data_4ECR
# 
_entry.id   4ECR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ECR         
NDB   NA1701       
RCSB  RCSB071453   
WWPDB D_1000071453 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ECR 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ECR 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ECR 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ?                                     ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    2   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 water       nat water                                                18.015    432 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ECR       4ECR   2 ? ? ? 
3 PDB 4ECR       4ECR   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ECR A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ECR T 1 ? 12  ? 4ECR   1 ? 12  ? 1 12  
3 3 4ECR P 1 ? 8   ? 4ECR   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ECR GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ECR PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ECR HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ECR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ECR 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.89 
_reflns.number_obs                   35861 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.08200 
_reflns.pdbx_netI_over_sigmaI        13.5000 
_reflns.B_iso_Wilson_estimate        16.570 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.90 
_reflns_shell.d_res_low                   1.93 
_reflns_shell.percent_possible_all        98.6 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.37200 
_reflns_shell.meanI_over_sigI_obs         2.900 
_reflns_shell.pdbx_redundancy             3.20 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ECR 
_refine.ls_number_reflns_obs                     35809 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.46 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.102 
_refine.ls_d_res_high                            1.892 
_refine.ls_percent_reflns_obs                    98.09 
_refine.ls_R_factor_obs                          0.1744 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1721 
_refine.ls_R_factor_R_free                       0.2164 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_number_reflns_R_free                  1794 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               22.0994 
_refine.aniso_B[1][1]                            0.2764 
_refine.aniso_B[2][2]                            0.2764 
_refine.aniso_B[3][3]                            -0.5529 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.329 
_refine.solvent_model_param_bsol                 31.389 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.22 
_refine.overall_FOM_work_R_set                   0.8583 
_refine.B_iso_max                                82.020 
_refine.B_iso_min                                4.590 
_refine.pdbx_overall_phase_error                 21.7400 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.210 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             432 
_refine_hist.number_atoms_total               4230 
_refine_hist.d_res_high                       1.892 
_refine_hist.d_res_low                        30.102 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4000 0.012  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5485 1.124  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     613  0.071  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      629  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1566 18.478 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.8922 1.9434  13 82.0000  2184 . 0.1963 0.2602 . 129 . 2313 . 'X-RAY DIFFRACTION' . 
1.9434 2.0006  13 99.0000  2619 . 0.1790 0.2314 . 140 . 2759 . 'X-RAY DIFFRACTION' . 
2.0006 2.0651  13 99.0000  2633 . 0.1853 0.2108 . 125 . 2758 . 'X-RAY DIFFRACTION' . 
2.0651 2.1389  13 99.0000  2643 . 0.1753 0.2705 . 134 . 2777 . 'X-RAY DIFFRACTION' . 
2.1389 2.2245  13 99.0000  2647 . 0.1757 0.2396 . 127 . 2774 . 'X-RAY DIFFRACTION' . 
2.2245 2.3257  13 99.0000  2636 . 0.1755 0.2478 . 127 . 2763 . 'X-RAY DIFFRACTION' . 
2.3257 2.4483  13 100.0000 2655 . 0.1816 0.2366 . 149 . 2804 . 'X-RAY DIFFRACTION' . 
2.4483 2.6016  13 100.0000 2654 . 0.1831 0.2393 . 142 . 2796 . 'X-RAY DIFFRACTION' . 
2.6016 2.8024  13 100.0000 2678 . 0.1846 0.2291 . 128 . 2806 . 'X-RAY DIFFRACTION' . 
2.8024 3.0841  13 100.0000 2642 . 0.1881 0.2334 . 147 . 2789 . 'X-RAY DIFFRACTION' . 
3.0841 3.5298  13 100.0000 2675 . 0.1655 0.2133 . 136 . 2811 . 'X-RAY DIFFRACTION' . 
3.5298 4.4449  13 100.0000 2660 . 0.1466 0.1666 . 156 . 2816 . 'X-RAY DIFFRACTION' . 
4.4449 30.1059 13 99.0000  2689 . 0.1550 0.1866 . 154 . 2843 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ECR 
_struct.title                     'Human DNA polymerase eta - DNA ternary complex: Reaction in the AT crystal at pH 7.0 for 40 sec' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ECR 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD2   B ? ? 1_555 D MG  . MG  ? ? A ASP 13  A MG  501 1_555 ? ? ? ? ? ? ?            2.103 ? 
metalc2  metalc ? ? D MG  .   MG    ? ? ? 1_555 I DTP . O2A ? ? A MG  501 P DTP 504 1_555 ? ? ? ? ? ? ?            2.161 ? 
metalc3  metalc ? ? D MG  .   MG    ? ? ? 1_555 J HOH . O   ? ? A MG  501 A HOH 601 1_555 ? ? ? ? ? ? ?            2.166 ? 
metalc4  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MG  . MG  ? ? A GLU 116 A MG  501 1_555 ? ? ? ? ? ? ?            2.182 ? 
metalc5  metalc ? ? A ASP 16  OD1   A ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.194 ? 
metalc6  metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D MG  . MG  ? ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.216 ? 
metalc7  metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1B ? ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.247 ? 
metalc8  metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O1B ? ? A MG  503 P DTP 504 1_555 ? ? ? ? ? ? ?            2.249 ? 
metalc9  metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O3G ? ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc10 metalc ? ? A ASP 16  OD1   B ? ? 1_555 F MG  . MG  B ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.265 ? 
metalc11 metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O3G ? ? A MG  503 P DTP 504 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc12 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D MG  . MG  ? ? A ASP 115 A MG  501 1_555 ? ? ? ? ? ? ?            2.271 ? 
metalc13 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F MG  . MG  B ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc14 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc15 metalc ? ? F MG  .   MG    B ? ? 1_555 I DTP . O2A ? ? A MG  503 P DTP 504 1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc16 metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc17 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O2A ? ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc18 metalc ? ? A MET 17  O     ? ? ? 1_555 F MG  . MG  B ? A MET 14  A MG  503 1_555 ? ? ? ? ? ? ?            2.337 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 0.45  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -1.42 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -9.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
A 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 503'  
AC4 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE DTP P 504' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 505' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4  AC1 8  CA  E .   ? CA  A 502 . ? 1_555 ? 
5  AC1 8  MG  F .   ? MG  A 503 . ? 1_555 ? 
6  AC1 8  HOH J .   ? HOH A 601 . ? 1_555 ? 
7  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8  AC1 8  DTP I .   ? DTP P 504 . ? 1_555 ? 
9  AC2 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 5  MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
12 AC2 5  MG  D .   ? MG  A 501 . ? 1_555 ? 
13 AC2 5  DTP I .   ? DTP P 504 . ? 1_555 ? 
14 AC3 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
15 AC3 5  MET A 17  ? MET A 14  . ? 1_555 ? 
16 AC3 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
17 AC3 5  MG  D .   ? MG  A 501 . ? 1_555 ? 
18 AC3 5  DTP I .   ? DTP P 504 . ? 1_555 ? 
19 AC4 26 ASP A 16  ? ASP A 13  . ? 1_555 ? 
20 AC4 26 MET A 17  ? MET A 14  . ? 1_555 ? 
21 AC4 26 ASP A 18  ? ASP A 15  . ? 1_555 ? 
22 AC4 26 CYS A 19  ? CYS A 16  . ? 1_555 ? 
23 AC4 26 PHE A 20  ? PHE A 17  . ? 1_555 ? 
24 AC4 26 PHE A 21  ? PHE A 18  . ? 1_555 ? 
25 AC4 26 ILE A 51  ? ILE A 48  . ? 1_555 ? 
26 AC4 26 ALA A 52  ? ALA A 49  . ? 1_555 ? 
27 AC4 26 TYR A 55  ? TYR A 52  . ? 1_555 ? 
28 AC4 26 ARG A 58  ? ARG A 55  . ? 1_555 ? 
29 AC4 26 ARG A 64  ? ARG A 61  . ? 1_555 ? 
30 AC4 26 ASP A 118 ? ASP A 115 . ? 1_555 ? 
31 AC4 26 LYS A 234 ? LYS A 231 . ? 1_555 ? 
32 AC4 26 MG  D .   ? MG  A 501 . ? 1_555 ? 
33 AC4 26 CA  E .   ? CA  A 502 . ? 1_555 ? 
34 AC4 26 MG  F .   ? MG  A 503 . ? 1_555 ? 
35 AC4 26 HOH J .   ? HOH A 601 . ? 1_555 ? 
36 AC4 26 HOH J .   ? HOH A 609 . ? 1_555 ? 
37 AC4 26 HOH J .   ? HOH A 643 . ? 1_555 ? 
38 AC4 26 HOH J .   ? HOH A 682 . ? 1_555 ? 
39 AC4 26 HOH J .   ? HOH A 722 . ? 1_555 ? 
40 AC4 26 HOH J .   ? HOH A 817 . ? 1_555 ? 
41 AC4 26 DT  C 8   ? DT  P 8   . ? 1_555 ? 
42 AC4 26 DT  B 3   ? DT  T 3   . ? 1_555 ? 
43 AC4 26 DT  B 4   ? DT  T 4   . ? 1_555 ? 
44 AC4 26 DA  B 5   ? DA  T 5   . ? 1_555 ? 
45 AC5 9  ARG A 27  ? ARG A 24  . ? 6_545 ? 
46 AC5 9  GLN A 28  ? GLN A 25  . ? 6_545 ? 
47 AC5 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
48 AC5 9  SER A 251 ? SER A 248 . ? 1_555 ? 
49 AC5 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
50 AC5 9  HOH J .   ? HOH A 606 . ? 1_555 ? 
51 AC5 9  HOH J .   ? HOH A 651 . ? 1_555 ? 
52 AC5 9  HOH J .   ? HOH A 660 . ? 1_555 ? 
53 AC5 9  HOH J .   ? HOH A 841 . ? 1_555 ? 
54 AC6 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
55 AC6 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
56 AC6 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
57 AC6 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
58 AC6 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
59 AC6 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
60 AC6 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
61 AC6 10 HOH J .   ? HOH A 802 . ? 5_664 ? 
62 AC6 10 HOH J .   ? HOH A 825 . ? 5_664 ? 
63 AC6 10 HOH J .   ? HOH A 915 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ECR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ECR 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.919 -34.128 -3.349  1.00 40.57 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.326 -33.969 -3.682  1.00 44.41 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.607 -33.011 -4.830  1.00 43.13 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.263 -31.830 -4.756  1.00 45.95 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.242 -33.522 -5.900  1.00 42.46 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.665 -32.745 -7.076  1.00 43.59 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.505 -32.214 -7.926  1.00 44.06 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.677 -31.237 -8.660  1.00 49.39 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.493 -33.755 -7.883  1.00 43.02 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.973 -35.089 -7.463  1.00 44.89 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.618 -34.942 -6.012  1.00 41.80 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.341 -32.846 -7.823  1.00 37.81 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.170 -32.435 -8.597  1.00 45.07 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.229 -31.524 -7.811  1.00 45.26 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.254 -31.004 -8.361  1.00 41.94 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.401 -33.666 -9.091  1.00 36.29 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.269 -34.691 -9.748  1.00 36.12 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.980 -34.435 -10.902 1.00 33.85 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.547 -35.973 -9.411  1.00 31.14 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.658 -35.515 -11.248 1.00 33.27 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.412 -36.462 -10.360 1.00 32.33 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.524 -31.336 -6.527  1.00 43.52 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.659 -30.546 -5.653  1.00 47.92 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.901 -29.041 -5.807  1.00 41.61 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.874 -28.499 -5.278  1.00 40.05 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.842 -30.969 -4.190  1.00 51.52 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.713 -30.527 -3.266  1.00 54.35 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.135 -31.319 -3.655  1.00 66.70 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.467 -33.008 -3.154  1.00 51.00 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 63.006 -28.374 -6.533  1.00 46.65 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.115 -26.934 -6.754  1.00 40.05 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.139 -26.180 -5.422  1.00 35.60 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.498 -26.590 -4.456  1.00 38.33 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.984 -26.440 -7.641  1.00 36.28 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.889 -25.084 -5.375  1.00 27.62 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.133 -24.379 -4.119  1.00 28.05 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.666 -22.926 -4.160  1.00 22.90 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.930 -22.158 -3.233  1.00 25.12 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.618 -24.393 -3.777  1.00 25.01 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.352 -23.776 -4.845  1.00 27.34 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.104 -25.827 -3.591  1.00 26.22 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.980 -22.555 -5.239  1.00 23.18 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.455 -21.207 -5.381  1.00 24.79 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.524 -20.132 -5.285  1.00 22.85 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.347 -19.128 -4.585  1.00 20.64 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.641 -20.345 -5.980  1.00 14.82 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.757 -19.394 -5.940  1.00 15.16 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.074 -18.815 -7.321  1.00 15.59 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.165 -18.295 -7.551  1.00 16.03 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.000 -20.068 -5.365  1.00 14.66 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.979 -20.199 -3.840  1.00 17.96 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.165 -20.987 -3.329  1.00 16.90 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 69.050 -20.453 -2.655  1.00 20.71 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.199 -22.267 -3.663  1.00 18.69 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.099 -18.908 -8.221  1.00 19.26 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.250 -18.537 -9.622  1.00 21.21 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.249 -17.024 -9.881  1.00 20.11 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.810 -16.574 -10.870 1.00 19.79 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.140 -19.200 -10.463 1.00 25.00 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.739 -19.042 -9.837  1.00 31.01 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.554 -19.399 -8.650  1.00 28.71 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.812 -18.559 -10.530 1.00 37.28 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.623 -16.249 -9.001  1.00 17.44 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.454 -14.807 -9.220  1.00 16.91 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.065 -13.972 -8.113  1.00 12.45 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.246 -14.445 -6.991  1.00 12.13 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.971 -14.446 -9.257  1.00 14.15 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.149 -15.097 -10.349 1.00 18.27 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.685 -14.683 -10.210 1.00 13.61 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.003 -15.360 -9.103  1.00 14.65 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.925 -14.876 -8.487  1.00 15.11 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.347 -15.555 -7.498  1.00 9.51  ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.416 -13.711 -8.866  1.00 11.43 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.348 -12.708 -8.415  1.00 10.10 ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.621 -11.740 -7.360  1.00 6.83  ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.500 -10.703 -7.389  1.00 10.11 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.270 -10.069 -8.419  1.00 10.24 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.996 -11.051 -7.520  1.00 8.33  ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.222 -10.046 -6.395  1.00 9.51  ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.115 -12.077 -7.547  1.00 7.46  ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.791 -10.546 -6.270  1.00 7.29  ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.614 -9.685  -6.229  1.00 7.36  ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.758 -8.725  -5.059  1.00 12.21 ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.201 -9.120  -3.984  1.00 9.33  ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.323 -10.509 -6.018  1.00 8.27  ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.134 -9.606  -5.734  1.00 8.95  ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.043 -11.421 -7.220  1.00 8.65  ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.403 -7.463  -5.259  1.00 9.25  ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.430 -6.510  -4.155  1.00 8.89  ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.074 -5.877  -3.945  1.00 8.72  ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.254 -5.819  -4.865  1.00 10.30 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.501 -5.431  -4.387  1.00 8.44  ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.834 -5.414  -2.725  1.00 5.46  ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.647 -4.642  -2.433  1.00 8.37  ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.117 -3.354  -1.767  1.00 12.76 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.762 -3.391  -0.709  1.00 9.29  ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.711 -5.412  -1.506  1.00 6.47  ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.364 -4.791  -1.099  1.00 14.73 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.529 -3.834  0.075   1.00 11.83 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.675 -4.094  -2.273  1.00 13.51 ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.824 -2.225  -2.407  1.00 8.93  ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.204 -0.933  -1.870  1.00 7.68  ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.966 -0.277  -1.291  1.00 11.73 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.958 -0.165  -1.977  1.00 10.18 ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.798 -0.023  -2.957  1.00 9.41  ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.087 1.362   -2.381  1.00 10.29 ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 62.062 -0.653  -3.534  1.00 15.90 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.046 0.143   -0.026  1.00 8.61  ? 13  ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 57.925 0.677   0.737   0.25 10.42 ? 13  ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 57.887 0.771   0.621   0.75 10.32 ? 13  ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.293 2.060   1.324   1.00 9.30  ? 13  ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.222 2.113   2.126   1.00 7.64  ? 13  ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.576 -0.303  1.859   0.25 10.91 ? 13  ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.265 -0.154  1.655   0.75 11.25 ? 13  ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.151 -0.144  2.350   0.25 14.04 ? 13  ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.178 0.544   2.451   0.75 12.37 ? 13  ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 55.816 0.945   2.863   0.25 12.22 ? 13  ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 56.498 1.169   3.466   0.75 14.93 ? 13  ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 55.366 -1.107  2.225   0.25 17.42 ? 13  ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 55.009 0.509   2.033   0.75 16.50 ? 13  ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.592 3.144   0.976   1.00 9.63  ? 14  MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 57.946 4.470   1.513   1.00 10.81 ? 14  MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.717 4.515   3.028   1.00 9.32  ? 14  MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.762 3.945   3.527   1.00 9.50  ? 14  MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.130 5.578   0.844   1.00 10.00 ? 14  MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.142 5.527   -0.681  1.00 8.18  ? 14  MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.817 5.493   -1.332  1.00 13.50 ? 14  MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.439 7.079   -0.849  1.00 12.71 ? 14  MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.599 5.176   3.761   1.00 6.75  ? 15  ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.393 5.299   5.200   1.00 11.09 ? 15  ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.301 6.344   5.492   1.00 13.34 ? 15  ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.273 7.406   4.868   1.00 9.38  ? 15  ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.695 5.673   5.905   1.00 10.00 ? 15  ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.786 4.604   5.757   1.00 11.66 ? 15  ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.482 3.400   5.670   1.00 10.70 ? 15  ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 61.970 4.977   5.746   1.00 13.93 ? 15  ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.421 6.038   6.445   1.00 9.47  ? 16  CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.307 6.919   6.826   1.00 10.83 ? 16  CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.951 7.895   5.714   1.00 8.61  ? 16  CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.143 9.099   5.849   1.00 6.12  ? 16  CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.612 7.671   8.127   1.00 10.54 ? 16  CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.145 8.606   8.176   1.00 13.72 ? 16  CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.419 7.363   4.620   1.00 6.35  ? 17  PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.416 8.076   3.355   1.00 8.53  ? 17  PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.700 9.437   3.359   1.00 7.03  ? 17  PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.310 10.440  3.017   1.00 5.11  ? 