 118 TYR A CG    
998  C CD1   . TYR A 121 ? 0.1835 0.1559 0.1467 0.0071  -0.0044 -0.0033 118 TYR A CD1   
999  C CD2   . TYR A 121 ? 0.2141 0.1801 0.1810 0.0067  -0.0010 -0.0015 118 TYR A CD2   
1000 C CE1   . TYR A 121 ? 0.2042 0.1796 0.1728 0.0039  -0.0056 -0.0028 118 TYR A CE1   
1001 C CE2   . TYR A 121 ? 0.2166 0.1850 0.1877 0.0036  -0.0026 -0.0010 118 TYR A CE2   
1002 C CZ    . TYR A 121 ? 0.2464 0.2195 0.2183 0.0022  -0.0045 -0.0015 118 TYR A CZ    
1003 O OH    . TYR A 121 ? 0.2626 0.2382 0.2388 -0.0005 -0.0051 -0.0004 118 TYR A OH    
1004 N N     . VAL A 122 ? 0.1918 0.1516 0.1484 0.0194  0.0106  0.0031  119 VAL A N     
1005 C CA    . VAL A 122 ? 0.1814 0.1383 0.1352 0.0236  0.0155  0.0050  119 VAL A CA    
1006 C C     . VAL A 122 ? 0.2175 0.1697 0.1690 0.0247  0.0167  0.0031  119 VAL A C     
1007 O O     . VAL A 122 ? 0.2061 0.1581 0.1639 0.0223  0.0158  0.0030  119 VAL A O     
1008 C CB    . VAL A 122 ? 0.2585 0.2177 0.2221 0.0232  0.0185  0.0092  119 VAL A CB    
1009 C CG1   . VAL A 122 ? 0.3508 0.3083 0.3132 0.0275  0.0243  0.0124  119 VAL A CG1   
1010 C CG2   . VAL A 122 ? 0.3325 0.2956 0.3003 0.0208  0.0159  0.0102  119 VAL A CG2   
1011 N N     . ASP A 123 ? 0.2374 0.1850 0.1792 0.0286  0.0187  0.0014  120 ASP A N     
1012 C CA    . ASP A 123 ? 0.2318 0.1737 0.1708 0.0306  0.0206  -0.0004 120 ASP A CA    
1013 C C     . ASP A 123 ? 0.2579 0.1991 0.1995 0.0348  0.0276  0.0037  120 ASP A C     
1014 O O     . ASP A 123 ? 0.3048 0.2446 0.2393 0.0392  0.0315  0.0052  120 ASP A O     
1015 C CB    . ASP A 123 ? 0.4148 0.3509 0.3408 0.0327  0.0184  -0.0055 120 ASP A CB    
1016 C CG    . ASP A 123 ? 0.4742 0.4031 0.3972 0.0343  0.0198  -0.0082 120 ASP A CG    
1017 O OD1   . ASP A 123 ? 0.3502 0.2777 0.2766 0.0373  0.0253  -0.0053 120 ASP A OD1   
1018 O OD2   . ASP A 123 ? 0.6414 0.5659 0.5594 0.0327  0.0153  -0.0133 120 ASP A OD2   
1019 N N     . LEU A 124 ? 0.2239 0.1665 0.1760 0.0336  0.0293  0.0061  121 LEU A N     
1020 C CA    . LEU A 124 ? 0.1969 0.1410 0.1557 0.0368  0.0357  0.0109  121 LEU A CA    
1021 C C     . LEU A 124 ? 0.2195 0.1584 0.1752 0.0413  0.0405  0.0105  121 LEU A C     
1022 O O     . LEU A 124 ? 0.2310 0.1716 0.1939 0.0442  0.0463  0.0149  121 LEU A O     
1023 C CB    . LEU A 124 ? 0.2422 0.1921 0.2160 0.0330  0.0344  0.0142  121 LEU A CB    
1024 C CG    . LEU A 124 ? 0.2459 0.2005 0.2236 0.0294  0.0308  0.0151  121 LEU A CG    
1025 C CD1   . LEU A 124 ? 0.3179 0.2766 0.3076 0.0254  0.0275  0.0165  121 LEU A CD1   
1026 C CD2   . LEU A 124 ? 0.3187 0.2747 0.2971 0.0320  0.0356  0.0189  121 LEU A CD2   
1027 N N     . THR A 125 ? 0.2304 0.1628 0.1762 0.0421  0.0381  0.0055  122 THR A N     
1028 C CA    . THR A 125 ? 0.2453 0.1714 0.1877 0.0464  0.0422  0.0043  122 THR A CA    
1029 C C     . THR A 125 ? 0.2295 0.1540 0.1676 0.0532  0.0505  0.0075  122 THR A C     
1030 O O     . THR A 125 ? 0.2882 0.2132 0.2337 0.0563  0.0561  0.0109  122 THR A O     
1031 C CB    . THR A 125 ? 0.2770 0.1948 0.2072 0.0464  0.0381  -0.0024 122 THR A CB    
1032 O OG1   . THR A 125 ? 0.2590 0.1786 0.1942 0.0399  0.0311  -0.0045 122 THR A OG1   
1033 C CG2   . THR A 125 ? 0.3229 0.2330 0.2504 0.0507  0.0421  -0.0038 122 THR A CG2   
1034 N N     . SER A 126 ? 0.2803 0.2034 0.2069 0.0559  0.0516  0.0070  123 SER A N     
1035 C CA    . SER A 126 ? 0.3018 0.2228 0.2220 0.0631  0.0601  0.0103  123 SER A CA    
1036 C C     . SER A 126 ? 0.2782 0.2070 0.2138 0.0631  0.0659  0.0182  123 SER A C     
1037 O O     . SER A 126 ? 0.3060 0.2347 0.2454 0.0679  0.0740  0.0223  123 SER A O     
1038 C CB    . SER A 126 ? 0.3749 0.2921 0.2777 0.0663  0.0592  0.0079  123 SER A CB    
1039 O OG    A SER A 126 ? 0.4010 0.3100 0.2891 0.0677  0.0547  0.0006  123 SER A OG    
1040 O OG    B SER A 126 ? 0.3548 0.2781 0.2614 0.0624  0.0555  0.0098  123 SER A OG    
1041 N N     . ALA A 127 ? 0.2651 0.2004 0.2098 0.0576  0.0618  0.0201  124 ALA A N     
1042 C CA    . ALA A 127 ? 0.2834 0.2257 0.2442 0.0563  0.0658  0.0268  124 ALA A CA    
1043 C C     . ALA A 127 ? 0.2499 0.1958 0.2264 0.0554  0.0675  0.0293  124 ALA A C     
1044 O O     . ALA A 127 ? 0.2822 0.2322 0.2705 0.0573  0.0737  0.0351  124 ALA A O     
1045 C CB    . ALA A 127 ? 0.2908 0.2381 0.2577 0.0504  0.0598  0.0272  124 ALA A CB    
1046 N N     . VAL A 128 ? 0.2460 0.1904 0.2235 0.0525  0.0619  0.0253  125 VAL A N     
1047 C CA    . VAL A 128 ? 0.2389 0.1861 0.2301 0.0522  0.0628  0.0274  125 VAL A CA    
1048 C C     . VAL A 128 ? 0.2840 0.2277 0.2733 0.0593  0.0711  0.0292  125 VAL A C     
1049 O O     . VAL A 128 ? 0.2755 0.2243 0.2791 0.0609  0.0759  0.0343  125 VAL A O     
1050 C CB    . VAL A 128 ? 0.2304 0.1758 0.2214 0.0480  0.0551  0.0230  125 VAL A CB    
1051 C CG1   . VAL A 128 ? 0.2487 0.1943 0.2491 0.0498  0.0569  0.0246  125 VAL A CG1   
1052 C CG2   . VAL A 128 ? 0.2361 0.1872 0.2345 0.0415  0.0482  0.0232  125 VAL A CG2   
1053 N N     . GLN A 129 ? 0.2644 0.1995 0.2360 0.0636  0.0728  0.0249  126 GLN A N     
1054 C CA    . GLN A 129 ? 0.4078 0.3380 0.3744 0.0714  0.0813  0.0260  126 GLN A CA    
1055 C C     . GLN A 129 ? 0.3677 0.3029 0.3408 0.0754  0.0905  0.0332  126 GLN A C     
1056 O O     . GLN A 129 ? 0.3502 0.2882 0.3339 0.0793  0.0976  0.0379  126 GLN A O     
1057 C CB    . GLN A 129 ? 0.5382 0.4573 0.4823 0.0754  0.0809  0.0195  126 GLN A CB    
1058 C CG    . GLN A 129 ? 0.6217 0.5350 0.5608 0.0718  0.0728  0.0126  126 GLN A CG    
1059 C CD    . GLN A 129 ? 0.7290 0.6416 0.6786 0.0725  0.0741  0.0135  126 GLN A CD    
1060 O OE1   . GLN A 129 ? 0.6962 0.6129 0.6573 0.0670  0.0685  0.0139  126 GLN A OE1   
1061 N NE2   . GLN A 129 ? 0.7648 0.6719 0.7099 0.0800  0.0818  0.0140  126 GLN A NE2   
1062 N N     . GLU A 130 ? 0.3653 0.3019 0.3333 0.0746  0.0906  0.0347  127 GLU A N     
1063 C CA    . GLU A 130 ? 0.4932 0.4341 0.4676 0.0781  0.0996  0.0421  127 GLU A CA    
1064 C C     . GLU A 130 ? 0.4721 0.4230 0.4721 0.0744  0.1010  0.0484  127 GLU A C     
1065 O O     . GLU A 130 ? 0.4319 0.3863 0.4421 0.0787  0.1099  0.0545  127 GLU A O     
1066 C CB    . GLU A 130 ? 0.4567 0.3973 0.4221 0.0769  0.0981  0.0426  127 GLU A CB    
1067 C CG    . GLU A 130 ? 0.6415 0.5729 0.5817 0.0811  0.0968  0.0370  127 GLU A CG    
1068 C CD    . GLU A 130 ? 0.8714 0.8032 0.8038 0.0806  0.0955  0.0384  127 GLU A CD    
1069 O OE1   . GLU A 130 ? 0.9200 0.8561 0.8612 0.0815  0.1018  0.0456  127 GLU A OE1   
1070 O OE2   . GLU A 130 ? 0.9412 0.8691 0.8597 0.0792  0.0883  0.0325  127 GLU A OE2   
1071 N N     . ARG A 131 ? 0.3626 0.3183 0.3732 0.0667  0.0920  0.0469  128 ARG A N     
1072 C CA    . ARG A 131 ? 0.3835 0.3485 0.4178 0.0627  0.0914  0.0520  128 ARG A CA    
1073 C C     . ARG A 131 ? 0.3815 0.3492 0.4275 0.0652  0.0940  0.0538  128 ARG A C     
1074 O O     . ARG A 131 ? 0.3724 0.3475 0.4372 0.0657  0.0987  0.0600  128 ARG A O     
1075 C CB    . ARG A 131 ? 0.2951 0.2632 0.3348 0.0546  0.0806  0.0490  128 ARG A CB    
1076 C CG    A ARG A 131 ? 0.3100 0.2870 0.3727 0.0499  0.0782  0.0532  128 ARG A CG    
1077 C CG    B ARG A 131 ? 0.3215 0.2986 0.3847 0.0501  0.0783  0.0533  128 ARG A CG    
1078 C CD    A ARG A 131 ? 0.2835 0.2644 0.3564 0.0501  0.0844  0.0596  128 ARG A CD    
1079 C CD    B ARG A 131 ? 0.2931 0.2745 0.3677 0.0508  0.0853  0.0601  128 ARG A CD    
1080 N NE    A ARG A 131 ? 0.3198 0.3081 0.4133 0.0441  0.0795  0.0621  128 ARG A NE    
1081 N NE    B ARG A 131 ? 0.2467 0.2248 0.3109 0.0492  0.0841  0.0591  128 ARG A NE    
1082 C CZ    A ARG A 131 ? 0.2474 0.2357 0.3410 0.0384  0.0722  0.0597  128 ARG A CZ    
1083 C CZ    B ARG A 131 ? 0.2688 0.2487 0.3375 0.0430  0.0766  0.0575  128 ARG A CZ    
1084 N NH1   A ARG A 131 ? 0.2780 0.2722 0.3899 0.0332  0.0674  0.0615  128 ARG A NH1   
1085 N NH1   B ARG A 131 ? 0.3509 0.3274 0.4097 0.0424  0.0761  0.0568  128 ARG A NH1   
1086 N NH2   A ARG A 131 ? 0.2524 0.2348 0.3279 0.0381  0.0694  0.0554  128 ARG A NH2   
1087 N NH2   B ARG A 131 ? 0.2298 0.2145 0.3124 0.0380  0.0695  0.0565  128 ARG A NH2   
1088 N N     . LEU A 132 ? 0.3385 0.3002 0.3742 0.0667  0.0910  0.0485  129 LEU A N     
1089 C CA    . LEU A 132 ? 0.3116 0.2744 0.3561 0.0701  0.0938  0.0498  129 LEU A CA    
1090 C C     . LEU A 132 ? 0.4322 0.3952 0.4788 0.0781  0.1061  0.0551  129 LEU A C     
1091 O O     . LEU A 132 ? 0.4391 0.4080 0.5024 0.0804  0.1103  0.0598  129 LEU A O     
1092 C CB    . LEU A 132 ? 0.3448 0.2988 0.3753 0.0709  0.0893  0.0430  129 LEU A CB    
1093 C CG    . LEU A 132 ? 0.3650 0.3210 0.4010 0.0640  0.0786  0.0401  129 LEU A CG    
1094 C CD1   . LEU A 132 ? 0.3549 0.3012 0.3758 0.0642  0.0744  0.0335  129 LEU A CD1   
1095 C CD2   . LEU A 132 ? 0.3473 0.3118 0.4048 0.0630  0.0777  0.0448  129 LEU A CD2   
1096 N N     . GLN A 133 ? 0.4230 0.3797 0.4524 0.0828  0.1120  0.0544  130 GLN A N     
1097 C CA    . GLN A 133 ? 0.6157 0.5717 0.6441 0.0912  0.1248  0.0597  130 GLN A CA    
1098 C C     . GLN A 133 ? 0.5681 0.5352 0.6193 0.0899  0.1305  0.0688  130 GLN A C     
1099 O O     . GLN A 133 ? 0.6556 0.6271 0.7188 0.0951  0.1397  0.0747  130 GLN A O     
1100 C CB    . GLN A 133 ? 0.8448 0.7912 0.8478 0.0965  0.1288  0.0568  130 GLN A CB    
1101 C CG    . GLN A 133 ? 0.9154 0.8501 0.8963 0.0991  0.1246  0.0480  130 GLN A CG    
1102 C CD    . GLN A 133 ? 1.0129 0.9438 0.9947 0.1055  0.1301  0.0476  130 GLN A CD    
1103 O OE1   . GLN A 133 ? 1.0527 0.9893 1.0485 0.1099  0.1392  0.0545  130 GLN A OE1   
1104 N NE2   . GLN A 133 ? 1.0346 0.9558 1.0023 0.1060  0.1248  0.0398  130 GLN A NE2   
1105 N N     . LYS A 134 ? 0.5178 0.4894 0.5756 0.0831  0.1252  0.0699  131 LYS A N     
1106 C CA    . LYS A 134 ? 0.7531 0.7348 0.8342 0.0806  0.1293  0.0781  131 LYS A CA    
1107 C C     . LYS A 134 ? 0.6489 0.6401 0.7553 0.0772  0.1258  0.0807  131 LYS A C     
1108 O O     . LYS A 134 ? 0.6978 0.6969 0.8240 0.0791  0.1331  0.0881  131 LYS A O     
1109 C CB    . LYS A 134 ? 0.9250 0.9078 1.0066 0.0739  0.1234  0.0779  131 LYS A CB    
1110 C CG    . LYS A 134 ? 0.9438 0.9200 1.0066 0.0778  0.1292  0.0787  131 LYS A CG    
1111 C CD    . LYS A 134 ? 0.9653 0.9442 1.0346 0.0718  0.1255  0.0809  131 LYS A CD    
1112 C CE    . LYS A 134 ? 0.9800 0.9585 1.0477 0.0640  0.1120  0.0739  131 LYS A CE    
1113 N NZ    . LYS A 134 ? 0.9794 0.9593 1.0520 0.0587  0.1085  0.0755  131 LYS A NZ    
1114 N N     . LEU A 135 ? 0.5145 0.5052 0.6204 0.0722  0.1147  0.0748  132 LEU A N     
1115 C CA    . LEU A 135 ? 0.8291 0.8284 0.9570 0.0689  0.1095  0.0767  132 LEU A CA    
1116 C C     . LEU A 135 ? 1.1539 1.1561 1.2913 0.0759  0.1177  0.0808  132 LEU A C     
1117 O O     . LEU A 135 ? 1.1518 1.1644 1.3137 0.0750  0.1187  0.0864  132 LEU A O     
1118 C CB    . LEU A 135 ? 0.8014 0.7977 0.9224 0.0639  0.0971  0.0696  132 LEU A CB    
1119 C CG    . LEU A 135 ? 0.7771 0.7761 0.9020 0.0554  0.0870  0.0675  132 LEU A CG    
1120 C CD1   . LEU A 135 ? 0.7766 0.7725 0.8924 0.0544  0.0899  0.0680  132 LEU A CD1   
1121 C CD2   . LEU A 135 ? 0.7625 0.7566 0.8755 0.0520  0.0767  0.0605  132 LEU A CD2   
1122 N N     . GLN A 136 ? 1.1607 1.1537 1.2790 0.0830  0.1234  0.0778  133 GLN A N     
1123 C CA    . GLN A 136 ? 1.3262 1.3201 1.4503 0.0909  0.1320  0.0811  133 GLN A CA    
1124 C C     . GLN A 136 ? 1.1299 1.1318 1.2747 0.0887  0.1262  0.0825  133 GLN A C     
1125 O O     . GLN A 136 ? 1.1077 1.1205 1.2764 0.0898  0.1305  0.0896  133 GLN A O     
1126 C CB    . GLN A 136 ? 1.7545 1.7536 1.8887 0.0964  0.1455  0.0895  133 GLN A CB    
1127 C CG    . GLN A 136 ? 1.7692 1.7592 1.8803 0.1013  0.1534  0.0888  133 GLN A CG    
1128 C CD    . GLN A 136 ? 1.7883 1.7648 1.8721 0.1083  0.1554  0.0820  133 GLN A CD    
1129 O OE1   . GLN A 136 ? 1.7896 1.7594 1.8610 0.1050  0.1457  0.0742  133 GLN A OE1   
1130 N NE2   . GLN A 136 ? 1.7997 1.7718 1.8739 0.1179  0.1682  0.0850  133 GLN A NE2   
1131 N N     . GLY A 137 ? 1.1318 1.1286 1.2677 0.0858  0.1164  0.0762  134 GLY A N     
1132 C CA    . GLY A 137 ? 0.9097 0.9123 1.0614 0.0846  0.1105  0.0771  134 GLY A CA    
1133 C C     . GLY A 137 ? 0.7853 0.8000 0.9595 0.0771  0.1022  0.0803  134 GLY A C     
1134 O O     . GLY A 137 ? 0.8000 0.8198 0.9863 0.0754  0.0952  0.0807  134 GLY A O     
1135 N N     . GLN A 138 ? 0.7685 0.7872 0.9478 0.0729  0.1028  0.0825  135 GLN A N     
1136 C CA    . GLN A 138 ? 0.6478 0.6768 0.8478 0.0654  0.0947  0.0848  135 GLN A CA    
1137 C C     . GLN A 138 ? 0.5999 0.6256 0.7913 0.0591  0.0811  0.0784  135 GLN A C     
1138 O O     . GLN A 138 ? 0.5570 0.5733 0.7266 0.0577  0.0785  0.0727  135 GLN A O     
1139 C CB    . GLN A 138 ? 1.0437 1.0752 1.2484 0.0625  0.0988  0.0881  135 GLN A CB    
1140 C CG    . GLN A 138 ? 1.0590 1.0994 1.2841 0.0544  0.0902  0.0897  135 GLN A CG    
1141 C CD    . GLN A 138 ? 1.0797 1.1211 1.3090 0.0516  0.0949  0.0931  135 GLN A CD    
1142 O OE1   . GLN A 138 ? 1.0890 1.1258 1.3078 0.0565  0.1056  0.0954  135 GLN A OE1   
1143 N NE2   . GLN A 138 ? 1.0730 1.1198 1.3171 0.0441  0.0868  0.0934  135 GLN A NE2   
1144 N N     . PRO A 139 ? 0.6129 0.6468 0.8216 0.0555  0.0724  0.0795  136 PRO A N     
1145 C CA    . PRO A 139 ? 0.5076 0.5390 0.7089 0.0502  0.0598  0.0741  136 PRO A CA    
1146 C C     . PRO A 139 ? 0.4305 0.4597 0.6250 0.0435  0.0544  0.0709  136 PRO A C     
1147 O O     . PRO A 139 ? 0.4350 0.4671 0.6370 0.0420  0.0588  0.0738  136 PRO A O     
1148 C CB    . PRO A 139 ? 0.6526 0.6950 0.8773 0.0487  0.0530  0.0776  136 PRO A CB    
1149 C CG    . PRO A 139 ? 0.6524 0.7046 0.9000 0.0501  0.0604  0.0846  136 PRO A CG    
1150 C CD    . PRO A 139 ? 0.6415 0.6878 0.8782 0.0567  0.0741  0.0863  136 PRO A CD    
1151 N N     . ILE A 140 ? 0.4077 0.4315 0.5882 0.0400  0.0455  0.0653  137 ILE A N     
1152 C CA    . ILE A 140 ? 0.3233 0.3447 0.4967 0.0342  0.0401  0.0619  137 ILE A CA    
1153 C C     . ILE A 140 ? 0.2610 0.2888 0.4477 0.0288  0.0292  0.0615  137 ILE A C     
1154 O O     . ILE A 140 ? 0.2640 0.2926 0.4503 0.0287  0.0220  0.0600  137 ILE A O     
1155 C CB    . ILE A 140 ? 0.3758 0.3870 0.5243 0.0338  0.0378  0.0558  137 ILE A CB    
1156 C CG1   . ILE A 140 ? 0.4602 0.4645 0.5949 0.0390  0.0477  0.0555  137 ILE A CG1   
1157 C CG2   . ILE A 140 ? 0.3020 0.3112 0.4438 0.0283  0.0323  0.0526  137 ILE A CG2   
1158 C CD1   . ILE A 140 ? 0.4886 0.4834 0.6011 0.0390  0.0455  0.0497  137 ILE A CD1   
1159 N N     . SER A 141 ? 0.2879 0.3197 0.4861 0.0247  0.0279  0.0630  138 SER A N     
1160 C CA    . SER A 141 ? 0.2737 0.3111 0.4852 0.0194  0.0173  0.0622  138 SER A CA    
1161 C C     . SER A 141 ? 0.2458 0.2765 0.4401 0.0156  0.0087  0.0559  138 SER A C     
1162 O O     . SER A 141 ? 0.2102 0.2338 0.3882 0.0153  0.0118  0.0532  138 SER A O     
1163 C CB    . SER A 141 ? 0.3298 0.3732 0.5612 0.0162  0.0196  0.0662  138 SER A CB    
1164 O OG    . SER A 141 ? 0.3728 0.4187 0.6129 0.0103  0.0085  0.0637  138 SER A OG    
1165 N N     . ALA A 142 ? 0.2048 0.2381 0.4028 0.0132  -0.0021 0.0537  139 ALA A N     
1166 C CA    . ALA A 142 ? 0.2045 0.2320 0.3872 0.0099  -0.0102 0.0481  139 ALA A CA    
1167 C C     . ALA A 142 ? 0.2012 0.2263 0.3844 0.0056  -0.0105 0.0465  139 ALA A C     
1168 O O     . ALA A 142 ? 0.2142 0.2328 0.3815 0.0039  -0.0134 0.0420  139 ALA A O     
1169 C CB    . ALA A 142 ? 0.2728 0.3037 0.4603 0.0085  -0.0217 0.0466  139 ALA A CB    
1170 N N     . ASP A 143 ? 0.2175 0.2479 0.4198 0.0042  -0.0070 0.0505  140 ASP A N     
1171 C CA    . ASP A 143 ? 0.2328 0.2608 0.4378 0.0002  -0.0068 0.0497  140 ASP A CA    
1172 C C     . ASP A 143 ? 0.2443 0.2649 0.4317 0.0021  0.0016  0.0491  140 ASP A C     
1173 O O     . ASP A 143 ? 0.2481 0.2641 0.4309 -0.0006 0.0010  0.0472  140 ASP A O     
1174 C CB    . ASP A 143 ? 0.3151 0.3506 0.5463 -0.0017 -0.0037 0.0553  140 ASP A CB    
1175 C CG    . ASP A 143 ? 0.4909 0.5345 0.7419 -0.0044 -0.0136 0.0556  140 ASP A CG    
1176 O OD1   . ASP A 143 ? 0.5094 0.5510 0.7521 -0.0057 -0.0242 0.0507  140 ASP A OD1   
1177 O OD2   . ASP A 143 ? 0.5593 0.6112 0.8342 -0.0051 -0.0108 0.0610  140 ASP A OD2   
1178 N N     . LEU A 144 ? 0.2186 0.2375 0.3960 0.0069  0.0089  0.0504  141 LEU A N     
1179 C CA    . LEU A 144 ? 0.1717 0.1838 0.3315 0.0092  0.0160  0.0494  141 LEU A CA    
1180 C C     . LEU A 144 ? 0.2002 0.2058 0.3391 0.0086  0.0108  0.0435  141 LEU A C     
1181 O O     . LEU A 144 ? 0.2245 0.2247 0.3487 0.0098  0.0147  0.0419  141 LEU A O     
1182 C CB    . LEU A 144 ? 0.2039 0.2162 0.3610 0.0148  0.0257  0.0527  141 LEU A CB    
1183 C CG    . LEU A 144 ? 0.2559 0.2741 0.4316 0.0165  0.0338  0.0594  141 LEU A CG    
1184 C CD1   . LEU A 144 ? 0.2914 0.3076 0.4594 0.0230  0.0441  0.0618  141 LEU A CD1   
1185 C CD2   . LEU A 144 ? 0.2554 0.2729 0.4369 0.0135  0.0363  0.0614  141 LEU A CD2   
1186 N N     . LEU A 145 ? 0.1876 0.1942 0.3258 0.0070  0.0021  0.0407  142 LEU A N     
1187 C CA    . LEU A 145 ? 0.1482 0.1494 0.2680 0.0067  -0.0024 0.0359  142 LEU A CA    
1188 C C     . LEU A 145 ? 0.1907 0.1915 0.3107 0.0031  -0.0122 0.0325  142 LEU A C     
1189 O O     . LEU A 145 ? 0.2000 0.2005 0.3146 0.0033  -0.0183 0.0305  142 LEU A O     
1190 C CB    . LEU A 145 ? 0.1825 0.1835 0.2970 0.0099  -0.0022 0.0360  142 LEU A CB    
1191 C CG    . LEU A 145 ? 0.1809 0.1802 0.2915 0.0140  0.0071  0.0381  142 LEU A CG    
1192 C CD1   . LEU A 145 ? 0.1949 0.1944 0.3049 0.0172  0.0073  0.0390  142 LEU A CD1   
1193 C CD2   . LEU A 145 ? 0.1989 0.1917 0.2921 0.0144  0.0103  0.0352  142 LEU A CD2   
1194 N N     . PRO A 146 ? 0.1979 0.1979 0.3233 0.0001  -0.0137 0.0318  143 PRO A N     
1195 C CA    . PRO A 146 ? 0.1773 0.1766 0.3047 -0.0033 -0.0233 0.0283  143 PRO A CA    
1196 C C     . PRO A 146 ? 0.2288 0.2222 0.3371 -0.0033 -0.0278 0.0234  143 PRO A C     
1197 O O     . PRO A 146 ? 0.2276 0.2200 0.3350 -0.0050 -0.0362 0.0202  143 PRO A O     
1198 C CB    . PRO A 146 ? 0.2152 0.2137 0.3529 -0.0062 -0.0216 0.0293  143 PRO A CB    
1199 C CG    . PRO A 146 ? 0.2214 0.2174 0.3522 -0.0038 -0.0114 0.0317  143 PRO A CG    
1200 C CD    . PRO A 146 ? 0.1960 0.1953 0.3262 -0.0001 -0.0062 0.0345  143 PRO A CD    
1201 N N     . SER A 147 ? 0.1652 0.1549 0.2586 -0.0012 -0.0226 0.0226  144 SER A N     
1202 C CA    . SER A 147 ? 0.1303 0.1153 0.2070 -0.0010 -0.0259 0.0186  144 SER A CA    
1203 C C     . SER A 147 ? 0.1629 0.1470 0.2283 0.0015  -0.0233 0.0188  144 SER A C     
1204 O O     . SER A 147 ? 0.1820 0.1626 0.2337 0.0020  -0.0233 0.0164  144 SER A O     
1205 C CB    . SER A 147 ? 0.2019 0.1826 0.2718 -0.0018 -0.0231 0.0169  144 SER A CB    
1206 O OG    . SER A 147 ? 0.2315 0.2119 0.2982 0.0000  -0.0150 0.0191  144 SER A OG    
1207 N N     . THR A 148 ? 0.1569 0.1443 0.2290 0.0032  -0.0211 0.0218  145 THR A N     
1208 C CA    . THR A 148 ? 0.1259 0.1118 0.1893 0.0056  -0.0182 0.0223  145 THR A CA    
1209 C C     . THR A 148 ? 0.1740 0.1603 0.2349 0.0064  -0.0238 0.0222  145 THR A C     
1210 O O     . THR A 148 ? 0.1889 0.1789 0.2600 0.0064  -0.0284 0.0236  145 THR A O     
1211 C CB    . THR A 148 ? 0.1806 0.1683 0.2511 0.0078  -0.0114 0.0256  145 THR A CB    
1212 O OG1   . THR A 148 ? 0.1700 0.1564 0.2394 0.0079  -0.0055 0.0258  145 THR A OG1   
1213 C CG2   . THR A 148 ? 0.1681 0.1532 0.2304 0.0103  -0.0088 0.0257  145 THR A CG2   
1214 N N     . TYR A 149 ? 0.1594 0.1419 0.2069 0.0071  -0.0234 0.0209  146 TYR A N     
1215 C CA    . TYR A 149 ? 0.1223 0.1040 0.1651 0.0086  -0.0270 0.0217  146 TYR A CA    
1216 C C     . TYR A 149 ? 0.1894 0.1695 0.2308 0.0106  -0.0217 0.0237  146 TYR A C     
1217 O O     . TYR A 149 ? 0.1938 0.1713 0.2302 0.0104  -0.0164 0.0228  146 TYR A O     
1218 C CB    . TYR A 149 ? 0.1611 0.1392 0.1899 0.0081  -0.0292 0.0194  146 TYR A CB    
1219 C CG    . TYR A 149 ? 0.1650 0.1433 0.1923 0.0072  -0.0360 0.0171  146 TYR A CG    
1220 C CD1   . TYR A 149 ? 0.2159 0.1943 0.2406 0.0085  -0.0423 0.0175  146 TYR A CD1   
1221 C CD2   . TYR A 149 ? 0.2205 0.1982 0.2483 0.0053  -0.0363 0.0145  146 TYR A CD2   
1222 C CE1   . TYR A 149 ? 0.2399 0.2177 0.2620 0.0080  -0.0492 0.0147  146 TYR A CE1   
1223 C CE2   . TYR A 149 ? 0.2501 0.2267 0.2762 0.0046  -0.0429 0.0118  146 TYR A CE2   
1224 C CZ    . TYR A 149 ? 0.2629 0.2394 0.2856 0.0059  -0.0496 0.0116  146 TYR A CZ    
1225 O OH    . TYR A 149 ? 0.3487 0.3232 0.3680 0.0056  -0.0568 0.0083  146 TYR A OH    
1226 N N     . ILE A 150 ? 0.1409 0.1220 0.1863 0.0126  -0.0235 0.0262  147 ILE A N     
1227 C CA    . ILE A 150 ? 0.1217 0.0997 0.1647 0.0147  -0.0191 0.0278  147 ILE A CA    
1228 C C     . ILE A 150 ? 0.1493 0.1236 0.1819 0.0151  -0.0214 0.0282  147 ILE A C     
1229 O O     . ILE A 150 ? 0.1780 0.1535 0.2113 0.0165  -0.0264 0.0299  147 ILE A O     
1230 C CB    . ILE A 150 ? 0.1354 0.1164 0.1904 0.0174  -0.0184 0.0311  147 ILE A CB    
1231 C CG1   . ILE A 150 ? 0.1880 0.1741 0.2557 0.0171  -0.0162 0.0318  147 ILE A CG1   
1232 C CG2   . ILE A 150 ? 0.1985 0.1747 0.2501 0.0198  -0.0130 0.0322  147 ILE A CG2   
1233 C CD1   . ILE A 150 ? 0.1979 0.1815 0.2627 0.0171  -0.0088 0.0306  147 ILE A CD1   
1234 N N     . GLU A 151 ? 0.1622 0.1321 0.1853 0.0141  -0.0179 0.0268  148 GLU A N     
1235 C CA    . GLU A 151 ? 0.1282 0.0948 0.1420 0.0142  -0.0192 0.0276  148 GLU A CA    
1236 C C     . GLU A 151 ? 0.2068 0.1712 0.2225 0.0169  -0.0195 0.0312  148 GLU A C     
1237 O O     . GLU A 151 ? 0.1846 0.1472 0.2052 0.0181  -0.0157 0.0320  148 GLU A O     
1238 C CB    . GLU A 151 ? 0.1789 0.1418 0.1854 0.0123  -0.0148 0.0259  148 GLU A CB    
1239 C CG    . GLU A 151 ? 0.2333 0.1929 0.2315 0.0122  -0.0148 0.0275  148 GLU A CG    
1240 C CD    . GLU A 151 ? 0.2632 0.2243 0.2552 0.0127  -0.0191 0.0279  148 GLU A CD    
1241 O OE1   . GLU A 151 ? 0.2971 0.2558 0.2836 0.0140  -0.0197 0.0307  148 GLU A OE1   
1242 O OE2   . GLU A 151 ? 0.2978 0.2618 0.2897 0.0120  -0.0216 0.0255  148 GLU A OE2   
1243 N N     . GLY A 152 ? 0.1823 0.1466 0.1937 0.0182  -0.0238 0.0332  149 GLY A N     
1244 C CA    . GLY A 152 ? 0.1983 0.1605 0.2107 0.0212  -0.0246 0.0371  149 GLY A CA    
1245 C C     . GLY A 152 ? 0.2461 0.2132 0.2669 0.0237  -0.0301 0.0390  149 GLY A C     
1246 O O     . GLY A 152 ? 0.2567 0.2228 0.2771 0.0267  -0.0325 0.0425  149 GLY A O     
1247 N N     . LEU A 153 ? 0.2092 0.1817 0.2383 0.0225  -0.0323 0.0369  150 LEU A N     
1248 C CA    . LEU A 153 ? 0.2037 0.1821 0.2439 0.0242  -0.0378 0.0385  150 LEU A CA    
1249 C C     . LEU A 153 ? 0.2346 0.2162 0.2733 0.0225  -0.0449 0.0358  150 LEU A C     
1250 O O     . LEU A 153 ? 0.2306 0.2107 0.2629 0.0198  -0.0440 0.0325  150 LEU A O     
1251 C CB    . LEU A 153 ? 0.1705 0.1526 0.2249 0.0243  -0.0338 0.0389  150 LEU A CB    
1252 C CG    . LEU A 153 ? 0.2029 0.1811 0.2587 0.0268  -0.0269 0.0411  150 LEU A CG    
1253 C CD1   . LEU A 153 ? 0.2327 0.2147 0.3014 0.0276  -0.0226 0.0415  150 LEU A CD1   
1254 C CD2   . LEU A 153 ? 0.2433 0.2202 0.2994 0.0306  -0.0295 0.0451  150 LEU A CD2   
1255 N N     . PRO A 154 ? 0.2272 0.2131 0.2717 0.0242  -0.0526 0.0371  151 PRO A N     
1256 C CA    . PRO A 154 ? 0.2741 0.2629 0.3273 0.0278  -0.0546 0.0414  151 PRO A CA    
1257 C C     . PRO A 154 ? 0.2104 0.1937 0.2517 0.0312  -0.0545 0.0446  151 PRO A C     
1258 O O     . PRO A 154 ? 0.2910 0.2696 0.3176 0.0307  -0.0549 0.0436  151 PRO A O     
1259 C CB    . PRO A 154 ? 0.2276 0.2228 0.2889 0.0278  -0.0646 0.0407  151 PRO A CB    
1260 C CG    . PRO A 154 ? 0.2274 0.2194 0.2757 0.0255  -0.0688 0.0363  151 PRO A CG    
1261 C CD    . PRO A 154 ? 0.2503 0.2384 0.2932 0.0226  -0.0605 0.0339  151 PRO A CD    
1262 N N     . GLN A 155 ? 0.2499 0.2338 0.2979 0.0348  -0.0536 0.0489  152 GLN A N     
1263 C CA    . GLN A 155 ? 0.3611 0.3395 0.3993 0.0383  -0.0532 0.0528  152 GLN A CA    
1264 C C     . GLN A 155 ? 0.4381 0.4208 0.4865 0.0429  -0.0576 0.0572  152 GLN A C     
1265 O O     . GLN A 155 ? 0.4203 0.4096 0.4846 0.0431  -0.0584 0.0574  152 GLN A O     
1266 C CB    . GLN A 155 ? 0.3696 0.3407 0.4037 0.0379  -0.0437 0.0536  152 GLN A CB    
1267 C CG    . GLN A 155 ? 0.5617 0.5290 0.5973 0.0423  -0.0416 0.0588  152 GLN A CG    
1268 C CD    . GLN A 155 ? 0.6259 0.5889 0.6670 0.0422  -0.0332 0.0587  152 GLN A CD    
1269 O OE1   . GLN A 155 ? 0.6832 0.6410 0.7180 0.0391  -0.0278 0.0560  152 GLN A OE1   
1270 N NE2   . GLN A 155 ? 0.4754 0.4407 0.5283 0.0459  -0.0323 0.0614  152 GLN A NE2   
1271 N N     . GLY A 156 ? 0.4147 0.3938 0.4542 0.0468  -0.0604 0.0611  153 GLY A N     
1272 C CA    . GLY A 156 ? 0.6611 0.6428 0.7092 0.0519  -0.0633 0.0662  153 GLY A CA    
1273 C C     . GLY A 156 ? 0.7826 0.7725 0.8369 0.0539  -0.0746 0.0666  153 GLY A C     
1274 O O     . GLY A 156 ? 0.7270 0.7192 0.7763 0.0514  -0.0809 0.0627  153 GLY A O     
1275 N N     . PRO A 157 ? 0.8665 0.8608 0.9320 0.0586  -0.0775 0.0713  154 PRO A N     
1276 C CA    . PRO A 157 ? 1.0065 1.0096 1.0803 0.0610  -0.0891 0.0723  154 PRO A CA    
1277 C C     . PRO A 157 ? 0.9493 0.9627 1.0431 0.0576  -0.0921 0.0693  154 PRO A C     
1278 O O     . PRO A 157 ? 0.9416 0.9557 1.0450 0.0550  -0.0838 0.0682  154 PRO A O     
1279 C CB    . PRO A 157 ? 0.8998 0.9031 0.9795 0.0676  -0.0887 0.0791  154 PRO A CB    
1280 C CG    . PRO A 157 ? 0.8735 0.8719 0.9582 0.0673  -0.0765 0.0802  154 PRO A CG    
1281 C CD    . PRO A 157 ? 0.8689 0.8592 0.9393 0.0622  -0.0699 0.0759  154 PRO A CD    
1282 N N     . THR A 163 ? 1.8023 1.8112 1.8628 0.0253  -0.1447 0.0192  160 THR A N     
1283 C CA    . THR A 163 ? 1.7338 1.7373 1.7893 0.0210  -0.1419 0.0136  160 THR A CA    
1284 C C     . THR A 163 ? 1.5435 1.5369 1.5716 0.0236  -0.1374 0.0118  160 THR A C     
1285 O O     . THR A 163 ? 1.5344 1.5254 1.5527 0.0266  -0.1292 0.0161  160 THR A O     
1286 C CB    . THR A 163 ? 1.7280 1.7345 1.7998 0.0168  -0.1308 0.0154  160 THR A CB    
1287 O OG1   . THR A 163 ? 1.7160 1.7165 1.7808 0.0134  -0.1277 0.0105  160 THR A OG1   
1288 C CG2   . THR A 163 ? 1.7258 1.7317 1.7940 0.0195  -0.1189 0.0210  160 THR A CG2   
1289 N N     . VAL A 164 ? 1.5550 1.5424 1.5715 0.0224  -0.1426 0.0054  161 VAL A N     
1290 C CA    . VAL A 164 ? 1.2929 1.2711 1.2838 0.0252  -0.1386 0.0034  161 VAL A CA    
1291 C C     . VAL A 164 ? 0.8896 0.8634 0.8789 0.0214  -0.1320 -0.0006 161 VAL A C     
1292 O O     . VAL A 164 ? 0.9161 0.8825 0.8859 0.0233  -0.1288 -0.0029 161 VAL A O     
1293 C CB    . VAL A 164 ? 1.2800 1.2531 1.2525 0.0292  -0.1503 -0.0007 161 VAL A CB    
1294 C CG1   . VAL A 164 ? 1.2874 1.2639 1.2575 0.0342  -0.1560 0.0041  161 VAL A CG1   
1295 C CG2   . VAL A 164 ? 1.2724 1.2454 1.2534 0.0255  -0.1617 -0.0077 161 VAL A CG2   
1296 N N     . GLN A 165 ? 0.8287 0.8071 0.8386 0.0164  -0.1296 -0.0008 162 GLN A N     
1297 C CA    . GLN A 165 ? 0.7897 0.7642 0.7999 0.0128  -0.1236 -0.0042 162 GLN A CA    
1298 C C     . GLN A 165 ? 0.5178 0.4942 0.5328 0.0117  -0.1102 0.0002  162 GLN A C     
1299 O O     . GLN A 165 ? 0.5239 0.5059 0.5498 0.0121  -0.1062 0.0054  162 GLN A O     
1300 C CB    . GLN A 165 ? 1.1762 1.1530 1.2048 0.0078  -0.1302 -0.0078 162 GLN A CB    
1301 C CG    . GLN A 165 ? 1.1958 1.1824 1.2503 0.0051  -0.1288 -0.0032 162 GLN A CG    
1302 C CD    . GLN A 165 ? 1.2345 1.2237 1.3085 0.0001  -0.1359 -0.0063 162 GLN A CD    
1303 O OE1   . GLN A 165 ? 1.2662 1.2502 1.3344 -0.0011 -0.1451 -0.0124 162 GLN A OE1   
1304 N NE2   . GLN A 165 ? 1.2226 1.2198 1.3202 -0.0028 -0.1315 -0.0021 162 GLN A NE2   
1305 N N     . LYS A 166 ? 0.4709 0.4422 0.4773 0.0107  -0.1037 -0.0020 163 LYS A N     
1306 C CA    . LYS A 166 ? 0.5035 0.4757 0.5116 0.0099  -0.0918 0.0013  163 LYS A CA    
1307 C C     . LYS A 166 ? 0.3440 0.3225 0.3737 0.0068  -0.0878 0.0043  163 LYS A C     
1308 O O     . LYS A 166 ? 0.3643 0.3461 0.3986 0.0078  -0.0814 0.0088  163 LYS A O     
1309 C CB    . LYS A 166 ? 0.6798 0.6460 0.6768 0.0093  -0.0871 -0.0021 163 LYS A CB    
1310 C CG    . LYS A 166 ? 0.7182 0.6854 0.7165 0.0085  -0.0759 0.0007  163 LYS A CG    
1311 C CD    . LYS A 166 ? 0.7972 0.7589 0.7833 0.0087  -0.0721 -0.0025 163 LYS A CD    
1312 C CE    . LYS A 166 ? 0.8398 0.7983 0.8299 0.0064  -0.0770 -0.0073 163 LYS A CE    
1313 N NZ    . LYS A 166 ? 0.8514 0.8042 0.8294 0.0074  -0.0732 -0.0103 163 LYS A NZ    
1314 N N     . GLU A 167 ? 0.3843 0.3640 0.4269 0.0033  -0.0911 0.0019  164 GLU A N     
1315 C CA    . GLU A 167 ? 0.4083 0.3939 0.4714 0.0006  -0.0866 0.0052  164 GLU A CA    
1316 C C     . GLU A 167 ? 0.3838 0.3767 0.4597 0.0019  -0.0891 0.0094  164 GLU A C     
1317 O O     . GLU A 167 ? 0.3131 0.3106 0.4003 0.0020  -0.0821 0.0137  164 GLU A O     
1318 C CB    . GLU A 167 ? 0.5072 0.4925 0.5830 -0.0036 -0.0903 0.0022  164 GLU A CB    
1319 C CG    . GLU A 167 ? 0.4547 0.4469 0.5539 -0.0063 -0.0862 0.0063  164 GLU A CG    
1320 C CD    . GLU A 167 ? 0.4735 0.4659 0.5728 -0.0058 -0.0737 0.0098  164 GLU A CD    
1321 O OE1   . GLU A 167 ? 0.4513 0.4492 0.5675 -0.0068 -0.0690 0.0138  164 GLU A OE1   
1322 O OE2   . GLU A 167 ? 0.4005 0.3877 0.4833 -0.0043 -0.0687 0.0085  164 GLU A OE2   
1323 N N     . GLY A 168 ? 0.4485 0.4422 0.5220 0.0035  -0.0991 0.0082  165 GLY A N     
1324 C CA    . GLY A 168 ? 0.4167 0.4175 0.5016 0.0054  -0.1024 0.0123  165 GLY A CA    
1325 C C     . GLY A 168 ? 0.3104 0.3111 0.3885 0.0090  -0.0941 0.0170  165 GLY A C     
1326 O O     . GLY A 168 ? 0.3307 0.3370 0.4224 0.0098  -0.0900 0.0215  165 GLY A O     
1327 N N     . MET A 169 ? 0.3067 0.3008 0.3640 0.0112  -0.0915 0.0160  166 MET A N     
1328 C CA    . MET A 169 ? 0.3185 0.3111 0.3685 0.0141  -0.0835 0.0200  166 MET A CA    
1329 C C     . MET A 169 ? 0.2671 0.2608 0.3254 0.0124  -0.0730 0.0218  166 MET A C     
1330 O O     . MET A 169 ? 0.2940 0.2897 0.3579 0.0142  -0.0679 0.0258  166 MET A O     
1331 C CB    . MET A 169 ? 0.5582 0.5436 0.5858 0.0161  -0.0821 0.0185  166 MET A CB    
1332 C CG    . MET A 169 ? 0.5914 0.5749 0.6113 0.0193  -0.0766 0.0230  166 MET A CG    
1333 S SD    . MET A 169 ? 1.5875 1.5690 1.5944 0.0242  -0.0844 0.0249  166 MET A SD    
1334 C CE    . MET A 169 ? 0.4205 0.4088 0.4428 0.0239  -0.0965 0.0237  166 MET A CE    
1335 N N     . ARG A 170 ? 0.2785 0.2703 0.3369 0.0094  -0.0698 0.0190  167 ARG A N     
1336 C CA    . ARG A 170 ? 0.2459 0.2383 0.3102 0.0082  -0.0602 0.0205  167 ARG A CA    
1337 C C     . ARG A 170 ? 0.2373 0.2363 0.3211 0.0084  -0.0584 0.0242  167 ARG A C     
1338 O O     . ARG A 170 ? 0.2202 0.2198 0.3064 0.0101  -0.0510 0.0272  167 ARG A O     
1339 C CB    . ARG A 170 ? 0.2246 0.2145 0.2875 0.0052  -0.0581 0.0172  167 ARG A CB    
1340 C CG    . ARG A 170 ? 0.2049 0.1948 0.2712 0.0046  -0.0484 0.0189  167 ARG A CG    
1341 C CD    . ARG A 170 ? 0.2095 0.1982 0.2794 0.0018  -0.0471 0.0167  167 ARG A CD    
1342 N NE    . ARG A 170 ? 0.2292 0.2225 0.3174 -0.0003 -0.0502 0.0178  167 ARG A NE    
1343 C CZ    . ARG A 170 ? 0.2628 0.2607 0.3658 -0.0003 -0.0449 0.0216  167 ARG A CZ    
1344 N NH1   . ARG A 170 ? 0.1895 0.1874 0.2896 0.0020  -0.0367 0.0242  167 ARG A NH1   
1345 N NH2   . ARG A 170 ? 0.2643 0.2669 0.3853 -0.0026 -0.0479 0.0228  167 ARG A NH2   
1346 N N     . LYS A 171 ? 0.2456 0.2496 0.3436 0.0067  -0.0651 0.0239  168 LYS A N     
1347 C CA    . LYS A 171 ? 0.2553 0.2668 0.3740 0.0068  -0.0634 0.0279  168 LYS A CA    
1348 C C     . LYS A 171 ? 0.2467 0.2612 0.3680 0.0108  -0.0636 0.0318  168 LYS A C     
1349 O O     . LYS A 171 ? 0.2283 0.2465 0.3606 0.0126  -0.0572 0.0357  168 LYS A O     
1350 C CB    . LYS A 171 ? 0.2991 0.3157 0.4343 0.0036  -0.0715 0.0268  168 LYS A CB    
1351 C CG    . LYS A 171 ? 0.4135 0.4278 0.5522 -0.0005 -0.0694 0.0242  168 LYS A CG    
1352 C CD    . LYS A 171 ? 0.5235 0.5444 0.6851 -0.0039 -0.0753 0.0248  168 LYS A CD    
1353 C CE    . LYS A 171 ? 0.6016 0.6197 0.7686 -0.0081 -0.0726 0.0232  168 LYS A CE    
1354 N NZ    . LYS A 171 ? 0.6351 0.6463 0.7905 -0.0104 -0.0807 0.0169  168 LYS A NZ    
1355 N N     . GLN A 172 ? 0.2490 0.2616 0.3598 0.0128  -0.0708 0.0310  169 GLN A N     
1356 C CA    . GLN A 172 ? 0.2634 0.2780 0.3753 0.0171  -0.0713 0.0350  169 GLN A CA    
1357 C C     . GLN A 172 ? 0.2364 0.2465 0.3410 0.0193  -0.0607 0.0372  169 GLN A C     
1358 O O     . GLN A 172 ? 0.2546 0.2675 0.3683 0.0222  -0.0566 0.0411  169 GLN A O     
1359 C CB    . GLN A 172 ? 0.4145 0.4263 0.5128 0.0192  -0.0801 0.0339  169 GLN A CB    
1360 C CG    . GLN A 172 ? 0.6455 0.6622 0.7520 0.0182  -0.0924 0.0321  169 GLN A CG    
1361 C CD    . GLN A 172 ? 0.8554 0.8767 0.9670 0.0224  -0.0988 0.0358  169 GLN A CD    
1362 O OE1   . GLN A 172 ? 0.9271 0.9478 1.0372 0.0261  -0.0934 0.0401  169 GLN A OE1   
1363 N NE2   . GLN A 172 ? 0.9066 0.9323 1.0243 0.0219  -0.1109 0.0341  169 GLN A NE2   
1364 N N     . GLY A 173 ? 0.2596 0.2627 0.3479 0.0182  -0.0566 0.0346  170 GLY A N     
1365 C CA    . GLY A 173 ? 0.2259 0.2241 0.3068 0.0196  -0.0475 0.0358  170 GLY A CA    
1366 C C     . GLY A 173 ? 0.1922 0.1926 0.2841 0.0193  -0.0396 0.0369  170 GLY A C     
1367 O O     . GLY A 173 ? 0.1911 0.1903 0.2849 0.0220  -0.0336 0.0394  170 GLY A O     
1368 N N     . LEU A 174 ? 0.1875 0.1906 0.2863 0.0162  -0.0395 0.0352  171 LEU A N     
1369 C CA    . LEU A 174 ? 0.1777 0.1830 0.2866 0.0162  -0.0316 0.0368  171 LEU A CA    
1370 C C     . LEU A 174 ? 0.2105 0.2223 0.3367 0.0191  -0.0304 0.0412  171 LEU A C     
1371 O O     . LEU A 174 ? 0.1974 0.2087 0.3266 0.0217  -0.0223 0.0434  171 LEU A O     
1372 C CB    . LEU A 174 ? 0.1716 0.1784 0.2856 0.0125  -0.0320 0.0348  171 LEU A CB    
1373 C CG    . LEU A 174 ? 0.1766 0.1854 0.2999 0.0127  -0.0234 0.0370  171 LEU A CG    
1374 C CD1   . LEU A 174 ? 0.1862 0.1887 0.2958 0.0147  -0.0151 0.0363  171 LEU A CD1   
1375 C CD2   . LEU A 174 ? 0.2069 0.2169 0.3362 0.0088  -0.0246 0.0356  171 LEU A CD2   
1376 N N     . PHE A 175 ? 0.2036 0.2215 0.3409 0.0189  -0.0386 0.0424  172 PHE A N     
1377 C CA    . PHE A 175 ? 0.2174 0.2428 0.3729 0.0217  -0.0383 0.0470  172 PHE A CA    
1378 C C     . PHE A 175 ? 0.2084 0.2306 0.3582 0.0267  -0.0342 0.0496  172 PHE A C     
1379 O O     . PHE A 175 ? 0.2568 0.2813 0.4162 0.0300  -0.0273 0.0529  172 PHE A O     
1380 C CB    . PHE A 175 ? 0.2179 0.2504 0.3852 0.0205  -0.0496 0.0473  172 PHE A CB    
1381 C CG    . PHE A 175 ? 0.4629 0.5002 0.6435 0.0159  -0.0530 0.0460  172 PHE A CG    
1382 C CD1   . PHE A 175 ? 0.5459 0.5854 0.7371 0.0146  -0.0446 0.0477  172 PHE A CD1   
1383 C CD2   . PHE A 175 ? 0.5550 0.5941 0.7372 0.0130  -0.0647 0.0430  172 PHE A CD2   
1384 C CE1   . PHE A 175 ? 0.5825 0.6258 0.7870 0.0101  -0.0473 0.0470  172 PHE A CE1   
1385 C CE2   . PHE A 175 ? 0.6197 0.6623 0.8150 0.0083  -0.0681 0.0415  172 PHE A CE2   
1386 C CZ    . PHE A 175 ? 0.6185 0.6633 0.8256 0.0067  -0.0593 0.0437  172 PHE A CZ    
1387 N N     . GLN A 176 ? 0.1966 0.2129 0.3307 0.0276  -0.0380 0.0482  173 GLN A N     
1388 C CA    . GLN A 176 ? 0.2055 0.2172 0.3336 0.0321  -0.0342 0.0506  173 GLN A CA    
1389 C C     . GLN A 176 ? 0.2517 0.2576 0.3745 0.0332  -0.0234 0.0501  173 GLN A C     
1390 O O     . GLN A 176 ? 0.2425 0.2475 0.3698 0.0373  -0.0179 0.0528  173 GLN A O     
1391 C CB    . GLN A 176 ? 0.2283 0.2337 0.3394 0.0324  -0.0391 0.0495  173 GLN A CB    
1392 C CG    . GLN A 176 ? 0.2452 0.2555 0.3594 0.0330  -0.0501 0.0504  173 GLN A CG    
1393 C CD    . GLN A 176 ? 0.3029 0.3067 0.3999 0.0347  -0.0536 0.0507  173 GLN A CD    
1394 O OE1   . GLN A 176 ? 0.2933 0.2892 0.3765 0.0343  -0.0482 0.0497  173 GLN A OE1   
1395 N NE2   . GLN A 176 ? 0.3674 0.3746 0.4657 0.0367  -0.0627 0.0523  173 GLN A NE2   