17  PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.894 7.182   2.222   1.00 6.54  ? 17  PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 53.942 7.830   0.874   1.00 8.44  ? 17  PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.098 8.461   0.431   1.00 8.40  ? 17  PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.827 7.818   0.050   1.00 11.34 ? 17  PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.137 9.067   -0.828  1.00 11.83 ? 17  PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.857 8.412   -1.201  1.00 12.07 ? 17  PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 54.011 9.039   -1.642  1.00 10.42 ? 17  PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.426 9.478   3.739   1.00 4.74  ? 18  PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.692 10.746  3.686   1.00 6.01  ? 18  PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.371 11.799  4.576   1.00 7.04  ? 18  PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.354 12.997  4.275   1.00 6.55  ? 18  PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.233 10.584  4.116   1.00 5.91  ? 18  PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.367 9.871   3.113   1.00 6.86  ? 18  PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 49.926 9.168   2.061   1.00 7.14  ? 18  PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 47.985 9.913   3.229   1.00 7.79  ? 18  PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.120 8.506   1.138   1.00 7.10  ? 18  PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.166 9.259   2.311   1.00 8.63  ? 18  PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.745 8.552   1.258   1.00 8.57  ? 18  PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.935 11.351  5.693   1.00 7.53  ? 19  VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.672 12.248  6.579   1.00 6.24  ? 19  VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.894 12.865  5.885   1.00 6.90  ? 19  VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.119 14.081  5.972   1.00 4.85  ? 19  VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.114 11.529  7.875   1.00 5.44  ? 19  VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.122 12.368  8.635   1.00 7.56  ? 19  VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.903 11.218  8.751   1.00 7.67  ? 19  VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.685 12.044  5.197   1.00 5.79  ? 20  GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.845 12.582  4.484   1.00 7.27  ? 20  GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.435 13.598  3.414   1.00 6.30  ? 20  GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.159 14.587  3.171   1.00 8.48  ? 20  GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.635 11.466  3.810   1.00 6.94  ? 20  GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.489 10.614  4.749   1.00 9.42  ? 20  GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.578 9.902   3.985   1.00 11.72 ? 20  GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.649 10.457  3.786   1.00 12.02 ? 20  GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.298 8.673   3.516   1.00 11.68 ? 20  GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.312 13.341  2.748   1.00 4.59  ? 21  VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.803 14.282  1.727   1.00 4.64  ? 21  VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.524 15.641  2.378   1.00 7.24  ? 21  VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.929 16.688  1.868   1.00 6.54  ? 21  VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.524 13.742  0.999   1.00 5.64  ? 21  VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.934 14.792  0.019   1.00 6.05  ? 21  VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.850 12.455  0.258   1.00 5.16  ? 21  VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.833 15.615  3.513   1.00 6.06  ? 22  GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.533 16.851  4.236   1.00 8.39  ? 22  GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.793 17.516  4.802   1.00 7.04  ? 22  GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.878 18.746  4.861   1.00 7.39  ? 22  GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.486 16.611  5.336   1.00 4.89  ? 22  GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.141 16.130  4.826   1.00 6.25  ? 22  GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.419 17.168  3.956   1.00 10.99 ? 22  GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.638 18.382  4.155   1.00 11.29 ? 22  GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.637 16.763  3.073   1.00 13.33 ? 22  GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.770 16.712  5.222   1.00 7.16  ? 23  GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.008 17.240  5.804   1.00 6.78  ? 23  GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.908 17.881  4.749   1.00 8.28  ? 23  GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.608 18.854  5.014   1.00 8.15  ? 23  GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.784 16.122  6.497   1.00 7.85  ? 23  GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.204 15.734  7.850   1.00 8.14  ? 23  GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.945 14.575  8.479   1.00 11.25 ? 23  GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.384 13.663  7.782   1.00 10.09 ? 23  GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.112 14.616  9.798   1.00 11.58 ? 23  GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.888 17.330  3.548   1.00 6.02  ? 24  ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.627 17.955  2.456   1.00 10.66 ? 24  ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.081 19.352  2.183   1.00 8.73  ? 24  ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.838 20.296  1.976   1.00 8.02  ? 24  ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.527 17.125  1.183   1.00 7.36  ? 24  ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.383 17.720  0.041   1.00 11.17 ? 24  ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.431 16.797  -1.174  1.00 10.63 ? 24  ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.139 16.737  -1.847  1.00 9.77  ? 24  ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 57.932 16.125  -3.007  1.00 8.56  ? 24  ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 58.937 15.528  -3.633  1.00 6.80  ? 24  ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.722 16.128  -3.548  1.00 12.63 ? 24  ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.755 19.469  2.184   1.00 6.99  ? 25  GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.078 20.726  1.854   1.00 11.79 ? 25  GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.209 21.756  2.973   1.00 10.51 ? 25  GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.329 22.958  2.720   1.00 9.08  ? 25  GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.590 20.466  1.562   1.00 10.75 ? 25  GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.774 21.721  1.191   1.00 13.27 ? 25  GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.272 21.431  0.977   1.00 17.90 ? 25  GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 51.896 20.361  0.515   1.00 18.12 ? 25  GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.423 22.395  1.321   1.00 22.96 ? 25  GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.177 21.284  4.213   1.00 7.79  ? 26  ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.225 22.173  5.365   1.00 12.55 ? 26  ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.377 21.791  6.282   1.00 11.30 ? 26  ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.245 20.916  7.142   1.00 11.12 ? 26  ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.881 22.178  6.117   1.00 13.13 ? 26  ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.898 23.092  7.357   1.00 15.05 ? 26  ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 55.897 23.745  7.642   1.00 11.21 ? 26  ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.786 23.134  8.084   1.00 15.40 ? 26  ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.533 22.435  6.088   1.00 9.10  ? 27  PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.730 22.092  6.859   1.00 12.74 ? 27  PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.530 22.140  8.375   1.00 14.12 ? 27  PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.269 21.460  9.091   1.00 12.18 ? 27  PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.735 23.169  6.432   1.00 14.79 ? 27  PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.304 23.535  5.040   1.00 14.51 ? 27  PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.802 23.469  5.072   1.00 11.96 ? 27  PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.567 22.928  8.853   1.00 13.37 ? 28  HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.282 22.998  10.290  1.00 17.51 ? 28  HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.868 21.639  10.846  1.00 17.54 ? 28  HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 57.915 21.422  12.058  1.00 19.66 ? 28  HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.172 24.011  10.593  1.00 17.99 ? 28  HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.628 25.435  10.555  1.00 23.53 ? 28  HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 56.961 26.410  9.844   1.00 27.36 ? 28  HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.689 26.047  11.132  1.00 25.93 ? 28  HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.588 27.563  9.991   1.00 33.83 ? 28  HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.641 27.371  10.766  1.00 29.25 ? 28  HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.434 20.735  9.972   1.00 12.37 ? 29  LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 56.985 19.414  10.429  1.00 11.55 ? 29  LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.126 18.385  10.454  1.00 14.21 ? 29  LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 57.965 17.287  10.981  1.00 10.71 ? 29  LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.837 18.891  9.565   1.00 9.03  ? 29  LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.567 19.746  9.491   1.00 12.96 ? 29  LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.526 19.095  8.580   1.00 11.71 ? 29  LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 53.984 20.016  10.870  1.00 14.95 ? 29  LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.271 18.737  9.875   1.00 10.19 ? 30  ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.372 17.786  9.727   1.00 10.10 ? 30  ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 60.985 17.401  11.062  1.00 14.89 ? 30  ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.160 18.248  11.941  1.00 11.03 ? 30  ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.456 18.349  8.797   1.00 12.14 ? 30  ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 60.947 18.615  7.398   1.00 13.70 ? 30  ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 62.012 19.168  6.473   1.00 13.79 ? 30  ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.441 19.520  5.168   1.00 14.86 ? 30  ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.153 19.984  4.147   1.00 15.88 ? 30  ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.464 20.143  4.272   1.00 16.30 ? 30  ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.556 20.290  3.006   1.00 9.90  ? 30  ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.302 16.115  11.198  1.00 13.93 ? 31  ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.932 15.591  12.408  1.00 18.66 ? 31  ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.100 15.886  13.646  1.00 21.68 ? 31  ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.643 16.195  14.711  1.00 24.42 ? 31  ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.341 16.173  12.582  1.00 22.33 ? 31  ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.226 15.938  11.367  1.00 23.39 ? 31  ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.497 14.796  10.986  1.00 29.84 ? 31  ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.677 17.024  10.749  1.00 28.33 ? 31  ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.779 15.809  13.494  1.00 12.96 ? 32  LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.863 16.045  14.600  1.00 11.58 ? 32  LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.898 14.882  14.727  1.00 13.56 ? 32  LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.625 14.206  13.745  1.00 12.93 ? 32  LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.059 17.326  14.365  1.00 14.85 ? 32  LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 58.910 18.596  14.359  1.00 18.62 ? 32  LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 59.199 19.049  15.781  1.00 31.22 ? 32  LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 60.302 20.106  15.822  1.00 35.85 ? 32  LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 60.223 21.040  14.665  1.00 32.75 ? 32  LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.374 14.655  15.939  1.00 13.78 ? 33  PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.225 13.761  16.095  1.00 10.33 ? 33  PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.064 14.422  15.369  1.00 11.32 ? 33  PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.599 15.498  15.756  1.00 8.79  ? 33  PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.974 13.775  17.601  1.00 15.36 ? 33  PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.563 15.053  18.079  1.00 19.97 ? 33  PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.762 15.289  17.209  1.00 17.64 ? 33  PRO A CD    1 
ATOM   294  N  N     . CYS A 1 37  ? 54.609 13.792  14.303  1.00 10.53 ? 34  CYS A N     1 
ATOM   295  C  CA    A CYS A 1 37  ? 53.639 14.391  13.399  0.37 9.51  ? 34  CYS A CA    1 
ATOM   296  C  CA    B CYS A 1 37  ? 53.531 14.379  13.540  0.63 9.43  ? 34  CYS A CA    1 
ATOM   297  C  C     . CYS A 1 37  ? 52.717 13.301  12.859  1.00 9.51  ? 34  CYS A C     1 
ATOM   298  O  O     . CYS A 1 37  ? 53.154 12.161  12.705  1.00 8.02  ? 34  CYS A O     1 
ATOM   299  C  CB    A CYS A 1 37  ? 54.406 15.084  12.262  0.37 11.04 ? 34  CYS A CB    1 
ATOM   300  C  CB    B CYS A 1 37  ? 54.073 15.399  12.537  0.63 11.51 ? 34  CYS A CB    1 
ATOM   301  S  SG    A CYS A 1 37  ? 53.439 15.689  10.860  0.37 9.29  ? 34  CYS A SG    1 
ATOM   302  S  SG    B CYS A 1 37  ? 55.146 14.687  11.299  0.63 12.52 ? 34  CYS A SG    1 
ATOM   303  N  N     . ALA A 1 38  ? 51.478 13.654  12.538  1.00 7.31  ? 35  ALA A N     1 
ATOM   304  C  CA    . ALA A 1 38  ? 50.555 12.710  11.940  1.00 6.34  ? 35  ALA A CA    1 
ATOM   305  C  C     . ALA A 1 38  ? 49.747 13.429  10.876  1.00 7.87  ? 35  ALA A C     1 
ATOM   306  O  O     . ALA A 1 38  ? 49.653 14.656  10.898  1.00 9.82  ? 35  ALA A O     1 
ATOM   307  C  CB    . ALA A 1 38  ? 49.646 12.118  12.978  1.00 6.52  ? 35  ALA A CB    1 
ATOM   308  N  N     . VAL A 1 39  ? 49.164 12.653  9.962   1.00 6.96  ? 36  VAL A N     1 
ATOM   309  C  CA    . VAL A 1 39  ? 48.285 13.187  8.939   1.00 6.21  ? 36  VAL A CA    1 
ATOM   310  C  C     . VAL A 1 39  ? 46.887 12.720  9.299   1.00 11.03 ? 36  VAL A C     1 
ATOM   311  O  O     . VAL A 1 39  ? 46.687 11.548  9.630   1.00 10.47 ? 36  VAL A O     1 
ATOM   312  C  CB    . VAL A 1 39  ? 48.681 12.665  7.551   1.00 6.92  ? 36  VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 39  ? 47.604 13.009  6.507   1.00 8.40  ? 36  VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 39  ? 50.069 13.221  7.161   1.00 6.50  ? 36  VAL A CG2   1 
ATOM   315  N  N     . VAL A 1 40  ? 45.933 13.644  9.266   1.00 8.27  ? 37  VAL A N     1 
ATOM   316  C  CA    . VAL A 1 40  ? 44.575 13.381  9.731   1.00 9.62  ? 37  VAL A CA    1 
ATOM   317  C  C     . VAL A 1 40  ? 43.563 13.747  8.647   1.00 13.72 ? 37  VAL A C     1 
ATOM   318  O  O     . VAL A 1 40  ? 43.817 14.639  7.831   1.00 13.80 ? 37  VAL A O     1 
ATOM   319  C  CB    . VAL A 1 40  ? 44.250 14.235  11.001  1.00 14.89 ? 37  VAL A CB    1 
ATOM   320  C  CG1   A VAL A 1 40  ? 45.164 13.848  12.158  0.56 11.60 ? 37  VAL A CG1   1 
ATOM   321  C  CG1   B VAL A 1 40  ? 44.087 15.703  10.632  0.44 12.86 ? 37  VAL A CG1   1 
ATOM   322  C  CG2   A VAL A 1 40  ? 44.339 15.723  10.693  0.56 12.83 ? 37  VAL A CG2   1 
ATOM   323  C  CG2   B VAL A 1 40  ? 43.021 13.732  11.692  0.44 12.81 ? 37  VAL A CG2   1 
ATOM   324  N  N     . GLN A 1 41  ? 42.416 13.073  8.616   1.00 11.50 ? 38  GLN A N     1 
ATOM   325  C  CA    . GLN A 1 41  ? 41.358 13.542  7.719   1.00 13.80 ? 38  GLN A CA    1 
ATOM   326  C  C     . GLN A 1 41  ? 40.118 13.955  8.490   1.00 13.56 ? 38  GLN A C     1 
ATOM   327  O  O     . GLN A 1 41  ? 39.721 13.288  9.446   1.00 10.90 ? 38  GLN A O     1 
ATOM   328  C  CB    . GLN A 1 41  ? 41.061 12.584  6.550   1.00 17.70 ? 38  GLN A CB    1 
ATOM   329  C  CG    . GLN A 1 41  ? 40.579 11.226  6.930   1.00 21.49 ? 38  GLN A CG    1 
ATOM   330  C  CD    . GLN A 1 41  ? 40.732 10.205  5.798   1.00 18.74 ? 38  GLN A CD    1 
ATOM   331  O  OE1   . GLN A 1 41  ? 41.163 10.523  4.674   1.00 17.46 ? 38  GLN A OE1   1 
ATOM   332  N  NE2   . GLN A 1 41  ? 40.376 8.971   6.098   1.00 19.39 ? 38  GLN A NE2   1 
ATOM   333  N  N     . TYR A 1 42  ? 39.547 15.085  8.079   1.00 11.32 ? 39  TYR A N     1 
ATOM   334  C  CA    . TYR A 1 42  ? 38.410 15.690  8.761   1.00 14.25 ? 39  TYR A CA    1 
ATOM   335  C  C     . TYR A 1 42  ? 38.924 16.189  10.114  1.00 21.38 ? 39  TYR A C     1 
ATOM   336  O  O     . TYR A 1 42  ? 40.117 16.064  10.401  1.00 22.29 ? 39  TYR A O     1 
ATOM   337  C  CB    . TYR A 1 42  ? 37.246 14.708  8.843   1.00 15.08 ? 39  TYR A CB    1 
ATOM   338  C  CG    . TYR A 1 42  ? 36.834 14.214  7.463   1.00 15.21 ? 39  TYR A CG    1 
ATOM   339  C  CD1   . TYR A 1 42  ? 36.551 15.113  6.442   1.00 14.32 ? 39  TYR A CD1   1 
ATOM   340  C  CD2   . TYR A 1 42  ? 36.781 12.849  7.167   1.00 16.20 ? 39  TYR A CD2   1 
ATOM   341  C  CE1   . TYR A 1 42  ? 36.185 14.670  5.165   1.00 16.62 ? 39  TYR A CE1   1 
ATOM   342  C  CE2   . TYR A 1 42  ? 36.423 12.397  5.892   1.00 13.63 ? 39  TYR A CE2   1 
ATOM   343  C  CZ    . TYR A 1 42  ? 36.125 13.313  4.902   1.00 14.97 ? 39  TYR A CZ    1 
ATOM   344  O  OH    . TYR A 1 42  ? 35.755 12.862  3.649   1.00 14.27 ? 39  TYR A OH    1 
ATOM   345  N  N     . LYS A 1 43  ? 38.072 16.793  10.925  1.00 23.13 ? 40  LYS A N     1 
ATOM   346  C  CA    . LYS A 1 43  ? 38.592 17.498  12.100  1.00 22.98 ? 40  LYS A CA    1 
ATOM   347  C  C     . LYS A 1 43  ? 37.548 17.615  13.174  1.00 26.16 ? 40  LYS A C     1 
ATOM   348  O  O     . LYS A 1 43  ? 37.863 17.609  14.364  1.00 22.49 ? 40  LYS A O     1 
ATOM   349  C  CB    . LYS A 1 43  ? 39.072 18.899  11.705  1.00 28.39 ? 40  LYS A CB    1 
ATOM   350  C  CG    . LYS A 1 43  ? 40.141 19.490  12.624  1.00 34.48 ? 40  LYS A CG    1 
ATOM   351  C  CD    . LYS A 1 43  ? 41.540 19.248  12.053  1.00 34.01 ? 40  LYS A CD    1 
ATOM   352  C  CE    . LYS A 1 43  ? 42.500 18.647  13.074  1.00 34.84 ? 40  LYS A CE    1 
ATOM   353  N  NZ    . LYS A 1 43  ? 42.739 19.534  14.243  1.00 30.16 ? 40  LYS A NZ    1 
ATOM   354  N  N     . SER A 1 44  ? 36.299 17.712  12.740  1.00 20.85 ? 41  SER A N     1 
ATOM   355  C  CA    . SER A 1 44  ? 35.194 17.995  13.638  1.00 25.31 ? 41  SER A CA    1 
ATOM   356  C  C     . SER A 1 44  ? 34.942 16.862  14.608  1.00 27.53 ? 41  SER A C     1 
ATOM   357  O  O     . SER A 1 44  ? 34.726 17.094  15.796  1.00 28.36 ? 41  SER A O     1 
ATOM   358  C  CB    . SER A 1 44  ? 33.936 18.289  12.827  1.00 31.15 ? 41  SER A CB    1 
ATOM   359  O  OG    . SER A 1 44  ? 34.161 19.417  12.006  1.00 33.68 ? 41  SER A OG    1 
ATOM   360  N  N     . TRP A 1 45  ? 34.960 15.634  14.103  1.00 23.53 ? 42  TRP A N     1 
ATOM   361  C  CA    . TRP A 1 45  ? 34.734 14.479  14.959  1.00 22.42 ? 42  TRP A CA    1 
ATOM   362  C  C     . TRP A 1 45  ? 36.047 14.048  15.608  1.00 22.62 ? 42  TRP A C     1 
ATOM   363  O  O     . TRP A 1 45  ? 36.912 13.446  14.961  1.00 18.86 ? 42  TRP A O     1 
ATOM   364  C  CB    . TRP A 1 45  ? 34.102 13.326  14.174  1.00 24.97 ? 42  TRP A CB    1 
ATOM   365  C  CG    . TRP A 1 45  ? 33.652 12.166  15.024  1.00 27.67 ? 42  TRP A CG    1 
ATOM   366  C  CD1   . TRP A 1 45  ? 34.359 11.033  15.306  1.00 25.35 ? 42  TRP A CD1   1 
ATOM   367  C  CD2   . TRP A 1 45  ? 32.390 12.024  15.682  1.00 31.35 ? 42  TRP A CD2   1 
ATOM   368  N  NE1   . TRP A 1 45  ? 33.618 10.199  16.105  1.00 31.36 ? 42  TRP A NE1   1 
ATOM   369  C  CE2   . TRP A 1 45  ? 32.403 10.782  16.348  1.00 31.71 ? 42  TRP A CE2   1 
ATOM   370  C  CE3   . TRP A 1 45  ? 31.247 12.828  15.772  1.00 34.40 ? 42  TRP A CE3   1 
ATOM   371  C  CZ2   . TRP A 1 45  ? 31.321 10.324  17.099  1.00 34.27 ? 42  TRP A CZ2   1 
ATOM   372  C  CZ3   . TRP A 1 45  ? 30.171 12.372  16.516  1.00 33.44 ? 42  TRP A CZ3   1 
ATOM   373  C  CH2   . TRP A 1 45  ? 30.215 11.131  17.169  1.00 33.16 ? 42  TRP A CH2   1 
ATOM   374  N  N     . LYS A 1 46  ? 36.187 14.397  16.884  1.00 23.98 ? 43  LYS A N     1 
ATOM   375  C  CA    . LYS A 1 46  ? 37.301 13.962  17.723  1.00 20.35 ? 43  LYS A CA    1 
ATOM   376  C  C     . LYS A 1 46  ? 38.671 14.392  17.208  1.00 19.27 ? 43  LYS A C     1 
ATOM   377  O  O     . LYS A 1 46  ? 39.670 13.715  17.452  1.00 16.48 ? 43  LYS A O     1 
ATOM   378  C  CB    . LYS A 1 46  ? 37.252 12.444  17.933  1.00 22.84 ? 43  LYS A CB    1 
ATOM   379  C  CG    . LYS A 1 46  ? 36.024 11.955  18.707  1.00 28.24 ? 43  LYS A CG    1 
ATOM   380  C  CD    . LYS A 1 46  ? 35.977 10.432  18.766  1.00 27.48 ? 43  LYS A CD    1 
ATOM   381  C  CE    . LYS A 1 46  ? 34.822 9.920   19.613  1.00 35.77 ? 43  LYS A CE    1 
ATOM   382  N  NZ    . LYS A 1 46  ? 35.082 10.130  21.066  1.00 44.34 ? 43  LYS A NZ    1 
ATOM   383  N  N     . GLY A 1 47  ? 38.705 15.522  16.502  1.00 15.15 ? 44  GLY A N     1 
ATOM   384  C  CA    . GLY A 1 47  ? 39.938 16.099  15.998  1.00 16.04 ? 44  GLY A CA    1 
ATOM   385  C  C     . GLY A 1 47  ? 40.414 15.474  14.696  1.00 14.49 ? 44  GLY A C     1 
ATOM   386  O  O     . GLY A 1 47  ? 41.473 15.830  14.189  1.00 14.32 ? 44  GLY A O     1 
ATOM   387  N  N     . GLY A 1 48  ? 39.639 14.534  14.168  1.00 16.71 ? 45  GLY A N     1 
ATOM   388  C  CA    . GLY A 1 48  ? 39.954 13.901  12.898  1.00 17.02 ? 45  GLY A CA    1 
ATOM   389  C  C     . GLY A 1 48  ? 40.570 12.525  13.056  1.00 16.69 ? 45  GLY A C     1 
ATOM   390  O  O     . GLY A 1 48  ? 41.123 12.197  14.102  1.00 13.74 ? 45  GLY A O     1 
ATOM   391  N  N     . GLY A 1 49  ? 40.500 11.717  12.006  1.00 11.74 ? 46  GLY A N     1 
ATOM   392  C  CA    . GLY A 1 49  ? 40.998 10.355  12.083  1.00 10.74 ? 46  GLY A CA    1 
ATOM   393  C  C     . GLY A 1 49  ? 42.418 10.290  11.561  1.00 15.44 ? 46  GLY A C     1 
ATOM   394  O  O     . GLY A 1 49  ? 42.688 10.774  10.460  1.00 12.79 ? 46  GLY A O     1 
ATOM   395  N  N     . ILE A 1 50  ? 43.326 9.699   12.334  1.00 9.45  ? 47  ILE A N     1 
ATOM   396  C  CA    . ILE A 1 50  ? 44.733 9.621   11.917  1.00 11.08 ? 47  ILE A CA    1 
ATOM   397  C  C     . ILE A 1 50  ? 44.954 8.568   10.832  1.00 10.08 ? 47  ILE A C     1 
ATOM   398  O  O     . ILE A 1 50  ? 44.496 7.439   10.959  1.00 11.03 ? 47  ILE A O     1 
ATOM   399  C  CB    . ILE A 1 50  ? 45.680 9.366   13.119  1.00 13.11 ? 47  ILE A CB    1 
ATOM   400  C  CG1   . ILE A 1 50  ? 45.798 10.634  13.969  1.00 15.67 ? 47  ILE A CG1   1 
ATOM   401  C  CG2   . ILE A 1 50  ? 47.066 8.930   12.637  1.00 8.90  ? 47  ILE A CG2   1 
ATOM   402  C  CD1   . ILE A 1 50  ? 46.601 10.449  15.241  1.00 18.05 ? 47  ILE A CD1   1 
ATOM   403  N  N     . ILE A 1 51  ? 45.640 8.937   9.752   1.00 9.21  ? 48  ILE A N     1 
ATOM   404  C  CA    . ILE A 1 51  ? 45.929 7.962   8.699   1.00 8.54  ? 48  ILE A CA    1 
ATOM   405  C  C     . ILE A 1 51  ? 47.413 7.662   8.429   1.00 11.38 ? 48  ILE A C     1 
ATOM   406  O  O     . ILE A 1 51  ? 47.724 6.706   7.728   1.00 10.71 ? 48  ILE A O     1 
ATOM   407  C  CB    . ILE A 1 51  ? 45.213 8.291   7.376   1.00 12.49 ? 48  ILE A CB    1 
ATOM   408  C  CG1   . ILE A 1 51  ? 45.624 9.664   6.839   1.00 9.54  ? 48  ILE A CG1   1 
ATOM   409  C  CG2   . ILE A 1 51  ? 43.696 8.182   7.552   1.00 17.72 ? 48  ILE A CG2   1 
ATOM   410  C  CD1   . ILE A 1 51  ? 45.117 9.895   5.413   1.00 13.61 ? 48  ILE A CD1   1 
ATOM   411  N  N     . ALA A 1 52  ? 48.318 8.463   8.988   1.00 9.06  ? 49  ALA A N     1 
ATOM   412  C  CA    . ALA A 1 52  ? 49.754 8.202   8.861   1.00 6.39  ? 49  ALA A CA    1 
ATOM   413  C  C     . ALA A 1 52  ? 50.460 8.844   10.041  1.00 9.05  ? 49  ALA A C     1 
ATOM   414  O  O     . ALA A 1 52  ? 50.008 9.879   10.535  1.00 7.51  ? 49  ALA A O     1 
ATOM   415  C  CB    . ALA A 1 52  ? 50.287 8.781   7.550   1.00 8.49  ? 49  ALA A CB    1 
ATOM   416  N  N     . VAL A 1 53  ? 51.573 8.253   10.473  1.00 5.58  ? 50  VAL A N     1 
ATOM   417  C  CA    . VAL A 1 53  ? 52.223 8.669   11.720  1.00 6.00  ? 50  VAL A CA    1 
ATOM   418  C  C     . VAL A 1 53  ? 53.735 8.628   11.579  1.00 6.97  ? 50  VAL A C     1 
ATOM   419  O  O     . VAL A 1 53  ? 54.300 7.615   11.154  1.00 6.72  ? 50  VAL A O     1 
ATOM   420  C  CB    . VAL A 1 53  ? 51.843 7.711   12.879  1.00 8.03  ? 50  VAL A CB    1 
ATOM   421  C  CG1   . VAL A 1 53  ? 52.316 8.263   14.218  1.00 8.30  ? 50  VAL A CG1   1 
ATOM   422  C  CG2   . VAL A 1 53  ? 50.347 7.482   12.912  1.00 11.55 ? 50  VAL A CG2   1 
ATOM   423  N  N     . SER A 1 54  ? 54.400 9.715   11.952  1.00 7.06  ? 51  SER A N     1 
ATOM   424  C  CA    . SER A 1 54  ? 55.849 9.760   11.857  1.00 8.66  ? 51  SER A CA    1 
ATOM   425  C  C     . SER A 1 54  ? 56.456 8.834   12.904  1.00 11.36 ? 51  SER A C     1 
ATOM   426  O  O     . SER A 1 54  ? 55.829 8.532   13.918  1.00 10.81 ? 51  SER A O     1 
ATOM   427  C  CB    . SER A 1 54  ? 56.386 11.186  12.021  1.00 9.71  ? 51  SER A CB    1 
ATOM   428  O  OG    . SER A 1 54  ? 56.462 11.573  13.385  1.00 11.71 ? 51  SER A OG    1 
ATOM   429  N  N     . TYR A 1 55  ? 57.674 8.375   12.648  1.00 9.70  ? 52  TYR A N     1 
ATOM   430  C  CA    . TYR A 1 55  ? 58.322 7.447   13.565  1.00 12.75 ? 52  TYR A CA    1 
ATOM   431  C  C     . TYR A 1 55  ? 58.543 8.049   14.951  1.00 14.73 ? 52  TYR A C     1 
ATOM   432  O  O     . TYR A 1 55  ? 58.437 7.350   15.948  1.00 10.95 ? 52  TYR A O     1 
ATOM   433  C  CB    . TYR A 1 55  ? 59.596 6.872   12.938  1.00 13.03 ? 52  TYR A CB    1 
ATOM   434  C  CG    . TYR A 1 55  ? 59.231 5.766   11.981  1.00 12.15 ? 52  TYR A CG    1 
ATOM   435  C  CD1   . TYR A 1 55  ? 58.838 6.047   10.676  1.00 10.74 ? 52  TYR A CD1   1 
ATOM   436  C  CD2   . TYR A 1 55  ? 59.215 4.444   12.397  1.00 15.85 ? 52  TYR A CD2   1 
ATOM   437  C  CE1   . TYR A 1 55  ? 58.455 5.027   9.807   1.00 12.49 ? 52  TYR A CE1   1 
ATOM   438  C  CE2   . TYR A 1 55  ? 58.841 3.425   11.543  1.00 13.94 ? 52  TYR A CE2   1 
ATOM   439  C  CZ    . TYR A 1 55  ? 58.459 3.720   10.246  1.00 13.74 ? 52  TYR A CZ    1 
ATOM   440  O  OH    . TYR A 1 55  ? 58.089 2.699   9.398   1.00 15.85 ? 52  TYR A OH    1 
ATOM   441  N  N     . GLU A 1 56  ? 58.794 9.355   15.006  1.00 12.58 ? 53  GLU A N     1 
ATOM   442  C  CA    . GLU A 1 56  ? 58.901 10.059  16.278  1.00 15.16 ? 53  GLU A CA    1 
ATOM   443  C  C     . GLU A 1 56  ? 57.597 9.976   17.075  1.00 11.55 ? 53  GLU A C     1 
ATOM   444  O  O     . GLU A 1 56  ? 57.614 9.777   18.287  1.00 12.81 ? 53  GLU A O     1 
ATOM   445  C  CB    . GLU A 1 56  ? 59.310 11.524  16.060  1.00 12.60 ? 53  GLU A CB    1 
ATOM   446  C  CG    . GLU A 1 56  ? 60.723 11.720  15.497  1.00 18.02 ? 53  GLU A CG    1 
ATOM   447  C  CD    . GLU A 1 56  ? 60.825 11.557  13.971  1.00 26.40 ? 53  GLU A CD    1 
ATOM   448  O  OE1   . GLU A 1 56  ? 59.865 11.065  13.322  1.00 19.32 ? 53  GLU A OE1   1 
ATOM   449  O  OE2   . GLU A 1 56  ? 61.888 11.925  13.423  1.00 27.61 ? 53  GLU A OE2   1 
ATOM   450  N  N     . ALA A 1 57  ? 56.462 10.124  16.393  1.00 10.86 ? 54  ALA A N     1 
ATOM   451  C  CA    . ALA A 1 57  ? 55.156 10.035  17.041  1.00 10.50 ? 54  ALA A CA    1 
ATOM   452  C  C     . ALA A 1 57  ? 54.791 8.605   17.459  1.00 9.16  ? 54  ALA A C     1 
ATOM   453  O  O     . ALA A 1 57  ? 54.159 8.400   18.491  1.00 10.27 ? 54  ALA A O     1 
ATOM   454  C  CB    . ALA A 1 57  ? 54.058 10.611  16.126  1.00 12.01 ? 54  ALA A CB    1 
ATOM   455  N  N     . ARG A 1 58  ? 55.174 7.618   16.655  1.00 10.92 ? 55  ARG A N     1 
ATOM   456  C  CA    . ARG A 1 58  ? 54.911 6.218   17.017  1.00 11.60 ? 55  ARG A CA    1 
ATOM   457  C  C     . ARG A 1 58  ? 55.546 5.853   18.362  1.00 14.58 ? 55  ARG A C     1 
ATOM   458  O  O     . ARG A 1 58  ? 55.017 5.025   19.112  1.00 13.05 ? 55  ARG A O     1 
ATOM   459  C  CB    . ARG A 1 58  ? 55.440 5.274   15.947  1.00 8.67  ? 55  ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 58  ? 54.740 5.441   14.631  1.00 10.91 ? 55  ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 58  ? 55.333 4.525   13.574  1.00 10.68 ? 55  ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 58  ? 54.948 5.004   12.253  1.00 12.01 ? 55  ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 58  ? 55.028 4.296   11.135  1.00 13.81 ? 55  ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 58  ? 55.462 3.046   11.171  1.00 15.18 ? 55  ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 58  ? 54.647 4.844   9.978   1.00 13.14 ? 55  ARG A NH2   1 
ATOM   466  N  N     . ALA A 1 59  ? 56.674 6.479   18.667  1.00 10.14 ? 56  ALA A N     1 
ATOM   467  C  CA    . ALA A 1 59  ? 57.349 6.210   19.933  1.00 16.87 ? 56  ALA A CA    1 
ATOM   468  C  C     . ALA A 1 59  ? 56.437 6.537   21.123  1.00 16.91 ? 56  ALA A C     1 
ATOM   469  O  O     . ALA A 1 59  ? 56.553 5.928   22.192  1.00 15.80 ? 56  ALA A O     1 
ATOM   470  C  CB    . ALA A 1 59  ? 58.655 6.979   20.015  1.00 16.35 ? 56  ALA A CB    1 
ATOM   471  N  N     . PHE A 1 60  ? 55.522 7.489   20.934  1.00 10.67 ? 57  PHE A N     1 
ATOM   472  C  CA    . PHE A 1 60  ? 54.559 7.829   21.982  1.00 13.31 ? 57  PHE A CA    1 
ATOM   473  C  C     . PHE A 1 60  ? 53.338 6.911   21.968  1.00 13.31 ? 57  PHE A C     1 
ATOM   474  O  O     . PHE A 1 60  ? 52.457 7.026   22.819  1.00 17.41 ? 57  PHE A O     1 
ATOM   475  C  CB    . PHE A 1 60  ? 54.095 9.287   21.862  1.00 12.74 ? 57  PHE A CB    1 
ATOM   476  C  CG    . PHE A 1 60  ? 55.167 10.298  22.159  1.00 14.42 ? 57  PHE A CG    1 
ATOM   477  C  CD1   . PHE A 1 60  ? 55.280 10.860  23.423  1.00 19.51 ? 57  PHE A CD1   1 
ATOM   478  C  CD2   . PHE A 1 60  ? 56.056 10.689  21.176  1.00 12.69 ? 57  PHE A CD2   1 
ATOM   479  C  CE1   . PHE A 1 60  ? 56.262 11.796  23.700  1.00 22.33 ? 57  PHE A CE1   1 
ATOM   480  C  CE2   . PHE A 1 60  ? 57.037 11.623  21.440  1.00 18.23 ? 57  PHE A CE2   1 
ATOM   481  C  CZ    . PHE A 1 60  ? 57.141 12.180  22.705  1.00 24.63 ? 57  PHE A CZ    1 
ATOM   482  N  N     . GLY A 1 61  ? 53.269 6.012   20.991  1.00 13.73 ? 58  GLY A N     1 
ATOM   483  C  CA    . GLY A 1 61  ? 52.163 5.072   20.903  1.00 13.85 ? 58  GLY A CA    1 
ATOM   484  C  C     . GLY A 1 61  ? 51.037 5.556   19.999  1.00 15.18 ? 58  GLY A C     1 
ATOM   485  O  O     . GLY A 1 61  ? 49.938 4.996   19.996  1.00 10.66 ? 58  GLY A O     1 
ATOM   486  N  N     . VAL A 1 62  ? 51.295 6.613   19.233  1.00 11.48 ? 59  VAL A N     1 
ATOM   487  C  CA    . VAL A 1 62  ? 50.298 7.097   18.285  1.00 11.51 ? 59  VAL A CA    1 
ATOM   488  C  C     . VAL A 1 62  ? 50.222 6.106   17.135  1.00 11.57 ? 59  VAL A C     1 
ATOM   489  O  O     . VAL A 1 62  ? 51.248 5.641   16.653  1.00 11.09 ? 59  VAL A O     1 
ATOM   490  C  CB    . VAL A 1 62  ? 50.647 8.510   17.728  1.00 11.30 ? 59  VAL A CB    1 
ATOM   491  C  CG1   . VAL A 1 62  ? 49.596 8.957   16.720  1.00 14.28 ? 59  VAL A CG1   1 
ATOM   492  C  CG2   . VAL A 1 62  ? 50.731 9.515   18.859  1.00 11.57 ? 59  VAL A CG2   1 
ATOM   493  N  N     . THR A 1 63  ? 49.005 5.788   16.700  1.00 13.98 ? 60  THR A N     1 
ATOM   494  C  CA    . THR A 1 63  ? 48.829 4.834   15.619  1.00 16.15 ? 60  THR A CA    1 
ATOM   495  C  C     . THR A 1 63  ? 47.809 5.317   14.605  1.00 13.84 ? 60  THR A C     1 
ATOM   496  O  O     . THR A 1 63  ? 47.024 6.222   14.871  1.00 15.25 ? 60  THR A O     1 
ATOM   497  C  CB    . THR A 1 63  ? 48.339 3.473   16.144  1.00 18.96 ? 60  THR A CB    1 
ATOM   498  O  OG1   . THR A 1 63  ? 47.024 3.617   16.697  1.00 18.87 ? 60  THR A OG1   1 
ATOM   499  C  CG2   . THR A 1 63  ? 49.289 2.940   17.207  1.00 15.91 ? 60  THR A CG2   1 
ATOM   500  N  N     . ARG A 1 64  ? 47.831 4.692   13.436  1.00 16.52 ? 61  ARG A N     1 
ATOM   501  C  CA    . ARG A 1 64  ? 46.760 4.824   12.461  1.00 15.57 ? 61  ARG A CA    1 
ATOM   502  C  C     . ARG A 1 64  ? 45.420 4.398   13.072  1.00 19.00 ? 61  ARG A C     1 
ATOM   503  O  O     . ARG A 1 64  ? 45.373 3.499   13.913  1.00 15.06 ? 61  ARG A O     1 
ATOM   504  C  CB    . ARG A 1 64  ? 47.108 3.964   11.238  1.00 18.95 ? 61  ARG A CB    1 
ATOM   505  C  CG    . ARG A 1 64  ? 45.988 3.679   10.262  1.00 28.99 ? 61  ARG A CG    1 
ATOM   506  C  CD    . ARG A 1 64  ? 46.570 2.995   9.018   1.00 21.40 ? 61  ARG A CD    1 
ATOM   507  N  NE    . ARG A 1 64  ? 47.605 3.838   8.430   1.00 24.79 ? 61  ARG A NE    1 
ATOM   508  C  CZ    . ARG A 1 64  ? 48.786 3.407   7.990   1.00 26.49 ? 61  ARG A CZ    1 
ATOM   509  N  NH1   . ARG A 1 64  ? 49.111 2.116   8.051   1.00 26.63 ? 61  ARG A NH1   1 
ATOM   510  N  NH2   . ARG A 1 64  ? 49.649 4.277   7.483   1.00 15.84 ? 61  ARG A NH2   1 
ATOM   511  N  N     . SER A 1 65  ? 44.348 5.064   12.639  1.00 16.04 ? 62  SER A N     1 
ATOM   512  C  CA    . SER A 1 65  ? 42.970 4.797   13.060  1.00 23.72 ? 62  SER A CA    1 
ATOM   513  C  C     . SER A 1 65  ? 42.606 5.482   14.375  1.00 24.23 ? 62  SER A C     1 
ATOM   514  O  O     . SER A 1 65  ? 41.451 5.500   14.781  1.00 31.16 ? 62  SER A O     1 
ATOM   515  C  CB    . SER A 1 65  ? 42.692 3.306   13.163  1.00 25.07 ? 62  SER A CB    1 
ATOM   516  O  OG    . SER A 1 65  ? 42.808 2.882   14.507  1.00 35.86 ? 62  SER A OG    1 
ATOM   517  N  N     . MET A 1 66  ? 43.604 6.039   15.040  1.00 19.29 ? 63  MET A N     1 
ATOM   518  C  CA    . MET A 1 66  ? 43.388 6.745   16.291  1.00 16.53 ? 63  MET A CA    1 
ATOM   519  C  C     . MET A 1 66  ? 42.769 8.105   15.980  1.00 16.64 ? 63  MET A C     1 
ATOM   520  O  O     . MET A 1 66  ? 43.119 8.725   14.978  1.00 15.59 ? 63  MET A O     1 
ATOM   521  C  CB    . MET A 1 66  ? 44.743 6.910   16.962  1.00 16.72 ? 63  MET A CB    1 
ATOM   522  C  CG    . MET A 1 66  ? 44.742 7.352   18.372  1.00 16.27 ? 63  MET A CG    1 
ATOM   523  S  SD    . MET A 1 66  ? 46.413 7.090   18.995  1.00 19.11 ? 63  MET A SD    1 
ATOM   524  C  CE    . MET A 1 66  ? 46.403 5.362   19.420  1.00 12.89 ? 63  MET A CE    1 
ATOM   525  N  N     . TRP A 1 67  ? 41.836 8.558   16.814  1.00 15.22 ? 64  TRP A N     1 
ATOM   526  C  CA    . TRP A 1 67  ? 41.288 9.911   16.680  1.00 15.02 ? 64  TRP A CA    1 
ATOM   527  C  C     . TRP A 1 67  ? 42.346 10.890  17.155  1.00 13.90 ? 64  TRP A C     1 
ATOM   528  O  O     . TRP A 1 67  ? 43.029 10.626  18.142  1.00 15.02 ? 64  TRP A O     1 
ATOM   529  C  CB    . TRP A 1 67  ? 40.016 10.087  17.516  1.00 14.84 ? 64  TRP A CB    1 
ATOM   530  C  CG    . TRP A 1 67  ? 38.895 9.242   17.056  1.00 18.37 ? 64  TRP A CG    1 
ATOM   531  C  CD1   . TRP A 1 67  ? 38.287 8.235   17.747  1.00 22.24 ? 64  TRP A CD1   1 
ATOM   532  C  CD2   . TRP A 1 67  ? 38.252 9.305   15.782  1.00 19.67 ? 64  TRP A CD2   1 
ATOM   533  N  NE1   . TRP A 1 67  ? 37.296 7.671   16.979  1.00 27.49 ? 64  TRP A NE1   1 
ATOM   534  C  CE2   . TRP A 1 67  ? 37.258 8.308   15.766  1.00 26.75 ? 64  TRP A CE2   1 
ATOM   535  C  CE3   . TRP A 1 67  ? 38.420 10.110  14.651  1.00 17.64 ? 64  TRP A CE3   1 
ATOM   536  C  CZ2   . TRP A 1 67  ? 36.433 8.093   14.661  1.00 27.02 ? 64  TRP A CZ2   1 
ATOM   537  C  CZ3   . TRP A 1 67  ? 37.597 9.894   13.553  1.00 20.27 ? 64  TRP A CZ3   1 
ATOM   538  C  CH2   . TRP A 1 67  ? 36.616 8.896   13.570  1.00 18.92 ? 64  TRP A CH2   1 
ATOM   539  N  N     . ALA A 1 68  ? 42.496 12.020  16.469  1.00 10.56 ? 65  ALA A N     1 
ATOM   540  C  CA    . ALA A 1 68  ? 43.544 12.963  16.857  1.00 13.07 ? 65  ALA A CA    1 
ATOM   541  C  C     . ALA A 1 68  ? 43.424 13.426  18.308  1.00 12.83 ? 65  ALA A C     1 
ATOM   542  O  O     . ALA A 1 68  ? 44.438 13.652  18.968  1.00 11.39 ? 65  ALA A O     1 
ATOM   543  C  CB    . ALA A 1 68  ? 43.585 14.160  15.919  1.00 14.41 ? 65  ALA A CB    1 
ATOM   544  N  N     . ASP A 1 69  ? 42.199 13.583  18.807  1.00 11.97 ? 66  ASP A N     1 
ATOM   545  C  CA    . ASP A 1 69  ? 42.046 14.030  20.193  1.00 14.81 ? 66  ASP A CA    1 
ATOM   546  C  C     . ASP A 1 69  ? 42.643 12.997  21.146  1.00 15.87 ? 66  ASP A C     1 
ATOM   547  O  O     . ASP A 1 69  ? 43.187 13.341  22.202  1.00 12.97 ? 66  ASP A O     1 
ATOM   548  C  CB    . ASP A 1 69  ? 40.586 14.272  20.544  1.00 18.63 ? 66  ASP A CB    1 
ATOM   549  C  CG    . ASP A 1 69  ? 40.032 15.524  19.901  1.00 19.63 ? 66  ASP A CG    1 
ATOM   550  O  OD1   . ASP A 1 69  ? 40.823 16.381  19.430  1.00 21.61 ? 66  ASP A OD1   1 
ATOM   551  O  OD2   . ASP A 1 69  ? 38.799 15.652  19.878  1.00 23.55 ? 66  ASP A OD2   1 
ATOM   552  N  N     . ASP A 1 70  ? 42.526 11.729  20.771  1.00 11.53 ? 67  ASP A N     1 
ATOM   553  C  CA    . ASP A 1 70  ? 43.084 10.648  21.575  1.00 14.89 ? 67  ASP A CA    1 
ATOM   554  C  C     . ASP A 1 70  ? 44.608 10.565  21.453  1.00 11.77 ? 67  ASP A C     1 
ATOM   555  O  O     . ASP A 1 70  ? 45.318 10.372  22.444  1.00 12.18 ? 67  ASP A O     1 
ATOM   556  C  CB    . ASP A 1 70  ? 42.419 9.320   21.199  1.00 14.42 ? 67  ASP A CB    1 
ATOM   557  C  CG    . ASP A 1 70  ? 40.925 9.300   21.534  1.00 22.74 ? 67  ASP A CG    1 
ATOM   558  O  OD1   . ASP A 1 70  ? 40.502 10.036  22.456  1.00 21.64 ? 67  ASP A OD1   1 
ATOM   559  O  OD2   . ASP A 1 70  ? 40.169 8.557   20.872  1.00 23.53 ? 67  ASP A OD2   1 
ATOM   560  N  N     . ALA A 1 71  ? 45.118 10.704  20.232  1.00 8.64  ? 68  ALA A N     1 
ATOM   561  C  CA    . ALA A 1 71  ? 46.556 10.747  20.014  1.00 11.49 ? 68  ALA A CA    1 
ATOM   562  C  C     . ALA A 1 71  ? 47.214 11.848  20.859  1.00 11.33 ? 68  ALA A C     1 
ATOM   563  O  O     . ALA A 1 71  ? 48.319 11.672  21.380  1.00 11.55 ? 68  ALA A O     1 
ATOM   564  C  CB    . ALA A 1 71  ? 46.864 10.956  18.527  1.00 11.84 ? 68  ALA A CB    1 
ATOM   565  N  N     . LYS A 1 72  ? 46.538 12.986  20.970  1.00 8.31  ? 69  LYS A N     1 
ATOM   566  C  CA    . LYS A 1 72  ? 47.066 14.138  21.707  1.00 10.32 ? 69  LYS A CA    1 
ATOM   567  C  C     . LYS A 1 72  ? 47.210 13.833  23.189  1.00 14.41 ? 69  LYS A C     1 
ATOM   568  O  O     . LYS A 1 72  ? 48.051 14.420  23.882  1.00 13.81 ? 69  LYS A O     1 
ATOM   569  C  CB    . LYS A 1 72  ? 46.166 15.363  21.508  1.00 11.25 ? 69  LYS A CB    1 
ATOM   570  C  CG    . LYS A 1 72  ? 46.543 16.235  20.282  1.00 14.39 ? 69  LYS A CG    1 
ATOM   571  C  CD    . LYS A 1 72  ? 47.757 17.131  20.608  1.00 16.91 ? 69  LYS A CD    1 
ATOM   572  C  CE    . LYS A 1 72  ? 47.973 18.226  19.553  1.00 18.56 ? 69  LYS A CE    1 
ATOM   573  N  NZ    . LYS A 1 72  ? 49.267 18.970  19.749  1.00 16.75 ? 69  LYS A NZ    1 
ATOM   574  N  N     . LYS A 1 73  ? 46.388 12.906  23.669  1.00 15.33 ? 70  LYS A N     1 
ATOM   575  C  CA    . LYS A 1 73  ? 46.500 12.432  25.042  1.00 13.44 ? 70  LYS A CA    1 
ATOM   576  C  C     . LYS A 1 73  ? 47.821 11.683  25.240  1.00 16.51 ? 70  LYS A C     1 
ATOM   577  O  O     . LYS A 1 73  ? 48.441 11.784  26.294  1.00 14.80 ? 70  LYS A O     1 
ATOM   578  C  CB    . LYS A 1 73  ? 45.296 11.556  25.411  1.00 9.85  ? 70  LYS A CB    1 
ATOM   579  C  CG    . LYS A 1 73  ? 43.954 12.267  25.246  1.00 11.59 ? 70  LYS A CG    1 
ATOM   580  C  CD    . LYS A 1 73  ? 42.784 11.331  25.566  1.00 11.63 ? 70  LYS A CD    1 
ATOM   581  C  CE    . LYS A 1 73  ? 41.442 12.004  25.276  1.00 15.58 ? 70  LYS A CE    1 
ATOM   582  N  NZ    . LYS A 1 73  ? 40.348 10.978  25.206  1.00 20.40 ? 70  LYS A NZ    1 
ATOM   583  N  N     . LEU A 1 74  ? 48.268 10.958  24.218  1.00 11.68 ? 71  LEU A N     1 
ATOM   584  C  CA    . LEU A 1 74  ? 49.527 10.215  24.316  1.00 12.15 ? 71  LEU A CA    1 
ATOM   585  C  C     . LEU A 1 74  ? 50.724 11.110  24.010  1.00 17.31 ? 71  LEU A C     1 
ATOM   586  O  O     . LEU A 1 74  ? 51.827 10.912  24.546  1.00 13.32 ? 71  LEU A O     1 
ATOM   587  C  CB    . LEU A 1 74  ? 49.527 9.025   23.350  1.00 10.38 ? 71  LEU A CB    1 
ATOM   588  C  CG    . LEU A 1 74  ? 48.498 7.912   23.573  1.00 15.39 ? 71  LEU A CG    1 
ATOM   589  C  CD1   . LEU A 1 74  ? 48.613 6.888   22.465  1.00 17.86 ? 71  LEU A CD1   1 
ATOM   590  C  CD2   . LEU A 1 74  ? 48.696 7.243   24.928  1.00 12.52 ? 71  LEU A CD2   1 
ATOM   591  N  N     . CYS A 1 75  ? 50.493 12.087  23.138  1.00 12.76 ? 72  CYS A N     1 
ATOM   592  C  CA    . CYS A 1 75  ? 51.557 12.921  22.582  1.00 13.14 ? 72  CYS A CA    1 
ATOM   593  C  C     . CYS A 1 75  ? 51.060 14.352  22.447  1.00 16.16 ? 72  CYS A C     1 
ATOM   594  O  O     . CYS A 1 75  ? 50.601 14.769  21.380  1.00 15.29 ? 72  CYS A O     1 
ATOM   595  C  CB    . CYS A 1 75  ? 51.970 12.371  21.219  1.00 12.93 ? 72  CYS A CB    1 
ATOM   596  S  SG    . CYS A 1 75  ? 53.363 13.215  20.425  1.00 19.73 ? 72  CYS A SG    1 
ATOM   597  N  N     . PRO A 1 76  ? 51.136 15.116  23.546  1.00 12.56 ? 73  PRO A N     1 
ATOM   598  C  CA    . PRO A 1 76  ? 50.593 16.470  23.619  1.00 16.20 ? 73  PRO A CA    1 
ATOM   599  C  C     . PRO A 1 76  ? 51.195 17.406  22.565  1.00 16.14 ? 73  PRO A C     1 
ATOM   600  O  O     . PRO A 1 76  ? 50.504 18.309  22.106  1.00 18.33 ? 73  PRO A O     1 
ATOM   601  C  CB    . PRO A 1 76  ? 50.983 16.927  25.031  1.00 18.31 ? 73  PRO A CB    1 
ATOM   602  C  CG    . PRO A 1 76  ? 51.139 15.660  25.804  1.00 28.05 ? 73  PRO A CG    1 
ATOM   603  C  CD    . PRO A 1 76  ? 51.708 14.672  24.829  1.00 18.85 ? 73  PRO A CD    1 
ATOM   604  N  N     . ASP A 1 77  ? 52.450 17.193  22.183  1.00 16.08 ? 74  ASP A N     1 
ATOM   605  C  CA    . ASP A 1 77  ? 53.082 18.079  21.208  1.00 20.41 ? 74  ASP A CA    1 
ATOM   606  C  C     . ASP A 1 77  ? 52.983 17.566  19.772  1.00 19.16 ? 74  ASP A C     1 
ATOM   607  O  O     . ASP A 1 77  ? 53.633 18.105  18.870  1.00 13.66 ? 74  ASP A O     1 
ATOM   608  C  CB    . ASP A 1 77  ? 54.544 18.311  21.569  1.00 18.09 ? 74  ASP A CB    1 
ATOM   609  C  CG    . ASP A 1 77  ? 54.708 18.982  22.919  1.00 32.37 ? 74  ASP A CG    1 
ATOM   610  O  OD1   . ASP A 1 77  ? 55.539 18.504  23.721  1.00 35.87 ? 74  ASP A OD1   1 
ATOM   611  O  OD2   . ASP A 1 77  ? 54.005 19.983  23.177  1.00 32.49 ? 74  ASP A OD2   1 
ATOM   612  N  N     . LEU A 1 78  ? 52.177 16.529  19.572  1.00 13.98 ? 75  LEU A N     1 
ATOM   613  C  CA    . LEU A 1 78  ? 51.949 15.965  18.241  1.00 13.46 ? 75  LEU A CA    1 
ATOM   614  C  C     . LEU A 1 78  ? 51.569 17.081  17.271  1.00 12.08 ? 75  LEU A C     1 
ATOM   615  O  O     . LEU A 1 78  ? 50.676 17.881  17.558  1.00 12.24 ? 75  LEU A O     1 
ATOM   616  C  CB    . LEU A 1 78  ? 50.824 14.927  18.303  1.00 13.16 ? 75  LEU A CB    1 
ATOM   617  C  CG    . LEU A 1 78  ? 50.411 14.242  17.000  1.00 9.46  ? 75  LEU A CG    1 
ATOM   618  C  CD1   . LEU A 1 78  ? 51.540 13.363  16.490  1.00 10.03 ? 75  LEU A CD1   1 
ATOM   619  C  CD2   . LEU A 1 78  ? 49.156 13.403  17.225  1.00 11.11 ? 75  LEU A CD2   1 
ATOM   620  N  N     . LEU A 1 79  ? 52.244 17.154  16.131  1.00 9.39  ? 76  LEU A N     1 
ATOM   621  C  CA    . LEU A 1 79  ? 51.842 18.115  15.108  1.00 9.01  ? 76  LEU A CA    1 
ATOM   622  C  C     . LEU A 1 79  ? 50.966 17.394  14.096  1.00 13.26 ? 76  LEU A C     1 
ATOM   623  O  O     . LEU A 1 79  ? 51.089 16.188  13.902  1.00 10.19 ? 76  LEU A O     1 
ATOM   624  C  CB    . LEU A 1 79  ? 53.061 18.713  14.413  1.00 6.71  ? 76  LEU A CB    1 
ATOM   625  C  CG    . LEU A 1 79  ? 54.016 19.387  15.395  1.00 10.88 ? 76  LEU A CG    1 
ATOM   626  C  CD1   . LEU A 1 79  ? 55.244 19.917  14.666  1.00 13.91 ? 76  LEU A CD1   1 
ATOM   627  C  CD2   . LEU A 1 79  ? 53.290 20.489  16.166  1.00 10.45 ? 76  LEU A CD2   1 
ATOM   628  N  N     . LEU A 1 80  ? 50.077 18.134  13.455  1.00 13.90 ? 77  LEU A N     1 
ATOM   629  C  CA    . LEU A 1 80  ? 49.140 17.515  12.530  1.00 11.57 ? 77  LEU A CA    1 
ATOM   630  C  C     . LEU A 1 80  ? 49.147 18.242  11.199  1.00 12.65 ? 77  LEU A C     1 
ATOM   631  O  O     . LEU A 1 80  ? 49.305 19.461  11.145  1.00 14.21 ? 77  LEU A O     1 
ATOM   632  C  CB    . LEU A 1 80  ? 47.728 17.522  13.109  1.00 8.40  ? 77  LEU A CB    1 
ATOM   633  C  CG    . LEU A 1 80  ? 47.538 16.765  14.412  1.00 10.13 ? 77  LEU A CG    1 
ATOM   634  C  CD1   . LEU A 1 80  ? 46.115 16.974  14.922  1.00 15.59 ? 77  LEU A CD1   1 
ATOM   635  C  CD2   . LEU A 1 80  ? 47.874 15.286  14.199  1.00 11.72 ? 77  LEU A CD2   1 
ATOM   636  N  N     . ALA A 1 81  ? 48.992 17.481  10.126  1.00 10.60 ? 78  ALA A N     1 
ATOM   637  C  CA    . ALA A 1 81  ? 48.655 18.062  8.835   1.00 10.12 ? 78  ALA A CA    1 
ATOM   638  C  C     . ALA A 1 81  ? 47.367 17.402  8.374   1.00 10.53 ? 78  ALA A C     1 
ATOM   639  O  O     . ALA A 1 81  ? 47.177 16.195  8.556   1.00 12.95 ? 78  ALA A O     1 
ATOM   640  C  CB    . ALA A 1 81  ? 49.774 17.841  7.835   1.00 10.99 ? 78  ALA A CB    1 
ATOM   641  N  N     . GLN A 1 82  ? 46.471 18.186  7.793   1.00 10.47 ? 79  GLN A N     1 
ATOM   642  C  CA    . GLN A 1 82  ? 45.173 17.663  7.386   1.00 13.25 ? 79  GLN A CA    1 
ATOM   643  C  C     . GLN A 1 82  ? 45.136 17.380  5.902   1.00 12.90 ? 79  GLN A C     1 
ATOM   644  O  O     . GLN A 1 82  ? 45.669 18.155  5.112   1.00 12.18 ? 79  GLN A O     1 
ATOM   645  C  CB    . GLN A 1 82  ? 44.074 18.681  7.669   1.00 15.66 ? 79  GLN A CB    1 
ATOM   646  C  CG    . GLN A 1 82  ? 43.971 19.150  9.084   1.00 24.56 ? 79  GLN A CG    1 
ATOM   647  C  CD    . GLN A 1 82  ? 42.895 20.203  9.221   1.00 33.21 ? 79  GLN A CD    1 
ATOM   648  O  OE1   . GLN A 1 82  ? 43.169 21.334  9.610   1.00 29.38 ? 79  GLN A OE1   1 
ATOM   649  N  NE2   . GLN A 1 82  ? 41.660 19.838  8.877   1.00 32.74 ? 79  GLN A NE2   1 
ATOM   650  N  N     . VAL A 1 83  ? 44.475 16.288  5.533   1.00 8.79  ? 80  VAL A N     1 
ATOM   651  C  CA    . VAL A 1 83  ? 44.207 15.980  4.137   1.00 12.79 ? 80  VAL A CA    1 
ATOM   652  C  C     . VAL A 1 83  ? 43.318 17.077  3.553   1.00 14.10 ? 80  VAL A C     1 