1396 N N     . TRP A 177 ? 0.2274 0.2290 0.3400 0.0298  -0.0205 0.0464  174 TRP A N     
1397 C CA    . TRP A 177 ? 0.1760 0.1718 0.2819 0.0306  -0.0114 0.0451  174 TRP A CA    
1398 C C     . TRP A 177 ? 0.2046 0.2050 0.3243 0.0331  -0.0048 0.0477  174 TRP A C     
1399 O O     . TRP A 177 ? 0.2218 0.2187 0.3407 0.0370  0.0019  0.0489  174 TRP A O     
1400 C CB    . TRP A 177 ? 0.1576 0.1497 0.2518 0.0265  -0.0109 0.0410  174 TRP A CB    
1401 C CG    . TRP A 177 ? 0.1754 0.1623 0.2623 0.0271  -0.0027 0.0392  174 TRP A CG    
1402 C CD1   . TRP A 177 ? 0.1847 0.1733 0.2752 0.0265  0.0021  0.0388  174 TRP A CD1   
1403 C CD2   . TRP A 177 ? 0.1851 0.1636 0.2593 0.0283  0.0011  0.0375  174 TRP A CD2   
1404 N NE1   . TRP A 177 ? 0.1829 0.1650 0.2626 0.0277  0.0082  0.0368  174 TRP A NE1   
1405 C CE2   . TRP A 177 ? 0.1890 0.1648 0.2591 0.0286  0.0074  0.0356  174 TRP A CE2   
1406 C CE3   . TRP A 177 ? 0.1952 0.1681 0.2616 0.0291  -0.0004 0.0374  174 TRP A CE3   
1407 C CZ2   . TRP A 177 ? 0.1951 0.1628 0.2535 0.0295  0.0114  0.0330  174 TRP A CZ2   
1408 C CZ3   . TRP A 177 ? 0.2071 0.1718 0.2632 0.0296  0.0041  0.0352  174 TRP A CZ3   
1409 C CH2   . TRP A 177 ? 0.2237 0.1859 0.2758 0.0297  0.0095  0.0326  174 TRP A CH2   
1410 N N     . LEU A 178 ? 0.1924 0.2002 0.3247 0.0308  -0.0065 0.0486  175 LEU A N     
1411 C CA    . LEU A 178 ? 0.1597 0.1723 0.3057 0.0330  0.0007  0.0517  175 LEU A CA    
1412 C C     . LEU A 178 ? 0.3031 0.3207 0.4628 0.0378  0.0018  0.0562  175 LEU A C     
1413 O O     . LEU A 178 ? 0.3028 0.3206 0.4677 0.0419  0.0104  0.0587  175 LEU A O     
1414 C CB    . LEU A 178 ? 0.2150 0.2346 0.3735 0.0290  -0.0016 0.0522  175 LEU A CB    
1415 C CG    . LEU A 178 ? 0.2153 0.2301 0.3619 0.0250  -0.0011 0.0483  175 LEU A CG    
1416 C CD1   . LEU A 178 ? 0.2475 0.2685 0.4078 0.0210  -0.0043 0.0491  175 LEU A CD1   
1417 C CD2   . LEU A 178 ? 0.2102 0.2192 0.3469 0.0274  0.0090  0.0479  175 LEU A CD2   
1418 N N     . ASP A 179 ? 0.2713 0.2927 0.4361 0.0378  -0.0067 0.0574  176 ASP A N     
1419 C CA    . ASP A 179 ? 0.3663 0.3930 0.5449 0.0427  -0.0067 0.0620  176 ASP A CA    
1420 C C     . ASP A 179 ? 0.3742 0.3927 0.5430 0.0479  0.0007  0.0625  176 ASP A C     
1421 O O     . ASP A 179 ? 0.3809 0.4022 0.5606 0.0530  0.0062  0.0663  176 ASP A O     
1422 C CB    . ASP A 179 ? 0.4167 0.4476 0.5989 0.0421  -0.0181 0.0629  176 ASP A CB    
1423 C CG    . ASP A 179 ? 0.5851 0.6263 0.7838 0.0383  -0.0258 0.0634  176 ASP A CG    
1424 O OD1   . ASP A 179 ? 0.6427 0.6900 0.8562 0.0372  -0.0212 0.0651  176 ASP A OD1   
1425 O OD2   . ASP A 179 ? 0.6305 0.6734 0.8274 0.0366  -0.0364 0.0622  176 ASP A OD2   
1426 N N     . SER A 180 ? 0.2873 0.2954 0.4362 0.0466  0.0009  0.0587  177 SER A N     
1427 C CA    . SER A 180 ? 0.4503 0.4487 0.5885 0.0508  0.0066  0.0583  177 SER A CA    
1428 C C     . SER A 180 ? 0.3615 0.3541 0.4934 0.0524  0.0166  0.0563  177 SER A C     
1429 O O     . SER A 180 ? 0.4830 0.4676 0.6080 0.0565  0.0221  0.0558  177 SER A O     
1430 C CB    . SER A 180 ? 0.5007 0.4906 0.6217 0.0484  0.0021  0.0554  177 SER A CB    
1431 O OG    . SER A 180 ? 0.5625 0.5568 0.6867 0.0477  -0.0069 0.0574  177 SER A OG    
1432 N N     A LEU A 181 ? 0.2469 0.2425 0.3799 0.0494  0.0189  0.0550  178 LEU A N     
1433 N N     B LEU A 181 ? 0.2612 0.2573 0.3948 0.0493  0.0184  0.0551  178 LEU A N     
1434 C CA    A LEU A 181 ? 0.2147 0.2040 0.3385 0.0511  0.0277  0.0528  178 LEU A CA    
1435 C CA    B LEU A 181 ? 0.2485 0.2403 0.3763 0.0510  0.0275  0.0536  178 LEU A CA    
1436 C C     A LEU A 181 ? 0.3586 0.3482 0.4900 0.0579  0.0367  0.0559  178 LEU A C     
1437 C C     B LEU A 181 ? 0.3304 0.3292 0.4748 0.0558  0.0342  0.0584  178 LEU A C     
1438 O O     A LEU A 181 ? 0.3768 0.3756 0.5263 0.0603  0.0374  0.0607  178 LEU A O     
1439 O O     B LEU A 181 ? 0.3515 0.3455 0.4922 0.0609  0.0429  0.0586  178 LEU A O     
1440 C CB    A LEU A 181 ? 0.2819 0.2747 0.4059 0.0471  0.0284  0.0515  178 LEU A CB    
1441 C CB    B LEU A 181 ? 0.2730 0.2655 0.3951 0.0458  0.0263  0.0508  178 LEU A CB    
1442 C CG    A LEU A 181 ? 0.2690 0.2570 0.3781 0.0417  0.0237  0.0468  178 LEU A CG    
1443 C CG    B LEU A 181 ? 0.2556 0.2416 0.3656 0.0469  0.0339  0.0481  178 LEU A CG    
1444 C CD1   A LEU A 181 ? 0.1972 0.1887 0.3083 0.0389  0.0256  0.0464  178 LEU A CD1   
1445 C CD1   B LEU A 181 ? 0.2288 0.2036 0.3200 0.0468  0.0335  0.0434  178 LEU A CD1   
1446 C CD2   A LEU A 181 ? 0.2450 0.2219 0.3361 0.0428  0.0265  0.0428  178 LEU A CD2   
1447 C CD2   B LEU A 181 ? 0.2022 0.1916 0.3121 0.0424  0.0327  0.0472  178 LEU A CD2   
1448 N N     A GLN A 182 ? 0.2983 0.2779 0.4160 0.0611  0.0434  0.0530  179 GLN A N     
1449 N N     B GLN A 182 ? 0.2731 0.2834 0.4363 0.0541  0.0301  0.0622  179 GLN A N     
1450 C CA    A GLN A 182 ? 0.3339 0.3123 0.4558 0.0681  0.0531  0.0553  179 GLN A CA    
1451 C CA    B GLN A 182 ? 0.1620 0.1813 0.3451 0.0581  0.0358  0.0677  179 GLN A CA    
1452 C C     A GLN A 182 ? 0.4425 0.4197 0.5584 0.0688  0.0603  0.0542  179 GLN A C     
1453 C C     B GLN A 182 ? 0.3602 0.3795 0.5495 0.0648  0.0384  0.0708  179 GLN A C     
1454 O O     A GLN A 182 ? 0.4438 0.4107 0.5422 0.0701  0.0639  0.0497  179 GLN A O     
1455 O O     B GLN A 182 ? 0.3838 0.4048 0.5809 0.0705  0.0475  0.0742  179 GLN A O     
1456 C CB    A GLN A 182 ? 0.6599 0.6266 0.7706 0.0728  0.0559  0.0530  179 GLN A CB    
1457 C CB    B GLN A 182 ? 0.4454 0.4772 0.6484 0.0537  0.0290  0.0705  179 GLN A CB    
1458 C CG    A GLN A 182 ? 0.6947 0.6598 0.8099 0.0811  0.0659  0.0555  179 GLN A CG    
1459 C CG    B GLN A 182 ? 0.4587 0.5020 0.6867 0.0575  0.0329  0.0770  179 GLN A CG    
1460 C CD    A GLN A 182 ? 0.7087 0.6874 0.8476 0.0840  0.0674  0.0626  179 GLN A CD    
1461 C CD    B GLN A 182 ? 0.4522 0.5077 0.7008 0.0526  0.0239  0.0793  179 GLN A CD    
1462 O OE1   A GLN A 182 ? 0.6819 0.6693 0.8314 0.0837  0.0711  0.0656  179 GLN A OE1   
1463 O OE1   B GLN A 182 ? 0.3853 0.4403 0.6297 0.0463  0.0169  0.0760  179 GLN A OE1   
1464 N NE2   A GLN A 182 ? 0.7168 0.6974 0.8650 0.0867  0.0643  0.0655  179 GLN A NE2   
1465 N NE2   B GLN A 182 ? 0.4845 0.5508 0.7559 0.0557  0.0236  0.0848  179 GLN A NE2   
1466 N N     A ILE A 183 ? 0.3740 0.3618 0.5048 0.0679  0.0623  0.0584  180 ILE A N     
1467 N N     B ILE A 183 ? 0.3313 0.3482 0.5166 0.0645  0.0308  0.0701  180 ILE A N     
1468 C CA    A ILE A 183 ? 0.4633 0.4509 0.5897 0.0681  0.0689  0.0584  180 ILE A CA    
1469 C CA    B ILE A 183 ? 0.3065 0.3227 0.4974 0.0709  0.0322  0.0733  180 ILE A CA    
1470 C C     A ILE A 183 ? 0.4977 0.4804 0.6193 0.0763  0.0805  0.0596  180 ILE A C     
1471 C C     B ILE A 183 ? 0.2613 0.2636 0.4348 0.0754  0.0397  0.0705  180 ILE A C     
1472 O O     A ILE A 183 ? 0.4525 0.4334 0.5676 0.0780  0.0872  0.0598  180 ILE A O     
1473 O O     B ILE A 183 ? 0.2807 0.2800 0.4568 0.0815  0.0427  0.0727  180 ILE A O     
1474 C CB    A ILE A 183 ? 0.5264 0.5263 0.6717 0.0645  0.0678  0.0631  180 ILE A CB    
1475 C CB    B ILE A 183 ? 0.4413 0.4600 0.6341 0.0693  0.0210  0.0742  180 ILE A CB    
1476 C CG1   A ILE A 183 ? 0.5593 0.5700 0.7284 0.0665  0.0672  0.0689  180 ILE A CG1   
1477 C CG1   B ILE A 183 ? 0.4780 0.5103 0.6886 0.0653  0.0126  0.0765  180 ILE A CG1   
1478 C CG2   A ILE A 183 ? 0.5294 0.5307 0.6718 0.0565  0.0577  0.0601  180 ILE A CG2   
1479 C CG2   B ILE A 183 ? 0.4292 0.4465 0.6270 0.0763  0.0224  0.0779  180 ILE A CG2   
1480 C CD1   A ILE A 183 ? 0.5971 0.6090 0.7734 0.0747  0.0784  0.0733  180 ILE A CD1   
1481 C CD1   B ILE A 183 ? 0.4979 0.5324 0.7082 0.0639  0.0008  0.0769  180 ILE A CD1   
1482 N N     A ASP A 184 ? 0.5240 0.5038 0.6480 0.0817  0.0829  0.0605  181 ASP A N     
1483 N N     B ASP A 184 ? 0.2343 0.2278 0.3903 0.0725  0.0423  0.0654  181 ASP A N     
1484 C CA    A ASP A 184 ? 0.7083 0.6826 0.8276 0.0904  0.0939  0.0614  181 ASP A CA    
1485 C CA    B ASP A 184 ? 0.4227 0.4023 0.5612 0.0759  0.0485  0.0616  181 ASP A CA    
1486 C C     A ASP A 184 ? 0.5012 0.4601 0.5942 0.0923  0.0960  0.0544  181 ASP A C     
1487 C C     B ASP A 184 ? 0.2232 0.1939 0.3509 0.0749  0.0428  0.0595  181 ASP A C     
1488 O O     A ASP A 184 ? 0.4923 0.4453 0.5760 0.0989  0.1052  0.0539  181 ASP A O     
1489 O O     B ASP A 184 ? 0.2185 0.1793 0.3393 0.0795  0.0467  0.0586  181 ASP A O     
1490 C CB    A ASP A 184 ? 1.0856 1.0614 1.2165 0.0957  0.0951  0.0646  181 ASP A CB    
1491 C CB    B ASP A 184 ? 0.7177 0.6963 0.8628 0.0843  0.0584  0.0645  181 ASP A CB    
1492 C CG    A ASP A 184 ? 1.1256 1.0945 1.2507 0.1055  0.1067  0.0651  181 ASP A CG    
1493 C CG    B ASP A 184 ? 0.7298 0.6932 0.8557 0.0880  0.0652  0.0596  181 ASP A CG    
1494 O OD1   A ASP A 184 ? 1.1382 1.1072 1.2596 0.1090  0.1156  0.0665  181 ASP A OD1   
1495 O OD1   B ASP A 184 ? 0.7321 0.6922 0.8487 0.0878  0.0704  0.0568  181 ASP A OD1   
1496 O OD2   A ASP A 184 ? 1.1421 1.1049 1.2656 0.1101  0.1073  0.0643  181 ASP A OD2   
1497 O OD2   B ASP A 184 ? 0.7259 0.6802 0.8460 0.0912  0.0650  0.0586  181 ASP A OD2   
1498 N N     A ASN A 185 ? 0.4485 0.4011 0.5299 0.0867  0.0872  0.0489  182 ASN A N     
1499 N N     B ASN A 185 ? 0.2069 0.1807 0.3330 0.0691  0.0337  0.0588  182 ASN A N     
1500 C CA    A ASN A 185 ? 0.4414 0.3797 0.4997 0.0875  0.0873  0.0417  182 ASN A CA    
1501 C CA    B ASN A 185 ? 0.2676 0.2336 0.3834 0.0676  0.0284  0.0576  182 ASN A CA    
1502 C C     A ASN A 185 ? 0.3745 0.3118 0.4210 0.0822  0.0841  0.0382  182 ASN A C     
1503 C C     B ASN A 185 ? 0.2669 0.2243 0.3649 0.0622  0.0270  0.0521  182 ASN A C     
1504 O O     A ASN A 185 ? 0.3412 0.2820 0.3893 0.0750  0.0759  0.0371  182 ASN A O     
1505 O O     B ASN A 185 ? 0.2410 0.1913 0.3300 0.0606  0.0236  0.0510  182 ASN A O     
1506 C CB    A ASN A 185 ? 0.3792 0.3100 0.4330 0.0854  0.0806  0.0383  182 ASN A CB    
1507 C CB    B ASN A 185 ? 0.2447 0.2193 0.3698 0.0660  0.0194  0.0613  182 ASN A CB    
1508 C CG    A ASN A 185 ? 0.4414 0.3575 0.4736 0.0853  0.0796  0.0307  182 ASN A CG    
1509 C CG    B ASN A 185 ? 0.1782 0.1600 0.3204 0.0719  0.0197  0.0670  182 ASN A CG    
1510 O OD1   A ASN A 185 ? 0.4594 0.3698 0.4785 0.0884  0.0845  0.0276  182 ASN A OD1   
1511 O OD1   B ASN A 185 ? 0.2532 0.2308 0.3978 0.0779  0.0266  0.0684  182 ASN A OD1   
1512 N ND2   A ASN A 185 ? 0.4784 0.3882 0.5067 0.0818  0.0731  0.0277  182 ASN A ND2   
1513 N ND2   B ASN A 185 ? 0.1946 0.1874 0.3489 0.0705  0.0118  0.0701  182 ASN A ND2   
1514 N N     A LEU A 186 ? 0.3425 0.2747 0.3765 0.0864  0.0908  0.0366  183 LEU A N     
1515 N N     B LEU A 186 ? 0.2647 0.2232 0.3587 0.0597  0.0298  0.0491  183 LEU A N     
1516 C CA    A LEU A 186 ? 0.4936 0.4253 0.5166 0.0825  0.0886  0.0339  183 LEU A CA    
1517 C CA    B LEU A 186 ? 0.2680 0.2189 0.3460 0.0552  0.0292  0.0438  183 LEU A CA    
1518 C C     A LEU A 186 ? 0.3312 0.2538 0.3381 0.0780  0.0808  0.0265  183 LEU A C     
1519 C C     B LEU A 186 ? 0.2743 0.2161 0.3430 0.0584  0.0367  0.0402  183 LEU A C     
1520 O O     A LEU A 186 ? 0.3923 0.3161 0.3930 0.0732  0.0764  0.0244  183 LEU A O     
1521 O O     B LEU A 186 ? 0.2721 0.2116 0.3448 0.0643  0.0425  0.0418  183 LEU A O     
1522 C CB    A LEU A 186 ? 0.7143 0.6429 0.7274 0.0891  0.0982  0.0348  183 LEU A CB    
1523 C CB    B LEU A 186 ? 0.2418 0.1998 0.3200 0.0497  0.0255  0.0426  183 LEU A CB    
1524 C CG    A LEU A 186 ? 0.7425 0.6820 0.7711 0.0914  0.1056  0.0428  183 LEU A CG    
1525 C CG    B LEU A 186 ? 0.2449 0.2094 0.3280 0.0462  0.0170  0.0445  183 LEU A CG    
1526 C CD1   A LEU A 186 ? 0.7637 0.7104 0.8126 0.0945  0.1093  0.0484  183 LEU A CD1   
1527 C CD1   B LEU A 186 ? 0.2445 0.2170 0.3317 0.0420  0.0139  0.0439  183 LEU A CD1   
1528 C CD2   A LEU A 186 ? 0.7440 0.6786 0.7590 0.0983  0.1154  0.0434  183 LEU A CD2   
1529 C CD2   B LEU A 186 ? 0.2719 0.2293 0.3429 0.0436  0.0130  0.0427  183 LEU A CD2   
1530 N N     A THR A 187 ? 0.3274 0.2409 0.3285 0.0795  0.0792  0.0228  184 THR A N     
1531 N N     B THR A 187 ? 0.2732 0.2096 0.3289 0.0547  0.0364  0.0354  184 THR A N     
1532 C CA    A THR A 187 ? 0.4153 0.3199 0.4030 0.0752  0.0721  0.0160  184 THR A CA    
1533 C CA    B THR A 187 ? 0.2877 0.2142 0.3319 0.0574  0.0421  0.0311  184 THR A CA    
1534 C C     A THR A 187 ? 0.3817 0.2899 0.3786 0.0685  0.0640  0.0167  184 THR A C     
1535 C C     B THR A 187 ? 0.3129 0.2431 0.3543 0.0573  0.0456  0.0297  184 THR A C     
1536 O O     A THR A 187 ? 0.3778 0.2794 0.3666 0.0645  0.0583  0.0120  184 THR A O     
1537 O O     B THR A 187 ? 0.2938 0.2335 0.3420 0.0542  0.0434  0.0318  184 THR A O     
1538 C CB    A THR A 187 ? 0.6524 0.5425 0.6262 0.0804  0.0748  0.0106  184 THR A CB    
1539 C CB    B THR A 187 ? 0.2814 0.1983 0.3124 0.0533  0.0386  0.0262  184 THR A CB    
1540 O OG1   A THR A 187 ? 0.6426 0.5312 0.6261 0.0836  0.0768  0.0132  184 THR A OG1   
1541 O OG1   B THR A 187 ? 0.2022 0.1244 0.2304 0.0473  0.0341  0.0248  184 THR A OG1   
1542 C CG2   A THR A 187 ? 0.6995 0.5849 0.6613 0.0879  0.0829  0.0095  184 THR A CG2   
1543 C CG2   B THR A 187 ? 0.3673 0.2797 0.4002 0.0529  0.0353  0.0280  184 THR A CG2   
1544 N N     A SER A 188 ? 0.3696 0.2882 0.3835 0.0674  0.0633  0.0226  185 SER A N     
1545 N N     B SER A 188 ? 0.2702 0.1922 0.3009 0.0609  0.0511  0.0262  185 SER A N     
1546 C CA    A SER A 188 ? 0.2746 0.1972 0.2966 0.0619  0.0558  0.0239  185 SER A CA    
1547 C CA    B SER A 188 ? 0.2544 0.1780 0.2792 0.0614  0.0547  0.0247  185 SER A CA    
1548 C C     A SER A 188 ? 0.2299 0.1552 0.2471 0.0547  0.0492  0.0216  185 SER A C     
1549 C C     B SER A 188 ? 0.2254 0.1516 0.2447 0.0546  0.0488  0.0222  185 SER A C     
1550 O O     A SER A 188 ? 0.2393 0.1717 0.2593 0.0530  0.0495  0.0231  185 SER A O     
1551 O O     B SER A 188 ? 0.2336 0.1676 0.2572 0.0529  0.0490  0.0242  185 SER A O     
1552 C CB    A SER A 188 ? 0.2901 0.2240 0.3309 0.0627  0.0560  0.0305  185 SER A CB    
1553 C CB    B SER A 188 ? 0.3332 0.2454 0.3438 0.0666  0.0604  0.0203  185 SER A CB    
1554 O OG    A SER A 188 ? 0.3562 0.2944 0.4032 0.0575  0.0482  0.0317  185 SER A OG    
1555 O OG    B SER A 188 ? 0.3754 0.2893 0.3797 0.0681  0.0644  0.0197  185 SER A OG    
1556 N N     . PRO A 189 ? 0.2360 0.1556 0.2464 0.0507  0.0438  0.0181  186 PRO A N     
1557 C CA    . PRO A 189 ? 0.1994 0.1220 0.2057 0.0445  0.0382  0.0161  186 PRO A CA    
1558 C C     . PRO A 189 ? 0.2115 0.1450 0.2292 0.0411  0.0346  0.0202  186 PRO A C     
1559 O O     . PRO A 189 ? 0.1991 0.1371 0.2152 0.0381  0.0328  0.0197  186 PRO A O     
1560 C CB    . PRO A 189 ? 0.2454 0.1604 0.2457 0.0413  0.0339  0.0129  186 PRO A CB    
1561 C CG    . PRO A 189 ? 0.2546 0.1590 0.2495 0.0463  0.0380  0.0105  186 PRO A CG    
1562 C CD    . PRO A 189 ? 0.2658 0.1744 0.2700 0.0521  0.0435  0.0151  186 PRO A CD    
1563 N N     . ASP A 190 ? 0.2076 0.1448 0.2359 0.0418  0.0331  0.0241  187 ASP A N     
1564 C CA    . ASP A 190 ? 0.1450 0.0920 0.1835 0.0388  0.0287  0.0274  187 ASP A CA    
1565 C C     . ASP A 190 ? 0.1801 0.1345 0.2264 0.0398  0.0320  0.0298  187 ASP A C     
1566 O O     . ASP A 190 ? 0.1920 0.1523 0.2415 0.0362  0.0286  0.0303  187 ASP A O     
1567 C CB    . ASP A 190 ? 0.1916 0.1413 0.2400 0.0401  0.0261  0.0312  187 ASP A CB    
1568 C CG    . ASP A 190 ? 0.2813 0.2248 0.3232 0.0382  0.0220  0.0301  187 ASP A CG    
1569 O OD1   . ASP A 190 ? 0.2164 0.1558 0.2485 0.0345  0.0201  0.0267  187 ASP A OD1   
1570 O OD2   . ASP A 190 ? 0.3142 0.2574 0.3617 0.0404  0.0209  0.0331  187 ASP A OD2   
1571 N N     . LEU A 191 ? 0.1849 0.1386 0.2344 0.0450  0.0388  0.0315  188 LEU A N     
1572 C CA    . LEU A 191 ? 0.1510 0.1113 0.2082 0.0464  0.0432  0.0345  188 LEU A CA    
1573 C C     . LEU A 191 ? 0.1744 0.1325 0.2205 0.0445  0.0442  0.0315  188 LEU A C     
1574 O O     . LEU A 191 ? 0.1877 0.1517 0.2392 0.0422  0.0437  0.0334  188 LEU A O     
1575 C CB    . LEU A 191 ? 0.2141 0.1735 0.2759 0.0532  0.0516  0.0372  188 LEU A CB    
1576 C CG    . LEU A 191 ? 0.2435 0.2091 0.3133 0.0553  0.0581  0.0410  188 LEU A CG    
1577 C CD1   . LEU A 191 ? 0.2422 0.2191 0.3302 0.0515  0.0542  0.0453  188 LEU A CD1   
1578 C CD2   . LEU A 191 ? 0.2709 0.2349 0.3436 0.0630  0.0674  0.0437  188 LEU A CD2   
1579 N N     . GLN A 192 ? 0.2011 0.1503 0.2317 0.0454  0.0451  0.0269  189 GLN A N     
1580 C CA    . GLN A 192 ? 0.1865 0.1335 0.2057 0.0440  0.0452  0.0239  189 GLN A CA    
1581 C C     . GLN A 192 ? 0.1711 0.1226 0.1916 0.0379  0.0385  0.0233  189 GLN A C     
1582 O O     . GLN A 192 ? 0.1798 0.1345 0.1998 0.0367  0.0391  0.0240  189 GLN A O     
1583 C CB    . GLN A 192 ? 0.2250 0.1617 0.2282 0.0457  0.0456  0.0185  189 GLN A CB    
1584 C CG    . GLN A 192 ? 0.2400 0.1709 0.2387 0.0527  0.0532  0.0186  189 GLN A CG    
1585 C CD    . GLN A 192 ? 0.4146 0.3340 0.3983 0.0544  0.0526  0.0126  189 GLN A CD    
1586 O OE1   . GLN A 192 ? 0.4353 0.3512 0.4150 0.0501  0.0466  0.0091  189 GLN A OE1   
1587 N NE2   . GLN A 192 ? 0.5237 0.4368 0.4990 0.0609  0.0591  0.0114  189 GLN A NE2   
1588 N N     . LEU A 193 ? 0.1612 0.1127 0.1831 0.0344  0.0326  0.0223  190 LEU A N     
1589 C CA    . LEU A 193 ? 0.1172 0.0726 0.1397 0.0293  0.0267  0.0218  190 LEU A CA    
1590 C C     . LEU A 193 ? 0.1833 0.1467 0.2181 0.0282  0.0260  0.0254  190 LEU A C     
1591 O O     . LEU A 193 ? 0.1802 0.1463 0.2143 0.0252  0.0236  0.0249  190 LEU A O     
1592 C CB    . LEU A 193 ? 0.1684 0.1224 0.1907 0.0268  0.0214  0.0210  190 LEU A CB    
1593 C CG    . LEU A 193 ? 0.1625 0.1090 0.1742 0.0259  0.0204  0.0173  190 LEU A CG    
1594 C CD1   . LEU A 193 ? 0.1973 0.1436 0.2105 0.0232  0.0156  0.0181  190 LEU A CD1   
1595 C CD2   . LEU A 193 ? 0.1849 0.1301 0.1872 0.0238  0.0197  0.0139  190 LEU A CD2   
1596 N N     . THR A 194 ? 0.1744 0.1416 0.2214 0.0304  0.0276  0.0291  191 THR A N     
1597 C CA    . THR A 194 ? 0.1161 0.0912 0.1772 0.0290  0.0262  0.0326  191 THR A CA    
1598 C C     . THR A 194 ? 0.1651 0.1420 0.2278 0.0296  0.0312  0.0340  191 THR A C     
1599 O O     . THR A 194 ? 0.1729 0.1536 0.2408 0.0264  0.0286  0.0348  191 THR A O     
1600 C CB    . THR A 194 ? 0.1542 0.1335 0.2290 0.0318  0.0274  0.0365  191 THR A CB    
1601 O OG1   . THR A 194 ? 0.1770 0.1540 0.2495 0.0315  0.0227  0.0356  191 THR A OG1   
1602 C CG2   . THR A 194 ? 0.1623 0.1502 0.2537 0.0297  0.0248  0.0399  191 THR A CG2   
1603 N N     . VAL A 195 ? 0.1597 0.1330 0.2171 0.0340  0.0385  0.0345  192 VAL A N     
1604 C CA    . VAL A 195 ? 0.1941 0.1680 0.2504 0.0355  0.0441  0.0363  192 VAL A CA    
1605 C C     . VAL A 195 ? 0.1734 0.1445 0.2177 0.0325  0.0410  0.0328  192 VAL A C     
1606 O O     . VAL A 195 ? 0.1729 0.1465 0.2203 0.0311  0.0418  0.0346  192 VAL A O     
1607 C CB    . VAL A 195 ? 0.2081 0.1779 0.2584 0.0418  0.0528  0.0372  192 VAL A CB    
1608 C CG1   . VAL A 195 ? 0.2174 0.1870 0.2640 0.0437  0.0588  0.0394  192 VAL A CG1   
1609 C CG2   . VAL A 195 ? 0.2291 0.2029 0.2935 0.0452  0.0568  0.0415  192 VAL A CG2   
1610 N N     . GLY A 196 ? 0.1563 0.1222 0.1879 0.0315  0.0373  0.0282  193 GLY A N     
1611 C CA    . GLY A 196 ? 0.1449 0.1092 0.1668 0.0286  0.0335  0.0251  193 GLY A CA    
1612 C C     . GLY A 196 ? 0.1596 0.1288 0.1894 0.0242  0.0286  0.0260  193 GLY A C     
1613 O O     . GLY A 196 ? 0.1969 0.1668 0.2245 0.0230  0.0283  0.0259  193 GLY A O     
1614 N N     . ALA A 197 ? 0.1704 0.1426 0.2091 0.0223  0.0244  0.0268  194 ALA A N     
1615 C CA    . ALA A 197 ? 0.1200 0.0961 0.1654 0.0185  0.0190  0.0270  194 ALA A CA    
1616 C C     . ALA A 197 ? 0.1548 0.1347 0.2116 0.0182  0.0214  0.0304  194 ALA A C     
1617 O O     . ALA A 197 ? 0.1622 0.1428 0.2200 0.0154  0.0186  0.0298  194 ALA A O     
1618 C CB    . ALA A 197 ? 0.1512 0.1293 0.2024 0.0172  0.0137  0.0272  194 ALA A CB    
1619 N N     . VAL A 198 ? 0.1364 0.1184 0.2020 0.0210  0.0271  0.0342  195 VAL A N     
1620 C CA    . VAL A 198 ? 0.1307 0.1164 0.2083 0.0208  0.0307  0.0382  195 VAL A CA    
1621 C C     . VAL A 198 ? 0.1829 0.1652 0.2513 0.0213  0.0342  0.0380  195 VAL A C     
1622 O O     . VAL A 198 ? 0.1932 0.1767 0.2674 0.0187  0.0331  0.0392  195 VAL A O     
1623 C CB    . VAL A 198 ? 0.1551 0.1438 0.2433 0.0246  0.0377  0.0429  195 VAL A CB    
1624 C CG1   . VAL A 198 ? 0.1790 0.1711 0.2789 0.0247  0.0431  0.0478  195 VAL A CG1   
1625 C CG2   . VAL A 198 ? 0.1845 0.1779 0.2849 0.0240  0.0336  0.0438  195 VAL A CG2   
1626 N N     . ILE A 199 ? 0.1570 0.1346 0.2107 0.0246  0.0377  0.0362  196 ILE A N     
1627 C CA    . ILE A 199 ? 0.1515 0.1258 0.1945 0.0258  0.0406  0.0359  196 ILE A CA    
1628 C C     . ILE A 199 ? 0.1661 0.1397 0.2044 0.0220  0.0341  0.0327  196 ILE A C     
1629 O O     . ILE A 199 ? 0.1679 0.1410 0.2060 0.0215  0.0352  0.0340  196 ILE A O     
1630 C CB    . ILE A 199 ? 0.1798 0.1491 0.2073 0.0303  0.0444  0.0339  196 ILE A CB    
1631 C CG1   . ILE A 199 ? 0.1987 0.1680 0.2301 0.0352  0.0524  0.0376  196 ILE A CG1   
1632 C CG2   . ILE A 199 ? 0.2057 0.1720 0.2210 0.0314  0.0453  0.0329  196 ILE A CG2   
1633 C CD1   . ILE A 199 ? 0.2281 0.1915 0.2444 0.0398  0.0553  0.0347  196 ILE A CD1   
1634 N N     . VAL A 200 ? 0.1545 0.1279 0.1892 0.0196  0.0279  0.0289  197 VAL A N     
1635 C CA    . VAL A 200 ? 0.0907 0.0636 0.1206 0.0165  0.0223  0.0259  197 VAL A CA    
1636 C C     . VAL A 200 ? 0.1941 0.1693 0.2351 0.0134  0.0192  0.0272  197 VAL A C     
1637 O O     . VAL A 200 ? 0.1625 0.1363 0.2006 0.0121  0.0175  0.0262  197 VAL A O     
1638 C CB    . VAL A 200 ? 0.1362 0.1080 0.1591 0.0151  0.0174  0.0221  197 VAL A CB    
1639 C CG1   . VAL A 200 ? 0.1699 0.1417 0.1886 0.0124  0.0124  0.0196  197 VAL A CG1   
1640 C CG2   . VAL A 200 ? 0.2050 0.1736 0.2169 0.0176  0.0199  0.0202  197 VAL A CG2   
1641 N N     . GLU A 201 ? 0.1532 0.1317 0.2075 0.0124  0.0183  0.0294  198 GLU A N     
1642 C CA    . GLU A 201 ? 0.1072 0.0877 0.1736 0.0093  0.0153  0.0305  198 GLU A CA    
1643 C C     . GLU A 201 ? 0.1926 0.1717 0.2615 0.0100  0.0205  0.0335  198 GLU A C     
1644 O O     . GLU A 201 ? 0.1882 0.1656 0.2588 0.0077  0.0180  0.0328  198 GLU A O     
1645 C CB    . GLU A 201 ? 0.1542 0.1394 0.2367 0.0085  0.0142  0.0332  198 GLU A CB    
1646 C CG    . GLU A 201 ? 0.1718 0.1586 0.2538 0.0078  0.0080  0.0309  198 GLU A CG    
1647 C CD    . GLU A 201 ? 0.2014 0.1882 0.2850 0.0043  -0.0006 0.0280  198 GLU A CD    
1648 O OE1   . GLU A 201 ? 0.2052 0.1898 0.2885 0.0023  -0.0024 0.0267  198 GLU A OE1   
1649 O OE2   . GLU A 201 ? 0.1858 0.1742 0.2704 0.0040  -0.0058 0.0269  198 GLU A OE2   
1650 N N     . GLU A 202 ? 0.1552 0.1344 0.2239 0.0135  0.0281  0.0370  199 GLU A N     
1651 C CA    . GLU A 202 ? 0.1148 0.0925 0.1852 0.0150  0.0343  0.0410  199 GLU A CA    
1652 C C     . GLU A 202 ? 0.1842 0.1575 0.2402 0.0157  0.0336  0.0386  199 GLU A C     
1653 O O     . GLU A 202 ? 0.1842 0.1557 0.2432 0.0146  0.0341  0.0401  199 GLU A O     
1654 C CB    . GLU A 202 ? 0.1631 0.1415 0.2332 0.0197  0.0430  0.0450  199 GLU A CB    
1655 C CG    . GLU A 202 ? 0.1825 0.1662 0.2705 0.0195  0.0454  0.0490  199 GLU A CG    
1656 C CD    . GLU A 202 ? 0.2736 0.2577 0.3591 0.0249  0.0535  0.0520  199 GLU A CD    
1657 O OE1   . GLU A 202 ? 0.3266 0.3154 0.4271 0.0254  0.0564  0.0558  199 GLU A OE1   
1658 O OE2   . GLU A 202 ? 0.3354 0.3149 0.4041 0.0289  0.0568  0.0504  199 GLU A OE2   
1659 N N     . MET A 203 ? 0.1521 0.1237 0.1936 0.0175  0.0322  0.0350  200 MET A N     
1660 C CA    . MET A 203 ? 0.1194 0.0881 0.1481 0.0182  0.0307  0.0325  200 MET A CA    
1661 C C     . MET A 203 ? 0.1520 0.1203 0.1832 0.0146  0.0247  0.0301  200 MET A C     
1662 O O     . MET A 203 ? 0.1698 0.1357 0.1980 0.0150  0.0252  0.0305  200 MET A O     
1663 C CB    . MET A 203 ? 0.1801 0.1480 0.1958 0.0197  0.0290  0.0287  200 MET A CB    
1664 C CG    A MET A 203 ? 0.2001 0.1662 0.2041 0.0206  0.0271  0.0263  200 MET A CG    
1665 C CG    B MET A 203 ? 0.2208 0.1877 0.2313 0.0236  0.0340  0.0297  200 MET A CG    
1666 S SD    A MET A 203 ? 0.3330 0.2990 0.3255 0.0207  0.0234  0.0214  200 MET A SD    
1667 S SD    B MET A 203 ? 0.2465 0.2113 0.2422 0.0243  0.0303  0.0242  200 MET A SD    
1668 C CE    A MET A 203 ? 0.2101 0.1734 0.1938 0.0257  0.0289  0.0224  200 MET A CE    
1669 C CE    B MET A 203 ? 0.0910 0.0555 0.0794 0.0238  0.0274  0.0228  200 MET A CE    
1670 N N     . ARG A 204 ? 0.1362 0.1062 0.1719 0.0116  0.0191  0.0274  201 ARG A N     
1671 C CA    . ARG A 204 ? 0.1024 0.0712 0.1385 0.0088  0.0133  0.0245  201 ARG A CA    
1672 C C     . ARG A 204 ? 0.1588 0.1262 0.2061 0.0069  0.0133  0.0267  201 ARG A C     
1673 O O     . ARG A 204 ? 0.1751 0.1393 0.2198 0.0061  0.0112  0.0251  201 ARG A O     
1674 C CB    . ARG A 204 ? 0.1612 0.1317 0.1979 0.0067  0.0074  0.0215  201 ARG A CB    
1675 C CG    . ARG A 204 ? 0.1584 0.1291 0.1835 0.0081  0.0069  0.0191  201 ARG A CG    
1676 C CD    . ARG A 204 ? 0.2017 0.1736 0.2268 0.0065  0.0020  0.0170  201 ARG A CD    
1677 N NE    . ARG A 204 ? 0.1817 0.1527 0.2086 0.0045  -0.0032 0.0151  201 ARG A NE    
1678 C CZ    . ARG A 204 ? 0.1909 0.1630 0.2266 0.0027  -0.0072 0.0152  201 ARG A CZ    
1679 N NH1   . ARG A 204 ? 0.1864 0.1566 0.2220 0.0012  -0.0124 0.0128  201 ARG A NH1   
1680 N NH2   . ARG A 204 ? 0.2194 0.1944 0.2639 0.0029  -0.0062 0.0177  201 ARG A NH2   
1681 N N     . ALA A 205 ? 0.1539 0.1235 0.2143 0.0063  0.0161  0.0304  202 ALA A N     
1682 C CA    . ALA A 205 ? 0.1231 0.0914 0.1965 0.0041  0.0168  0.0331  202 ALA A CA    
1683 C C     . ALA A 205 ? 0.1440 0.1085 0.2124 0.0064  0.0225  0.0360  202 ALA A C     
1684 O O     . ALA A 205 ? 0.1672 0.1279 0.2392 0.0047  0.0211  0.0359  202 ALA A O     
1685 C CB    . ALA A 205 ? 0.1616 0.1343 0.2514 0.0032  0.0196  0.0374  202 ALA A CB    
1686 N N     . ALA A 206 ? 0.1585 0.1233 0.2179 0.0105  0.0285  0.0383  203 ALA A N     
1687 C CA    . ALA A 206 ? 0.1375 0.0988 0.1904 0.0136  0.0337  0.0413  203 ALA A CA    
1688 C C     . ALA A 206 ? 0.1585 0.1164 0.2004 0.0138  0.0296  0.0374  203 ALA A C     
1689 O O     . ALA A 206 ? 0.1893 0.1434 0.2318 0.0142  0.0310  0.0392  203 ALA A O     
1690 C CB    . ALA A 206 ? 0.1895 0.1515 0.2330 0.0185  0.0402  0.0439  203 ALA A CB    
1691 N N     . ILE A 207 ? 0.1400 0.0995 0.1726 0.0136  0.0249  0.0326  204 ILE A N     
1692 C CA    . ILE A 207 ? 0.1093 0.0666 0.1330 0.0139  0.0211  0.0291  204 ILE A CA    
1693 C C     . ILE A 207 ? 0.1610 0.1149 0.1922 0.0109  0.0175  0.0278  204 ILE A C     
1694 O O     . ILE A 207 ? 0.1681 0.1181 0.1965 0.0120  0.0180  0.0280  204 ILE A O     
1695 C CB    . ILE A 207 ? 0.1536 0.1137 0.1687 0.0136  0.0168  0.0245  204 ILE A CB    
1696 C CG1   . ILE A 207 ? 0.1769 0.1389 0.1834 0.0167  0.0199  0.0251  204 ILE A CG1   
1697 C CG2   . ILE A 207 ? 0.1640 0.1226 0.1725 0.0136  0.0131  0.0212  204 ILE A CG2   
1698 C CD1   . ILE A 207 ? 0.1904 0.1551 0.1914 0.0157  0.0162  0.0213  204 ILE A CD1   
1699 N N     . GLU A 208 ? 0.1504 0.1053 0.1909 0.0074  0.0135  0.0262  205 GLU A N     
1700 C CA    . GLU A 208 ? 0.1061 0.0569 0.1525 0.0045  0.0088  0.0238  205 GLU A CA    
1701 C C     . GLU A 208 ? 0.1532 0.0999 0.2098 0.0038  0.0124  0.0279  205 GLU A C     
1702 O O     . GLU A 208 ? 0.1849 0.1259 0.2406 0.0035  0.0110  0.0266  205 GLU A O     
1703 C CB    . GLU A 208 ? 0.1987 0.1516 0.2523 0.0011  0.0027  0.0210  205 GLU A CB    
1704 C CG    . GLU A 208 ? 0.2162 0.1640 0.2717 -0.0014 -0.0036 0.0169  205 GLU A CG    
1705 C CD    . GLU A 208 ? 0.2383 0.1878 0.2996 -0.0044 -0.0107 0.0138  205 GLU A CD    
1706 O OE1   . GLU A 208 ? 0.3050 0.2499 0.3667 -0.0062 -0.0166 0.0098  205 GLU A OE1   
1707 O OE2   . GLU A 208 ? 0.2782 0.2334 0.3430 -0.0046 -0.0105 0.0152  205 GLU A OE2   
1708 N N     . ARG A 209 ? 0.1593 0.1086 0.2257 0.0037  0.0177  0.0331  206 ARG A N     
1709 C CA    . ARG A 209 ? 0.1080 0.0537 0.1851 0.0031  0.0222  0.0381  206 ARG A CA    
1710 C C     . ARG A 209 ? 0.1692 0.1100 0.2360 0.0068  0.0263  0.0400  206 ARG A C     
1711 O O     . ARG A 209 ? 0.1902 0.1249 0.2616 0.0058  0.0264  0.0409  206 ARG A O     
1712 C CB    . ARG A 209 ? 0.1527 0.1027 0.2401 0.0037  0.0290  0.0444  206 ARG A CB    
1713 C CG    . ARG A 209 ? 0.2247 0.1713 0.3264 0.0023  0.0341  0.0504  206 ARG A CG    
1714 C CD    . ARG A 209 ? 0.3356 0.2865 0.4471 0.0039  0.0427  0.0577  206 ARG A CD    
1715 N NE    . ARG A 209 ? 0.3939 0.3442 0.4918 0.0100  0.0507  0.0618  206 ARG A NE    
1716 C CZ    . ARG A 209 ? 0.3927 0.3379 0.4865 0.0129  0.0565  0.0664  206 ARG A CZ    
1717 N NH1   . ARG A 209 ? 0.3700 0.3151 0.4500 0.0189  0.0630  0.0698  206 ARG A NH1   
1718 N NH2   . ARG A 209 ? 0.3271 0.2668 0.4300 0.0100  0.0555  0.0676  206 ARG A NH2   
1719 N N     . GLU A 210 ? 0.1523 0.0954 0.2053 0.0112  0.0293  0.0405  207 GLU A N     
1720 C CA    . GLU A 210 ? 0.1273 0.0670 0.1711 0.0156  0.0339  0.0436  207 GLU A CA    
1721 C C     . GLU A 210 ? 0.1332 0.0704 0.1658 0.0171  0.0296  0.0392  207 GLU A C     
1722 O O     . GLU A 210 ? 0.1740 0.1076 0.2008 0.0205  0.0324  0.0416  207 GLU A O     
1723 C CB    . GLU A 210 ? 0.1745 0.1177 0.2096 0.0201  0.0395  0.0469  207 GLU A CB    
1724 C CG    . GLU A 210 ? 0.1785 0.1238 0.2241 0.0197  0.0452  0.0521  207 GLU A CG    
1725 C CD    . GLU A 210 ? 0.3056 0.2535 0.3409 0.0246  0.0506  0.0545  207 GLU A CD    
1726 O OE1   . GLU A 210 ? 0.3248 0.2714 0.3455 0.0289  0.0514  0.0542  207 GLU A OE1   
1727 O OE2   . GLU A 210 ? 0.3517 0.3029 0.3935 0.0244  0.0537  0.0566  207 GLU A OE2   
1728 N N     . THR A 211 ? 0.1740 0.1130 0.2036 0.0150  0.0232  0.0332  208 THR A N     
1729 C CA    . THR A 211 ? 0.1237 0.0607 0.1438 0.0166  0.0198  0.0292  208 THR A CA    
1730 C C     . THR A 211 ? 0.1794 0.1127 0.2030 0.0135  0.0139  0.0243  208 THR A C     
1731 O O     . THR A 211 ? 0.2038 0.1336 0.2214 0.0151  0.0122  0.0218  208 THR A O     
1732 C CB    . THR A 211 ? 0.1759 0.1188 0.1847 0.0186  0.0180  0.0264  208 THR A CB    
1733 O OG1   . THR A 211 ? 0.1668 0.1130 0.1777 0.0154  0.0140  0.0229  208 THR A OG1   
1734 C CG2   . THR A 211 ? 0.2006 0.1467 0.2041 0.0218  0.0226  0.0300  208 THR A CG2   
1735 N N     . GLY A 212 ? 0.1744 0.1085 0.2071 0.0094  0.0107  0.0228  209 GLY A N     
1736 C CA    . GLY A 212 ? 0.1576 0.0886 0.1912 0.0068  0.0041  0.0173  209 GLY A CA    
1737 C C     . GLY A 212 ? 0.2273 0.1629 0.2522 0.0070  0.0000  0.0131  209 GLY A C     
1738 O O     . GLY A 212 ? 0.2669 0.2004 0.2917 0.0051  -0.0056 0.0087  209 GLY A O     
1739 N N     . PHE A 213 ? 0.1822 0.1235 0.1999 0.0092  0.0026  0.0143  210 PHE A N     
1740 C CA    . PHE A 213 ? 0.1074 0.0525 0.1168 0.0097  -0.0004 0.0108  210 PHE A CA    
1741 C C     . PHE A 213 ? 0.1834 0.1328 0.1972 0.0073  -0.0022 0.0108  210 PHE A C     
1742 O O     . PHE A 213 ? 0.2010 0.1532 0.2206 0.0070  0.0010  0.0142  210 PHE A O     
1743 C CB    . PHE A 213 ? 0.1431 0.0920 0.1432 0.0130  0.0026  0.0118  210 PHE A CB    
1744 C CG    . PHE A 213 ? 0.1440 0.0898 0.1395 0.0161  0.0045  0.0123  210 PHE A CG    
1745 C CD1   . PHE A 213 ? 0.1680 0.1163 0.1594 0.0192  0.0082  0.0153  210 PHE A CD1   
1746 C CD2   . PHE A 213 ? 0.1681 0.1082 0.1629 0.0164  0.0023  0.0098  210 PHE A CD2   
1747 C CE1   . PHE A 213 ? 0.1687 0.1145 0.1561 0.0226  0.0097  0.0162  210 PHE A CE1   
1748 C CE2   . PHE A 213 ? 0.1831 0.1201 0.1738 0.0199  0.0043  0.0105  210 PHE A CE2   
1749 C CZ    . PHE A 213 ? 0.1689 0.1092 0.1564 0.0230  0.0080  0.0140  210 PHE A CZ    
1750 N N     . GLN A 214 ? 0.1585 0.1084 0.1691 0.0062  -0.0070 0.0072  211 GLN A N     
1751 C CA    . GLN A 214 ? 0.1022 0.0562 0.1154 0.0046  -0.0091 0.0071  211 GLN A CA    
1752 C C     . GLN A 214 ? 0.1540 0.1121 0.1585 0.0062  -0.0078 0.0068  211 GLN A C     
1753 O O     . GLN A 214 ? 0.1777 0.1357 0.1740 0.0081  -0.0070 0.0056  211 GLN A O     
1754 C CB    . GLN A 214 ? 0.1990 0.1507 0.2134 0.0027  -0.0155 0.0037  211 GLN A CB    
1755 C CG    . GLN A 214 ? 0.1855 0.1335 0.2112 0.0002  -0.0180 0.0036  211 GLN A CG    
1756 C CD    . GLN A 214 ? 0.2371 0.1828 0.2638 -0.0017 -0.0256 -0.0003 211 GLN A CD    
1757 O OE1   . GLN A 214 ? 0.2442 0.1897 0.2607 -0.0003 -0.0287 -0.0033 211 GLN A OE1   
1758 N NE2   . GLN A 214 ? 0.2609 0.2049 0.3003 -0.0047 -0.0288 -0.0002 211 GLN A NE2   
1759 N N     . CYS A 215 ? 0.1484 0.1100 0.1554 0.0054  -0.0076 0.0080  212 CYS A N     
1760 C CA    . CYS A 215 ? 0.0935 0.0581 0.0934 0.0064  -0.0065 0.0078  212 CYS A CA    
1761 C C     . CYS A 215 ? 0.1558 0.1223 0.1585 0.0052  -0.0086 0.0079  212 CYS A C     
1762 O O     . CYS A 215 ? 0.1943 0.1608 0.2052 0.0038  -0.0106 0.0086  212 CYS A O     
1763 C CB    . CYS A 215 ? 0.1611 0.1274 0.1595 0.0080  -0.0018 0.0099  212 CYS A CB    
1764 S SG    . CYS A 215 ? 0.2230 0.1900 0.2302 0.0079  0.0016  0.0132  212 CYS A SG    
1765 N N     . SER A 216 ? 0.1582 0.1266 0.1550 0.0056  -0.0083 0.0075  213 SER A N     
1766 C CA    A SER A 216 ? 0.0995 0.0692 0.0981 0.0050  -0.0094 0.0082  213 SER A CA    
1767 C CA    B SER A 216 ? 0.1152 0.0850 0.1140 0.0050  -0.0093 0.0083  213 SER A CA    
1768 C C     . SER A 216 ? 0.1624 0.1335 0.1604 0.0057  -0.0055 0.0096  213 SER A C     
1769 O O     . SER A 216 ? 0.1703 0.1415 0.1646 0.0067  -0.0029 0.0094  213 SER A O     
1770 C CB    A SER A 216 ? 0.1855 0.1551 0.1775 0.0050  -0.0121 0.0069  213 SER A CB    
1771 C CB    B SER A 216 ? 0.1873 0.1569 0.1795 0.0050  -0.0121 0.0069  213 SER A CB    
1772 O OG    A SER A 216 ? 0.2119 0.1793 0.2026 0.0049  -0.0160 0.0051  213 SER A OG    
1773 O OG    B SER A 216 ? 0.1753 0.1459 0.1610 0.0056  -0.0098 0.0066  213 SER A OG    
1774 N N     . ALA A 217 ? 0.1415 0.1131 0.1428 0.0056  -0.0053 0.0107  214 ALA A N     
1775 C CA    . ALA A 217 ? 0.0922 0.0637 0.0919 0.0066  -0.0020 0.0113  214 ALA A CA    
1776 C C     . ALA A 217 ? 0.1580 0.1291 0.1581 0.0063  -0.0029 0.0117  214 ALA A C     
1777 O O     . ALA A 217 ? 0.1415 0.1131 0.1458 0.0059  -0.0057 0.0125  214 ALA A O     
1778 C CB    . ALA A 217 ? 0.1503 0.1217 0.1549 0.0079  0.0016  0.0131  214 ALA A CB    
1779 N N     . GLY A 218 ? 0.1497 0.1196 0.1457 0.0067  -0.0010 0.0111  215 GLY A N     
1780 C CA    . GLY A 218 ? 0.0858 0.0540 0.0827 0.0068  -0.0009 0.0117  215 GLY A CA    
1781 C C     . GLY A 218 ? 0.1420 0.1082 0.1396 0.0087  0.0028  0.0119  215 GLY A C     
1782 O O     . GLY A 218 ? 0.1496 0.1152 0.1432 0.0096  0.0049  0.0107  215 GLY A O     
1783 N N     . ILE A 219 ? 0.1399 0.1050 0.1419 0.0099  0.0036  0.0134  216 ILE A N     
1784 C CA    . ILE A 219 ? 0.0770 0.0394 0.0790 0.0124  0.0076  0.0135  216 ILE A CA    
1785 C C     . ILE A 219 ? 0.1368 0.0954 0.1375 0.0126  0.0073  0.0131  216 ILE A C     
1786 O O     . ILE A 219 ? 0.1600 0.1193 0.1652 0.0123  0.0053  0.0150  216 ILE A O     
1787 C CB    . ILE A 219 ? 0.1446 0.1092 0.1553 0.0145  0.0100  0.0163  216 ILE A CB    
1788 C CG1   . ILE A 219 ? 0.1690 0.1368 0.1826 0.0138  0.0103  0.0172  216 ILE A CG1   
1789 C CG2   . ILE A 219 ? 0.1653 0.1268 0.1747 0.0180  0.0153  0.0165  216 ILE A CG2   
1790 C CD1   . ILE A 219 ? 0.2085 0.1797 0.2286 0.0115  0.0058  0.0180  216 ILE A CD1   
1791 N N     . SER A 220 ? 0.1221 0.0761 0.1165 0.0131  0.0088  0.0107  217 SER A N     
1792 C CA    . SER A 220 ? 0.0760 0.0250 0.0694 0.0133  0.0090  0.0101  217 SER A CA    
1793 C C     . SER A 220 ? 0.1472 0.0906 0.1341 0.0152  0.0115  0.0071  217 SER A C     
1794 O O     . SER A 220 ? 0.1595 0.1033 0.1439 0.0176  0.0141  0.0065  217 SER A O     