ATOM   653  O  O     . VAL A 1 83  ? 42.375 17.541  4.192   1.00 8.46  ? 80  VAL A O     1 
ATOM   654  C  CB    . VAL A 1 83  ? 43.482 14.634  3.995   1.00 9.87  ? 80  VAL A CB    1 
ATOM   655  C  CG1   . VAL A 1 83  ? 43.165 14.348  2.543   1.00 9.96  ? 80  VAL A CG1   1 
ATOM   656  C  CG2   . VAL A 1 83  ? 44.335 13.495  4.584   1.00 10.88 ? 80  VAL A CG2   1 
ATOM   657  N  N     . ARG A 1 84  ? 43.627 17.489  2.337   1.00 12.71 ? 81  ARG A N     1 
ATOM   658  C  CA    . ARG A 1 84  ? 42.833 18.504  1.658   1.00 13.03 ? 81  ARG A CA    1 
ATOM   659  C  C     . ARG A 1 84  ? 41.373 18.078  1.510   1.00 13.29 ? 81  ARG A C     1 
ATOM   660  O  O     . ARG A 1 84  ? 41.060 16.891  1.375   1.00 12.24 ? 81  ARG A O     1 
ATOM   661  C  CB    . ARG A 1 84  ? 43.447 18.779  0.285   1.00 16.92 ? 81  ARG A CB    1 
ATOM   662  C  CG    . ARG A 1 84  ? 42.633 19.712  -0.621  1.00 17.48 ? 81  ARG A CG    1 
ATOM   663  C  CD    . ARG A 1 84  ? 43.310 19.819  -1.991  1.00 31.97 ? 81  ARG A CD    1 
ATOM   664  N  NE    . ARG A 1 84  ? 42.389 20.229  -3.050  1.00 37.69 ? 81  ARG A NE    1 
ATOM   665  C  CZ    . ARG A 1 84  ? 42.639 20.103  -4.353  1.00 47.33 ? 81  ARG A CZ    1 
ATOM   666  N  NH1   . ARG A 1 84  ? 43.784 19.572  -4.766  1.00 41.14 ? 81  ARG A NH1   1 
ATOM   667  N  NH2   . ARG A 1 84  ? 41.740 20.500  -5.248  1.00 38.82 ? 81  ARG A NH2   1 
ATOM   668  N  N     . GLU A 1 85  ? 40.473 19.053  1.543   1.00 10.44 ? 82  GLU A N     1 
ATOM   669  C  CA    . GLU A 1 85  ? 39.067 18.784  1.308   1.00 14.09 ? 82  GLU A CA    1 
ATOM   670  C  C     . GLU A 1 85  ? 38.596 19.567  0.100   1.00 14.88 ? 82  GLU A C     1 
ATOM   671  O  O     . GLU A 1 85  ? 38.857 20.765  -0.015  1.00 13.87 ? 82  GLU A O     1 
ATOM   672  C  CB    . GLU A 1 85  ? 38.228 19.142  2.532   1.00 17.27 ? 82  GLU A CB    1 
ATOM   673  C  CG    . GLU A 1 85  ? 38.189 18.028  3.569   1.00 20.84 ? 82  GLU A CG    1 
ATOM   674  C  CD    . GLU A 1 85  ? 37.541 18.470  4.875   1.00 26.09 ? 82  GLU A CD    1 
ATOM   675  O  OE1   . GLU A 1 85  ? 36.325 18.795  4.877   1.00 28.35 ? 82  GLU A OE1   1 
ATOM   676  O  OE2   . GLU A 1 85  ? 38.263 18.499  5.893   1.00 34.67 ? 82  GLU A OE2   1 
ATOM   677  N  N     . SER A 1 86  ? 37.921 18.869  -0.804  1.00 12.69 ? 83  SER A N     1 
ATOM   678  C  CA    . SER A 1 86  ? 37.334 19.474  -1.983  1.00 14.29 ? 83  SER A CA    1 
ATOM   679  C  C     . SER A 1 86  ? 35.967 18.858  -2.207  1.00 16.84 ? 83  SER A C     1 
ATOM   680  O  O     . SER A 1 86  ? 35.773 17.660  -1.985  1.00 15.08 ? 83  SER A O     1 
ATOM   681  C  CB    . SER A 1 86  ? 38.204 19.217  -3.212  1.00 14.32 ? 83  SER A CB    1 
ATOM   682  O  OG    . SER A 1 86  ? 39.524 19.666  -2.983  1.00 26.02 ? 83  SER A OG    1 
ATOM   683  N  N     . ARG A 1 87  ? 35.027 19.684  -2.653  1.00 16.96 ? 84  ARG A N     1 
ATOM   684  C  CA    . ARG A 1 87  ? 33.657 19.242  -2.898  1.00 20.89 ? 84  ARG A CA    1 
ATOM   685  C  C     . ARG A 1 87  ? 33.095 18.484  -1.711  1.00 17.97 ? 84  ARG A C     1 
ATOM   686  O  O     . ARG A 1 87  ? 32.305 17.547  -1.869  1.00 23.61 ? 84  ARG A O     1 
ATOM   687  C  CB    . ARG A 1 87  ? 33.581 18.389  -4.164  1.00 21.03 ? 84  ARG A CB    1 
ATOM   688  C  CG    . ARG A 1 87  ? 34.234 19.036  -5.367  1.00 24.22 ? 84  ARG A CG    1 
ATOM   689  C  CD    . ARG A 1 87  ? 34.008 18.218  -6.629  1.00 24.34 ? 84  ARG A CD    1 
ATOM   690  N  NE    . ARG A 1 87  ? 34.873 18.669  -7.714  1.00 27.50 ? 84  ARG A NE    1 
ATOM   691  C  CZ    . ARG A 1 87  ? 36.163 18.359  -7.820  1.00 25.84 ? 84  ARG A CZ    1 
ATOM   692  N  NH1   . ARG A 1 87  ? 36.750 17.596  -6.901  1.00 31.04 ? 84  ARG A NH1   1 
ATOM   693  N  NH2   . ARG A 1 87  ? 36.870 18.819  -8.843  1.00 31.35 ? 84  ARG A NH2   1 
ATOM   694  N  N     . GLY A 1 88  ? 33.497 18.893  -0.516  1.00 15.20 ? 85  GLY A N     1 
ATOM   695  C  CA    . GLY A 1 88  ? 32.957 18.325  0.706   1.00 16.80 ? 85  GLY A CA    1 
ATOM   696  C  C     . GLY A 1 88  ? 33.559 17.002  1.148   1.00 19.04 ? 85  GLY A C     1 
ATOM   697  O  O     . GLY A 1 88  ? 33.074 16.394  2.104   1.00 15.90 ? 85  GLY A O     1 
ATOM   698  N  N     . LYS A 1 89  ? 34.612 16.551  0.468   1.00 11.67 ? 86  LYS A N     1 
ATOM   699  C  CA    . LYS A 1 89  ? 35.230 15.267  0.799   1.00 11.69 ? 86  LYS A CA    1 
ATOM   700  C  C     . LYS A 1 89  ? 36.756 15.326  0.834   1.00 11.48 ? 86  LYS A C     1 
ATOM   701  O  O     . LYS A 1 89  ? 37.366 16.227  0.267   1.00 13.55 ? 86  LYS A O     1 
ATOM   702  C  CB    . LYS A 1 89  ? 34.789 14.180  -0.187  1.00 14.44 ? 86  LYS A CB    1 
ATOM   703  C  CG    . LYS A 1 89  ? 35.325 14.333  -1.603  1.00 12.99 ? 86  LYS A CG    1 
ATOM   704  C  CD    . LYS A 1 89  ? 34.824 13.196  -2.515  1.00 17.63 ? 86  LYS A CD    1 
ATOM   705  C  CE    . LYS A 1 89  ? 35.450 11.852  -2.138  1.00 11.42 ? 86  LYS A CE    1 
ATOM   706  N  NZ    . LYS A 1 89  ? 36.934 11.833  -2.353  1.00 12.10 ? 86  LYS A NZ    1 
ATOM   707  N  N     . ALA A 1 90  ? 37.365 14.354  1.502   1.00 13.72 ? 87  ALA A N     1 
ATOM   708  C  CA    . ALA A 1 90  ? 38.823 14.276  1.555   1.00 12.54 ? 87  ALA A CA    1 
ATOM   709  C  C     . ALA A 1 90  ? 39.268 14.045  0.137   1.00 13.29 ? 87  ALA A C     1 
ATOM   710  O  O     . ALA A 1 90  ? 38.620 13.291  -0.600  1.00 14.87 ? 87  ALA A O     1 
ATOM   711  C  CB    . ALA A 1 90  ? 39.269 13.124  2.433   1.00 15.12 ? 87  ALA A CB    1 
ATOM   712  N  N     . ASN A 1 91  ? 40.352 14.711  -0.247  1.00 11.70 ? 88  ASN A N     1 
ATOM   713  C  CA    . ASN A 1 91  ? 40.908 14.581  -1.589  1.00 13.25 ? 88  ASN A CA    1 
ATOM   714  C  C     . ASN A 1 91  ? 42.373 14.158  -1.521  1.00 10.47 ? 88  ASN A C     1 
ATOM   715  O  O     . ASN A 1 91  ? 43.215 14.882  -0.977  1.00 11.79 ? 88  ASN A O     1 
ATOM   716  C  CB    . ASN A 1 91  ? 40.780 15.907  -2.336  1.00 13.65 ? 88  ASN A CB    1 
ATOM   717  C  CG    . ASN A 1 91  ? 41.170 15.783  -3.788  1.00 20.35 ? 88  ASN A CG    1 
ATOM   718  O  OD1   . ASN A 1 91  ? 42.308 15.463  -4.098  1.00 13.11 ? 88  ASN A OD1   1 
ATOM   719  N  ND2   . ASN A 1 91  ? 40.215 16.006  -4.686  1.00 25.34 ? 88  ASN A ND2   1 
ATOM   720  N  N     . LEU A 1 92  ? 42.690 12.980  -2.048  1.00 11.82 ? 89  LEU A N     1 
ATOM   721  C  CA    . LEU A 1 92  ? 44.034 12.434  -1.844  1.00 12.62 ? 89  LEU A CA    1 
ATOM   722  C  C     . LEU A 1 92  ? 44.998 12.724  -2.994  1.00 13.01 ? 89  LEU A C     1 
ATOM   723  O  O     . LEU A 1 92  ? 46.041 12.085  -3.108  1.00 10.20 ? 89  LEU A O     1 
ATOM   724  C  CB    . LEU A 1 92  ? 43.977 10.924  -1.593  1.00 9.25  ? 89  LEU A CB    1 
ATOM   725  C  CG    . LEU A 1 92  ? 43.052 10.438  -0.477  1.00 10.89 ? 89  LEU A CG    1 
ATOM   726  C  CD1   . LEU A 1 92  ? 42.936 8.922   -0.518  1.00 14.31 ? 89  LEU A CD1   1 
ATOM   727  C  CD2   . LEU A 1 92  ? 43.557 10.924  0.884   1.00 12.06 ? 89  LEU A CD2   1 
ATOM   728  N  N     . THR A 1 93  ? 44.668 13.702  -3.826  1.00 8.94  ? 90  THR A N     1 
ATOM   729  C  CA    . THR A 1 93  ? 45.488 13.992  -5.004  1.00 12.91 ? 90  THR A CA    1 
ATOM   730  C  C     . THR A 1 93  ? 46.983 14.241  -4.744  1.00 13.45 ? 90  THR A C     1 
ATOM   731  O  O     . THR A 1 93  ? 47.844 13.748  -5.493  1.00 10.73 ? 90  THR A O     1 
ATOM   732  C  CB    . THR A 1 93  ? 44.905 15.177  -5.802  1.00 19.68 ? 90  THR A CB    1 
ATOM   733  O  OG1   . THR A 1 93  ? 43.578 14.840  -6.230  1.00 17.94 ? 90  THR A OG1   1 
ATOM   734  C  CG2   . THR A 1 93  ? 45.762 15.463  -7.017  1.00 11.79 ? 90  THR A CG2   1 
ATOM   735  N  N     . LYS A 1 94  ? 47.296 15.006  -3.701  1.00 11.23 ? 91  LYS A N     1 
ATOM   736  C  CA    . LYS A 1 94  ? 48.687 15.321  -3.390  1.00 9.90  ? 91  LYS A CA    1 
ATOM   737  C  C     . LYS A 1 94  ? 49.534 14.055  -3.194  1.00 9.20  ? 91  LYS A C     1 
ATOM   738  O  O     . LYS A 1 94  ? 50.691 14.003  -3.616  1.00 9.81  ? 91  LYS A O     1 
ATOM   739  C  CB    . LYS A 1 94  ? 48.774 16.213  -2.145  1.00 11.24 ? 91  LYS A CB    1 
ATOM   740  C  CG    . LYS A 1 94  ? 50.163 16.807  -1.890  1.00 13.10 ? 91  LYS A CG    1 
ATOM   741  C  CD    . LYS A 1 94  ? 50.324 17.317  -0.449  1.00 11.88 ? 91  LYS A CD    1 
ATOM   742  C  CE    . LYS A 1 94  ? 49.327 18.411  -0.107  1.00 14.96 ? 91  LYS A CE    1 
ATOM   743  N  NZ    . LYS A 1 94  ? 49.514 18.921  1.277   1.00 9.52  ? 91  LYS A NZ    1 
ATOM   744  N  N     . TYR A 1 95  ? 48.951 13.036  -2.570  1.00 9.68  ? 92  TYR A N     1 
ATOM   745  C  CA    . TYR A 1 95  ? 49.680 11.810  -2.263  1.00 9.18  ? 92  TYR A CA    1 
ATOM   746  C  C     . TYR A 1 95  ? 49.778 10.930  -3.504  1.00 8.50  ? 92  TYR A C     1 
ATOM   747  O  O     . TYR A 1 95  ? 50.813 10.311  -3.745  1.00 10.31 ? 92  TYR A O     1 
ATOM   748  C  CB    . TYR A 1 95  ? 49.031 11.071  -1.079  1.00 7.53  ? 92  TYR A CB    1 
ATOM   749  C  CG    . TYR A 1 95  ? 48.696 12.050  0.022   1.00 6.75  ? 92  TYR A CG    1 
ATOM   750  C  CD1   . TYR A 1 95  ? 47.387 12.455  0.230   1.00 10.27 ? 92  TYR A CD1   1 
ATOM   751  C  CD2   . TYR A 1 95  ? 49.702 12.640  0.784   1.00 7.11  ? 92  TYR A CD2   1 
ATOM   752  C  CE1   . TYR A 1 95  ? 47.068 13.387  1.207   1.00 8.84  ? 92  TYR A CE1   1 
ATOM   753  C  CE2   . TYR A 1 95  ? 49.401 13.570  1.753   1.00 8.22  ? 92  TYR A CE2   1 
ATOM   754  C  CZ    . TYR A 1 95  ? 48.068 13.943  1.955   1.00 7.82  ? 92  TYR A CZ    1 
ATOM   755  O  OH    . TYR A 1 95  ? 47.727 14.873  2.908   1.00 11.04 ? 92  TYR A OH    1 
ATOM   756  N  N     . ARG A 1 96  ? 48.717 10.906  -4.308  1.00 9.72  ? 93  ARG A N     1 
ATOM   757  C  CA    . ARG A 1 96  ? 48.763 10.160  -5.572  1.00 10.41 ? 93  ARG A CA    1 
ATOM   758  C  C     . ARG A 1 96  ? 49.861 10.705  -6.472  1.00 10.35 ? 93  ARG A C     1 
ATOM   759  O  O     . ARG A 1 96  ? 50.601 9.935   -7.090  1.00 10.81 ? 93  ARG A O     1 
ATOM   760  C  CB    . ARG A 1 96  ? 47.421 10.189  -6.308  1.00 11.83 ? 93  ARG A CB    1 
ATOM   761  C  CG    . ARG A 1 96  ? 46.320 9.426   -5.591  1.00 11.61 ? 93  ARG A CG    1 
ATOM   762  C  CD    . ARG A 1 96  ? 45.122 9.176   -6.495  1.00 12.78 ? 93  ARG A CD    1 
ATOM   763  N  NE    . ARG A 1 96  ? 44.081 8.471   -5.761  1.00 16.35 ? 93  ARG A NE    1 
ATOM   764  C  CZ    . ARG A 1 96  ? 43.055 9.068   -5.168  1.00 13.33 ? 93  ARG A CZ    1 
ATOM   765  N  NH1   . ARG A 1 96  ? 42.172 8.337   -4.493  1.00 15.81 ? 93  ARG A NH1   1 
ATOM   766  N  NH2   . ARG A 1 96  ? 42.909 10.390  -5.252  1.00 11.38 ? 93  ARG A NH2   1 
ATOM   767  N  N     . GLU A 1 97  ? 49.972 12.029  -6.538  1.00 9.71  ? 94  GLU A N     1 
ATOM   768  C  CA    . GLU A 1 97  ? 50.988 12.668  -7.378  1.00 14.21 ? 94  GLU A CA    1 
ATOM   769  C  C     . GLU A 1 97  ? 52.406 12.428  -6.835  1.00 12.16 ? 94  GLU A C     1 
ATOM   770  O  O     . GLU A 1 97  ? 53.348 12.212  -7.600  1.00 10.82 ? 94  GLU A O     1 
ATOM   771  C  CB    . GLU A 1 97  ? 50.702 14.163  -7.558  1.00 13.96 ? 94  GLU A CB    1 
ATOM   772  C  CG    . GLU A 1 97  ? 49.381 14.434  -8.278  1.00 19.66 ? 94  GLU A CG    1 
ATOM   773  C  CD    . GLU A 1 97  ? 49.070 15.917  -8.479  1.00 31.48 ? 94  GLU A CD    1 
ATOM   774  O  OE1   . GLU A 1 97  ? 49.696 16.775  -7.820  1.00 33.68 ? 94  GLU A OE1   1 
ATOM   775  O  OE2   . GLU A 1 97  ? 48.187 16.224  -9.311  1.00 31.50 ? 94  GLU A OE2   1 
ATOM   776  N  N     . ALA A 1 98  ? 52.558 12.448  -5.515  1.00 9.29  ? 95  ALA A N     1 
ATOM   777  C  CA    . ALA A 1 98  ? 53.848 12.111  -4.925  1.00 10.56 ? 95  ALA A CA    1 
ATOM   778  C  C     . ALA A 1 98  ? 54.226 10.657  -5.215  1.00 9.93  ? 95  ALA A C     1 
ATOM   779  O  O     . ALA A 1 98  ? 55.403 10.337  -5.413  1.00 11.05 ? 95  ALA A O     1 
ATOM   780  C  CB    . ALA A 1 98  ? 53.843 12.381  -3.427  1.00 9.44  ? 95  ALA A CB    1 
ATOM   781  N  N     . SER A 1 99  ? 53.226 9.780   -5.216  1.00 9.10  ? 96  SER A N     1 
ATOM   782  C  CA    . SER A 1 99  ? 53.412 8.379   -5.559  1.00 11.34 ? 96  SER A CA    1 
ATOM   783  C  C     . SER A 1 99  ? 53.973 8.223   -6.968  1.00 10.14 ? 96  SER A C     1 
ATOM   784  O  O     . SER A 1 99  ? 54.898 7.445   -7.211  1.00 9.83  ? 96  SER A O     1 
ATOM   785  C  CB    . SER A 1 99  ? 52.074 7.651   -5.496  1.00 11.72 ? 96  SER A CB    1 
ATOM   786  O  OG    . SER A 1 99  ? 52.249 6.282   -5.765  1.00 12.33 ? 96  SER A OG    1 
ATOM   787  N  N     . VAL A 1 100 ? 53.387 8.952   -7.903  1.00 9.81  ? 97  VAL A N     1 
ATOM   788  C  CA    . VAL A 1 100 ? 53.878 8.934   -9.281  1.00 10.55 ? 97  VAL A CA    1 
ATOM   789  C  C     . VAL A 1 100 ? 55.360 9.314   -9.356  1.00 10.97 ? 97  VAL A C     1 
ATOM   790  O  O     . VAL A 1 100 ? 56.126 8.690   -10.096 1.00 10.45 ? 97  VAL A O     1 
ATOM   791  C  CB    . VAL A 1 100 ? 53.028 9.845   -10.181 1.00 13.43 ? 97  VAL A CB    1 
ATOM   792  C  CG1   . VAL A 1 100 ? 53.643 9.951   -11.590 1.00 13.33 ? 97  VAL A CG1   1 
ATOM   793  C  CG2   . VAL A 1 100 ? 51.593 9.311   -10.249 1.00 10.86 ? 97  VAL A CG2   1 
ATOM   794  N  N     . GLU A 1 101 ? 55.775 10.319  -8.584  1.00 7.19  ? 98  GLU A N     1 
ATOM   795  C  CA    . GLU A 1 101 ? 57.183 10.721  -8.562  1.00 11.17 ? 98  GLU A CA    1 
ATOM   796  C  C     . GLU A 1 101 ? 58.084 9.528   -8.253  1.00 13.38 ? 98  GLU A C     1 
ATOM   797  O  O     . GLU A 1 101 ? 59.115 9.313   -8.909  1.00 10.69 ? 98  GLU A O     1 
ATOM   798  C  CB    . GLU A 1 101 ? 57.455 11.790  -7.486  1.00 13.43 ? 98  GLU A CB    1 
ATOM   799  C  CG    . GLU A 1 101 ? 56.926 13.196  -7.751  1.00 15.12 ? 98  GLU A CG    1 
ATOM   800  C  CD    . GLU A 1 101 ? 57.327 14.178  -6.643  1.00 15.06 ? 98  GLU A CD    1 
ATOM   801  O  OE1   . GLU A 1 101 ? 58.526 14.519  -6.546  1.00 13.61 ? 98  GLU A OE1   1 
ATOM   802  O  OE2   . GLU A 1 101 ? 56.446 14.588  -5.852  1.00 15.46 ? 98  GLU A OE2   1 
ATOM   803  N  N     . VAL A 1 102 ? 57.711 8.772   -7.223  1.00 9.52  ? 99  VAL A N     1 
ATOM   804  C  CA    . VAL A 1 102 ? 58.539 7.663   -6.779  1.00 9.16  ? 99  VAL A CA    1 
ATOM   805  C  C     . VAL A 1 102 ? 58.501 6.523   -7.774  1.00 9.82  ? 99  VAL A C     1 
ATOM   806  O  O     . VAL A 1 102 ? 59.545 5.955   -8.118  1.00 13.17 ? 99  VAL A O     1 
ATOM   807  C  CB    . VAL A 1 102 ? 58.106 7.140   -5.402  1.00 10.78 ? 99  VAL A CB    1 
ATOM   808  C  CG1   . VAL A 1 102 ? 58.891 5.880   -5.057  1.00 11.24 ? 99  VAL A CG1   1 
ATOM   809  C  CG2   . VAL A 1 102 ? 58.321 8.223   -4.346  1.00 11.65 ? 99  VAL A CG2   1 
ATOM   810  N  N     . MET A 1 103 ? 57.302 6.201   -8.251  1.00 9.60  ? 100 MET A N     1 
ATOM   811  C  CA    . MET A 1 103 ? 57.132 5.087   -9.171  1.00 9.62  ? 100 MET A CA    1 
ATOM   812  C  C     . MET A 1 103 ? 57.952 5.311   -10.443 1.00 13.87 ? 100 MET A C     1 
ATOM   813  O  O     . MET A 1 103 ? 58.548 4.377   -10.970 1.00 9.76  ? 100 MET A O     1 
ATOM   814  C  CB    . MET A 1 103 ? 55.653 4.861   -9.507  1.00 10.49 ? 100 MET A CB    1 
ATOM   815  C  CG    . MET A 1 103 ? 54.746 4.576   -8.309  1.00 17.70 ? 100 MET A CG    1 
ATOM   816  S  SD    . MET A 1 103 ? 55.061 2.955   -7.586  1.00 21.63 ? 100 MET A SD    1 
ATOM   817  C  CE    . MET A 1 103 ? 54.250 3.058   -5.967  1.00 11.94 ? 100 MET A CE    1 
ATOM   818  N  N     . GLU A 1 104 ? 58.003 6.552   -10.924 1.00 9.28  ? 101 GLU A N     1 
ATOM   819  C  CA    . GLU A 1 104 ? 58.749 6.853   -12.145 1.00 14.19 ? 101 GLU A CA    1 
ATOM   820  C  C     . GLU A 1 104 ? 60.269 6.681   -11.974 1.00 13.49 ? 101 GLU A C     1 
ATOM   821  O  O     . GLU A 1 104 ? 60.945 6.182   -12.865 1.00 11.42 ? 101 GLU A O     1 
ATOM   822  C  CB    . GLU A 1 104 ? 58.359 8.238   -12.703 1.00 12.29 ? 101 GLU A CB    1 
ATOM   823  C  CG    . GLU A 1 104 ? 56.891 8.279   -13.143 1.00 16.25 ? 101 GLU A CG    1 
ATOM   824  C  CD    . GLU A 1 104 ? 56.514 9.535   -13.914 1.00 29.30 ? 101 GLU A CD    1 
ATOM   825  O  OE1   . GLU A 1 104 ? 57.317 10.490  -13.938 1.00 30.99 ? 101 GLU A OE1   1 
ATOM   826  O  OE2   . GLU A 1 104 ? 55.410 9.562   -14.502 1.00 33.82 ? 101 GLU A OE2   1 
ATOM   827  N  N     . ILE A 1 105 ? 60.795 7.062   -10.817 1.00 11.80 ? 102 ILE A N     1 
ATOM   828  C  CA    . ILE A 1 105 ? 62.201 6.821   -10.509 1.00 11.40 ? 102 ILE A CA    1 
ATOM   829  C  C     . ILE A 1 105 ? 62.509 5.318   -10.452 1.00 11.31 ? 102 ILE A C     1 
ATOM   830  O  O     . ILE A 1 105 ? 63.467 4.840   -11.060 1.00 12.36 ? 102 ILE A O     1 
ATOM   831  C  CB    . ILE A 1 105 ? 62.599 7.497   -9.177  1.00 7.85  ? 102 ILE A CB    1 
ATOM   832  C  CG1   . ILE A 1 105 ? 62.428 9.012   -9.281  1.00 12.09 ? 102 ILE A CG1   1 
ATOM   833  C  CG2   . ILE A 1 105 ? 64.033 7.130   -8.760  1.00 10.29 ? 102 ILE A CG2   1 
ATOM   834  C  CD1   . ILE A 1 105 ? 62.321 9.706   -7.933  1.00 13.63 ? 102 ILE A CD1   1 
ATOM   835  N  N     . MET A 1 106 ? 61.692 4.561   -9.732  1.00 10.43 ? 103 MET A N     1 
ATOM   836  C  CA    . MET A 1 106 ? 61.923 3.125   -9.646  1.00 11.47 ? 103 MET A CA    1 
ATOM   837  C  C     . MET A 1 106 ? 61.914 2.459   -11.021 1.00 11.06 ? 103 MET A C     1 
ATOM   838  O  O     . MET A 1 106 ? 62.704 1.560   -11.286 1.00 13.38 ? 103 MET A O     1 
ATOM   839  C  CB    . MET A 1 106 ? 60.865 2.478   -8.747  1.00 10.49 ? 103 MET A CB    1 
ATOM   840  C  CG    A MET A 1 106 ? 60.925 2.903   -7.302  0.58 11.24 ? 103 MET A CG    1 
ATOM   841  C  CG    B MET A 1 106 ? 61.124 2.768   -7.277  0.42 11.31 ? 103 MET A CG    1 
ATOM   842  S  SD    A MET A 1 106 ? 59.663 2.050   -6.345  0.58 13.70 ? 103 MET A SD    1 
ATOM   843  S  SD    B MET A 1 106 ? 60.058 1.837   -6.174  0.42 12.77 ? 103 MET A SD    1 
ATOM   844  C  CE    A MET A 1 106 ? 60.030 0.340   -6.738  0.58 9.82  ? 103 MET A CE    1 
ATOM   845  C  CE    B MET A 1 106 ? 58.457 2.484   -6.649  0.42 10.83 ? 103 MET A CE    1 
ATOM   846  N  N     . SER A 1 107 ? 61.011 2.900   -11.886 1.00 11.40 ? 104 SER A N     1 
ATOM   847  C  CA    A SER A 1 107 ? 60.877 2.311   -13.211 0.21 12.74 ? 104 SER A CA    1 
ATOM   848  C  CA    B SER A 1 107 ? 60.866 2.321   -13.216 0.79 12.91 ? 104 SER A CA    1 
ATOM   849  C  C     . SER A 1 107 ? 62.134 2.491   -14.064 1.00 14.04 ? 104 SER A C     1 
ATOM   850  O  O     . SER A 1 107 ? 62.295 1.814   -15.073 1.00 15.44 ? 104 SER A O     1 
ATOM   851  C  CB    A SER A 1 107 ? 59.654 2.880   -13.934 0.21 14.15 ? 104 SER A CB    1 
ATOM   852  C  CB    B SER A 1 107 ? 59.670 2.946   -13.943 0.79 14.13 ? 104 SER A CB    1 
ATOM   853  O  OG    A SER A 1 107 ? 59.744 4.287   -14.050 0.21 14.57 ? 104 SER A OG    1 
ATOM   854  O  OG    B SER A 1 107 ? 58.442 2.564   -13.350 0.79 16.69 ? 104 SER A OG    1 
ATOM   855  N  N     . ARG A 1 108 ? 63.028 3.397   -13.664 1.00 13.66 ? 105 ARG A N     1 
ATOM   856  C  CA    . ARG A 1 108 ? 64.290 3.579   -14.399 1.00 16.69 ? 105 ARG A CA    1 
ATOM   857  C  C     . ARG A 1 108 ? 65.218 2.385   -14.177 1.00 22.35 ? 105 ARG A C     1 
ATOM   858  O  O     . ARG A 1 108 ? 66.081 2.094   -15.008 1.00 17.91 ? 105 ARG A O     1 
ATOM   859  C  CB    . ARG A 1 108 ? 65.046 4.856   -13.989 1.00 17.06 ? 105 ARG A CB    1 
ATOM   860  C  CG    . ARG A 1 108 ? 64.337 6.179   -14.239 1.00 17.98 ? 105 ARG A CG    1 
ATOM   861  C  CD    . ARG A 1 108 ? 65.341 7.323   -14.397 1.00 21.08 ? 105 ARG A CD    1 
ATOM   862  N  NE    . ARG A 1 108 ? 66.367 7.367   -13.357 1.00 21.01 ? 105 ARG A NE    1 
ATOM   863  C  CZ    . ARG A 1 108 ? 66.375 8.240   -12.349 1.00 18.76 ? 105 ARG A CZ    1 
ATOM   864  N  NH1   . ARG A 1 108 ? 67.350 8.215   -11.449 1.00 21.41 ? 105 ARG A NH1   1 
ATOM   865  N  NH2   . ARG A 1 108 ? 65.409 9.136   -12.238 1.00 16.68 ? 105 ARG A NH2   1 
ATOM   866  N  N     . PHE A 1 109 ? 65.037 1.698   -13.052 1.00 17.36 ? 106 PHE A N     1 
ATOM   867  C  CA    . PHE A 1 109 ? 65.933 0.605   -12.680 1.00 20.88 ? 106 PHE A CA    1 
ATOM   868  C  C     . PHE A 1 109 ? 65.426 -0.751  -13.131 1.00 21.38 ? 106 PHE A C     1 
ATOM   869  O  O     . PHE A 1 109 ? 66.210 -1.639  -13.463 1.00 24.81 ? 106 PHE A O     1 
ATOM   870  C  CB    . PHE A 1 109 ? 66.151 0.581   -11.170 1.00 15.91 ? 106 PHE A CB    1 
ATOM   871  C  CG    . PHE A 1 109 ? 66.882 1.777   -10.644 1.00 20.01 ? 106 PHE A CG    1 
ATOM   872  C  CD1   . PHE A 1 109 ? 66.222 2.980   -10.447 1.00 12.14 ? 106 PHE A CD1   1 
ATOM   873  C  CD2   . PHE A 1 109 ? 68.228 1.700   -10.341 1.00 15.97 ? 106 PHE A CD2   1 
ATOM   874  C  CE1   . PHE A 1 109 ? 66.892 4.079   -9.963  1.00 12.45 ? 106 PHE A CE1   1 
ATOM   875  C  CE2   . PHE A 1 109 ? 68.906 2.796   -9.849  1.00 17.01 ? 106 PHE A CE2   1 
ATOM   876  C  CZ    . PHE A 1 109 ? 68.242 3.990   -9.662  1.00 14.91 ? 106 PHE A CZ    1 
ATOM   877  N  N     . ALA A 1 110 ? 64.111 -0.914  -13.130 1.00 19.98 ? 107 ALA A N     1 
ATOM   878  C  CA    . ALA A 1 110 ? 63.513 -2.183  -13.492 1.00 17.35 ? 107 ALA A CA    1 
ATOM   879  C  C     . ALA A 1 110 ? 62.025 -2.032  -13.674 1.00 22.16 ? 107 ALA A C     1 
ATOM   880  O  O     . ALA A 1 110 ? 61.445 -1.000  -13.336 1.00 22.32 ? 107 ALA A O     1 
ATOM   881  C  CB    . ALA A 1 110 ? 63.803 -3.226  -12.425 1.00 21.14 ? 107 ALA A CB    1 
ATOM   882  N  N     . VAL A 1 111 ? 61.412 -3.069  -14.225 1.00 24.58 ? 108 VAL A N     1 
ATOM   883  C  CA    . VAL A 1 111 ? 59.972 -3.133  -14.330 1.00 25.46 ? 108 VAL A CA    1 
ATOM   884  C  C     . VAL A 1 111 ? 59.385 -3.277  -12.930 1.00 18.02 ? 108 VAL A C     1 
ATOM   885  O  O     . VAL A 1 111 ? 59.908 -4.033  -12.100 1.00 24.11 ? 108 VAL A O     1 
ATOM   886  C  CB    . VAL A 1 111 ? 59.544 -4.312  -15.211 1.00 34.35 ? 108 VAL A CB    1 
ATOM   887  C  CG1   . VAL A 1 111 ? 58.155 -4.807  -14.818 1.00 28.76 ? 108 VAL A CG1   1 
ATOM   888  C  CG2   . VAL A 1 111 ? 59.605 -3.912  -16.682 1.00 36.71 ? 108 VAL A CG2   1 
ATOM   889  N  N     . ILE A 1 112 ? 58.327 -2.523  -12.653 1.00 20.75 ? 109 ILE A N     1 
ATOM   890  C  CA    . ILE A 1 112 ? 57.720 -2.561  -11.322 1.00 14.94 ? 109 ILE A CA    1 
ATOM   891  C  C     . ILE A 1 112 ? 56.255 -2.935  -11.374 1.00 13.42 ? 109 ILE A C     1 
ATOM   892  O  O     . ILE A 1 112 ? 55.597 -2.755  -12.391 1.00 12.18 ? 109 ILE A O     1 
ATOM   893  C  CB    . ILE A 1 112 ? 57.876 -1.218  -10.565 1.00 19.04 ? 109 ILE A CB    1 
ATOM   894  C  CG1   . ILE A 1 112 ? 56.948 -0.154  -11.143 1.00 15.65 ? 109 ILE A CG1   1 
ATOM   895  C  CG2   . ILE A 1 112 ? 59.332 -0.763  -10.572 1.00 17.41 ? 109 ILE A CG2   1 
ATOM   896  C  CD1   . ILE A 1 112 ? 56.872 1.116   -10.309 1.00 18.07 ? 109 ILE A CD1   1 
ATOM   897  N  N     . GLU A 1 113 ? 55.763 -3.489  -10.270 1.00 12.56 ? 110 GLU A N     1 
ATOM   898  C  CA    . GLU A 1 113 ? 54.339 -3.706  -10.075 1.00 13.65 ? 110 GLU A CA    1 
ATOM   899  C  C     . GLU A 1 113 ? 53.894 -2.784  -8.955  1.00 10.80 ? 110 GLU A C     1 
ATOM   900  O  O     . GLU A 1 113 ? 54.336 -2.936  -7.826  1.00 9.89  ? 110 GLU A O     1 
ATOM   901  C  CB    . GLU A 1 113 ? 54.057 -5.157  -9.672  1.00 10.56 ? 110 GLU A CB    1 
ATOM   902  C  CG    . GLU A 1 113 ? 52.579 -5.446  -9.405  1.00 11.07 ? 110 GLU A CG    1 
ATOM   903  C  CD    . GLU A 1 113 ? 52.320 -6.889  -8.986  1.00 22.57 ? 110 GLU A CD    1 
ATOM   904  O  OE1   . GLU A 1 113 ? 51.220 -7.155  -8.458  1.00 24.60 ? 110 GLU A OE1   1 
ATOM   905  O  OE2   . GLU A 1 113 ? 53.207 -7.757  -9.184  1.00 15.01 ? 110 GLU A OE2   1 
ATOM   906  N  N     . ARG A 1 114 ? 53.055 -1.807  -9.273  1.00 12.46 ? 111 ARG A N     1 
ATOM   907  C  CA    . ARG A 1 114 ? 52.509 -0.918  -8.244  1.00 13.44 ? 111 ARG A CA    1 
ATOM   908  C  C     . ARG A 1 114 ? 51.618 -1.733  -7.332  1.00 14.84 ? 111 ARG A C     1 
ATOM   909  O  O     . ARG A 1 114 ? 50.600 -2.280  -7.762  1.00 18.25 ? 111 ARG A O     1 
ATOM   910  C  CB    . ARG A 1 114 ? 51.700 0.216   -8.888  1.00 11.86 ? 111 ARG A CB    1 
ATOM   911  C  CG    . ARG A 1 114 ? 51.136 1.234   -7.900  1.00 15.62 ? 111 ARG A CG    1 
ATOM   912  C  CD    . ARG A 1 114 ? 49.960 1.970   -8.516  1.00 14.91 ? 111 ARG A CD    1 
ATOM   913  N  NE    . ARG A 1 114 ? 49.625 3.215   -7.832  1.00 16.79 ? 111 ARG A NE    1 
ATOM   914  C  CZ    . ARG A 1 114 ? 48.673 3.332   -6.910  1.00 20.92 ? 111 ARG A CZ    1 
ATOM   915  N  NH1   . ARG A 1 114 ? 47.960 2.271   -6.548  1.00 20.08 ? 111 ARG A NH1   1 
ATOM   916  N  NH2   . ARG A 1 114 ? 48.431 4.512   -6.347  1.00 18.93 ? 111 ARG A NH2   1 
ATOM   917  N  N     . ALA A 1 115 ? 51.990 -1.832  -6.066  1.00 12.45 ? 112 ALA A N     1 
ATOM   918  C  CA    . ALA A 1 115 ? 51.227 -2.665  -5.161  1.00 11.67 ? 112 ALA A CA    1 
ATOM   919  C  C     . ALA A 1 115 ? 50.232 -1.858  -4.319  1.00 15.26 ? 112 ALA A C     1 
ATOM   920  O  O     . ALA A 1 115 ? 49.215 -2.391  -3.874  1.00 19.27 ? 112 ALA A O     1 
ATOM   921  C  CB    . ALA A 1 115 ? 52.170 -3.485  -4.267  1.00 12.14 ? 112 ALA A CB    1 
ATOM   922  N  N     . SER A 1 116 ? 50.546 -0.585  -4.095  1.00 12.37 ? 113 SER A N     1 
ATOM   923  C  CA    . SER A 1 116 ? 49.678 0.331   -3.360  1.00 13.08 ? 113 SER A CA    1 
ATOM   924  C  C     . SER A 1 116 ? 50.186 1.731   -3.657  1.00 11.51 ? 113 SER A C     1 
ATOM   925  O  O     . SER A 1 116 ? 51.175 1.887   -4.361  1.00 11.17 ? 113 SER A O     1 
ATOM   926  C  CB    . SER A 1 116 ? 49.805 0.093   -1.861  1.00 17.37 ? 113 SER A CB    1 
ATOM   927  O  OG    . SER A 1 116 ? 51.090 0.513   -1.422  1.00 15.51 ? 113 SER A OG    1 
ATOM   928  N  N     . ILE A 1 117 ? 49.539 2.750   -3.096  1.00 9.92  ? 114 ILE A N     1 
ATOM   929  C  CA    . ILE A 1 117 ? 49.995 4.125   -3.296  1.00 8.32  ? 114 ILE A CA    1 
ATOM   930  C  C     . ILE A 1 117 ? 51.480 4.319   -2.926  1.00 12.48 ? 114 ILE A C     1 
ATOM   931  O  O     . ILE A 1 117 ? 52.145 5.200   -3.462  1.00 9.35  ? 114 ILE A O     1 
ATOM   932  C  CB    . ILE A 1 117 ? 49.133 5.136   -2.480  1.00 9.39  ? 114 ILE A CB    1 
ATOM   933  C  CG1   . ILE A 1 117 ? 49.281 6.559   -3.021  1.00 9.96  ? 114 ILE A CG1   1 
ATOM   934  C  CG2   . ILE A 1 117 ? 49.495 5.085   -1.009  1.00 11.73 ? 114 ILE A CG2   1 
ATOM   935  C  CD1   . ILE A 1 117 ? 48.131 7.478   -2.608  1.00 12.92 ? 114 ILE A CD1   1 
ATOM   936  N  N     . ASP A 1 118 ? 52.021 3.508   -2.020  1.00 7.29  ? 115 ASP A N     1 
ATOM   937  C  CA    . ASP A 1 118 ? 53.395 3.779   -1.602  1.00 9.27  ? 115 ASP A CA    1 
ATOM   938  C  C     . ASP A 1 118 ? 54.372 2.611   -1.670  1.00 11.15 ? 115 ASP A C     1 
ATOM   939  O  O     . ASP A 1 118 ? 55.454 2.664   -1.065  1.00 11.67 ? 115 ASP A O     1 
ATOM   940  C  CB    . ASP A 1 118 ? 53.414 4.420   -0.215  1.00 9.72  ? 115 ASP A CB    1 
ATOM   941  C  CG    . ASP A 1 118 ? 53.528 3.405   0.894   1.00 12.05 ? 115 ASP A CG    1 
ATOM   942  O  OD1   . ASP A 1 118 ? 54.302 3.711   1.819   1.00 11.84 ? 115 ASP A OD1   1 
ATOM   943  O  OD2   . ASP A 1 118 ? 52.864 2.322   0.848   1.00 12.09 ? 115 ASP A OD2   1 
ATOM   944  N  N     . GLU A 1 119 ? 54.025 1.575   -2.423  1.00 9.89  ? 116 GLU A N     1 
ATOM   945  C  CA    . GLU A 1 119 ? 54.973 0.493   -2.613  1.00 10.89 ? 116 GLU A CA    1 
ATOM   946  C  C     . GLU A 1 119 ? 54.871 -0.193  -3.957  1.00 10.07 ? 116 GLU A C     1 
ATOM   947  O  O     . GLU A 1 119 ? 53.813 -0.212  -4.605  1.00 7.23  ? 116 GLU A O     1 
ATOM   948  C  CB    . GLU A 1 119 ? 54.854 -0.536  -1.501  1.00 16.72 ? 116 GLU A CB    1 
ATOM   949  C  CG    . GLU A 1 119 ? 53.660 -1.406  -1.592  1.00 17.82 ? 116 GLU A CG    1 
ATOM   950  C  CD    . GLU A 1 119 ? 53.209 -1.848  -0.218  1.00 23.64 ? 116 GLU A CD    1 
ATOM   951  O  OE1   . GLU A 1 119 ? 53.468 -3.012  0.143   1.00 20.71 ? 116 GLU A OE1   1 
ATOM   952  O  OE2   . GLU A 1 119 ? 52.619 -1.016  0.505   1.00 22.24 ? 116 GLU A OE2   1 
ATOM   953  N  N     . ALA A 1 120 ? 55.995 -0.766  -4.352  1.00 9.60  ? 117 ALA A N     1 
ATOM   954  C  CA    . ALA A 1 120 ? 56.100 -1.415  -5.629  1.00 10.55 ? 117 ALA A CA    1 
ATOM   955  C  C     . ALA A 1 120 ? 57.028 -2.609  -5.486  1.00 10.34 ? 117 ALA A C     1 
ATOM   956  O  O     . ALA A 1 120 ? 58.043 -2.536  -4.794  1.00 11.15 ? 117 ALA A O     1 
ATOM   957  C  CB    . ALA A 1 120 ? 56.655 -0.448  -6.647  1.00 12.27 ? 117 ALA A CB    1 
ATOM   958  N  N     . TYR A 1 121 ? 56.675 -3.704  -6.146  1.00 10.05 ? 118 TYR A N     1 
ATOM   959  C  CA    . TYR A 1 121 ? 57.604 -4.810  -6.300  1.00 9.99  ? 118 TYR A CA    1 
ATOM   960  C  C     . TYR A 1 121 ? 58.470 -4.578  -7.512  1.00 12.88 ? 118 TYR A C     1 
ATOM   961  O  O     . TYR A 1 121 ? 58.033 -3.952  -8.469  1.00 10.95 ? 118 TYR A O     1 
ATOM   962  C  CB    . TYR A 1 121 ? 56.836 -6.109  -6.462  1.00 8.13  ? 118 TYR A CB    1 
ATOM   963  C  CG    . TYR A 1 121 ? 56.107 -6.504  -5.205  1.00 10.20 ? 118 TYR A CG    1 
ATOM   964  C  CD1   . TYR A 1 121 ? 54.784 -6.137  -5.004  1.00 11.82 ? 118 TYR A CD1   1 
ATOM   965  C  CD2   . TYR A 1 121 ? 56.750 -7.221  -4.209  1.00 13.11 ? 118 TYR A CD2   1 
ATOM   966  C  CE1   . TYR A 1 121 ? 54.107 -6.497  -3.851  1.00 14.30 ? 118 TYR A CE1   1 
ATOM   967  C  CE2   . TYR A 1 121 ? 56.082 -7.587  -3.048  1.00 10.09 ? 118 TYR A CE2   1 
ATOM   968  C  CZ    . TYR A 1 121 ? 54.769 -7.215  -2.875  1.00 12.87 ? 118 TYR A CZ    1 
ATOM   969  O  OH    . TYR A 1 121 ? 54.110 -7.586  -1.732  1.00 14.67 ? 118 TYR A OH    1 
ATOM   970  N  N     . VAL A 1 122 ? 59.689 -5.108  -7.460  1.00 8.71  ? 119 VAL A N     1 
ATOM   971  C  CA    . VAL A 1 122 ? 60.683 -4.952  -8.506  1.00 11.57 ? 119 VAL A CA    1 
ATOM   972  C  C     . VAL A 1 122 ? 61.221 -6.327  -8.872  1.00 11.98 ? 119 VAL A C     1 
ATOM   973  O  O     . VAL A 1 122 ? 61.682 -7.046  -7.986  1.00 10.32 ? 119 VAL A O     1 
ATOM   974  C  CB    . VAL A 1 122 ? 61.883 -4.138  -7.952  1.00 13.50 ? 119 VAL A CB    1 
ATOM   975  C  CG1   . VAL A 1 122 ? 62.719 -3.614  -9.080  1.00 19.85 ? 119 VAL A CG1   1 
ATOM   976  C  CG2   . VAL A 1 122 ? 61.392 -2.995  -7.071  1.00 18.26 ? 119 VAL A CG2   1 
ATOM   977  N  N     . ASP A 1 123 ? 61.183 -6.711  -10.149 1.00 10.94 ? 120 ASP A N     1 
ATOM   978  C  CA    . ASP A 1 123 ? 61.886 -7.931  -10.576 1.00 10.87 ? 120 ASP A CA    1 
ATOM   979  C  C     . ASP A 1 123 ? 63.307 -7.586  -11.039 1.00 16.05 ? 120 ASP A C     1 
ATOM   980  O  O     . ASP A 1 123 ? 63.502 -7.055  -12.120 1.00 17.54 ? 120 ASP A O     1 
ATOM   981  C  CB    . ASP A 1 123 ? 61.114 -8.689  -11.670 1.00 17.68 ? 120 ASP A CB    1 
ATOM   982  C  CG    . ASP A 1 123 ? 61.680 -10.094 -11.925 1.00 20.79 ? 120 ASP A CG    1 
ATOM   983  O  OD1   . ASP A 1 123 ? 62.915 -10.252 -12.004 1.00 19.98 ? 120 ASP A OD1   1 
ATOM   984  O  OD2   . ASP A 1 123 ? 60.889 -11.054 -12.036 1.00 33.02 ? 120 ASP A OD2   1 
ATOM   985  N  N     . LEU A 1 124 ? 64.296 -7.887  -10.210 1.00 12.35 ? 121 LEU A N     1 
ATOM   986  C  CA    . LEU A 1 124 ? 65.679 -7.486  -10.472 1.00 13.34 ? 121 LEU A CA    1 
ATOM   987  C  C     . LEU A 1 124 ? 66.514 -8.581  -11.141 1.00 11.81 ? 121 LEU A C     1 
ATOM   988  O  O     . LEU A 1 124 ? 67.729 -8.433  -11.278 1.00 12.55 ? 121 LEU A O     1 
ATOM   989  C  CB    . LEU A 1 124 ? 66.355 -7.097  -9.157  1.00 13.45 ? 121 LEU A CB    1 
ATOM   990  C  CG    . LEU A 1 124 ? 65.797 -5.890  -8.402  1.00 15.33 ? 121 LEU A CG    1 
ATOM   991  C  CD1   . LEU A 1 124 ? 66.307 -5.852  -6.969  1.00 13.34 ? 121 LEU A CD1   1 
ATOM   992  C  CD2   . LEU A 1 124 ? 66.153 -4.615  -9.152  1.00 19.28 ? 121 LEU A CD2   1 
ATOM   993  N  N     . THR A 1 125 ? 65.884 -9.689  -11.519 1.00 12.83 ? 122 THR A N     1 
ATOM   994  C  CA    . THR A 1 125 ? 66.658 -10.840 -11.993 1.00 10.84 ? 122 THR A CA    1 
ATOM   995  C  C     . THR A 1 125 ? 67.629 -10.464 -13.117 1.00 12.87 ? 122 THR A C     1 
ATOM   996  O  O     . THR A 1 125 ? 68.826 -10.756 -13.040 1.00 13.11 ? 122 THR A O     1 
ATOM   997  C  CB    . THR A 1 125 ? 65.766 -11.999 -12.428 1.00 16.71 ? 122 THR A CB    1 
ATOM   998  O  OG1   . THR A 1 125 ? 64.838 -12.299 -11.378 1.00 14.76 ? 122 THR A OG1   1 
ATOM   999  C  CG2   . THR A 1 125 ? 66.624 -13.241 -12.732 1.00 14.11 ? 122 THR A CG2   1 
ATOM   1000 N  N     . SER A 1 126 ? 67.122 -9.787  -14.141 1.00 15.51 ? 123 SER A N     1 
ATOM   1001 C  CA    . SER A 1 126 ? 67.961 -9.437  -15.288 1.00 16.30 ? 123 SER A CA    1 
ATOM   1002 C  C     . SER A 1 126 ? 69.002 -8.373  -14.926 1.00 17.56 ? 123 SER A C     1 
ATOM   1003 O  O     . SER A 1 126 ? 70.167 -8.477  -15.319 1.00 19.27 ? 123 SER A O     1 
ATOM   1004 C  CB    . SER A 1 126 ? 67.109 -8.970  -16.464 1.00 18.25 ? 123 SER A CB    1 
ATOM   1005 O  OG    A SER A 1 126 ? 66.104 -9.914  -16.776 0.42 23.09 ? 123 SER A OG    1 
ATOM   1006 O  OG    B SER A 1 126 ? 66.406 -7.790  -16.143 0.58 20.82 ? 123 SER A OG    1 
ATOM   1007 N  N     . ALA A 1 127 ? 68.589 -7.364  -14.163 1.00 14.18 ? 124 ALA A N     1 
ATOM   1008 C  CA    . ALA A 1 127 ? 69.506 -6.314  -13.732 1.00 17.87 ? 124 ALA A CA    1 
ATOM   1009 C  C     . ALA A 1 127 ? 70.679 -6.899  -12.960 1.00 18.76 ? 124 ALA A C     1 
ATOM   1010 O  O     . ALA A 1 127 ? 71.808 -6.426  -13.076 1.00 15.52 ? 124 ALA A O     1 
ATOM   1011 C  CB    . ALA A 1 127 ? 68.777 -5.261  -12.882 1.00 15.37 ? 124 ALA A CB    1 
ATOM   1012 N  N     . VAL A 1 128 ? 70.410 -7.934  -12.168 1.00 13.03 ? 125 VAL A N     1 
ATOM   1013 C  CA    . VAL A 1 128 ? 71.471 -8.576  -11.398 1.00 16.65 ? 125 VAL A CA    1 
ATOM   1014 C  C     . VAL A 1 128 ? 72.471 -9.295  -12.306 1.00 15.78 ? 125 VAL A C     1 
ATOM   1015 O  O     . VAL A 1 128 ? 73.681 -9.159  -12.133 1.00 17.05 ? 125 VAL A O     1 
ATOM   1016 C  CB    . VAL A 1 128 ? 70.897 -9.548  -10.340 1.00 15.51 ? 125 VAL A CB    1 
ATOM   1017 C  CG1   . VAL A 1 128 ? 71.956 -10.553 -9.884  1.00 14.63 ? 125 VAL A CG1   1 
ATOM   1018 C  CG2   . VAL A 1 128 ? 70.350 -8.753  -9.146  1.00 12.48 ? 125 VAL A CG2   1 
ATOM   1019 N  N     . GLN A 1 129 ? 71.961 -10.048 -13.273 1.00 18.25 ? 126 GLN A N     1 
ATOM   1020 C  CA    . GLN A 1 129 ? 72.826 -10.730 -14.227 1.00 24.34 ? 126 GLN A CA    1 
ATOM   1021 C  C     . GLN A 1 129 ? 73.759 -9.722  -14.890 1.00 25.76 ? 126 GLN A C     1 
ATOM   1022 O  O     . GLN A 1 129 ? 74.964 -9.947  -14.993 1.00 26.85 ? 126 GLN A O     1 
ATOM   1023 C  CB    . GLN A 1 129 ? 72.001 -11.464 -15.284 1.00 25.65 ? 126 GLN A CB    1 
ATOM   1024 C  CG    . GLN A 1 129 ? 71.096 -12.561 -14.728 1.00 30.36 ? 126 GLN A CG    1 
ATOM   1025 C  CD    . GLN A 1 129 ? 71.875 -13.741 -14.157 1.00 41.43 ? 126 GLN A CD    1 
ATOM   1026 O  OE1   . GLN A 1 129 ? 73.001 -14.021 -14.575 1.00 45.26 ? 126 GLN A OE1   1 
ATOM   1027 N  NE2   . GLN A 1 129 ? 71.273 -14.439 -13.198 1.00 40.45 ? 126 GLN A NE2   1 
ATOM   1028 N  N     . GLU A 1 130 ? 73.195 -8.599  -15.321 1.00 22.42 ? 127 GLU A N     1 
ATOM   1029 C  CA    . GLU A 1 130 ? 73.980 -7.547  -15.950 1.00 31.77 ? 127 GLU A CA    1 
ATOM   1030 C  C     . GLU A 1 130 ? 75.089 -7.013  -15.049 1.00 30.39 ? 127 GLU A C     1 
ATOM   1031 O  O     . GLU A 1 130 ? 76.245 -6.924  -15.464 1.00 29.74 ? 127 GLU A O     1 
ATOM   1032 C  CB    . GLU A 1 130 ? 73.077 -6.394  -16.389 1.00 29.42 ? 127 GLU A CB    1 
ATOM   1033 C  CG    . GLU A 1 130 ? 72.218 -6.712  -17.592 1.00 36.44 ? 127 GLU A CG    1 
ATOM   1034 C  CD    . GLU A 1 130 ? 71.763 -5.456  -18.319 1.00 59.14 ? 127 GLU A CD    1 
ATOM   1035 O  OE1   . GLU A 1 130 ? 72.528 -4.465  -18.336 1.00 55.56 ? 127 GLU A OE1   1 
ATOM   1036 O  OE2   . GLU A 1 130 ? 70.640 -5.457  -18.870 1.00 66.45 ? 127 GLU A OE2   1 
ATOM   1037 N  N     . ARG A 1 131 ? 74.735 -6.638  -13.825 1.00 22.15 ? 128 ARG A N     1 
ATOM   1038 C  CA    . ARG A 1 131 ? 75.719 -6.090  -12.897 1.00 22.26 ? 128 ARG A CA    1 
ATOM   1039 C  C     . ARG A 1 131 ? 76.809 -7.114  -12.600 1.00 25.64 ? 128 ARG A C     1 
ATOM   1040 O  O     . ARG A 1 131 ? 77.976 -6.756  -12.446 1.00 26.42 ? 128 ARG A O     1 
ATOM   1041 C  CB    . ARG A 1 131 ? 75.046 -5.623  -11.602 1.00 19.95 ? 128 ARG A CB    1 
ATOM   1042 C  CG    . ARG A 1 131 ? 76.002 -4.993  -10.582 1.00 25.34 ? 128 ARG A CG    1 
ATOM   1043 C  CD    . ARG A 1 131 ? 76.589 -3.693  -11.113 1.00 22.77 ? 128 ARG A CD    1 
ATOM   1044 N  NE    . ARG A 1 131 ? 75.515 -2.745  -11.362 1.00 34.03 ? 128 ARG A NE    1 
ATOM   1045 C  CZ    . ARG A 1 131 ? 75.087 -1.866  -10.463 1.00 30.83 ? 128 ARG A CZ    1 
ATOM   1046 N  NH1   . ARG A 1 131 ? 75.676 -1.795  -9.276  1.00 25.08 ? 128 ARG A NH1   1 
ATOM   1047 N  NH2   . ARG A 1 131 ? 74.088 -1.047  -10.761 1.00 38.99 ? 128 ARG A NH2   1 
ATOM   1048 N  N     . LEU A 1 132 ? 76.430 -8.387  -12.534 1.00 22.38 ? 129 LEU A N     1 
ATOM   1049 C  CA    . LEU A 1 132 ? 77.395 -9.463  -12.288 1.00 21.65 ? 129 LEU A CA    1 
ATOM   1050 C  C     . LEU A 1 132 ? 78.470 -9.548  -13.379 1.00 32.32 ? 129 LEU A C     1 
ATOM   1051 O  O     . LEU A 1 132 ? 79.641 -9.793  -13.087 1.00 28.75 ? 129 LEU A O     1 
ATOM   1052 C  CB    . LEU A 1 132 ? 76.685 -10.811 -12.109 1.00 23.98 ? 129 LEU A CB    1 
ATOM   1053 C  CG    . LEU A 1 132 ? 76.259 -11.133 -10.666 1.00 19.54 ? 129 LEU A CG    1 
ATOM   1054 C  CD1   . LEU A 1 132 ? 75.261 -12.274 -10.589 1.00 22.02 ? 129 LEU A CD1   1 
ATOM   1055 C  CD2   . LEU A 1 132 ? 77.474 -11.427 -9.795  1.00 25.10 ? 129 LEU A CD2   1 
ATOM   1056 N  N     . GLN A 1 133 ? 78.067 -9.341  -14.630 1.00 37.12 ? 130 GLN A N     1 
ATOM   1057 C  CA    . GLN A 1 133 ? 79.021 -9.270  -15.738 1.00 38.82 ? 130 GLN A CA    1 
ATOM   1058 C  C     . GLN A 1 133 ? 79.970 -8.082  -15.594 1.00 39.46 ? 130 GLN A C     1 
ATOM   1059 O  O     . GLN A 1 133 ? 81.176 -8.222  -15.788 1.00 46.55 ? 130 GLN A O     1 
ATOM   1060 C  CB    . GLN A 1 133 ? 78.294 -9.227  -17.077 1.00 41.89 ? 130 GLN A CB    1 
ATOM   1061 C  CG    . GLN A 1 133 ? 77.531 -10.505 -17.385 1.00 47.05 ? 130 GLN A CG    1 
ATOM   1062 C  CD    . GLN A 1 133 ? 76.683 -10.388 -18.638 1.00 63.34 ? 130 GLN A CD    1 
ATOM   1063 O  OE1   . GLN A 1 133 ? 76.613 -9.324  -19.258 1.00 64.76 ? 130 GLN A OE1   1 
ATOM   1064 N  NE2   . GLN A 1 133 ? 76.030 -11.484 -19.017 1.00 68.73 ? 130 GLN A NE2   1 
ATOM   1065 N  N     . LYS A 1 134 ? 79.432 -6.918  -15.242 1.00 36.57 ? 131 LYS A N     1 
ATOM   1066 C  CA    . LYS A 1 134 ? 80.272 -5.750  -14.978 1.00 41.23 ? 131 LYS A CA    1 
ATOM   1067 C  C     . LYS A 1 134 ? 81.320 -6.056  -13.909 1.00 48.09 ? 131 LYS A C     1 
ATOM   1068 O  O     . LYS A 1 134 ? 82.503 -5.755  -14.081 1.00 47.17 ? 131 LYS A O     1 
ATOM   1069 C  CB    . LYS A 1 134 ? 79.434 -4.534  -14.558 1.00 43.53 ? 131 LYS A CB    1 
ATOM   1070 C  CG    . LYS A 1 134 ? 78.831 -3.749  -15.718 1.00 44.31 ? 131 LYS A CG    1 
ATOM   1071 C  CD    . LYS A 1 134 ? 78.214 -2.431  -15.253 1.00 48.17 ? 131 LYS A CD    1 
ATOM   1072 C  CE    . LYS A 1 134 ? 76.922 -2.651  -14.471 1.00 49.10 ? 131 LYS A CE    1 
ATOM   1073 N  NZ    . LYS A 1 134 ? 76.280 -1.366  -14.046 1.00 46.04 ? 131 LYS A NZ    1 
ATOM   1074 N  N     . LEU A 1 135 ? 80.877 -6.659  -12.809 1.00 40.76 ? 132 LEU A N     1 
ATOM   1075 C  CA    . LEU A 1 135 ? 81.757 -6.949  -11.682 1.00 47.17 ? 132 LEU A CA    1 
ATOM   1076 C  C     . LEU A 1 135 ? 82.968 -7.796  -12.066 1.00 51.17 ? 132 LEU A C     1 
ATOM   1077 O  O     . LEU A 1 135 ? 84.065 -7.593  -11.543 1.00 51.91 ? 132 LEU A O     1 
ATOM   1078 C  CB    . LEU A 1 135 ? 80.975 -7.625  -10.554 1.00 45.43 ? 132 LEU A CB    1 
ATOM   1079 C  CG    . LEU A 1 135 ? 80.035 -6.684  -9.805  1.00 40.34 ? 132 LEU A CG    1 
ATOM   1080 C  CD1   . LEU A 1 135 ? 79.325 -7.417  -8.676  1.00 37.20 ? 132 LEU A CD1   1 
ATOM   1081 C  CD2   . LEU A 1 135 ? 80.815 -5.491  -9.271  1.00 46.33 ? 132 LEU A CD2   1 
ATOM   1082 N  N     . GLN A 1 136 ? 82.763 -8.745  -12.976 1.00 50.01 ? 133 GLN A N     1 
ATOM   1083 C  CA    . GLN A 1 136 ? 83.844 -9.614  -13.431 1.00 53.12 ? 133 GLN A CA    1 
ATOM   1084 C  C     . GLN A 1 136 ? 84.511 -10.327 -12.256 1.00 51.77 ? 133 GLN A C     1 
ATOM   1085 O  O     . GLN A 1 136 ? 85.716 -10.189 -12.048 1.00 50.43 ? 133 GLN A O     1 
ATOM   1086 C  CB    . GLN A 1 136 ? 84.898 -8.806  -14.193 1.00 48.54 ? 133 GLN A CB    1 
ATOM   1087 C  CG    . GLN A 1 136 ? 84.355 -7.986  -15.352 1.00 48.73 ? 133 GLN A CG    1 
ATOM   1088 C  CD    . GLN A 1 136 ? 84.504 -8.687  -16.690 1.00 61.74 ? 133 GLN A CD    1 
ATOM   1089 O  OE1   . GLN A 1 136 ? 84.246 -8.098  -17.742 1.00 63.02 ? 133 GLN A OE1   1 
ATOM   1090 N  NE2   . GLN A 1 136 ? 84.924 -9.949  -16.658 1.00 61.88 ? 133 GLN A NE2   1 
ATOM   1091 N  N     . GLY A 1 137 ? 83.727 -11.078 -11.487 1.00 45.75 ? 134 GLY A N     1 
ATOM   1092 C  CA    . GLY A 1 137 ? 84.259 -11.850 -10.376 1.00 43.25 ? 134 GLY A CA    1 
ATOM   1093 C  C     . GLY A 1 137 ? 84.872 -11.002 -9.277  1.00 45.35 ? 134 GLY A C     1 
ATOM   1094 O  O     . GLY A 1 137 ? 85.584 -11.508 -8.414  1.00 46.50 ? 134 GLY A O     1 
ATOM   1095 N  N     . GLN A 1 138 ? 84.601 -9.704  -9.310  1.00 45.25 ? 135 GLN A N     1 
ATOM   1096 C  CA    . GLN A 1 138 ? 85.075 -8.801  -8.270  1.00 46.28 ? 135 GLN A CA    1 
ATOM   1097 C  C     . GLN A 1 138 ? 84.171 -8.890  -7.042  1.00 42.63 ? 135 GLN A C     1 
ATOM   1098 O  O     . GLN A 1 138 ? 82.950 -8.851  -7.163  1.00 38.05 ? 135 GLN A O     1 
ATOM   1099 C  CB    . GLN A 1 138 ? 85.115 -7.368  -8.804  1.00 48.82 ? 135 GLN A CB    1 
ATOM   1100 C  CG    . GLN A 1 138 ? 85.492 -6.311  -7.782  1.00 56.75 ? 135 GLN A CG    1 
ATOM   1101 C  CD    . GLN A 1 138 ? 85.576 -4.925  -8.401  1.00 64.89 ? 135 GLN A CD    1 
ATOM   1102 O  OE1   . GLN A 1 138 ? 85.411 -3.911  -7.718  1.00 57.67 ? 135 GLN A OE1   1 
ATOM   1103 N  NE2   . GLN A 1 138 ? 85.833 -4.878  -9.706  1.00 62.92 ? 135 GLN A NE2   1 
ATOM   1104 N  N     . PRO A 1 139 ? 84.774 -9.008  -5.851  1.00 39.00 ? 136 PRO A N     1 
ATOM   1105 C  CA    . PRO A 1 139 ? 84.016 -9.141  -4.603  1.00 37.76 ? 136 PRO A CA    1 
ATOM   1106 C  C     . PRO A 1 139 ? 83.163 -7.907  -4.327  1.00 38.02 ? 136 PRO A C     1 
ATOM   1107 O  O     . PRO A 1 139 ? 83.402 -6.842  -4.895  1.00 36.78 ? 136 PRO A O     1 
ATOM   1108 C  CB    . PRO A 1 139 ? 85.114 -9.266  -3.545  1.00 40.80 ? 136 PRO A CB    1 
ATOM   1109 C  CG    . PRO A 1 139 ? 86.288 -8.586  -4.146  1.00 42.71 ? 136 PRO A CG    1 
ATOM   1110 C  CD    . PRO A 1 139 ? 86.221 -8.918  -5.604  1.00 44.93 ? 136 PRO A CD    1 
ATOM   1111 N  N     . ILE A 1 140 ? 82.171 -8.055  -3.458  1.00 35.76 ? 137 ILE A N     1 
ATOM   1112 C  CA    . ILE A 1 140 ? 81.295 -6.946  -3.118  1.00 28.91 ? 137 ILE A CA    1 
ATOM   1113 C  C     . ILE A 1 140 ? 81.713 -6.345  -1.790  1.00 24.22 ? 137 ILE A C     1 
ATOM   1114 O  O     . ILE A 1 140 ? 81.730 -7.021  -0.766  1.00 26.62 ? 137 ILE A O     1 
ATOM   1115 C  CB    . ILE A 1 140 ? 79.824 -7.391  -3.085  1.00 28.95 ? 137 ILE A CB    1 
ATOM   1116 C  CG1   . ILE A 1 140 ? 79.417 -7.904  -4.469  1.00 34.62 ? 137 ILE A CG1   1 
ATOM   1117 C  CG2   . ILE A 1 140 ? 78.922 -6.246  -2.650  1.00 23.68 ? 137 ILE A CG2   1 
ATOM   1118 C  CD1   . ILE A 1 140 ? 78.066 -8.565  -4.512  1.00 30.36 ? 137 ILE A CD1   1 
ATOM   1119 N  N     . SER A 1 141 ? 82.074 -5.068  -1.828  1.00 25.89 ? 138 SER A N     1 
ATOM   1120 C  CA    . SER A 1 141 ? 82.487 -4.336  -0.641  1.00 25.11 ? 138 SER A CA    1 
ATOM   1121 C  C     . SER A 1 141 ? 81.280 -3.981  0.228   1.00 24.22 ? 138 SER A C     1 
ATOM   1122 O  O     . SER A 1 141 ? 80.208 -3.644  -0.287  1.00 22.50 ? 138 SER A O     1 
ATOM   1123 C  CB    . SER A 1 141 ? 83.234 -3.063  -1.061  1.00 27.12 ? 138 SER A CB    1 
ATOM   1124 O  OG    . SER A 1 141 ? 83.331 -2.135  0.008   1.00 29.45 ? 138 SER A OG    1 
ATOM   1125 N  N     . ALA A 1 142 ? 81.457 -4.052  1.543   1.00 18.26 ? 139 ALA A N     1 
ATOM   1126 C  CA    . ALA A 1 142 ? 80.406 -3.658  2.466   1.00 22.44 ? 139 ALA A CA    1 
ATOM   1127 C  C     . ALA A 1 142 ? 80.035 -2.192  2.262   1.00 25.31 ? 139 ALA A C     1 
ATOM   1128 O  O     . ALA A 1 142 ? 78.946 -1.757  2.642   1.00 20.11 ? 139 ALA A O     1 
ATOM   1129 C  CB    . ALA A 1 142 ? 80.835 -3.896  3.893   1.00 23.87 ? 139 ALA A CB    1 
ATOM   1130 N  N     . ASP A 1 143 ? 80.948 -1.432  1.666   1.00 23.80 ? 140 ASP A N     1 
ATOM   1131 C  CA    . ASP A 1 143 ? 80.692 -0.025  1.387   1.00 26.36 ? 140 ASP A CA    1 
ATOM   1132 C  C     . ASP A 1 143 ? 79.524 0.147   0.427   1.00 24.04 ? 140 ASP A C     1 
ATOM   1133 O  O     . ASP A 1 143 ? 78.871 1.190   0.420   1.00 21.62 ? 140 ASP A O     1 
ATOM   1134 C  CB    . ASP A 1 143 ? 81.939 0.652   0.818   1.00 29.03 ? 140 ASP A CB    1 
ATOM   1135 C  CG    . ASP A 1 143 ? 83.041 0.807   1.854   1.00 40.26 ? 140 ASP A CG    1 
ATOM   1136 O  OD1   . ASP A 1 143 ? 82.726 0.829   3.064   1.00 37.79 ? 140 ASP A OD1   1 
ATOM   1137 O  OD2   . ASP A 1 143 ? 84.222 0.915   1.458   1.00 55.49 ? 140 ASP A OD2   1 
ATOM   1138 N  N     . LEU A 1 144 ? 79.261 -0.884  -0.370  1.00 20.17 ? 141 LEU A N     1 
ATOM   1139 C  CA    . LEU A 1 144 ? 78.188 -0.838  -1.360  1.00 18.56 ? 141 LEU A CA    1 
ATOM   1140 C  C     . LEU A 1 144 ? 76.815 -1.159  -0.771  1.00 18.80 ? 141 LEU A C     1 
ATOM   1141 O  O     . LEU A 1 144 ? 75.799 -1.089  -1.467  1.00 16.94 ? 141 LEU A O     1 
ATOM   1142 C  CB    . LEU A 1 144 ? 78.487 -1.804  -2.487  1.00 15.41 ? 141 LEU A CB    1 
ATOM   1143 C  CG    . LEU A 1 144 ? 79.782 -1.478  -3.227  1.00 21.72 ? 141 LEU A CG    1 
ATOM   1144 C  CD1   . LEU A 1 144 ? 79.959 -2.390  -4.414  1.00 27.54 ? 141 LEU A CD1   1 
ATOM   1145 C  CD2   . LEU A 1 144 ? 79.766 -0.023  -3.663  1.00 23.76 ? 141 LEU A CD2   1 
ATOM   1146 N  N     . LEU A 1 145 ? 76.804 -1.521  0.506   1.00 16.02 ? 142 LEU A N     1 
ATOM   1147 C  CA    . LEU A 1 145 ? 75.596 -1.953  1.201   1.00 14.24 ? 142 LEU A CA    1 
ATOM   1148 C  C     . LEU A 1 145 ? 75.470 -1.191  2.523   1.00 17.06 ? 142 LEU A C     1 
ATOM   1149 O  O     . LEU A 1 145 ? 75.361 -1.782  3.599   1.00 11.88 ? 142 LEU A O     1 
ATOM   1150 C  CB    . LEU A 1 145 ? 75.643 -3.476  1.415   1.00 15.12 ? 142 LEU A CB    1 
ATOM   1151 C  CG    . LEU A 1 145 ? 75.594 -4.305  0.124   1.00 13.38 ? 142 LEU A CG    1 
ATOM   1152 C  CD1   . LEU A 1 145 ? 76.045 -5.769  0.308   1.00 14.74 ? 142 LEU A CD1   1 
ATOM   1153 C  CD2   . LEU A 1 145 ? 74.198 -4.267  -0.471  1.00 17.01 ? 142 LEU A CD2   1 
ATOM   1154 N  N     . PRO A 1 146 ? 75.484 0.149   2.451   1.00 19.09 ? 143 PRO A N     1 
ATOM   1155 C  CA    . PRO A 1 146 ? 75.580 0.924   3.697   1.00 19.00 ? 143 PRO A CA    1 
ATOM   1156 C  C     . PRO A 1 146 ? 74.313 0.923   4.542   1.00 18.96 ? 143 PRO A C     1 
ATOM   1157 O  O     . PRO A 1 146 ? 74.385 1.336   5.692   1.00 16.71 ? 143 PRO A O     1 
ATOM   1158 C  CB    . PRO A 1 146 ? 75.873 2.345   3.202   1.00 25.39 ? 143 PRO A CB    1 
ATOM   1159 C  CG    . PRO A 1 146 ? 75.299 2.388   1.812   1.00 20.61 ? 143 PRO A CG    1 