1795 C CB    . SER A 220 ? 0.1597 0.1085 0.1514 0.0099  0.0057  0.0098  217 SER A CB    
1796 O OG    . SER A 220 ? 0.1775 0.1214 0.1700 0.0101  0.0059  0.0105  217 SER A OG    
1797 N N     . HIS A 221 ? 0.1642 0.1018 0.1481 0.0143  0.0107  0.0051  218 HIS A N     
1798 C CA    . HIS A 221 ? 0.1257 0.0564 0.1029 0.0162  0.0124  0.0014  218 HIS A CA    
1799 C C     . HIS A 221 ? 0.1812 0.1108 0.1521 0.0134  0.0094  -0.0026 218 HIS A C     
1800 O O     . HIS A 221 ? 0.2042 0.1279 0.1683 0.0148  0.0096  -0.0065 218 HIS A O     
1801 C CB    . HIS A 221 ? 0.1731 0.0966 0.1513 0.0172  0.0133  0.0012  218 HIS A CB    
1802 C CG    . HIS A 221 ? 0.1824 0.1061 0.1662 0.0213  0.0168  0.0045  218 HIS A CG    
1803 N ND1   . HIS A 221 ? 0.1999 0.1236 0.1826 0.0258  0.0211  0.0047  218 HIS A ND1   
1804 C CD2   . HIS A 221 ? 0.2043 0.1288 0.1953 0.0218  0.0167  0.0082  218 HIS A CD2   
1805 C CE1   . HIS A 221 ? 0.2242 0.1491 0.2145 0.0287  0.0236  0.0083  218 HIS A CE1   
1806 N NE2   . HIS A 221 ? 0.2073 0.1328 0.2027 0.0264  0.0205  0.0104  218 HIS A NE2   
1807 N N     . ASN A 222 ? 0.1525 0.0876 0.1255 0.0098  0.0065  -0.0018 219 ASN A N     
1808 C CA    . ASN A 222 ? 0.1067 0.0424 0.0759 0.0072  0.0035  -0.0051 219 ASN A CA    
1809 C C     . ASN A 222 ? 0.1745 0.1182 0.1464 0.0050  0.0018  -0.0031 219 ASN A C     
1810 O O     . ASN A 222 ? 0.1826 0.1301 0.1586 0.0052  0.0026  0.0002  219 ASN A O     
1811 C CB    . ASN A 222 ? 0.1684 0.0988 0.1384 0.0041  0.0014  -0.0071 219 ASN A CB    
1812 C CG    . ASN A 222 ? 0.1678 0.0993 0.1445 0.0017  0.0014  -0.0033 219 ASN A CG    
1813 O OD1   . ASN A 222 ? 0.1838 0.1216 0.1635 -0.0002 0.0004  -0.0009 219 ASN A OD1   
1814 N ND2   . ASN A 222 ? 0.1804 0.1052 0.1586 0.0024  0.0026  -0.0027 219 ASN A ND2   
1815 N N     . LYS A 223 ? 0.1657 0.1118 0.1351 0.0033  -0.0007 -0.0055 220 LYS A N     
1816 C CA    . LYS A 223 ? 0.1101 0.0635 0.0814 0.0020  -0.0018 -0.0039 220 LYS A CA    
1817 C C     . LYS A 223 ? 0.1501 0.1065 0.1269 -0.0007 -0.0023 -0.0011 220 LYS A C     
1818 O O     . LYS A 223 ? 0.1644 0.1252 0.1426 -0.0003 -0.0019 0.0012  220 LYS A O     
1819 C CB    . LYS A 223 ? 0.1687 0.1243 0.1370 0.0011  -0.0046 -0.0069 220 LYS A CB    
1820 C CG    . LYS A 223 ? 0.2110 0.1647 0.1718 0.0047  -0.0042 -0.0091 220 LYS A CG    
1821 C CD    . LYS A 223 ? 0.3351 0.2893 0.2921 0.0039  -0.0082 -0.0129 220 LYS A CD    
1822 C CE    . LYS A 223 ? 0.3517 0.3138 0.3113 0.0029  -0.0102 -0.0119 220 LYS A CE    
1823 N NZ    . LYS A 223 ? 0.2649 0.2279 0.2212 0.0024  -0.0148 -0.0157 220 LYS A NZ    
1824 N N     . VAL A 224 ? 0.1704 0.1238 0.1496 -0.0034 -0.0031 -0.0013 221 VAL A N     
1825 C CA    . VAL A 224 ? 0.1264 0.0825 0.1099 -0.0056 -0.0029 0.0019  221 VAL A CA    
1826 C C     . VAL A 224 ? 0.1557 0.1113 0.1399 -0.0036 -0.0015 0.0052  221 VAL A C     
1827 O O     . VAL A 224 ? 0.1844 0.1440 0.1690 -0.0036 -0.0015 0.0076  221 VAL A O     
1828 C CB    . VAL A 224 ? 0.1811 0.1337 0.1680 -0.0089 -0.0034 0.0019  221 VAL A CB    
1829 C CG1   . VAL A 224 ? 0.2392 0.1930 0.2293 -0.0100 -0.0020 0.0063  221 VAL A CG1   
1830 C CG2   . VAL A 224 ? 0.2210 0.1768 0.2097 -0.0116 -0.0058 -0.0007 221 VAL A CG2   
1831 N N     . LEU A 225 ? 0.1583 0.1089 0.1423 -0.0017 -0.0004 0.0052  222 LEU A N     
1832 C CA    . LEU A 225 ? 0.0961 0.0471 0.0819 0.0003  0.0002  0.0082  222 LEU A CA    
1833 C C     . LEU A 225 ? 0.1428 0.0985 0.1286 0.0021  0.0001  0.0086  222 LEU A C     
1834 O O     . LEU A 225 ? 0.1594 0.1176 0.1468 0.0026  -0.0009 0.0108  222 LEU A O     
1835 C CB    . LEU A 225 ? 0.1523 0.0977 0.1395 0.0024  0.0017  0.0085  222 LEU A CB    
1836 C CG    . LEU A 225 ? 0.1738 0.1133 0.1621 0.0010  0.0019  0.0093  222 LEU A CG    
1837 C CD1   . LEU A 225 ? 0.1873 0.1209 0.1767 0.0040  0.0037  0.0096  222 LEU A CD1   
1838 C CD2   . LEU A 225 ? 0.1801 0.1217 0.1699 -0.0003 0.0012  0.0132  222 LEU A CD2   
1839 N N     . ALA A 226 ? 0.1453 0.1017 0.1291 0.0032  0.0009  0.0064  223 ALA A N     
1840 C CA    . ALA A 226 ? 0.0830 0.0432 0.0676 0.0046  0.0011  0.0071  223 ALA A CA    
1841 C C     . ALA A 226 ? 0.1504 0.1148 0.1342 0.0032  -0.0007 0.0075  223 ALA A C     
1842 O O     . ALA A 226 ? 0.1591 0.1257 0.1446 0.0038  -0.0015 0.0088  223 ALA A O     
1843 C CB    . ALA A 226 ? 0.1678 0.1274 0.1494 0.0065  0.0028  0.0054  223 ALA A CB    
1844 N N     . LYS A 227 ? 0.1537 0.1193 0.1354 0.0014  -0.0014 0.0063  224 LYS A N     
1845 C CA    . LYS A 227 ? 0.1166 0.0863 0.0976 0.0005  -0.0023 0.0069  224 LYS A CA    
1846 C C     . LYS A 227 ? 0.1609 0.1304 0.1424 0.0003  -0.0029 0.0093  224 LYS A C     
1847 O O     . LYS A 227 ? 0.1852 0.1566 0.1654 0.0012  -0.0037 0.0099  224 LYS A O     
1848 C CB    . LYS A 227 ? 0.1765 0.1482 0.1571 -0.0013 -0.0026 0.0056  224 LYS A CB    
1849 C CG    A LYS A 227 ? 0.2246 0.2009 0.2053 -0.0018 -0.0027 0.0067  224 LYS A CG    
1850 C CG    B LYS A 227 ? 0.2254 0.2016 0.2061 -0.0019 -0.0027 0.0067  224 LYS A CG    
1851 C CD    A LYS A 227 ? 0.2787 0.2572 0.2574 0.0003  -0.0028 0.0064  224 LYS A CD    
1852 C CD    B LYS A 227 ? 0.2980 0.2765 0.2768 0.0003  -0.0028 0.0065  224 LYS A CD    
1853 C CE    A LYS A 227 ? 0.3507 0.3329 0.3287 0.0005  -0.0024 0.0073  224 LYS A CE    
1854 C CE    B LYS A 227 ? 0.3664 0.3488 0.3445 0.0004  -0.0024 0.0074  224 LYS A CE    
1855 N NZ    A LYS A 227 ? 0.3344 0.3202 0.3151 -0.0013 -0.0021 0.0074  224 LYS A NZ    
1856 N NZ    B LYS A 227 ? 0.3416 0.3244 0.3173 0.0027  -0.0026 0.0070  224 LYS A NZ    
1857 N N     . LEU A 228 ? 0.1507 0.1173 0.1333 -0.0006 -0.0025 0.0106  225 LEU A N     
1858 C CA    . LEU A 228 ? 0.1083 0.0743 0.0903 -0.0002 -0.0031 0.0133  225 LEU A CA    
1859 C C     . LEU A 228 ? 0.1729 0.1388 0.1556 0.0018  -0.0048 0.0139  225 LEU A C     
1860 O O     . LEU A 228 ? 0.1977 0.1648 0.1780 0.0027  -0.0065 0.0147  225 LEU A O     
1861 C CB    . LEU A 228 ? 0.1847 0.1466 0.1682 -0.0011 -0.0022 0.0150  225 LEU A CB    
1862 C CG    . LEU A 228 ? 0.2009 0.1617 0.1827 -0.0004 -0.0024 0.0186  225 LEU A CG    
1863 C CD1   . LEU A 228 ? 0.2220 0.1858 0.2011 -0.0013 -0.0013 0.0198  225 LEU A CD1   
1864 C CD2   . LEU A 228 ? 0.2236 0.1793 0.2076 -0.0009 -0.0013 0.0205  225 LEU A CD2   
1865 N N     . ALA A 229 ? 0.1609 0.1253 0.1471 0.0027  -0.0044 0.0134  226 ALA A N     
1866 C CA    . ALA A 229 ? 0.1145 0.0798 0.1041 0.0043  -0.0060 0.0142  226 ALA A CA    
1867 C C     . ALA A 229 ? 0.1774 0.1454 0.1663 0.0044  -0.0075 0.0130  226 ALA A C     
1868 O O     . ALA A 229 ? 0.1844 0.1531 0.1742 0.0050  -0.0104 0.0136  226 ALA A O     
1869 C CB    . ALA A 229 ? 0.1611 0.1251 0.1551 0.0055  -0.0040 0.0139  226 ALA A CB    
1870 N N     . CYS A 230 ? 0.1534 0.1225 0.1405 0.0039  -0.0060 0.0113  227 CYS A N     
1871 C CA    . CYS A 230 ? 0.0941 0.0649 0.0810 0.0042  -0.0070 0.0103  227 CYS A CA    
1872 C C     . CYS A 230 ? 0.1754 0.1464 0.1582 0.0044  -0.0095 0.0102  227 CYS A C     
1873 O O     . CYS A 230 ? 0.2236 0.1944 0.2073 0.0048  -0.0119 0.0095  227 CYS A O     
1874 C CB    . CYS A 230 ? 0.1507 0.1225 0.1352 0.0042  -0.0049 0.0089  227 CYS A CB    
1875 S SG    . CYS A 230 ? 0.1927 0.1655 0.1772 0.0050  -0.0053 0.0080  227 CYS A SG    
1876 N N     . GLY A 231 ? 0.1804 0.1515 0.1589 0.0041  -0.0088 0.0108  228 GLY A N     
1877 C CA    . GLY A 231 ? 0.1653 0.1364 0.1382 0.0050  -0.0102 0.0109  228 GLY A CA    
1878 C C     . GLY A 231 ? 0.2438 0.2130 0.2151 0.0060  -0.0134 0.0121  228 GLY A C     
1879 O O     . GLY A 231 ? 0.2641 0.2325 0.2292 0.0074  -0.0152 0.0118  228 GLY A O     
1880 N N     . LEU A 232 ? 0.1879 0.1564 0.1642 0.0059  -0.0143 0.0134  229 LEU A N     
1881 C CA    . LEU A 232 ? 0.1448 0.1121 0.1198 0.0072  -0.0177 0.0150  229 LEU A CA    
1882 C C     . LEU A 232 ? 0.1926 0.1599 0.1683 0.0079  -0.0226 0.0132  229 LEU A C     
1883 O O     . LEU A 232 ? 0.2366 0.2028 0.2077 0.0095  -0.0265 0.0136  229 LEU A O     
1884 C CB    . LEU A 232 ? 0.1970 0.1637 0.1780 0.0072  -0.0171 0.0171  229 LEU A CB    
1885 C CG    . LEU A 232 ? 0.2335 0.1986 0.2135 0.0064  -0.0132 0.0187  229 LEU A CG    
1886 C CD1   . LEU A 232 ? 0.2189 0.1822 0.2044 0.0070  -0.0126 0.0205  229 LEU A CD1   
1887 C CD2   . LEU A 232 ? 0.2995 0.2634 0.2722 0.0069  -0.0126 0.0207  229 LEU A CD2   
1888 N N     . ASN A 233 ? 0.1770 0.1454 0.1584 0.0069  -0.0227 0.0114  230 ASN A N     
1889 C CA    . ASN A 233 ? 0.1440 0.1121 0.1282 0.0068  -0.0275 0.0095  230 ASN A CA    
1890 C C     . ASN A 233 ? 0.2497 0.2173 0.2346 0.0060  -0.0260 0.0073  230 ASN A C     
1891 O O     . ASN A 233 ? 0.3446 0.3135 0.3371 0.0049  -0.0238 0.0076  230 ASN A O     
1892 C CB    . ASN A 233 ? 0.1783 0.1483 0.1736 0.0064  -0.0297 0.0110  230 ASN A CB    
1893 C CG    . ASN A 233 ? 0.1973 0.1676 0.1920 0.0078  -0.0317 0.0135  230 ASN A CG    
1894 O OD1   . ASN A 233 ? 0.2318 0.2013 0.2224 0.0090  -0.0370 0.0131  230 ASN A OD1   
1895 N ND2   . ASN A 233 ? 0.2023 0.1731 0.2006 0.0080  -0.0278 0.0159  230 ASN A ND2   
1896 N N     . LYS A 234 ? 0.3497 0.3154 0.3258 0.0070  -0.0264 0.0053  231 LYS A N     
1897 C CA    . LYS A 234 ? 0.2188 0.1834 0.1943 0.0069  -0.0251 0.0032  231 LYS A CA    
1898 C C     . LYS A 234 ? 0.3349 0.2958 0.3059 0.0077  -0.0303 0.0003  231 LYS A C     
1899 O O     . LYS A 234 ? 0.4312 0.3906 0.3954 0.0092  -0.0336 -0.0001 231 LYS A O     
1900 C CB    . LYS A 234 ? 0.3321 0.2975 0.3009 0.0078  -0.0206 0.0034  231 LYS A CB    
1901 C CG    . LYS A 234 ? 0.3584 0.3265 0.3317 0.0069  -0.0161 0.0047  231 LYS A CG    
1902 C CD    . LYS A 234 ? 0.4225 0.3914 0.3911 0.0079  -0.0132 0.0039  231 LYS A CD    
1903 C CE    . LYS A 234 ? 0.4095 0.3808 0.3820 0.0074  -0.0100 0.0046  231 LYS A CE    
1904 N NZ    . LYS A 234 ? 0.2608 0.2308 0.2351 0.0081  -0.0095 0.0037  231 LYS A NZ    
1905 N N     . PRO A 235 ? 0.2433 0.2020 0.2174 0.0071  -0.0312 -0.0019 232 PRO A N     
1906 C CA    . PRO A 235 ? 0.1809 0.1405 0.1622 0.0059  -0.0274 -0.0011 232 PRO A CA    
1907 C C     . PRO A 235 ? 0.1970 0.1578 0.1911 0.0037  -0.0290 0.0001  232 PRO A C     
1908 O O     . PRO A 235 ? 0.2296 0.1905 0.2278 0.0029  -0.0339 -0.0003 232 PRO A O     
1909 C CB    . PRO A 235 ? 0.2417 0.1970 0.2184 0.0069  -0.0281 -0.0040 232 PRO A CB    
1910 C CG    . PRO A 235 ? 0.3000 0.2513 0.2735 0.0071  -0.0349 -0.0071 232 PRO A CG    
1911 C CD    . PRO A 235 ? 0.2900 0.2437 0.2587 0.0080  -0.0363 -0.0057 232 PRO A CD    
1912 N N     . ASN A 236 ? 0.1783 0.1400 0.1786 0.0031  -0.0247 0.0017  233 ASN A N     
1913 C CA    . ASN A 236 ? 0.1196 0.0822 0.1328 0.0012  -0.0249 0.0034  233 ASN A CA    
1914 C C     . ASN A 236 ? 0.1458 0.1123 0.1668 0.0005  -0.0258 0.0057  233 ASN A C     
1915 O O     . ASN A 236 ? 0.1726 0.1401 0.2048 -0.0011 -0.0286 0.0064  233 ASN A O     
1916 C CB    . ASN A 236 ? 0.2044 0.1629 0.2216 -0.0002 -0.0298 0.0008  233 ASN A CB    
1917 C CG    . ASN A 236 ? 0.2138 0.1730 0.2455 -0.0023 -0.0283 0.0031  233 ASN A CG    
1918 O OD1   . ASN A 236 ? 0.2208 0.1817 0.2555 -0.0017 -0.0222 0.0063  233 ASN A OD1   
1919 N ND2   . ASN A 236 ? 0.2598 0.2174 0.3003 -0.0046 -0.0340 0.0016  233 ASN A ND2   
1920 N N     . ARG A 237 ? 0.1408 0.1094 0.1569 0.0018  -0.0234 0.0070  234 ARG A N     
1921 C CA    . ARG A 237 ? 0.0977 0.0694 0.1202 0.0018  -0.0236 0.0094  234 ARG A CA    
1922 C C     . ARG A 237 ? 0.1570 0.1297 0.1761 0.0031  -0.0179 0.0111  234 ARG A C     
1923 O O     . ARG A 237 ? 0.1676 0.1391 0.1787 0.0037  -0.0152 0.0102  234 ARG A O     
1924 C CB    . ARG A 237 ? 0.1878 0.1594 0.2064 0.0023  -0.0293 0.0085  234 ARG A CB    
1925 C CG    . ARG A 237 ? 0.1900 0.1602 0.2111 0.0013  -0.0364 0.0061  234 ARG A CG    
1926 C CD    . ARG A 237 ? 0.2483 0.2216 0.2856 -0.0005 -0.0384 0.0077  234 ARG A CD    
1927 N NE    . ARG A 237 ? 0.3002 0.2723 0.3411 -0.0018 -0.0467 0.0051  234 ARG A NE    
1928 C CZ    . ARG A 237 ? 0.3084 0.2774 0.3525 -0.0037 -0.0492 0.0025  234 ARG A CZ    
1929 N NH1   . ARG A 237 ? 0.3042 0.2711 0.3482 -0.0041 -0.0436 0.0028  234 ARG A NH1   
1930 N NH2   . ARG A 237 ? 0.3613 0.3288 0.4085 -0.0050 -0.0577 -0.0005 234 ARG A NH2   
1931 N N     . GLN A 238 ? 0.1358 0.1106 0.1616 0.0036  -0.0163 0.0135  235 GLN A N     
1932 C CA    . GLN A 238 ? 0.0786 0.0532 0.1005 0.0049  -0.0116 0.0146  235 GLN A CA    
1933 C C     . GLN A 238 ? 0.1419 0.1171 0.1650 0.0058  -0.0130 0.0159  235 GLN A C     
1934 O O     . GLN A 238 ? 0.1624 0.1395 0.1926 0.0057  -0.0166 0.0170  235 GLN A O     
1935 C CB    . GLN A 238 ? 0.1400 0.1153 0.1672 0.0059  -0.0062 0.0163  235 GLN A CB    
1936 C CG    . GLN A 238 ? 0.1672 0.1452 0.2077 0.0060  -0.0059 0.0190  235 GLN A CG    
1937 C CD    . GLN A 238 ? 0.1732 0.1517 0.2179 0.0075  0.0006  0.0214  235 GLN A CD    
1938 O OE1   . GLN A 238 ? 0.2085 0.1859 0.2520 0.0072  0.0027  0.0214  235 GLN A OE1   
1939 N NE2   . GLN A 238 ? 0.1630 0.1425 0.2119 0.0096  0.0042  0.0236  235 GLN A NE2   
1940 N N     . THR A 239 ? 0.1307 0.1041 0.1474 0.0065  -0.0103 0.0158  236 THR A N     
1941 C CA    . THR A 239 ? 0.0985 0.0712 0.1149 0.0074  -0.0114 0.0172  236 THR A CA    
1942 C C     . THR A 239 ? 0.1499 0.1206 0.1664 0.0087  -0.0067 0.0179  236 THR A C     
1943 O O     . THR A 239 ? 0.1649 0.1338 0.1758 0.0085  -0.0037 0.0164  236 THR A O     
1944 C CB    . THR A 239 ? 0.1382 0.1091 0.1454 0.0069  -0.0135 0.0164  236 THR A CB    
1945 O OG1   . THR A 239 ? 0.1785 0.1502 0.1836 0.0063  -0.0177 0.0152  236 THR A OG1   
1946 C CG2   . THR A 239 ? 0.1702 0.1397 0.1771 0.0080  -0.0146 0.0185  236 THR A CG2   
1947 N N     . LEU A 240 ? 0.1347 0.1058 0.1574 0.0104  -0.0063 0.0201  237 LEU A N     
1948 C CA    . LEU A 240 ? 0.0820 0.0501 0.1045 0.0123  -0.0020 0.0206  237 LEU A CA    
1949 C C     . LEU A 240 ? 0.1433 0.1080 0.1615 0.0125  -0.0033 0.0211  237 LEU A C     
1950 O O     . LEU A 240 ? 0.1637 0.1297 0.1848 0.0131  -0.0066 0.0232  237 LEU A O     
1951 C CB    . LEU A 240 ? 0.1453 0.1159 0.1784 0.0147  0.0001  0.0231  237 LEU A CB    
1952 C CG    . LEU A 240 ? 0.1468 0.1142 0.1803 0.0177  0.0054  0.0237  237 LEU A CG    
1953 C CD1   . LEU A 240 ? 0.1929 0.1643 0.2376 0.0201  0.0087  0.0265  237 LEU A CD1   
1954 C CD2   . LEU A 240 ? 0.1760 0.1400 0.2084 0.0190  0.0045  0.0247  237 LEU A CD2   
1955 N N     . VAL A 241 ? 0.1385 0.0988 0.1497 0.0119  -0.0009 0.0194  238 VAL A N     
1956 C CA    . VAL A 241 ? 0.1125 0.0685 0.1204 0.0118  -0.0011 0.0202  238 VAL A CA    
1957 C C     . VAL A 241 ? 0.1629 0.1140 0.1716 0.0139  0.0026  0.0198  238 VAL A C     
1958 O O     . VAL A 241 ? 0.1777 0.1259 0.1823 0.0136  0.0051  0.0170  238 VAL A O     
1959 C CB    . VAL A 241 ? 0.1594 0.1140 0.1601 0.0090  -0.0016 0.0185  238 VAL A CB    
1960 C CG1   . VAL A 241 ? 0.1808 0.1297 0.1791 0.0085  -0.0006 0.0191  238 VAL A CG1   
1961 C CG2   . VAL A 241 ? 0.1830 0.1414 0.1819 0.0080  -0.0050 0.0193  238 VAL A CG2   
1962 N N     . SER A 242 ? 0.1387 0.0888 0.1526 0.0164  0.0028  0.0224  239 SER A N     
1963 C CA    . SER A 242 ? 0.1128 0.0574 0.1274 0.0192  0.0066  0.0221  239 SER A CA    
1964 C C     . SER A 242 ? 0.1636 0.1007 0.1727 0.0180  0.0069  0.0212  239 SER A C     
1965 O O     . SER A 242 ? 0.1665 0.1033 0.1730 0.0156  0.0045  0.0221  239 SER A O     
1966 C CB    . SER A 242 ? 0.2110 0.1578 0.2344 0.0227  0.0067  0.0258  239 SER A CB    
1967 O OG    . SER A 242 ? 0.2233 0.1700 0.2472 0.0224  0.0031  0.0285  239 SER A OG    
1968 N N     . HIS A 243 ? 0.1584 0.1261 0.1518 0.0205  -0.0040 0.0193  240 HIS A N     
1969 C CA    . HIS A 243 ? 0.1152 0.0788 0.1034 0.0202  -0.0028 0.0185  240 HIS A CA    
1970 C C     . HIS A 243 ? 0.1651 0.1316 0.1548 0.0217  -0.0015 0.0190  240 HIS A C     
1971 O O     . HIS A 243 ? 0.1851 0.1512 0.1736 0.0207  -0.0021 0.0175  240 HIS A O     
1972 C CB    . HIS A 243 ? 0.1864 0.1425 0.1672 0.0208  0.0001  0.0196  240 HIS A CB    
1973 C CG    . HIS A 243 ? 0.2043 0.1549 0.1788 0.0199  0.0012  0.0186  240 HIS A CG    
1974 N ND1   . HIS A 243 ? 0.2595 0.2081 0.2318 0.0171  -0.0011 0.0165  240 HIS A ND1   
1975 C CD2   . HIS A 243 ? 0.2872 0.2339 0.2572 0.0214  0.0044  0.0195  240 HIS A CD2   
1976 C CE1   . HIS A 243 ? 0.2749 0.2184 0.2413 0.0165  0.0006  0.0161  240 HIS A CE1   
1977 N NE2   . HIS A 243 ? 0.2976 0.2393 0.2622 0.0191  0.0040  0.0179  240 HIS A NE2   
1978 N N     . GLY A 244 ? 0.1519 0.1216 0.1444 0.0238  0.0001  0.0211  241 GLY A N     
1979 C CA    . GLY A 244 ? 0.1600 0.1324 0.1536 0.0256  0.0012  0.0220  241 GLY A CA    
1980 C C     . GLY A 244 ? 0.1712 0.1492 0.1694 0.0245  -0.0015 0.0205  241 GLY A C     
1981 O O     . GLY A 244 ? 0.1975 0.1763 0.1950 0.0252  -0.0009 0.0206  241 GLY A O     
1982 N N     . SER A 245 ? 0.1461 0.1272 0.1484 0.0228  -0.0044 0.0191  242 SER A N     
1983 C CA    . SER A 245 ? 0.1169 0.1026 0.1230 0.0218  -0.0070 0.0173  242 SER A CA    
1984 C C     . SER A 245 ? 0.1521 0.1360 0.1559 0.0204  -0.0076 0.0151  242 SER A C     
1985 O O     . SER A 245 ? 0.1641 0.1513 0.1701 0.0199  -0.0089 0.0137  242 SER A O     
1986 C CB    . SER A 245 ? 0.1614 0.1501 0.1720 0.0206  -0.0096 0.0165  242 SER A CB    
1987 O OG    . SER A 245 ? 0.1742 0.1600 0.1836 0.0192  -0.0110 0.0149  242 SER A OG    
1988 N N     . VAL A 246 ? 0.1503 0.1290 0.1495 0.0195  -0.0067 0.0147  243 VAL A N     
1989 C CA    . VAL A 246 ? 0.1139 0.0915 0.1116 0.0176  -0.0077 0.0126  243 VAL A CA    
1990 C C     . VAL A 246 ? 0.1454 0.1237 0.1417 0.0175  -0.0066 0.0121  243 VAL A C     
1991 O O     . VAL A 246 ? 0.1589 0.1404 0.1576 0.0164  -0.0080 0.0103  243 VAL A O     
1992 C CB    . VAL A 246 ? 0.1638 0.1358 0.1568 0.0163  -0.0073 0.0123  243 VAL A CB    
1993 C CG1   . VAL A 246 ? 0.1848 0.1563 0.1762 0.0140  -0.0081 0.0104  243 VAL A CG1   
1994 C CG2   . VAL A 246 ? 0.1816 0.1539 0.1765 0.0160  -0.0092 0.0123  243 VAL A CG2   
1995 N N     . PRO A 247 ? 0.1479 0.1230 0.1403 0.0189  -0.0039 0.0138  244 PRO A N     
1996 C CA    . PRO A 247 ? 0.1192 0.0941 0.1096 0.0186  -0.0029 0.0134  244 PRO A CA    
1997 C C     . PRO A 247 ? 0.1586 0.1399 0.1538 0.0189  -0.0045 0.0127  244 PRO A C     
1998 O O     . PRO A 247 ? 0.1720 0.1547 0.1673 0.0175  -0.0050 0.0110  244 PRO A O     
1999 C CB    . PRO A 247 ? 0.1620 0.1327 0.1479 0.0209  0.0001  0.0158  244 PRO A CB    
2000 C CG    . PRO A 247 ? 0.1625 0.1282 0.1453 0.0212  0.0012  0.0166  244 PRO A CG    
2001 C CD    . PRO A 247 ? 0.1551 0.1254 0.1435 0.0206  -0.0014 0.0159  244 PRO A CD    
2002 N N     . GLN A 248 ? 0.1379 0.1230 0.1369 0.0206  -0.0053 0.0138  245 GLN A N     
2003 C CA    . GLN A 248 ? 0.1409 0.1313 0.1434 0.0206  -0.0070 0.0130  245 GLN A CA    
2004 C C     . GLN A 248 ? 0.1588 0.1516 0.1646 0.0189  -0.0093 0.0104  245 GLN A C     
2005 O O     . GLN A 248 ? 0.1526 0.1477 0.1591 0.0182  -0.0099 0.0088  245 GLN A O     
2006 C CB    . GLN A 248 ? 0.1787 0.1727 0.1844 0.0223  -0.0075 0.0149  245 GLN A CB    
2007 C CG    . GLN A 248 ? 0.2832 0.2763 0.2864 0.0246  -0.0053 0.0175  245 GLN A CG    
2008 C CD    . GLN A 248 ? 0.4119 0.4107 0.4185 0.0258  -0.0065 0.0189  245 GLN A CD    
2009 O OE1   . GLN A 248 ? 0.4956 0.4967 0.5023 0.0253  -0.0077 0.0179  245 GLN A OE1   
2010 N NE2   . GLN A 248 ? 0.3757 0.3767 0.3847 0.0274  -0.0062 0.0213  245 GLN A NE2   
2011 N N     . LEU A 249 ? 0.1397 0.1320 0.1472 0.0184  -0.0105 0.0101  246 LEU A N     
2012 C CA    . LEU A 249 ? 0.1166 0.1107 0.1271 0.0173  -0.0127 0.0078  246 LEU A CA    
2013 C C     . LEU A 249 ? 0.1219 0.1158 0.1313 0.0159  -0.0124 0.0061  246 LEU A C     
2014 O O     . LEU A 249 ? 0.1743 0.1713 0.1861 0.0155  -0.0135 0.0042  246 LEU A O     
2015 C CB    . LEU A 249 ? 0.1726 0.1650 0.1840 0.0171  -0.0137 0.0082  246 LEU A CB    
2016 C CG    . LEU A 249 ? 0.1689 0.1627 0.1833 0.0164  -0.0161 0.0063  246 LEU A CG    
2017 C CD1   . LEU A 249 ? 0.1717 0.1688 0.1893 0.0169  -0.0175 0.0054  246 LEU A CD1   
2018 C CD2   . LEU A 249 ? 0.1964 0.1874 0.2104 0.0163  -0.0168 0.0070  246 LEU A CD2   
2019 N N     . PHE A 250 ? 0.1278 0.1179 0.1333 0.0151  -0.0109 0.0067  247 PHE A N     
2020 C CA    . PHE A 250 ? 0.1093 0.0996 0.1140 0.0132  -0.0109 0.0052  247 PHE A CA    
2021 C C     . PHE A 250 ? 0.1432 0.1347 0.1466 0.0128  -0.0094 0.0048  247 PHE A C     
2022 O O     . PHE A 250 ? 0.1614 0.1545 0.1652 0.0112  -0.0094 0.0033  247 PHE A O     
2023 C CB    . PHE A 250 ? 0.1386 0.1238 0.1389 0.0119  -0.0100 0.0058  247 PHE A CB    
2024 C CG    . PHE A 250 ? 0.1327 0.1175 0.1343 0.0113  -0.0120 0.0054  247 PHE A CG    
2025 C CD1   . PHE A 250 ? 0.1702 0.1509 0.1679 0.0096  -0.0119 0.0056  247 PHE A CD1   
2026 C CD2   . PHE A 250 ? 0.1623 0.1502 0.1685 0.0124  -0.0141 0.0049  247 PHE A CD2   
2027 C CE1   . PHE A 250 ? 0.1593 0.1395 0.1577 0.0090  -0.0139 0.0053  247 PHE A CE1   
2028 C CE2   . PHE A 250 ? 0.1603 0.1473 0.1672 0.0120  -0.0159 0.0047  247 PHE A CE2   
2029 C CZ    . PHE A 250 ? 0.1576 0.1410 0.1607 0.0103  -0.0159 0.0050  247 PHE A CZ    
2030 N N     . SER A 251 ? 0.1288 0.1196 0.1305 0.0143  -0.0082 0.0062  248 SER A N     
2031 C CA    . SER A 251 ? 0.1213 0.1122 0.1205 0.0140  -0.0066 0.0062  248 SER A CA    
2032 C C     . SER A 251 ? 0.1564 0.1521 0.1587 0.0136  -0.0075 0.0042  248 SER A C     
2033 O O     . SER A 251 ? 0.1656 0.1614 0.1660 0.0126  -0.0061 0.0037  248 SER A O     
2034 C CB    . SER A 251 ? 0.1591 0.1484 0.1558 0.0161  -0.0053 0.0084  248 SER A CB    
2035 O OG    . SER A 251 ? 0.1647 0.1583 0.1650 0.0175  -0.0069 0.0085  248 SER A OG    
2036 N N     . GLN A 252 ? 0.1610 0.1600 0.1676 0.0144  -0.0095 0.0031  249 GLN A N     
2037 C CA    . GLN A 252 ? 0.1397 0.1426 0.1489 0.0142  -0.0102 0.0011  249 GLN A CA    
2038 C C     . GLN A 252 ? 0.1898 0.1949 0.2031 0.0140  -0.0120 -0.0007 249 GLN A C     
2039 O O     . GLN A 252 ? 0.1979 0.2057 0.2137 0.0147  -0.0128 -0.0023 249 GLN A O     
2040 C CB    . GLN A 252 ? 0.2369 0.2414 0.2467 0.0156  -0.0111 0.0012  249 GLN A CB    
2041 C CG    . GLN A 252 ? 0.2646 0.2678 0.2707 0.0162  -0.0098 0.0031  249 GLN A CG    
2042 C CD    . GLN A 252 ? 0.2501 0.2556 0.2568 0.0171  -0.0111 0.0029  249 GLN A CD    
2043 O OE1   . GLN A 252 ? 0.3213 0.3283 0.3272 0.0168  -0.0109 0.0015  249 GLN A OE1   
2044 N NE2   . GLN A 252 ? 0.2552 0.2613 0.2636 0.0179  -0.0126 0.0042  249 GLN A NE2   
2045 N N     . MET A 253 ? 0.1486 0.1520 0.1621 0.0133  -0.0124 -0.0002 250 MET A N     
2046 C CA    . MET A 253 ? 0.1097 0.1148 0.1269 0.0134  -0.0144 -0.0014 250 MET A CA    
2047 C C     . MET A 253 ? 0.1343 0.1423 0.1530 0.0120  -0.0140 -0.0027 250 MET A C     
2048 O O     . MET A 253 ? 0.1440 0.1505 0.1605 0.0102  -0.0132 -0.0021 250 MET A O     
2049 C CB    . MET A 253 ? 0.1591 0.1609 0.1754 0.0133  -0.0153 -0.0001 250 MET A CB    
2050 C CG    . MET A 253 ? 0.1763 0.1794 0.1959 0.0136  -0.0176 -0.0009 250 MET A CG    
2051 S SD    . MET A 253 ? 0.2163 0.2209 0.2394 0.0156  -0.0193 -0.0020 250 MET A SD    
2052 C CE    . MET A 253 ? 0.2112 0.2124 0.2323 0.0161  -0.0193 0.0000  250 MET A CE    
2053 N N     . PRO A 254 ? 0.1306 0.1427 0.1529 0.0128  -0.0145 -0.0044 251 PRO A N     
2054 C CA    . PRO A 254 ? 0.1395 0.1554 0.1641 0.0116  -0.0141 -0.0054 251 PRO A CA    
2055 C C     . PRO A 254 ? 0.1447 0.1603 0.1704 0.0106  -0.0157 -0.0049 251 PRO A C     
2056 O O     . PRO A 254 ? 0.1466 0.1605 0.1732 0.0117  -0.0177 -0.0045 251 PRO A O     
2057 C CB    . PRO A 254 ? 0.1570 0.1769 0.1857 0.0137  -0.0146 -0.0073 251 PRO A CB    
2058 C CG    . PRO A 254 ? 0.1811 0.1987 0.2077 0.0150  -0.0144 -0.0074 251 PRO A CG    
2059 C CD    . PRO A 254 ? 0.1519 0.1651 0.1760 0.0148  -0.0153 -0.0055 251 PRO A CD    
2060 N N     . ILE A 255 ? 0.1414 0.1585 0.1667 0.0081  -0.0150 -0.0048 252 ILE A N     
2061 C CA    . ILE A 255 ? 0.1217 0.1386 0.1473 0.0064  -0.0167 -0.0042 252 ILE A CA    
2062 C C     . ILE A 255 ? 0.1375 0.1580 0.1682 0.0083  -0.0193 -0.0049 252 ILE A C     
2063 O O     . ILE A 255 ? 0.1483 0.1664 0.1783 0.0082  -0.0213 -0.0041 252 ILE A O     
2064 C CB    . ILE A 255 ? 0.1584 0.1772 0.1831 0.0029  -0.0156 -0.0043 252 ILE A CB    
2065 C CG1   . ILE A 255 ? 0.2443 0.2565 0.2620 0.0012  -0.0136 -0.0031 252 ILE A CG1   
2066 C CG2   . ILE A 255 ? 0.1801 0.2013 0.2070 0.0011  -0.0179 -0.0041 252 ILE A CG2   
2067 C CD1   . ILE A 255 ? 0.2653 0.2783 0.2811 -0.0020 -0.0115 -0.0032 252 ILE A CD1   
2068 N N     . ARG A 256 ? 0.1355 0.1611 0.1708 0.0102  -0.0191 -0.0062 253 ARG A N     
2069 C CA    . ARG A 256 ? 0.1101 0.1391 0.1503 0.0123  -0.0213 -0.0068 253 ARG A CA    
2070 C C     . ARG A 256 ? 0.1516 0.1760 0.1908 0.0145  -0.0231 -0.0063 253 ARG A C     
2071 O O     . ARG A 256 ? 0.1588 0.1845 0.2009 0.0163  -0.0252 -0.0064 253 ARG A O     
2072 C CB    . ARG A 256 ? 0.1789 0.2137 0.2237 0.0144  -0.0202 -0.0084 253 ARG A CB    
2073 C CG    . ARG A 256 ? 0.1702 0.2022 0.2131 0.0164  -0.0188 -0.0093 253 ARG A CG    
2074 C CD    . ARG A 256 ? 0.2059 0.2426 0.2524 0.0186  -0.0175 -0.0111 253 ARG A CD    
2075 N NE    . ARG A 256 ? 0.2049 0.2382 0.2485 0.0200  -0.0163 -0.0120 253 ARG A NE    
2076 C CZ    . ARG A 256 ? 0.2046 0.2372 0.2450 0.0188  -0.0141 -0.0122 253 ARG A CZ    
2077 N NH1   . ARG A 256 ? 0.2076 0.2421 0.2471 0.0161  -0.0125 -0.0115 253 ARG A NH1   
2078 N NH2   . ARG A 256 ? 0.2282 0.2577 0.2658 0.0201  -0.0136 -0.0130 253 ARG A NH2   
2079 N N     . LYS A 257 ? 0.1452 0.1644 0.1803 0.0146  -0.0222 -0.0057 254 LYS A N     
2080 C CA    . LYS A 257 ? 0.1214 0.1365 0.1557 0.0163  -0.0237 -0.0052 254 LYS A CA    
2081 C C     . LYS A 257 ? 0.2136 0.2251 0.2456 0.0153  -0.0253 -0.0037 254 LYS A C     
2082 O O     . LYS A 257 ? 0.1871 0.1957 0.2189 0.0166  -0.0267 -0.0031 254 LYS A O     
2083 C CB    . LYS A 257 ? 0.1781 0.1899 0.2094 0.0166  -0.0224 -0.0050 254 LYS A CB    
2084 C CG    . LYS A 257 ? 0.2087 0.2230 0.2410 0.0175  -0.0209 -0.0065 254 LYS A CG    
2085 C CD    . LYS A 257 ? 0.2172 0.2335 0.2529 0.0198  -0.0219 -0.0081 254 LYS A CD    
2086 C CE    . LYS A 257 ? 0.3098 0.3276 0.3453 0.0207  -0.0203 -0.0097 254 LYS A CE    
2087 N NZ    . LYS A 257 ? 0.3889 0.4074 0.4268 0.0233  -0.0209 -0.0114 254 LYS A NZ    
2088 N N     . ILE A 258 ? 0.1606 0.1719 0.1905 0.0129  -0.0249 -0.0030 255 ILE A N     
2089 C CA    . ILE A 258 ? 0.1299 0.1369 0.1564 0.0117  -0.0262 -0.0016 255 ILE A CA    
2090 C C     . ILE A 258 ? 0.1545 0.1645 0.1839 0.0118  -0.0289 -0.0017 255 ILE A C     
2091 O O     . ILE A 258 ? 0.1808 0.1964 0.2138 0.0111  -0.0292 -0.0025 255 ILE A O     
2092 C CB    . ILE A 258 ? 0.1666 0.1707 0.1882 0.0089  -0.0245 -0.0008 255 ILE A CB    
2093 C CG1   . ILE A 258 ? 0.2836 0.2832 0.3014 0.0094  -0.0222 0.0000  255 ILE A CG1   
2094 C CG2   . ILE A 258 ? 0.2163 0.2171 0.2347 0.0072  -0.0261 0.0001  255 ILE A CG2   
2095 C CD1   . ILE A 258 ? 0.3784 0.3805 0.3984 0.0109  -0.0209 -0.0007 255 ILE A CD1   
2096 N N     . ARG A 259 ? 0.1544 0.1610 0.1826 0.0127  -0.0308 -0.0007 256 ARG A N     
2097 C CA    . ARG A 259 ? 0.1655 0.1747 0.1963 0.0133  -0.0337 -0.0006 256 ARG A CA    
2098 C C     . ARG A 259 ? 0.2033 0.2153 0.2337 0.0103  -0.0346 -0.0004 256 ARG A C     
2099 O O     . ARG A 259 ? 0.1878 0.1957 0.2130 0.0076  -0.0339 0.0003  256 ARG A O     
2100 C CB    . ARG A 259 ? 0.2361 0.2397 0.2639 0.0141  -0.0354 0.0007  256 ARG A CB    
2101 C CG    . ARG A 259 ? 0.2596 0.2654 0.2904 0.0158  -0.0386 0.0010  256 ARG A CG    
2102 C CD    . ARG A 259 ? 0.3946 0.3944 0.4208 0.0156  -0.0402 0.0026  256 ARG A CD    
2103 N NE    . ARG A 259 ? 0.5478 0.5465 0.5703 0.0127  -0.0413 0.0034  256 ARG A NE    
2104 C CZ    . ARG A 259 ? 0.6566 0.6490 0.6730 0.0115  -0.0417 0.0047  256 ARG A CZ    
2105 N NH1   . ARG A 259 ? 0.7305 0.7218 0.7430 0.0086  -0.0427 0.0051  256 ARG A NH1   
2106 N NH2   . ARG A 259 ? 0.5961 0.5831 0.6100 0.0129  -0.0411 0.0055  256 ARG A NH2   
2107 N N     . SER A 260 ? 0.1767 0.1959 0.2128 0.0108  -0.0360 -0.0011 257 SER A N     
2108 C CA    . SER A 260 ? 0.1714 0.1955 0.2089 0.0079  -0.0373 -0.0009 257 SER A CA    
2109 C C     . SER A 260 ? 0.1643 0.1932 0.2040 0.0061  -0.0348 -0.0020 257 SER A C     
2110 O O     . SER A 260 ? 0.1729 0.2077 0.2154 0.0038  -0.0357 -0.0021 257 SER A O     
2111 C CB    . SER A 260 ? 0.2101 0.2287 0.2411 0.0046  -0.0386 0.0002  257 SER A CB    
2112 O OG    . SER A 260 ? 0.2346 0.2490 0.2604 0.0017  -0.0359 0.0001  257 SER A OG    
2113 N N     . LEU A 261 ? 0.1472 0.1738 0.1856 0.0070  -0.0318 -0.0027 258 LEU A N     
2114 C CA    . LEU A 261 ? 0.1495 0.1798 0.1891 0.0054  -0.0292 -0.0035 258 LEU A CA    
2115 C C     . LEU A 261 ? 0.1472 0.1830 0.1925 0.0085  -0.0280 -0.0048 258 LEU A C     
2116 O O     . LEU A 261 ? 0.1479 0.1859 0.1936 0.0078  -0.0254 -0.0056 258 LEU A O     
2117 C CB    . LEU A 261 ? 0.1628 0.1863 0.1959 0.0039  -0.0265 -0.0032 258 LEU A CB    
2118 C CG    . LEU A 261 ? 0.1552 0.1724 0.1818 0.0009  -0.0270 -0.0021 258 LEU A CG    
2119 C CD1   . LEU A 261 ? 0.1855 0.1965 0.2062 0.0002  -0.0240 -0.0017 258 LEU A CD1   
2120 C CD2   . LEU A 261 ? 0.1866 0.2075 0.2137 -0.0030 -0.0282 -0.0021 258 LEU A CD2   
2121 N N     . GLY A 262 ? 0.1519 0.1892 0.2008 0.0120  -0.0298 -0.0050 259 GLY A N     
2122 C CA    . GLY A 262 ? 0.1524 0.1937 0.2058 0.0153  -0.0285 -0.0063 259 GLY A CA    
2123 C C     . GLY A 262 ? 0.1885 0.2393 0.2486 0.0157  -0.0284 -0.0069 259 GLY A C     
2124 O O     . GLY A 262 ? 0.1927 0.2470 0.2564 0.0187  -0.0270 -0.0081 259 GLY A O     
2125 N N     . GLY A 263 ? 0.1453 0.2003 0.2069 0.0126  -0.0298 -0.0061 260 GLY A N     
2126 C CA    . GLY A 263 ? 0.1353 0.2005 0.2041 0.0126  -0.0300 -0.0063 260 GLY A CA    
2127 C C     . GLY A 263 ? 0.1835 0.2526 0.2522 0.0078  -0.0284 -0.0062 260 GLY A C     
2128 O O     . GLY A 263 ? 0.1832 0.2483 0.2474 0.0058  -0.0256 -0.0066 260 GLY A O     
2129 N N     . LYS A 264 ? 0.2047 0.2816 0.2782 0.0057  -0.0303 -0.0055 261 LYS A N     
2130 C CA    . LYS A 264 ? 0.1557 0.2374 0.2301 0.0008  -0.0289 -0.0054 261 LYS A CA    
2131 C C     . LYS A 264 ? 0.1641 0.2374 0.2299 -0.0041 -0.0284 -0.0049 261 LYS A C     
2132 O O     . LYS A 264 ? 0.2214 0.2942 0.2848 -0.0072 -0.0256 -0.0053 261 LYS A O     
2133 C CB    . LYS A 264 ? 0.2044 0.2967 0.2861 -0.0007 -0.0316 -0.0045 261 LYS A CB    
2134 C CG    . LYS A 264 ? 0.2445 0.3469 0.3355 0.0040  -0.0311 -0.0049 261 LYS A CG    
2135 C CD    . LYS A 264 ? 0.3216 0.4354 0.4205 0.0028  -0.0341 -0.0036 261 LYS A CD    
2136 C CE    . LYS A 264 ? 0.4252 0.5490 0.5336 0.0082  -0.0333 -0.0038 261 LYS A CE    
2137 N NZ    . LYS A 264 ? 0.4345 0.5714 0.5518 0.0069  -0.0360 -0.0024 261 LYS A NZ    
2138 N N     . LEU A 265 ? 0.1662 0.2324 0.2267 -0.0048 -0.0310 -0.0041 262 LEU A N     
2139 C CA    . LEU A 265 ? 0.1549 0.2124 0.2068 -0.0089 -0.0302 -0.0037 262 LEU A CA    
2140 C C     . LEU A 265 ? 0.1646 0.2155 0.2117 -0.0078 -0.0265 -0.0043 262 LEU A C     
2141 O O     . LEU A 265 ? 0.2089 0.2569 0.2517 -0.0111 -0.0242 -0.0044 262 LEU A O     
2142 C CB    . LEU A 265 ? 0.1723 0.2228 0.2189 -0.0092 -0.0332 -0.0028 262 LEU A CB    
2143 C CG    . LEU A 265 ? 0.1939 0.2336 0.2305 -0.0124 -0.0321 -0.0024 262 LEU A CG    
2144 C CD1   . LEU A 265 ? 0.2448 0.2852 0.2788 -0.0183 -0.0315 -0.0024 262 LEU A CD1   
2145 C CD2   . LEU A 265 ? 0.2224 0.2554 0.2541 -0.0120 -0.0348 -0.0015 262 LEU A CD2   
2146 N N     . GLY A 266 ? 0.1651 0.2136 0.2126 -0.0031 -0.0261 -0.0047 263 GLY A N     
2147 C CA    . GLY A 266 ? 0.1352 0.1782 0.1786 -0.0018 -0.0231 -0.0052 263 GLY A CA    
2148 C C     . GLY A 266 ? 0.1526 0.2004 0.1983 -0.0028 -0.0200 -0.0060 263 GLY A C     
2149 O O     . GLY A 266 ? 0.1651 0.2083 0.2057 -0.0043 -0.0174 -0.0059 263 GLY A O     
2150 N N     . ALA A 267 ? 0.1645 0.2215 0.2176 -0.0016 -0.0201 -0.0067 264 ALA A N     
2151 C CA    . ALA A 267 ? 0.1709 0.2331 0.2263 -0.0026 -0.0169 -0.0074 264 ALA A CA    
2152 C C     . ALA A 267 ? 0.1471 0.2088 0.1993 -0.0083 -0.0159 -0.0068 264 ALA A C     
2153 O O     . ALA A 267 ? 0.1778 0.2378 0.2269 -0.0099 -0.0128 -0.0070 264 ALA A O     
2154 C CB    . ALA A 267 ? 0.1986 0.2713 0.2630 -0.0002 -0.0171 -0.0080 264 ALA A CB    
2155 N N     . SER A 268 ? 0.1452 0.2076 0.1974 -0.0115 -0.0186 -0.0059 265 SER A N     
2156 C CA    . SER A 268 ? 0.1724 0.2334 0.2207 -0.0174 -0.0178 -0.0054 265 SER A CA    
2157 C C     . SER A 268 ? 0.1724 0.2215 0.2106 -0.0189 -0.0162 -0.0050 265 SER A C     
2158 O O     . SER A 268 ? 0.1813 0.2279 0.2155 -0.0224 -0.0138 -0.0048 265 SER A O     
2159 C CB    . SER A 268 ? 0.2282 0.2933 0.2789 -0.0208 -0.0214 -0.0047 265 SER A CB    
2160 O OG    . SER A 268 ? 0.3358 0.3933 0.3813 -0.0204 -0.0241 -0.0041 265 SER A OG    
2161 N N     . VAL A 269 ? 0.1638 0.2056 0.1980 -0.0160 -0.0173 -0.0047 266 VAL A N     
2162 C CA    . VAL A 269 ? 0.1810 0.2121 0.2062 -0.0165 -0.0155 -0.0041 266 VAL A CA    
2163 C C     . VAL A 269 ? 0.1860 0.2163 0.2099 -0.0153 -0.0119 -0.0045 266 VAL A C     
2164 O O     . VAL A 269 ? 0.1824 0.2073 0.2002 -0.0179 -0.0096 -0.0040 266 VAL A O     
2165 C CB    . VAL A 269 ? 0.1956 0.2206 0.2181 -0.0130 -0.0170 -0.0037 266 VAL A CB    
2166 C CG1   . VAL A 269 ? 0.2173 0.2328 0.2320 -0.0125 -0.0145 -0.0030 266 VAL A CG1   
2167 C CG2   . VAL A 269 ? 0.1983 0.2219 0.2198 -0.0147 -0.0202 -0.0031 266 VAL A CG2   
2168 N N     . ILE A 270 ? 0.1663 0.2017 0.1955 -0.0114 -0.0115 -0.0053 267 ILE A N     
2169 C CA    . ILE A 270 ? 0.1530 0.1882 0.1810 -0.0101 -0.0084 -0.0057 267 ILE A CA    
2170 C C     . ILE A 270 ? 0.1866 0.2254 0.2149 -0.0139 -0.0060 -0.0058 267 ILE A C     
2171 O O     . ILE A 270 ? 0.2312 0.2652 0.2539 -0.0151 -0.0033 -0.0054 267 ILE A O     
2172 C CB    . ILE A 270 ? 0.1827 0.2230 0.2164 -0.0055 -0.0087 -0.0068 267 ILE A CB    
2173 C CG1   . ILE A 270 ? 0.2248 0.2599 0.2568 -0.0021 -0.0105 -0.0066 267 ILE A CG1   
2174 C CG2   . ILE A 270 ? 0.2551 0.2967 0.2881 -0.0047 -0.0055 -0.0075 267 ILE A CG2   
2175 C CD1   . ILE A 270 ? 0.2651 0.3044 0.3025 0.0021  -0.0115 -0.0077 267 ILE A CD1   
2176 N N     . GLU A 271 ? 0.1706 0.2180 0.2053 -0.0158 -0.0069 -0.0062 268 GLU A N     
2177 C CA    . GLU A 271 ? 0.1833 0.2360 0.2197 -0.0194 -0.0045 -0.0063 268 GLU A CA    
2178 C C     . GLU A 271 ? 0.2159 0.2629 0.2458 -0.0251 -0.0039 -0.0054 268 GLU A C     
2179 O O     . GLU A 271 ? 0.2551 0.3000 0.2812 -0.0276 -0.0008 -0.0051 268 GLU A O     
2180 C CB    . GLU A 271 ? 0.4547 0.5195 0.5009 -0.0196 -0.0057 -0.0068 268 GLU A CB    
2181 C CG    . GLU A 271 ? 0.6002 0.6715 0.6488 -0.0242 -0.0035 -0.0066 268 GLU A CG    
2182 C CD    . GLU A 271 ? 0.7437 0.8269 0.8017 -0.0219 -0.0022 -0.0074 268 GLU A CD    
2183 O OE1   . GLU A 271 ? 0.7621 0.8548 0.8269 -0.0245 -0.0032 -0.0071 268 GLU A OE1   
2184 O OE2   . GLU A 271 ? 0.8038 0.8868 0.8623 -0.0175 -0.0003 -0.0083 268 GLU A OE2   
2185 N N     . ILE A 272 ? 0.1978 0.2419 0.2259 -0.0272 -0.0067 -0.0048 269 ILE A N     
2186 C CA    . ILE A 272 ? 0.1917 0.2298 0.2131 -0.0329 -0.0064 -0.0041 269 ILE A CA    
2187 C C     . ILE A 272 ? 0.2041 0.2297 0.2152 -0.0325 -0.0041 -0.0035 269 ILE A C     
2188 O O     . ILE A 272 ? 0.2432 0.2640 0.2486 -0.0364 -0.0018 -0.0030 269 ILE A O     
2189 C CB    . ILE A 272 ? 0.1972 0.2347 0.2185 -0.0352 -0.0102 -0.0038 269 ILE A CB    
2190 C CG1   . ILE A 272 ? 0.2362 0.2867 0.2675 -0.0367 -0.0124 -0.0041 269 ILE A CG1   
2191 C CG2   . ILE A 272 ? 0.2052 0.2334 0.2173 -0.0407 -0.0098 -0.0032 269 ILE A CG2   
2192 C CD1   . ILE A 272 ? 0.3120 0.3630 0.3438 -0.0387 -0.0168 -0.0037 269 ILE A CD1   