ATOM   1160 C  CD    . PRO A 1 146 ? 75.525 1.008   1.253   1.00 17.43 ? 143 PRO A CD    1 
ATOM   1161 N  N     . SER A 1 147 ? 73.178 0.489   4.000   1.00 15.23 ? 144 SER A N     1 
ATOM   1162 C  CA    . SER A 1 147 ? 71.953 0.468   4.806   1.00 13.67 ? 144 SER A CA    1 
ATOM   1163 C  C     . SER A 1 147 ? 71.267 -0.910  4.840   1.00 14.71 ? 144 SER A C     1 
ATOM   1164 O  O     . SER A 1 147 ? 70.085 -1.020  5.168   1.00 11.97 ? 144 SER A O     1 
ATOM   1165 C  CB    . SER A 1 147 ? 70.969 1.555   4.338   1.00 14.15 ? 144 SER A CB    1 
ATOM   1166 O  OG    . SER A 1 147 ? 70.542 1.343   2.999   1.00 18.22 ? 144 SER A OG    1 
ATOM   1167 N  N     . THR A 1 148 ? 72.032 -1.956  4.546   1.00 9.84  ? 145 THR A N     1 
ATOM   1168 C  CA    . THR A 1 148 ? 71.491 -3.308  4.404   1.00 11.62 ? 145 THR A CA    1 
ATOM   1169 C  C     . THR A 1 148 ? 71.678 -4.169  5.651   1.00 12.40 ? 145 THR A C     1 
ATOM   1170 O  O     . THR A 1 148 ? 72.756 -4.180  6.267   1.00 14.77 ? 145 THR A O     1 
ATOM   1171 C  CB    . THR A 1 148 ? 72.172 -4.023  3.214   1.00 10.75 ? 145 THR A CB    1 
ATOM   1172 O  OG1   . THR A 1 148 ? 71.890 -3.305  2.017   1.00 9.40  ? 145 THR A OG1   1 
ATOM   1173 C  CG2   . THR A 1 148 ? 71.678 -5.479  3.059   1.00 7.58  ? 145 THR A CG2   1 
ATOM   1174 N  N     . TYR A 1 149 ? 70.613 -4.875  6.028   1.00 9.94  ? 146 TYR A N     1 
ATOM   1175 C  CA    . TYR A 1 149 ? 70.662 -5.887  7.068   1.00 12.72 ? 146 TYR A CA    1 
ATOM   1176 C  C     . TYR A 1 149 ? 70.592 -7.251  6.409   1.00 15.18 ? 146 TYR A C     1 
ATOM   1177 O  O     . TYR A 1 149 ? 69.842 -7.428  5.444   1.00 12.59 ? 146 TYR A O     1 
ATOM   1178 C  CB    . TYR A 1 149 ? 69.455 -5.754  7.980   1.00 12.83 ? 146 TYR A CB    1 
ATOM   1179 C  CG    . TYR A 1 149 ? 69.616 -4.715  9.055   1.00 13.45 ? 146 TYR A CG    1 
ATOM   1180 C  CD1   . TYR A 1 149 ? 70.021 -5.084  10.330  1.00 15.65 ? 146 TYR A CD1   1 
ATOM   1181 C  CD2   . TYR A 1 149 ? 69.348 -3.367  8.804   1.00 13.96 ? 146 TYR A CD2   1 
ATOM   1182 C  CE1   . TYR A 1 149 ? 70.169 -4.147  11.326  1.00 15.79 ? 146 TYR A CE1   1 
ATOM   1183 C  CE2   . TYR A 1 149 ? 69.500 -2.417  9.797   1.00 16.38 ? 146 TYR A CE2   1 
ATOM   1184 C  CZ    . TYR A 1 149 ? 69.912 -2.816  11.058  1.00 21.79 ? 146 TYR A CZ    1 
ATOM   1185 O  OH    . TYR A 1 149 ? 70.061 -1.895  12.071  1.00 21.49 ? 146 TYR A OH    1 
ATOM   1186 N  N     . ILE A 1 150 ? 71.348 -8.218  6.929   1.00 10.18 ? 147 ILE A N     1 
ATOM   1187 C  CA    . ILE A 1 150 ? 71.204 -9.602  6.472   1.00 10.48 ? 147 ILE A CA    1 
ATOM   1188 C  C     . ILE A 1 150 ? 70.466 -10.402 7.538   1.00 11.13 ? 147 ILE A C     1 
ATOM   1189 O  O     . ILE A 1 150 ? 71.012 -10.666 8.609   1.00 12.14 ? 147 ILE A O     1 
ATOM   1190 C  CB    . ILE A 1 150 ? 72.561 -10.285 6.216   1.00 11.36 ? 147 ILE A CB    1 
ATOM   1191 C  CG1   . ILE A 1 150 ? 73.466 -9.417  5.340   1.00 11.16 ? 147 ILE A CG1   1 
ATOM   1192 C  CG2   . ILE A 1 150 ? 72.335 -11.648 5.565   1.00 13.43 ? 147 ILE A CG2   1 
ATOM   1193 C  CD1   . ILE A 1 150 ? 72.941 -9.157  3.920   1.00 10.82 ? 147 ILE A CD1   1 
ATOM   1194 N  N     . GLU A 1 151 ? 69.221 -10.777 7.256   1.00 11.06 ? 148 GLU A N     1 
ATOM   1195 C  CA    . GLU A 1 151 ? 68.381 -11.429 8.257   1.00 11.75 ? 148 GLU A CA    1 
ATOM   1196 C  C     . GLU A 1 151 ? 69.027 -12.731 8.738   1.00 13.58 ? 148 GLU A C     1 
ATOM   1197 O  O     . GLU A 1 151 ? 69.458 -13.539 7.924   1.00 10.99 ? 148 GLU A O     1 
ATOM   1198 C  CB    . GLU A 1 151 ? 66.989 -11.705 7.679   1.00 13.31 ? 148 GLU A CB    1 
ATOM   1199 C  CG    . GLU A 1 151 ? 66.044 -12.475 8.609   1.00 11.61 ? 148 GLU A CG    1 
ATOM   1200 C  CD    . GLU A 1 151 ? 65.865 -11.820 9.957   1.00 19.50 ? 148 GLU A CD    1 
ATOM   1201 O  OE1   . GLU A 1 151 ? 65.576 -12.541 10.936  1.00 17.85 ? 148 GLU A OE1   1 
ATOM   1202 O  OE2   . GLU A 1 151 ? 65.996 -10.581 10.035  1.00 19.99 ? 148 GLU A OE2   1 
ATOM   1203 N  N     . GLY A 1 152 ? 69.101 -12.912 10.055  1.00 11.37 ? 149 GLY A N     1 
ATOM   1204 C  CA    . GLY A 1 152 ? 69.677 -14.114 10.628  1.00 15.26 ? 149 GLY A CA    1 
ATOM   1205 C  C     . GLY A 1 152 ? 71.118 -13.958 11.089  1.00 18.96 ? 149 GLY A C     1 
ATOM   1206 O  O     . GLY A 1 152 ? 71.640 -14.807 11.817  1.00 18.42 ? 149 GLY A O     1 
ATOM   1207 N  N     . LEU A 1 153 ? 71.769 -12.881 10.663  1.00 13.54 ? 150 LEU A N     1 
ATOM   1208 C  CA    . LEU A 1 153 ? 73.147 -12.601 11.080  1.00 14.55 ? 150 LEU A CA    1 
ATOM   1209 C  C     . LEU A 1 153 ? 73.231 -11.288 11.869  1.00 18.11 ? 150 LEU A C     1 
ATOM   1210 O  O     . LEU A 1 153 ? 72.386 -10.423 11.708  1.00 15.39 ? 150 LEU A O     1 
ATOM   1211 C  CB    . LEU A 1 153 ? 74.058 -12.533 9.860   1.00 13.19 ? 150 LEU A CB    1 
ATOM   1212 C  CG    . LEU A 1 153 ? 74.080 -13.777 8.971   1.00 12.81 ? 150 LEU A CG    1 
ATOM   1213 C  CD1   . LEU A 1 153 ? 74.963 -13.549 7.757   1.00 12.27 ? 150 LEU A CD1   1 
ATOM   1214 C  CD2   . LEU A 1 153 ? 74.541 -15.000 9.765   1.00 18.06 ? 150 LEU A CD2   1 
ATOM   1215 N  N     . PRO A 1 154 ? 74.260 -11.136 12.726  1.00 16.25 ? 151 PRO A N     1 
ATOM   1216 C  CA    . PRO A 1 154 ? 75.323 -12.123 12.966  1.00 18.08 ? 151 PRO A CA    1 
ATOM   1217 C  C     . PRO A 1 154 ? 74.850 -13.311 13.804  1.00 17.90 ? 151 PRO A C     1 
ATOM   1218 O  O     . PRO A 1 154 ? 73.829 -13.227 14.481  1.00 20.02 ? 151 PRO A O     1 
ATOM   1219 C  CB    . PRO A 1 154 ? 76.367 -11.323 13.760  1.00 18.60 ? 151 PRO A CB    1 
ATOM   1220 C  CG    . PRO A 1 154 ? 75.572 -10.282 14.473  1.00 23.06 ? 151 PRO A CG    1 
ATOM   1221 C  CD    . PRO A 1 154 ? 74.453 -9.911  13.521  1.00 21.07 ? 151 PRO A CD    1 
ATOM   1222 N  N     . GLN A 1 155 ? 75.598 -14.405 13.741  1.00 20.21 ? 152 GLN A N     1 
ATOM   1223 C  CA    . GLN A 1 155 ? 75.329 -15.596 14.535  1.00 30.85 ? 152 GLN A CA    1 
ATOM   1224 C  C     . GLN A 1 155 ? 76.663 -16.054 15.123  1.00 40.52 ? 152 GLN A C     1 
ATOM   1225 O  O     . GLN A 1 155 ? 77.725 -15.631 14.658  1.00 39.66 ? 152 GLN A O     1 
ATOM   1226 C  CB    . GLN A 1 155 ? 74.754 -16.711 13.664  1.00 25.98 ? 152 GLN A CB    1 
ATOM   1227 C  CG    . GLN A 1 155 ? 75.665 -17.930 13.623  1.00 34.17 ? 152 GLN A CG    1 
ATOM   1228 C  CD    . GLN A 1 155 ? 75.184 -19.004 12.681  1.00 34.20 ? 152 GLN A CD    1 
ATOM   1229 O  OE1   . GLN A 1 155 ? 74.017 -19.411 12.723  1.00 33.47 ? 152 GLN A OE1   1 
ATOM   1230 N  NE2   . GLN A 1 155 ? 76.081 -19.470 11.812  1.00 25.40 ? 152 GLN A NE2   1 
ATOM   1231 N  N     . GLY A 1 156 ? 76.611 -16.911 16.141  1.00 45.46 ? 153 GLY A N     1 
ATOM   1232 C  CA    . GLY A 1 156 ? 77.815 -17.458 16.746  1.00 53.77 ? 153 GLY A CA    1 
ATOM   1233 C  C     . GLY A 1 156 ? 78.645 -16.433 17.499  1.00 66.67 ? 153 GLY A C     1 
ATOM   1234 O  O     . GLY A 1 156 ? 78.095 -15.545 18.156  1.00 69.80 ? 153 GLY A O     1 
ATOM   1235 N  N     . PRO A 1 157 ? 79.982 -16.551 17.409  1.00 76.47 ? 154 PRO A N     1 
ATOM   1236 C  CA    . PRO A 1 157 ? 80.919 -15.634 18.074  1.00 80.50 ? 154 PRO A CA    1 
ATOM   1237 C  C     . PRO A 1 157 ? 80.834 -14.213 17.521  1.00 76.60 ? 154 PRO A C     1 
ATOM   1238 O  O     . PRO A 1 157 ? 81.745 -13.425 17.775  1.00 75.24 ? 154 PRO A O     1 
ATOM   1239 C  CB    . PRO A 1 157 ? 82.290 -16.238 17.747  1.00 65.93 ? 154 PRO A CB    1 
ATOM   1240 C  CG    . PRO A 1 157 ? 82.069 -17.022 16.498  1.00 60.00 ? 154 PRO A CG    1 
ATOM   1241 C  CD    . PRO A 1 157 ? 80.688 -17.591 16.640  1.00 67.67 ? 154 PRO A CD    1 
ATOM   1242 N  N     . THR A 1 163 ? 79.115 -5.145  19.633  1.00 76.48 ? 160 THR A N     1 
ATOM   1243 C  CA    . THR A 1 163 ? 77.846 -5.858  19.512  1.00 73.06 ? 160 THR A CA    1 
ATOM   1244 C  C     . THR A 1 163 ? 76.802 -5.244  20.447  1.00 67.16 ? 160 THR A C     1 
ATOM   1245 O  O     . THR A 1 163 ? 75.743 -5.824  20.694  1.00 68.60 ? 160 THR A O     1 
ATOM   1246 C  CB    . THR A 1 163 ? 78.020 -7.374  19.786  1.00 72.90 ? 160 THR A CB    1 
ATOM   1247 O  OG1   . THR A 1 163 ? 76.787 -8.061  19.536  1.00 75.88 ? 160 THR A OG1   1 
ATOM   1248 C  CG2   . THR A 1 163 ? 78.465 -7.622  21.222  1.00 73.44 ? 160 THR A CG2   1 
ATOM   1249 N  N     . VAL A 1 164 ? 77.109 -4.054  20.950  1.00 61.55 ? 161 VAL A N     1 
ATOM   1250 C  CA    . VAL A 1 164 ? 76.209 -3.349  21.854  1.00 62.96 ? 161 VAL A CA    1 
ATOM   1251 C  C     . VAL A 1 164 ? 75.179 -2.498  21.105  1.00 57.67 ? 161 VAL A C     1 
ATOM   1252 O  O     . VAL A 1 164 ? 74.005 -2.482  21.475  1.00 55.93 ? 161 VAL A O     1 
ATOM   1253 C  CB    . VAL A 1 164 ? 76.999 -2.468  22.847  1.00 68.05 ? 161 VAL A CB    1 
ATOM   1254 C  CG1   . VAL A 1 164 ? 77.507 -3.306  24.016  1.00 58.32 ? 161 VAL A CG1   1 
ATOM   1255 C  CG2   . VAL A 1 164 ? 78.154 -1.765  22.134  1.00 61.79 ? 161 VAL A CG2   1 
ATOM   1256 N  N     . GLN A 1 165 ? 75.617 -1.808  20.052  1.00 50.40 ? 162 GLN A N     1 
ATOM   1257 C  CA    . GLN A 1 165 ? 74.757 -0.859  19.336  1.00 47.89 ? 162 GLN A CA    1 
ATOM   1258 C  C     . GLN A 1 165 ? 74.246 -1.389  17.992  1.00 42.43 ? 162 GLN A C     1 
ATOM   1259 O  O     . GLN A 1 165 ? 74.845 -2.289  17.405  1.00 39.70 ? 162 GLN A O     1 
ATOM   1260 C  CB    . GLN A 1 165 ? 75.478 0.476   19.158  1.00 51.56 ? 162 GLN A CB    1 
ATOM   1261 C  CG    . GLN A 1 165 ? 75.781 1.166   20.484  1.00 62.64 ? 162 GLN A CG    1 
ATOM   1262 C  CD    . GLN A 1 165 ? 76.805 2.278   20.354  1.00 66.92 ? 162 GLN A CD    1 
ATOM   1263 O  OE1   . GLN A 1 165 ? 77.911 2.180   20.888  1.00 63.63 ? 162 GLN A OE1   1 
ATOM   1264 N  NE2   . GLN A 1 165 ? 76.437 3.348   19.651  1.00 59.20 ? 162 GLN A NE2   1 
ATOM   1265 N  N     . LYS A 1 166 ? 73.138 -0.828  17.509  1.00 37.27 ? 163 LYS A N     1 
ATOM   1266 C  CA    . LYS A 1 166 ? 72.458 -1.389  16.338  1.00 39.20 ? 163 LYS A CA    1 
ATOM   1267 C  C     . LYS A 1 166 ? 73.282 -1.339  15.048  1.00 25.78 ? 163 LYS A C     1 
ATOM   1268 O  O     . LYS A 1 166 ? 73.315 -2.314  14.296  1.00 25.91 ? 163 LYS A O     1 
ATOM   1269 C  CB    . LYS A 1 166 ? 71.071 -0.757  16.115  1.00 34.63 ? 163 LYS A CB    1 
ATOM   1270 C  CG    . LYS A 1 166 ? 69.965 -1.803  15.901  1.00 41.00 ? 163 LYS A CG    1 
ATOM   1271 C  CD    . LYS A 1 166 ? 68.918 -1.400  14.849  1.00 44.27 ? 163 LYS A CD    1 
ATOM   1272 C  CE    . LYS A 1 166 ? 68.003 -2.594  14.493  1.00 38.24 ? 163 LYS A CE    1 
ATOM   1273 N  NZ    . LYS A 1 166 ? 67.101 -2.382  13.296  1.00 35.58 ? 163 LYS A NZ    1 
ATOM   1274 N  N     . GLU A 1 167 ? 73.924 -0.207  14.776  1.00 26.16 ? 164 GLU A N     1 
ATOM   1275 C  CA    . GLU A 1 167 ? 74.713 -0.091  13.558  1.00 29.21 ? 164 GLU A CA    1 
ATOM   1276 C  C     . GLU A 1 167 ? 75.847 -1.110  13.545  1.00 29.08 ? 164 GLU A C     1 
ATOM   1277 O  O     . GLU A 1 167 ? 76.190 -1.653  12.497  1.00 25.52 ? 164 GLU A O     1 
ATOM   1278 C  CB    . GLU A 1 167 ? 75.256 1.327   13.367  1.00 30.62 ? 164 GLU A CB    1 
ATOM   1279 C  CG    . GLU A 1 167 ? 76.200 1.484   12.167  1.00 29.49 ? 164 GLU A CG    1 
ATOM   1280 C  CD    . GLU A 1 167 ? 75.554 1.145   10.820  1.00 31.73 ? 164 GLU A CD    1 
ATOM   1281 O  OE1   . GLU A 1 167 ? 76.291 1.068   9.811   1.00 34.66 ? 164 GLU A OE1   1 
ATOM   1282 O  OE2   . GLU A 1 167 ? 74.319 0.965   10.760  1.00 32.44 ? 164 GLU A OE2   1 
ATOM   1283 N  N     . GLY A 1 168 ? 76.424 -1.367  14.713  1.00 30.14 ? 165 GLY A N     1 
ATOM   1284 C  CA    . GLY A 1 168 ? 77.529 -2.299  14.818  1.00 28.26 ? 165 GLY A CA    1 
ATOM   1285 C  C     . GLY A 1 168 ? 77.082 -3.723  14.566  1.00 26.39 ? 165 GLY A C     1 
ATOM   1286 O  O     . GLY A 1 168 ? 77.789 -4.498  13.926  1.00 25.19 ? 165 GLY A O     1 
ATOM   1287 N  N     . MET A 1 169 ? 75.909 -4.069  15.087  1.00 29.47 ? 166 MET A N     1 
ATOM   1288 C  CA    . MET A 1 169 ? 75.301 -5.362  14.810  1.00 24.06 ? 166 MET A CA    1 
ATOM   1289 C  C     . MET A 1 169 ? 75.060 -5.487  13.312  1.00 24.24 ? 166 MET A C     1 
ATOM   1290 O  O     . MET A 1 169 ? 75.409 -6.496  12.693  1.00 23.62 ? 166 MET A O     1 
ATOM   1291 C  CB    . MET A 1 169 ? 73.983 -5.510  15.572  1.00 28.06 ? 166 MET A CB    1 
ATOM   1292 C  CG    . MET A 1 169 ? 74.141 -5.777  17.068  1.00 45.48 ? 166 MET A CG    1 
ATOM   1293 S  SD    . MET A 1 169 ? 74.623 -7.477  17.455  1.00 61.26 ? 166 MET A SD    1 
ATOM   1294 C  CE    . MET A 1 169 ? 73.183 -8.391  16.885  1.00 41.01 ? 166 MET A CE    1 
ATOM   1295 N  N     . ARG A 1 170 ? 74.478 -4.452  12.716  1.00 22.51 ? 167 ARG A N     1 
ATOM   1296 C  CA    . ARG A 1 170 ? 74.211 -4.501  11.280  1.00 19.83 ? 167 ARG A CA    1 
ATOM   1297 C  C     . ARG A 1 170 ? 75.478 -4.864  10.527  1.00 20.56 ? 167 ARG A C     1 
ATOM   1298 O  O     . ARG A 1 170 ? 75.468 -5.751  9.680   1.00 15.63 ? 167 ARG A O     1 
ATOM   1299 C  CB    . ARG A 1 170 ? 73.662 -3.167  10.759  1.00 17.35 ? 167 ARG A CB    1 
ATOM   1300 C  CG    . ARG A 1 170 ? 73.306 -3.191  9.268   1.00 15.56 ? 167 ARG A CG    1 
ATOM   1301 C  CD    . ARG A 1 170 ? 73.127 -1.785  8.709   1.00 17.33 ? 167 ARG A CD    1 
ATOM   1302 N  NE    . ARG A 1 170 ? 74.410 -1.117  8.515   1.00 19.00 ? 167 ARG A NE    1 
ATOM   1303 C  CZ    . ARG A 1 170 ? 75.214 -1.331  7.479   1.00 20.56 ? 167 ARG A CZ    1 
ATOM   1304 N  NH1   . ARG A 1 170 ? 74.878 -2.198  6.529   1.00 15.86 ? 167 ARG A NH1   1 
ATOM   1305 N  NH2   . ARG A 1 170 ? 76.356 -0.674  7.386   1.00 22.09 ? 167 ARG A NH2   1 
ATOM   1306 N  N     . LYS A 1 171 ? 76.568 -4.170  10.841  1.00 17.21 ? 168 LYS A N     1 
ATOM   1307 C  CA    . LYS A 1 171 ? 77.828 -4.380  10.138  1.00 17.89 ? 168 LYS A CA    1 
ATOM   1308 C  C     . LYS A 1 171 ? 78.448 -5.753  10.385  1.00 19.50 ? 168 LYS A C     1 
ATOM   1309 O  O     . LYS A 1 171 ? 79.021 -6.344  9.473   1.00 17.02 ? 168 LYS A O     1 
ATOM   1310 C  CB    . LYS A 1 171 ? 78.844 -3.287  10.483  1.00 27.43 ? 168 LYS A CB    1 
ATOM   1311 C  CG    . LYS A 1 171 ? 78.670 -1.997  9.696   1.00 27.86 ? 168 LYS A CG    1 
ATOM   1312 C  CD    . LYS A 1 171 ? 79.891 -1.099  9.876   1.00 38.24 ? 168 LYS A CD    1 
ATOM   1313 C  CE    . LYS A 1 171 ? 79.910 0.024   8.857   1.00 41.87 ? 168 LYS A CE    1 
ATOM   1314 N  NZ    . LYS A 1 171 ? 81.179 0.801   8.917   1.00 47.67 ? 168 LYS A NZ    1 
ATOM   1315 N  N     . GLN A 1 172 ? 78.345 -6.256  11.612  1.00 20.90 ? 169 GLN A N     1 
ATOM   1316 C  CA    . GLN A 1 172 ? 78.891 -7.572  11.911  1.00 25.19 ? 169 GLN A CA    1 
ATOM   1317 C  C     . GLN A 1 172 ? 78.171 -8.594  11.055  1.00 18.83 ? 169 GLN A C     1 
ATOM   1318 O  O     . GLN A 1 172 ? 78.786 -9.506  10.503  1.00 17.97 ? 169 GLN A O     1 
ATOM   1319 C  CB    . GLN A 1 172 ? 78.684 -7.952  13.374  1.00 20.97 ? 169 GLN A CB    1 
ATOM   1320 C  CG    . GLN A 1 172 ? 79.394 -7.093  14.394  1.00 32.69 ? 169 GLN A CG    1 
ATOM   1321 C  CD    . GLN A 1 172 ? 79.003 -7.470  15.813  1.00 44.41 ? 169 GLN A CD    1 
ATOM   1322 O  OE1   . GLN A 1 172 ? 78.227 -8.406  16.024  1.00 43.03 ? 169 GLN A OE1   1 
ATOM   1323 N  NE2   . GLN A 1 172 ? 79.538 -6.746  16.792  1.00 52.40 ? 169 GLN A NE2   1 
ATOM   1324 N  N     . GLY A 1 173 ? 76.852 -8.449  10.972  1.00 18.06 ? 170 GLY A N     1 
ATOM   1325 C  CA    . GLY A 1 173 ? 76.040 -9.383  10.212  1.00 14.84 ? 170 GLY A CA    1 
ATOM   1326 C  C     . GLY A 1 173 ? 76.413 -9.325  8.753   1.00 14.25 ? 170 GLY A C     1 
ATOM   1327 O  O     . GLY A 1 173 ? 76.587 -10.357 8.098   1.00 12.99 ? 170 GLY A O     1 
ATOM   1328 N  N     . LEU A 1 174 ? 76.534 -8.105  8.234   1.00 15.41 ? 171 LEU A N     1 
ATOM   1329 C  CA    . LEU A 1 174 ? 76.940 -7.901  6.846   1.00 15.56 ? 171 LEU A CA    1 
ATOM   1330 C  C     . LEU A 1 174 ? 78.307 -8.508  6.556   1.00 19.03 ? 171 LEU A C     1 
ATOM   1331 O  O     . LEU A 1 174 ? 78.520 -9.108  5.508   1.00 15.73 ? 171 LEU A O     1 
ATOM   1332 C  CB    . LEU A 1 174 ? 76.970 -6.412  6.490   1.00 11.34 ? 171 LEU A CB    1 
ATOM   1333 C  CG    . LEU A 1 174 ? 77.341 -6.086  5.045   1.00 12.76 ? 171 LEU A CG    1 
ATOM   1334 C  CD1   . LEU A 1 174 ? 76.350 -6.733  4.071   1.00 14.19 ? 171 LEU A CD1   1 
ATOM   1335 C  CD2   . LEU A 1 174 ? 77.381 -4.578  4.836   1.00 15.50 ? 171 LEU A CD2   1 
ATOM   1336 N  N     . PHE A 1 175 ? 79.243 -8.350  7.479   1.00 16.75 ? 172 PHE A N     1 
ATOM   1337 C  CA    . PHE A 1 175 ? 80.582 -8.857  7.216   1.00 19.66 ? 172 PHE A CA    1 
ATOM   1338 C  C     . PHE A 1 175 ? 80.605 -10.387 7.191   1.00 15.76 ? 172 PHE A C     1 
ATOM   1339 O  O     . PHE A 1 175 ? 81.270 -10.985 6.343   1.00 21.42 ? 172 PHE A O     1 
ATOM   1340 C  CB    . PHE A 1 175 ? 81.597 -8.283  8.199   1.00 19.91 ? 172 PHE A CB    1 
ATOM   1341 C  CG    . PHE A 1 175 ? 82.071 -6.908  7.827   1.00 34.69 ? 172 PHE A CG    1 
ATOM   1342 C  CD1   . PHE A 1 175 ? 81.680 -5.802  8.558   1.00 31.36 ? 172 PHE A CD1   1 
ATOM   1343 C  CD2   . PHE A 1 175 ? 82.885 -6.721  6.719   1.00 38.29 ? 172 PHE A CD2   1 
ATOM   1344 C  CE1   . PHE A 1 175 ? 82.106 -4.531  8.206   1.00 41.00 ? 172 PHE A CE1   1 
ATOM   1345 C  CE2   . PHE A 1 175 ? 83.317 -5.455  6.361   1.00 42.73 ? 172 PHE A CE2   1 
ATOM   1346 C  CZ    . PHE A 1 175 ? 82.927 -4.358  7.107   1.00 44.35 ? 172 PHE A CZ    1 
ATOM   1347 N  N     . GLN A 1 176 ? 79.871 -11.016 8.110   1.00 20.56 ? 173 GLN A N     1 
ATOM   1348 C  CA    . GLN A 1 176 ? 79.766 -12.478 8.115   1.00 21.91 ? 173 GLN A CA    1 
ATOM   1349 C  C     . GLN A 1 176 ? 79.219 -12.956 6.783   1.00 19.33 ? 173 GLN A C     1 
ATOM   1350 O  O     . GLN A 1 176 ? 79.705 -13.932 6.210   1.00 17.74 ? 173 GLN A O     1 
ATOM   1351 C  CB    . GLN A 1 176 ? 78.885 -12.986 9.268   1.00 18.53 ? 173 GLN A CB    1 
ATOM   1352 C  CG    . GLN A 1 176 ? 79.498 -12.785 10.649  1.00 19.22 ? 173 GLN A CG    1 
ATOM   1353 C  CD    . GLN A 1 176 ? 78.733 -13.500 11.741  1.00 24.38 ? 173 GLN A CD    1 
ATOM   1354 O  OE1   . GLN A 1 176 ? 77.670 -14.066 11.502  1.00 22.52 ? 173 GLN A OE1   1 
ATOM   1355 N  NE2   . GLN A 1 176 ? 79.277 -13.483 12.952  1.00 28.68 ? 173 GLN A NE2   1 
ATOM   1356 N  N     . TRP A 1 177 ? 78.213 -12.246 6.280   1.00 15.88 ? 174 TRP A N     1 
ATOM   1357 C  CA    . TRP A 1 177 ? 77.572 -12.609 5.021   1.00 16.35 ? 174 TRP A CA    1 
ATOM   1358 C  C     . TRP A 1 177 ? 78.544 -12.498 3.855   1.00 18.84 ? 174 TRP A C     1 
ATOM   1359 O  O     . TRP A 1 177 ? 78.685 -13.432 3.055   1.00 19.81 ? 174 TRP A O     1 
ATOM   1360 C  CB    . TRP A 1 177 ? 76.333 -11.724 4.794   1.00 11.06 ? 174 TRP A CB    1 
ATOM   1361 C  CG    . TRP A 1 177 ? 75.680 -11.875 3.441   1.00 16.79 ? 174 TRP A CG    1 
ATOM   1362 C  CD1   . TRP A 1 177 ? 75.795 -11.026 2.380   1.00 14.96 ? 174 TRP A CD1   1 
ATOM   1363 C  CD2   . TRP A 1 177 ? 74.799 -12.926 3.017   1.00 13.43 ? 174 TRP A CD2   1 
ATOM   1364 N  NE1   . TRP A 1 177 ? 75.048 -11.478 1.324   1.00 12.92 ? 174 TRP A NE1   1 
ATOM   1365 C  CE2   . TRP A 1 177 ? 74.424 -12.642 1.689   1.00 15.72 ? 174 TRP A CE2   1 
ATOM   1366 C  CE3   . TRP A 1 177 ? 74.292 -14.079 3.634   1.00 13.71 ? 174 TRP A CE3   1 
ATOM   1367 C  CZ2   . TRP A 1 177 ? 73.572 -13.466 0.962   1.00 13.91 ? 174 TRP A CZ2   1 
ATOM   1368 C  CZ3   . TRP A 1 177 ? 73.441 -14.890 2.918   1.00 13.88 ? 174 TRP A CZ3   1 
ATOM   1369 C  CH2   . TRP A 1 177 ? 73.087 -14.583 1.590   1.00 13.97 ? 174 TRP A CH2   1 
ATOM   1370 N  N     . LEU A 1 178 ? 79.222 -11.359 3.762   1.00 15.60 ? 175 LEU A N     1 
ATOM   1371 C  CA    . LEU A 1 178 ? 80.145 -11.126 2.654   1.00 16.95 ? 175 LEU A CA    1 
ATOM   1372 C  C     . LEU A 1 178 ? 81.378 -12.014 2.750   1.00 25.22 ? 175 LEU A C     1 
ATOM   1373 O  O     . LEU A 1 178 ? 82.008 -12.325 1.744   1.00 24.64 ? 175 LEU A O     1 
ATOM   1374 C  CB    . LEU A 1 178 ? 80.574 -9.659  2.596   1.00 15.91 ? 175 LEU A CB    1 
ATOM   1375 C  CG    . LEU A 1 178 ? 79.431 -8.680  2.319   1.00 17.09 ? 175 LEU A CG    1 
ATOM   1376 C  CD1   . LEU A 1 178 ? 79.910 -7.247  2.442   1.00 21.02 ? 175 LEU A CD1   1 
ATOM   1377 C  CD2   . LEU A 1 178 ? 78.839 -8.937  0.942   1.00 16.55 ? 175 LEU A CD2   1 
ATOM   1378 N  N     . ASP A 1 179 ? 81.727 -12.404 3.967   1.00 20.70 ? 176 ASP A N     1 
ATOM   1379 C  CA    . ASP A 1 179 ? 82.890 -13.257 4.169   1.00 29.56 ? 176 ASP A CA    1 
ATOM   1380 C  C     . ASP A 1 179 ? 82.635 -14.658 3.649   1.00 29.80 ? 176 ASP A C     1 
ATOM   1381 O  O     . ASP A 1 179 ? 83.568 -15.361 3.269   1.00 35.01 ? 176 ASP A O     1 
ATOM   1382 C  CB    . ASP A 1 179 ? 83.288 -13.309 5.644   1.00 24.75 ? 176 ASP A CB    1 
ATOM   1383 C  CG    . ASP A 1 179 ? 84.274 -12.226 6.009   1.00 41.91 ? 176 ASP A CG    1 
ATOM   1384 O  OD1   . ASP A 1 179 ? 85.231 -12.024 5.229   1.00 49.72 ? 176 ASP A OD1   1 
ATOM   1385 O  OD2   . ASP A 1 179 ? 84.092 -11.572 7.060   1.00 47.67 ? 176 ASP A OD2   1 
ATOM   1386 N  N     . SER A 1 180 ? 81.363 -15.043 3.613   1.00 26.92 ? 177 SER A N     1 
ATOM   1387 C  CA    A SER A 1 180 ? 80.992 -16.386 3.191   0.50 29.14 ? 177 SER A CA    1 
ATOM   1388 C  CA    B SER A 1 180 ? 80.958 -16.386 3.201   0.50 29.14 ? 177 SER A CA    1 
ATOM   1389 C  C     . SER A 1 180 ? 80.597 -16.481 1.717   1.00 32.42 ? 177 SER A C     1 
ATOM   1390 O  O     . SER A 1 180 ? 80.428 -17.579 1.182   1.00 34.09 ? 177 SER A O     1 
ATOM   1391 C  CB    A SER A 1 180 ? 79.840 -16.902 4.055   0.50 26.93 ? 177 SER A CB    1 
ATOM   1392 C  CB    B SER A 1 180 ? 79.777 -16.865 4.044   0.50 26.92 ? 177 SER A CB    1 
ATOM   1393 O  OG    A SER A 1 180 ? 80.169 -16.833 5.429   0.50 27.73 ? 177 SER A OG    1 
ATOM   1394 O  OG    B SER A 1 180 ? 79.314 -18.119 3.579   0.50 31.32 ? 177 SER A OG    1 
ATOM   1395 N  N     . LEU A 1 181 ? 80.451 -15.339 1.057   1.00 23.92 ? 178 LEU A N     1 
ATOM   1396 C  CA    . LEU A 1 181 ? 80.009 -15.331 -0.340  1.00 25.75 ? 178 LEU A CA    1 
ATOM   1397 C  C     . LEU A 1 181 ? 81.010 -15.959 -1.302  1.00 35.70 ? 178 LEU A C     1 
ATOM   1398 O  O     . LEU A 1 181 ? 82.208 -15.674 -1.237  1.00 31.12 ? 178 LEU A O     1 
ATOM   1399 C  CB    . LEU A 1 181 ? 79.737 -13.902 -0.805  1.00 32.62 ? 178 LEU A CB    1 
ATOM   1400 C  CG    . LEU A 1 181 ? 78.323 -13.347 -0.690  1.00 27.83 ? 178 LEU A CG    1 
ATOM   1401 C  CD1   . LEU A 1 181 ? 78.219 -12.064 -1.516  1.00 16.42 ? 178 LEU A CD1   1 
ATOM   1402 C  CD2   . LEU A 1 181 ? 77.298 -14.379 -1.158  1.00 20.88 ? 178 LEU A CD2   1 
ATOM   1403 N  N     . GLN A 1 182 ? 80.515 -16.797 -2.210  1.00 37.01 ? 179 GLN A N     1 
ATOM   1404 C  CA    . GLN A 1 182 ? 81.349 -17.295 -3.299  1.00 48.57 ? 179 GLN A CA    1 
ATOM   1405 C  C     . GLN A 1 182 ? 81.058 -16.526 -4.580  1.00 50.58 ? 179 GLN A C     1 
ATOM   1406 O  O     . GLN A 1 182 ? 80.112 -16.842 -5.306  1.00 49.33 ? 179 GLN A O     1 
ATOM   1407 C  CB    . GLN A 1 182 ? 81.142 -18.795 -3.521  1.00 50.92 ? 179 GLN A CB    1 
ATOM   1408 C  CG    . GLN A 1 182 ? 82.101 -19.395 -4.545  1.00 55.52 ? 179 GLN A CG    1 
ATOM   1409 C  CD    . GLN A 1 182 ? 83.555 -19.022 -4.273  1.00 62.90 ? 179 GLN A CD    1 
ATOM   1410 O  OE1   . GLN A 1 182 ? 84.066 -18.031 -4.803  1.00 57.83 ? 179 GLN A OE1   1 
ATOM   1411 N  NE2   . GLN A 1 182 ? 84.226 -19.816 -3.442  1.00 58.77 ? 179 GLN A NE2   1 
ATOM   1412 N  N     . ILE A 1 183 ? 81.885 -15.520 -4.851  1.00 45.59 ? 180 ILE A N     1 
ATOM   1413 C  CA    . ILE A 1 183 ? 81.674 -14.624 -5.984  1.00 50.12 ? 180 ILE A CA    1 
ATOM   1414 C  C     . ILE A 1 183 ? 82.139 -15.233 -7.306  1.00 54.22 ? 180 ILE A C     1 
ATOM   1415 O  O     . ILE A 1 183 ? 81.994 -14.626 -8.372  1.00 52.84 ? 180 ILE A O     1 
ATOM   1416 C  CB    . ILE A 1 183 ? 82.358 -13.262 -5.748  1.00 43.72 ? 180 ILE A CB    1 
ATOM   1417 C  CG1   . ILE A 1 183 ? 83.863 -13.437 -5.529  1.00 48.14 ? 180 ILE A CG1   1 
ATOM   1418 C  CG2   . ILE A 1 183 ? 81.748 -12.580 -4.536  1.00 41.14 ? 180 ILE A CG2   1 
ATOM   1419 C  CD1   . ILE A 1 183 ? 84.651 -13.734 -6.785  1.00 48.23 ? 180 ILE A CD1   1 
ATOM   1420 N  N     . ASP A 1 184 ? 82.696 -16.437 -7.215  1.00 58.54 ? 181 ASP A N     1 
ATOM   1421 C  CA    . ASP A 1 184 ? 83.194 -17.175 -8.368  1.00 56.49 ? 181 ASP A CA    1 
ATOM   1422 C  C     . ASP A 1 184 ? 82.037 -17.707 -9.213  1.00 56.63 ? 181 ASP A C     1 
ATOM   1423 O  O     . ASP A 1 184 ? 82.152 -17.861 -10.431 1.00 53.11 ? 181 ASP A O     1 
ATOM   1424 C  CB    . ASP A 1 184 ? 84.052 -18.347 -7.880  1.00 59.23 ? 181 ASP A CB    1 
ATOM   1425 C  CG    . ASP A 1 184 ? 84.953 -18.916 -8.963  1.00 75.46 ? 181 ASP A CG    1 
ATOM   1426 O  OD1   . ASP A 1 184 ? 84.670 -18.702 -10.163 1.00 76.33 ? 181 ASP A OD1   1 
ATOM   1427 O  OD2   . ASP A 1 184 ? 85.948 -19.589 -8.608  1.00 76.89 ? 181 ASP A OD2   1 
ATOM   1428 N  N     . ASN A 1 185 ? 80.919 -17.987 -8.554  1.00 51.31 ? 182 ASN A N     1 
ATOM   1429 C  CA    . ASN A 1 185 ? 79.775 -18.600 -9.212  1.00 50.09 ? 182 ASN A CA    1 
ATOM   1430 C  C     . ASN A 1 185 ? 78.708 -17.564 -9.555  1.00 48.98 ? 182 ASN A C     1 
ATOM   1431 O  O     . ASN A 1 185 ? 78.094 -16.974 -8.664  1.00 45.49 ? 182 ASN A O     1 
ATOM   1432 C  CB    . ASN A 1 185 ? 79.201 -19.702 -8.311  1.00 44.63 ? 182 ASN A CB    1 
ATOM   1433 C  CG    . ASN A 1 185 ? 78.005 -20.406 -8.923  1.00 45.94 ? 182 ASN A CG    1 
ATOM   1434 O  OD1   . ASN A 1 185 ? 77.704 -20.242 -10.107 1.00 49.60 ? 182 ASN A OD1   1 
ATOM   1435 N  ND2   . ASN A 1 185 ? 77.316 -21.205 -8.112  1.00 45.16 ? 182 ASN A ND2   1 
ATOM   1436 N  N     . LEU A 1 186 ? 78.492 -17.345 -10.850 1.00 47.34 ? 183 LEU A N     1 
ATOM   1437 C  CA    . LEU A 1 186 ? 77.556 -16.318 -11.306 1.00 45.55 ? 183 LEU A CA    1 
ATOM   1438 C  C     . LEU A 1 186 ? 76.086 -16.727 -11.197 1.00 44.13 ? 183 LEU A C     1 
ATOM   1439 O  O     . LEU A 1 186 ? 75.191 -15.910 -11.423 1.00 46.40 ? 183 LEU A O     1 
ATOM   1440 C  CB    . LEU A 1 186 ? 77.882 -15.883 -12.739 1.00 42.31 ? 183 LEU A CB    1 
ATOM   1441 C  CG    . LEU A 1 186 ? 78.747 -14.623 -12.862 1.00 51.27 ? 183 LEU A CG    1 
ATOM   1442 C  CD1   . LEU A 1 186 ? 80.005 -14.729 -11.999 1.00 53.71 ? 183 LEU A CD1   1 
ATOM   1443 C  CD2   . LEU A 1 186 ? 79.102 -14.341 -14.313 1.00 45.58 ? 183 LEU A CD2   1 
ATOM   1444 N  N     . THR A 1 187 ? 75.837 -17.988 -10.860 1.00 41.83 ? 184 THR A N     1 
ATOM   1445 C  CA    . THR A 1 187 ? 74.468 -18.452 -10.652 1.00 38.97 ? 184 THR A CA    1 
ATOM   1446 C  C     . THR A 1 187 ? 74.214 -18.760 -9.176  1.00 35.93 ? 184 THR A C     1 
ATOM   1447 O  O     . THR A 1 187 ? 73.198 -19.367 -8.834  1.00 36.80 ? 184 THR A O     1 
ATOM   1448 C  CB    . THR A 1 187 ? 74.129 -19.694 -11.511 1.00 45.96 ? 184 THR A CB    1 
ATOM   1449 O  OG1   . THR A 1 187 ? 74.859 -20.833 -11.034 1.00 49.61 ? 184 THR A OG1   1 
ATOM   1450 C  CG2   . THR A 1 187 ? 74.468 -19.442 -12.980 1.00 47.20 ? 184 THR A CG2   1 
ATOM   1451 N  N     . SER A 1 188 ? 75.137 -18.353 -8.306  1.00 33.67 ? 185 SER A N     1 
ATOM   1452 C  CA    . SER A 1 188 ? 74.914 -18.495 -6.868  1.00 25.30 ? 185 SER A CA    1 
ATOM   1453 C  C     . SER A 1 188 ? 73.756 -17.620 -6.380  1.00 18.90 ? 185 SER A C     1 
ATOM   1454 O  O     . SER A 1 188 ? 73.839 -16.394 -6.434  1.00 17.75 ? 185 SER A O     1 
ATOM   1455 C  CB    . SER A 1 188 ? 76.165 -18.177 -6.050  1.00 27.18 ? 185 SER A CB    1 
ATOM   1456 O  OG    . SER A 1 188 ? 75.859 -18.208 -4.656  1.00 28.76 ? 185 SER A OG    1 
ATOM   1457 N  N     . PRO A 1 189 ? 72.665 -18.247 -5.912  1.00 17.62 ? 186 PRO A N     1 
ATOM   1458 C  CA    . PRO A 1 189 ? 71.505 -17.455 -5.473  1.00 15.28 ? 186 PRO A CA    1 
ATOM   1459 C  C     . PRO A 1 189 ? 71.853 -16.429 -4.393  1.00 14.71 ? 186 PRO A C     1 
ATOM   1460 O  O     . PRO A 1 189 ? 71.311 -15.332 -4.466  1.00 11.16 ? 186 PRO A O     1 
ATOM   1461 C  CB    . PRO A 1 189 ? 70.548 -18.513 -4.919  1.00 18.68 ? 186 PRO A CB    1 
ATOM   1462 C  CG    . PRO A 1 189 ? 70.920 -19.771 -5.674  1.00 19.19 ? 186 PRO A CG    1 
ATOM   1463 C  CD    . PRO A 1 189 ? 72.412 -19.695 -5.833  1.00 17.91 ? 186 PRO A CD    1 
ATOM   1464 N  N     . ASP A 1 190 ? 72.715 -16.764 -3.424  1.00 11.88 ? 187 ASP A N     1 
ATOM   1465 C  CA    . ASP A 1 190 ? 73.077 -15.806 -2.381  1.00 12.89 ? 187 ASP A CA    1 
ATOM   1466 C  C     . ASP A 1 190 ? 73.817 -14.606 -2.965  1.00 14.08 ? 187 ASP A C     1 
ATOM   1467 O  O     . ASP A 1 190 ? 73.645 -13.469 -2.512  1.00 11.61 ? 187 ASP A O     1 
ATOM   1468 C  CB    . ASP A 1 190 ? 73.933 -16.460 -1.285  1.00 13.35 ? 187 ASP A CB    1 
ATOM   1469 C  CG    . ASP A 1 190 ? 73.144 -17.456 -0.436  1.00 17.15 ? 187 ASP A CG    1 
ATOM   1470 O  OD1   . ASP A 1 190 ? 71.903 -17.443 -0.504  1.00 11.50 ? 187 ASP A OD1   1 
ATOM   1471 O  OD2   . ASP A 1 190 ? 73.765 -18.245 0.303   1.00 19.55 ? 187 ASP A OD2   1 
ATOM   1472 N  N     . LEU A 1 191 ? 74.667 -14.868 -3.953  1.00 11.32 ? 188 LEU A N     1 
ATOM   1473 C  CA    . LEU A 1 191 ? 75.386 -13.799 -4.630  1.00 14.07 ? 188 LEU A CA    1 
ATOM   1474 C  C     . LEU A 1 191 ? 74.401 -12.926 -5.389  1.00 12.23 ? 188 LEU A C     1 
ATOM   1475 O  O     . LEU A 1 191 ? 74.501 -11.706 -5.362  1.00 11.64 ? 188 LEU A O     1 
ATOM   1476 C  CB    . LEU A 1 191 ? 76.410 -14.380 -5.614  1.00 15.59 ? 188 LEU A CB    1 
ATOM   1477 C  CG    . LEU A 1 191 ? 77.258 -13.357 -6.391  1.00 16.49 ? 188 LEU A CG    1 
ATOM   1478 C  CD1   . LEU A 1 191 ? 77.948 -12.381 -5.456  1.00 14.82 ? 188 LEU A CD1   1 
ATOM   1479 C  CD2   . LEU A 1 191 ? 78.291 -14.064 -7.275  1.00 20.06 ? 188 LEU A CD2   1 
ATOM   1480 N  N     . GLN A 1 192 ? 73.459 -13.562 -6.078  1.00 12.30 ? 189 GLN A N     1 
ATOM   1481 C  CA    . GLN A 1 192 ? 72.460 -12.834 -6.848  1.00 15.30 ? 189 GLN A CA    1 
ATOM   1482 C  C     . GLN A 1 192 ? 71.649 -11.891 -5.959  1.00 14.49 ? 189 GLN A C     1 
ATOM   1483 O  O     . GLN A 1 192 ? 71.431 -10.729 -6.312  1.00 12.61 ? 189 GLN A O     1 
ATOM   1484 C  CB    . GLN A 1 192 ? 71.561 -13.805 -7.616  1.00 11.81 ? 189 GLN A CB    1 
ATOM   1485 C  CG    . GLN A 1 192 ? 72.275 -14.463 -8.793  1.00 19.88 ? 189 GLN A CG    1 
ATOM   1486 C  CD    . GLN A 1 192 ? 71.465 -15.570 -9.424  1.00 29.91 ? 189 GLN A CD    1 
ATOM   1487 O  OE1   . GLN A 1 192 ? 70.523 -16.086 -8.823  1.00 30.86 ? 189 GLN A OE1   1 
ATOM   1488 N  NE2   . GLN A 1 192 ? 71.827 -15.947 -10.645 1.00 39.39 ? 189 GLN A NE2   1 
ATOM   1489 N  N     . LEU A 1 193 ? 71.217 -12.387 -4.801  1.00 10.79 ? 190 LEU A N     1 
ATOM   1490 C  CA    . LEU A 1 193 ? 70.504 -11.551 -3.838  1.00 8.72  ? 190 LEU A CA    1 
ATOM   1491 C  C     . LEU A 1 193 ? 71.376 -10.375 -3.386  1.00 12.16 ? 190 LEU A C     1 
ATOM   1492 O  O     . LEU A 1 193 ? 70.888 -9.263  -3.208  1.00 10.58 ? 190 LEU A O     1 
ATOM   1493 C  CB    . LEU A 1 193 ? 70.076 -12.365 -2.604  1.00 8.30  ? 190 LEU A CB    1 
ATOM   1494 C  CG    . LEU A 1 193 ? 68.979 -13.429 -2.721  1.00 10.52 ? 190 LEU A CG    1 
ATOM   1495 C  CD1   . LEU A 1 193 ? 68.635 -13.943 -1.314  1.00 9.29  ? 190 LEU A CD1   1 
ATOM   1496 C  CD2   . LEU A 1 193 ? 67.750 -12.865 -3.397  1.00 8.91  ? 190 LEU A CD2   1 
ATOM   1497 N  N     . THR A 1 194 ? 72.663 -10.627 -3.177  1.00 10.26 ? 191 THR A N     1 
ATOM   1498 C  CA    . THR A 1 194 ? 73.552 -9.590  -2.664  1.00 9.15  ? 191 THR A CA    1 
ATOM   1499 C  C     . THR A 1 194 ? 73.668 -8.464  -3.679  1.00 11.99 ? 191 THR A C     1 
ATOM   1500 O  O     . THR A 1 194 ? 73.594 -7.284  -3.323  1.00 11.35 ? 191 THR A O     1 
ATOM   1501 C  CB    . THR A 1 194 ? 74.942 -10.151 -2.360  1.00 13.43 ? 191 THR A CB    1 
ATOM   1502 O  OG1   . THR A 1 194 ? 74.814 -11.215 -1.413  1.00 13.64 ? 191 THR A OG1   1 
ATOM   1503 C  CG2   . THR A 1 194 ? 75.829 -9.067  -1.776  1.00 11.42 ? 191 THR A CG2   1 
ATOM   1504 N  N     . VAL A 1 195 ? 73.826 -8.835  -4.946  1.00 10.03 ? 192 VAL A N     1 
ATOM   1505 C  CA    . VAL A 1 195 ? 73.920 -7.842  -6.004  1.00 14.99 ? 192 VAL A CA    1 
ATOM   1506 C  C     . VAL A 1 195 ? 72.595 -7.116  -6.130  1.00 14.10 ? 192 VAL A C     1 
ATOM   1507 O  O     . VAL A 1 195 ? 72.564 -5.903  -6.366  1.00 11.89 ? 192 VAL A O     1 
ATOM   1508 C  CB    . VAL A 1 195 ? 74.348 -8.471  -7.344  1.00 13.81 ? 192 VAL A CB    1 
ATOM   1509 C  CG1   . VAL A 1 195 ? 74.235 -7.455  -8.477  1.00 18.52 ? 192 VAL A CG1   1 
ATOM   1510 C  CG2   . VAL A 1 195 ? 75.768 -8.982  -7.237  1.00 11.38 ? 192 VAL A CG2   1 
ATOM   1511 N  N     . GLY A 1 196 ? 71.501 -7.847  -5.947  1.00 10.04 ? 193 GLY A N     1 
ATOM   1512 C  CA    . GLY A 1 196 ? 70.184 -7.222  -5.926  1.00 9.77  ? 193 GLY A CA    1 
ATOM   1513 C  C     . GLY A 1 196 ? 70.125 -6.133  -4.859  1.00 10.65 ? 193 GLY A C     1 
ATOM   1514 O  O     . GLY A 1 196 ? 69.603 -5.044  -5.086  1.00 11.75 ? 193 GLY A O     1 
ATOM   1515 N  N     . ALA A 1 197 ? 70.680 -6.421  -3.689  1.00 9.88  ? 194 ALA A N     1 
ATOM   1516 C  CA    . ALA A 1 197 ? 70.699 -5.450  -2.610  1.00 9.86  ? 194 ALA A CA    1 
ATOM   1517 C  C     . ALA A 1 197 ? 71.530 -4.219  -2.984  1.00 11.99 ? 194 ALA A C     1 
ATOM   1518 O  O     . ALA A 1 197 ? 71.171 -3.093  -2.640  1.00 8.40  ? 194 ALA A O     1 
ATOM   1519 C  CB    . ALA A 1 197 ? 71.219 -6.089  -1.322  1.00 13.02 ? 194 ALA A CB    1 
ATOM   1520 N  N     . VAL A 1 198 ? 72.638 -4.422  -3.689  1.00 8.44  ? 195 VAL A N     1 
ATOM   1521 C  CA    . VAL A 1 198 ? 73.427 -3.272  -4.147  1.00 11.68 ? 195 VAL A CA    1 
ATOM   1522 C  C     . VAL A 1 198 ? 72.594 -2.373  -5.068  1.00 12.86 ? 195 VAL A C     1 
ATOM   1523 O  O     . VAL A 1 198 ? 72.613 -1.143  -4.937  1.00 12.49 ? 195 VAL A O     1 
ATOM   1524 C  CB    . VAL A 1 198 ? 74.722 -3.701  -4.852  1.00 13.82 ? 195 VAL A CB    1 
ATOM   1525 C  CG1   . VAL A 1 198 ? 75.454 -2.475  -5.425  1.00 16.04 ? 195 VAL A CG1   1 
ATOM   1526 C  CG2   . VAL A 1 198 ? 75.614 -4.441  -3.872  1.00 11.62 ? 195 VAL A CG2   1 
ATOM   1527 N  N     . ILE A 1 199 ? 71.837 -2.980  -5.975  1.00 8.70  ? 196 ILE A N     1 
ATOM   1528 C  CA    . ILE A 1 199 ? 70.996 -2.193  -6.874  1.00 14.13 ? 196 ILE A CA    1 
ATOM   1529 C  C     . ILE A 1 199 ? 69.914 -1.434  -6.094  1.00 11.69 ? 196 ILE A C     1 
ATOM   1530 O  O     . ILE A 1 199 ? 69.633 -0.265  -6.380  1.00 11.90 ? 196 ILE A O     1 
ATOM   1531 C  CB    . ILE A 1 199 ? 70.381 -3.058  -7.979  1.00 11.22 ? 196 ILE A CB    1 
ATOM   1532 C  CG1   . ILE A 1 199 ? 71.493 -3.609  -8.882  1.00 11.70 ? 196 ILE A CG1   1 
ATOM   1533 C  CG2   . ILE A 1 199 ? 69.403 -2.245  -8.813  1.00 12.89 ? 196 ILE A CG2   1 
ATOM   1534 C  CD1   . ILE A 1 199 ? 71.019 -4.693  -9.836  1.00 14.64 ? 196 ILE A CD1   1 
ATOM   1535 N  N     . VAL A 1 200 ? 69.334 -2.088  -5.091  1.00 10.15 ? 197 VAL A N     1 
ATOM   1536 C  CA    . VAL A 1 200 ? 68.281 -1.474  -4.298  1.00 7.89  ? 197 VAL A CA    1 
ATOM   1537 C  C     . VAL A 1 200 ? 68.812 -0.315  -3.452  1.00 10.83 ? 197 VAL A C     1 
ATOM   1538 O  O     . VAL A 1 200 ? 68.126 0.700   -3.301  1.00 10.06 ? 197 VAL A O     1 
ATOM   1539 C  CB    . VAL A 1 200 ? 67.513 -2.519  -3.451  1.00 7.15  ? 197 VAL A CB    1 
ATOM   1540 C  CG1   . VAL A 1 200 ? 66.490 -1.823  -2.537  1.00 8.59  ? 197 VAL A CG1   1 
ATOM   1541 C  CG2   . VAL A 1 200 ? 66.823 -3.512  -4.378  1.00 10.44 ? 197 VAL A CG2   1 
ATOM   1542 N  N     . GLU A 1 201 ? 70.033 -0.434  -2.932  1.00 9.10  ? 198 GLU A N     1 
ATOM   1543 C  CA    . GLU A 1 201 ? 70.690 0.723   -2.317  1.00 10.13 ? 198 GLU A CA    1 
ATOM   1544 C  C     . GLU A 1 201 ? 70.712 1.900   -3.300  1.00 12.24 ? 198 GLU A C     1 
ATOM   1545 O  O     . GLU A 1 201 ? 70.410 3.041   -2.931  1.00 11.40 ? 198 GLU A O     1 
ATOM   1546 C  CB    . GLU A 1 201 ? 72.136 0.410   -1.887  1.00 17.09 ? 198 GLU A CB    1 
ATOM   1547 C  CG    . GLU A 1 201 ? 72.300 -0.598  -0.738  1.00 12.86 ? 198 GLU A CG    1 
ATOM   1548 C  CD    . GLU A 1 201 ? 72.122 0.008   0.644   1.00 14.24 ? 198 GLU A CD    1 
ATOM   1549 O  OE1   . GLU A 1 201 ? 71.724 1.191   0.748   1.00 17.75 ? 198 GLU A OE1   1 
ATOM   1550 O  OE2   . GLU A 1 201 ? 72.386 -0.701  1.646   1.00 16.67 ? 198 GLU A OE2   1 
ATOM   1551 N  N     . GLU A 1 202 ? 71.080 1.619   -4.549  1.00 9.20  ? 199 GLU A N     1 
ATOM   1552 C  CA    . GLU A 1 202 ? 71.181 2.673   -5.561  1.00 12.49 ? 199 GLU A CA    1 
ATOM   1553 C  C     . GLU A 1 202 ? 69.801 3.274   -5.887  1.00 15.26 ? 199 GLU A C     1 
ATOM   1554 O  O     . GLU A 1 202 ? 69.644 4.506   -5.979  1.00 10.62 ? 199 GLU A O     1 
ATOM   1555 C  CB    . GLU A 1 202 ? 71.900 2.153   -6.818  1.00 13.83 ? 199 GLU A CB    1 
ATOM   1556 C  CG    . GLU A 1 202 ? 73.375 1.829   -6.573  1.00 18.57 ? 199 GLU A CG    1 
ATOM   1557 C  CD    . GLU A 1 202 ? 74.005 0.921   -7.643  1.00 22.72 ? 199 GLU A CD    1 
ATOM   1558 O  OE1   . GLU A 1 202 ? 75.224 0.642   -7.545  1.00 29.05 ? 199 GLU A OE1   1 
ATOM   1559 O  OE2   . GLU A 1 202 ? 73.297 0.478   -8.567  1.00 25.21 ? 199 GLU A OE2   1 
ATOM   1560 N  N     . MET A 1 203 ? 68.802 2.407   -6.038  1.00 12.32 ? 200 MET A N     1 
ATOM   1561 C  CA    . MET A 1 203 ? 67.438 2.856   -6.272  1.00 11.12 ? 200 MET A CA    1 
ATOM   1562 C  C     . MET A 1 203 ? 66.941 3.720   -5.122  1.00 10.37 ? 200 MET A C     1 
ATOM   1563 O  O     . MET A 1 203 ? 66.304 4.754   -5.348  1.00 10.11 ? 200 MET A O     1 
ATOM   1564 C  CB    . MET A 1 203 ? 66.471 1.664   -6.413  1.00 11.33 ? 200 MET A CB    1 
ATOM   1565 C  CG    A MET A 1 203 ? 66.804 0.623   -7.464  0.52 10.61 ? 200 MET A CG    1 
ATOM   1566 C  CG    B MET A 1 203 ? 65.062 2.055   -6.795  0.48 12.24 ? 200 MET A CG    1 
ATOM   1567 S  SD    A MET A 1 203 ? 65.529 -0.678  -7.492  0.52 15.88 ? 200 MET A SD    1 
ATOM   1568 S  SD    B MET A 1 203 ? 63.937 0.648   -6.841  0.48 19.09 ? 200 MET A SD    1 
ATOM   1569 C  CE    A MET A 1 203 ? 64.067 0.295   -7.847  0.52 9.71  ? 200 MET A CE    1 
ATOM   1570 C  CE    B MET A 1 203 ? 64.665 -0.374  -8.105  0.48 12.92 ? 200 MET A CE    1 
ATOM   1571 N  N     . ARG A 1 204 ? 67.194 3.281   -3.890  1.00 8.06  ? 201 ARG A N     1 
ATOM   1572 C  CA    . ARG A 1 204 ? 66.760 4.029   -2.718  1.00 10.63 ? 201 ARG A CA    1 
ATOM   1573 C  C     . ARG A 1 204 ? 67.486 5.381   -2.612  1.00 12.99 ? 201 ARG A C     1 
ATOM   1574 O  O     . ARG A 1 204 ? 66.883 6.387   -2.247  1.00 10.81 ? 201 ARG A O     1 
ATOM   1575 C  CB    . ARG A 1 204 ? 66.877 3.186   -1.441  1.00 12.59 ? 201 ARG A CB    1 
ATOM   1576 C  CG    . ARG A 1 204 ? 65.943 1.972   -1.472  1.00 9.11  ? 201 ARG A CG    1 
ATOM   1577 C  CD    . ARG A 1 204 ? 65.973 1.170   -0.182  1.00 12.20 ? 201 ARG A CD    1 
ATOM   1578 N  NE    . ARG A 1 204 ? 65.990 2.025   0.993   1.00 8.48  ? 201 ARG A NE    1 
ATOM   1579 C  CZ    . ARG A 1 204 ? 67.037 2.144   1.798   1.00 12.89 ? 201 ARG A CZ    1 
ATOM   1580 N  NH1   . ARG A 1 204 ? 66.991 2.957   2.846   1.00 11.54 ? 201 ARG A NH1   1 
ATOM   1581 N  NH2   . ARG A 1 204 ? 68.134 1.448   1.552   1.00 11.95 ? 201 ARG A NH2   1 
ATOM   1582 N  N     . ALA A 1 205 ? 68.763 5.412   -2.978  1.00 11.11 ? 202 ALA A N     1 
ATOM   1583 C  CA    . ALA A 1 205 ? 69.502 6.676   -2.966  1.00 13.83 ? 202 ALA A CA    1 
ATOM   1584 C  C     . ALA A 1 205 ? 68.891 7.647   -3.983  1.00 10.29 ? 202 ALA A C     1 
ATOM   1585 O  O     . ALA A 1 205 ? 68.712 8.838   -3.704  1.00 10.75 ? 202 ALA A O     1 
ATOM   1586 C  CB    . ALA A 1 205 ? 70.979 6.438   -3.276  1.00 13.43 ? 202 ALA A CB    1 
ATOM   1587 N  N     . ALA A 1 206 ? 68.558 7.132   -5.155  1.00 10.10 ? 203 ALA A N     1 
ATOM   1588 C  CA    . ALA A 1 206 ? 67.990 7.966   -6.202  1.00 12.09 ? 203 ALA A CA    1 
ATOM   1589 C  C     . ALA A 1 206 ? 66.633 8.518   -5.773  1.00 10.34 ? 203 ALA A C     1 
ATOM   1590 O  O     . ALA A 1 206 ? 66.315 9.690   -6.020  1.00 11.72 ? 203 ALA A O     1 
ATOM   1591 C  CB    . ALA A 1 206 ? 67.857 7.180   -7.492  1.00 12.29 ? 203 ALA A CB    1 
ATOM   1592 N  N     . ILE A 1 207 ? 65.822 7.677   -5.149  1.00 8.46  ? 204 ILE A N     1 
ATOM   1593 C  CA    . ILE A 1 207 ? 64.527 8.145   -4.671  1.00 11.70 ? 204 ILE A CA    1 
ATOM   1594 C  C     . ILE A 1 207 ? 64.716 9.303   -3.699  1.00 11.16 ? 204 ILE A C     1 
ATOM   1595 O  O     . ILE A 1 207 ? 64.037 10.325  -3.806  1.00 7.41  ? 204 ILE A O     1 
ATOM   1596 C  CB    . ILE A 1 207 ? 63.697 7.020   -4.024  1.00 7.79  ? 204 ILE A CB    1 
ATOM   1597 C  CG1   . ILE A 1 207 ? 63.295 6.005   -5.098  1.00 6.27  ? 204 ILE A CG1   1 
ATOM   1598 C  CG2   . ILE A 1 207 ? 62.443 7.591   -3.351  1.00 8.62  ? 204 ILE A CG2   1 
ATOM   1599 C  CD1   . ILE A 1 207 ? 62.471 4.802   -4.561  1.00 9.40  ? 204 ILE A CD1   1 
ATOM   1600 N  N     . GLU A 1 208 ? 65.645 9.158   -2.760  1.00 9.94  ? 205 GLU A N     1 
ATOM   1601 C  CA    . GLU A 1 208 ? 65.833 10.203  -1.753  1.00 12.58 ? 205 GLU A CA    1 
ATOM   1602 C  C     . GLU A 1 208 ? 66.423 11.465  -2.366  1.00 13.13 ? 205 GLU A C     1 
ATOM   1603 O  O     . GLU A 1 208 ? 65.984 12.570  -2.053  1.00 12.02 ? 205 GLU A O     1 
ATOM   1604 C  CB    . GLU A 1 208 ? 66.711 9.736   -0.593  1.00 12.71 ? 205 GLU A CB    1 
ATOM   1605 C  CG    . GLU A 1 208 ? 66.771 10.769  0.538   1.00 15.90 ? 205 GLU A CG    1 
ATOM   1606 C  CD    . GLU A 1 208 ? 67.517 10.280  1.773   1.00 16.27 ? 205 GLU A CD    1 
ATOM   1607 O  OE1   . GLU A 1 208 ? 67.496 10.990  2.797   1.00 19.43 ? 205 GLU A OE1   1 
ATOM   1608 O  OE2   . GLU A 1 208 ? 68.121 9.195   1.717   1.00 15.92 ? 205 GLU A OE2   1 
ATOM   1609 N  N     . ARG A 1 209 ? 67.400 11.298  -3.255  1.00 12.11 ? 206 ARG A N     1 
ATOM   1610 C  CA    . ARG A 1 209 ? 68.020 12.457  -3.904  1.00 13.63 ? 206 ARG A CA    1 
ATOM   1611 C  C     . ARG A 1 209 ? 67.002 13.293  -4.684  1.00 10.96 ? 206 ARG A C     1 
ATOM   1612 O  O     . ARG A 1 209 ? 67.038 14.516  -4.640  1.00 10.85 ? 206 ARG A O     1 
ATOM   1613 C  CB    . ARG A 1 209 ? 69.176 12.047  -4.844  1.00 13.27 ? 206 ARG A CB    1 
ATOM   1614 C  CG    . ARG A 1 209 ? 69.955 13.276  -5.385  1.00 16.05 ? 206 ARG A CG    1 
ATOM   1615 C  CD    . ARG A 1 209 ? 70.984 12.946  -6.487  1.00 20.48 ? 206 ARG A CD    1 
ATOM   1616 N  NE    . ARG A 1 209 ? 70.395 12.604  -7.787  1.00 25.03 ? 206 ARG A NE    1 
ATOM   1617 C  CZ    . ARG A 1 209 ? 70.033 13.490  -8.718  1.00 25.57 ? 206 ARG A CZ    1 
ATOM   1618 N  NH1   . ARG A 1 209 ? 69.525 13.076  -9.876  1.00 19.90 ? 206 ARG A NH1   1 
ATOM   1619 N  NH2   . ARG A 1 209 ? 70.176 14.790  -8.496  1.00 18.96 ? 206 ARG A NH2   1 
ATOM   1620 N  N     . GLU A 1 210 ? 66.115 12.625  -5.413  1.00 9.86  ? 207 GLU A N     1 
ATOM   1621 C  CA    . GLU A 1 210 ? 65.261 13.298  -6.385  1.00 11.68 ? 207 GLU A CA    1 
ATOM   1622 C  C     . GLU A 1 210 ? 63.871 13.655  -5.851  1.00 10.70 ? 207 GLU A C     1 
ATOM   1623 O  O     . GLU A 1 210 ? 63.137 14.421  -6.485  1.00 8.28  ? 207 GLU A O     1 
ATOM   1624 C  CB    . GLU A 1 210 ? 65.150 12.449  -7.651  1.00 12.51 ? 207 GLU A CB    1 
ATOM   1625 C  CG    . GLU A 1 210 ? 66.503 12.073  -8.214  1.00 13.20 ? 207 GLU A CG    1 
ATOM   1626 C  CD    . GLU A 1 210 ? 66.421 11.187  -9.441  1.00 18.82 ? 207 GLU A CD    1 
ATOM   1627 O  OE1   . GLU A 1 210 ? 65.396 11.227  -10.155 1.00 19.53 ? 207 GLU A OE1   1 
ATOM   1628 O  OE2   . GLU A 1 210 ? 67.392 10.443  -9.691  1.00 19.14 ? 207 GLU A OE2   1 
ATOM   1629 N  N     . THR A 1 211 ? 63.504 13.129  -4.684  1.00 8.59  ? 208 THR A N     1 
ATOM   1630 C  CA    . THR A 1 211 ? 62.176 13.443  -4.153  1.00 9.25  ? 208 THR A CA    1 
ATOM   1631 C  C     . THR A 1 211 ? 62.235 13.977  -2.746  1.00 9.39  ? 208 THR A C     1 
ATOM   1632 O  O     . THR A 1 211 ? 61.338 14.681  -2.334  1.00 10.91 ? 208 THR A O     1 
ATOM   1633 C  CB    . THR A 1 211 ? 61.227 12.236  -4.156  1.00 10.16 ? 208 THR A CB    1 
ATOM   1634 O  OG1   . THR A 1 211 ? 61.648 11.285  -3.173  1.00 9.60  ? 208 THR A OG1   1 
ATOM   1635 C  CG2   . THR A 1 211 ? 61.177 11.596  -5.528  1.00 7.88  ? 208 THR A CG2   1 
ATOM   1636 N  N     . GLY A 1 212 ? 63.286 13.627  -2.016  1.00 9.39  ? 209 GLY A N     1 
ATOM   1637 C  CA    . GLY A 1 212 ? 63.370 13.956  -0.610  1.00 13.48 ? 209 GLY A CA    1 
ATOM   1638 C  C     . GLY A 1 212 ? 62.818 12.856  0.286   1.00 15.20 ? 209 GLY A C     1 
ATOM   1639 O  O     . GLY A 1 212 ? 63.012 12.895  1.493   1.00 15.47 ? 209 GLY A O     1 
ATOM   1640 N  N     . PHE A 1 213 ? 62.136 11.875  -0.307  1.00 10.76 ? 210 PHE A N     1 
ATOM   1641 C  CA    . PHE A 1 213 ? 61.470 10.811  0.454   1.00 9.13  ? 210 PHE A CA    1 
ATOM   1642 C  C     . PHE A 1 213 ? 62.397 9.626   0.747   1.00 12.45 ? 210 PHE A C     1 
ATOM   1643 O  O     . PHE A 1 213 ? 63.141 9.184   -0.125  1.00 11.54 ? 210 PHE A O     1 
ATOM   1644 C  CB    . PHE A 1 213 ? 60.257 10.285  -0.315  1.00 6.64  ? 210 PHE A CB    1 
ATOM   1645 C  CG    . PHE A 1 213 ? 59.255 11.341  -0.663  1.00 7.54  ? 210 PHE A CG    1 
ATOM   1646 C  CD1   . PHE A 1 213 ? 58.538 11.268  -1.844  1.00 7.78  ? 210 PHE A CD1   1 
ATOM   1647 C  CD2   . PHE A 1 213 ? 59.026 12.415  0.198   1.00 9.40  ? 210 PHE A CD2   1 
ATOM   1648 C  CE1   . PHE A 1 213 ? 57.608 12.250  -2.169  1.00 10.99 ? 210 PHE A CE1   1 
ATOM   1649 C  CE2   . PHE A 1 213 ? 58.098 13.387  -0.122  1.00 9.52  ? 210 PHE A CE2   1 
ATOM   1650 C  CZ    . PHE A 1 213 ? 57.389 13.303  -1.314  1.00 8.47  ? 210 PHE A CZ    1 
ATOM   1651 N  N     . GLN A 1 214 ? 62.333 9.114   1.976   1.00 7.24  ? 211 GLN A N     1 
ATOM   1652 C  CA    . GLN A 1 214 ? 63.070 7.912   2.357   1.00 8.56  ? 211 GLN A CA    1 
ATOM   1653 C  C     . GLN A 1 214 ? 62.163 6.691   2.329   1.00 10.06 ? 211 GLN A C     1 
ATOM   1654 O  O     . GLN A 1 214 ? 60.947 6.806   2.494   1.00 9.38  ? 211 GLN A O     1 
ATOM   1655 C  CB    . GLN A 1 214 ? 63.649 8.077   3.763   1.00 11.26 ? 211 GLN A CB    1 
ATOM   1656 C  CG    . GLN A 1 214 ? 64.856 9.009   3.815   1.00 11.38 ? 211 GLN A CG    1 
ATOM   1657 C  CD    . GLN A 1 214 ? 65.357 9.224   5.228   1.00 18.46 ? 211 GLN A CD    1 
ATOM   1658 O  OE1   . GLN A 1 214 ? 64.797 8.692   6.193   1.00 14.45 ? 211 GLN A OE1   1 
ATOM   1659 N  NE2   . GLN A 1 214 ? 66.418 10.013  5.359   1.00 20.22 ? 211 GLN A NE2   1 
ATOM   1660 N  N     . CYS A 1 215 ? 62.745 5.517   2.129   1.00 9.35  ? 212 CYS A N     1 
ATOM   1661 C  CA    . CYS A 1 215 ? 61.943 4.296   2.078   1.00 9.82  ? 212 CYS A CA    1 
ATOM   1662 C  C     . CYS A 1 215 ? 62.716 3.121   2.658   1.00 10.47 ? 212 CYS A C     1 
ATOM   1663 O  O     . CYS A 1 215 ? 63.926 3.217   2.901   1.00 11.36 ? 212 CYS A O     1 
ATOM   1664 C  CB    . CYS A 1 215 ? 61.561 3.972   0.639   1.00 11.09 ? 212 CYS A CB    1 
ATOM   1665 S  SG    . CYS A 1 215 ? 62.998 3.799   -0.435  1.00 17.04 ? 212 CYS A SG    1 
ATOM   1666 N  N     . SER A 1 216 ? 62.010 2.018   2.888   1.00 7.43  ? 213 SER A N     1 