2193 N N     . LEU A 273 ? 0.2115 0.2321 0.2206 -0.0278 -0.0047 -0.0033 270 LEU A N     
2194 C CA    . LEU A 273 ? 0.2505 0.2598 0.2503 -0.0270 -0.0027 -0.0024 270 LEU A CA    
2195 C C     . LEU A 273 ? 0.2458 0.2546 0.2447 -0.0241 0.0001  -0.0023 270 LEU A C     
2196 O O     . LEU A 273 ? 0.2443 0.2447 0.2357 -0.0238 0.0022  -0.0014 270 LEU A O     
2197 C CB    . LEU A 273 ? 0.1978 0.2016 0.1953 -0.0237 -0.0047 -0.0020 270 LEU A CB    
2198 C CG    . LEU A 273 ? 0.2328 0.2352 0.2294 -0.0264 -0.0075 -0.0020 270 LEU A CG    
2199 C CD1   . LEU A 273 ? 0.2381 0.2348 0.2321 -0.0228 -0.0089 -0.0015 270 LEU A CD1   
2200 C CD2   . LEU A 273 ? 0.3004 0.2958 0.2892 -0.0319 -0.0064 -0.0015 270 LEU A CD2   
2201 N N     . GLY A 274 ? 0.1891 0.2066 0.1952 -0.0218 0.0003  -0.0033 271 GLY A N     
2202 C CA    . GLY A 274 ? 0.2117 0.2290 0.2167 -0.0192 0.0027  -0.0034 271 GLY A CA    
2203 C C     . GLY A 274 ? 0.2454 0.2570 0.2472 -0.0148 0.0023  -0.0028 271 GLY A C     
2204 O O     . GLY A 274 ? 0.2744 0.2810 0.2709 -0.0137 0.0043  -0.0020 271 GLY A O     
2205 N N     . ILE A 275 ? 0.1854 0.1981 0.1905 -0.0123 -0.0004 -0.0031 272 ILE A N     
2206 C CA    . ILE A 275 ? 0.2066 0.2151 0.2099 -0.0082 -0.0011 -0.0025 272 ILE A CA    
2207 C C     . ILE A 275 ? 0.1609 0.1756 0.1709 -0.0048 -0.0029 -0.0037 272 ILE A C     
2208 O O     . ILE A 275 ? 0.1997 0.2212 0.2156 -0.0052 -0.0038 -0.0048 272 ILE A O     
2209 C CB    . ILE A 275 ? 0.2105 0.2122 0.2096 -0.0084 -0.0024 -0.0015 272 ILE A CB    
2210 C CG1   . ILE A 275 ? 0.1979 0.2031 0.2013 -0.0095 -0.0052 -0.0021 272 ILE A CG1   
2211 C CG2   . ILE A 275 ? 0.1942 0.1883 0.1854 -0.0115 -0.0003 -0.0003 272 ILE A CG2   
2212 C CD1   . ILE A 275 ? 0.1655 0.1637 0.1645 -0.0094 -0.0065 -0.0011 272 ILE A CD1   
2213 N N     . GLU A 276 ? 0.1664 0.1785 0.1754 -0.0014 -0.0034 -0.0034 273 GLU A N     
2214 C CA    . GLU A 276 ? 0.1691 0.1855 0.1834 0.0017  -0.0051 -0.0045 273 GLU A CA    
2215 C C     . GLU A 276 ? 0.1589 0.1722 0.1733 0.0037  -0.0074 -0.0039 273 GLU A C     
2216 O O     . GLU A 276 ? 0.1746 0.1910 0.1936 0.0053  -0.0093 -0.0047 273 GLU A O     
2217 C CB    . GLU A 276 ? 0.2059 0.2229 0.2193 0.0038  -0.0038 -0.0050 273 GLU A CB    
2218 C CG    . GLU A 276 ? 0.2538 0.2748 0.2679 0.0023  -0.0014 -0.0059 273 GLU A CG    
2219 C CD    . GLU A 276 ? 0.4587 0.4788 0.4699 0.0040  0.0001  -0.0061 273 GLU A CD    
2220 O OE1   . GLU A 276 ? 0.5771 0.5977 0.5858 0.0025  0.0025  -0.0061 273 GLU A OE1   
2221 O OE2   . GLU A 276 ? 0.4688 0.4876 0.4799 0.0066  -0.0013 -0.0062 273 GLU A OE2   
2222 N N     . TYR A 277 ? 0.1509 0.1580 0.1602 0.0037  -0.0069 -0.0023 274 TYR A N     
2223 C CA    . TYR A 277 ? 0.1482 0.1524 0.1573 0.0058  -0.0084 -0.0014 274 TYR A CA    
2224 C C     . TYR A 277 ? 0.1554 0.1551 0.1616 0.0044  -0.0090 -0.0004 274 TYR A C     
2225 O O     . TYR A 277 ? 0.1641 0.1603 0.1660 0.0020  -0.0076 0.0002  274 TYR A O     
2226 C CB    . TYR A 277 ? 0.1580 0.1594 0.1641 0.0077  -0.0074 -0.0003 274 TYR A CB    
2227 C CG    . TYR A 277 ? 0.1544 0.1592 0.1620 0.0089  -0.0069 -0.0012 274 TYR A CG    
2228 C CD1   . TYR A 277 ? 0.1674 0.1709 0.1713 0.0086  -0.0049 -0.0006 274 TYR A CD1   
2229 C CD2   . TYR A 277 ? 0.1589 0.1679 0.1712 0.0103  -0.0085 -0.0028 274 TYR A CD2   
2230 C CE1   . TYR A 277 ? 0.1936 0.2000 0.1982 0.0096  -0.0046 -0.0016 274 TYR A CE1   
2231 C CE2   . TYR A 277 ? 0.2102 0.2216 0.2230 0.0113  -0.0080 -0.0039 274 TYR A CE2   
2232 C CZ    . TYR A 277 ? 0.2233 0.2335 0.2322 0.0108  -0.0061 -0.0033 274 TYR A CZ    
2233 O OH    . TYR A 277 ? 0.2483 0.2605 0.2570 0.0117  -0.0056 -0.0044 274 TYR A OH    
2234 N N     . MET A 278 ? 0.1294 0.1285 0.1373 0.0057  -0.0109 -0.0001 275 MET A N     
2235 C CA    . MET A 278 ? 0.1295 0.1242 0.1343 0.0046  -0.0115 0.0008  275 MET A CA    
2236 C C     . MET A 278 ? 0.1668 0.1546 0.1648 0.0041  -0.0093 0.0023  275 MET A C     
2237 O O     . MET A 278 ? 0.1773 0.1610 0.1711 0.0018  -0.0088 0.0026  275 MET A O     
2238 C CB    . MET A 278 ? 0.1886 0.1830 0.1956 0.0066  -0.0135 0.0011  275 MET A CB    
2239 C CG    A MET A 278 ? 0.1820 0.1735 0.1871 0.0053  -0.0149 0.0016  275 MET A CG    
2240 C CG    B MET A 278 ? 0.2209 0.2201 0.2332 0.0068  -0.0160 -0.0001 275 MET A CG    
2241 S SD    A MET A 278 ? 0.2015 0.1975 0.2097 0.0027  -0.0171 0.0003  275 MET A SD    
2242 S SD    B MET A 278 ? 0.2048 0.2040 0.2161 0.0036  -0.0173 -0.0003 275 MET A SD    
2243 C CE    A MET A 278 ? 0.2597 0.2497 0.2628 0.0010  -0.0183 0.0013  275 MET A CE    
2244 C CE    B MET A 278 ? 0.2082 0.1988 0.2124 0.0030  -0.0169 0.0014  275 MET A CE    
2245 N N     . GLY A 279 ? 0.1446 0.1310 0.1412 0.0063  -0.0078 0.0033  276 GLY A N     
2246 C CA    . GLY A 279 ? 0.1622 0.1421 0.1526 0.0066  -0.0055 0.0050  276 GLY A CA    
2247 C C     . GLY A 279 ? 0.1988 0.1754 0.1843 0.0040  -0.0036 0.0049  276 GLY A C     
2248 O O     . GLY A 279 ? 0.2082 0.1777 0.1873 0.0034  -0.0019 0.0060  276 GLY A O     
2249 N N     . GLU A 280 ? 0.1582 0.1394 0.1463 0.0024  -0.0037 0.0037  277 GLU A N     
2250 C CA    . GLU A 280 ? 0.1277 0.1060 0.1114 -0.0005 -0.0017 0.0036  277 GLU A CA    
2251 C C     . GLU A 280 ? 0.1515 0.1262 0.1320 -0.0040 -0.0022 0.0033  277 GLU A C     
2252 O O     . GLU A 280 ? 0.1851 0.1547 0.1599 -0.0066 -0.0004 0.0036  277 GLU A O     
2253 C CB    . GLU A 280 ? 0.1620 0.1467 0.1497 -0.0017 -0.0016 0.0023  277 GLU A CB    
2254 C CG    . GLU A 280 ? 0.1663 0.1535 0.1553 0.0011  -0.0008 0.0025  277 GLU A CG    
2255 C CD    . GLU A 280 ? 0.2251 0.2181 0.2173 -0.0001 -0.0003 0.0011  277 GLU A CD    
2256 O OE1   . GLU A 280 ? 0.1960 0.1951 0.1941 0.0011  -0.0019 -0.0002 277 GLU A OE1   
2257 O OE2   . GLU A 280 ? 0.2435 0.2348 0.2321 -0.0022 0.0018  0.0013  277 GLU A OE2   
2258 N N     . LEU A 281 ? 0.1714 0.1481 0.1550 -0.0042 -0.0047 0.0028  278 LEU A N     
2259 C CA    . LEU A 281 ? 0.1701 0.1433 0.1503 -0.0076 -0.0055 0.0025  278 LEU A CA    
2260 C C     . LEU A 281 ? 0.1738 0.1367 0.1450 -0.0079 -0.0036 0.0038  278 LEU A C     
2261 O O     . LEU A 281 ? 0.1906 0.1488 0.1569 -0.0114 -0.0038 0.0035  278 LEU A O     
2262 C CB    . LEU A 281 ? 0.1798 0.1570 0.1647 -0.0073 -0.0087 0.0019  278 LEU A CB    
2263 C CG    . LEU A 281 ? 0.1751 0.1618 0.1679 -0.0082 -0.0108 0.0005  278 LEU A CG    
2264 C CD1   . LEU A 281 ? 0.1984 0.1890 0.1964 -0.0061 -0.0137 0.0002  278 LEU A CD1   
2265 C CD2   . LEU A 281 ? 0.1914 0.1795 0.1834 -0.0129 -0.0111 -0.0001 278 LEU A CD2   
2266 N N     . THR A 282 ? 0.1756 0.1347 0.1445 -0.0042 -0.0019 0.0051  279 THR A N     
2267 C CA    . THR A 282 ? 0.1632 0.1123 0.1236 -0.0037 0.0001  0.0064  279 THR A CA    
2268 C C     . THR A 282 ? 0.1998 0.1418 0.1526 -0.0064 0.0026  0.0066  279 THR A C     
2269 O O     . THR A 282 ? 0.2387 0.1714 0.1834 -0.0070 0.0041  0.0073  279 THR A O     
2270 C CB    . THR A 282 ? 0.2003 0.1476 0.1604 0.0011  0.0017  0.0082  279 THR A CB    
2271 O OG1   . THR A 282 ? 0.2293 0.1784 0.1902 0.0028  0.0033  0.0089  279 THR A OG1   
2272 C CG2   . THR A 282 ? 0.2102 0.1634 0.1770 0.0034  -0.0005 0.0081  279 THR A CG2   
2273 N N     . GLN A 283 ? 0.2016 0.1475 0.1565 -0.0080 0.0030  0.0061  280 GLN A N     
2274 C CA    A GLN A 283 ? 0.2152 0.1542 0.1627 -0.0106 0.0056  0.0065  280 GLN A CA    
2275 C CA    B GLN A 283 ? 0.2153 0.1541 0.1627 -0.0106 0.0056  0.0065  280 GLN A CA    
2276 C C     . GLN A 283 ? 0.2987 0.2352 0.2429 -0.0164 0.0048  0.0053  280 GLN A C     
2277 O O     . GLN A 283 ? 0.3878 0.3184 0.3257 -0.0194 0.0068  0.0055  280 GLN A O     
2278 C CB    A GLN A 283 ? 0.2521 0.1958 0.2026 -0.0097 0.0067  0.0066  280 GLN A CB    
2279 C CB    B GLN A 283 ? 0.2538 0.1967 0.2036 -0.0098 0.0069  0.0067  280 GLN A CB    
2280 C CG    A GLN A 283 ? 0.1736 0.1174 0.1250 -0.0044 0.0078  0.0082  280 GLN A CG    
2281 C CG    B GLN A 283 ? 0.2761 0.2289 0.2334 -0.0123 0.0052  0.0051  280 GLN A CG    
2282 C CD    A GLN A 283 ? 0.2626 0.1965 0.2062 -0.0021 0.0099  0.0099  280 GLN A CD    
2283 C CD    B GLN A 283 ? 0.3540 0.3136 0.3167 -0.0093 0.0054  0.0052  280 GLN A CD    
2284 O OE1   A GLN A 283 ? 0.2895 0.2148 0.2250 -0.0031 0.0124  0.0107  280 GLN A OE1   
2285 O OE1   B GLN A 283 ? 0.5106 0.4674 0.4711 -0.0057 0.0068  0.0065  280 GLN A OE1   
2286 N NE2   A GLN A 283 ? 0.2200 0.1545 0.1657 0.0009  0.0090  0.0105  280 GLN A NE2   
2287 N NE2   B GLN A 283 ? 0.2120 0.1805 0.1817 -0.0106 0.0041  0.0037  280 GLN A NE2   
2288 N N     . PHE A 284 ? 0.2195 0.1604 0.1676 -0.0181 0.0018  0.0043  281 PHE A N     
2289 C CA    . PHE A 284 ? 0.1991 0.1388 0.1448 -0.0239 0.0004  0.0032  281 PHE A CA    
2290 C C     . PHE A 284 ? 0.2157 0.1470 0.1545 -0.0248 -0.0002 0.0034  281 PHE A C     
2291 O O     . PHE A 284 ? 0.2563 0.1873 0.1962 -0.0211 -0.0009 0.0038  281 PHE A O     
2292 C CB    . PHE A 284 ? 0.2213 0.1734 0.1772 -0.0255 -0.0027 0.0020  281 PHE A CB    
2293 C CG    . PHE A 284 ? 0.2177 0.1777 0.1798 -0.0247 -0.0018 0.0017  281 PHE A CG    
2294 C CD1   . PHE A 284 ? 0.2559 0.2166 0.2167 -0.0290 -0.0005 0.0014  281 PHE A CD1   
2295 C CD2   . PHE A 284 ? 0.2000 0.1660 0.1685 -0.0199 -0.0020 0.0018  281 PHE A CD2   
2296 C CE1   . PHE A 284 ? 0.2773 0.2448 0.2432 -0.0282 0.0008  0.0011  281 PHE A CE1   
2297 C CE2   . PHE A 284 ? 0.2052 0.1776 0.1785 -0.0192 -0.0010 0.0014  281 PHE A CE2   
2298 C CZ    . PHE A 284 ? 0.2880 0.2612 0.2599 -0.0232 0.0005  0.0011  281 PHE A CZ    
2299 N N     . THR A 285 ? 0.2465 0.1706 0.1775 -0.0298 0.0000  0.0029  282 THR A N     
2300 C CA    . THR A 285 ? 0.2386 0.1545 0.1624 -0.0310 -0.0009 0.0028  282 THR A CA    
2301 C C     . THR A 285 ? 0.2106 0.1347 0.1409 -0.0328 -0.0052 0.0019  282 THR A C     
2302 O O     . THR A 285 ? 0.2217 0.1569 0.1611 -0.0341 -0.0074 0.0012  282 THR A O     
2303 C CB    . THR A 285 ? 0.2435 0.1485 0.1562 -0.0364 0.0004  0.0025  282 THR A CB    
2304 O OG1   . THR A 285 ? 0.2691 0.1806 0.1856 -0.0424 -0.0021 0.0014  282 THR A OG1   
2305 C CG2   . THR A 285 ? 0.3081 0.2046 0.2140 -0.0350 0.0047  0.0035  282 THR A CG2   
2306 N N     . GLU A 286 ? 0.2330 0.1513 0.1583 -0.0325 -0.0063 0.0020  283 GLU A N     
2307 C CA    . GLU A 286 ? 0.2315 0.1561 0.1615 -0.0342 -0.0106 0.0013  283 GLU A CA    
2308 C C     . GLU A 286 ? 0.2278 0.1568 0.1591 -0.0407 -0.0132 0.0003  283 GLU A C     
2309 O O     . GLU A 286 ? 0.2263 0.1666 0.1668 -0.0415 -0.0165 -0.0001 283 GLU A O     
2310 C CB    . GLU A 286 ? 0.2370 0.1529 0.1593 -0.0333 -0.0110 0.0017  283 GLU A CB    
2311 C CG    . GLU A 286 ? 0.2438 0.1663 0.1712 -0.0339 -0.0154 0.0013  283 GLU A CG    
2312 C CD    . GLU A 286 ? 0.3974 0.3115 0.3175 -0.0323 -0.0155 0.0018  283 GLU A CD    
2313 O OE1   . GLU A 286 ? 0.4342 0.3376 0.3455 -0.0305 -0.0118 0.0024  283 GLU A OE1   
2314 O OE2   . GLU A 286 ? 0.3560 0.2745 0.2793 -0.0325 -0.0191 0.0018  283 GLU A OE2   
2315 N N     A SER A 287 ? 0.2476 0.1675 0.1695 -0.0454 -0.0116 0.0000  284 SER A N     
2316 N N     B SER A 287 ? 0.2448 0.1648 0.1668 -0.0453 -0.0116 0.0000  284 SER A N     
2317 C CA    A SER A 287 ? 0.2677 0.1914 0.1902 -0.0524 -0.0139 -0.0008 284 SER A CA    
2318 C CA    B SER A 287 ? 0.2708 0.1943 0.1932 -0.0523 -0.0139 -0.0008 284 SER A CA    
2319 C C     A SER A 287 ? 0.2424 0.1785 0.1756 -0.0529 -0.0139 -0.0010 284 SER A C     
2320 C C     B SER A 287 ? 0.2411 0.1772 0.1743 -0.0529 -0.0139 -0.0010 284 SER A C     
2321 O O     A SER A 287 ? 0.2512 0.1973 0.1913 -0.0566 -0.0170 -0.0015 284 SER A O     
2322 O O     B SER A 287 ? 0.2458 0.1918 0.1859 -0.0565 -0.0170 -0.0015 284 SER A O     
2323 C CB    A SER A 287 ? 0.2771 0.1872 0.1864 -0.0575 -0.0119 -0.0011 284 SER A CB    
2324 C CB    B SER A 287 ? 0.2878 0.1976 0.1970 -0.0573 -0.0117 -0.0011 284 SER A CB    
2325 O OG    A SER A 287 ? 0.3382 0.2364 0.2370 -0.0572 -0.0118 -0.0011 284 SER A OG    
2326 O OG    B SER A 287 ? 0.2644 0.1678 0.1696 -0.0548 -0.0071 -0.0004 284 SER A OG    
2327 N N     . GLN A 288 ? 0.2209 0.1566 0.1554 -0.0491 -0.0104 -0.0004 285 GLN A N     
2328 C CA    . GLN A 288 ? 0.2421 0.1892 0.1864 -0.0490 -0.0100 -0.0006 285 GLN A CA    
2329 C C     . GLN A 288 ? 0.2116 0.1720 0.1679 -0.0461 -0.0132 -0.0009 285 GLN A C     
2330 O O     . GLN A 288 ? 0.2390 0.2103 0.2035 -0.0484 -0.0149 -0.0014 285 GLN A O     
2331 C CB    . GLN A 288 ? 0.2011 0.1450 0.1441 -0.0447 -0.0060 0.0001  285 GLN A CB    
2332 C CG    . GLN A 288 ? 0.2657 0.1995 0.1990 -0.0481 -0.0027 0.0005  285 GLN A CG    
2333 C CD    . GLN A 288 ? 0.3261 0.2572 0.2584 -0.0434 0.0010  0.0015  285 GLN A CD    
2334 O OE1   . GLN A 288 ? 0.2714 0.2001 0.2034 -0.0377 0.0019  0.0022  285 GLN A OE1   
2335 N NE2   . GLN A 288 ? 0.4077 0.3395 0.3394 -0.0461 0.0031  0.0016  285 GLN A NE2   
2336 N N     . LEU A 289 ? 0.1952 0.1546 0.1526 -0.0408 -0.0138 -0.0005 286 LEU A N     
2337 C CA    . LEU A 289 ? 0.2078 0.1786 0.1760 -0.0377 -0.0166 -0.0007 286 LEU A CA    
2338 C C     . LEU A 289 ? 0.2365 0.2125 0.2075 -0.0414 -0.0209 -0.0011 286 LEU A C     
2339 O O     . LEU A 289 ? 0.2346 0.2224 0.2154 -0.0410 -0.0232 -0.0014 286 LEU A O     
2340 C CB    . LEU A 289 ? 0.1843 0.1523 0.1526 -0.0317 -0.0163 -0.0002 286 LEU A CB    
2341 C CG    . LEU A 289 ? 0.1761 0.1414 0.1436 -0.0276 -0.0126 0.0004  286 LEU A CG    
2342 C CD1   . LEU A 289 ? 0.2042 0.1667 0.1715 -0.0225 -0.0126 0.0011  286 LEU A CD1   
2343 C CD2   . LEU A 289 ? 0.1988 0.1743 0.1751 -0.0264 -0.0121 -0.0001 286 LEU A CD2   
2344 N N     . GLN A 290 ? 0.2186 0.1859 0.1807 -0.0448 -0.0220 -0.0011 287 GLN A N     
2345 C CA    . GLN A 290 ? 0.2655 0.2373 0.2292 -0.0489 -0.0265 -0.0013 287 GLN A CA    
2346 C C     . GLN A 290 ? 0.2419 0.2220 0.2104 -0.0544 -0.0275 -0.0017 287 GLN A C     
2347 O O     . GLN A 290 ? 0.2638 0.2543 0.2399 -0.0561 -0.0312 -0.0018 287 GLN A O     
2348 C CB    . GLN A 290 ? 0.2406 0.1998 0.1921 -0.0519 -0.0271 -0.0013 287 GLN A CB    
2349 C CG    . GLN A 290 ? 0.2304 0.1831 0.1781 -0.0469 -0.0269 -0.0007 287 GLN A CG    
2350 C CD    . GLN A 290 ? 0.3043 0.2435 0.2388 -0.0497 -0.0268 -0.0008 287 GLN A CD    
2351 O OE1   . GLN A 290 ? 0.2958 0.2260 0.2214 -0.0534 -0.0245 -0.0012 287 GLN A OE1   
2352 N NE2   . GLN A 290 ? 0.3330 0.2700 0.2653 -0.0481 -0.0291 -0.0005 287 GLN A NE2   
2353 N N     . SER A 291 ? 0.2414 0.2174 0.2060 -0.0570 -0.0241 -0.0019 288 SER A N     
2354 C CA    . SER A 291 ? 0.2624 0.2461 0.2313 -0.0627 -0.0246 -0.0022 288 SER A CA    
2355 C C     . SER A 291 ? 0.2884 0.2878 0.2712 -0.0600 -0.0252 -0.0022 288 SER A C     
2356 O O     . SER A 291 ? 0.3534 0.3634 0.3432 -0.0638 -0.0274 -0.0022 288 SER A O     
2357 C CB    . SER A 291 ? 0.2485 0.2236 0.2095 -0.0660 -0.0205 -0.0022 288 SER A CB    
2358 O OG    A SER A 291 ? 0.2650 0.2421 0.2294 -0.0615 -0.0169 -0.0020 288 SER A OG    
2359 O OG    B SER A 291 ? 0.2487 0.2307 0.2130 -0.0726 -0.0213 -0.0024 288 SER A OG    
2360 N N     . HIS A 292 ? 0.2482 0.2492 0.2350 -0.0534 -0.0231 -0.0021 289 HIS A N     
2361 C CA    . HIS A 292 ? 0.3100 0.3244 0.3088 -0.0504 -0.0231 -0.0023 289 HIS A CA    
2362 C C     . HIS A 292 ? 0.2936 0.3161 0.3003 -0.0469 -0.0269 -0.0022 289 HIS A C     
2363 O O     . HIS A 292 ? 0.2806 0.3155 0.2973 -0.0467 -0.0285 -0.0023 289 HIS A O     
2364 C CB    . HIS A 292 ? 0.2670 0.2793 0.2661 -0.0453 -0.0193 -0.0024 289 HIS A CB    
2365 C CG    . HIS A 292 ? 0.2509 0.2577 0.2443 -0.0482 -0.0154 -0.0023 289 HIS A CG    
2366 N ND1   . HIS A 292 ? 0.3264 0.3399 0.3233 -0.0527 -0.0144 -0.0025 289 HIS A ND1   
2367 C CD2   . HIS A 292 ? 0.3375 0.3330 0.3219 -0.0471 -0.0122 -0.0019 289 HIS A CD2   
2368 C CE1   . HIS A 292 ? 0.3440 0.3498 0.3339 -0.0544 -0.0107 -0.0022 289 HIS A CE1   
2369 N NE2   . HIS A 292 ? 0.3455 0.3402 0.3277 -0.0508 -0.0094 -0.0019 289 HIS A NE2   
2370 N N     . PHE A 293 ? 0.2348 0.2501 0.2369 -0.0438 -0.0282 -0.0019 290 PHE A N     
2371 C CA    . PHE A 293 ? 0.2695 0.2908 0.2783 -0.0392 -0.0311 -0.0017 290 PHE A CA    
2372 C C     . PHE A 293 ? 0.2416 0.2609 0.2474 -0.0412 -0.0354 -0.0013 290 PHE A C     
2373 O O     . PHE A 293 ? 0.2472 0.2704 0.2576 -0.0376 -0.0381 -0.0009 290 PHE A O     
2374 C CB    . PHE A 293 ? 0.1782 0.1947 0.1860 -0.0330 -0.0289 -0.0017 290 PHE A CB    
2375 C CG    . PHE A 293 ? 0.1737 0.1912 0.1831 -0.0314 -0.0249 -0.0021 290 PHE A CG    
2376 C CD1   . PHE A 293 ? 0.2002 0.2286 0.2187 -0.0304 -0.0244 -0.0026 290 PHE A CD1   
2377 C CD2   . PHE A 293 ? 0.2187 0.2261 0.2201 -0.0308 -0.0216 -0.0019 290 PHE A CD2   
2378 C CE1   . PHE A 293 ? 0.2083 0.2372 0.2274 -0.0291 -0.0207 -0.0030 290 PHE A CE1   
2379 C CE2   . PHE A 293 ? 0.2155 0.2238 0.2179 -0.0294 -0.0181 -0.0022 290 PHE A CE2   
2380 C CZ    . PHE A 293 ? 0.2115 0.2303 0.2225 -0.0288 -0.0177 -0.0028 290 PHE A CZ    
2381 N N     . GLY A 294 ? 0.2265 0.2394 0.2244 -0.0470 -0.0361 -0.0013 291 GLY A N     
2382 C CA    . GLY A 294 ? 0.3010 0.3108 0.2945 -0.0495 -0.0401 -0.0009 291 GLY A CA    
2383 C C     . GLY A 294 ? 0.2603 0.2559 0.2425 -0.0479 -0.0390 -0.0007 291 GLY A C     
2384 O O     . GLY A 294 ? 0.2581 0.2483 0.2383 -0.0435 -0.0356 -0.0007 291 GLY A O     
2385 N N     . GLU A 295 ? 0.2585 0.2484 0.2334 -0.0516 -0.0419 -0.0006 292 GLU A N     
2386 C CA    . GLU A 295 ? 0.3099 0.2857 0.2731 -0.0507 -0.0407 -0.0004 292 GLU A CA    
2387 C C     . GLU A 295 ? 0.2259 0.2008 0.1914 -0.0438 -0.0400 0.0002  292 GLU A C     
2388 O O     . GLU A 295 ? 0.2363 0.2025 0.1963 -0.0407 -0.0363 0.0003  292 GLU A O     
2389 C CB    . GLU A 295 ? 0.2905 0.2623 0.2468 -0.0557 -0.0447 -0.0004 292 GLU A CB    
2390 C CG    . GLU A 295 ? 0.3423 0.2988 0.2850 -0.0557 -0.0433 -0.0004 292 GLU A CG    
2391 C CD    . GLU A 295 ? 0.4857 0.4387 0.4216 -0.0606 -0.0478 -0.0004 292 GLU A CD    
2392 O OE1   . GLU A 295 ? 0.5553 0.5008 0.4844 -0.0587 -0.0485 0.0000  292 GLU A OE1   
2393 O OE2   . GLU A 295 ? 0.4412 0.3994 0.3786 -0.0666 -0.0506 -0.0007 292 GLU A OE2   
2394 N N     . LYS A 296 ? 0.2136 0.1973 0.1871 -0.0413 -0.0436 0.0007  293 LYS A N     
2395 C CA    . LYS A 296 ? 0.2488 0.2312 0.2239 -0.0354 -0.0434 0.0013  293 LYS A CA    
2396 C C     . LYS A 296 ? 0.2398 0.2246 0.2204 -0.0306 -0.0396 0.0011  293 LYS A C     
2397 O O     . LYS A 296 ? 0.2247 0.2025 0.2013 -0.0273 -0.0369 0.0014  293 LYS A O     
2398 C CB    . LYS A 296 ? 0.2919 0.2831 0.2743 -0.0339 -0.0482 0.0019  293 LYS A CB    
2399 C CG    . LYS A 296 ? 0.3936 0.3820 0.3760 -0.0286 -0.0485 0.0027  293 LYS A CG    
2400 C CD    . LYS A 296 ? 0.4091 0.4045 0.3968 -0.0277 -0.0536 0.0036  293 LYS A CD    
2401 C CE    . LYS A 296 ? 0.4775 0.4715 0.4671 -0.0220 -0.0537 0.0044  293 LYS A CE    
2402 N NZ    . LYS A 296 ? 0.4868 0.4868 0.4808 -0.0208 -0.0586 0.0054  293 LYS A NZ    
2403 N N     . ASN A 297 ? 0.2208 0.2159 0.2107 -0.0304 -0.0395 0.0006  294 ASN A N     
2404 C CA    . ASN A 297 ? 0.2398 0.2378 0.2349 -0.0261 -0.0363 0.0003  294 ASN A CA    
2405 C C     . ASN A 297 ? 0.2002 0.1894 0.1881 -0.0266 -0.0319 0.0002  294 ASN A C     
2406 O O     . ASN A 297 ? 0.1845 0.1713 0.1726 -0.0226 -0.0293 0.0003  294 ASN A O     
2407 C CB    . ASN A 297 ? 0.2599 0.2698 0.2648 -0.0265 -0.0366 -0.0002 294 ASN A CB    
2408 C CG    . ASN A 297 ? 0.2666 0.2862 0.2807 -0.0236 -0.0399 0.0000  294 ASN A CG    
2409 O OD1   . ASN A 297 ? 0.3176 0.3349 0.3316 -0.0200 -0.0413 0.0005  294 ASN A OD1   
2410 N ND2   . ASN A 297 ? 0.3254 0.3558 0.3474 -0.0250 -0.0410 -0.0003 294 ASN A ND2   
2411 N N     . GLY A 298 ? 0.2303 0.2151 0.2120 -0.0317 -0.0312 -0.0001 295 GLY A N     
2412 C CA    . GLY A 298 ? 0.2453 0.2216 0.2199 -0.0322 -0.0270 -0.0001 295 GLY A CA    
2413 C C     . GLY A 298 ? 0.1940 0.1594 0.1605 -0.0294 -0.0252 0.0005  295 GLY A C     
2414 O O     . GLY A 298 ? 0.2103 0.1719 0.1753 -0.0261 -0.0217 0.0009  295 GLY A O     
2415 N N     . SER A 299 ? 0.1878 0.1482 0.1490 -0.0305 -0.0274 0.0008  296 SER A N     
2416 C CA    . SER A 299 ? 0.2016 0.1520 0.1553 -0.0277 -0.0255 0.0016  296 SER A CA    
2417 C C     . SER A 299 ? 0.2141 0.1688 0.1744 -0.0220 -0.0251 0.0022  296 SER A C     
2418 O O     . SER A 299 ? 0.2100 0.1592 0.1672 -0.0187 -0.0221 0.0029  296 SER A O     
2419 C CB    . SER A 299 ? 0.2438 0.1887 0.1907 -0.0303 -0.0282 0.0017  296 SER A CB    
2420 O OG    . SER A 299 ? 0.2853 0.2232 0.2235 -0.0356 -0.0279 0.0011  296 SER A OG    
2421 N N     . TRP A 300 ? 0.1825 0.1469 0.1519 -0.0208 -0.0282 0.0020  297 TRP A N     
2422 C CA    . TRP A 300 ? 0.1651 0.1331 0.1404 -0.0158 -0.0281 0.0025  297 TRP A CA    
2423 C C     . TRP A 300 ? 0.1873 0.1572 0.1660 -0.0132 -0.0248 0.0024  297 TRP A C     
2424 O O     . TRP A 300 ? 0.1844 0.1515 0.1626 -0.0097 -0.0229 0.0031  297 TRP A O     
2425 C CB    . TRP A 300 ? 0.2039 0.1815 0.1879 -0.0150 -0.0320 0.0023  297 TRP A CB    
2426 C CG    . TRP A 300 ? 0.1947 0.1750 0.1839 -0.0102 -0.0322 0.0027  297 TRP A CG    
2427 C CD1   . TRP A 300 ? 0.2599 0.2364 0.2469 -0.0082 -0.0333 0.0036  297 TRP A CD1   
2428 C CD2   . TRP A 300 ? 0.1621 0.1487 0.1589 -0.0072 -0.0311 0.0022  297 TRP A CD2   
2429 N NE1   . TRP A 300 ? 0.2712 0.2513 0.2642 -0.0043 -0.0332 0.0037  297 TRP A NE1   
2430 C CE2   . TRP A 300 ? 0.2124 0.1985 0.2113 -0.0036 -0.0319 0.0028  297 TRP A CE2   
2431 C CE3   . TRP A 300 ? 0.2219 0.2140 0.2233 -0.0073 -0.0296 0.0013  297 TRP A CE3   
2432 C CZ2   . TRP A 300 ? 0.2169 0.2076 0.2220 -0.0003 -0.0313 0.0024  297 TRP A CZ2   
2433 C CZ3   . TRP A 300 ? 0.2448 0.2416 0.2524 -0.0038 -0.0289 0.0009  297 TRP A CZ3   
2434 C CH2   . TRP A 300 ? 0.1941 0.1900 0.2034 -0.0004 -0.0298 0.0013  297 TRP A CH2   
2435 N N     . LEU A 301 ? 0.1768 0.1515 0.1586 -0.0151 -0.0241 0.0016  298 LEU A N     
2436 C CA    . LEU A 301 ? 0.1582 0.1347 0.1426 -0.0130 -0.0211 0.0014  298 LEU A CA    
2437 C C     . LEU A 301 ? 0.1824 0.1496 0.1589 -0.0123 -0.0175 0.0022  298 LEU A C     
2438 O O     . LEU A 301 ? 0.1778 0.1447 0.1555 -0.0089 -0.0155 0.0028  298 LEU A O     
2439 C CB    . LEU A 301 ? 0.1722 0.1549 0.1605 -0.0157 -0.0209 0.0005  298 LEU A CB    
2440 C CG    . LEU A 301 ? 0.1949 0.1887 0.1929 -0.0151 -0.0236 -0.0002 298 LEU A CG    
2441 C CD1   . LEU A 301 ? 0.2054 0.2050 0.2063 -0.0188 -0.0234 -0.0009 298 LEU A CD1   
2442 C CD2   . LEU A 301 ? 0.1877 0.1855 0.1915 -0.0104 -0.0228 -0.0004 298 LEU A CD2   
2443 N N     . TYR A 302 ? 0.1661 0.1256 0.1342 -0.0156 -0.0168 0.0024  299 TYR A N     
2444 C CA    . TYR A 302 ? 0.1799 0.1297 0.1397 -0.0147 -0.0132 0.0032  299 TYR A CA    
2445 C C     . TYR A 302 ? 0.2255 0.1720 0.1843 -0.0104 -0.0122 0.0044  299 TYR A C     
2446 O O     . TYR A 302 ? 0.1872 0.1316 0.1453 -0.0073 -0.0093 0.0053  299 TYR A O     
2447 C CB    . TYR A 302 ? 0.2003 0.1412 0.1503 -0.0191 -0.0129 0.0030  299 TYR A CB    
2448 C CG    . TYR A 302 ? 0.2328 0.1629 0.1737 -0.0180 -0.0089 0.0038  299 TYR A CG    
2449 C CD1   . TYR A 302 ? 0.2203 0.1481 0.1587 -0.0189 -0.0062 0.0039  299 TYR A CD1   
2450 C CD2   . TYR A 302 ? 0.2780 0.2002 0.2126 -0.0156 -0.0075 0.0048  299 TYR A CD2   
2451 C CE1   . TYR A 302 ? 0.2486 0.1661 0.1784 -0.0174 -0.0024 0.0048  299 TYR A CE1   
2452 C CE2   . TYR A 302 ? 0.2857 0.1982 0.2121 -0.0140 -0.0034 0.0057  299 TYR A CE2   
2453 C CZ    . TYR A 302 ? 0.3068 0.2169 0.2308 -0.0148 -0.0010 0.0057  299 TYR A CZ    
2454 O OH    . TYR A 302 ? 0.3860 0.2862 0.3018 -0.0127 0.0030  0.0068  299 TYR A OH    
2455 N N     . ALA A 303 ? 0.1872 0.1336 0.1461 -0.0102 -0.0145 0.0045  300 ALA A N     
2456 C CA    . ALA A 303 ? 0.1654 0.1092 0.1237 -0.0065 -0.0136 0.0057  300 ALA A CA    
2457 C C     . ALA A 303 ? 0.1808 0.1325 0.1482 -0.0030 -0.0141 0.0059  300 ALA A C     
2458 O O     . ALA A 303 ? 0.1827 0.1332 0.1504 0.0002  -0.0119 0.0070  300 ALA A O     
2459 C CB    . ALA A 303 ? 0.2090 0.1496 0.1639 -0.0075 -0.0159 0.0058  300 ALA A CB    
2460 N N     . MET A 304 ? 0.1623 0.1221 0.1369 -0.0036 -0.0169 0.0048  301 MET A N     
2461 C CA    . MET A 304 ? 0.1179 0.0842 0.1003 -0.0006 -0.0177 0.0048  301 MET A CA    
2462 C C     . MET A 304 ? 0.1524 0.1203 0.1367 0.0014  -0.0152 0.0050  301 MET A C     
2463 O O     . MET A 304 ? 0.1701 0.1398 0.1575 0.0043  -0.0148 0.0057  301 MET A O     
2464 C CB    . MET A 304 ? 0.1665 0.1408 0.1559 -0.0013 -0.0209 0.0036  301 MET A CB    
2465 C CG    . MET A 304 ? 0.1986 0.1779 0.1947 0.0019  -0.0221 0.0035  301 MET A CG    
2466 S SD    . MET A 304 ? 0.2230 0.1983 0.2173 0.0035  -0.0235 0.0047  301 MET A SD    
2467 C CE    . MET A 304 ? 0.2629 0.2360 0.2569 0.0063  -0.0205 0.0058  301 MET A CE    
2468 N N     . CYS A 305 ? 0.1620 0.1293 0.1442 -0.0003 -0.0135 0.0046  302 CYS A N     
2469 C CA    . CYS A 305 ? 0.1221 0.0909 0.1058 0.0015  -0.0113 0.0049  302 CYS A CA    
2470 C C     . CYS A 305 ? 0.1617 0.1248 0.1409 0.0040  -0.0086 0.0066  302 CYS A C     
2471 O O     . CYS A 305 ? 0.1831 0.1479 0.1639 0.0061  -0.0071 0.0072  302 CYS A O     
2472 C CB    . CYS A 305 ? 0.1587 0.1280 0.1409 -0.0009 -0.0100 0.0042  302 CYS A CB    
2473 S SG    . CYS A 305 ? 0.1858 0.1451 0.1577 -0.0037 -0.0076 0.0048  302 CYS A SG    
2474 N N     . ARG A 306 ? 0.1553 0.1120 0.1289 0.0037  -0.0080 0.0074  303 ARG A N     
2475 C CA    . ARG A 306 ? 0.1387 0.0903 0.1085 0.0064  -0.0054 0.0092  303 ARG A CA    
2476 C C     . ARG A 306 ? 0.1887 0.1420 0.1616 0.0084  -0.0065 0.0100  303 ARG A C     
2477 O O     . ARG A 306 ? 0.2418 0.1915 0.2121 0.0106  -0.0043 0.0116  303 ARG A O     
2478 C CB    . ARG A 306 ? 0.1871 0.1291 0.1474 0.0050  -0.0034 0.0096  303 ARG A CB    
2479 C CG    . ARG A 306 ? 0.1900 0.1287 0.1459 0.0030  -0.0017 0.0092  303 ARG A CG    
2480 C CD    . ARG A 306 ? 0.2120 0.1407 0.1579 0.0004  -0.0003 0.0090  303 ARG A CD    
2481 N NE    . ARG A 306 ? 0.2756 0.2002 0.2170 -0.0007 0.0020  0.0091  303 ARG A NE    
2482 C CZ    . ARG A 306 ? 0.2437 0.1715 0.1867 -0.0040 0.0008  0.0078  303 ARG A CZ    
2483 N NH1   . ARG A 306 ? 0.2423 0.1658 0.1808 -0.0049 0.0032  0.0081  303 ARG A NH1   
2484 N NH2   . ARG A 306 ? 0.2025 0.1376 0.1517 -0.0064 -0.0025 0.0064  303 ARG A NH2   
2485 N N     . GLY A 307 ? 0.1508 0.1096 0.1294 0.0078  -0.0096 0.0090  304 GLY A N     
2486 C CA    . GLY A 307 ? 0.1554 0.1158 0.1371 0.0095  -0.0109 0.0096  304 GLY A CA    
2487 C C     . GLY A 307 ? 0.1640 0.1197 0.1415 0.0084  -0.0119 0.0099  304 GLY A C     
2488 O O     . GLY A 307 ? 0.1940 0.1494 0.1725 0.0097  -0.0122 0.0109  304 GLY A O     
2489 N N     . ILE A 308 ? 0.1691 0.1210 0.1415 0.0057  -0.0124 0.0092  305 ILE A N     
2490 C CA    . ILE A 308 ? 0.1673 0.1134 0.1338 0.0044  -0.0131 0.0095  305 ILE A CA    
2491 C C     . ILE A 308 ? 0.1971 0.1464 0.1657 0.0020  -0.0171 0.0083  305 ILE A C     
2492 O O     . ILE A 308 ? 0.2004 0.1528 0.1707 -0.0002 -0.0183 0.0070  305 ILE A O     
2493 C CB    . ILE A 308 ? 0.2210 0.1584 0.1781 0.0030  -0.0105 0.0097  305 ILE A CB    
2494 C CG1   . ILE A 308 ? 0.2637 0.1980 0.2186 0.0060  -0.0063 0.0112  305 ILE A CG1   
2495 C CG2   . ILE A 308 ? 0.2444 0.1752 0.1943 0.0011  -0.0114 0.0098  305 ILE A CG2   
2496 C CD1   . ILE A 308 ? 0.3207 0.2458 0.2661 0.0051  -0.0032 0.0114  305 ILE A CD1   
2497 N N     . GLU A 309 ? 0.1807 0.1293 0.1493 0.0023  -0.0192 0.0087  306 GLU A N     
2498 C CA    . GLU A 309 ? 0.2126 0.1646 0.1835 0.0006  -0.0232 0.0079  306 GLU A CA    
2499 C C     . GLU A 309 ? 0.2695 0.2160 0.2352 0.0005  -0.0243 0.0090  306 GLU A C     
2500 O O     . GLU A 309 ? 0.2598 0.2036 0.2244 0.0026  -0.0225 0.0102  306 GLU A O     
2501 C CB    . GLU A 309 ? 0.2918 0.2519 0.2719 0.0025  -0.0252 0.0074  306 GLU A CB    
2502 C CG    . GLU A 309 ? 0.3918 0.3577 0.3761 0.0009  -0.0287 0.0063  306 GLU A CG    
2503 C CD    . GLU A 309 ? 0.3834 0.3532 0.3729 0.0028  -0.0317 0.0065  306 GLU A CD    
2504 O OE1   . GLU A 309 ? 0.2807 0.2490 0.2711 0.0051  -0.0311 0.0073  306 GLU A OE1   
2505 O OE2   . GLU A 309 ? 0.4613 0.4356 0.4539 0.0018  -0.0348 0.0059  306 GLU A OE2   
2506 N N     . HIS A 310 ? 0.4043 0.1769 0.2033 0.0343  -0.0636 -0.0592 307 HIS A N     
2507 C CA    . HIS A 310 ? 0.3554 0.1485 0.1678 0.0395  -0.0572 -0.0604 307 HIS A CA    
2508 C C     . HIS A 310 ? 0.3384 0.1525 0.1613 0.0358  -0.0453 -0.0538 307 HIS A C     
2509 O O     . HIS A 310 ? 0.4149 0.2447 0.2463 0.0395  -0.0395 -0.0539 307 HIS A O     
2510 C CB    . HIS A 310 ? 0.6258 0.4115 0.4257 0.0406  -0.0622 -0.0641 307 HIS A CB    
2511 C CG    . HIS A 310 ? 0.7162 0.4823 0.5072 0.0462  -0.0744 -0.0715 307 HIS A CG    
2512 N ND1   . HIS A 310 ? 0.6954 0.4651 0.4997 0.0557  -0.0777 -0.0780 307 HIS A ND1   
2513 C CD2   . HIS A 310 ? 0.7695 0.5117 0.5398 0.0437  -0.0845 -0.0739 307 HIS A CD2   
2514 C CE1   . HIS A 310 ? 0.7717 0.5207 0.5640 0.0597  -0.0900 -0.0844 307 HIS A CE1   
2515 N NE2   . HIS A 310 ? 0.7906 0.5217 0.5612 0.0524  -0.0944 -0.0816 307 HIS A NE2   
2516 N N     . ASP A 311 ? 0.3344 0.1481 0.1560 0.0290  -0.0419 -0.0484 308 ASP A N     
2517 C CA    . ASP A 311 ? 0.2942 0.1265 0.1253 0.0258  -0.0318 -0.0425 308 ASP A CA    
2518 C C     . ASP A 311 ? 0.3460 0.1961 0.1965 0.0327  -0.0252 -0.0424 308 ASP A C     
2519 O O     . ASP A 311 ? 0.3259 0.1761 0.1869 0.0363  -0.0258 -0.0441 308 ASP A O     
2520 C CB    . ASP A 311 ? 0.3521 0.1813 0.1816 0.0188  -0.0299 -0.0382 308 ASP A CB    
2521 C CG    . ASP A 311 ? 0.4609 0.3079 0.2988 0.0156  -0.0208 -0.0327 308 ASP A CG    
2522 O OD1   . ASP A 311 ? 0.5778 0.4296 0.4237 0.0139  -0.0171 -0.0297 308 ASP A OD1   
2523 O OD2   . ASP A 311 ? 0.5077 0.3632 0.3439 0.0152  -0.0180 -0.0319 308 ASP A OD2   
2524 N N     . PRO A 312 ? 0.2903 0.1550 0.1451 0.0344  -0.0188 -0.0406 309 PRO A N     
2525 C CA    . PRO A 312 ? 0.2117 0.0914 0.0831 0.0403  -0.0119 -0.0405 309 PRO A CA    
2526 C C     . PRO A 312 ? 0.2309 0.1205 0.1143 0.0382  -0.0048 -0.0350 309 PRO A C     
2527 O O     . PRO A 312 ? 0.2928 0.1826 0.1724 0.0326  -0.0033 -0.0303 309 PRO A O     
2528 C CB    . PRO A 312 ? 0.2946 0.1842 0.1630 0.0424  -0.0075 -0.0400 309 PRO A CB    
2529 C CG    . PRO A 312 ? 0.3408 0.2253 0.1952 0.0362  -0.0100 -0.0374 309 PRO A CG    
2530 C CD    . PRO A 312 ? 0.2903 0.1569 0.1346 0.0320  -0.0184 -0.0397 309 PRO A CD    
2531 N N     . VAL A 313 ? 0.2574 0.1554 0.1563 0.0427  -0.0005 -0.0361 310 VAL A N     
2532 C CA    . VAL A 313 ? 0.1813 0.0901 0.0923 0.0415  0.0073  -0.0307 310 VAL A CA    
2533 C C     . VAL A 313 ? 0.2438 0.1639 0.1527 0.0415  0.0146  -0.0261 310 VAL A C     
2534 O O     . VAL A 313 ? 0.2795 0.2057 0.1899 0.0455  0.0182  -0.0280 310 VAL A O     
2535 C CB    . VAL A 313 ? 0.2461 0.1608 0.1746 0.0460  0.0103  -0.0339 310 VAL A CB    
2536 C CG1   . VAL A 313 ? 0.2135 0.1384 0.1539 0.0443  0.0185  -0.0280 310 VAL A CG1   
2537 C CG2   . VAL A 313 ? 0.2582 0.1610 0.1884 0.0473  0.0014  -0.0395 310 VAL A CG2   
2538 N N     . LYS A 314 ? 0.2682 0.1903 0.1725 0.0371  0.0164  -0.0207 311 LYS A N     
2539 C CA    . LYS A 314 ? 0.2220 0.1529 0.1221 0.0375  0.0215  -0.0167 311 LYS A CA    
2540 C C     . LYS A 314 ? 0.2291 0.1700 0.1404 0.0396  0.0301  -0.0122 311 LYS A C     
2541 O O     . LYS A 314 ? 0.2770 0.2189 0.1981 0.0382  0.0319  -0.0099 311 LYS A O     
2542 C CB    . LYS A 314 ? 0.3049 0.2342 0.1962 0.0323  0.0190  -0.0139 311 LYS A CB    
2543 C CG    . LYS A 314 ? 0.4142 0.3326 0.2930 0.0293  0.0113  -0.0183 311 LYS A CG    
2544 C CD    . LYS A 314 ? 0.5839 0.5000 0.4563 0.0226  0.0091  -0.0167 311 LYS A CD    
2545 C CE    . LYS A 314 ? 0.6323 0.5354 0.4915 0.0188  0.0020  -0.0210 311 LYS A CE    
2546 N NZ    . LYS A 314 ? 0.6011 0.4915 0.4595 0.0199  -0.0029 -0.0245 311 LYS A NZ    
2547 N N     . PRO A 315 ? 0.2329 0.1802 0.1419 0.0428  0.0355  -0.0110 312 PRO A N     
2548 C CA    . PRO A 315 ? 0.1962 0.1512 0.1132 0.0442  0.0442  -0.0061 312 PRO A CA    
2549 C C     . PRO A 315 ? 0.2760 0.2331 0.1900 0.0419  0.0455  0.0003  312 PRO A C     
2550 O O     . PRO A 315 ? 0.3172 0.2770 0.2219 0.0432  0.0470  0.0031  312 PRO A O     
2551 C CB    . PRO A 315 ? 0.2946 0.2536 0.2055 0.0480  0.0488  -0.0071 312 PRO A CB    
2552 C CG    . PRO A 315 ? 0.2972 0.2521 0.1940 0.0481  0.0420  -0.0099 312 PRO A CG    
2553 C CD    . PRO A 315 ? 0.2603 0.2071 0.1582 0.0454  0.0338  -0.0141 312 PRO A CD    
2554 N N     . ARG A 316 ? 0.2330 0.1889 0.1550 0.0392  0.0443  0.0020  313 ARG A N     
2555 C CA    . ARG A 316 ? 0.1750 0.1333 0.0960 0.0374  0.0448  0.0071  313 ARG A CA    
2556 C C     . ARG A 316 ? 0.2752 0.2340 0.2092 0.0360  0.0469  0.0093  313 ARG A C     
2557 O O     . ARG A 316 ? 0.2702 0.2249 0.2089 0.0337  0.0429  0.0065  313 ARG A O     
2558 C CB    A ARG A 316 ? 0.2817 0.2374 0.1945 0.0340  0.0380  0.0050  313 ARG A CB    
2559 C CB    B ARG A 316 ? 0.2922 0.2482 0.2048 0.0341  0.0382  0.0052  313 ARG A CB    
2560 C CG    A ARG A 316 ? 0.2943 0.2540 0.2068 0.0324  0.0378  0.0086  313 ARG A CG    
2561 C CG    B ARG A 316 ? 0.2989 0.2592 0.2113 0.0329  0.0384  0.0091  313 ARG A CG    
2562 C CD    A ARG A 316 ? 0.3107 0.2686 0.2178 0.0277  0.0319  0.0053  313 ARG A CD    
2563 C CD    B ARG A 316 ? 0.2972 0.2566 0.2034 0.0287  0.0326  0.0061  313 ARG A CD    
2564 N NE    A ARG A 316 ? 0.3314 0.2843 0.2438 0.0239  0.0298  0.0034  313 ARG A NE    
2565 N NE    B ARG A 316 ? 0.2993 0.2523 0.2077 0.0246  0.0293  0.0028  313 ARG A NE    
2566 C CZ    A ARG A 316 ? 0.3715 0.3161 0.2789 0.0211  0.0255  -0.0008 313 ARG A CZ    
2567 C CZ    B ARG A 316 ? 0.3314 0.2836 0.2480 0.0226  0.0298  0.0037  313 ARG A CZ    
2568 N NH1   A ARG A 316 ? 0.3865 0.3255 0.2973 0.0180  0.0235  -0.0021 313 ARG A NH1   
2569 N NH1   B ARG A 316 ? 0.3497 0.2943 0.2655 0.0191  0.0262  0.0005  313 ARG A NH1   
2570 N NH2   A ARG A 316 ? 0.4115 0.3523 0.3095 0.0214  0.0227  -0.0037 313 ARG A NH2   
2571 N NH2   B ARG A 316 ? 0.2949 0.2527 0.2195 0.0244  0.0334  0.0077  313 ARG A NH2   
2572 N N     . GLN A 317 ? 0.2510 0.2133 0.1894 0.0374  0.0530  0.0144  314 GLN A N     
2573 C CA    . GLN A 317 ? 0.2521 0.2146 0.2034 0.0364  0.0554  0.0166  314 GLN A CA    
2574 C C     . GLN A 317 ? 0.2990 0.2625 0.2499 0.0352  0.0537  0.0204  314 GLN A C     
2575 O O     . GLN A 317 ? 0.3572 0.3200 0.3178 0.0338  0.0533  0.0210  314 GLN A O     
2576 C CB    . GLN A 317 ? 0.4260 0.3906 0.3834 0.0381  0.0637  0.0196  314 GLN A CB    
2577 C CG    . GLN A 317 ? 0.5507 0.5153 0.5230 0.0368  0.0666  0.0210  314 GLN A CG    
2578 C CD    . GLN A 317 ? 0.5573 0.5238 0.5355 0.0374  0.0757  0.0234  314 GLN A CD    
2579 O OE1   . GLN A 317 ? 0.5938 0.5620 0.5659 0.0388  0.0799  0.0227  314 GLN A OE1   
2580 N NE2   . GLN A 317 ? 0.5300 0.4961 0.5200 0.0360  0.0791  0.0259  314 GLN A NE2   
2581 N N     . LEU A 318 ? 0.2421 0.2074 0.1822 0.0361  0.0521  0.0221  315 LEU A N     
2582 C CA    . LEU A 318 ? 0.1896 0.1570 0.1295 0.0360  0.0501  0.0248  315 LEU A CA    
2583 C C     . LEU A 318 ? 0.2350 0.2038 0.1706 0.0330  0.0438  0.0206  315 LEU A C     
2584 O O     . LEU A 318 ? 0.2676 0.2355 0.1952 0.0321  0.0412  0.0172  315 LEU A O     
2585 C CB    . LEU A 318 ? 0.2588 0.2274 0.1894 0.0396  0.0521  0.0291  315 LEU A CB    
2586 C CG    . LEU A 318 ? 0.3244 0.2905 0.2544 0.0421  0.0593  0.0342  315 LEU A CG    
2587 C CD1   . LEU A 318 ? 0.3132 0.2783 0.2291 0.0458  0.0596  0.0378  315 LEU A CD1   
2588 C CD2   . LEU A 318 ? 0.3241 0.2885 0.2654 0.0414  0.0620  0.0377  315 LEU A CD2   
2589 N N     . PRO A 319 ? 0.2395 0.2105 0.1803 0.0313  0.0417  0.0204  316 PRO A N     
2590 C CA    . PRO A 319 ? 0.1773 0.1509 0.1142 0.0278  0.0369  0.0162  316 PRO A CA    
2591 C C     . PRO A 319 ? 0.2370 0.2149 0.1647 0.0295  0.0349  0.0157  316 PRO A C     
2592 O O     . PRO A 319 ? 0.2740 0.2533 0.1991 0.0341  0.0364  0.0194  316 PRO A O     
2593 C CB    . PRO A 319 ? 0.2879 0.2645 0.2336 0.0267  0.0363  0.0164  316 PRO A CB    
2594 C CG    . PRO A 319 ? 0.3478 0.3237 0.2999 0.0307  0.0398  0.0216  316 PRO A CG    
2595 C CD    . PRO A 319 ? 0.2496 0.2211 0.2002 0.0324  0.0438  0.0238  316 PRO A CD    
2596 N N     . LYS A 320 ? 0.2477 0.2264 0.1697 0.0258  0.0312  0.0110  317 LYS A N     
2597 C CA    . LYS A 320 ? 0.1900 0.1729 0.1039 0.0268  0.0284  0.0091  317 LYS A CA    
2598 C C     . LYS A 320 ? 0.2747 0.2659 0.1925 0.0264  0.0258  0.0071  317 LYS A C     
2599 O O     . LYS A 320 ? 0.3006 0.2966 0.2136 0.0280  0.0229  0.0050  317 LYS A O     
2600 C CB    . LYS A 320 ? 0.4549 0.4346 0.3617 0.0221  0.0255  0.0042  317 LYS A CB    
2601 C CG    . LYS A 320 ? 0.5322 0.5041 0.4340 0.0228  0.0264  0.0042  317 LYS A CG    
2602 C CD    . LYS A 320 ? 0.6067 0.5748 0.4999 0.0183  0.0223  -0.0008 317 LYS A CD    
2603 C CE    . LYS A 320 ? 0.7023 0.6632 0.5892 0.0205  0.0220  -0.0017 317 LYS A CE    
2604 N NZ    . LYS A 320 ? 0.7306 0.6869 0.6079 0.0167  0.0175  -0.0064 317 LYS A NZ    
2605 N N     . THR A 321 ? 0.2502 0.2433 0.1771 0.0242  0.0265  0.0067  318 THR A N     
2606 C CA    . THR A 321 ? 0.1800 0.1820 0.1127 0.0238  0.0241  0.0037  318 THR A CA    
2607 C C     . THR A 321 ? 0.2548 0.2572 0.1970 0.0262  0.0259  0.0067  318 THR A C     
2608 O O     . THR A 321 ? 0.2688 0.2647 0.2140 0.0257  0.0288  0.0097  318 THR A O     
2609 C CB    . THR A 321 ? 0.2849 0.2906 0.2185 0.0160  0.0227  -0.0029 318 THR A CB    
2610 O OG1   . THR A 321 ? 0.2940 0.2928 0.2292 0.0112  0.0248  -0.0029 318 THR A OG1   
2611 C CG2   . THR A 321 ? 0.2942 0.2991 0.2184 0.0133  0.0205  -0.0062 318 THR A CG2   
2612 N N     . ILE A 322 ? 0.2167 0.2265 0.1639 0.0292  0.0235  0.0054  319 ILE A N     
2613 C CA    . ILE A 322 ? 0.1713 0.1818 0.1276 0.0317  0.0242  0.0073  319 ILE A CA    
2614 C C     . ILE A 322 ? 0.2182 0.2393 0.1821 0.0296  0.0214  0.0007  319 ILE A C     
2615 O O     . ILE A 322 ? 0.2403 0.2691 0.2040 0.0322  0.0177  -0.0027 319 ILE A O     
2616 C CB    . ILE A 322 ? 0.1846 0.1918 0.1386 0.0395  0.0238  0.0132  319 ILE A CB    
2617 C CG1   . ILE A 322 ? 0.2653 0.2628 0.2126 0.0407  0.0280  0.0193  319 ILE A CG1   
2618 C CG2   . ILE A 322 ? 0.2585 0.2664 0.2222 0.0423  0.0233  0.0145  319 ILE A CG2   
2619 C CD1   . ILE A 322 ? 0.2874 0.2794 0.2300 0.0472  0.0289  0.0257  319 ILE A CD1   
2620 N N     . GLY A 323 ? 0.2123 0.2341 0.1827 0.0247  0.0232  -0.0019 320 GLY A N     
2621 C CA    . GLY A 323 ? 0.1853 0.2179 0.1628 0.0212  0.0219  -0.0092 320 GLY A CA    
2622 C C     . GLY A 323 ? 0.1897 0.2243 0.1773 0.0222  0.0226  -0.0100 320 GLY A C     
2623 O O     . GLY A 323 ? 0.2137 0.2399 0.2028 0.0235  0.0245  -0.0051 320 GLY A O     
2624 N N     . CYS A 324 ? 0.1798 0.2264 0.1753 0.0213  0.0209  -0.0169 321 CYS A N     
2625 C CA    A CYS A 324 ? 0.1633 0.2143 0.1694 0.0228  0.0209  -0.0194 321 CYS A CA    
2626 C CA    B CYS A 324 ? 0.1648 0.2159 0.1710 0.0227  0.0209  -0.0195 321 CYS A CA    
2627 C CA    C CYS A 324 ? 0.1451 0.1952 0.1506 0.0219  0.0214  -0.0193 321 CYS A CA    
2628 C C     . CYS A 324 ? 0.1798 0.2421 0.1906 0.0155  0.0224  -0.0287 321 CYS A C     
2629 O O     . CYS A 324 ? 0.2306 0.3032 0.2427 0.0143  0.0207  -0.0345 321 CYS A O     
2630 C CB    A CYS A 324 ? 0.2132 0.2691 0.2251 0.0321  0.0161  -0.0190 321 CYS A CB    
2631 C CB    B CYS A 324 ? 0.1973 0.2536 0.2099 0.0319  0.0162  -0.0194 321 CYS A CB    
2632 C CB    C CYS A 324 ? 0.2469 0.2987 0.2587 0.0313  0.0176  -0.0171 321 CYS A CB    
2633 S SG    A CYS A 324 ? 0.2353 0.2905 0.2581 0.0375  0.0149  -0.0183 321 CYS A SG    
2634 S SG    B CYS A 324 ? 0.2646 0.3076 0.2707 0.0404  0.0148  -0.0087 321 CYS A SG    
2635 S SG    C CYS A 324 ? 0.2569 0.3221 0.2725 0.0367  0.0117  -0.0233 321 CYS A SG    
2636 N N     . SER A 325 ? 0.1641 0.2248 0.1776 0.0108  0.0256  -0.0307 322 SER A N     
2637 C CA    A SER A 325 ? 0.1388 0.2093 0.1553 0.0029  0.0283  -0.0395 322 SER A CA    
2638 C CA    B SER A 325 ? 0.1669 0.2364 0.1825 0.0025  0.0285  -0.0391 322 SER A CA    
2639 C C     . SER A 325 ? 0.1901 0.2633 0.2144 0.0026  0.0300  -0.0426 322 SER A C     
2640 O O     . SER A 325 ? 0.2222 0.2860 0.2469 0.0063  0.0297  -0.0373 322 SER A O     
2641 C CB    A SER A 325 ? 0.2906 0.3530 0.2948 -0.0068 0.0319  -0.0394 322 SER A CB    
2642 C CB    B SER A 325 ? 0.2756 0.3345 0.2783 -0.0065 0.0321  -0.0378 322 SER A CB    
2643 O OG    A SER A 325 ? 0.2272 0.2753 0.2250 -0.0082 0.0337  -0.0343 322 SER A OG    
2644 O OG    B SER A 325 ? 0.2473 0.3105 0.2493 -0.0157 0.0361  -0.0446 322 SER A OG    
2645 N N     . LYS A 326 ? 0.1607 0.2477 0.1921 -0.0018 0.0318  -0.0519 323 LYS A N     
2646 C CA    . LYS A 326 ? 0.1262 0.2169 0.1643 -0.0030 0.0341  -0.0563 323 LYS A CA    
2647 C C     . LYS A 326 ? 0.1817 0.2816 0.2193 -0.0135 0.0395  -0.0654 323 LYS A C     
2648 O O     . LYS A 326 ? 0.1801 0.2927 0.2217 -0.0167 0.0398  -0.0719 323 LYS A O     
2649 C CB    . LYS A 326 ? 0.1756 0.2765 0.2282 0.0066  0.0297  -0.0592 323 LYS A CB    
2650 C CG    . LYS A 326 ? 0.1879 0.2912 0.2473 0.0063  0.0317  -0.0634 323 LYS A CG    
2651 C CD    . LYS A 326 ? 0.2537 0.3617 0.3255 0.0172  0.0262  -0.0639 323 LYS A CD    
2652 C CE    . LYS A 326 ? 0.3170 0.4295 0.3964 0.0169  0.0280  -0.0697 323 LYS A CE    
2653 N NZ    . LYS A 326 ? 0.3850 0.4827 0.4548 0.0119  0.0318  -0.0647 323 LYS A NZ    
2654 N N     . ASN A 327 ? 0.1826 0.2755 0.2147 -0.0193 0.0438  -0.0660 324 ASN A N     
2655 C CA    . ASN A 327 ? 0.1909 0.2911 0.2215 -0.0297 0.0500  -0.0746 324 ASN A CA    
2656 C C     . ASN A 327 ? 0.2023 0.3185 0.2483 -0.0265 0.0506  -0.0831 324 ASN A C     
2657 O O     . ASN A 327 ? 0.1930 0.3080 0.2465 -0.0174 0.0467  -0.0807 324 ASN A O     
2658 C CB    . ASN A 327 ? 0.2662 0.3488 0.2807 -0.0371 0.0540  -0.0711 324 ASN A CB    
2659 C CG    . ASN A 327 ? 0.3366 0.4037 0.3348 -0.0422 0.0540  -0.0650 324 ASN A CG    
2660 O OD1   . ASN A 327 ? 0.3809 0.4510 0.3797 -0.0407 0.0516  -0.0634 324 ASN A OD1   
2661 N ND2   . ASN A 327 ? 0.4197 0.4695 0.4027 -0.0475 0.0560  -0.0617 324 ASN A ND2   
2662 N N     . PHE A 328 ? 0.2244 0.3552 0.2749 -0.0345 0.0558  -0.0934 325 PHE A N     
2663 C CA    . PHE A 328 ? 0.2035 0.3519 0.2691 -0.0328 0.0574  -0.1037 325 PHE A CA    
2664 C C     . PHE A 328 ? 0.2766 0.4265 0.3347 -0.0461 0.0668  -0.1103 325 PHE A C     
2665 O O     . PHE A 328 ? 0.2811 0.4457 0.3441 -0.0540 0.0717  -0.1194 325 PHE A O     
2666 C CB    . PHE A 328 ? 0.2842 0.4537 0.3670 -0.0279 0.0537  -0.1117 325 PHE A CB    
2667 C CG    . PHE A 328 ? 0.2188 0.3844 0.3055 -0.0154 0.0445  -0.1047 325 PHE A CG    
2668 C CD1   . PHE A 328 ? 0.2401 0.4001 0.3195 -0.0155 0.0419  -0.0993 325 PHE A CD1   
2669 C CD2   . PHE A 328 ? 0.2148 0.3806 0.3107 -0.0038 0.0387  -0.1031 325 PHE A CD2   
2670 C CE1   . PHE A 328 ? 0.1615 0.3165 0.2423 -0.0043 0.0341  -0.0926 325 PHE A CE1   
2671 C CE2   . PHE A 328 ? 0.1784 0.3383 0.2755 0.0070  0.0309  -0.0961 325 PHE A CE2   
2672 C CZ    . PHE A 328 ? 0.2056 0.3600 0.2946 0.0067  0.0288  -0.0907 325 PHE A CZ    
2673 N N     . PRO A 329 ? 0.3384 0.4722 0.3838 -0.0488 0.0694  -0.1058 326 PRO A N     
2674 C CA    . PRO A 329 ? 0.3562 0.4840 0.3874 -0.0618 0.0782  -0.1093 326 PRO A CA    
2675 C C     . PRO A 329 ? 0.4401 0.5859 0.4819 -0.0655 0.0843  -0.1216 326 PRO A C     
2676 O O     . PRO A 329 ? 0.3291 0.4881 0.3881 -0.0561 0.0807  -0.1261 326 PRO A O     
2677 C CB    . PRO A 329 ? 0.3383 0.4425 0.3541 -0.0597 0.0762  -0.1001 326 PRO A CB    
2678 C CG    . PRO A 329 ? 0.3661 0.4725 0.3958 -0.0456 0.0686  -0.0966 326 PRO A CG    
2679 C CD    . PRO A 329 ? 0.3347 0.4535 0.3776 -0.0392 0.0637  -0.0966 326 PRO A CD    
2680 N N     . GLY A 330 ? 0.4809 0.6265 0.5118 -0.0794 0.0937  -0.1269 327 GLY A N     
2681 C CA    . GLY A 330 ? 0.5356 0.6963 0.5730 -0.0852 0.1016  -0.1387 327 GLY A CA    
2682 C C     . GLY A 330 ? 0.4053 0.5948 0.4703 -0.0781 0.0995  -0.1498 327 GLY A C     
2683 O O     . GLY A 330 ? 0.3805 0.5847 0.4572 -0.0785 0.0982  -0.1544 327 GLY A O     
2684 N N     . LYS A 331 ? 0.4097 0.6065 0.4849 -0.0709 0.0984  -0.1545 328 LYS A N     
2685 C CA    . LYS A 331 ? 0.5652 0.7893 0.6664 -0.0640 0.0965  -0.1668 328 LYS A CA    
2686 C C     . LYS A 331 ? 0.3888 0.6179 0.5050 -0.0495 0.0845  -0.1633 328 LYS A C     
2687 O O     . LYS A 331 ? 0.3809 0.6321 0.5183 -0.0432 0.0813  -0.1734 328 LYS A O     
2688 C CB    . LYS A 331 ? 1.1993 1.4277 1.3053 -0.0604 0.0985  -0.1728 328 LYS A CB    
2689 C CG    . LYS A 331 ? 1.2213 1.4779 1.3541 -0.0532 0.0967  -0.1871 328 LYS A CG    
2690 C CD    . LYS A 331 ? 1.2425 1.5028 1.3779 -0.0515 0.1002  -0.1938 328 LYS A CD    
2691 C CE    . LYS A 331 ? 1.2346 1.5217 1.3976 -0.0418 0.0962  -0.2076 328 LYS A CE    
2692 N NZ    . LYS A 331 ? 1.2247 1.5092 1.3993 -0.0252 0.0821  -0.2018 328 LYS A NZ    
2693 N N     . THR A 332 ? 0.3558 0.5643 0.4607 -0.0440 0.0779  -0.1494 329 THR A N     
2694 C CA    . THR A 332 ? 0.3266 0.5370 0.4427 -0.0304 0.0670  -0.1450 329 THR A CA    
2695 C C     . THR A 332 ? 0.3110 0.5278 0.4295 -0.0320 0.0648  -0.1451 329 THR A C     
2696 O O     . THR A 332 ? 0.3007 0.5186 0.4265 -0.0214 0.0560  -0.1416 329 THR A O     
2697 C CB    . THR A 332 ? 0.3546 0.5416 0.4602 -0.0223 0.0607  -0.1307 329 THR A CB    
2698 O OG1   . THR A 332 ? 0.3472 0.5167 0.4352 -0.0282 0.0618  -0.1205 329 THR A OG1   
2699 C CG2   . THR A 332 ? 0.4126 0.5906 0.5133 -0.0222 0.0631  -0.1300 329 THR A CG2   
2700 N N     . ALA A 333 ? 0.2793 0.4994 0.3908 -0.0455 0.0728  -0.1491 330 ALA A N     
2701 C CA    . ALA A 333 ? 0.2803 0.5067 0.3938 -0.0483 0.0712  -0.1503 330 ALA A CA    
2702 C C     . ALA A 333 ? 0.3427 0.5920 0.4793 -0.0386 0.0643  -0.1599 330 ALA A C     
2703 O O     . ALA A 333 ? 0.3823 0.6507 0.5356 -0.0365 0.0655  -0.1718 330 ALA A O     
2704 C CB    . ALA A 333 ? 0.3417 0.5711 0.4470 -0.0653 0.0818  -0.1559 330 ALA A CB    
2705 N N     . LEU A 334 ? 0.2562 0.5033 0.3933 -0.0323 0.0568  -0.1552 331 LEU A N     
2706 C CA    . LEU A 334 ? 0.2088 0.4730 0.3648 -0.0208 0.0478  -0.1624 331 LEU A CA    
2707 C C     . LEU A 334 ? 0.2512 0.5412 0.4232 -0.0278 0.0515  -0.1785 331 LEU A C     
2708 O O     . LEU A 334 ? 0.3141 0.6049 0.4807 -0.0376 0.0554  -0.1793 331 LEU A O     
2709 C CB    . LEU A 334 ? 0.2122 0.4638 0.3606 -0.0125 0.0389  -0.1519 331 LEU A CB    
2710 C CG    . LEU A 334 ? 0.1887 0.4146 0.3208 -0.0074 0.0364  -0.1359 331 LEU A CG    
2711 C CD1   . LEU A 334 ? 0.2279 0.4443 0.3543 0.0013  0.0280  -0.1272 331 LEU A CD1   
2712 C CD2   . LEU A 334 ? 0.1942 0.4185 0.3328 0.0011  0.0338  -0.1356 331 LEU A CD2   
2713 N N     . ALA A 335 ? 0.2719 0.5833 0.4646 -0.0225 0.0499  -0.1916 332 ALA A N     
2714 C CA    . ALA A 335 ? 0.3047 0.6432 0.5152 -0.0302 0.0551  -0.2090 332 ALA A CA    
2715 C C     . ALA A 335 ? 0.3043 0.6638 0.5377 -0.0178 0.0443  -0.2203 332 ALA A C     
2716 O O     . ALA A 335 ? 0.2822 0.6669 0.5341 -0.0225 0.0471  -0.2363 332 ALA A O     
2717 C CB    . ALA A 335 ? 0.4061 0.7550 0.6220 -0.0382 0.0655  -0.2182 332 ALA A CB    
2718 N N     . THR A 336 ? 0.2375 0.5862 0.4692 -0.0021 0.0319  -0.2123 333 THR A N     
2719 C CA    . THR A 336 ? 0.2229 0.5868 0.4723 0.0112  0.0196  -0.2212 333 THR A CA    
2720 C C     . THR A 336 ? 0.4298 0.7769 0.6664 0.0191  0.0100  -0.2092 333 THR A C     
2721 O O     . THR A 336 ? 0.3702 0.6926 0.5861 0.0185  0.0109  -0.1930 333 THR A O     
2722 C CB    . THR A 336 ? 0.4348 0.8036 0.6966 0.0254  0.0119  -0.2258 333 THR A CB    
2723 O OG1   . THR A 336 ? 0.3450 0.6876 0.5907 0.0352  0.0052  -0.2092 333 THR A OG1   
2724 C CG2   . THR A 336 ? 0.4457 0.8259 0.7156 0.0180  0.0221  -0.2346 333 THR A CG2   
2725 N N     . ARG A 337 ? 0.3945 0.7553 0.6436 0.0266  0.0007  -0.2180 334 ARG A N     
2726 C CA    . ARG A 337 ? 0.2550 0.6012 0.4921 0.0348  -0.0091 -0.2082 334 ARG A CA    
2727 C C     . ARG A 337 ? 0.3364 0.6613 0.5623 0.0489  -0.0178 -0.1952 334 ARG A C     
2728 O O     . ARG A 337 ? 0.3289 0.6315 0.5352 0.0507  -0.0195 -0.1800 334 ARG A O     
2729 C CB    . ARG A 337 ? 0.7753 1.1419 1.0296 0.0412  -0.0184 -0.2222 334 ARG A CB    
2730 C CG    . ARG A 337 ? 0.8468 1.1989 1.0889 0.0519  -0.0301 -0.2134 334 ARG A CG    
2731 C CD    . ARG A 337 ? 0.9313 1.3042 1.1908 0.0581  -0.0398 -0.2287 334 ARG A CD    
2732 N NE    . ARG A 337 ? 1.0251 1.4194 1.3085 0.0667  -0.0457 -0.2446 334 ARG A NE    
2733 C CZ    . ARG A 337 ? 1.0992 1.4870 1.3839 0.0833  -0.0577 -0.2433 334 ARG A CZ    
2734 N NH1   . ARG A 337 ? 1.1266 1.4868 1.3895 0.0922  -0.0642 -0.2264 334 ARG A NH1   
2735 N NH2   . ARG A 337 ? 1.1199 1.5283 1.4275 0.0908  -0.0631 -0.2593 334 ARG A NH2   
2736 N N     . GLU A 338 ? 0.3544 0.6864 0.5930 0.0588  -0.0232 -0.2016 335 GLU A N     
2737 C CA    . GLU A 338 ? 0.3740 0.6857 0.6031 0.0715  -0.0310 -0.1901 335 GLU A CA    
2738 C C     . GLU A 338 ? 0.3002 0.5886 0.5096 0.0645  -0.0226 -0.1737 335 GLU A C     
2739 O O     . GLU A 338 ? 0.2939 0.5600 0.4875 0.0706  -0.0269 -0.1593 335 GLU A O     
2740 C CB    . GLU A 338 ? 1.0162 1.3403 1.2631 0.0809  -0.0363 -0.2010 335 GLU A CB    
2741 C CG    . GLU A 338 ? 1.0540 1.3981 1.3201 0.0919  -0.0480 -0.2167 335 GLU A CG    
2742 C CD    . GLU A 338 ? 1.0812 1.4090 1.3365 0.1064  -0.0624 -0.2088 335 GLU A CD    
2743 O OE1   . GLU A 338 ? 1.0871 1.3883 1.3213 0.1086  -0.0629 -0.1913 335 GLU A OE1   
2744 O OE2   . GLU A 338 ? 1.0843 1.4257 1.3520 0.1156  -0.0732 -0.2205 335 GLU A OE2   
2745 N N     . GLN A 339 ? 0.2734 0.5670 0.4840 0.0518  -0.0105 -0.1764 336 GLN A N     
2746 C CA    . GLN A 339 ? 0.2510 0.5237 0.4436 0.0444  -0.0025 -0.1625 336 GLN A CA    
2747 C C     . GLN A 339 ? 0.2551 0.5111 0.4291 0.0399  -0.0013 -0.1501 336 GLN A C     
2748 O O     . GLN A 339 ? 0.2805 0.5146 0.4394 0.0432  -0.0025 -0.1358 336 GLN A O     
2749 C CB    . GLN A 339 ? 0.4391 0.7212 0.6347 0.0304  0.0100  -0.1692 336 GLN A CB    
2750 C CG    . GLN A 339 ? 0.3741 0.6536 0.5727 0.0322  0.0126  -0.1696 336 GLN A CG    
2751 C CD    . GLN A 339 ? 0.3070 0.5913 0.5029 0.0174  0.0256  -0.1740 336 GLN A CD    
2752 O OE1   . GLN A 339 ? 0.3115 0.6127 0.5142 0.0076  0.0319  -0.1846 336 GLN A OE1   
2753 N NE2   . GLN A 339 ? 0.2526 0.5212 0.4376 0.0153  0.0297  -0.1659 336 GLN A NE2   
2754 N N     . VAL A 340 ? 0.2411 0.5079 0.4168 0.0320  0.0015  -0.1561 337 VAL A N     
2755 C CA    . VAL A 340 ? 0.2204 0.4731 0.3792 0.0271  0.0029  -0.1461 337 VAL A CA    
2756 C C     . VAL A 340 ? 0.2257 0.4648 0.3764 0.0402  -0.0076 -0.1368 337 VAL A C     
2757 O O     . VAL A 340 ? 0.2279 0.4469 0.3613 0.0399  -0.0067 -0.1233 337 VAL A O     
2758 C CB    . VAL A 340 ? 0.2662 0.5346 0.4307 0.0178  0.0060  -0.1561 337 VAL A CB    
2759 C CG1   . VAL A 340 ? 0.2094 0.4630 0.3570 0.0152  0.0051  -0.1462 337 VAL A CG1   
2760 C CG2   . VAL A 340 ? 0.2819 0.5600 0.4502 0.0026  0.0181  -0.1636 337 VAL A CG2   
2761 N N     . GLN A 341 ? 0.2862 0.5358 0.4489 0.0519  -0.0177 -0.1444 338 GLN A N     
2762 C CA    . GLN A 341 ? 0.2550 0.4910 0.4084 0.0647  -0.0282 -0.1363 338 GLN A CA    
2763 C C     . GLN A 341 ? 0.2701 0.4850 0.4130 0.0715  -0.0297 -0.1233 338 GLN A C     
2764 O O     . GLN A 341 ? 0.2872 0.4829 0.4138 0.0752  -0.0319 -0.1107 338 GLN A O     
2765 C CB    . GLN A 341 ? 0.3640 0.6158 0.5320 0.0758  -0.0397 -0.1486 338 GLN A CB    
2766 C CG    . GLN A 341 ? 0.3565 0.6275 0.5338 0.0697  -0.0393 -0.1605 338 GLN A CG    
2767 C CD    . GLN A 341 ? 0.4136 0.7012 0.6068 0.0813  -0.0516 -0.1740 338 GLN A CD    
2768 O OE1   . GLN A 341 ? 0.4323 0.7237 0.6353 0.0918  -0.0586 -0.1789 338 GLN A OE1   
2769 N NE2   . GLN A 341 ? 0.4010 0.6983 0.5970 0.0799  -0.0550 -0.1806 338 GLN A NE2   
2770 N N     . TRP A 342 ? 0.2142 0.4328 0.3665 0.0727  -0.0281 -0.1267 339 TRP A N     
2771 C CA    . TRP A 342 ? 0.1869 0.3863 0.3312 0.0784  -0.0293 -0.1154 339 TRP A CA    
2772 C C     . TRP A 342 ? 0.2148 0.3957 0.3424 0.0700  -0.0209 -0.1018 339 TRP A C     
2773 O O     . TRP A 342 ? 0.1986 0.3602 0.3139 0.0750  -0.0231 -0.0895 339 TRP A O     
2774 C CB    . TRP A 342 ? 0.2200 0.4282 0.3784 0.0801  -0.0284 -0.1230 339 TRP A CB    
2775 C CG    . TRP A 342 ? 0.2445 0.4338 0.3968 0.0879  -0.0320 -0.1130 339 TRP A CG    
2776 C CD1   . TRP A 342 ? 0.3470 0.5281 0.4990 0.1013  -0.0427 -0.1108 339 TRP A CD1   
2777 C CD2   . TRP A 342 ? 0.2113 0.3866 0.3565 0.0827  -0.0250 -0.1038 339 TRP A CD2   
2778 N NE1   . TRP A 342 ? 0.2909 0.4538 0.4365 0.1040  -0.0422 -0.1007 339 TRP A NE1   
2779 C CE2   . TRP A 342 ? 0.2542 0.4141 0.3964 0.0929  -0.0316 -0.0966 339 TRP A CE2   
2780 C CE3   . TRP A 342 ? 0.1859 0.3592 0.3263 0.0706  -0.0144 -0.1013 339 TRP A CE3   
2781 C CZ2   . TRP A 342 ? 0.2837 0.4282 0.4204 0.0911  -0.0276 -0.0875 339 TRP A CZ2   
2782 C CZ3   . TRP A 342 ? 0.2405 0.3983 0.3749 0.0696  -0.0113 -0.0925 339 TRP A CZ3   
2783 C CH2   . TRP A 342 ? 0.2756 0.4199 0.4091 0.0796  -0.0177 -0.0859 339 TRP A CH2   
2784 N N     . TRP A 343 ? 0.1778 0.3642 0.3047 0.0572  -0.0114 -0.1042 340 TRP A N     
2785 C CA    . TRP A 343 ? 0.1266 0.2958 0.2382 0.0496  -0.0042 -0.0926 340 TRP A CA    
2786 C C     . TRP A 343 ? 0.1510 0.3096 0.2485 0.0492  -0.0054 -0.0844 340 TRP A C     
2787 O O     . TRP A 343 ? 0.1930 0.3337 0.2777 0.0492  -0.0036 -0.0726 340 TRP A O     
2788 C CB    . TRP A 343 ? 0.1938 0.3689 0.3063 0.0363  0.0057  -0.0973 340 TRP A CB    
2789 C CG    . TRP A 343 ? 0.1666 0.3430 0.2861 0.0362  0.0085  -0.1001 340 TRP A CG    
2790 C CD1   . TRP A 343 ? 0.2051 0.3994 0.3386 0.0338  0.0107  -0.1127 340 TRP A CD1   
2791 C CD2   . TRP A 343 ? 0.1434 0.3030 0.2566 0.0385  0.0093  -0.0906 340 TRP A CD2   
2792 N NE1   . TRP A 343 ? 0.2070 0.3959 0.3422 0.0349  0.0127  -0.1114 340 TRP A NE1   
2793 C CE2   . TRP A 343 ? 0.1749 0.3425 0.2981 0.0379  0.0116  -0.0979 340 TRP A CE2   
2794 C CE3   . TRP A 343 ? 0.1898 0.3291 0.2907 0.0410  0.0085  -0.0773 340 TRP A CE3   
2795 C CZ2   . TRP A 343 ? 0.2022 0.3573 0.3230 0.0398  0.0124  -0.0922 340 TRP A CZ2   
2796 C CZ3   . TRP A 343 ? 0.1942 0.3220 0.2941 0.0427  0.0096  -0.0719 340 TRP A CZ3   
2797 C CH2   . TRP A 343 ? 0.2160 0.3514 0.3256 0.0421  0.0112  -0.0792 340 TRP A CH2   
2798 N N     . LEU A 344 ? 0.1870 0.3572 0.2875 0.0492  -0.0086 -0.0913 341 LEU A N     
2799 C CA    . LEU A 344 ? 0.1565 0.3168 0.2436 0.0502  -0.0107 -0.0841 341 LEU A CA    
2800 C C     . LEU A 344 ? 0.2350 0.3800 0.3138 0.0620  -0.0174 -0.0744 341 LEU A C     
2801 O O     . LEU A 344 ? 0.1812 0.3104 0.2453 0.0622  -0.0162 -0.0636 341 LEU A O     
2802 C CB    . LEU A 344 ? 0.2044 0.3802 0.2973 0.0497  -0.0145 -0.0941 341 LEU A CB    
2803 C CG    . LEU A 344 ? 0.2438 0.4314 0.3404 0.0361  -0.0071 -0.1019 341 LEU A CG    
2804 C CD1   . LEU A 344 ? 0.2586 0.4635 0.3646 0.0369  -0.0121 -0.1134 341 LEU A CD1   
2805 C CD2   . LEU A 344 ? 0.2563 0.4283 0.3362 0.0274  -0.0006 -0.0922 341 LEU A CD2   
2806 N N     . LEU A 345 ? 0.2296 0.3787 0.3175 0.0717  -0.0244 -0.0784 342 LEU A N     
2807 C CA    . LEU A 345 ? 0.1939 0.3266 0.2729 0.0827  -0.0308 -0.0692 342 LEU A CA    
2808 C C     . LEU A 345 ? 0.2516 0.3664 0.3224 0.0804  -0.0251 -0.0573 342 LEU A C     
2809 O O     . LEU A 345 ? 0.2205 0.3184 0.2779 0.0837  -0.0256 -0.0463 342 LEU A O     
2810 C CB    . LEU A 345 ? 0.2340 0.3739 0.3244 0.0937  -0.0403 -0.0768 342 LEU A CB    
2811 C CG    . LEU A 345 ? 0.2586 0.3798 0.3383 0.1054  -0.0479 -0.0676 342 LEU A CG    
2812 C CD1   . LEU A 345 ? 0.2552 0.3661 0.3184 0.1091  -0.0516 -0.0612 342 LEU A CD1   
2813 C CD2   . LEU A 345 ? 0.3221 0.4501 0.4135 0.1164  -0.0580 -0.0763 342 LEU A CD2   
2814 N N     . GLN A 346 ? 0.1874 0.3063 0.2666 0.0747  -0.0195 -0.0599 343 GLN A N     
2815 C CA    . GLN A 346 ? 0.1605 0.2637 0.2338 0.0724  -0.0145 -0.0499 343 GLN A CA    
2816 C C     . GLN A 346 ? 0.2183 0.3104 0.2779 0.0657  -0.0086 -0.0411 343 GLN A C     
2817 O O     . GLN A 346 ? 0.1950 0.2710 0.2452 0.0680  -0.0077 -0.0306 343 GLN A O     
2818 C CB    . GLN A 346 ? 0.2000 0.3097 0.2835 0.0668  -0.0096 -0.0552 343 GLN A CB    
2819 C CG    . GLN A 346 ? 0.1547 0.2776 0.2536 0.0729  -0.0148 -0.0656 343 GLN A CG    
2820 C CD    . GLN A 346 ? 0.2246 0.3390 0.3232 0.0855  -0.0239 -0.0622 343 GLN A CD    
2821 O OE1   . GLN A 346 ? 0.2611 0.3593 0.3544 0.0887  -0.0242 -0.0531 343 GLN A OE1   
2822 N NE2   . GLN A 346 ? 0.2486 0.3734 0.3527 0.0926  -0.0318 -0.0700 343 GLN A NE2   
2823 N N     . LEU A 347 ? 0.2219 0.3225 0.2806 0.0572  -0.0045 -0.0459 344 LEU A N     
2824 C CA    . LEU A 347 ? 0.1863 0.2773 0.2324 0.0510  0.0003  -0.0391 344 LEU A CA    
2825 C C     . LEU A 347 ? 0.1976 0.2797 0.2326 0.0575  -0.0037 -0.0323 344 LEU A C     
2826 O O     . LEU A 347 ? 0.1953 0.2635 0.2198 0.0569  -0.0007 -0.0230 344 LEU A O     
2827 C CB    . LEU A 347 ? 0.1489 0.2504 0.1954 0.0413  0.0042  -0.0462 344 LEU A CB    
2828 C CG    . LEU A 347 ? 0.2703 0.3754 0.3212 0.0322  0.0105  -0.0506 344 LEU A CG    
2829 C CD1   . LEU A 347 ? 0.3151 0.4293 0.3647 0.0222  0.0142  -0.0575 344 LEU A CD1   
2830 C CD2   . LEU A 347 ? 0.3413 0.4302 0.3842 0.0296  0.0146  -0.0415 344 LEU A CD2   
2831 N N     . ALA A 348 ? 0.2146 0.3047 0.2520 0.0640  -0.0106 -0.0375 345 ALA A N     
2832 C CA    . ALA A 348 ? 0.1928 0.2746 0.2179 0.0702  -0.0149 -0.0321 345 ALA A CA    
2833 C C     . ALA A 348 ? 0.2076 0.2724 0.2249 0.0777  -0.0165 -0.0218 345 ALA A C     
2834 O O     . ALA A 348 ? 0.2051 0.2576 0.2086 0.0798  -0.0160 -0.0137 345 ALA A O     
2835 C CB    . ALA A 348 ? 0.1791 0.2735 0.2090 0.0758  -0.0230 -0.0412 345 ALA A CB    
2836 N N     . GLN A 349 ? 0.2105 0.2745 0.2364 0.0813  -0.0183 -0.0225 346 GLN A N     
2837 C CA    . GLN A 349 ? 0.2369 0.2839 0.2561 0.0873  -0.0193 -0.0129 346 GLN A CA    
2838 C C     . GLN A 349 ? 0.2273 0.2622 0.2407 0.0809  -0.0108 -0.0037 346 GLN A C     
2839 O O     . GLN A 349 ? 0.2251 0.2451 0.2272 0.0834  -0.0094 0.0057  346 GLN A O     
2840 C CB    . GLN A 349 ? 0.2315 0.2806 0.2621 0.0928  -0.0239 -0.0167 346 GLN A CB    
2841 C CG    . GLN A 349 ? 0.2882 0.3457 0.3230 0.1019  -0.0342 -0.0248 346 GLN A CG    
2842 C CD    . GLN A 349 ? 0.3846 0.4458 0.4321 0.1077  -0.0394 -0.0302 346 GLN A CD    
2843 O OE1   . GLN A 349 ? 0.4452 0.5035 0.4989 0.1045  -0.0351 -0.0284 346 GLN A OE1   
2844 N NE2   . GLN A 349 ? 0.4169 0.4844 0.4684 0.1169  -0.0493 -0.0375 346 GLN A NE2   
2845 N N     . GLU A 350 ? 0.1803 0.2214 0.2011 0.0727  -0.0051 -0.0068 347 GLU A N     
2846 C CA    . GLU A 350 ? 0.1871 0.2179 0.2031 0.0669  0.0020  0.0004  347 GLU A CA    
2847 C C     . GLU A 350 ? 0.1955 0.2219 0.1988 0.0649  0.0044  0.0046  347 GLU A C     
2848 O O     . GLU A 350 ? 0.2100 0.2242 0.2053 0.0650  0.0079  0.0128  347 GLU A O     
2849 C CB    . GLU A 350 ? 0.1850 0.2220 0.2092 0.0589  0.0066  -0.0043 347 GLU A CB    
2850 C CG    . GLU A 350 ? 0.2093 0.2348 0.2286 0.0542  0.0127  0.0028  347 GLU A CG    
2851 C CD    . GLU A 350 ? 0.2684 0.2968 0.2924 0.0465  0.0166  -0.0010 347 GLU A CD    
2852 O OE1   . GLU A 350 ? 0.2975 0.3333 0.3303 0.0455  0.0157  -0.0072 347 GLU A OE1   
2853 O OE2   . GLU A 350 ? 0.2775 0.2997 0.2955 0.0418  0.0205  0.0020  347 GLU A OE2   
2854 N N     . LEU A 351 ? 0.1968 0.2334 0.1988 0.0627  0.0026  -0.0017 348 LEU A N     
2855 C CA    . LEU A 351 ? 0.1808 0.2140 0.1709 0.0608  0.0042  0.0011  348 LEU A CA    
2856 C C     . LEU A 351 ? 0.2115 0.2341 0.1898 0.0685  0.0015  0.0080  348 LEU A C     
2857 O O     . LEU A 351 ? 0.2368 0.2497 0.2047 0.0675  0.0056  0.0148  348 LEU A O     
2858 C CB    . LEU A 351 ? 0.2368 0.2834 0.2289 0.0575  0.0019  -0.0078 348 LEU A CB    
2859 C CG    . LEU A 351 ? 0.2626 0.3069 0.2436 0.0544  0.0034  -0.0065 348 LEU A CG    
2860 C CD1   . LEU A 351 ? 0.2893 0.3255 0.2666 0.0475  0.0101  -0.0021 348 LEU A CD1   
2861 C CD2   . LEU A 351 ? 0.2751 0.3330 0.2596 0.0508  0.0006  -0.0161 348 LEU A CD2   
2862 N N     . GLU A 352 ? 0.2274 0.2513 0.2064 0.0763  -0.0054 0.0062  349 GLU A N     
2863 C CA    . GLU A 352 ? 0.2611 0.2724 0.2263 0.0839  -0.0085 0.0131  349 GLU A CA    
2864 C C     . GLU A 352 ? 0.2420 0.2375 0.2014 0.0833  -0.0025 0.0235  349 GLU A C     
2865 O O     . GLU A 352 ? 0.2728 0.2573 0.2183 0.0844  0.0003  0.0305  349 GLU A O     
2866 C CB    . GLU A 352 ? 0.2577 0.2708 0.2249 0.0931  -0.0179 0.0093  349 GLU A CB    
2867 C CG    . GLU A 352 ? 0.2834 0.2801 0.2333 0.1011  -0.0214 0.0172  349 GLU A CG    
2868 C CD    . GLU A 352 ? 0.5091 0.5043 0.4592 0.1112  -0.0320 0.0139  349 GLU A CD    
2869 O OE1   . GLU A 352 ? 0.6485 0.6267 0.5837 0.1177  -0.0347 0.0215  349 GLU A OE1   
2870 O OE2   . GLU A 352 ? 0.4856 0.4960 0.4503 0.1128  -0.0375 0.0037  349 GLU A OE2   
2871 N N     . GLU A 353 ? 0.2510 0.2455 0.2213 0.0815  -0.0004 0.0239  350 GLU A N     
2872 C CA    . GLU A 353 ? 0.2716 0.2522 0.2393 0.0805  0.0051  0.0327  350 GLU A CA    
2873 C C     . GLU A 353 ? 0.2665 0.2441 0.2299 0.0739  0.0132  0.0365  350 GLU A C     
2874 O O     . GLU A 353 ? 0.2681 0.2341 0.2218 0.0742  0.0177  0.0441  350 GLU A O     
2875 C CB    . GLU A 353 ? 0.3617 0.3442 0.3441 0.0791  0.0054  0.0306  350 GLU A CB    
2876 C CG    . GLU A 353 ? 0.5289 0.4971 0.5108 0.0790  0.0095  0.0388  350 GLU A CG    
2877 C CD    . GLU A 353 ? 0.7342 0.7041 0.7303 0.0792  0.0079  0.0359  350 GLU A CD    
2878 O OE1   . GLU A 353 ? 0.7899 0.7714 0.7971 0.0751  0.0084  0.0291  350 GLU A OE1   
2879 O OE2   . GLU A 353 ? 0.8057 0.7646 0.8009 0.0835  0.0059  0.0404  350 GLU A OE2   
2880 N N     . ARG A 354 ? 0.2265 0.2144 0.1967 0.0679  0.0150  0.0308  351 ARG A N     
2881 C CA    . ARG A 354 ? 0.1787 0.1641 0.1455 0.0622  0.0214  0.0330  351 ARG A CA    
2882 C C     . ARG A 354 ? 0.2299 0.2127 0.1824 0.0637  0.0218  0.0352  351 ARG A C     
2883 O O     . ARG A 354 ? 0.2520 0.2276 0.1982 0.0620  0.0274  0.0402  351 ARG A O     
2884 C CB    . ARG A 354 ? 0.2216 0.2162 0.1971 0.0556  0.0224  0.0264  351 ARG A CB    
2885 C CG    A ARG A 354 ? 0.2137 0.2081 0.2017 0.0534  0.0237  0.0254  351 ARG A CG    
2886 C CG    B ARG A 354 ? 0.2308 0.2259 0.2188 0.0533  0.0235  0.0250  351 ARG A CG    
2887 C CD    A ARG A 354 ? 0.2143 0.2181 0.2091 0.0479  0.0232  0.0178  351 ARG A CD    
2888 C CD    B ARG A 354 ? 0.2389 0.2413 0.2318 0.0467  0.0244  0.0185  351 ARG A CD    
2889 N NE    A ARG A 354 ? 0.1671 0.1700 0.1565 0.0423  0.0262  0.0170  351 ARG A NE    
2890 N NE    B ARG A 354 ? 0.1884 0.1869 0.1749 0.0424  0.0280  0.0199  351 ARG A NE    
2891 C CZ    A ARG A 354 ? 0.1691 0.1775 0.1598 0.0365  0.0262  0.0111  351 ARG A CZ    
2892 C CZ    B ARG A 354 ? 0.2181 0.2203 0.2032 0.0368  0.0283  0.0151  351 ARG A CZ    
2893 N NH1   A ARG A 354 ? 0.1496 0.1662 0.1475 0.0351  0.0242  0.0051  351 ARG A NH1   
2894 N NH1   B ARG A 354 ? 0.2721 0.2826 0.2616 0.0339  0.0262  0.0086  351 ARG A NH1   
2895 N NH2   A ARG A 354 ? 0.1113 0.1164 0.0955 0.0321  0.0282  0.0109  351 ARG A NH2   
2896 N NH2   B ARG A 354 ? 0.2836 0.2808 0.2625 0.0338  0.0308  0.0164  351 ARG A NH2   
2897 N N     . LEU A 355 ? 0.2222 0.2112 0.1701 0.0671  0.0158  0.0309  352 LEU A N     
2898 C CA    . LEU A 355 ? 0.1978 0.1845 0.1316 0.0691  0.0152  0.0322  352 LEU A CA    
2899 C C     . LEU A 355 ? 0.2604 0.2334 0.1810 0.0744  0.0167  0.0407  352 LEU A C     
2900 O O     . LEU A 355 ? 0.2996 0.2665 0.2088 0.0739  0.0209  0.0446  352 LEU A O     
2901 C CB    . LEU A 355 ? 0.2381 0.2347 0.1711 0.0722  0.0076  0.0251  352 LEU A CB    
2902 C CG    . LEU A 355 ? 0.2564 0.2656 0.1976 0.0657  0.0073  0.0169  352 LEU A CG    
2903 C CD1   . LEU A 355 ? 0.2295 0.2498 0.1733 0.0688  -0.0003 0.0089  352 LEU A CD1   
2904 C CD2   . LEU A 355 ? 0.3123 0.3185 0.2455 0.0611  0.0118  0.0182  352 LEU A CD2   
2905 N N     . THR A 356 ? 0.2598 0.2272 0.1809 0.0796  0.0132  0.0431  353 THR A N     
2906 C CA    . THR A 356 ? 0.2801 0.2319 0.1864 0.0844  0.0143  0.0515  353 THR A CA    
2907 C C     . THR A 356 ? 0.3080 0.2508 0.2133 0.0794  0.0244  0.0585  353 THR A C     
2908 O O     . THR A 356 ? 0.3079 0.2411 0.1989 0.0800  0.0289  0.0643  353 THR A O     
2909 C CB    . THR A 356 ? 0.3327 0.2787 0.2397 0.0909  0.0076  0.0526  353 THR A CB    
2910 O OG1   . THR A 356 ? 0.3603 0.3152 0.2677 0.0964  -0.0021 0.0453  353 THR A OG1   
2911 C CG2   . THR A 356 ? 0.3626 0.2896 0.2519 0.0951  0.0093  0.0620  353 THR A CG2   
2912 N N     . LYS A 357 ? 0.3010 0.2473 0.2218 0.0745  0.0280  0.0574  354 LYS A N     
2913 C CA    . LYS A 357 ? 0.2645 0.2048 0.1879 0.0694  0.0371  0.0622  354 LYS A CA    
2914 C C     . LYS A 357 ? 0.2947 0.2388 0.2134 0.0658  0.0419  0.0608  354 LYS A C     
2915 O O     . LYS A 357 ? 0.3085 0.2454 0.2197 0.0644  0.0488  0.0657  354 LYS A O     
2916 C CB    . LYS A 357 ? 0.2950 0.2397 0.2368 0.0654  0.0383  0.0595  354 LYS A CB    
2917 C CG    . LYS A 357 ? 0.3797 0.3204 0.3277 0.0601  0.0469  0.0626  354 LYS A CG    
2918 C CD    . LYS A 357 ? 0.5570 0.4839 0.4976 0.0611  0.0520  0.0708  354 LYS A CD    
2919 C CE    . LYS A 357 ? 0.6223 0.5461 0.5768 0.0566  0.0577  0.0724  354 LYS A CE    
2920 N NZ    . LYS A 357 ? 0.5226 0.4535 0.4861 0.0514  0.0627  0.0687  354 LYS A NZ    
2921 N N     . ASP A 358 ? 0.2554 0.2106 0.1782 0.0641  0.0382  0.0539  355 ASP A N     
2922 C CA    . ASP A 358 ? 0.2061 0.1644 0.1242 0.0610  0.0414  0.0519  355 ASP A CA    
2923 C C     . ASP A 358 ? 0.2742 0.2265 0.1743 0.0648  0.0425  0.0555  355 ASP A C     
2924 O O     . ASP A 358 ? 0.3054 0.2550 0.2003 0.0628  0.0486  0.0572  355 ASP A O     
2925 C CB    . ASP A 358 ? 0.2415 0.2111 0.1651 0.0585  0.0365  0.0439  355 ASP A CB    
2926 C CG    . ASP A 358 ? 0.3120 0.2835 0.2304 0.0555  0.0388  0.0415  355 ASP A CG    
2927 O OD1   . ASP A 358 ? 0.2907 0.2617 0.2157 0.0512  0.0430  0.0408  355 ASP A OD1   
2928 O OD2   . ASP A 358 ? 0.2826 0.2557 0.1904 0.0578  0.0358  0.0398  355 ASP A OD2   
2929 N N     . ARG A 359 ? 0.2593 0.2097 0.1498 0.0705  0.0362  0.0559  356 ARG A N     
2930 C CA    . ARG A 359 ? 0.2751 0.2184 0.1462 0.0749  0.0360  0.0591  356 ARG A CA    
2931 C C     . ARG A 359 ? 0.3053 0.2351 0.1666 0.0749  0.0441  0.0677  356 ARG A C     
2932 O O     . ARG A 359 ? 0.3497 0.2750 0.1984 0.0748  0.0493  0.0702  356 ARG A O     
2933 C CB    . ARG A 359 ? 0.3022 0.2451 0.1659 0.0819  0.0263  0.0575  356 ARG A CB    
2934 C CG    . ARG A 359 ? 0.3385 0.2737 0.1806 0.0875  0.0242  0.0600  356 ARG A CG    
2935 C CD    . ARG A 359 ? 0.4155 0.3509 0.2525 0.0951  0.0129  0.0571  356 ARG A CD    
2936 N NE    . ARG A 359 ? 0.4761 0.4012 0.3120 0.0989  0.0109  0.0619  356 ARG A NE    
2937 C CZ    . ARG A 359 ? 0.5351 0.4622 0.3748 0.1048  0.0011  0.0583  356 ARG A CZ    
2938 N NH1   . ARG A 359 ? 0.4997 0.4401 0.3456 0.1071  -0.0072 0.0493  356 ARG A NH1   
2939 N NH2   . ARG A 359 ? 0.5378 0.4535 0.3754 0.1082  -0.0004 0.0633  356 ARG A NH2   
2940 N N     . ASN A 360 ? 0.3046 0.2276 0.1714 0.0748  0.0456  0.0720  357 ASN A N     
2941 C CA    . ASN A 360 ? 0.3231 0.2329 0.1822 0.0734  0.0542  0.0801  357 ASN A CA    
2942 C C     . ASN A 360 ? 0.3078 0.2208 0.1759 0.0666  0.0644  0.0800  357 ASN A C     
2943 O O     . ASN A 360 ? 0.3520 0.2574 0.2096 0.0651  0.0727  0.0846  357 ASN A O     
2944 C CB    . ASN A 360 ? 0.3256 0.2271 0.1898 0.0746  0.0525  0.0841  357 ASN A CB    
2945 C CG    . ASN A 360 ? 0.3899 0.2833 0.2405 0.0823  0.0435  0.0858  357 ASN A CG    
2946 O OD1   . ASN A 360 ? 0.4744 0.3606 0.3054 0.0866  0.0418  0.0882  357 ASN A OD1   
2947 N ND2   . ASN A 360 ? 0.4333 0.3274 0.2940 0.0848  0.0370  0.0842  357 ASN A ND2   
2948 N N     . ASP A 361 ? 0.2864 0.2101 0.1733 0.0627  0.0639  0.0745  358 ASP A N     
2949 C CA    . ASP A 361 ? 0.2922 0.2193 0.1894 0.0571  0.0720  0.0731  358 ASP A CA    
2950 C C     . ASP A 361 ? 0.3011 0.2335 0.1920 0.0564  0.0740  0.0695  358 ASP A C     
2951 O O     . ASP A 361 ? 0.3282 0.2594 0.2189 0.0537  0.0822  0.0704  358 ASP A O     
2952 C CB    . ASP A 361 ? 0.3115 0.2467 0.2292 0.0537  0.0697  0.0681  358 ASP A CB    
2953 C CG    . ASP A 361 ? 0.4213 0.3513 0.3483 0.0534  0.0695  0.0713  358 ASP A CG    
2954 O OD1   . ASP A 361 ? 0.4680 0.3871 0.3866 0.0547  0.0728  0.0779  358 ASP A OD1   
2955 O OD2   . ASP A 361 ? 0.4603 0.3963 0.4020 0.0517  0.0660  0.0670  358 ASP A OD2   
2956 N N     . ASN A 362 ? 0.2899 0.2286 0.1767 0.0587  0.0665  0.0648  359 ASN A N     
2957 C CA    . ASN A 362 ? 0.2644 0.2095 0.1496 0.0573  0.0668  0.0596  359 ASN A CA    
2958 C C     . ASN A 362 ? 0.3129 0.2567 0.1799 0.0614  0.0641  0.0594  359 ASN A C     
2959 O O     . ASN A 362 ? 0.3339 0.2825 0.1987 0.0607  0.0634  0.0548  359 ASN A O     
2960 C CB    . ASN A 362 ? 0.2766 0.2307 0.1752 0.0545  0.0611  0.0527  359 ASN A CB    
2961 C CG    . ASN A 362 ? 0.2720 0.2270 0.1878 0.0505  0.0639  0.0522  359 ASN A CG    
2962 O OD1   . ASN A 362 ? 0.2828 0.2354 0.2035 0.0485  0.0709  0.0538  359 ASN A OD1   
2963 N ND2   . ASN A 362 ? 0.2918 0.2508 0.2172 0.0495  0.0584  0.0493  359 ASN A ND2   
2964 N N     . ASP A 363 ? 0.3286 0.2649 0.1821 0.0661  0.0619  0.0641  360 ASP A N     
2965 C CA    . ASP A 363 ? 0.3067 0.2396 0.1407 0.0707  0.0595  0.0645  360 ASP A CA    
2966 C C     . ASP A 363 ? 0.3637 0.3061 0.1988 0.0716  0.0513  0.0570  360 ASP A C     
2967 O O     . ASP A 363 ? 0.3772 0.3213 0.2041 0.0721  0.0519  0.0543  360 ASP A O     
2968 C CB    . ASP A 363 ? 0.4147 0.3434 0.2389 0.0694  0.0689  0.0668  360 ASP A CB    
2969 C CG    . ASP A 363 ? 0.4740 0.3922 0.2943 0.0680  0.0779  0.0743  360 ASP A CG    
2970 O OD1   . ASP A 363 ? 0.4429 0.3512 0.2530 0.0713  0.0756  0.0798  360 ASP A OD1   
2971 O OD2   . ASP A 363 ? 0.5823 0.5020 0.4100 0.0635  0.0871  0.0744  360 ASP A OD2   
2972 N N     . ARG A 364 ? 0.3146 0.2633 0.1601 0.0716  0.0440  0.0533  361 ARG A N     
2973 C CA    . ARG A 364 ? 0.2587 0.2167 0.1066 0.0714  0.0365  0.0458  361 ARG A CA    
2974 C C     . ARG A 364 ? 0.3473 0.3098 0.2008 0.0739  0.0283  0.0431  361 ARG A C     
2975 O O     . ARG A 364 ? 0.3641 0.3240 0.2240 0.0747  0.0284  0.0461  361 ARG A O     
2976 C CB    . ARG A 364 ? 0.3217 0.2866 0.1826 0.0650  0.0385  0.0409  361 ARG A CB    
2977 C CG    . ARG A 364 ? 0.3012 0.2685 0.1788 0.0609  0.0398  0.0408  361 ARG A CG    
2978 C CD    . ARG A 364 ? 0.3016 0.2735 0.1889 0.0551  0.0408  0.0358  361 ARG A CD    
2979 N NE    . ARG A 364 ? 0.2934 0.2673 0.1953 0.0516  0.0409  0.0351  361 ARG A NE    
2980 C CZ    . ARG A 364 ? 0.3097 0.2864 0.2200 0.0466  0.0405  0.0307  361 ARG A CZ    
2981 N NH1   . ARG A 364 ? 0.2747 0.2525 0.1968 0.0440  0.0405  0.0302  361 ARG A NH1   
2982 N NH2   . ARG A 364 ? 0.3144 0.2915 0.2203 0.0445  0.0397  0.0269  361 ARG A NH2   
2983 N N     . VAL A 365 ? 0.3035 0.2733 0.1553 0.0753  0.0210  0.0368  362 VAL A N     
2984 C CA    . VAL A 365 ? 0.2757 0.2526 0.1352 0.0773  0.0130  0.0322  362 VAL A CA    
2985 C C     . VAL A 365 ? 0.3194 0.3086 0.1890 0.0724  0.0093  0.0234  362 VAL A C     
2986 O O     . VAL A 365 ? 0.3455 0.3363 0.2091 0.0708  0.0087  0.0202  362 VAL A O     
2987 C CB    . VAL A 365 ? 0.3702 0.3431 0.2162 0.0857  0.0060  0.0327  362 VAL A CB    
2988 C CG1   . VAL A 365 ? 0.4908 0.4496 0.3260 0.0903  0.0090  0.0417  362 VAL A CG1   
2989 C CG2   . VAL A 365 ? 0.3896 0.3622 0.2221 0.0876  0.0041  0.0303  362 VAL A CG2   
2990 N N     . ALA A 366 ? 0.2866 0.2837 0.1707 0.0697  0.0069  0.0192  363 ALA A N     
2991 C CA    . ALA A 366 ? 0.2314 0.2399 0.1246 0.0643  0.0038  0.0107  363 ALA A CA    
2992 C C     . ALA A 366 ? 0.3322 0.3476 0.2224 0.0687  -0.0045 0.0046  363 ALA A C     
2993 O O     . ALA A 366 ? 0.4202 0.4340 0.3070 0.0762  -0.0093 0.0057  363 ALA A O     
2994 C CB    . ALA A 366 ? 0.2588 0.2735 0.1677 0.0600  0.0047  0.0081  363 ALA A CB    
2995 N N     . THR A 367 ? 0.2851 0.3077 0.1767 0.0643  -0.0066 -0.0022 364 THR A N     
2996 C CA    . THR A 367 ? 0.2333 0.2635 0.1235 0.0682  -0.0147 -0.0091 364 THR A CA    
2997 C C     . THR A 367 ? 0.3153 0.3600 0.2204 0.0620  -0.0175 -0.0191 364 THR A C     
2998 O O     . THR A 367 ? 0.3349 0.3884 0.2428 0.0648  -0.0245 -0.0263 364 THR A O     
2999 C CB    . THR A 367 ? 0.2931 0.3185 0.1687 0.0699  -0.0161 -0.0091 364 THR A CB    
3000 O OG1   . THR A 367 ? 0.3352 0.3624 0.2133 0.0613  -0.0127 -0.0122 364 THR A OG1   
3001 C CG2   . THR A 367 ? 0.3548 0.3663 0.2149 0.0753  -0.0120 0.0004  364 THR A CG2   
3002 N N     . GLN A 368 ? 0.3032 0.3501 0.2177 0.0535  -0.0121 -0.0199 365 GLN A N     
3003 C CA    . GLN A 368 ? 0.2303 0.2900 0.1578 0.0461  -0.0130 -0.0291 365 GLN A CA    
3004 C C     . GLN A 368 ? 0.2553 0.3187 0.1953 0.0431  -0.0096 -0.0291 365 GLN A C     
3005 O O     . GLN A 368 ? 0.2846 0.3391 0.2229 0.0418  -0.0043 -0.0224 365 GLN A O     
3006 C CB    . GLN A 368 ? 0.3619 0.4196 0.2859 0.0369  -0.0099 -0.0315 365 GLN A CB    
3007 C CG    . GLN A 368 ? 0.4665 0.5364 0.4016 0.0283  -0.0105 -0.0413 365 GLN A CG    
3008 C CD    . GLN A 368 ? 0.5335 0.5986 0.4626 0.0191  -0.0080 -0.0432 365 GLN A CD    
3009 O OE1   . GLN A 368 ? 0.5925 0.6489 0.5185 0.0134  -0.0028 -0.0394 365 GLN A OE1   
3010 N NE2   . GLN A 368 ? 0.4991 0.5692 0.4263 0.0179  -0.0124 -0.0495 365 GLN A NE2   
3011 N N     . LEU A 369 ? 0.2608 0.3378 0.2138 0.0423  -0.0128 -0.0374 366 LEU A N     
3012 C CA    . LEU A 369 ? 0.2445 0.3268 0.2100 0.0388  -0.0095 -0.0391 366 LEU A CA    
3013 C C     . LEU A 369 ? 0.2822 0.3737 0.2554 0.0274  -0.0064 -0.0473 366 LEU A C     
3014 O O     . LEU A 369 ? 0.2772 0.3797 0.2550 0.0252  -0.0097 -0.0558 366 LEU A O     
3015 C CB    . LEU A 369 ? 0.2490 0.3403 0.2242 0.0469  -0.0155 -0.0431 366 LEU A CB    
3016 C CG    . LEU A 369 ? 0.2627 0.3611 0.2520 0.0446  -0.0130 -0.0463 366 LEU A CG    
3017 C CD1   . LEU A 369 ? 0.2734 0.3585 0.2586 0.0449  -0.0078 -0.0365 366 LEU A CD1   
3018 C CD2   . LEU A 369 ? 0.2838 0.3928 0.2835 0.0531  -0.0204 -0.0526 366 LEU A CD2   
3019 N N     . VAL A 370 ? 0.2418 0.3282 0.2156 0.0200  0.0001  -0.0449 367 VAL A N     
3020 C CA    . VAL A 370 ? 0.2129 0.3053 0.1914 0.0084  0.0040  -0.0517 367 VAL A CA    
3021 C C     . VAL A 370 ? 0.2598 0.3612 0.2513 0.0061  0.0065  -0.0560 367 VAL A C     
3022 O O     . VAL A 370 ? 0.2563 0.3514 0.2485 0.0093  0.0084  -0.0504 367 VAL A O     
3023 C CB    . VAL A 370 ? 0.2362 0.3140 0.2030 0.0010  0.0090  -0.0464 367 VAL A CB    
3024 C CG1   . VAL A 370 ? 0.3443 0.4254 0.3135 -0.0114 0.0132  -0.0528 367 VAL A CG1   
3025 C CG2   . VAL A 370 ? 0.2870 0.3566 0.2414 0.0035  0.0064  -0.0431 367 VAL A CG2   
3026 N N     . VAL A 371 ? 0.2242 0.3409 0.2267 0.0007  0.0065  -0.0665 368 VAL A N     
3027 C CA    . VAL A 371 ? 0.1899 0.3173 0.2055 -0.0020 0.0093  -0.0722 368 VAL A CA    
3028 C C     . VAL A 371 ? 0.2623 0.3908 0.2772 -0.0160 0.0165  -0.0769 368 VAL A C     
3029 O O     . VAL A 371 ? 0.2812 0.4141 0.2949 -0.0234 0.0172  -0.0826 368 VAL A O     
3030 C CB    . VAL A 371 ? 0.2799 0.4265 0.3110 0.0036  0.0038  -0.0823 368 VAL A CB    
3031 C CG1   . VAL A 371 ? 0.3077 0.4655 0.3531 0.0025  0.0064  -0.0883 368 VAL A CG1   
3032 C CG2   . VAL A 371 ? 0.3099 0.4528 0.3378 0.0174  -0.0044 -0.0777 368 VAL A CG2   
3033 N N     . SER A 372 ? 0.2362 0.3593 0.2507 -0.0198 0.0216  -0.0745 369 SER A N     
3034 C CA    . SER A 372 ? 0.2555 0.3774 0.2670 -0.0331 0.0287  -0.0785 369 SER A CA    
3035 C C     . SER A 372 ? 0.2254 0.3581 0.2487 -0.0352 0.0325  -0.0844 369 SER A C     
3036 O O     . SER A 372 ? 0.2561 0.3888 0.2849 -0.0268 0.0305  -0.0813 369 SER A O     
3037 C CB    . SER A 372 ? 0.3788 0.4791 0.3733 -0.0369 0.0315  -0.0692 369 SER A CB    
3038 O OG    . SER A 372 ? 0.4676 0.5636 0.4560 -0.0496 0.0379  -0.0725 369 SER A OG    
3039 N N     . ILE A 373 ? 0.2492 0.3910 0.2763 -0.0467 0.0381  -0.0932 370 ILE A N     
3040 C CA    . ILE A 373 ? 0.2304 0.3826 0.2676 -0.0501 0.0430  -0.0997 370 ILE A CA    
3041 C C     . ILE A 373 ? 0.2832 0.4279 0.3099 -0.0650 0.0517  -0.1015 370 ILE A C     
3042 O O     . ILE A 373 ? 0.3338 0.4700 0.3490 -0.0736 0.0537  -0.1006 370 ILE A O     
3043 C CB    . ILE A 373 ? 0.2744 0.4520 0.3323 -0.0480 0.0412  -0.1125 370 ILE A CB    
3044 C CG1   . ILE A 373 ? 0.3379 0.5256 0.3983 -0.0590 0.0442  -0.1214 370 ILE A CG1   
3045 C CG2   . ILE A 373 ? 0.2656 0.4486 0.3320 -0.0326 0.0315  -0.1108 370 ILE A CG2   
3046 C CD1   . ILE A 373 ? 0.3645 0.5789 0.4471 -0.0577 0.0426  -0.1356 370 ILE A CD1   
3047 N N     . ARG A 374 ? 0.2495 0.3964 0.2792 -0.0678 0.0567  -0.1040 371 ARG A N     
3048 C CA    . ARG A 374 ? 0.3155 0.4581 0.3363 -0.0824 0.0657  -0.1078 371 ARG A CA    
3049 C C     . ARG A 374 ? 0.3814 0.5471 0.4195 -0.0865 0.0707  -0.1207 371 ARG A C     
3050 O O     . ARG A 374 ? 0.3079 0.4859 0.3609 -0.0771 0.0677  -0.1238 371 ARG A O     
3051 C CB    . ARG A 374 ? 0.3424 0.4641 0.3478 -0.0830 0.0678  -0.0993 371 ARG A CB    
3052 C CG    . ARG A 374 ? 0.4511 0.5609 0.4400 -0.0980 0.0761  -0.1006 371 ARG A CG    
3053 C CD    . ARG A 374 ? 0.5960 0.6855 0.5704 -0.0968 0.0766  -0.0928 371 ARG A CD    
3054 N NE    . ARG A 374 ? 0.7518 0.8253 0.7062 -0.1105 0.0833  -0.0929 371 ARG A NE    
3055 C CZ    . ARG A 374 ? 0.8580 0.9132 0.7973 -0.1120 0.0848  -0.0881 371 ARG A CZ    
3056 N NH1   . ARG A 374 ? 0.8576 0.9099 0.8018 -0.1008 0.0803  -0.0835 371 ARG A NH1   
3057 N NH2   . ARG A 374 ? 0.9235 0.9626 0.8424 -0.1247 0.0905  -0.0883 371 ARG A NH2   
3058 N N     . VAL A 375 ? 0.3530 0.5245 0.3894 -0.1008 0.0783  -0.1285 372 VAL A N     
3059 C CA    . VAL A 375 ? 0.4179 0.6118 0.4703 -0.1070 0.0849  -0.1419 372 VAL A CA    
3060 C C     . VAL A 375 ? 0.4210 0.6048 0.4606 -0.1174 0.0945  -0.1417 372 VAL A C     
3061 O O     . VAL A 375 ? 0.4178 0.5785 0.4348 -0.1253 0.0976  -0.1341 372 VAL A O     
3062 C CB    . VAL A 375 ? 0.6544 0.8641 0.7156 -0.1172 0.0884  -0.1525 372 VAL A CB    
3063 C CG1   . VAL A 375 ? 0.6146 0.8359 0.6895 -0.1060 0.0782  -0.1542 372 VAL A CG1   
3064 C CG2   . VAL A 375 ? 0.6957 0.8857 0.7347 -0.1318 0.0941  -0.1480 372 VAL A CG2   
3065 N N     . GLN A 376 ? 0.3779 0.5782 0.4312 -0.1169 0.0986  -0.1505 373 GLN A N     
3066 C CA    . GLN A 376 ? 0.4040 0.5954 0.4452 -0.1259 0.1076  -0.1509 373 GLN A CA    
3067 C C     . GLN A 376 ? 0.4658 0.6516 0.4929 -0.1450 0.1183  -0.1548 373 GLN A C     
3068 O O     . GLN A 376 ? 0.4902 0.6943 0.5296 -0.1528 0.1224  -0.1651 373 GLN A O     
3069 C CB    . GLN A 376 ? 0.5539 0.7671 0.6146 -0.1216 0.1102  -0.1613 373 GLN A CB    
3070 C CG    . GLN A 376 ? 0.5773 0.7786 0.6250 -0.1253 0.1164  -0.1593 373 GLN A CG    
3071 C CD    . GLN A 376 ? 0.5929 0.8121 0.6599 -0.1157 0.1150  -0.1666 373 GLN A CD    
3072 O OE1   . GLN A 376 ? 0.5721 0.8181 0.6611 -0.1156 0.1170  -0.1798 373 GLN A OE1   
3073 N NE2   . GLN A 376 ? 0.5735 0.7783 0.6331 -0.1070 0.1110  -0.1587 373 GLN A NE2   
3074 N N     . GLY A 377 ? 0.5247 0.6842 0.5256 -0.1525 0.1223  -0.1466 374 GLY A N     
3075 C CA    . GLY A 377 ? 0.9234 1.0717 0.9060 -0.1708 0.1320  -0.1484 374 GLY A CA    
3076 C C     . GLY A 377 ? 0.9292 1.0518 0.8904 -0.1734 0.1274  -0.1377 374 GLY A C     
3077 O O     . GLY A 377 ? 0.9268 1.0268 0.8630 -0.1854 0.1328  -0.1338 374 GLY A O     
3078 N N     . ASP A 378 ? 0.9091 1.0341 0.8791 -0.1618 0.1172  -0.1332 375 ASP A N     
3079 C CA    . ASP A 378 ? 0.6806 0.7834 0.6329 -0.1625 0.1119  -0.1238 375 ASP A CA    
3080 C C     . ASP A 378 ? 0.9012 0.9753 0.8314 -0.1577 0.1081  -0.1118 375 ASP A C     
3081 O O     . ASP A 378 ? 0.8778 0.9525 0.8143 -0.1451 0.1030  -0.1076 375 ASP A O     
3082 C CB    . ASP A 378 ? 0.5194 0.6338 0.4875 -0.1504 0.1022  -0.1228 375 ASP A CB    
3083 C CG    . ASP A 378 ? 0.6002 0.6955 0.5523 -0.1524 0.0975  -0.1155 375 ASP A CG    
3084 O OD1   . ASP A 378 ? 0.5959 0.6647 0.5242 -0.1567 0.0979  -0.1075 375 ASP A OD1   
3085 O OD2   . ASP A 378 ? 0.6270 0.7337 0.5901 -0.1491 0.0929  -0.1183 375 ASP A OD2   
3086 N N     . LYS A 379 ? 0.9324 0.9810 0.8369 -0.1677 0.1101  -0.1066 376 LYS A N     
3087 C CA    . LYS A 379 ? 1.1684 1.1885 1.0509 -0.1639 0.1061  -0.0963 376 LYS A CA    
3088 C C     . LYS A 379 ? 1.2291 1.2408 1.1125 -0.1503 0.0950  -0.0876 376 LYS A C     
3089 O O     . LYS A 379 ? 1.2278 1.2250 1.1039 -0.1417 0.0898  -0.0802 376 LYS A O     
3090 C CB    . LYS A 379 ? 1.5581 1.5519 1.4111 -0.1790 0.1112  -0.0942 376 LYS A CB    
3091 C CG    . LYS A 379 ? 1.5567 1.5197 1.3856 -0.1751 0.1062  -0.0845 376 LYS A CG    
3092 C CD    . LYS A 379 ? 1.5681 1.5032 1.3658 -0.1901 0.1107  -0.0827 376 LYS A CD    
3093 C CE    . LYS A 379 ? 1.5580 1.4617 1.3316 -0.1849 0.1040  -0.0737 376 LYS A CE    
3094 N NZ    . LYS A 379 ? 1.5315 1.4288 1.3091 -0.1716 0.0924  -0.0668 376 LYS A NZ    
3095 N N     . ARG A 380 ? 1.2138 1.2352 1.1067 -0.1487 0.0915  -0.0889 377 ARG A N     
3096 C CA    . ARG A 380 ? 0.8362 0.8511 0.7300 -0.1365 0.0818  -0.0814 377 ARG A CA    
3097 C C     . ARG A 380 ? 1.0672 1.0960 0.9798 -0.1211 0.0768  -0.0795 377 ARG A C     
3098 O O     . ARG A 380 ? 1.0720 1.1225 1.0030 -0.1189 0.0793  -0.0861 377 ARG A O     
3099 C CB    . ARG A 380 ? 0.7133 0.7366 0.6127 -0.1388 0.0797  -0.0844 377 ARG A CB    
3100 C CG    . ARG A 380 ? 0.7050 0.7141 0.5864 -0.1542 0.0841  -0.0863 377 ARG A CG    
3101 C CD    . ARG A 380 ? 0.6904 0.7131 0.5823 -0.1564 0.0824  -0.0914 377 ARG A CD    
3102 N NE    . ARG A 380 ? 0.6502 0.7033 0.5669 -0.1565 0.0859  -0.1015 377 ARG A NE    
3103 C CZ    . ARG A 380 ? 0.5840 0.6548 0.5157 -0.1556 0.0835  -0.1076 377 ARG A CZ    
3104 N NH1   . ARG A 380 ? 0.5934 0.6542 0.5173 -0.1547 0.0779  -0.1043 377 ARG A NH1   
3105 N NH2   . ARG A 380 ? 0.5414 0.6397 0.4960 -0.1550 0.0860  -0.1176 377 ARG A NH2   
3106 N N     . LEU A 381 ? 1.0428 1.0589 0.9508 -0.1106 0.0697  -0.0709 378 LEU A N     
3107 C CA    . LEU A 381 ? 0.8852 0.9113 0.8090 -0.0964 0.0650  -0.0681 378 LEU A CA    
3108 C C     . LEU A 381 ? 0.8343 0.8829 0.7775 -0.0903 0.0624  -0.0724 378 LEU A C     
3109 O O     . LEU A 381 ? 0.8274 0.8913 0.7871 -0.0824 0.0613  -0.0746 378 LEU A O     
3110 C CB    . LEU A 381 ? 1.2089 1.2169 1.1237 -0.0876 0.0586  -0.0585 378 LEU A CB    
3111 C CG    . LEU A 381 ? 1.2146 1.2035 1.1164 -0.0880 0.0588  -0.0542 378 LEU A CG    
3112 C CD1   . LEU A 381 ? 1.2282 1.1990 1.1082 -0.1009 0.0624  -0.0553 378 LEU A CD1   
3113 C CD2   . LEU A 381 ? 1.2046 1.1813 1.1042 -0.0774 0.0521  -0.0463 378 LEU A CD2   
3114 N N     . SER A 382 ? 0.8250 0.8746 0.7656 -0.0936 0.0609  -0.0737 379 SER A N     
3115 C CA    . SER A 382 ? 0.5936 0.6637 0.5510 -0.0885 0.0579  -0.0787 379 SER A CA    
3116 C C     . SER A 382 ? 0.5861 0.6667 0.5460 -0.1005 0.0623  -0.0880 379 SER A C     
3117 O O     . SER A 382 ? 0.6458 0.7130 0.5907 -0.1103 0.0643  -0.0872 379 SER A O     
3118 C CB    . SER A 382 ? 0.5297 0.5937 0.4844 -0.0790 0.0506  -0.0722 379 SER A CB    
3119 O OG    . SER A 382 ? 0.5162 0.5970 0.4827 -0.0765 0.0477  -0.0779 379 SER A OG    
3120 N N     . SER A 383 ? 0.5715 0.6761 0.5509 -0.0996 0.0635  -0.0972 380 SER A N     
3121 C CA    . SER A 383 ? 0.4790 0.5975 0.4650 -0.1110 0.0681  -0.1077 380 SER A CA    
3122 C C     . SER A 383 ? 0.5510 0.6789 0.5449 -0.1062 0.0616  -0.1103 380 SER A C     
3123 O O     . SER A 383 ? 0.5295 0.6602 0.5220 -0.1160 0.0637  -0.1158 380 SER A O     
3124 C CB    . SER A 383 ? 0.4882 0.6295 0.4928 -0.1131 0.0731  -0.1183 380 SER A CB    
3125 O OG    . SER A 383 ? 0.4474 0.5804 0.4444 -0.1175 0.0792  -0.1166 380 SER A OG    
3126 N N     . LEU A 384 ? 0.5327 0.6647 0.5340 -0.0912 0.0537  -0.1063 381 LEU A N     
3127 C CA    . LEU A 384 ? 0.3696 0.5115 0.3787 -0.0848 0.0468  -0.1091 381 LEU A CA    
3128 C C     . LEU A 384 ? 0.3564 0.4906 0.3623 -0.0694 0.0389  -0.0998 381 LEU A C     
3129 O O     . LEU A 384 ? 0.3113 0.4436 0.3199 -0.0612 0.0379  -0.0950 381 LEU A O     
3130 C CB    . LEU A 384 ? 0.4717 0.6409 0.5035 -0.0839 0.0464  -0.1220 381 LEU A CB    
3131 C CG    . LEU A 384 ? 0.5119 0.6932 0.5536 -0.0757 0.0379  -0.1265 381 LEU A CG    
3132 C CD1   . LEU A 384 ? 0.5589 0.7620 0.6168 -0.0843 0.0402  -0.1412 381 LEU A CD1   
3133 C CD2   . LEU A 384 ? 0.4911 0.6789 0.5422 -0.0590 0.0302  -0.1241 381 LEU A CD2   
3134 N N     . ARG A 385 ? 0.3388 0.4683 0.3388 -0.0660 0.0335  -0.0974 382 ARG A N     
3135 C CA    . ARG A 385 ? 0.3358 0.4576 0.3312 -0.0525 0.0268  -0.0889 382 ARG A CA    
3136 C C     . ARG A 385 ? 0.3821 0.5141 0.3829 -0.0467 0.0199  -0.0934 382 ARG A C     
3137 O O     . ARG A 385 ? 0.4107 0.5434 0.4085 -0.0539 0.0198  -0.0979 382 ARG A O     
3138 C CB    . ARG A 385 ? 0.5750 0.6736 0.5511 -0.0538 0.0275  -0.0788 382 ARG A CB    
3139 C CG    . ARG A 385 ? 0.6655 0.7548 0.6373 -0.0413 0.0237  -0.0690 382 ARG A CG    
3140 C CD    . ARG A 385 ? 0.7813 0.8536 0.7373 -0.0403 0.0217  -0.0621 382 ARG A CD    
3141 N NE    . ARG A 385 ? 0.8615 0.9390 0.8168 -0.0379 0.0168  -0.0654 382 ARG A NE    
3142 C CZ    . ARG A 385 ? 0.8934 0.9598 0.8373 -0.0336 0.0135  -0.0603 382 ARG A CZ    
3143 N NH1   . ARG A 385 ? 0.9201 0.9920 0.8637 -0.0314 0.0089  -0.0641 382 ARG A NH1   
3144 N NH2   . ARG A 385 ? 0.9018 0.9525 0.8353 -0.0314 0.0147  -0.0521 382 ARG A NH2   
3145 N N     . ARG A 386 ? 0.2852 0.4239 0.2932 -0.0336 0.0138  -0.0923 383 ARG A N     
3146 C CA    . ARG A 386 ? 0.2834 0.4301 0.2948 -0.0262 0.0060  -0.0962 383 ARG A CA    
3147 C C     . ARG A 386 ? 0.3183 0.4545 0.3213 -0.0126 0.0006  -0.0864 383 ARG A C     
3148 O O     . ARG A 386 ? 0.3127 0.4431 0.3150 -0.0073 0.0019  -0.0799 383 ARG A O     
3149 C CB    . ARG A 386 ? 0.2858 0.4554 0.3173 -0.0238 0.0030  -0.1082 383 ARG A CB    
3150 C CG    . ARG A 386 ? 0.2981 0.4814 0.3402 -0.0376 0.0086  -0.1197 383 ARG A CG    
3151 C CD    . ARG A 386 ? 0.3038 0.4874 0.3420 -0.0440 0.0069  -0.1242 383 ARG A CD    
3152 N NE    . ARG A 386 ? 0.2887 0.4872 0.3390 -0.0574 0.0124  -0.1364 383 ARG A NE    
3153 C CZ    . ARG A 386 ? 0.3950 0.5856 0.4376 -0.0723 0.0212  -0.1362 383 ARG A CZ    
3154 N NH1   . ARG A 386 ? 0.4272 0.5951 0.4504 -0.0747 0.0244  -0.1247 383 ARG A NH1   
3155 N NH2   . ARG A 386 ? 0.4506 0.6556 0.5047 -0.0848 0.0266  -0.1479 383 ARG A NH2   
3156 N N     . CYS A 387 ? 0.3270 0.4604 0.3230 -0.0071 -0.0052 -0.0855 384 CYS A N     
3157 C CA    . CYS A 387 ? 0.3274 0.4510 0.3143 0.0055  -0.0099 -0.0767 384 CYS A CA    
3158 C C     . CYS A 387 ? 0.3599 0.4939 0.3528 0.0163  -0.0188 -0.0818 384 CYS A C     
3159 O O     . CYS A 387 ? 0.3602 0.5081 0.3625 0.0142  -0.0225 -0.0923 384 CYS A O     
3160 C CB    . CYS A 387 ? 0.3043 0.4114 0.2737 0.0049  -0.0092 -0.0691 384 CYS A CB    
3161 S SG    A CYS A 387 ? 0.3973 0.5072 0.3619 0.0014  -0.0136 -0.0759 384 CYS A SG    
3162 S SG    B CYS A 387 ? 0.4530 0.5452 0.4137 -0.0056 -0.0007 -0.0629 384 CYS A SG    
3163 N N     . CYS A 388 ? 0.3161 0.4426 0.3031 0.0279  -0.0224 -0.0745 385 CYS A N     
3164 C CA    . CYS A 388 ? 0.4509 0.5813 0.4372 0.0395  -0.0318 -0.0770 385 CYS A CA    
3165 C C     . CYS A 388 ? 0.4350 0.5479 0.4039 0.0489  -0.0332 -0.0651 385 CYS A C     
3166 O O     . CYS A 388 ? 0.3681 0.4687 0.3296 0.0468  -0.0269 -0.0558 385 CYS A O     
3167 C CB    . CYS A 388 ? 0.4083 0.5530 0.4109 0.0451  -0.0365 -0.0846 385 CYS A CB    
3168 S SG    . CYS A 388 ? 0.4091 0.5468 0.4139 0.0493  -0.0330 -0.0767 385 CYS A SG    
3169 N N     . ALA A 389 ? 0.4151 0.5269 0.3773 0.0591  -0.0415 -0.0658 386 ALA A N     
3170 C CA    . ALA A 389 ? 0.3534 0.4482 0.2975 0.0677  -0.0424 -0.0548 386 ALA A CA    
3171 C C     . ALA A 389 ? 0.3263 0.4144 0.2713 0.0728  -0.0405 -0.0477 386 ALA A C     
3172 O O     . ALA A 389 ? 0.4058 0.5029 0.3632 0.0761  -0.0442 -0.0528 386 ALA A O     
3173 C CB    . ALA A 389 ? 0.3238 0.4179 0.2589 0.0779  -0.0522 -0.0576 386 ALA A CB    
3174 N N     . LEU A 390 ? 0.3041 0.3767 0.2366 0.0731  -0.0346 -0.0365 387 LEU A N     
3175 C CA    . LEU A 390 ? 0.2760 0.3394 0.2067 0.0782  -0.0329 -0.0286 387 LEU A CA    
3176 C C     . LEU A 390 ? 0.3143 0.3637 0.2262 0.0880  -0.0366 -0.0213 387 LEU A C     
3177 O O     . LEU A 390 ? 0.3462 0.3844 0.2445 0.0869  -0.0316 -0.0141 387 LEU A O     
3178 C CB    . LEU A 390 ? 0.3412 0.3975 0.2726 0.0707  -0.0230 -0.0218 387 LEU A CB    
3179 C CG    . LEU A 390 ? 0.3502 0.4031 0.2886 0.0721  -0.0203 -0.0173 387 LEU A CG    
3180 C CD1   . LEU A 390 ? 0.2964 0.3426 0.2352 0.0644  -0.0112 -0.0117 387 LEU A CD1   
3181 C CD2   . LEU A 390 ? 0.4065 0.4476 0.3344 0.0823  -0.0238 -0.0102 387 LEU A CD2   
3182 N N     . THR A 391 ? 0.3468 0.3966 0.2574 0.0977  -0.0454 -0.0237 388 THR A N     
3183 C CA    . THR A 391 ? 0.4173 0.4535 0.3078 0.1075  -0.0504 -0.0182 388 THR A CA    
3184 C C     . THR A 391 ? 0.4229 0.4447 0.3053 0.1145  -0.0507 -0.0095 388 THR A C     
3185 O O     . THR A 391 ? 0.4698 0.4758 0.3322 0.1208  -0.0517 -0.0019 388 THR A O     
3186 C CB    . THR A 391 ? 0.5471 0.5916 0.4377 0.1147  -0.0623 -0.0278 388 THR A CB    
3187 O OG1   . THR A 391 ? 0.5119 0.5676 0.4190 0.1183  -0.0689 -0.0356 388 THR A OG1   
3188 C CG2   . THR A 391 ? 0.5049 0.5615 0.4011 0.1078  -0.0621 -0.0360 388 THR A CG2   
3189 N N     . ARG A 392 ? 0.4130 0.4397 0.3102 0.1132  -0.0499 -0.0107 389 ARG A N     
3190 C CA    . ARG A 392 ? 0.4162 0.4291 0.3076 0.1189  -0.0501 -0.0028 389 ARG A CA    
3191 C C     . ARG A 392 ? 0.3805 0.3966 0.2870 0.1119  -0.0426 -0.0011 389 ARG A C     
3192 O O     . ARG A 392 ? 0.4017 0.4337 0.3267 0.1068  -0.0424 -0.0094 389 ARG A O     
3193 C CB    . ARG A 392 ? 0.7989 0.8124 0.6907 0.1300  -0.0626 -0.0081 389 ARG A CB    
3194 C CG    . ARG A 392 ? 0.9116 0.9160 0.7837 0.1392  -0.0710 -0.0076 389 ARG A CG    
3195 C CD    . ARG A 392 ? 1.0408 1.0440 0.9129 0.1511  -0.0846 -0.0129 389 ARG A CD    
3196 N NE    . ARG A 392 ? 1.1669 1.1559 1.0354 0.1552  -0.0845 -0.0055 389 ARG A NE    
3197 C CZ    . ARG A 392 ? 1.2518 1.2495 1.1392 0.1548  -0.0856 -0.0100 389 ARG A CZ    
3198 N NH1   . ARG A 392 ? 1.2747 1.2574 1.1569 0.1587  -0.0859 -0.0027 389 ARG A NH1   
3199 N NH2   . ARG A 392 ? 1.2815 1.3025 1.1925 0.1501  -0.0863 -0.0219 389 ARG A NH2   
3200 N N     . TYR A 393 ? 0.3594 0.3603 0.2577 0.1115  -0.0363 0.0095  390 TYR A N     
3201 C CA    . TYR A 393 ? 0.3722 0.3739 0.2835 0.1062  -0.0301 0.0117  390 TYR A CA    
3202 C C     . TYR A 393 ? 0.4603 0.4626 0.3797 0.1130  -0.0374 0.0089  390 TYR A C     
3203 O O     . TYR A 393 ? 0.4543 0.4416 0.3659 0.1175  -0.0376 0.0165  390 TYR A O     
3204 C CB    . TYR A 393 ? 0.3624 0.3479 0.2630 0.1034  -0.0210 0.0234  390 TYR A CB    
3205 C CG    . TYR A 393 ? 0.3156 0.3026 0.2141 0.0953  -0.0125 0.0251  390 TYR A CG    
3206 C CD1   . TYR A 393 ? 0.2878 0.2636 0.1806 0.0917  -0.0035 0.0337  390 TYR A CD1   
3207 C CD2   . TYR A 393 ? 0.3965 0.3961 0.2992 0.0912  -0.0136 0.0176  390 TYR A CD2   
3208 C CE1   . TYR A 393 ? 0.2863 0.2636 0.1780 0.0851  0.0035  0.0344  390 TYR A CE1   
3209 C CE2   . TYR A 393 ? 0.3598 0.3592 0.2598 0.0843  -0.0067 0.0189  390 TYR A CE2   
3210 C CZ    . TYR A 393 ? 0.3321 0.3206 0.2268 0.0818  0.0015  0.0271  390 TYR A CZ    
3211 O OH    . TYR A 393 ? 0.3124 0.3010 0.2053 0.0757  0.0076  0.0276  390 TYR A OH    
3212 N N     . ASP A 394 ? 0.3787 0.3984 0.3138 0.1136  -0.0433 -0.0025 391 ASP A N     
3213 C CA    . ASP A 394 ? 0.3287 0.3522 0.2739 0.1205  -0.0511 -0.0077 391 ASP A CA    
3214 C C     . ASP A 394 ? 0.2742 0.3180 0.2424 0.1143  -0.0494 -0.0182 391 ASP A C     
3215 O O     . ASP A 394 ? 0.3493 0.4090 0.3257 0.1105  -0.0505 -0.0274 391 ASP A O     
3216 C CB    . ASP A 394 ? 0.4040 0.4275 0.3423 0.1314  -0.0636 -0.0129 391 ASP A CB    
3217 C CG    . ASP A 394 ? 0.5438 0.5715 0.4931 0.1396  -0.0730 -0.0194 391 ASP A CG    
3218 O OD1   . ASP A 394 ? 0.5156 0.5638 0.4848 0.1381  -0.0758 -0.0316 391 ASP A OD1   
3219 O OD2   . ASP A 394 ? 0.6836 0.6938 0.6217 0.1474  -0.0773 -0.0125 391 ASP A OD2   
3220 N N     . ALA A 395 ? 0.2881 0.3310 0.2662 0.1129  -0.0466 -0.0169 392 ALA A N     
3221 C CA    . ALA A 395 ? 0.3720 0.4322 0.3699 0.1059  -0.0431 -0.0257 392 ALA A CA    
3222 C C     . ALA A 395 ? 0.2965 0.3764 0.3093 0.1092  -0.0508 -0.0400 392 ALA A C     
3223 O O     . ALA A 395 ? 0.2761 0.3728 0.3016 0.1012  -0.0470 -0.0486 392 ALA A O     
3224 C CB    . ALA A 395 ? 0.2834 0.3371 0.2877 0.1049  -0.0393 -0.0214 392 ALA A CB    
3225 N N     . HIS A 396 ? 0.3174 0.3952 0.3289 0.1207  -0.0616 -0.0430 393 HIS A N     
3226 C CA    . HIS A 396 ? 0.4280 0.5258 0.4552 0.1247  -0.0697 -0.0578 393 HIS A CA    
3227 C C     . HIS A 396 ? 0.2425 0.3518 0.2692 0.1211  -0.0706 -0.0643 393 HIS A C     
3228 O O     . HIS A 396 ? 0.3539 0.4843 0.3976 0.1168  -0.0708 -0.0769 393 HIS A O     
3229 C CB    . HIS A 396 ? 0.3205 0.4122 0.3459 0.1390  -0.0827 -0.0600 393 HIS A CB    
3230 C CG    . HIS A 396 ? 0.4288 0.5173 0.4628 0.1423  -0.0834 -0.0596 393 HIS A CG    
3231 N ND1   . HIS A 396 ? 0.5109 0.5768 0.5318 0.1451  -0.0818 -0.0467 393 HIS A ND1   
3232 C CD2   . HIS A 396 ? 0.4709 0.5761 0.5258 0.1426  -0.0851 -0.0707 393 HIS A CD2   
3233 C CE1   . HIS A 396 ? 0.4919 0.5601 0.5250 0.1474  -0.0832 -0.0499 393 HIS A CE1   
3234 N NE2   . HIS A 396 ? 0.5197 0.6117 0.5734 0.1463  -0.0853 -0.0645 393 HIS A NE2   
3235 N N     . LYS A 397 ? 0.2883 0.3838 0.2958 0.1226  -0.0709 -0.0559 394 LYS A N     
3236 C CA    . LYS A 397 ? 0.3916 0.4958 0.3969 0.1193  -0.0717 -0.0612 394 LYS A CA    
3237 C C     . LYS A 397 ? 0.2941 0.4075 0.3061 0.1049  -0.0606 -0.0626 394 LYS A C     
3238 O O     . LYS A 397 ? 0.3086 0.4387 0.3310 0.0996  -0.0608 -0.0730 394 LYS A O     
3239 C CB    . LYS A 397 ? 0.3632 0.4490 0.3447 0.1247  -0.0744 -0.0516 394 LYS A CB    
3240 C CG    . LYS A 397 ? 0.4304 0.5235 0.4083 0.1206  -0.0745 -0.0561 394 LYS A CG    
3241 C CD    . LYS A 397 ? 0.4964 0.5724 0.4506 0.1280  -0.0790 -0.0484 394 LYS A CD    
3242 C CE    . LYS A 397 ? 0.5375 0.6205 0.4884 0.1235  -0.0788 -0.0529 394 LYS A CE    
3243 N NZ    . LYS A 397 ? 0.5615 0.6673 0.5320 0.1226  -0.0851 -0.0687 394 LYS A NZ    
3244 N N     . MET A 398 ? 0.2840 0.3858 0.2896 0.0986  -0.0511 -0.0524 395 MET A N     
3245 C CA    . MET A 398 ? 0.3145 0.4216 0.3236 0.0856  -0.0412 -0.0529 395 MET A CA    
3246 C C     . MET A 398 ? 0.2633 0.3893 0.2926 0.0791  -0.0389 -0.0643 395 MET A C     
3247 O O     . MET A 398 ? 0.2645 0.4013 0.2993 0.0697  -0.0347 -0.0707 395 MET A O     
3248 C CB    . MET A 398 ? 0.2504 0.3409 0.2492 0.0814  -0.0327 -0.0404 395 MET A CB    
3249 C CG    . MET A 398 ? 0.2405 0.3145 0.2195 0.0846  -0.0323 -0.0303 395 MET A CG    
3250 S SD    . MET A 398 ? 0.3554 0.4143 0.3255 0.0774  -0.0212 -0.0185 395 MET A SD    
3251 C CE    . MET A 398 ? 0.3816 0.4316 0.3558 0.0825  -0.0210 -0.0125 395 MET A CE    
3252 N N     . SER A 399 ? 0.2822 0.4116 0.3218 0.0841  -0.0416 -0.0670 396 SER A N     
3253 C CA    . SER A 399 ? 0.2686 0.4159 0.3272 0.0783  -0.0386 -0.0779 396 SER A CA    
3254 C C     . SER A 399 ? 0.2290 0.3972 0.3015 0.0795  -0.0447 -0.0927 396 SER A C     
3255 O O     . SER A 399 ? 0.2454 0.4298 0.3305 0.0701  -0.0396 -0.1022 396 SER A O     
3256 C CB    . SER A 399 ? 0.3392 0.4837 0.4050 0.0835  -0.0396 -0.0766 396 SER A CB    
3257 O OG    . SER A 399 ? 0.4014 0.5443 0.4682 0.0967  -0.0506 -0.0786 396 SER A OG    
3258 N N     . HIS A 400 ? 0.2711 0.4386 0.3407 0.0909  -0.0555 -0.0949 397 HIS A N     
3259 C CA    . HIS A 400 ? 0.3634 0.5504 0.4460 0.0931  -0.0625 -0.1094 397 HIS A CA    
3260 C C     . HIS A 400 ? 0.2724 0.4643 0.3514 0.0832  -0.0581 -0.1115 397 HIS A C     
3261 O O     . HIS A 400 ? 0.2995 0.5108 0.3936 0.0760  -0.0563 -0.1240 397 HIS A O     
3262 C CB    . HIS A 400 ? 0.9066 1.0881 0.9836 0.1086  -0.0763 -0.1101 397 HIS A CB    
3263 C CG    . HIS A 400 ? 0.9383 1.1402 1.0302 0.1126  -0.0853 -0.1261 397 HIS A CG    
3264 N ND1   . HIS A 400 ? 0.9464 1.1512 1.0330 0.1118  -0.0887 -0.1292 397 HIS A ND1   
3265 C CD2   . HIS A 400 ? 0.9534 1.1747 1.0665 0.1175  -0.0917 -0.1407 397 HIS A CD2   
3266 C CE1   . HIS A 400 ? 0.9579 1.1831 1.0623 0.1160  -0.0970 -0.1451 397 HIS A CE1   
3267 N NE2   . HIS A 400 ? 0.9619 1.1978 1.0829 0.1195  -0.0989 -0.1526 397 HIS A NE2   
3268 N N     . ASP A 401 ? 0.2609 0.4348 0.3199 0.0824  -0.0559 -0.0996 398 ASP A N     
3269 C CA    . ASP A 401 ? 0.3241 0.4996 0.3774 0.0737  -0.0521 -0.1005 398 ASP A CA    
3270 C C     . ASP A 401 ? 0.2462 0.4285 0.3065 0.0584  -0.0407 -0.1031 398 ASP A C     
3271 O O     . ASP A 401 ? 0.2978 0.4917 0.3642 0.0500  -0.0386 -0.1113 398 ASP A O     
3272 C CB    . ASP A 401 ? 0.3096 0.4635 0.3397 0.0764  -0.0514 -0.0868 398 ASP A CB    
3273 C CG    . ASP A 401 ? 0.3928 0.5394 0.4124 0.0900  -0.0625 -0.0852 398 ASP A CG    
3274 O OD1   . ASP A 401 ? 0.3342 0.4934 0.3646 0.0971  -0.0720 -0.0959 398 ASP A OD1   
3275 O OD2   . ASP A 401 ? 0.4121 0.5400 0.4121 0.0936  -0.0619 -0.0736 398 ASP A OD2   
3276 N N     . ALA A 402 ? 0.2690 0.4429 0.3273 0.0548  -0.0336 -0.0958 399 ALA A N     
3277 C CA    . ALA A 402 ? 0.2587 0.4363 0.3211 0.0410  -0.0232 -0.0975 399 ALA A CA    
3278 C C     . ALA A 402 ? 0.2398 0.4402 0.3226 0.0357  -0.0221 -0.1125 399 ALA A C     
3279 O O     . ALA A 402 ? 0.2529 0.4608 0.3392 0.0234  -0.0155 -0.1182 399 ALA A O     
3280 C CB    . ALA A 402 ? 0.2772 0.4411 0.3340 0.0401  -0.0173 -0.0875 399 ALA A CB    
3281 N N     . PHE A 403 ? 0.2284 0.4394 0.3245 0.0449  -0.0284 -0.1192 400 PHE A N     
3282 C CA    . PHE A 403 ? 0.2210 0.4559 0.3386 0.0409  -0.0277 -0.1350 400 PHE A CA    
3283 C C     . PHE A 403 ? 0.2801 0.5289 0.4040 0.0368  -0.0304 -0.1454 400 PHE A C     
3284 O O     . PHE A 403 ? 0.2756 0.5395 0.4108 0.0252  -0.0239 -0.1554 400 PHE A O     
3285 C CB    . PHE A 403 ? 0.2445 0.4880 0.3752 0.0536  -0.0362 -0.1411 400 PHE A CB    
3286 C CG    . PHE A 403 ? 0.3490 0.6183 0.5035 0.0499  -0.0348 -0.1581 400 PHE A CG    
3287 C CD1   . PHE A 403 ? 0.4265 0.7152 0.5958 0.0531  -0.0420 -0.1722 400 PHE A CD1   
3288 C CD2   . PHE A 403 ? 0.3607 0.6355 0.5231 0.0430  -0.0264 -0.1606 400 PHE A CD2   
3289 C CE1   . PHE A 403 ? 0.4593 0.7736 0.6524 0.0493  -0.0402 -0.1890 400 PHE A CE1   
3290 C CE2   . PHE A 403 ? 0.4872 0.7866 0.6716 0.0392  -0.0242 -0.1769 400 PHE A CE2   
3291 C CZ    . PHE A 403 ? 0.4694 0.7892 0.6699 0.0421  -0.0309 -0.1913 400 PHE A CZ    
3292 N N     . THR A 404 ? 0.2997 0.5425 0.4155 0.0461  -0.0396 -0.1428 401 THR A N     
3293 C CA    . THR A 404 ? 0.3436 0.5988 0.4652 0.0439  -0.0438 -0.1528 401 THR A CA    
3294 C C     . THR A 404 ? 0.3443 0.5980 0.4603 0.0279  -0.0341 -0.1521 401 THR A C     
3295 O O     . THR A 404 ? 0.3888 0.6598 0.5181 0.0194  -0.0320 -0.1646 401 THR A O     
3296 C CB    . THR A 404 ? 0.3569 0.6018 0.4661 0.0569  -0.0554 -0.1482 401 THR A CB    
3297 O OG1   . THR A 404 ? 0.3130 0.5603 0.4283 0.0717  -0.0658 -0.1512 401 THR A OG1   
3298 C CG2   . THR A 404 ? 0.3638 0.6206 0.4784 0.0540  -0.0597 -0.1585 401 THR A CG2   
3299 N N     . VAL A 405 ? 0.2951 0.5279 0.3918 0.0237  -0.0281 -0.1382 402 VAL A N     
3300 C CA    . VAL A 405 ? 0.3373 0.5652 0.4259 0.0098  -0.0204 -0.1367 402 VAL A CA    
3301 C C     . VAL A 405 ? 0.3350 0.5711 0.4320 -0.0049 -0.0094 -0.1423 402 VAL A C     
3302 O O     . VAL A 405 ? 0.4039 0.6406 0.4982 -0.0175 -0.0036 -0.1454 402 VAL A O     
3303 C CB    . VAL A 405 ? 0.5217 0.7246 0.5869 0.0104  -0.0183 -0.1211 402 VAL A CB    
3304 C CG1   . VAL A 405 ? 0.5479 0.7427 0.6031 0.0238  -0.0281 -0.1160 402 VAL A CG1   
3305 C CG2   . VAL A 405 ? 0.5445 0.7352 0.6038 0.0103  -0.0125 -0.1112 402 VAL A CG2   
3306 N N     . ILE A 406 ? 0.3453 0.5866 0.4512 -0.0032 -0.0066 -0.1438 403 ILE A N     
3307 C CA    . ILE A 406 ? 0.3176 0.5654 0.4296 -0.0167 0.0042  -0.1487 403 ILE A CA    
3308 C C     . ILE A 406 ? 0.3321 0.6065 0.4685 -0.0181 0.0047  -0.1651 403 ILE A C     
3309 O O     . ILE A 406 ? 0.3541 0.6367 0.4966 -0.0304 0.0143  -0.1714 403 ILE A O     
3310 C CB    . ILE A 406 ? 0.3897 0.6222 0.4921 -0.0162 0.0094  -0.1379 403 ILE A CB    
3311 C CG1   . ILE A 406 ? 0.3704 0.6089 0.4836 -0.0032 0.0035  -0.1392 403 ILE A CG1   
3312 C CG2   . ILE A 406 ? 0.4058 0.6135 0.4862 -0.0147 0.0093  -0.1228 403 ILE A CG2   
3313 C CD1   . ILE A 406 ? 0.4075 0.6380 0.5181 -0.0047 0.0095  -0.1336 403 ILE A CD1   
3314 N N     . LYS A 407 ? 0.3355 0.6228 0.4851 -0.0055 -0.0057 -0.1723 404 LYS A N     
3315 C CA    . LYS A 407 ? 0.3748 0.6875 0.5491 -0.0041 -0.0067 -0.1882 404 LYS A CA    
3316 C C     . LYS A 407 ? 0.6831 1.0157 0.8714 -0.0190 0.0006  -0.2026 404 LYS A C     
3317 O O     . LYS A 407 ? 0.6542 1.0060 0.8604 -0.0240 0.0058  -0.2147 404 LYS A O     
3318 C CB    . LYS A 407 ? 0.7655 1.0867 0.9501 0.0132  -0.0211 -0.1937 404 LYS A CB    
3319 C CG    . LYS A 407 ? 0.7564 1.0817 0.9411 0.0161  -0.0292 -0.1983 404 LYS A CG    
3320 C CD    . LYS A 407 ? 0.7808 1.1120 0.9734 0.0343  -0.0443 -0.2033 404 LYS A CD    
3321 C CE    . LYS A 407 ? 0.8228 1.1604 1.0175 0.0374  -0.0530 -0.2103 404 LYS A CE    
3322 N NZ    . LYS A 407 ? 0.8508 1.1669 1.0215 0.0341  -0.0515 -0.1969 404 LYS A NZ    
3323 N N     . ASN A 408 ? 0.6793 1.0070 0.8593 -0.0264 0.0014  -0.2015 405 ASN A N     
3324 C CA    . ASN A 408 ? 0.5438 0.8885 0.7359 -0.0414 0.0084  -0.2146 405 ASN A CA    
3325 C C     . ASN A 408 ? 0.6381 0.9763 0.8219 -0.0591 0.0234  -0.2120 405 ASN A C     
3326 O O     . ASN A 408 ? 0.6549 1.0051 0.8467 -0.0739 0.0314  -0.2222 405 ASN A O     
3327 C CB    . ASN A 408 ? 1.1128 1.4535 1.2985 -0.0431 0.0033  -0.2146 405 ASN A CB    
3328 C CG    . ASN A 408 ? 1.1251 1.4372 1.2831 -0.0473 0.0064  -0.1979 405 ASN A CG    
3329 O OD1   . ASN A 408 ? 1.1127 1.4060 1.2554 -0.0407 0.0059  -0.1842 405 ASN A OD1   
3330 N ND2   . ASN A 408 ? 1.1464 1.4554 1.2985 -0.0583 0.0093  -0.1995 405 ASN A ND2   
3331 N N     . CYS A 409 ? 0.5760 0.8941 0.7431 -0.0578 0.0271  -0.1985 406 CYS A N     
3332 C CA    . CYS A 409 ? 0.3402 0.6493 0.4967 -0.0730 0.0402  -0.1952 406 CYS A CA    
3333 C C     . CYS A 409 ? 0.4890 0.8179 0.6635 -0.0768 0.0469  -0.2069 406 CYS A C     
3334 O O     . CYS A 409 ? 0.5599 0.8887 0.7308 -0.0917 0.0589  -0.2097 406 CYS A O     
3335 C CB    . CYS A 409 ? 0.5684 0.8492 0.7014 -0.0693 0.0408  -0.1774 406 CYS A CB    
3336 S SG    . CYS A 409 ? 0.9690 1.2255 1.0797 -0.0658 0.0347  -0.1636 406 CYS A SG    
3337 N N     . ASN A 410 ? 0.4384 0.7833 0.6310 -0.0630 0.0389  -0.2139 407 ASN A N     
3338 C CA    . ASN A 410 ? 0.2367 0.6019 0.4483 -0.0641 0.0437  -0.2259 407 ASN A CA    
3339 C C     . ASN A 410 ? 0.7202 1.1119 0.9518 -0.0772 0.0509  -0.2443 407 ASN A C     
3340 O O     . ASN A 410 ? 0.7096 1.1191 0.9582 -0.0732 0.0439  -0.2554 407 ASN A O     
3341 C CB    . ASN A 410 ? 0.3708 0.7450 0.5964 -0.0448 0.0315  -0.2289 407 ASN A CB    
3342 C CG    . ASN A 410 ? 0.3600 0.7551 0.6057 -0.0443 0.0354  -0.2417 407 ASN A CG    
3343 O OD1   . ASN A 410 ? 0.4016 0.8029 0.6488 -0.0584 0.0482  -0.2470 407 ASN A OD1   
3344 N ND2   . ASN A 410 ? 0.3390 0.7442 0.5993 -0.0278 0.0242  -0.2469 407 ASN A ND2   
3345 N N     . THR A 411 ? 0.6915 1.0851 0.9207 -0.0929 0.0650  -0.2478 408 THR A N     
3346 C CA    . THR A 411 ? 0.4948 0.9125 0.7415 -0.1079 0.0747  -0.2650 408 THR A CA    
3347 C C     . THR A 411 ? 0.9547 1.4043 1.2323 -0.1010 0.0726  -0.2830 408 THR A C     
3348 O O     . THR A 411 ? 0.9537 1.4293 1.2542 -0.1057 0.0734  -0.2998 408 THR A O     
3349 C CB    . THR A 411 ? 1.1900 1.5968 1.4207 -0.1276 0.0913  -0.2620 408 THR A CB    
3350 O OG1   . THR A 411 ? 1.1917 1.5724 1.3969 -0.1363 0.0933  -0.2492 408 THR A OG1   
3351 C CG2   . THR A 411 ? 1.2168 1.6509 1.4678 -0.1429 0.1028  -0.2811 408 THR A CG2   
3352 N N     . SER A 412 ? 0.9487 1.3964 1.2277 -0.0897 0.0696  -0.2799 409 SER A N     
3353 C CA    . SER A 412 ? 0.4309 0.9070 0.7379 -0.0822 0.0674  -0.2965 409 SER A CA    
3354 C C     . SER A 412 ? 1.1253 1.6274 1.4589 -0.0746 0.0572  -0.3125 409 SER A C     
3355 O O     . SER A 412 ? 1.1056 1.5997 1.4355 -0.0628 0.0441  -0.3068 409 SER A O     
3356 C CB    . SER A 412 ? 0.8787 1.3443 1.1818 -0.0653 0.0593  -0.2882 409 SER A CB    
3357 O OG    . SER A 412 ? 0.8580 1.3501 1.1882 -0.0564 0.0554  -0.3046 409 SER A OG    
3358 N N     . GLY A 413 ? 1.1433 1.6769 1.5038 -0.0813 0.0634  -0.3330 410 GLY A N     
3359 C CA    . GLY A 413 ? 0.7123 1.2741 1.1020 -0.0734 0.0534  -0.3511 410 GLY A CA    
3360 C C     . GLY A 413 ? 1.4619 2.0297 1.8641 -0.0504 0.0377  -0.3540 410 GLY A C     
3361 O O     . GLY A 413 ? 1.4541 2.0353 1.8729 -0.0377 0.0238  -0.3634 410 GLY A O     
3362 N N     . ILE A 414 ? 1.4645 2.0209 1.8576 -0.0450 0.0396  -0.3461 411 ILE A N     
3363 C CA    . ILE A 414 ? 0.7262 1.2829 1.1269 -0.0236 0.0251  -0.3464 411 ILE A CA    
3364 C C     . ILE A 414 ? 1.5212 2.0449 1.8955 -0.0114 0.0140  -0.3248 411 ILE A C     
3365 O O     . ILE A 414 ? 1.5194 2.0169 1.8680 -0.0172 0.0206  -0.3071 411 ILE A O     
3366 C CB    . ILE A 414 ? 1.4169 1.9770 1.8210 -0.0233 0.0321  -0.3486 411 ILE A CB    
3367 C CG1   . ILE A 414 ? 1.4194 2.0077 1.8430 -0.0399 0.0478  -0.3671 411 ILE A CG1   
3368 C CG2   . ILE A 414 ? 1.4130 1.9787 1.8306 -0.0013 0.0165  -0.3535 411 ILE A CG2   
3369 C CD1   . ILE A 414 ? 1.4226 2.0144 1.8482 -0.0410 0.0562  -0.3698 411 ILE A CD1   
3370 N N     . GLN A 415 ? 1.5250 2.0501 1.9056 0.0054  -0.0029 -0.3268 412 GLN A N     
3371 C CA    . GLN A 415 ? 0.8671 1.3623 1.2234 0.0171  -0.0137 -0.3077 412 GLN A CA    
3372 C C     . GLN A 415 ? 1.3571 1.8290 1.6957 0.0229  -0.0127 -0.2920 412 GLN A C     
3373 O O     . GLN A 415 ? 1.3596 1.8036 1.6724 0.0219  -0.0115 -0.2730 412 GLN A O     
3374 C CB    . GLN A 415 ? 1.6563 2.1584 2.0239 0.0360  -0.0326 -0.3148 412 GLN A CB    
3375 C CG    . GLN A 415 ? 1.6583 2.1319 2.0009 0.0460  -0.0432 -0.2970 412 GLN A CG    
3376 C CD    . GLN A 415 ? 1.6543 2.1250 1.9888 0.0364  -0.0409 -0.2948 412 GLN A CD    
3377 O OE1   . GLN A 415 ? 1.6485 2.1240 1.9823 0.0183  -0.0271 -0.2963 412 GLN A OE1   
3378 N NE2   . GLN A 415 ? 1.6579 2.1196 1.9850 0.0486  -0.0548 -0.2913 412 GLN A NE2   
3379 N N     . THR A 416 ? 1.3491 1.8334 1.7028 0.0291  -0.0134 -0.3009 413 THR A N     
3380 C CA    . THR A 416 ? 0.5672 1.0317 0.9077 0.0361  -0.0140 -0.2883 413 THR A CA    
3381 C C     . THR A 416 ? 0.9356 1.3843 1.2573 0.0207  0.0016  -0.2763 413 THR A C     
3382 O O     . THR A 416 ? 0.9318 1.3560 1.2346 0.0247  0.0011  -0.2604 413 THR A O     
3383 C CB    . THR A 416 ? 1.1496 1.6331 1.5126 0.0461  -0.0185 -0.3028 413 THR A CB    
3384 O OG1   . THR A 416 ? 1.1540 1.6499 1.5332 0.0621  -0.0349 -0.3137 413 THR A OG1   
3385 C CG2   . THR A 416 ? 1.1531 1.6151 1.5023 0.0536  -0.0199 -0.2897 413 THR A CG2   
3386 N N     . GLU A 417 ? 0.9406 1.4027 1.2670 0.0030  0.0154  -0.2843 414 GLU A N     
3387 C CA    . GLU A 417 ? 0.3243 0.7717 0.6324 -0.0122 0.0302  -0.2746 414 GLU A CA    
3388 C C     . GLU A 417 ? 0.4885 0.9137 0.7727 -0.0214 0.0336  -0.2599 414 GLU A C     
3389 O O     . GLU A 417 ? 0.4941 0.9238 0.7808 -0.0219 0.0291  -0.2625 414 GLU A O     
3390 C CB    . GLU A 417 ? 0.9106 1.3817 1.2337 -0.0273 0.0443  -0.2906 414 GLU A CB    
3391 C CG    . GLU A 417 ? 0.9060 1.4021 1.2550 -0.0189 0.0416  -0.3075 414 GLU A CG    
3392 C CD    . GLU A 417 ? 0.8822 1.3630 1.2241 -0.0053 0.0352  -0.2984 414 GLU A CD    
3393 O OE1   . GLU A 417 ? 0.8763 1.3439 1.2041 -0.0124 0.0447  -0.2907 414 GLU A OE1   
3394 O OE2   . GLU A 417 ? 0.8767 1.3576 1.2266 0.0125  0.0202  -0.2991 414 GLU A OE2   
3395 N N     . TRP A 418 ? 0.3827 0.7841 0.6440 -0.0281 0.0411  -0.2451 415 TRP A N     
3396 C CA    . TRP A 418 ? 0.1904 0.5706 0.4288 -0.0376 0.0451  -0.2320 415 TRP A CA    
3397 C C     . TRP A 418 ? 0.4117 0.7872 0.6389 -0.0566 0.0609  -0.2316 415 TRP A C     
3398 O O     . TRP A 418 ? 0.3593 0.7279 0.5801 -0.0590 0.0670  -0.2285 415 TRP A O     
3399 C CB    . TRP A 418 ? 0.2585 0.6096 0.4759 -0.0274 0.0380  -0.2127 415 TRP A CB    
3400 C CG    . TRP A 418 ? 0.2898 0.6223 0.4874 -0.0335 0.0387  -0.2012 415 TRP A CG    
3401 C CD1   . TRP A 418 ? 0.3163 0.6354 0.4968 -0.0485 0.0490  -0.1950 415 TRP A CD1   
3402 C CD2   . TRP A 418 ? 0.3054 0.6303 0.4979 -0.0245 0.0283  -0.1951 415 TRP A CD2   
3403 N NE1   . TRP A 418 ? 0.3571 0.6615 0.5233 -0.0491 0.0455  -0.1859 415 TRP A NE1   
3404 C CE2   . TRP A 418 ? 0.3373 0.6453 0.5105 -0.0347 0.0332  -0.1858 415 TRP A CE2   
3405 C CE3   . TRP A 418 ? 0.3584 0.6880 0.5593 -0.0085 0.0151  -0.1967 415 TRP A CE3   
3406 C CZ2   . TRP A 418 ? 0.3861 0.6833 0.5494 -0.0295 0.0258  -0.1784 415 TRP A CZ2   
3407 C CZ3   . TRP A 418 ? 0.3870 0.7048 0.5765 -0.0037 0.0079  -0.1890 415 TRP A CZ3   
3408 C CH2   . TRP A 418 ? 0.4049 0.7074 0.5763 -0.0141 0.0136  -0.1801 415 TRP A CH2   
3409 N N     . SER A 419 ? 0.4468 0.8247 0.6704 -0.0702 0.0670  -0.2346 416 SER A N     
3410 C CA    . SER A 419 ? 0.3088 0.6793 0.5186 -0.0892 0.0818  -0.2337 416 SER A CA    
3411 C C     . SER A 419 ? 0.5859 0.9426 0.7798 -0.0997 0.0839  -0.2272 416 SER A C     
3412 O O     . SER A 419 ? 0.5356 0.9011 0.7386 -0.0963 0.0770  -0.2314 416 SER A O     
3413 C CB    . SER A 419 ? 0.8247 1.2231 1.0547 -0.0997 0.0920  -0.2525 416 SER A CB    
3414 O OG    . SER A 419 ? 0.8342 1.2571 1.0863 -0.1002 0.0887  -0.2667 416 SER A OG    
3415 N N     . PRO A 420 ? 0.6088 0.9425 0.7781 -0.1117 0.0925  -0.2169 417 PRO A N     
3416 C CA    . PRO A 420 ? 0.3903 0.7109 0.5470 -0.1136 0.0988  -0.2109 417 PRO A CA    
3417 C C     . PRO A 420 ? 0.3447 0.6493 0.4946 -0.0967 0.0883  -0.1980 417 PRO A C     
3418 O O     . PRO A 420 ? 0.4586 0.7537 0.6041 -0.0877 0.0788  -0.1898 417 PRO A O     
3419 C CB    . PRO A 420 ? 0.7098 1.0068 0.8398 -0.1297 0.1079  -0.2024 417 PRO A CB    
3420 C CG    . PRO A 420 ? 0.6845 0.9738 0.8087 -0.1296 0.1018  -0.1974 417 PRO A CG    
3421 C CD    . PRO A 420 ? 0.6358 0.9536 0.7873 -0.1237 0.0960  -0.2108 417 PRO A CD    
3422 N N     . PRO A 421 ? 0.3804 0.6822 0.5297 -0.0926 0.0903  -0.1967 418 PRO A N     
3423 C CA    . PRO A 421 ? 0.3086 0.5960 0.4531 -0.0771 0.0810  -0.1853 418 PRO A CA    
3424 C C     . PRO A 421 ? 0.3384 0.5976 0.4599 -0.0760 0.0774  -0.1686 418 PRO A C     
3425 O O     . PRO A 421 ? 0.3248 0.5702 0.4289 -0.0885 0.0839  -0.1643 418 PRO A O     
3426 C CB    . PRO A 421 ? 0.3537 0.6384 0.4952 -0.0794 0.0876  -0.1864 418 PRO A CB    
3427 C CG    . PRO A 421 ? 0.3828 0.6918 0.5388 -0.0902 0.0973  -0.2031 418 PRO A CG    
3428 C CD    . PRO A 421 ? 0.3538 0.6660 0.5068 -0.1028 0.1018  -0.2063 418 PRO A CD    
3429 N N     . LEU A 422 ? 0.3250 0.5754 0.4462 -0.0612 0.0670  -0.1597 419 LEU A N     
3430 C CA    . LEU A 422 ? 0.2549 0.4806 0.3568 -0.0586 0.0631  -0.1447 419 LEU A CA    
3431 C C     . LEU A 422 ? 0.2817 0.4873 0.3699 -0.0568 0.0645  -0.1344 419 LEU A C     
3432 O O     . LEU A 422 ? 0.3165 0.5252 0.4130 -0.0481 0.0618  -0.1349 419 LEU A O     
3433 C CB    . LEU A 422 ? 0.2738 0.5005 0.3817 -0.0445 0.0517  -0.1407 419 LEU A CB    
3434 C CG    . LEU A 422 ? 0.2613 0.5057 0.3813 -0.0448 0.0483  -0.1501 419 LEU A CG    
3435 C CD1   . LEU A 422 ? 0.2499 0.4892 0.3695 -0.0309 0.0370  -0.1436 419 LEU A CD1   
3436 C CD2   . LEU A 422 ? 0.2855 0.5262 0.3953 -0.0599 0.0553  -0.1513 419 LEU A CD2   
3437 N N     . THR A 423 ? 0.2480 0.4326 0.3154 -0.0646 0.0682  -0.1257 420 THR A N     
3438 C CA    . THR A 423 ? 0.2618 0.4265 0.3155 -0.0636 0.0693  -0.1167 420 THR A CA    
3439 C C     . THR A 423 ? 0.2216 0.3671 0.2650 -0.0551 0.0623  -0.1034 420 THR A C     
3440 O O     . THR A 423 ? 0.2671 0.3958 0.3001 -0.0533 0.0622  -0.0957 420 THR A O     
3441 C CB    . THR A 423 ? 0.3492 0.5020 0.3854 -0.0785 0.0785  -0.1169 420 THR A CB    
3442 O OG1   . THR A 423 ? 0.3775 0.5219 0.4016 -0.0868 0.0797  -0.1144 420 THR A OG1   
3443 C CG2   . THR A 423 ? 0.3690 0.5401 0.4147 -0.0871 0.0869  -0.1299 420 THR A CG2   
3444 N N     . MET A 424 ? 0.2133 0.3619 0.2600 -0.0498 0.0567  -0.1014 421 MET A N     
3445 C CA    . MET A 424 ? 0.1546 0.2872 0.1928 -0.0414 0.0505  -0.0897 421 MET A CA    
3446 C C     . MET A 424 ? 0.2425 0.3843 0.2888 -0.0334 0.0438  -0.0903 421 MET A C     
3447 O O     . MET A 424 ? 0.2242 0.3783 0.2755 -0.0380 0.0444  -0.0978 421 MET A O     
3448 C CB    . MET A 424 ? 0.2626 0.3749 0.2806 -0.0493 0.0531  -0.0825 421 MET A CB    
3449 C CG    . MET A 424 ? 0.2426 0.3387 0.2520 -0.0414 0.0477  -0.0712 421 MET A CG    
3450 S SD    . MET A 424 ? 0.3060 0.4056 0.3150 -0.0379 0.0427  -0.0699 421 MET A SD    
3451 C CE    . MET A 424 ? 0.2957 0.3899 0.2915 -0.0527 0.0477  -0.0733 421 MET A CE    
3452 N N     . LEU A 425 ? 0.1985 0.3339 0.2459 -0.0215 0.0375  -0.0828 422 LEU A N     
3453 C CA    . LEU A 425 ? 0.1672 0.3051 0.2166 -0.0132 0.0308  -0.0807 422 LEU A CA    
3454 C C     . LEU A 425 ? 0.1884 0.3066 0.2240 -0.0092 0.0288  -0.0683 422 LEU A C     
3455 O O     . LEU A 425 ? 0.1959 0.3021 0.2274 -0.0073 0.0300  -0.0617 422 LEU A O     
3456 C CB    . LEU A 425 ? 0.1826 0.3318 0.2465 -0.0015 0.0246  -0.0840 422 LEU A CB    
3457 C CG    . LEU A 425 ? 0.2616 0.4329 0.3429 -0.0019 0.0245  -0.0975 422 LEU A CG    
3458 C CD1   . LEU A 425 ? 0.2532 0.4301 0.3458 0.0118  0.0166  -0.0986 422 LEU A CD1   
3459 C CD2   . LEU A 425 ? 0.2457 0.4307 0.3313 -0.0077 0.0247  -0.1063 422 LEU A CD2   
3460 N N     . PHE A 426 ? 0.1704 0.2861 0.1998 -0.0077 0.0258  -0.0658 423 PHE A N     
3461 C CA    . PHE A 426 ? 0.1473 0.2457 0.1635 -0.0049 0.0247  -0.0552 423 PHE A CA    
3462 C C     . PHE A 426 ? 0.2175 0.3181 0.2324 0.0026  0.0189  -0.0537 423 PHE A C     
3463 O O     . PHE A 426 ? 0.2697 0.3798 0.2864 -0.0001 0.0174  -0.0601 423 PHE A O     
3464 C CB    . PHE A 426 ? 0.2672 0.3553 0.2706 -0.0155 0.0292  -0.0541 423 PHE A CB    
3465 C CG    . PHE A 426 ? 0.3238 0.3946 0.3144 -0.0132 0.0283  -0.0445 423 PHE A CG    
3466 C CD1   . PHE A 426 ? 0.4896 0.5506 0.4678 -0.0207 0.0302  -0.0436 423 PHE A CD1   
3467 C CD2   . PHE A 426 ? 0.3350 0.3991 0.3260 -0.0038 0.0259  -0.0370 423 PHE A CD2   
3468 C CE1   . PHE A 426 ? 0.5274 0.5735 0.4950 -0.0182 0.0292  -0.0360 423 PHE A CE1   
3469 C CE2   . PHE A 426 ? 0.4078 0.4577 0.3885 -0.0021 0.0258  -0.0294 423 PHE A CE2   
3470 C CZ    . PHE A 426 ? 0.4318 0.4734 0.4014 -0.0089 0.0273  -0.0292 423 PHE A CZ    
3471 N N     . LEU A 427 ? 0.1586 0.2502 0.1701 0.0118  0.0159  -0.0456 424 LEU A N     
3472 C CA    . LEU A 427 ? 0.1536 0.2433 0.1598 0.0192  0.0109  -0.0424 424 LEU A CA    
3473 C C     . LEU A 427 ? 0.1904 0.2636 0.1835 0.0197  0.0128  -0.0326 424 LEU A C     
3474 O O     . LEU A 427 ? 0.2304 0.2941 0.2224 0.0210  0.0153  -0.0265 424 LEU A O     
3475 C CB    . LEU A 427 ? 0.2364 0.3291 0.2489 0.0303  0.0055  -0.0414 424 LEU A CB    
3476 C CG    . LEU A 427 ? 0.2842 0.3939 0.3115 0.0324  0.0020  -0.0517 424 LEU A CG    
3477 C CD1   . LEU A 427 ? 0.3045 0.4128 0.3351 0.0445  -0.0045 -0.0493 424 LEU A CD1   
3478 C CD2   . LEU A 427 ? 0.2704 0.3932 0.3008 0.0290  -0.0002 -0.0608 424 LEU A CD2   
3479 N N     . CYS A 428 ? 0.2031 0.2735 0.1871 0.0191  0.0115  -0.0318 425 CYS A N     
3480 C CA    . CYS A 428 ? 0.1676 0.2236 0.1397 0.0197  0.0134  -0.0237 425 CYS A CA    
3481 C C     . CYS A 428 ? 0.2626 0.3167 0.2266 0.0262  0.0096  -0.0212 425 CYS A C     
3482 O O     . CYS A 428 ? 0.2855 0.3471 0.2488 0.0254  0.0063  -0.0269 425 CYS A O     
3483 C CB    . CYS A 428 ? 0.2402 0.2909 0.2060 0.0100  0.0169  -0.0252 425 CYS A CB    
3484 S SG    . CYS A 428 ? 0.3327 0.3661 0.2861 0.0106  0.0192  -0.0168 425 CYS A SG    
3485 N N     . ALA A 429 ? 0.2097 0.2537 0.1675 0.0326  0.0101  -0.0131 426 ALA A N     
3486 C CA    . ALA A 429 ? 0.1764 0.2161 0.1238 0.0387  0.0074  -0.0097 426 ALA A CA    
3487 C C     . ALA A 429 ? 0.2540 0.2852 0.1913 0.0349  0.0105  -0.0070 426 ALA A C     
3488 O O     . ALA A 429 ? 0.2412 0.2647 0.1781 0.0318  0.0150  -0.0031 426 ALA A O     
3489 C CB    . ALA A 429 ? 0.2658 0.2982 0.2105 0.0470  0.0072  -0.0023 426 ALA A CB    
3490 N N     . THR A 430 ? 0.2651 0.2979 0.1948 0.0355  0.0076  -0.0095 427 THR A N     
3491 C CA    . THR A 430 ? 0.2444 0.2700 0.1647 0.0318  0.0095  -0.0086 427 THR A CA    
3492 C C     . THR A 430 ? 0.3037 0.3272 0.2129 0.0376  0.0065  -0.0074 427 THR A C     
3493 O O     . THR A 430 ? 0.2829 0.3096 0.1908 0.0444  0.0027  -0.0073 427 THR A O     
3494 C CB    . THR A 430 ? 0.3422 0.3717 0.2647 0.0224  0.0093  -0.0156 427 THR A CB    
3495 O OG1   . THR A 430 ? 0.3954 0.4349 0.3194 0.0224  0.0046  -0.0223 427 THR A OG1   
3496 C CG2   . THR A 430 ? 0.3601 0.3925 0.2926 0.0165  0.0121  -0.0176 427 THR A CG2   
3497 N N     . LYS A 431 ? 0.2974 0.3146 0.1977 0.0354  0.0078  -0.0070 428 LYS A N     
3498 C CA    . LYS A 431 ? 0.2512 0.2658 0.1397 0.0406  0.0051  -0.0065 428 LYS A CA    
3499 C C     . LYS A 431 ? 0.2632 0.2722 0.1446 0.0491  0.0065  0.0006  428 LYS A C     
3500 O O     . LYS A 431 ? 0.3160 0.3269 0.1923 0.0554  0.0021  0.0004  428 LYS A O     
3501 C CB    . LYS A 431 ? 0.3583 0.3821 0.2474 0.0406  -0.0013 -0.0138 428 LYS A CB    
3502 C CG    . LYS A 431 ? 0.4890 0.5171 0.3832 0.0311  -0.0018 -0.0207 428 LYS A CG    
3503 C CD    . LYS A 431 ? 0.5745 0.6093 0.4666 0.0307  -0.0076 -0.0280 428 LYS A CD    
3504 C CE    . LYS A 431 ? 0.6259 0.6638 0.5225 0.0199  -0.0072 -0.0347 428 LYS A CE    
3505 N NZ    . LYS A 431 ? 0.6301 0.6561 0.5202 0.0144  -0.0031 -0.0315 428 LYS A NZ    
3506 N N     . PHE A 432 ? 0.3170 0.3185 0.1979 0.0490  0.0125  0.0065  429 PHE A N     
3507 C CA    . PHE A 432 ? 0.2293 0.2239 0.1030 0.0554  0.0156  0.0136  429 PHE A CA    
3508 C C     . PHE A 432 ? 0.3685 0.3585 0.2270 0.0597  0.0153  0.0147  429 PHE A C     
3509 O O     . PHE A 432 ? 0.3937 0.3833 0.2485 0.0569  0.0153  0.0114  429 PHE A O     
3510 C CB    . PHE A 432 ? 0.2906 0.2797 0.1701 0.0530  0.0226  0.0185  429 PHE A CB    
3511 C CG    . PHE A 432 ? 0.3129 0.3047 0.2052 0.0511  0.0229  0.0191  429 PHE A CG    
3512 C CD1   . PHE A 432 ? 0.3114 0.3009 0.2046 0.0558  0.0232  0.0237  429 PHE A CD1   
3513 C CD2   . PHE A 432 ? 0.3341 0.3297 0.2365 0.0447  0.0227  0.0149  429 PHE A CD2   
3514 C CE1   . PHE A 432 ? 0.2999 0.2918 0.2049 0.0545  0.0231  0.0238  429 PHE A CE1   
3515 C CE2   . PHE A 432 ? 0.3616 0.3598 0.2752 0.0432  0.0230  0.0150  429 PHE A CE2   
3516 C CZ    . PHE A 432 ? 0.3157 0.3125 0.2313 0.0483  0.0231  0.0192  429 PHE A CZ    
3517 N N     . SER A 433 ? 0.3190 0.3045 0.1676 0.0666  0.0148  0.0191  430 SER A N     
3518 C CA    . SER A 433 ? 0.2741 0.2534 0.1061 0.0713  0.0158  0.0214  430 SER A CA    
3519 C C     . SER A 433 ? 0.4066 0.3767 0.2321 0.0744  0.0225  0.0298  430 SER A C     
3520 O O     . SER A 433 ? 0.3723 0.3408 0.2039 0.0750  0.0233  0.0334  430 SER A O     
3521 C CB    . SER A 433 ? 0.5053 0.4868 0.3281 0.0770  0.0075  0.0180  430 SER A CB    
3522 O OG    . SER A 433 ? 0.5919 0.5824 0.4212 0.0733  0.0018  0.0098  430 SER A OG    
3523 N N     . ALA A 434 ? 0.3794 0.3432 0.1926 0.0761  0.0277  0.0326  431 ALA A N     
3524 C CA    . ALA A 434 ? 0.3938 0.3486 0.2000 0.0780  0.0355  0.0404  431 ALA A CA    
3525 C C     . ALA A 434 ? 0.4832 0.4311 0.2779 0.0842  0.0316  0.0448  431 ALA A C     
3526 O O     . ALA A 434 ? 0.5217 0.4704 0.3073 0.0890  0.0237  0.0418  431 ALA A O     
3527 C CB    . ALA A 434 ? 0.5201 0.4706 0.3145 0.0786  0.0418  0.0413  431 ALA A CB    
3528 N N     . SER A 435 ? 0.4147 0.3552 0.2099 0.0842  0.0367  0.0516  432 SER A N     
3529 C CA    . SER A 435 ? 0.4186 0.3494 0.2009 0.0904  0.0332  0.0567  432 SER A CA    
3530 C C     . SER A 435 ? 0.6038 0.5215 0.3749 0.0900  0.0432  0.0654  432 SER A C     
3531 O O     . SER A 435 ? 0.5956 0.5017 0.3551 0.0940  0.0421  0.0713  432 SER A O     
3532 C CB    . SER A 435 ? 0.6860 0.6206 0.4819 0.0909  0.0269  0.0554  432 SER A CB    
3533 O OG    . SER A 435 ? 0.7533 0.6878 0.5635 0.0857  0.0335  0.0584  432 SER A OG    
3534 O OXT   . SER A 435 ? 0.6276 0.5458 0.4014 0.0855  0.0526  0.0664  432 SER A OXT   
3535 O "O3'" . DC  B 1   ? 0.7801 1.0201 0.7177 -0.1202 0.0076  -0.0839 1   DC  T "O3'" 
3536 P P     . DA  B 2   ? 1.8012 2.0453 1.7378 -0.1403 0.0062  -0.0795 2   DA  T P     
3537 O OP1   . DA  B 2   ? 1.7888 2.0319 1.7269 -0.1543 -0.0013 -0.0730 2   DA  T OP1   
3538 O OP2   . DA  B 2   ? 1.8061 2.0722 1.7418 -0.1440 0.0106  -0.0879 2   DA  T OP2   
3539 O "O5'" . DA  B 2   ? 0.7583 0.9790 0.6934 -0.1367 0.0090  -0.0728 2   DA  T "O5'" 
3540 C "C5'" . DA  B 2   ? 0.7084 0.9051 0.6443 -0.1295 0.0067  -0.0653 2   DA  T "C5'" 
3541 C "C4'" . DA  B 2   ? 0.6619 0.8396 0.5961 -0.1277 0.0100  -0.0599 2   DA  T "C4'" 
3542 O "O4'" . DA  B 2   ? 0.6189 0.7963 0.5518 -0.1117 0.0170  -0.0663 2   DA  T "O4'" 
3543 C "C3'" . DA  B 2   ? 0.6587 0.8415 0.5916 -0.1451 0.0099  -0.0569 2   DA  T "C3'" 
3544 O "O3'" A DA  B 2   ? 0.6303 0.7905 0.5627 -0.1479 0.0090  -0.0475 2   DA  T "O3'" 
3545 O "O3'" B DA  B 2   ? 0.6419 0.8021 0.5743 -0.1479 0.0090  -0.0475 2   DA  T "O3'" 
3546 C "C2'" . DA  B 2   ? 0.6419 0.8381 0.5730 -0.1397 0.0170  -0.0655 2   DA  T "C2'" 
3547 C "C1'" . DA  B 2   ? 0.6202 0.8041 0.5513 -0.1181 0.0213  -0.0683 2   DA  T "C1'" 
3548 N N9    . DA  B 2   ? 0.5306 0.7305 0.4613 -0.1078 0.0273  -0.0788 2   DA  T N9    
3549 C C8    . DA  B 2   ? 0.5125 0.7375 0.4435 -0.1133 0.0281  -0.0867 2   DA  T C8    
3550 N N7    . DA  B 2   ? 0.4841 0.7183 0.4149 -0.1008 0.0341  -0.0953 2   DA  T N7    
3551 C C5    . DA  B 2   ? 0.4805 0.6942 0.4108 -0.0862 0.0373  -0.0927 2   DA  T C5    
3552 C C6    . DA  B 2   ? 0.4989 0.7099 0.4289 -0.0687 0.0438  -0.0983 2   DA  T C6    
3553 N N6    . DA  B 2   ? 0.5016 0.7317 0.4322 -0.0629 0.0484  -0.1080 2   DA  T N6    
3554 N N1    . DA  B 2   ? 0.4754 0.6634 0.4049 -0.0574 0.0454  -0.0934 2   DA  T N1    
3555 C C2    . DA  B 2   ? 0.3980 0.5669 0.3273 -0.0632 0.0408  -0.0836 2   DA  T C2    
3556 N N3    . DA  B 2   ? 0.4193 0.5884 0.3489 -0.0794 0.0346  -0.0775 2   DA  T N3    
3557 C C4    . DA  B 2   ? 0.4748 0.6672 0.4049 -0.0902 0.0332  -0.0826 2   DA  T C4    
3558 P P     . DT  B 3   ? 0.9438 1.0958 0.8776 -0.1651 0.0018  -0.0372 3   DT  T P     
3559 O OP1   . DT  B 3   ? 0.9738 1.1482 0.9083 -0.1797 -0.0019 -0.0402 3   DT  T OP1   
3560 O OP2   . DT  B 3   ? 0.9371 1.0730 0.8696 -0.1707 0.0030  -0.0300 3   DT  T OP2   
3561 O "O5'" . DT  B 3   ? 0.8307 0.9663 0.7668 -0.1554 -0.0020 -0.0327 3   DT  T "O5'" 
3562 C "C5'" . DT  B 3   ? 0.7799 0.8896 0.7160 -0.1459 -0.0011 -0.0262 3   DT  T "C5'" 
3563 C "C4'" . DT  B 3   ? 0.7638 0.8688 0.6985 -0.1261 0.0055  -0.0322 3   DT  T "C4'" 
3564 O "O4'" . DT  B 3   ? 0.7706 0.8503 0.7049 -0.1193 0.0070  -0.0253 3   DT  T "O4'" 
3565 C "C3'" . DT  B 3   ? 0.7254 0.8330 0.6612 -0.1110 0.0055  -0.0376 3   DT  T "C3'" 
3566 O "O3'" . DT  B 3   ? 0.6485 0.7639 0.5828 -0.0971 0.0120  -0.0463 3   DT  T "O3'" 
3567 C "C2'" . DT  B 3   ? 0.7598 0.8410 0.6966 -0.1029 0.0035  -0.0297 3   DT  T "C2'" 
3568 C "C1'" . DT  B 3   ? 0.8329 0.8989 0.7681 -0.1031 0.0071  -0.0251 3   DT  T "C1'" 
3569 N N1    . DT  B 3   ? 0.9379 0.9787 0.8743 -0.1050 0.0039  -0.0143 3   DT  T N1    
3570 C C2    . DT  B 3   ? 0.9937 1.0137 0.9292 -0.0925 0.0075  -0.0114 3   DT  T C2    
3571 O O2    . DT  B 3   ? 1.0378 1.0586 0.9715 -0.0796 0.0134  -0.0172 3   DT  T O2    
3572 N N3    . DT  B 3   ? 0.9784 0.9762 0.9154 -0.0957 0.0041  -0.0014 3   DT  T N3    
3573 C C4    . DT  B 3   ? 0.9638 0.9584 0.9032 -0.1098 -0.0025 0.0059  3   DT  T C4    
3574 O O4    . DT  B 3   ? 0.9252 0.8990 0.8660 -0.1116 -0.0050 0.0148  3   DT  T O4    
3575 C C5    . DT  B 3   ? 0.9778 0.9950 0.9179 -0.1224 -0.0061 0.0024  3   DT  T C5    
3576 C C7    . DT  B 3   ? 0.9991 1.0152 0.9419 -0.1382 -0.0132 0.0097  3   DT  T C7    
3577 C C6    . DT  B 3   ? 0.9571 0.9960 0.8957 -0.1194 -0.0028 -0.0074 3   DT  T C6    
3578 P P     . DT  B 4   ? 0.5569 0.6737 0.4920 -0.0782 0.0137  -0.0526 4   DT  T P     
3579 O OP1   . DT  B 4   ? 0.5808 0.7117 0.5145 -0.0689 0.0202  -0.0622 4   DT  T OP1   
3580 O OP2   . DT  B 4   ? 0.6520 0.7766 0.5890 -0.0833 0.0078  -0.0524 4   DT  T OP2   
3581 O "O5'" . DT  B 4   ? 0.3843 0.4726 0.3193 -0.0653 0.0146  -0.0463 4   DT  T "O5'" 
3582 C "C5'" . DT  B 4   ? 0.3103 0.3882 0.2436 -0.0554 0.0206  -0.0469 4   DT  T "C5'" 
3583 C "C4'" . DT  B 4   ? 0.2764 0.3323 0.2099 -0.0389 0.0213  -0.0440 4   DT  T "C4'" 
3584 O "O4'" . DT  B 4   ? 0.3060 0.3416 0.2405 -0.0458 0.0168  -0.0335 4   DT  T "O4'" 
3585 C "C3'" . DT  B 4   ? 0.2844 0.3445 0.2191 -0.0274 0.0199  -0.0484 4   DT  T "C3'" 
3586 O "O3'" . DT  B 4   ? 0.2653 0.3125 0.1992 -0.0086 0.0246  -0.0503 4   DT  T "O3'" 
3587 C "C2'" . DT  B 4   ? 0.2766 0.3244 0.2130 -0.0345 0.0131  -0.0403 4   DT  T "C2'" 
3588 C "C1'" . DT  B 4   ? 0.2967 0.3225 0.2326 -0.0380 0.0135  -0.0314 4   DT  T "C1'" 
3589 N N1    . DT  B 4   ? 0.2794 0.2949 0.2170 -0.0523 0.0073  -0.0219 4   DT  T N1    
3590 C C2    . DT  B 4   ? 0.2660 0.2561 0.2040 -0.0488 0.0069  -0.0138 4   DT  T C2    
3591 O O2    . DT  B 4   ? 0.2658 0.2425 0.2026 -0.0346 0.0113  -0.0143 4   DT  T O2    
3592 N N3    . DT  B 4   ? 0.2664 0.2475 0.2063 -0.0623 0.0012  -0.0050 4   DT  T N3    
3593 C C4    . DT  B 4   ? 0.3300 0.3248 0.2714 -0.0787 -0.0040 -0.0036 4   DT  T C4    
3594 O O4    . DT  B 4   ? 0.3154 0.3001 0.2588 -0.0899 -0.0089 0.0048  4   DT  T O4    
3595 C C5    . DT  B 4   ? 0.3416 0.3631 0.2823 -0.0816 -0.0033 -0.0126 4   DT  T C5    
3596 C C7    . DT  B 4   ? 0.3630 0.4015 0.3052 -0.0990 -0.0087 -0.0121 4   DT  T C7    
3597 C C6    . DT  B 4   ? 0.3270 0.3575 0.2659 -0.0685 0.0023  -0.0213 4   DT  T C6    
3598 P P     . DA  B 5   ? 0.2648 0.3121 0.1993 0.0079  0.0246  -0.0551 5   DA  T P     
3599 O OP1   . DA  B 5   ? 0.3194 0.3704 0.2529 0.0235  0.0314  -0.0624 5   DA  T OP1   
3600 O OP2   . DA  B 5   ? 0.2735 0.3385 0.2095 -0.0001 0.0198  -0.0579 5   DA  T OP2   
3601 O "O5'" . DA  B 5   ? 0.2646 0.2844 0.1996 0.0137  0.0220  -0.0465 5   DA  T "O5'" 
3602 C "C5'" . DA  B 5   ? 0.2644 0.2633 0.1983 0.0229  0.0258  -0.0427 5   DA  T "C5'" 
3603 C "C4'" . DA  B 5   ? 0.2643 0.2394 0.1991 0.0275  0.0224  -0.0350 5   DA  T "C4'" 
3604 O "O4'" . DA  B 5   ? 0.2685 0.2380 0.2046 0.0104  0.0168  -0.0267 5   DA  T "O4'" 
3605 C "C3'" . DA  B 5   ? 0.2642 0.2410 0.1998 0.0374  0.0202  -0.0380 5   DA  T "C3'" 
3606 O "O3'" . DA  B 5   ? 0.2640 0.2171 0.1993 0.0509  0.0213  -0.0340 5   DA  T "O3'" 
3607 C "C2'" . DA  B 5   ? 0.2645 0.2458 0.2019 0.0219  0.0133  -0.0336 5   DA  T "C2'" 
3608 C "C1'" . DA  B 5   ? 0.2808 0.2452 0.2185 0.0111  0.0118  -0.0240 5   DA  T "C1'" 
3609 N N9    . DA  B 5   ? 0.2650 0.2353 0.2044 -0.0078 0.0060  -0.0192 5   DA  T N9    
3610 C C8    . DA  B 5   ? 0.2868 0.2805 0.2268 -0.0194 0.0035  -0.0233 5   DA  T C8    
3611 N N7    . DA  B 5   ? 0.2984 0.2915 0.2400 -0.0358 -0.0019 -0.0170 5   DA  T N7    
3612 C C5    . DA  B 5   ? 0.3152 0.2831 0.2576 -0.0349 -0.0029 -0.0080 5   DA  T C5    
3613 C C6    . DA  B 5   ? 0.2931 0.2482 0.2375 -0.0479 -0.0079 0.0017  5   DA  T C6    
3614 N N6    . DA  B 5   ? 0.3187 0.2853 0.2648 -0.0650 -0.0129 0.0042  5   DA  T N6    
3615 N N1    . DA  B 5   ? 0.3125 0.2424 0.2574 -0.0423 -0.0073 0.0089  5   DA  T N1    
3616 C C2    . DA  B 5   ? 0.3035 0.2216 0.2467 -0.0252 -0.0024 0.0066  5   DA  T C2    
3617 N N3    . DA  B 5   ? 0.2758 0.2040 0.2170 -0.0118 0.0025  -0.0023 5   DA  T N3    
3618 C C4    . DA  B 5   ? 0.2651 0.2186 0.2061 -0.0178 0.0019  -0.0092 5   DA  T C4    
3619 P P     . DT  B 6   ? 0.2674 0.2178 0.2028 0.0672  0.0213  -0.0380 6   DT  T P     
3620 O OP1   . DT  B 6   ? 0.3068 0.2312 0.2416 0.0796  0.0232  -0.0331 6   DT  T OP1   
3621 O OP2   . DT  B 6   ? 0.2672 0.2397 0.2020 0.0742  0.0246  -0.0482 6   DT  T OP2   
3622 O "O5'" . DT  B 6   ? 0.3027 0.2571 0.2398 0.0565  0.0143  -0.0349 6   DT  T "O5'" 
3623 C "C5'" . DT  B 6   ? 0.3067 0.2413 0.2449 0.0582  0.0105  -0.0280 6   DT  T "C5'" 
3624 C "C4'" . DT  B 6   ? 0.3048 0.2212 0.2439 0.0472  0.0082  -0.0179 6   DT  T "C4'" 
3625 O "O4'" . DT  B 6   ? 0.3238 0.2538 0.2640 0.0281  0.0050  -0.0160 6   DT  T "O4'" 
3626 C "C3'" . DT  B 6   ? 0.2819 0.1808 0.2226 0.0472  0.0036  -0.0112 6   DT  T "C3'" 
3627 O "O3'" . DT  B 6   ? 0.3017 0.1785 0.2415 0.0617  0.0067  -0.0087 6   DT  T "O3'" 
3628 C "C2'" . DT  B 6   ? 0.3587 0.2521 0.3014 0.0288  -0.0008 -0.0026 6   DT  T "C2'" 
3629 C "C1'" . DT  B 6   ? 0.3395 0.2536 0.2816 0.0174  0.0004  -0.0064 6   DT  T "C1'" 
3630 N N1    . DT  B 6   ? 0.3044 0.2349 0.2481 0.0004  -0.0047 -0.0058 6   DT  T N1    
3631 C C2    . DT  B 6   ? 0.2886 0.2086 0.2345 -0.0132 -0.0096 0.0032  6   DT  T C2    
3632 O O2    . DT  B 6   ? 0.3100 0.2075 0.2567 -0.0117 -0.0099 0.0107  6   DT  T O2    
3633 N N3    . DT  B 6   ? 0.2948 0.2318 0.2421 -0.0287 -0.0141 0.0030  6   DT  T N3    
3634 C C4    . DT  B 6   ? 0.2865 0.2492 0.2332 -0.0320 -0.0141 -0.0050 6   DT  T C4    
3635 O O4    . DT  B 6   ? 0.3649 0.3410 0.3131 -0.0466 -0.0184 -0.0043 6   DT  T O4    
3636 C C5    . DT  B 6   ? 0.2691 0.2416 0.2136 -0.0174 -0.0088 -0.0141 6   DT  T C5    
3637 C C7    . DT  B 6   ? 0.3561 0.3563 0.3001 -0.0194 -0.0084 -0.0233 6   DT  T C7    
3638 C C6    . DT  B 6   ? 0.3101 0.2663 0.2532 -0.0021 -0.0044 -0.0141 6   DT  T C6    
3639 P P     . DG  B 7   ? 0.3298 0.1920 0.2699 0.0736  0.0050  -0.0073 7   DG  T P     
3640 O OP1   . DG  B 7   ? 0.4027 0.2406 0.3419 0.0861  0.0086  -0.0036 7   DG  T OP1   
3641 O OP2   . DG  B 7   ? 0.3190 0.1996 0.2584 0.0807  0.0051  -0.0160 7   DG  T OP2   
3642 O "O5'" . DG  B 7   ? 0.3575 0.2144 0.3004 0.0587  -0.0017 0.0001  7   DG  T "O5'" 
3643 C "C5'" . DG  B 7   ? 0.4462 0.2790 0.3906 0.0555  -0.0038 0.0097  7   DG  T "C5'" 
3644 C "C4'" . DG  B 7   ? 0.2956 0.1305 0.2429 0.0391  -0.0102 0.0152  7   DG  T "C4'" 
3645 O "O4'" . DG  B 7   ? 0.3518 0.2090 0.2995 0.0243  -0.0119 0.0128  7   DG  T "O4'" 
3646 C "C3'" . DG  B 7   ? 0.3861 0.2237 0.3344 0.0412  -0.0140 0.0138  7   DG  T "C3'" 
3647 O "O3'" . DG  B 7   ? 0.4076 0.2207 0.3573 0.0444  -0.0155 0.0212  7   DG  T "O3'" 
3648 C "C2'" . DG  B 7   ? 0.4278 0.2820 0.3783 0.0226  -0.0191 0.0150  7   DG  T "C2'" 
3649 C "C1'" . DG  B 7   ? 0.3550 0.2148 0.3053 0.0116  -0.0178 0.0168  7   DG  T "C1'" 
3650 N N9    . DG  B 7   ? 0.3380 0.2238 0.2885 -0.0006 -0.0198 0.0122  7   DG  T N9    
3651 C C8    . DG  B 7   ? 0.3490 0.2574 0.2977 0.0031  -0.0173 0.0028  7   DG  T C8    
3652 N N7    . DG  B 7   ? 0.3020 0.2302 0.2515 -0.0112 -0.0202 0.0011  7   DG  T N7    
3653 C C5    . DG  B 7   ? 0.2940 0.2120 0.2462 -0.0251 -0.0251 0.0100  7   DG  T C5    
3654 C C6    . DG  B 7   ? 0.2659 0.1959 0.2202 -0.0436 -0.0299 0.0128  7   DG  T C6    
3655 O O6    . DG  B 7   ? 0.3095 0.2624 0.2635 -0.0521 -0.0309 0.0077  7   DG  T O6    
3656 N N1    . DG  B 7   ? 0.2660 0.1781 0.2231 -0.0526 -0.0338 0.0227  7   DG  T N1    
3657 C C2    . DG  B 7   ? 0.2661 0.1523 0.2239 -0.0447 -0.0330 0.0291  7   DG  T C2    
3658 N N2    . DG  B 7   ? 0.3568 0.2288 0.3178 -0.0557 -0.0372 0.0385  7   DG  T N2    
3659 N N3    . DG  B 7   ? 0.3237 0.1984 0.2794 -0.0273 -0.0285 0.0264  7   DG  T N3    
3660 C C4    . DG  B 7   ? 0.2896 0.1815 0.2426 -0.0186 -0.0248 0.0169  7   DG  T C4    
3661 P P     . DA  B 8   ? 0.4097 0.2178 0.3605 0.0484  -0.0191 0.0215  8   DA  T P     
3662 O OP1   . DA  B 8   ? 0.4916 0.2734 0.4422 0.0605  -0.0173 0.0260  8   DA  T OP1   
3663 O OP2   . DA  B 8   ? 0.4646 0.2953 0.4138 0.0529  -0.0189 0.0122  8   DA  T OP2   
3664 O "O5'" . DA  B 8   ? 0.3765 0.1847 0.3309 0.0293  -0.0252 0.0287  8   DA  T "O5'" 
3665 C "C5'" . DA  B 8   ? 0.3738 0.1636 0.3304 0.0210  -0.0263 0.0381  8   DA  T "C5'" 
3666 C "C4'" . DA  B 8   ? 0.4106 0.2019 0.3709 0.0045  -0.0324 0.0440  8   DA  T "C4'" 
3667 O "O4'" . DA  B 8   ? 0.4032 0.2187 0.3637 -0.0091 -0.0342 0.0408  8   DA  T "O4'" 
3668 C "C3'" . DA  B 8   ? 0.4356 0.2266 0.3969 0.0078  -0.0356 0.0428  8   DA  T "C3'" 
3669 O "O3'" . DA  B 8   ? 0.4040 0.1797 0.3691 -0.0021 -0.0398 0.0518  8   DA  T "O3'" 
3670 C "C2'" . DA  B 8   ? 0.4085 0.2277 0.3693 0.0003  -0.0377 0.0359  8   DA  T "C2'" 
3671 C "C1'" . DA  B 8   ? 0.3989 0.2282 0.3607 -0.0148 -0.0384 0.0383  8   DA  T "C1'" 
3672 N N9    . DA  B 8   ? 0.3417 0.1982 0.3016 -0.0177 -0.0376 0.0299  8   DA  T N9    
3673 C C8    . DA  B 8   ? 0.3798 0.2477 0.3364 -0.0047 -0.0333 0.0209  8   DA  T C8    
3674 N N7    . DA  B 8   ? 0.3228 0.2154 0.2785 -0.0111 -0.0335 0.0147  8   DA  T N7    
3675 C C5    . DA  B 8   ? 0.2897 0.1874 0.2482 -0.0295 -0.0382 0.0199  8   DA  T C5    
3676 C C6    . DA  B 8   ? 0.2824 0.2029 0.2415 -0.0438 -0.0406 0.0173  8   DA  T C6    
3677 N N6    . DA  B 8   ? 0.2983 0.2415 0.2554 -0.0416 -0.0385 0.0083  8   DA  T N6    
3678 N N1    . DA  B 8   ? 0.2846 0.2038 0.2468 -0.0606 -0.0453 0.0242  8   DA  T N1    
3679 C C2    . DA  B 8   ? 0.3025 0.1990 0.2671 -0.0628 -0.0474 0.0332  8   DA  T C2    
3680 N N3    . DA  B 8   ? 0.3121 0.1858 0.2765 -0.0504 -0.0455 0.0364  8   DA  T N3    
3681 C C4    . DA  B 8   ? 0.2969 0.1725 0.2580 -0.0338 -0.0408 0.0294  8   DA  T C4    
3682 P P     . DC  B 9   ? 0.4413 0.2108 0.4082 -0.0003 -0.0433 0.0531  9   DC  T P     
3683 O OP1   . DC  B 9   ? 0.5097 0.2579 0.4800 -0.0019 -0.0445 0.0613  9   DC  T OP1   
3684 O OP2   . DC  B 9   ? 0.4931 0.2702 0.4566 0.0150  -0.0409 0.0445  9   DC  T OP2   
3685 O "O5'" . DC  B 9   ? 0.3777 0.1673 0.3471 -0.0178 -0.0486 0.0530  9   DC  T "O5'" 
3686 C "C5'" . DC  B 9   ? 0.3945 0.1830 0.3670 -0.0346 -0.0516 0.0601  9   DC  T "C5'" 
3687 C "C4'" . DC  B 9   ? 0.4396 0.2517 0.4134 -0.0485 -0.0558 0.0573  9   DC  T "C4'" 
3688 O "O4'" . DC  B 9   ? 0.4577 0.2926 0.4281 -0.0462 -0.0532 0.0485  9   DC  T "O4'" 
3689 C "C3'" . DC  B 9   ? 0.4311 0.2469 0.4058 -0.0466 -0.0588 0.0551  9   DC  T "C3'" 
3690 O "O3'" . DC  B 9   ? 0.4784 0.2997 0.4570 -0.0637 -0.0641 0.0599  9   DC  T "O3'" 
3691 C "C2'" . DC  B 9   ? 0.4043 0.2435 0.3754 -0.0395 -0.0570 0.0442  9   DC  T "C2'" 
3692 C "C1'" . DC  B 9   ? 0.4370 0.2910 0.4073 -0.0487 -0.0558 0.0428  9   DC  T "C1'" 
3693 N N1    . DC  B 9   ? 0.3904 0.2652 0.3570 -0.0411 -0.0525 0.0327  9   DC  T N1    
3694 C C2    . DC  B 9   ? 0.3672 0.2661 0.3338 -0.0530 -0.0540 0.0289  9   DC  T C2    
3695 O O2    . DC  B 9   ? 0.3570 0.2590 0.3265 -0.0694 -0.0580 0.0342  9   DC  T O2    
3696 N N3    . DC  B 9   ? 0.3374 0.2554 0.3009 -0.0463 -0.0509 0.0196  9   DC  T N3    
3697 C C4    . DC  B 9   ? 0.4123 0.3264 0.3729 -0.0287 -0.0466 0.0143  9   DC  T C4    
3698 N N4    . DC  B 9   ? 0.3670 0.3010 0.3252 -0.0230 -0.0437 0.0053  9   DC  T N4    
3699 C C5    . DC  B 9   ? 0.4117 0.3015 0.3722 -0.0163 -0.0452 0.0180  9   DC  T C5    
3700 C C6    . DC  B 9   ? 0.4022 0.2731 0.3657 -0.0231 -0.0482 0.0271  9   DC  T C6    
3701 P P     . DG  B 10  ? 0.5027 0.3211 0.4840 -0.0664 -0.0684 0.0617  10  DG  T P     
3702 O OP1   . DG  B 10  ? 0.6470 0.4412 0.6324 -0.0711 -0.0704 0.0719  10  DG  T OP1   
3703 O OP2   . DG  B 10  ? 0.5686 0.3917 0.5465 -0.0511 -0.0664 0.0538  10  DG  T OP2   
3704 O "O5'" . DG  B 10  ? 0.4781 0.3201 0.4612 -0.0833 -0.0729 0.0603  10  DG  T "O5'" 
3705 C "C5'" . DG  B 10  ? 0.4713 0.3199 0.4560 -0.0978 -0.0742 0.0640  10  DG  T "C5'" 
3706 C "C4'" . DG  B 10  ? 0.4111 0.2865 0.3959 -0.1092 -0.0773 0.0592  10  DG  T "C4'" 
3707 O "O4'" . DG  B 10  ? 0.4500 0.3440 0.4305 -0.1017 -0.0738 0.0497  10  DG  T "O4'" 
3708 C "C3'" . DG  B 10  ? 0.4397 0.3199 0.4260 -0.1099 -0.0809 0.0576  10  DG  T "C3'" 
3709 O "O3'" . DG  B 10  ? 0.4252 0.3197 0.4146 -0.1278 -0.0857 0.0598  10  DG  T "O3'" 
3710 C "C2'" . DG  B 10  ? 0.4318 0.3271 0.4137 -0.0966 -0.0780 0.0470  10  DG  T "C2'" 
3711 C "C1'" . DG  B 10  ? 0.4502 0.3603 0.4294 -0.0979 -0.0750 0.0425  10  DG  T "C1'" 
3712 N N9    . DG  B 10  ? 0.3776 0.2934 0.3524 -0.0815 -0.0701 0.0340  10  DG  T N9    
3713 C C8    . DG  B 10  ? 0.3898 0.2885 0.3625 -0.0647 -0.0661 0.0334  10  DG  T C8    
3714 N N7    . DG  B 10  ? 0.4015 0.3111 0.3706 -0.0525 -0.0622 0.0250  10  DG  T N7    
3715 C C5    . DG  B 10  ? 0.3512 0.2867 0.3199 -0.0617 -0.0637 0.0196  10  DG  T C5    
3716 C C6    . DG  B 10  ? 0.3363 0.2928 0.3019 -0.0555 -0.0609 0.0100  10  DG  T C6    
3717 O O6    . DG  B 10  ? 0.3731 0.3295 0.3358 -0.0401 -0.0566 0.0043  10  DG  T O6    
3718 N N1    . DG  B 10  ? 0.3672 0.3467 0.3337 -0.0692 -0.0637 0.0072  10  DG  T N1    
3719 C C2    . DG  B 10  ? 0.3512 0.3330 0.3209 -0.0867 -0.0685 0.0131  10  DG  T C2    
3720 N N2    . DG  B 10  ? 0.3909 0.3965 0.3610 -0.0980 -0.0706 0.0091  10  DG  T N2    
3721 N N3    . DG  B 10  ? 0.3838 0.3461 0.3566 -0.0928 -0.0712 0.0223  10  DG  T N3    
3722 C C4    . DG  B 10  ? 0.3264 0.2661 0.2985 -0.0796 -0.0685 0.0250  10  DG  T C4    
3723 P P     . DC  B 11  ? 0.4426 0.3451 0.4344 -0.1336 -0.0904 0.0591  11  DC  T P     
3724 O OP1   . DC  B 11  ? 0.4883 0.3889 0.4851 -0.1518 -0.0953 0.0672  11  DC  T OP1   
3725 O OP2   . DC  B 11  ? 0.5127 0.4006 0.5037 -0.1192 -0.0892 0.0581  11  DC  T OP2   
3726 O "O5'" . DC  B 11  ? 0.4337 0.3656 0.4223 -0.1339 -0.0903 0.0489  11  DC  T "O5'" 
3727 C "C5'" . DC  B 11  ? 0.3682 0.3186 0.3560 -0.1437 -0.0901 0.0465  11  DC  T "C5'" 
3728 C "C4'" . DC  B 11  ? 0.3583 0.3355 0.3439 -0.1437 -0.0907 0.0370  11  DC  T "C4'" 
3729 O "O4'" . DC  B 11  ? 0.3390 0.3209 0.3201 -0.1272 -0.0858 0.0289  11  DC  T "O4'" 
3730 C "C3'" . DC  B 11  ? 0.2875 0.2701 0.2747 -0.1454 -0.0946 0.0357  11  DC  T "C3'" 
3731 O "O3'" . DC  B 11  ? 0.2834 0.2912 0.2710 -0.1576 -0.0975 0.0317  11  DC  T "O3'" 
3732 C "C2'" . DC  B 11  ? 0.3211 0.3018 0.3047 -0.1264 -0.0912 0.0288  11  DC  T "C2'" 
3733 C "C1'" . DC  B 11  ? 0.3000 0.2905 0.2798 -0.1192 -0.0864 0.0226  11  DC  T "C1'" 
3734 N N1    . DC  B 11  ? 0.2892 0.2692 0.2657 -0.0998 -0.0814 0.0188  11  DC  T N1    
3735 C C2    . DC  B 11  ? 0.2695 0.2663 0.2423 -0.0899 -0.0781 0.0092  11  DC  T C2    
3736 O O2    . DC  B 11  ? 0.3214 0.3416 0.2938 -0.0972 -0.0794 0.0040  11  DC  T O2    
3737 N N3    . DC  B 11  ? 0.2701 0.2571 0.2400 -0.0723 -0.0736 0.0059  11  DC  T N3    
3738 C C4    . DC  B 11  ? 0.2887 0.2505 0.2590 -0.0648 -0.0724 0.0117  11  DC  T C4    
3739 N N4    . DC  B 11  ? 0.2752 0.2284 0.2425 -0.0474 -0.0679 0.0081  11  DC  T N4    
3740 C C5    . DC  B 11  ? 0.2821 0.2264 0.2561 -0.0747 -0.0756 0.0214  11  DC  T C5    
3741 C C6    . DC  B 11  ? 0.2919 0.2461 0.2690 -0.0921 -0.0801 0.0247  11  DC  T C6    
3742 P P     . DT  B 12  ? 0.3190 0.3371 0.3090 -0.1647 -0.1024 0.0309  12  DT  T P     
3743 O OP1   . DT  B 12  ? 0.3647 0.4018 0.3565 -0.1825 -0.1059 0.0313  12  DT  T OP1   
3744 O OP2   . DT  B 12  ? 0.3671 0.3629 0.3598 -0.1624 -0.1042 0.0376  12  DT  T OP2   
3745 O "O5'" . DT  B 12  ? 0.2972 0.3303 0.2831 -0.1513 -0.1001 0.0203  12  DT  T "O5'" 
3746 C "C5'" . DT  B 12  ? 0.3504 0.4084 0.3341 -0.1540 -0.0992 0.0127  12  DT  T "C5'" 
3747 C "C4'" . DT  B 12  ? 0.2925 0.3610 0.2728 -0.1396 -0.0969 0.0034  12  DT  T "C4'" 
3748 O "O4'" . DT  B 12  ? 0.3342 0.3867 0.3119 -0.1230 -0.0921 0.0026  12  DT  T "O4'" 
3749 C "C3'" . DT  B 12  ? 0.3415 0.4091 0.3231 -0.1382 -0.1003 0.0032  12  DT  T "C3'" 
3750 O "O3'" . DT  B 12  ? 0.3938 0.4839 0.3733 -0.1351 -0.1005 -0.0058 12  DT  T "O3'" 
3751 C "C2'" . DT  B 12  ? 0.3239 0.3683 0.3042 -0.1225 -0.0975 0.0050  12  DT  T "C2'" 
3752 C "C1'" . DT  B 12  ? 0.3742 0.4218 0.3508 -0.1111 -0.0921 -0.0003 12  DT  T "C1'" 
3753 N N1    . DT  B 12  ? 0.4607 0.4856 0.4357 -0.0961 -0.0882 0.0018  12  DT  T N1    
3754 C C2    . DT  B 12  ? 0.4219 0.4510 0.3932 -0.0811 -0.0835 -0.0052 12  DT  T C2    
3755 O O2    . DT  B 12  ? 0.4653 0.5155 0.4347 -0.0796 -0.0823 -0.0128 12  DT  T O2    
3756 N N3    . DT  B 12  ? 0.3703 0.3775 0.3403 -0.0678 -0.0802 -0.0028 12  DT  T N3    
3757 C C4    . DT  B 12  ? 0.3302 0.3125 0.3023 -0.0679 -0.0810 0.0056  12  DT  T C4    
3758 O O4    . DT  B 12  ? 0.3849 0.3491 0.3554 -0.0550 -0.0776 0.0068  12  DT  T O4    
3759 C C5    . DT  B 12  ? 0.3906 0.3700 0.3668 -0.0841 -0.0860 0.0126  12  DT  T C5    
3760 C C7    . DT  B 12  ? 0.4233 0.3765 0.4024 -0.0860 -0.0873 0.0220  12  DT  T C7    
3761 C C6    . DT  B 12  ? 0.3946 0.3952 0.3721 -0.0973 -0.0893 0.0104  12  DT  T C6    
3762 O "O5'" A DA  C 1   ? 0.7238 0.4585 0.4811 0.0341  -0.0495 -0.0449 1   DA  P "O5'" 
3763 O "O5'" B DA  C 1   ? 0.6753 0.3957 0.4264 0.0319  -0.0453 -0.0445 1   DA  P "O5'" 
3764 C "C5'" A DA  C 1   ? 0.6608 0.3919 0.4058 0.0373  -0.0532 -0.0469 1   DA  P "C5'" 
3765 C "C5'" B DA  C 1   ? 0.6502 0.3786 0.3906 0.0380  -0.0538 -0.0474 1   DA  P "C5'" 
3766 C "C4'" A DA  C 1   ? 0.6043 0.3680 0.3623 0.0408  -0.0605 -0.0442 1   DA  P "C4'" 
3767 C "C4'" B DA  C 1   ? 0.6033 0.3679 0.3617 0.0408  -0.0606 -0.0440 1   DA  P "C4'" 
3768 O "O4'" A DA  C 1   ? 0.6266 0.4045 0.4073 0.0349  -0.0543 -0.0367 1   DA  P "O4'" 
3769 O "O4'" B DA  C 1   ? 0.6179 0.3968 0.3993 0.0349  -0.0544 -0.0365 1   DA  P "O4'" 
3770 C "C3'" A DA  C 1   ? 0.5719 0.3602 0.3381 0.0452  -0.0682 -0.0447 1   DA  P "C3'" 
3771 C "C3'" B DA  C 1   ? 0.5897 0.3709 0.3563 0.0431  -0.0651 -0.0445 1   DA  P "C3'" 
3772 O "O3'" A DA  C 1   ? 0.5126 0.3180 0.2730 0.0522  -0.0785 -0.0470 1   DA  P "O3'" 
3773 O "O3'" B DA  C 1   ? 0.5959 0.3883 0.3514 0.0511  -0.0761 -0.0491 1   DA  P "O3'" 
3774 C "C2'" A DA  C 1   ? 0.5762 0.3863 0.3709 0.0396  -0.0632 -0.0373 1   DA  P "C2'" 
3775 C "C2'" B DA  C 1   ? 0.5821 0.3920 0.3775 0.0393  -0.0627 -0.0370 1   DA  P "C2'" 
3776 C "C1'" A DA  C 1   ? 0.5876 0.3923 0.3906 0.0338  -0.0553 -0.0324 1   DA  P "C1'" 
3777 C "C1'" B DA  C 1   ? 0.5868 0.3919 0.3902 0.0337  -0.0552 -0.0323 1   DA  P "C1'" 
3778 N N9    . DA  C 1   ? 0.5626 0.3609 0.3806 0.0259  -0.0448 -0.0275 1   DA  P N9    
3779 C C8    . DA  C 1   ? 0.5960 0.3664 0.4055 0.0218  -0.0371 -0.0290 1   DA  P C8    
3780 N N7    . DA  C 1   ? 0.5966 0.3686 0.4242 0.0149  -0.0284 -0.0234 1   DA  P N7    
3781 C C5    . DA  C 1   ? 0.5051 0.3082 0.3546 0.0143  -0.0306 -0.0180 1   DA  P C5    
3782 C C6    . DA  C 1   ? 0.4979 0.3181 0.3732 0.0084  -0.0247 -0.0108 1   DA  P C6    
3783 N N6    . DA  C 1   ? 0.5089 0.3165 0.3926 0.0016  -0.0149 -0.0076 1   DA  P N6    
3784 N N1    . DA  C 1   ? 0.4861 0.3371 0.3783 0.0098  -0.0293 -0.0068 1   DA  P N1    
3785 C C2    . DA  C 1   ? 0.3750 0.2389 0.2590 0.0167  -0.0391 -0.0098 1   DA  P C2    
3786 N N3    A DA  C 1   ? 0.4316 0.2818 0.2918 0.0227  -0.0455 -0.0166 1   DA  P N3    
3787 N N3    B DA  C 1   ? 0.4298 0.2801 0.2901 0.0227  -0.0455 -0.0165 1   DA  P N3    
3788 C C4    . DA  C 1   ? 0.4803 0.3000 0.3242 0.0211  -0.0407 -0.0204 1   DA  P C4    
3789 P P     A DG  C 2   ? 0.5147 0.3340 0.2690 0.0595  -0.0888 -0.0515 2   DG  P P     
3790 P P     B DG  C 2   ? 0.5611 0.3693 0.3200 0.0553  -0.0827 -0.0512 2   DG  P P     
3791 O OP1   A DG  C 2   ? 0.5050 0.3342 0.2487 0.0663  -0.0980 -0.0544 2   DG  P OP1   
3792 O OP1   B DG  C 2   ? 0.5974 0.4076 0.3379 0.0636  -0.0933 -0.0573 2   DG  P OP1   
3793 O OP2   A DG  C 2   ? 0.5815 0.3772 0.3213 0.0596  -0.0871 -0.0563 2   DG  P OP2   
3794 O OP2   B DG  C 2   ? 0.5932 0.3841 0.3522 0.0511  -0.0762 -0.0516 2   DG  P OP2   
3795 O "O5'" A DG  C 2   ? 0.5381 0.3892 0.3198 0.0577  -0.0892 -0.0456 2   DG  P "O5'" 
3796 O "O5'" B DG  C 2   ? 0.5561 0.4000 0.3431 0.0538  -0.0838 -0.0443 2   DG  P "O5'" 
3797 C "C5'" A DG  C 2   ? 0.4886 0.3681 0.2859 0.0588  -0.0928 -0.0412 2   DG  P "C5'" 
3798 C "C5'" B DG  C 2   ? 0.5156 0.3825 0.3084 0.0574  -0.0901 -0.0426 2   DG  P "C5'" 
3799 C "C4'" A DG  C 2   ? 0.4446 0.3483 0.2690 0.0548  -0.0898 -0.0348 2   DG  P "C4'" 
3800 C "C4'" B DG  C 2   ? 0.4570 0.3555 0.2776 0.0550  -0.0897 -0.0358 2   DG  P "C4'" 
3801 O "O4'" A DG  C 2   ? 0.4433 0.3329 0.2774 0.0466  -0.0786 -0.0308 2   DG  P "O4'" 
3802 O "O4'" B DG  C 2   ? 0.4391 0.3310 0.2747 0.0466  -0.0788 -0.0303 2   DG  P "O4'" 
3803 C "C3'" A DG  C 2   ? 0.4587 0.3739 0.2868 0.0577  -0.0944 -0.0365 2   DG  P "C3'" 
3804 C "C3'" B DG  C 2   ? 0.4612 0.3756 0.2889 0.0577  -0.0944 -0.0367 2   DG  P "C3'" 
3805 O "O3'" A DG  C 2   ? 0.4790 0.4280 0.3233 0.0607  -0.1007 -0.0332 2   DG  P "O3'" 
3806 O "O3'" B DG  C 2   ? 0.4722 0.4208 0.3163 0.0607  -0.1006 -0.0332 2   DG  P "O3'" 
3807 C "C2'" A DG  C 2   ? 0.4479 0.3548 0.2888 0.0505  -0.0849 -0.0330 2   DG  P "C2'" 
3808 C "C2'" B DG  C 2   ? 0.4434 0.3500 0.2843 0.0504  -0.0848 -0.0330 2   DG  P "C2'" 
3809 C "C1'" A DG  C 2   ? 0.4154 0.3193 0.2676 0.0439  -0.0765 -0.0275 2   DG  P "C1'" 
3810 C "C1'" B DG  C 2   ? 0.4200 0.3242 0.2725 0.0439  -0.0765 -0.0274 2   DG  P "C1'" 
3811 N N9    . DG  C 2   ? 0.4358 0.3194 0.2921 0.0366  -0.0658 -0.0253 2   DG  P N9    
3812 C C8    . DG  C 2   ? 0.4536 0.3066 0.2928 0.0353  -0.0616 -0.0296 2   DG  P C8    
3813 N N7    . DG  C 2   ? 0.4402 0.2814 0.2888 0.0281  -0.0517 -0.0259 2   DG  P N7    
3814 C C5    . DG  C 2   ? 0.3892 0.2545 0.2625 0.0243  -0.0489 -0.0189 2   DG  P C5    
3815 C C6    . DG  C 2   ? 0.3446 0.2113 0.2374 0.0164  -0.0392 -0.0125 2   DG  P C6    
3816 O O6    . DG  C 2   ? 0.3652 0.2113 0.2575 0.0110  -0.0306 -0.0117 2   DG  P O6    
3817 N N1    . DG  C 2   ? 0.3301 0.2259 0.2451 0.0151  -0.0401 -0.0065 2   DG  P N1    
3818 C C2    . DG  C 2   ? 0.3429 0.2633 0.2606 0.0207  -0.0492 -0.0067 2   DG  P C2    
3819 N N2    . DG  C 2   ? 0.3429 0.2900 0.2833 0.0185  -0.0488 -0.0004 2   DG  P N2    
3820 N N3    . DG  C 2   ? 0.3893 0.3088 0.2890 0.0281  -0.0583 -0.0125 2   DG  P N3    
3821 C C4    . DG  C 2   ? 0.4225 0.3139 0.3006 0.0295  -0.0576 -0.0184 2   DG  P C4    
3822 P P     . DC  C 3   ? 0.5356 0.5066 0.3892 0.0643  -0.1068 -0.0335 3   DC  P P     
3823 O OP1   . DC  C 3   ? 0.6556 0.6508 0.5087 0.0714  -0.1172 -0.0346 3   DC  P OP1   
3824 O OP2   . DC  C 3   ? 0.6010 0.5503 0.4404 0.0650  -0.1061 -0.0386 3   DC  P OP2   
3825 O "O5'" . DC  C 3   ? 0.5805 0.5698 0.4631 0.0576  -0.1000 -0.0257 3   DC  P "O5'" 
3826 C "C5'" . DC  C 3   ? 0.5784 0.5842 0.4780 0.0543  -0.0973 -0.0195 3   DC  P "C5'" 
3827 C "C4'" . DC  C 3   ? 0.5413 0.5593 0.4662 0.0475  -0.0899 -0.0128 3   DC  P "C4'" 
3828 O "O4'" . DC  C 3   ? 0.5211 0.5118 0.4429 0.0408  -0.0796 -0.0122 3   DC  P "O4'" 
3829 C "C3'" . DC  C 3   ? 0.5183 0.5523 0.4534 0.0490  -0.0931 -0.0127 3   DC  P "C3'" 
3830 O "O3'" . DC  C 3   ? 0.5081 0.5740 0.4680 0.0478  -0.0940 -0.0065 3   DC  P "O3'" 
3831 C "C2'" . DC  C 3   ? 0.5335 0.5459 0.4694 0.0430  -0.0842 -0.0124 3   DC  P "C2'" 
3832 C "C1'" . DC  C 3   ? 0.5374 0.5319 0.4734 0.0368  -0.0751 -0.0096 3   DC  P "C1'" 
3833 N N1    . DC  C 3   ? 0.5073 0.4694 0.4310 0.0329  -0.0679 -0.0123 3   DC  P N1    
3834 C C2    . DC  C 3   ? 0.4296 0.3839 0.3670 0.0248  -0.0573 -0.0073 3   DC  P C2    
3835 O O2    . DC  C 3   ? 0.4585 0.4330 0.4180 0.0210  -0.0543 -0.0010 3   DC  P O2    
3836 N N3    . DC  C 3   ? 0.4827 0.4077 0.4090 0.0214  -0.0507 -0.0097 3   DC  P N3    
3837 C C4    . DC  C 3   ? 0.4838 0.3880 0.3865 0.0257  -0.0544 -0.0166 3   DC  P C4    
3838 N N4    . DC  C 3   ? 0.4803 0.3560 0.3731 0.0220  -0.0475 -0.0185 3   DC  P N4    
3839 C C5    . DC  C 3   ? 0.5261 0.4378 0.4143 0.0339  -0.0652 -0.0218 3   DC  P C5    
3840 C C6    . DC  C 3   ? 0.4592 0.3999 0.3586 0.0373  -0.0716 -0.0194 3   DC  P C6    
3841 P P     . DG  C 4   ? 0.4913 0.5800 0.4655 0.0496  -0.0979 -0.0052 4   DG  P P     
3842 O OP1   . DG  C 4   ? 0.5651 0.6879 0.5549 0.0527  -0.1040 -0.0015 4   DG  P OP1   
3843 O OP2   . DG  C 4   ? 0.4950 0.5690 0.4504 0.0543  -0.1025 -0.0121 4   DG  P OP2   
3844 O "O5'" . DG  C 4   ? 0.4062 0.4914 0.3992 0.0409  -0.0873 0.0002  4   DG  P "O5'" 
3845 C "C5'" . DG  C 4   ? 0.4278 0.5192 0.4376 0.0348  -0.0803 0.0066  4   DG  P "C5'" 
3846 C "C4'" . DG  C 4   ? 0.4781 0.5624 0.5023 0.0270  -0.0705 0.0107  4   DG  P "C4'" 
3847 O "O4'" . DG  C 4   ? 0.5003 0.5499 0.5072 0.0243  -0.0645 0.0070  4   DG  P "O4'" 
3848 C "C3'" . DG  C 4   ? 0.4508 0.5505 0.4869 0.0277  -0.0726 0.0114  4   DG  P "C3'" 
3849 O "O3'" . DG  C 4   ? 0.4427 0.5612 0.5053 0.0220  -0.0671 0.0188  4   DG  P "O3'" 
3850 C "C2'" . DG  C 4   ? 0.4135 0.4846 0.4355 0.0262  -0.0687 0.0072  4   DG  P "C2'" 
3851 C "C1'" . DG  C 4   ? 0.4363 0.4796 0.4479 0.0216  -0.0608 0.0070  4   DG  P "C1'" 
3852 N N9    . DG  C 4   ? 0.3900 0.4020 0.3779 0.0229  -0.0601 0.0006  4   DG  P N9    
3853 C C8    . DG  C 4   ? 0.4019 0.4041 0.3669 0.0299  -0.0679 -0.0064 4   DG  P C8    
3854 N N7    . DG  C 4   ? 0.3946 0.3672 0.3419 0.0291  -0.0647 -0.0108 4   DG  P N7    
3855 C C5    . DG  C 4   ? 0.3503 0.3124 0.3095 0.0211  -0.0541 -0.0064 4   DG  P C5    
3856 C C6    . DG  C 4   ? 0.3467 0.2788 0.2963 0.0168  -0.0465 -0.0081 4   DG  P C6    
3857 O O6    . DG  C 4   ? 0.4493 0.3573 0.3773 0.0192  -0.0477 -0.0140 4   DG  P O6    
3858 N N1    . DG  C 4   ? 0.2917 0.2234 0.2597 0.0088  -0.0366 -0.0020 4   DG  P N1    
3859 C C2    . DG  C 4   ? 0.2546 0.2116 0.2470 0.0055  -0.0345 0.0047  4   DG  P C2    
3860 N N2    . DG  C 4   ? 0.2890 0.2413 0.2966 -0.0023 -0.0245 0.0099  4   DG  P N2    
3861 N N3    . DG  C 4   ? 0.2627 0.2481 0.2645 0.0095  -0.0416 0.0064  4   DG  P N3    
3862 C C4    . DG  C 4   ? 0.3299 0.3159 0.3139 0.0172  -0.0511 0.0005  4   DG  P C4    
3863 P P     . DT  C 5   ? 0.4110 0.5507 0.4921 0.0215  -0.0682 0.0215  5   DT  P P     
3864 O OP1   . DT  C 5   ? 0.4119 0.5815 0.5179 0.0192  -0.0677 0.0284  5   DT  P OP1   
3865 O OP2   . DT  C 5   ? 0.4013 0.5425 0.4686 0.0288  -0.0772 0.0155  5   DT  P OP2   
3866 O "O5'" . DT  C 5   ? 0.3390 0.4566 0.4232 0.0142  -0.0580 0.0227  5   DT  P "O5'" 
3867 C "C5'" . DT  C 5   ? 0.2597 0.3666 0.3523 0.0068  -0.0481 0.0272  5   DT  P "C5'" 
3868 C "C4'" . DT  C 5   ? 0.2300 0.3158 0.3232 0.0011  -0.0398 0.0274  5   DT  P "C4'" 
3869 O "O4'" . DT  C 5   ? 0.2501 0.3053 0.3176 0.0033  -0.0400 0.0207  5   DT  P "O4'" 
3870 C "C3'" . DT  C 5   ? 0.2181 0.3179 0.3241 0.0011  -0.0412 0.0284  5   DT  P "C3'" 
3871 O "O3'" . DT  C 5   ? 0.2049 0.3054 0.3303 -0.0069 -0.0315 0.0345  5   DT  P "O3'" 
3872 C "C2'" . DT  C 5   ? 0.1833 0.2592 0.2682 0.0040  -0.0431 0.0217  5   DT  P "C2'" 
3873 C "C1'" . DT  C 5   ? 0.2058 0.2510 0.2725 0.0020  -0.0379 0.0191  5   DT  P "C1'" 
3874 N N1    . DT  C 5   ? 0.2307 0.2537 0.2706 0.0072  -0.0427 0.0114  5   DT  P N1    
3875 C C2    . DT  C 5   ? 0.2176 0.2098 0.2448 0.0039  -0.0363 0.0089  5   DT  P C2    
3876 O O2    . DT  C 5   ? 0.2652 0.2475 0.3023 -0.0031 -0.0269 0.0127  5   DT  P O2    
3877 N N3    . DT  C 5   ? 0.2343 0.2075 0.2366 0.0092  -0.0414 0.0017  5   DT  P N3    
3878 C C4    . DT  C 5   ? 0.2229 0.2047 0.2120 0.0173  -0.0520 -0.0031 5   DT  P C4    
3879 O O4    . DT  C 5   ? 0.2648 0.2275 0.2313 0.0215  -0.0558 -0.0096 5   DT  P O4    
3880 C C5    . DT  C 5   ? 0.2981 0.3127 0.3018 0.0203  -0.0581 0.0000  5   DT  P C5    
3881 C C7    . DT  C 5   ? 0.3439 0.3713 0.3358 0.0290  -0.0696 -0.0045 5   DT  P C7    
3882 C C6    . DT  C 5   ? 0.2252 0.2587 0.2534 0.0152  -0.0532 0.0071  5   DT  P C6    
3883 P P     . DC  C 6   ? 0.1499 0.2680 0.2959 -0.0093 -0.0304 0.0381  6   DC  P P     
3884 O OP1   . DC  C 6   ? 0.1682 0.2962 0.3375 -0.0169 -0.0219 0.0456  6   DC  P OP1   
3885 O OP2   . DC  C 6   ? 0.2005 0.3428 0.3479 -0.0022 -0.0410 0.0361  6   DC  P OP2   
3886 O "O5'" . DC  C 6   ? 0.1457 0.2364 0.2792 -0.0110 -0.0265 0.0342  6   DC  P "O5'" 
3887 C "C5'" . DC  C 6   ? 0.1296 0.1949 0.2609 -0.0177 -0.0162 0.0356  6   DC  P "C5'" 
3888 C "C4'" . DC  C 6   ? 0.1853 0.2264 0.3021 -0.0175 -0.0150 0.0309  6   DC  P "C4'" 
3889 O "O4'" . DC  C 6   ? 0.2059 0.2315 0.2967 -0.0112 -0.0214 0.0238  6   DC  P "O4'" 
3890 C "C3'" . DC  C 6   ? 0.1384 0.1935 0.2642 -0.0158 -0.0188 0.0307  6   DC  P "C3'" 
3891 O "O3'" . DC  C 6   ? 0.1529 0.1990 0.2909 -0.0231 -0.0095 0.0344  6   DC  P "O3'" 
3892 C "C2'" . DC  C 6   ? 0.1747 0.2137 0.2759 -0.0094 -0.0257 0.0228  6   DC  P "C2'" 
3893 C "C1'" . DC  C 6   ? 0.2133 0.2274 0.2935 -0.0088 -0.0240 0.0193  6   DC  P "C1'" 
3894 N N1    . DC  C 6   ? 0.2077 0.2163 0.2651 -0.0006 -0.0335 0.0123  6   DC  P N1    
3895 C C2    . DC  C 6   ? 0.2075 0.1851 0.2416 0.0004  -0.0325 0.0066  6   DC  P C2    
3896 O O2    . DC  C 6   ? 0.2460 0.2021 0.2793 -0.0054 -0.0237 0.0077  6   DC  P O2    
3897 N N3    . DC  C 6   ? 0.2140 0.1865 0.2272 0.0077  -0.0411 0.0001  6   DC  P N3    
3898 C C4    . DC  C 6   ? 0.2253 0.2219 0.2402 0.0139  -0.0504 -0.0007 6   DC  P C4    
3899 N N4    . DC  C 6   ? 0.2540 0.2437 0.2475 0.0211  -0.0586 -0.0073 6   DC  P N4    
3900 C C5    . DC  C 6   ? 0.2123 0.2408 0.2508 0.0131  -0.0516 0.0050  6   DC  P C5    
3901 C C6    . DC  C 6   ? 0.2316 0.2649 0.2906 0.0057  -0.0431 0.0114  6   DC  P C6    
3902 P P     . DA  C 7   ? 0.1518 0.2068 0.3007 -0.0235 -0.0106 0.0350  7   DA  P P     
3903 O OP1   . DA  C 7   ? 0.1574 0.2156 0.3281 -0.0317 -0.0008 0.0417  7   DA  P OP1   
3904 O OP2   . DA  C 7   ? 0.1515 0.2339 0.3044 -0.0167 -0.0211 0.0337  7   DA  P OP2   
3905 O "O5'" . DA  C 7   ? 0.1980 0.2233 0.3235 -0.0213 -0.0113 0.0283  7   DA  P "O5'" 
3906 C "C5'" . DA  C 7   ? 0.2769 0.2708 0.3919 -0.0261 -0.0029 0.0274  7   DA  P "C5'" 
3907 C "C4'" . DA  C 7   ? 0.3195 0.2900 0.4089 -0.0214 -0.0072 0.0199  7   DA  P "C4'" 
3908 O "O4'" . DA  C 7   ? 0.3038 0.2744 0.3757 -0.0148 -0.0150 0.0152  7   DA  P "O4'" 
3909 C "C3'" . DA  C 7   ? 0.3238 0.3008 0.4110 -0.0171 -0.0141 0.0165  7   DA  P "C3'" 
3910 O "O3'" . DA  C 7   ? 0.3413 0.3150 0.4417 -0.0225 -0.0078 0.0197  7   DA  P "O3'" 
3911 C "C2'" . DA  C 7   ? 0.3600 0.3132 0.4189 -0.0118 -0.0187 0.0089  7   DA  P "C2'" 
3912 C "C1'" . DA  C 7   ? 0.3172 0.2720 0.3684 -0.0097 -0.0205 0.0083  7   DA  P "C1'" 
3913 N N9    . DA  C 7   ? 0.2571 0.2267 0.2986 -0.0014 -0.0318 0.0042  7   DA  P N9    
3914 C C8    . DA  C 7   ? 0.2581 0.2579 0.3113 0.0022  -0.0382 0.0063  7   DA  P C8    
3915 N N7    . DA  C 7   ? 0.2382 0.2426 0.2763 0.0099  -0.0479 0.0011  7   DA  P N7    
3916 C C5    . DA  C 7   ? 0.2624 0.2374 0.2773 0.0115  -0.0479 -0.0049 7   DA  P C5    
3917 C C6    . DA  C 7   ? 0.2807 0.2445 0.2718 0.0186  -0.0558 -0.0121 7   DA  P C6    
3918 N N6    . DA  C 7   ? 0.3169 0.2989 0.3032 0.0258  -0.0658 -0.0146 7   DA  P N6    
3919 N N1    . DA  C 7   ? 0.2588 0.1919 0.2309 0.0179  -0.0531 -0.0166 7   DA  P N1    
3920 C C2    . DA  C 7   ? 0.2546 0.1699 0.2320 0.0107  -0.0430 -0.0138 7   DA  P C2    
3921 N N3    . DA  C 7   ? 0.2746 0.1979 0.2738 0.0037  -0.0349 -0.0071 7   DA  P N3    
3922 C C4    . DA  C 7   ? 0.2801 0.2336 0.2971 0.0046  -0.0380 -0.0029 7   DA  P C4    
3923 P P     A DT  C 8   ? 0.4230 0.3628 0.5113 -0.0266 -0.0005 0.0175  8   DT  P P     
3924 P P     B DT  C 8   ? 0.2126 0.1829 0.3082 -0.0197 -0.0123 0.0160  8   DT  P P     
3925 O OP1   A DT  C 8   ? 0.4860 0.4068 0.5696 -0.0314 0.0078  0.0192  8   DT  P OP1   
3926 O OP1   B DT  C 8   ? 0.2203 0.1859 0.3315 -0.0269 -0.0036 0.0205  8   DT  P OP1   
3927 O OP2   A DT  C 8   ? 0.4069 0.3523 0.5107 -0.0302 0.0025  0.0204  8   DT  P OP2   
3928 O OP2   B DT  C 8   ? 0.2266 0.2244 0.3264 -0.0129 -0.0229 0.0146  8   DT  P OP2   
3929 O "O5'" A DT  C 8   ? 0.3750 0.2999 0.4372 -0.0193 -0.0089 0.0093  8   DT  P "O5'" 
3930 O "O5'" B DT  C 8   ? 0.3279 0.2667 0.3938 -0.0162 -0.0142 0.0086  8   DT  P "O5'" 
3931 C "C5'" A DT  C 8   ? 0.3742 0.2846 0.4306 -0.0196 -0.0084 0.0067  8   DT  P "C5'" 
3932 C "C5'" B DT  C 8   ? 0.3675 0.2770 0.4240 -0.0201 -0.0077 0.0070  8   DT  P "C5'" 
3933 C "C4'" . DT  C 8   ? 0.3263 0.2114 0.3547 -0.0150 -0.0123 -0.0007 8   DT  P "C4'" 
3934 O "O4'" . DT  C 8   ? 0.2578 0.1512 0.2737 -0.0082 -0.0207 -0.0044 8   DT  P "O4'" 
3935 C "C3'" . DT  C 8   ? 0.2910 0.1711 0.3125 -0.0119 -0.0172 -0.0048 8   DT  P "C3'" 
3936 O "O3'" . DT  C 8   ? 0.3872 0.2348 0.3890 -0.0127 -0.0140 -0.0090 8   DT  P "O3'" 
3937 C "C2'" . DT  C 8   ? 0.3335 0.2309 0.3463 -0.0030 -0.0295 -0.0093 8   DT  P "C2'" 
3938 C "C1'" . DT  C 8   ? 0.3016 0.1948 0.3031 -0.0011 -0.0302 -0.0105 8   DT  P "C1'" 
3939 N N1    . DT  C 8   ? 0.2742 0.1935 0.2773 0.0054  -0.0398 -0.0115 8   DT  P N1    
3940 C C2    . DT  C 8   ? 0.3246 0.2392 0.3067 0.0130  -0.0489 -0.0181 8   DT  P C2    
3941 O O2    . DT  C 8   ? 0.3719 0.2620 0.3340 0.0147  -0.0496 -0.0234 8   DT  P O2    
3942 N N3    . DT  C 8   ? 0.2865 0.2265 0.2718 0.0186  -0.0572 -0.0184 8   DT  P N3    
3943 C C4    . DT  C 8   ? 0.2862 0.2552 0.2933 0.0174  -0.0574 -0.0128 8   DT  P C4    
3944 O O4    . DT  C 8   ? 0.3064 0.2968 0.3145 0.0229  -0.0652 -0.0135 8   DT  P O4    
3945 C C5    . DT  C 8   ? 0.2501 0.2224 0.2784 0.0093  -0.0476 -0.0060 8   DT  P C5    
3946 C C7    . DT  C 8   ? 0.2310 0.2340 0.2838 0.0073  -0.0471 0.0005  8   DT  P C7    
3947 C C6    . DT  C 8   ? 0.2614 0.2091 0.2869 0.0037  -0.0394 -0.0056 8   DT  P C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   ?   ?   ?   P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1   501 502 CA  CA  A . 
E 5 GOL 1   503 436 GOL GOL A . 
F 5 GOL 1   504 437 GOL GOL A . 
G 5 GOL 1   505 438 GOL GOL A . 
H 6 DTP 1   502 9   DTP DTP P . 
I 7 HOH 1   601 1   HOH HOH A . 
I 7 HOH 2   602 2   HOH HOH A . 
I 7 HOH 3   603 3   HOH HOH A . 
I 7 HOH 4   604 4   HOH HOH A . 
I 7 HOH 5   605 5   HOH HOH A . 
I 7 HOH 6   606 6   HOH HOH A . 
I 7 HOH 7   607 7   HOH HOH A . 
I 7 HOH 8   608 8   HOH HOH A . 
I 7 HOH 9   609 9   HOH HOH A . 
I 7 HOH 10  610 10  HOH HOH A . 
I 7 HOH 11  611 11  HOH HOH A . 
I 7 HOH 12  612 12  HOH HOH A . 
I 7 HOH 13  613 13  HOH HOH A . 
I 7 HOH 14  614 14  HOH HOH A . 
I 7 HOH 15  615 15  HOH HOH A . 
I 7 HOH 16  616 16  HOH HOH A . 
I 7 HOH 17  617 17  HOH HOH A . 
I 7 HOH 18  618 18  HOH HOH A . 
I 7 HOH 19  619 19  HOH HOH A . 
I 7 HOH 20  620 20  HOH HOH A . 
I 7 HOH 21  621 21  HOH HOH A . 
I 7 HOH 22  622 22  HOH HOH A . 
I 7 HOH 23  623 23  HOH HOH A . 
I 7 HOH 24  624 24  HOH HOH A . 
I 7 HOH 25  625 25  HOH HOH A . 
I 7 HOH 26  626 26  HOH HOH A . 
I 7 HOH 27  627 27  HOH HOH A . 
I 7 HOH 28  628 28  HOH HOH A . 
I 7 HOH 29  629 29  HOH HOH A . 
I 7 HOH 30  630 30  HOH HOH A . 
I 7 HOH 31  631 31  HOH HOH A . 
I 7 HOH 32  632 32  HOH HOH A . 
I 7 HOH 33  633 33  HOH HOH A . 
I 7 HOH 34  634 34  HOH HOH A . 
I 7 HOH 35  635 35  HOH HOH A . 
I 7 HOH 36  636 36  HOH HOH A . 
I 7 HOH 37  637 37  HOH HOH A . 
I 7 HOH 38  638 38  HOH HOH A . 
I 7 HOH 39  639 39  HOH HOH A . 
I 7 HOH 40  640 41  HOH HOH A . 
I 7 HOH 41  641 42  HOH HOH A . 
I 7 HOH 42  642 43  HOH HOH A . 
I 7 HOH 43  643 44  HOH HOH A . 
I 7 HOH 44  644 47  HOH HOH A . 
I 7 HOH 45  645 48  HOH HOH A . 
I 7 HOH 46  646 49  HOH HOH A . 
I 7 HOH 47  647 50  HOH HOH A . 
I 7 HOH 48  648 51  HOH HOH A . 
I 7 HOH 49  649 52  HOH HOH A . 
I 7 HOH 50  650 53  HOH HOH A . 
I 7 HOH 51  651 54  HOH HOH A . 
I 7 HOH 52  652 55  HOH HOH A . 
I 7 HOH 53  653 56  HOH HOH A . 
I 7 HOH 54  654 57  HOH HOH A . 
I 7 HOH 55  655 58  HOH HOH A . 
I 7 HOH 56  656 59  HOH HOH A . 
I 7 HOH 57  657 60  HOH HOH A . 
I 7 HOH 58  658 61  HOH HOH A . 
I 7 HOH 59  659 62  HOH HOH A . 
I 7 HOH 60  660 63  HOH HOH A . 
I 7 HOH 61  661 64  HOH HOH A . 
I 7 HOH 62  662 66  HOH HOH A . 
I 7 HOH 63  663 67  HOH HOH A . 
I 7 HOH 64  664 68  HOH HOH A . 
I 7 HOH 65  665 70  HOH HOH A . 
I 7 HOH 66  666 71  HOH HOH A . 
I 7 HOH 67  667 72  HOH HOH A . 
I 7 HOH 68  668 73  HOH HOH A . 
I 7 HOH 69  669 75  HOH HOH A . 
I 7 HOH 70  670 76  HOH HOH A . 
I 7 HOH 71  671 77  HOH HOH A . 
I 7 HOH 72  672 78  HOH HOH A . 
I 7 HOH 73  673 79  HOH HOH A . 
I 7 HOH 74  674 80  HOH HOH A . 
I 7 HOH 75  675 81  HOH HOH A . 
I 7 HOH 76  676 82  HOH HOH A . 
I 7 HOH 77  677 83  HOH HOH A . 
I 7 HOH 78  678 85  HOH HOH A . 
I 7 HOH 79  679 86  HOH HOH A . 
I 7 HOH 80  680 87  HOH HOH A . 
I 7 HOH 81  681 88  HOH HOH A . 
I 7 HOH 82  682 89  HOH HOH A . 
I 7 HOH 83  683 90  HOH HOH A . 
I 7 HOH 84  684 91  HOH HOH A . 
I 7 HOH 85  685 92  HOH HOH A . 
I 7 HOH 86  686 93  HOH HOH A . 
I 7 HOH 87  687 94  HOH HOH A . 
I 7 HOH 88  688 95  HOH HOH A . 
I 7 HOH 89  689 96  HOH HOH A . 
I 7 HOH 90  690 97  HOH HOH A . 
I 7 HOH 91  691 99  HOH HOH A . 
I 7 HOH 92  692 100 HOH HOH A . 
I 7 HOH 93  693 101 HOH HOH A . 
I 7 HOH 94  694 103 HOH HOH A . 
I 7 HOH 95  695 104 HOH HOH A . 
I 7 HOH 96  696 105 HOH HOH A . 
I 7 HOH 97  697 106 HOH HOH A . 
I 7 HOH 98  698 107 HOH HOH A . 
I 7 HOH 99  699 108 HOH HOH A . 
I 7 HOH 100 700 110 HOH HOH A . 
I 7 HOH 101 701 111 HOH HOH A . 
I 7 HOH 102 702 112 HOH HOH A . 
I 7 HOH 103 703 114 HOH HOH A . 
I 7 HOH 104 704 116 HOH HOH A . 
I 7 HOH 105 705 118 HOH HOH A . 
I 7 HOH 106 706 119 HOH HOH A . 
I 7 HOH 107 707 120 HOH HOH A . 
I 7 HOH 108 708 121 HOH HOH A . 
I 7 HOH 109 709 123 HOH HOH A . 
I 7 HOH 110 710 124 HOH HOH A . 
I 7 HOH 111 711 125 HOH HOH A . 
I 7 HOH 112 712 127 HOH HOH A . 
I 7 HOH 113 713 128 HOH HOH A . 
I 7 HOH 114 714 131 HOH HOH A . 
I 7 HOH 115 715 132 HOH HOH A . 
I 7 HOH 116 716 133 HOH HOH A . 
I 7 HOH 117 717 134 HOH HOH A . 
I 7 HOH 118 718 135 HOH HOH A . 
I 7 HOH 119 719 136 HOH HOH A . 
I 7 HOH 120 720 137 HOH HOH A . 
I 7 HOH 121 721 138 HOH HOH A . 
I 7 HOH 122 722 140 HOH HOH A . 
I 7 HOH 123 723 141 HOH HOH A . 
I 7 HOH 124 724 142 HOH HOH A . 
I 7 HOH 125 725 143 HOH HOH A . 
I 7 HOH 126 726 144 HOH HOH A . 
I 7 HOH 127 727 145 HOH HOH A . 
I 7 HOH 128 728 146 HOH HOH A . 
I 7 HOH 129 729 147 HOH HOH A . 
I 7 HOH 130 730 148 HOH HOH A . 
I 7 HOH 131 731 149 HOH HOH A . 
I 7 HOH 132 732 150 HOH HOH A . 
I 7 HOH 133 733 151 HOH HOH A . 
I 7 HOH 134 734 152 HOH HOH A . 
I 7 HOH 135 735 153 HOH HOH A . 
I 7 HOH 136 736 155 HOH HOH A . 
I 7 HOH 137 737 157 HOH HOH A . 
I 7 HOH 138 738 159 HOH HOH A . 
I 7 HOH 139 739 160 HOH HOH A . 
I 7 HOH 140 740 161 HOH HOH A . 
I 7 HOH 141 741 162 HOH HOH A . 
I 7 HOH 142 742 164 HOH HOH A . 
I 7 HOH 143 743 166 HOH HOH A . 
I 7 HOH 144 744 167 HOH HOH A . 
I 7 HOH 145 745 168 HOH HOH A . 
I 7 HOH 146 746 169 HOH HOH A . 
I 7 HOH 147 747 170 HOH HOH A . 
I 7 HOH 148 748 172 HOH HOH A . 
I 7 HOH 149 749 174 HOH HOH A . 
I 7 HOH 150 750 175 HOH HOH A . 
I 7 HOH 151 751 178 HOH HOH A . 
I 7 HOH 152 752 179 HOH HOH A . 
I 7 HOH 153 753 181 HOH HOH A . 
I 7 HOH 154 754 184 HOH HOH A . 
I 7 HOH 155 755 185 HOH HOH A . 
I 7 HOH 156 756 186 HOH HOH A . 
I 7 HOH 157 757 187 HOH HOH A . 
I 7 HOH 158 758 188 HOH HOH A . 
I 7 HOH 159 759 189 HOH HOH A . 
I 7 HOH 160 760 190 HOH HOH A . 
I 7 HOH 161 761 191 HOH HOH A . 
I 7 HOH 162 762 192 HOH HOH A . 
I 7 HOH 163 763 194 HOH HOH A . 
I 7 HOH 164 764 195 HOH HOH A . 
I 7 HOH 165 765 196 HOH HOH A . 
I 7 HOH 166 766 197 HOH HOH A . 
I 7 HOH 167 767 198 HOH HOH A . 
I 7 HOH 168 768 199 HOH HOH A . 
I 7 HOH 169 769 200 HOH HOH A . 
I 7 HOH 170 770 201 HOH HOH A . 
I 7 HOH 171 771 202 HOH HOH A . 
I 7 HOH 172 772 203 HOH HOH A . 
I 7 HOH 173 773 205 HOH HOH A . 
I 7 HOH 174 774 207 HOH HOH A . 
I 7 HOH 175 775 208 HOH HOH A . 
I 7 HOH 176 776 209 HOH HOH A . 
I 7 HOH 177 777 210 HOH HOH A . 
I 7 HOH 178 778 211 HOH HOH A . 
I 7 HOH 179 779 212 HOH HOH A . 
I 7 HOH 180 780 213 HOH HOH A . 
I 7 HOH 181 781 214 HOH HOH A . 
I 7 HOH 182 782 215 HOH HOH A . 
I 7 HOH 183 783 216 HOH HOH A . 
I 7 HOH 184 784 218 HOH HOH A . 
I 7 HOH 185 785 219 HOH HOH A . 
I 7 HOH 186 786 220 HOH HOH A . 
I 7 HOH 187 787 221 HOH HOH A . 
I 7 HOH 188 788 222 HOH HOH A . 
I 7 HOH 189 789 223 HOH HOH A . 
I 7 HOH 190 790 226 HOH HOH A . 
I 7 HOH 191 791 227 HOH HOH A . 
I 7 HOH 192 792 228 HOH HOH A . 
I 7 HOH 193 793 230 HOH HOH A . 
I 7 HOH 194 794 231 HOH HOH A . 
I 7 HOH 195 795 232 HOH HOH A . 
I 7 HOH 196 796 233 HOH HOH A . 
I 7 HOH 197 797 234 HOH HOH A . 
I 7 HOH 198 798 235 HOH HOH A . 
I 7 HOH 199 799 236 HOH HOH A . 
I 7 HOH 200 800 237 HOH HOH A . 
I 7 HOH 201 801 238 HOH HOH A . 
I 7 HOH 202 802 239 HOH HOH A . 
I 7 HOH 203 803 240 HOH HOH A . 
I 7 HOH 204 804 241 HOH HOH A . 
I 7 HOH 205 805 242 HOH HOH A . 
I 7 HOH 206 806 243 HOH HOH A . 
I 7 HOH 207 807 244 HOH HOH A . 
I 7 HOH 208 808 245 HOH HOH A . 
I 7 HOH 209 809 246 HOH HOH A . 
I 7 HOH 210 810 248 HOH HOH A . 
I 7 HOH 211 811 249 HOH HOH A . 
I 7 HOH 212 812 250 HOH HOH A . 
I 7 HOH 213 813 251 HOH HOH A . 
I 7 HOH 214 814 253 HOH HOH A . 
I 7 HOH 215 815 254 HOH HOH A . 
I 7 HOH 216 816 257 HOH HOH A . 
I 7 HOH 217 817 258 HOH HOH A . 
I 7 HOH 218 818 260 HOH HOH A . 
I 7 HOH 219 819 262 HOH HOH A . 
I 7 HOH 220 820 263 HOH HOH A . 
I 7 HOH 221 821 264 HOH HOH A . 
I 7 HOH 222 822 266 HOH HOH A . 
I 7 HOH 223 823 267 HOH HOH A . 
I 7 HOH 224 824 268 HOH HOH A . 
I 7 HOH 225 825 269 HOH HOH A . 
I 7 HOH 226 826 271 HOH HOH A . 
I 7 HOH 227 827 272 HOH HOH A . 
I 7 HOH 228 828 273 HOH HOH A . 
I 7 HOH 229 829 274 HOH HOH A . 
I 7 HOH 230 830 275 HOH HOH A . 
I 7 HOH 231 831 276 HOH HOH A . 
I 7 HOH 232 832 279 HOH HOH A . 
I 7 HOH 233 833 280 HOH HOH A . 
I 7 HOH 234 834 281 HOH HOH A . 
I 7 HOH 235 835 282 HOH HOH A . 
I 7 HOH 236 836 285 HOH HOH A . 
I 7 HOH 237 837 286 HOH HOH A . 
I 7 HOH 238 838 288 HOH HOH A . 
I 7 HOH 239 839 289 HOH HOH A . 
I 7 HOH 240 840 291 HOH HOH A . 
I 7 HOH 241 841 292 HOH HOH A . 
I 7 HOH 242 842 293 HOH HOH A . 
I 7 HOH 243 843 294 HOH HOH A . 
I 7 HOH 244 844 295 HOH HOH A . 
I 7 HOH 245 845 297 HOH HOH A . 
I 7 HOH 246 846 298 HOH HOH A . 
I 7 HOH 247 847 299 HOH HOH A . 
I 7 HOH 248 848 300 HOH HOH A . 
I 7 HOH 249 849 301 HOH HOH A . 
I 7 HOH 250 850 302 HOH HOH A . 
I 7 HOH 251 851 303 HOH HOH A . 
I 7 HOH 252 852 305 HOH HOH A . 
I 7 HOH 253 853 306 HOH HOH A . 
I 7 HOH 254 854 307 HOH HOH A . 
I 7 HOH 255 855 310 HOH HOH A . 
I 7 HOH 256 856 311 HOH HOH A . 
I 7 HOH 257 857 312 HOH HOH A . 
I 7 HOH 258 858 313 HOH HOH A . 
I 7 HOH 259 859 314 HOH HOH A . 
I 7 HOH 260 860 315 HOH HOH A . 
I 7 HOH 261 861 316 HOH HOH A . 
I 7 HOH 262 862 318 HOH HOH A . 
I 7 HOH 263 863 319 HOH HOH A . 
I 7 HOH 264 864 320 HOH HOH A . 
I 7 HOH 265 865 322 HOH HOH A . 
I 7 HOH 266 866 326 HOH HOH A . 
I 7 HOH 267 867 330 HOH HOH A . 
I 7 HOH 268 868 331 HOH HOH A . 
I 7 HOH 269 869 332 HOH HOH A . 
I 7 HOH 270 870 333 HOH HOH A . 
I 7 HOH 271 871 334 HOH HOH A . 
I 7 HOH 272 872 335 HOH HOH A . 
I 7 HOH 273 873 336 HOH HOH A . 
I 7 HOH 274 874 340 HOH HOH A . 
I 7 HOH 275 875 341 HOH HOH A . 
I 7 HOH 276 876 342 HOH HOH A . 
I 7 HOH 277 877 343 HOH HOH A . 
I 7 HOH 278 878 344 HOH HOH A . 
I 7 HOH 279 879 346 HOH HOH A . 
I 7 HOH 280 880 348 HOH HOH A . 
I 7 HOH 281 881 350 HOH HOH A . 
I 7 HOH 282 882 355 HOH HOH A . 
I 7 HOH 283 883 356 HOH HOH A . 
I 7 HOH 284 884 358 HOH HOH A . 
I 7 HOH 285 885 359 HOH HOH A . 
I 7 HOH 286 886 361 HOH HOH A . 
I 7 HOH 287 887 362 HOH HOH A . 
I 7 HOH 288 888 363 HOH HOH A . 
I 7 HOH 289 889 366 HOH HOH A . 
I 7 HOH 290 890 367 HOH HOH A . 
I 7 HOH 291 891 368 HOH HOH A . 
I 7 HOH 292 892 369 HOH HOH A . 
I 7 HOH 293 893 372 HOH HOH A . 
I 7 HOH 294 894 373 HOH HOH A . 
I 7 HOH 295 895 378 HOH HOH A . 
I 7 HOH 296 896 379 HOH HOH A . 
I 7 HOH 297 897 380 HOH HOH A . 
I 7 HOH 298 898 381 HOH HOH A . 
I 7 HOH 299 899 383 HOH HOH A . 
I 7 HOH 300 900 385 HOH HOH A . 
I 7 HOH 301 901 387 HOH HOH A . 
I 7 HOH 302 902 389 HOH HOH A . 
I 7 HOH 303 903 390 HOH HOH A . 
I 7 HOH 304 904 392 HOH HOH A . 
I 7 HOH 305 905 398 HOH HOH A . 
I 7 HOH 306 906 403 HOH HOH A . 
I 7 HOH 307 907 405 HOH HOH A . 
I 7 HOH 308 908 408 HOH HOH A . 
I 7 HOH 309 909 410 HOH HOH A . 
I 7 HOH 310 910 411 HOH HOH A . 
I 7 HOH 311 911 413 HOH HOH A . 
I 7 HOH 312 912 414 HOH HOH A . 
I 7 HOH 313 913 415 HOH HOH A . 
I 7 HOH 314 914 416 HOH HOH A . 
I 7 HOH 315 915 417 HOH HOH A . 
I 7 HOH 316 916 418 HOH HOH A . 
I 7 HOH 317 917 420 HOH HOH A . 
I 7 HOH 318 918 421 HOH HOH A . 
I 7 HOH 319 919 422 HOH HOH A . 
I 7 HOH 320 920 423 HOH HOH A . 
I 7 HOH 321 921 424 HOH HOH A . 
I 7 HOH 322 922 425 HOH HOH A . 
I 7 HOH 323 923 426 HOH HOH A . 
I 7 HOH 324 924 427 HOH HOH A . 
I 7 HOH 325 925 428 HOH HOH A . 
I 7 HOH 326 926 429 HOH HOH A . 
I 7 HOH 327 927 432 HOH HOH A . 
I 7 HOH 328 928 433 HOH HOH A . 
I 7 HOH 329 929 434 HOH HOH A . 
I 7 HOH 330 930 435 HOH HOH A . 
I 7 HOH 331 931 436 HOH HOH A . 
I 7 HOH 332 932 437 HOH HOH A . 
I 7 HOH 333 933 438 HOH HOH A . 
I 7 HOH 334 934 439 HOH HOH A . 
I 7 HOH 335 935 440 HOH HOH A . 
I 7 HOH 336 936 441 HOH HOH A . 
I 7 HOH 337 937 442 HOH HOH A . 
I 7 HOH 338 938 443 HOH HOH A . 
I 7 HOH 339 939 444 HOH HOH A . 
I 7 HOH 340 940 446 HOH HOH A . 
I 7 HOH 341 941 449 HOH HOH A . 
I 7 HOH 342 942 450 HOH HOH A . 
I 7 HOH 343 943 452 HOH HOH A . 
I 7 HOH 344 944 453 HOH HOH A . 
I 7 HOH 345 945 454 HOH HOH A . 
I 7 HOH 346 946 455 HOH HOH A . 
I 7 HOH 347 947 456 HOH HOH A . 
I 7 HOH 348 948 457 HOH HOH A . 
I 7 HOH 349 949 458 HOH HOH A . 
I 7 HOH 350 950 459 HOH HOH A . 
I 7 HOH 351 951 460 HOH HOH A . 
I 7 HOH 352 952 461 HOH HOH A . 
I 7 HOH 353 953 462 HOH HOH A . 
I 7 HOH 354 954 463 HOH HOH A . 
I 7 HOH 355 955 464 HOH HOH A . 
I 7 HOH 356 956 468 HOH HOH A . 
I 7 HOH 357 957 469 HOH HOH A . 
I 7 HOH 358 958 470 HOH HOH A . 
I 7 HOH 359 959 471 HOH HOH A . 
I 7 HOH 360 960 472 HOH HOH A . 
I 7 HOH 361 961 473 HOH HOH A . 
I 7 HOH 362 962 474 HOH HOH A . 
I 7 HOH 363 963 476 HOH HOH A . 
I 7 HOH 364 964 477 HOH HOH A . 
I 7 HOH 365 965 479 HOH HOH A . 
I 7 HOH 366 966 480 HOH HOH A . 
I 7 HOH 367 967 481 HOH HOH A . 
I 7 HOH 368 968 483 HOH HOH A . 
I 7 HOH 369 969 484 HOH HOH A . 
I 7 HOH 370 970 485 HOH HOH A . 
I 7 HOH 371 971 486 HOH HOH A . 
I 7 HOH 372 972 488 HOH HOH A . 
I 7 HOH 373 973 489 HOH HOH A . 
I 7 HOH 374 974 490 HOH HOH A . 
I 7 HOH 375 975 491 HOH HOH A . 
I 7 HOH 376 976 492 HOH HOH A . 
I 7 HOH 377 977 496 HOH HOH A . 
I 7 HOH 378 978 497 HOH HOH A . 
I 7 HOH 379 979 498 HOH HOH A . 
I 7 HOH 380 980 499 HOH HOH A . 
I 7 HOH 381 981 500 HOH HOH A . 
I 7 HOH 382 982 501 HOH HOH A . 
I 7 HOH 383 983 502 HOH HOH A . 
I 7 HOH 384 984 503 HOH HOH A . 
I 7 HOH 385 985 176 HOH HOH A . 
J 7 HOH 1   101 102 HOH HOH T . 
J 7 HOH 2   102 122 HOH HOH T . 
J 7 HOH 3   103 126 HOH HOH T . 
J 7 HOH 4   104 130 HOH HOH T . 
J 7 HOH 5   105 158 HOH HOH T . 
J 7 HOH 6   106 171 HOH HOH T . 
J 7 HOH 7   107 180 HOH HOH T . 
J 7 HOH 8   108 193 HOH HOH T . 
J 7 HOH 9   109 204 HOH HOH T . 
J 7 HOH 10  110 217 HOH HOH T . 
J 7 HOH 11  111 229 HOH HOH T . 
J 7 HOH 12  112 255 HOH HOH T . 
J 7 HOH 13  113 256 HOH HOH T . 
J 7 HOH 14  114 259 HOH HOH T . 
J 7 HOH 15  115 283 HOH HOH T . 
J 7 HOH 16  116 287 HOH HOH T . 
J 7 HOH 17  117 317 HOH HOH T . 
J 7 HOH 18  118 324 HOH HOH T . 
J 7 HOH 19  119 353 HOH HOH T . 
J 7 HOH 20  120 370 HOH HOH T . 
J 7 HOH 21  121 375 HOH HOH T . 
J 7 HOH 22  122 376 HOH HOH T . 
J 7 HOH 23  123 377 HOH HOH T . 
J 7 HOH 24  124 406 HOH HOH T . 
J 7 HOH 25  125 431 HOH HOH T . 
J 7 HOH 26  126 447 HOH HOH T . 
J 7 HOH 27  127 465 HOH HOH T . 
J 7 HOH 28  128 466 HOH HOH T . 
J 7 HOH 29  129 467 HOH HOH T . 
J 7 HOH 30  130 475 HOH HOH T . 
J 7 HOH 31  131 478 HOH HOH T . 
J 7 HOH 32  132 495 HOH HOH T . 
K 7 HOH 1   101 40  HOH HOH P . 
K 7 HOH 2   102 69  HOH HOH P . 
K 7 HOH 3   103 74  HOH HOH P . 
K 7 HOH 4   104 84  HOH HOH P . 
K 7 HOH 5   105 109 HOH HOH P . 
K 7 HOH 6   106 113 HOH HOH P . 
K 7 HOH 7   107 115 HOH HOH P . 
K 7 HOH 8   108 139 HOH HOH P . 
K 7 HOH 9   109 163 HOH HOH P . 
K 7 HOH 10  110 173 HOH HOH P . 
K 7 HOH 11  111 225 HOH HOH P . 
K 7 HOH 12  112 247 HOH HOH P . 
K 7 HOH 13  113 261 HOH HOH P . 
K 7 HOH 14  114 284 HOH HOH P . 
K 7 HOH 15  115 327 HOH HOH P . 
K 7 HOH 16  116 337 HOH HOH P . 
K 7 HOH 17  117 349 HOH HOH P . 
K 7 HOH 18  118 351 HOH HOH P . 
K 7 HOH 19  119 352 HOH HOH P . 
K 7 HOH 20  120 360 HOH HOH P . 
K 7 HOH 21  121 364 HOH HOH P . 
K 7 HOH 22  122 371 HOH HOH P . 
K 7 HOH 23  123 445 HOH HOH P . 
K 7 HOH 24  124 448 HOH HOH P . 
K 7 HOH 25  125 482 HOH HOH P . 
K 7 HOH 26  126 493 HOH HOH P . 
K 7 HOH 27  127 494 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5600  ? 
1 MORE         -45   ? 
1 'SSA (A^2)'  21980 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O3G ? H DTP .   ? P DTP 502 ? 1_555 97.1  ? 
2  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 83.4  ? 
3  O3G ? H DTP .   ? P DTP 502 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 163.9 ? 
4  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O1B ? H DTP .   ? P DTP 502 ? 1_555 89.4  ? 
5  O3G ? H DTP .   ? P DTP 502 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O1B ? H DTP .   ? P DTP 502 ? 1_555 78.6  ? 
6  OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O1B ? H DTP .   ? P DTP 502 ? 1_555 85.3  ? 
7  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 94.8  ? 
8  O3G ? H DTP .   ? P DTP 502 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 103.3 ? 
9  OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 92.7  ? 
10 O1B ? H DTP .   ? P DTP 502 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 175.1 ? 
11 O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 502 ? 1_555 170.1 ? 
12 O3G ? H DTP .   ? P DTP 502 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 502 ? 1_555 83.7  ? 
13 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 502 ? 1_555 93.1  ? 
14 O1B ? H DTP .   ? P DTP 502 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 502 ? 1_555 81.1  ? 
15 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 502 ? 1_555 94.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 67.7151 -5.3069  -1.8122 0.0550 0.0260 0.0775 0.0140  0.0114  0.0197  0.7177 1.0194 0.5816  
-0.3760 -0.0419 -0.1964 0.0287  -0.0764 0.0056  0.0290  0.0187  -0.2232 -0.0649 0.0459  0.0492  
'X-RAY DIFFRACTION' 2 ? refined 48.3638 13.4932  11.0606 0.0905 0.0673 0.0544 0.0091  0.0055  0.0022  0.1284 0.2900 0.3309  0.0615 
0.0462  0.0781  0.0312  -0.0799 0.0046  -0.0872 -0.0135 0.0207  0.0208  -0.0772 -0.0073 
'X-RAY DIFFRACTION' 3 ? refined 51.6681 -22.3122 6.0808  0.1062 0.0963 0.1042 -0.0064 -0.0153 0.0003  0.1737 0.4065 0.5793  0.0364 
-0.0614 -0.1148 -0.0429 0.0014  -0.0251 -0.0172 0.0197  0.0728  -0.0621 0.1146  -0.1154 
'X-RAY DIFFRACTION' 4 ? refined 30.8042 5.7119   -7.7659 0.1105 0.2128 0.1256 0.0201  0.0084  -0.0497 0.4379 1.0737 0.8339  
-0.0629 0.2646  0.6459  0.0657  -0.2483 0.1101  0.0645  0.1233  0.2214  -0.1123 0.0258  -0.3477 
'X-RAY DIFFRACTION' 5 ? refined 38.0992 -3.0091  -0.3953 0.2629 0.2378 0.2158 -0.0530 -0.0301 0.0001  0.0931 0.0966 -0.0229 0.1043 
-0.0436 -0.0301 0.2838  -0.3190 -0.0009 -0.2060 -0.0574 -0.0167 -0.0038 0.0020  -0.5012 
'X-RAY DIFFRACTION' 6 ? refined 35.8892 -8.1571  -2.8204 0.2342 0.1855 0.1937 0.0188  -0.0506 -0.0072 0.0374 0.0435 0.0236  
-0.0448 0.0507  -0.0404 -0.0974 -0.0104 -0.0006 -0.2607 -0.0994 -0.2118 -0.3452 -0.2635 -0.1910 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A -2  A 15  '(chain A and (resid -2:15 or resid 88:239))' ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 A 88  A 239 '(chain A and (resid -2:15 or resid 88:239))' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 A 16  A 87  '(chain A and resid 16:87)'                   ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 3 A 240 A 306 '(chain A and resid 240:306)'                 ? ? ? ? ? 
'X-RAY DIFFRACTION' 5 4 A 307 A 432 '(chain A and resid 307:432)'                 ? ? ? ? ? 
'X-RAY DIFFRACTION' 6 5 T 1   T 12  '(chain T and resid 1:12)'                    ? ? ? ? ? 
'X-RAY DIFFRACTION' 7 6 P 1   P 8   '(chain P and resid 1:8)'                     ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 7 ? ? "C1'" T DG 7 ? ? N9    T DG 7 ? ? 110.16 108.30 1.86  0.30 N 
2 1 "O4'" T DC 9 ? ? "C1'" T DC 9 ? ? N1    T DC 9 ? ? 110.86 108.30 2.56  0.30 N 
3 1 "O4'" P DG 2 ? B "C1'" P DG 2 ? B N9    P DG 2 ? ? 110.59 108.30 2.29  0.30 N 
4 1 "O4'" P DA 7 ? ? "C4'" P DA 7 ? ? "C3'" P DA 7 ? ? 99.78  104.50 -4.72 0.40 N 
5 1 "O4'" P DA 7 ? ? "C1'" P DA 7 ? ? N9    P DA 7 ? ? 110.23 108.30 1.93  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 25.39   63.22   
2 1 TYR A 39  ? A 61.62   174.12  
3 1 TYR A 39  ? B 74.35   85.76   
4 1 LYS A 40  ? A -146.09 -26.70  
5 1 SER A 62  ? ? 85.70   -15.81  
6 1 ASP A 181 ? B 73.88   36.31   
7 1 LEU A 183 ? B -108.51 -167.65 
8 1 SER A 217 ? ? -155.63 -155.58 
9 1 SER A 257 ? ? 97.61   -12.87  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
6 1 Y 1 P DA  9   ? C DA  9   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ECQ 'double helix'        
4ECQ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 6  1_555 C DA 7 1_555 -0.076 -0.070 0.132  -2.875 -17.205 -0.053 1 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.158 -0.148 -0.242 -9.738 -3.544  -1.866 2 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.102  -0.094 -0.034 4.257  -1.579  0.389  3 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.176  -0.119 -0.330 11.162 -5.874  0.206  4 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.272 -0.165 -0.133 -2.169 -4.541  2.568  5 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.150  -0.113 0.093  -3.960 -1.095  -0.353 6 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.169 -0.197 -0.088 16.672 -1.595  5.823  7 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.207 -1.264 3.487 5.204  8.225 29.092 -4.031 1.429  2.948 15.825 -10.012 
30.644 1 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.516 -0.493 3.100 0.111  2.272 34.324 -1.167 0.888  3.060 3.844  -0.188  
34.397 2 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.495  -0.702 3.249 2.371  0.511 30.245 -1.443 -0.470 3.265 0.978  -4.535  
30.340 3 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.446 -0.543 3.767 -4.302 5.841 34.478 -1.895 0.003  3.657 9.721  7.160   
35.210 4 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.497 -0.633 3.456 -2.475 1.419 36.577 -1.211 0.431  3.455 2.257  3.937   
36.684 5 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.315  0.037  3.008 -1.676 2.215 26.072 -0.467 -1.109 2.974 4.892  3.702   
26.217 6 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                       CA  
5 GLYCEROL                            GOL 
6 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
7 water                               HOH 
#