ATOM   1667 C  CA    . SER A 1 216 ? 62.650 0.766   3.262   1.00 9.35  ? 213 SER A CA    1 
ATOM   1668 C  C     . SER A 1 216 ? 62.459 -0.211  2.118   1.00 9.21  ? 213 SER A C     1 
ATOM   1669 O  O     . SER A 1 216 ? 61.677 0.063   1.198   1.00 9.72  ? 213 SER A O     1 
ATOM   1670 C  CB    . SER A 1 216 ? 62.024 0.223   4.540   1.00 11.24 ? 213 SER A CB    1 
ATOM   1671 O  OG    . SER A 1 216 ? 62.207 1.155   5.595   1.00 10.84 ? 213 SER A OG    1 
ATOM   1672 N  N     . ALA A 1 217 ? 63.171 -1.337  2.152   1.00 6.26  ? 214 ALA A N     1 
ATOM   1673 C  CA    . ALA A 1 217 ? 62.997 -2.342  1.113   1.00 5.19  ? 214 ALA A CA    1 
ATOM   1674 C  C     . ALA A 1 217 ? 63.356 -3.729  1.604   1.00 7.86  ? 214 ALA A C     1 
ATOM   1675 O  O     . ALA A 1 217 ? 64.156 -3.881  2.537   1.00 8.41  ? 214 ALA A O     1 
ATOM   1676 C  CB    . ALA A 1 217 ? 63.843 -1.991  -0.105  1.00 6.41  ? 214 ALA A CB    1 
ATOM   1677 N  N     . GLY A 1 218 ? 62.741 -4.737  0.997   1.00 6.27  ? 215 GLY A N     1 
ATOM   1678 C  CA    . GLY A 1 218 ? 63.154 -6.112  1.228   1.00 7.28  ? 215 GLY A CA    1 
ATOM   1679 C  C     . GLY A 1 218 ? 63.695 -6.688  -0.067  1.00 10.29 ? 215 GLY A C     1 
ATOM   1680 O  O     . GLY A 1 218 ? 63.186 -6.372  -1.139  1.00 9.14  ? 215 GLY A O     1 
ATOM   1681 N  N     . ILE A 1 219 ? 64.740 -7.509  0.023   1.00 7.99  ? 216 ILE A N     1 
ATOM   1682 C  CA    . ILE A 1 219 ? 65.256 -8.215  -1.147  1.00 5.60  ? 216 ILE A CA    1 
ATOM   1683 C  C     . ILE A 1 219 ? 65.250 -9.716  -0.881  1.00 9.98  ? 216 ILE A C     1 
ATOM   1684 O  O     . ILE A 1 219 ? 65.849 -10.177 0.101   1.00 9.03  ? 216 ILE A O     1 
ATOM   1685 C  CB    . ILE A 1 219 ? 66.702 -7.787  -1.476  1.00 8.23  ? 216 ILE A CB    1 
ATOM   1686 C  CG1   . ILE A 1 219 ? 66.817 -6.261  -1.679  1.00 9.36  ? 216 ILE A CG1   1 
ATOM   1687 C  CG2   . ILE A 1 219 ? 67.201 -8.527  -2.715  1.00 9.68  ? 216 ILE A CG2   1 
ATOM   1688 C  CD1   . ILE A 1 219 ? 67.195 -5.475  -0.425  1.00 11.11 ? 216 ILE A CD1   1 
ATOM   1689 N  N     . SER A 1 220 ? 64.563 -10.481 -1.724  1.00 7.22  ? 217 SER A N     1 
ATOM   1690 C  CA    . SER A 1 220 ? 64.551 -11.933 -1.575  1.00 7.56  ? 217 SER A CA    1 
ATOM   1691 C  C     . SER A 1 220 ? 64.306 -12.585 -2.924  1.00 10.32 ? 217 SER A C     1 
ATOM   1692 O  O     . SER A 1 220 ? 64.580 -11.984 -3.954  1.00 8.65  ? 217 SER A O     1 
ATOM   1693 C  CB    . SER A 1 220 ? 63.485 -12.370 -0.566  1.00 9.69  ? 217 SER A CB    1 
ATOM   1694 O  OG    . SER A 1 220 ? 63.701 -13.714 -0.169  1.00 8.15  ? 217 SER A OG    1 
ATOM   1695 N  N     . HIS A 1 221 ? 63.782 -13.806 -2.915  1.00 8.87  ? 218 HIS A N     1 
ATOM   1696 C  CA    . HIS A 1 221 ? 63.601 -14.576 -4.137  1.00 9.40  ? 218 HIS A CA    1 
ATOM   1697 C  C     . HIS A 1 221 ? 62.163 -14.550 -4.641  1.00 9.83  ? 218 HIS A C     1 
ATOM   1698 O  O     . HIS A 1 221 ? 61.868 -15.088 -5.700  1.00 9.36  ? 218 HIS A O     1 
ATOM   1699 C  CB    . HIS A 1 221 ? 64.027 -16.037 -3.930  1.00 9.66  ? 218 HIS A CB    1 
ATOM   1700 C  CG    . HIS A 1 221 ? 65.507 -16.228 -3.820  1.00 13.82 ? 218 HIS A CG    1 
ATOM   1701 N  ND1   . HIS A 1 221 ? 66.373 -15.936 -4.853  1.00 11.31 ? 218 HIS A ND1   1 
ATOM   1702 C  CD2   . HIS A 1 221 ? 66.274 -16.684 -2.799  1.00 10.68 ? 218 HIS A CD2   1 
ATOM   1703 C  CE1   . HIS A 1 221 ? 67.611 -16.204 -4.474  1.00 16.10 ? 218 HIS A CE1   1 
ATOM   1704 N  NE2   . HIS A 1 221 ? 67.578 -16.654 -3.231  1.00 11.22 ? 218 HIS A NE2   1 
ATOM   1705 N  N     . ASN A 1 222 ? 61.264 -13.937 -3.885  1.00 4.83  ? 219 ASN A N     1 
ATOM   1706 C  CA    . ASN A 1 222 ? 59.870 -13.837 -4.317  1.00 5.23  ? 219 ASN A CA    1 
ATOM   1707 C  C     . ASN A 1 222 ? 59.158 -12.696 -3.601  1.00 9.54  ? 219 ASN A C     1 
ATOM   1708 O  O     . ASN A 1 222 ? 59.712 -12.079 -2.684  1.00 7.95  ? 219 ASN A O     1 
ATOM   1709 C  CB    . ASN A 1 222 ? 59.123 -15.165 -4.098  1.00 7.29  ? 219 ASN A CB    1 
ATOM   1710 C  CG    . ASN A 1 222 ? 59.189 -15.628 -2.655  1.00 10.30 ? 219 ASN A CG    1 
ATOM   1711 O  OD1   . ASN A 1 222 ? 58.726 -14.929 -1.755  1.00 7.29  ? 219 ASN A OD1   1 
ATOM   1712 N  ND2   . ASN A 1 222 ? 59.765 -16.811 -2.428  1.00 9.47  ? 219 ASN A ND2   1 
ATOM   1713 N  N     . LYS A 1 223 ? 57.937 -12.400 -4.018  1.00 8.70  ? 220 LYS A N     1 
ATOM   1714 C  CA    . LYS A 1 223 ? 57.237 -11.227 -3.488  1.00 8.23  ? 220 LYS A CA    1 
ATOM   1715 C  C     . LYS A 1 223 ? 56.903 -11.334 -2.005  1.00 9.13  ? 220 LYS A C     1 
ATOM   1716 O  O     . LYS A 1 223 ? 57.064 -10.359 -1.253  1.00 9.59  ? 220 LYS A O     1 
ATOM   1717 C  CB    . LYS A 1 223 ? 55.962 -10.953 -4.287  1.00 8.98  ? 220 LYS A CB    1 
ATOM   1718 C  CG    . LYS A 1 223 ? 56.232 -10.542 -5.714  1.00 9.71  ? 220 LYS A CG    1 
ATOM   1719 C  CD    . LYS A 1 223 ? 55.056 -9.749  -6.304  1.00 19.09 ? 220 LYS A CD    1 
ATOM   1720 C  CE    . LYS A 1 223 ? 53.865 -10.614 -6.605  1.00 21.96 ? 220 LYS A CE    1 
ATOM   1721 N  NZ    . LYS A 1 223 ? 52.772 -9.840  -7.300  1.00 17.55 ? 220 LYS A NZ    1 
ATOM   1722 N  N     . VAL A 1 224 ? 56.422 -12.497 -1.576  1.00 7.86  ? 221 VAL A N     1 
ATOM   1723 C  CA    . VAL A 1 224 ? 56.030 -12.656 -0.167  1.00 7.59  ? 221 VAL A CA    1 
ATOM   1724 C  C     . VAL A 1 224 ? 57.217 -12.462 0.781   1.00 7.90  ? 221 VAL A C     1 
ATOM   1725 O  O     . VAL A 1 224 ? 57.112 -11.720 1.769   1.00 8.46  ? 221 VAL A O     1 
ATOM   1726 C  CB    . VAL A 1 224 ? 55.326 -14.007 0.115   1.00 12.02 ? 221 VAL A CB    1 
ATOM   1727 C  CG1   . VAL A 1 224 ? 55.184 -14.229 1.604   1.00 10.75 ? 221 VAL A CG1   1 
ATOM   1728 C  CG2   . VAL A 1 224 ? 53.951 -14.033 -0.539  1.00 15.27 ? 221 VAL A CG2   1 
ATOM   1729 N  N     . LEU A 1 225 ? 58.347 -13.097 0.475   1.00 7.32  ? 222 LEU A N     1 
ATOM   1730 C  CA    . LEU A 1 225 ? 59.553 -12.918 1.296   1.00 7.85  ? 222 LEU A CA    1 
ATOM   1731 C  C     . LEU A 1 225 ? 60.109 -11.489 1.199   1.00 7.96  ? 222 LEU A C     1 
ATOM   1732 O  O     . LEU A 1 225 ? 60.586 -10.941 2.190   1.00 8.85  ? 222 LEU A O     1 
ATOM   1733 C  CB    . LEU A 1 225 ? 60.662 -13.928 0.936   1.00 5.64  ? 222 LEU A CB    1 
ATOM   1734 C  CG    . LEU A 1 225 ? 60.423 -15.404 1.306   1.00 6.80  ? 222 LEU A CG    1 
ATOM   1735 C  CD1   . LEU A 1 225 ? 61.678 -16.241 0.988   1.00 11.35 ? 222 LEU A CD1   1 
ATOM   1736 C  CD2   . LEU A 1 225 ? 60.047 -15.548 2.773   1.00 10.64 ? 222 LEU A CD2   1 
ATOM   1737 N  N     . ALA A 1 226 ? 60.063 -10.890 0.009   1.00 6.86  ? 223 ALA A N     1 
ATOM   1738 C  CA    . ALA A 1 226 ? 60.521 -9.501  -0.137  1.00 8.28  ? 223 ALA A CA    1 
ATOM   1739 C  C     . ALA A 1 226 ? 59.704 -8.563  0.727   1.00 8.86  ? 223 ALA A C     1 
ATOM   1740 O  O     . ALA A 1 226 ? 60.240 -7.668  1.396   1.00 5.96  ? 223 ALA A O     1 
ATOM   1741 C  CB    . ALA A 1 226 ? 60.471 -9.054  -1.603  1.00 8.35  ? 223 ALA A CB    1 
ATOM   1742 N  N     . LYS A 1 227 ? 58.396 -8.766  0.696   1.00 6.75  ? 224 LYS A N     1 
ATOM   1743 C  CA    . LYS A 1 227 ? 57.496 -7.976  1.504   1.00 8.73  ? 224 LYS A CA    1 
ATOM   1744 C  C     . LYS A 1 227 ? 57.760 -8.150  3.011   1.00 11.33 ? 224 LYS A C     1 
ATOM   1745 O  O     . LYS A 1 227 ? 57.817 -7.180  3.776   1.00 8.10  ? 224 LYS A O     1 
ATOM   1746 C  CB    . LYS A 1 227 ? 56.039 -8.364  1.231   1.00 8.82  ? 224 LYS A CB    1 
ATOM   1747 C  CG    A LYS A 1 227 ? 55.036 -7.703  2.178   0.75 15.10 ? 224 LYS A CG    1 
ATOM   1748 C  CG    B LYS A 1 227 ? 55.031 -7.728  2.179   0.25 15.06 ? 224 LYS A CG    1 
ATOM   1749 C  CD    A LYS A 1 227 ? 55.115 -6.181  2.089   0.75 16.47 ? 224 LYS A CD    1 
ATOM   1750 C  CD    B LYS A 1 227 ? 54.930 -6.224  1.965   0.25 16.64 ? 224 LYS A CD    1 
ATOM   1751 C  CE    A LYS A 1 227 ? 54.002 -5.517  2.895   0.75 24.09 ? 224 LYS A CE    1 
ATOM   1752 C  CE    B LYS A 1 227 ? 53.879 -5.608  2.880   0.25 23.63 ? 224 LYS A CE    1 
ATOM   1753 N  NZ    A LYS A 1 227 ? 54.062 -4.031  2.816   0.75 20.33 ? 224 LYS A NZ    1 
ATOM   1754 N  NZ    B LYS A 1 227 ? 52.541 -6.238  2.693   0.25 18.33 ? 224 LYS A NZ    1 
ATOM   1755 N  N     . LEU A 1 228 ? 57.898 -9.397  3.437   1.00 8.33  ? 225 LEU A N     1 
ATOM   1756 C  CA    . LEU A 1 228 ? 58.213 -9.688  4.835   1.00 9.49  ? 225 LEU A CA    1 
ATOM   1757 C  C     . LEU A 1 228 ? 59.555 -9.062  5.249   1.00 11.26 ? 225 LEU A C     1 
ATOM   1758 O  O     . LEU A 1 228 ? 59.656 -8.399  6.288   1.00 9.33  ? 225 LEU A O     1 
ATOM   1759 C  CB    . LEU A 1 228 ? 58.219 -11.204 5.049   1.00 9.05  ? 225 LEU A CB    1 
ATOM   1760 C  CG    . LEU A 1 228 ? 58.404 -11.703 6.481   1.00 16.83 ? 225 LEU A CG    1 
ATOM   1761 C  CD1   . LEU A 1 228 ? 57.247 -11.215 7.359   1.00 16.55 ? 225 LEU A CD1   1 
ATOM   1762 C  CD2   . LEU A 1 228 ? 58.496 -13.216 6.484   1.00 13.16 ? 225 LEU A CD2   1 
ATOM   1763 N  N     . ALA A 1 229 ? 60.581 -9.275  4.430   1.00 7.55  ? 226 ALA A N     1 
ATOM   1764 C  CA    . ALA A 1 229 ? 61.898 -8.667  4.652   1.00 9.11  ? 226 ALA A CA    1 
ATOM   1765 C  C     . ALA A 1 229 ? 61.831 -7.149  4.843   1.00 10.51 ? 226 ALA A C     1 
ATOM   1766 O  O     . ALA A 1 229 ? 62.468 -6.596  5.738   1.00 10.82 ? 226 ALA A O     1 
ATOM   1767 C  CB    . ALA A 1 229 ? 62.845 -9.005  3.482   1.00 7.28  ? 226 ALA A CB    1 
ATOM   1768 N  N     . CYS A 1 230 ? 61.073 -6.477  3.983   1.00 6.45  ? 227 CYS A N     1 
ATOM   1769 C  CA    . CYS A 1 230 ? 61.012 -5.018  4.004   1.00 7.02  ? 227 CYS A CA    1 
ATOM   1770 C  C     . CYS A 1 230 ? 60.644 -4.489  5.398   1.00 9.39  ? 227 CYS A C     1 
ATOM   1771 O  O     . CYS A 1 230 ? 61.220 -3.509  5.884   1.00 12.53 ? 227 CYS A O     1 
ATOM   1772 C  CB    . CYS A 1 230 ? 59.998 -4.522  2.970   1.00 7.13  ? 227 CYS A CB    1 
ATOM   1773 S  SG    . CYS A 1 230 ? 59.886 -2.711  2.852   1.00 11.44 ? 227 CYS A SG    1 
ATOM   1774 N  N     . GLY A 1 231 ? 59.691 -5.153  6.039   1.00 8.48  ? 228 GLY A N     1 
ATOM   1775 C  CA    . GLY A 1 231 ? 59.217 -4.728  7.350   1.00 11.33 ? 228 GLY A CA    1 
ATOM   1776 C  C     . GLY A 1 231 ? 60.144 -5.077  8.514   1.00 15.16 ? 228 GLY A C     1 
ATOM   1777 O  O     . GLY A 1 231 ? 59.908 -4.658  9.644   1.00 14.58 ? 228 GLY A O     1 
ATOM   1778 N  N     . LEU A 1 232 ? 61.199 -5.841  8.257   1.00 11.82 ? 229 LEU A N     1 
ATOM   1779 C  CA    . LEU A 1 232 ? 62.021 -6.345  9.362   1.00 12.63 ? 229 LEU A CA    1 
ATOM   1780 C  C     . LEU A 1 232 ? 62.889 -5.253  9.967   1.00 15.78 ? 229 LEU A C     1 
ATOM   1781 O  O     . LEU A 1 232 ? 63.212 -5.293  11.150  1.00 13.57 ? 229 LEU A O     1 
ATOM   1782 C  CB    . LEU A 1 232 ? 62.889 -7.515  8.908   1.00 13.75 ? 229 LEU A CB    1 
ATOM   1783 C  CG    . LEU A 1 232 ? 62.119 -8.792  8.571   1.00 14.18 ? 229 LEU A CG    1 
ATOM   1784 C  CD1   . LEU A 1 232 ? 63.086 -9.880  8.145   1.00 12.33 ? 229 LEU A CD1   1 
ATOM   1785 C  CD2   . LEU A 1 232 ? 61.270 -9.246  9.768   1.00 15.34 ? 229 LEU A CD2   1 
ATOM   1786 N  N     . ASN A 1 233 ? 63.272 -4.284  9.140   1.00 11.54 ? 230 ASN A N     1 
ATOM   1787 C  CA    . ASN A 1 233 ? 64.101 -3.163  9.572   1.00 15.28 ? 230 ASN A CA    1 
ATOM   1788 C  C     . ASN A 1 233 ? 63.618 -1.878  8.893   1.00 16.71 ? 230 ASN A C     1 
ATOM   1789 O  O     . ASN A 1 233 ? 63.971 -1.596  7.754   1.00 27.20 ? 230 ASN A O     1 
ATOM   1790 C  CB    . ASN A 1 233 ? 65.573 -3.416  9.230   1.00 13.04 ? 230 ASN A CB    1 
ATOM   1791 C  CG    . ASN A 1 233 ? 66.156 -4.606  9.977   1.00 15.68 ? 230 ASN A CG    1 
ATOM   1792 O  OD1   . ASN A 1 233 ? 66.498 -4.498  11.151  1.00 15.00 ? 230 ASN A OD1   1 
ATOM   1793 N  ND2   . ASN A 1 233 ? 66.299 -5.735  9.291   1.00 11.95 ? 230 ASN A ND2   1 
ATOM   1794 N  N     . LYS A 1 234 ? 62.762 -1.146  9.588   1.00 21.00 ? 231 LYS A N     1 
ATOM   1795 C  CA    . LYS A 1 234 ? 62.213 0.117   9.117   1.00 16.50 ? 231 LYS A CA    1 
ATOM   1796 C  C     . LYS A 1 234 ? 62.511 1.081   10.248  1.00 18.08 ? 231 LYS A C     1 
ATOM   1797 O  O     . LYS A 1 234 ? 62.630 0.661   11.397  1.00 21.68 ? 231 LYS A O     1 
ATOM   1798 C  CB    . LYS A 1 234 ? 60.688 0.010   8.907   1.00 18.08 ? 231 LYS A CB    1 
ATOM   1799 C  CG    . LYS A 1 234 ? 60.220 -0.360  7.488   1.00 22.26 ? 231 LYS A CG    1 
ATOM   1800 C  CD    . LYS A 1 234 ? 58.743 0.080   7.248   1.00 22.41 ? 231 LYS A CD    1 
ATOM   1801 C  CE    . LYS A 1 234 ? 58.373 0.199   5.748   1.00 25.01 ? 231 LYS A CE    1 
ATOM   1802 N  NZ    . LYS A 1 234 ? 58.285 1.632   5.223   1.00 15.07 ? 231 LYS A NZ    1 
ATOM   1803 N  N     . PRO A 1 235 ? 62.649 2.376   9.943   1.00 12.95 ? 232 PRO A N     1 
ATOM   1804 C  CA    . PRO A 1 235 ? 62.576 3.003   8.619   1.00 14.58 ? 232 PRO A CA    1 
ATOM   1805 C  C     . PRO A 1 235 ? 63.941 3.170   7.976   1.00 14.08 ? 232 PRO A C     1 
ATOM   1806 O  O     . PRO A 1 235 ? 64.958 2.959   8.633   1.00 11.41 ? 232 PRO A O     1 
ATOM   1807 C  CB    . PRO A 1 235 ? 62.031 4.388   8.943   1.00 15.56 ? 232 PRO A CB    1 
ATOM   1808 C  CG    . PRO A 1 235 ? 62.673 4.706   10.283  1.00 15.21 ? 232 PRO A CG    1 
ATOM   1809 C  CD    . PRO A 1 235 ? 62.719 3.379   11.023  1.00 16.69 ? 232 PRO A CD    1 
ATOM   1810 N  N     . ASN A 1 236 ? 63.956 3.551   6.702   1.00 10.51 ? 233 ASN A N     1 
ATOM   1811 C  CA    . ASN A 1 236 ? 65.201 3.958   6.054   1.00 12.42 ? 233 ASN A CA    1 
ATOM   1812 C  C     . ASN A 1 236 ? 66.299 2.884   6.062   1.00 9.70  ? 233 ASN A C     1 
ATOM   1813 O  O     . ASN A 1 236 ? 67.478 3.210   6.172   1.00 11.88 ? 233 ASN A O     1 
ATOM   1814 C  CB    . ASN A 1 236 ? 65.724 5.244   6.708   1.00 12.85 ? 233 ASN A CB    1 
ATOM   1815 C  CG    . ASN A 1 236 ? 66.774 5.950   5.864   1.00 15.96 ? 233 ASN A CG    1 
ATOM   1816 O  OD1   . ASN A 1 236 ? 66.712 5.931   4.642   1.00 15.69 ? 233 ASN A OD1   1 
ATOM   1817 N  ND2   . ASN A 1 236 ? 67.740 6.580   6.522   1.00 19.54 ? 233 ASN A ND2   1 
ATOM   1818 N  N     . ARG A 1 237 ? 65.911 1.615   5.932   1.00 8.29  ? 234 ARG A N     1 
ATOM   1819 C  CA    . ARG A 1 237 ? 66.869 0.505   5.876   1.00 12.89 ? 234 ARG A CA    1 
ATOM   1820 C  C     . ARG A 1 237 ? 66.333 -0.570  4.939   1.00 11.89 ? 234 ARG A C     1 
ATOM   1821 O  O     . ARG A 1 237 ? 65.152 -0.587  4.621   1.00 10.84 ? 234 ARG A O     1 
ATOM   1822 C  CB    . ARG A 1 237 ? 67.090 -0.119  7.263   1.00 12.12 ? 234 ARG A CB    1 
ATOM   1823 C  CG    . ARG A 1 237 ? 67.741 0.801   8.304   1.00 12.47 ? 234 ARG A CG    1 
ATOM   1824 C  CD    . ARG A 1 237 ? 69.208 1.078   7.963   1.00 22.42 ? 234 ARG A CD    1 
ATOM   1825 N  NE    . ARG A 1 237 ? 69.896 1.864   8.993   1.00 21.41 ? 234 ARG A NE    1 
ATOM   1826 C  CZ    . ARG A 1 237 ? 69.922 3.195   9.035   1.00 25.78 ? 234 ARG A CZ    1 
ATOM   1827 N  NH1   . ARG A 1 237 ? 69.298 3.914   8.107   1.00 20.17 ? 234 ARG A NH1   1 
ATOM   1828 N  NH2   . ARG A 1 237 ? 70.576 3.812   10.008  1.00 26.36 ? 234 ARG A NH2   1 
ATOM   1829 N  N     . GLN A 1 238 ? 67.196 -1.474  4.497   1.00 7.76  ? 235 GLN A N     1 
ATOM   1830 C  CA    . GLN A 1 238 ? 66.740 -2.551  3.646   1.00 8.39  ? 235 GLN A CA    1 
ATOM   1831 C  C     . GLN A 1 238 ? 67.263 -3.881  4.169   1.00 8.88  ? 235 GLN A C     1 
ATOM   1832 O  O     . GLN A 1 238 ? 68.315 -3.931  4.799   1.00 11.33 ? 235 GLN A O     1 
ATOM   1833 C  CB    . GLN A 1 238 ? 67.155 -2.324  2.187   1.00 6.39  ? 235 GLN A CB    1 
ATOM   1834 C  CG    . GLN A 1 238 ? 68.652 -2.229  1.979   1.00 11.18 ? 235 GLN A CG    1 
ATOM   1835 C  CD    . GLN A 1 238 ? 69.003 -1.971  0.531   1.00 12.67 ? 235 GLN A CD    1 
ATOM   1836 O  OE1   . GLN A 1 238 ? 68.570 -0.976  -0.062  1.00 11.93 ? 235 GLN A OE1   1 
ATOM   1837 N  NE2   . GLN A 1 238 ? 69.763 -2.878  -0.058  1.00 8.56  ? 235 GLN A NE2   1 
ATOM   1838 N  N     . THR A 1 239 ? 66.512 -4.948  3.923   1.00 7.25  ? 236 THR A N     1 
ATOM   1839 C  CA    . THR A 1 239 ? 66.811 -6.249  4.518   1.00 11.30 ? 236 THR A CA    1 
ATOM   1840 C  C     . THR A 1 239 ? 66.851 -7.338  3.451   1.00 10.67 ? 236 THR A C     1 
ATOM   1841 O  O     . THR A 1 239 ? 65.956 -7.429  2.622   1.00 9.06  ? 236 THR A O     1 
ATOM   1842 C  CB    . THR A 1 239 ? 65.758 -6.609  5.578   1.00 10.30 ? 236 THR A CB    1 
ATOM   1843 O  OG1   . THR A 1 239 ? 65.651 -5.546  6.529   1.00 10.96 ? 236 THR A OG1   1 
ATOM   1844 C  CG2   . THR A 1 239 ? 66.135 -7.898  6.320   1.00 10.70 ? 236 THR A CG2   1 
ATOM   1845 N  N     . LEU A 1 240 ? 67.896 -8.159  3.474   1.00 9.07  ? 237 LEU A N     1 
ATOM   1846 C  CA    . LEU A 1 240 ? 68.020 -9.272  2.548   1.00 6.94  ? 237 LEU A CA    1 
ATOM   1847 C  C     . LEU A 1 240 ? 67.628 -10.563 3.281   1.00 9.95  ? 237 LEU A C     1 
ATOM   1848 O  O     . LEU A 1 240 ? 68.169 -10.868 4.346   1.00 8.11  ? 237 LEU A O     1 
ATOM   1849 C  CB    . LEU A 1 240 ? 69.454 -9.331  1.999   1.00 9.52  ? 237 LEU A CB    1 
ATOM   1850 C  CG    . LEU A 1 240 ? 69.906 -10.377 0.976   1.00 11.10 ? 237 LEU A CG    1 
ATOM   1851 C  CD1   . LEU A 1 240 ? 71.239 -9.976  0.331   1.00 12.44 ? 237 LEU A CD1   1 
ATOM   1852 C  CD2   . LEU A 1 240 ? 70.033 -11.765 1.607   1.00 11.17 ? 237 LEU A CD2   1 
ATOM   1853 N  N     . VAL A 1 241 ? 66.648 -11.281 2.735   1.00 10.72 ? 238 VAL A N     1 
ATOM   1854 C  CA    . VAL A 1 241 ? 66.227 -12.568 3.299   1.00 10.58 ? 238 VAL A CA    1 
ATOM   1855 C  C     . VAL A 1 241 ? 66.606 -13.663 2.324   1.00 9.24  ? 238 VAL A C     1 
ATOM   1856 O  O     . VAL A 1 241 ? 66.028 -13.763 1.245   1.00 8.92  ? 238 VAL A O     1 
ATOM   1857 C  CB    . VAL A 1 241 ? 64.723 -12.611 3.572   1.00 8.91  ? 238 VAL A CB    1 
ATOM   1858 C  CG1   . VAL A 1 241 ? 64.244 -14.065 3.856   1.00 8.32  ? 238 VAL A CG1   1 
ATOM   1859 C  CG2   . VAL A 1 241 ? 64.386 -11.691 4.744   1.00 8.78  ? 238 VAL A CG2   1 
ATOM   1860 N  N     . SER A 1 242 ? 67.609 -14.452 2.689   1.00 10.83 ? 239 SER A N     1 
ATOM   1861 C  CA    . SER A 1 242 ? 68.093 -15.494 1.790   1.00 11.53 ? 239 SER A CA    1 
ATOM   1862 C  C     . SER A 1 242 ? 67.241 -16.749 1.936   1.00 8.27  ? 239 SER A C     1 
ATOM   1863 O  O     . SER A 1 242 ? 66.498 -16.897 2.905   1.00 7.49  ? 239 SER A O     1 
ATOM   1864 C  CB    . SER A 1 242 ? 69.557 -15.820 2.089   1.00 11.82 ? 239 SER A CB    1 
ATOM   1865 O  OG    . SER A 1 242 ? 69.670 -16.347 3.405   1.00 11.72 ? 239 SER A OG    1 
ATOM   1866 N  N     . HIS A 1 243 ? 67.350 -17.659 0.975   1.00 8.39  ? 240 HIS A N     1 
ATOM   1867 C  CA    . HIS A 1 243 ? 66.607 -18.903 1.066   1.00 10.03 ? 240 HIS A CA    1 
ATOM   1868 C  C     . HIS A 1 243 ? 67.009 -19.617 2.356   1.00 11.41 ? 240 HIS A C     1 
ATOM   1869 O  O     . HIS A 1 243 ? 66.171 -20.209 3.038   1.00 9.59  ? 240 HIS A O     1 
ATOM   1870 C  CB    . HIS A 1 243 ? 66.911 -19.825 -0.116  1.00 13.11 ? 240 HIS A CB    1 
ATOM   1871 C  CG    . HIS A 1 243 ? 66.168 -21.127 -0.057  1.00 12.92 ? 240 HIS A CG    1 
ATOM   1872 N  ND1   . HIS A 1 243 ? 64.813 -21.218 -0.281  1.00 13.42 ? 240 HIS A ND1   1 
ATOM   1873 C  CD2   . HIS A 1 243 ? 66.590 -22.384 0.222   1.00 13.38 ? 240 HIS A CD2   1 
ATOM   1874 C  CE1   . HIS A 1 243 ? 64.432 -22.480 -0.163  1.00 14.82 ? 240 HIS A CE1   1 
ATOM   1875 N  NE2   . HIS A 1 243 ? 65.493 -23.208 0.142   1.00 14.38 ? 240 HIS A NE2   1 
ATOM   1876 N  N     . GLY A 1 244 ? 68.301 -19.544 2.670   1.00 10.22 ? 241 GLY A N     1 
ATOM   1877 C  CA    . GLY A 1 244 ? 68.866 -20.225 3.826   1.00 11.13 ? 241 GLY A CA    1 
ATOM   1878 C  C     . GLY A 1 244 ? 68.335 -19.733 5.158   1.00 9.89  ? 241 GLY A C     1 
ATOM   1879 O  O     . GLY A 1 244 ? 68.269 -20.500 6.121   1.00 10.15 ? 241 GLY A O     1 
ATOM   1880 N  N     . SER A 1 245 ? 67.941 -18.464 5.214   1.00 8.14  ? 242 SER A N     1 
ATOM   1881 C  CA    . SER A 1 245 ? 67.451 -17.872 6.460   1.00 9.99  ? 242 SER A CA    1 
ATOM   1882 C  C     . SER A 1 245 ? 66.030 -18.277 6.793   1.00 7.48  ? 242 SER A C     1 
ATOM   1883 O  O     . SER A 1 245 ? 65.565 -18.022 7.897   1.00 8.77  ? 242 SER A O     1 
ATOM   1884 C  CB    . SER A 1 245 ? 67.518 -16.344 6.409   1.00 8.76  ? 242 SER A CB    1 
ATOM   1885 O  OG    . SER A 1 245 ? 66.571 -15.808 5.489   1.00 10.77 ? 242 SER A OG    1 
ATOM   1886 N  N     . VAL A 1 246 ? 65.341 -18.898 5.844   1.00 6.70  ? 243 VAL A N     1 
ATOM   1887 C  CA    . VAL A 1 246 ? 63.904 -19.134 6.012   1.00 7.86  ? 243 VAL A CA    1 
ATOM   1888 C  C     . VAL A 1 246 ? 63.546 -20.064 7.183   1.00 8.70  ? 243 VAL A C     1 
ATOM   1889 O  O     . VAL A 1 246 ? 62.686 -19.735 7.989   1.00 7.96  ? 243 VAL A O     1 
ATOM   1890 C  CB    . VAL A 1 246 ? 63.260 -19.624 4.703   1.00 9.25  ? 243 VAL A CB    1 
ATOM   1891 C  CG1   . VAL A 1 246 ? 61.805 -20.115 4.936   1.00 8.83  ? 243 VAL A CG1   1 
ATOM   1892 C  CG2   . VAL A 1 246 ? 63.312 -18.505 3.667   1.00 9.17  ? 243 VAL A CG2   1 
ATOM   1893 N  N     . PRO A 1 247 ? 64.208 -21.225 7.293   1.00 7.48  ? 244 PRO A N     1 
ATOM   1894 C  CA    . PRO A 1 247 ? 63.767 -22.090 8.397   1.00 8.27  ? 244 PRO A CA    1 
ATOM   1895 C  C     . PRO A 1 247 ? 63.822 -21.419 9.783   1.00 9.06  ? 244 PRO A C     1 
ATOM   1896 O  O     . PRO A 1 247 ? 62.873 -21.563 10.556  1.00 8.08  ? 244 PRO A O     1 
ATOM   1897 C  CB    . PRO A 1 247 ? 64.735 -23.282 8.330   1.00 10.59 ? 244 PRO A CB    1 
ATOM   1898 C  CG    . PRO A 1 247 ? 65.158 -23.332 6.867   1.00 13.29 ? 244 PRO A CG    1 
ATOM   1899 C  CD    . PRO A 1 247 ? 65.213 -21.878 6.426   1.00 11.36 ? 244 PRO A CD    1 
ATOM   1900 N  N     . GLN A 1 248 ? 64.900 -20.715 10.099  1.00 8.10  ? 245 GLN A N     1 
ATOM   1901 C  CA    . GLN A 1 248 ? 64.975 -20.051 11.401  1.00 10.54 ? 245 GLN A CA    1 
ATOM   1902 C  C     . GLN A 1 248 ? 63.965 -18.901 11.489  1.00 11.04 ? 245 GLN A C     1 
ATOM   1903 O  O     . GLN A 1 248 ? 63.284 -18.727 12.512  1.00 11.26 ? 245 GLN A O     1 
ATOM   1904 C  CB    . GLN A 1 248 ? 66.391 -19.546 11.688  1.00 11.63 ? 245 GLN A CB    1 
ATOM   1905 C  CG    . GLN A 1 248 ? 67.408 -20.655 11.978  1.00 18.12 ? 245 GLN A CG    1 
ATOM   1906 C  CD    . GLN A 1 248 ? 68.397 -20.267 13.070  1.00 27.27 ? 245 GLN A CD    1 
ATOM   1907 O  OE1   . GLN A 1 248 ? 68.015 -20.118 14.233  1.00 33.48 ? 245 GLN A OE1   1 
ATOM   1908 N  NE2   . GLN A 1 248 ? 69.677 -20.111 12.701  1.00 20.23 ? 245 GLN A NE2   1 
ATOM   1909 N  N     . LEU A 1 249 ? 63.874 -18.117 10.414  1.00 9.31  ? 246 LEU A N     1 
ATOM   1910 C  CA    . LEU A 1 249 ? 62.953 -16.974 10.373  1.00 8.46  ? 246 LEU A CA    1 
ATOM   1911 C  C     . LEU A 1 249 ? 61.511 -17.422 10.597  1.00 8.95  ? 246 LEU A C     1 
ATOM   1912 O  O     . LEU A 1 249 ? 60.760 -16.820 11.373  1.00 9.01  ? 246 LEU A O     1 
ATOM   1913 C  CB    . LEU A 1 249 ? 63.072 -16.257 9.028   1.00 7.72  ? 246 LEU A CB    1 
ATOM   1914 C  CG    . LEU A 1 249 ? 62.109 -15.091 8.810   1.00 11.06 ? 246 LEU A CG    1 
ATOM   1915 C  CD1   . LEU A 1 249 ? 62.358 -14.043 9.878   1.00 13.64 ? 246 LEU A CD1   1 
ATOM   1916 C  CD2   . LEU A 1 249 ? 62.266 -14.506 7.408   1.00 11.23 ? 246 LEU A CD2   1 
ATOM   1917 N  N     . PHE A 1 250 ? 61.123 -18.495 9.919   1.00 8.88  ? 247 PHE A N     1 
ATOM   1918 C  CA    . PHE A 1 250 ? 59.750 -18.968 9.995   1.00 9.62  ? 247 PHE A CA    1 
ATOM   1919 C  C     . PHE A 1 250 ? 59.452 -19.742 11.278  1.00 10.58 ? 247 PHE A C     1 
ATOM   1920 O  O     . PHE A 1 250 ? 58.287 -19.898 11.632  1.00 8.37  ? 247 PHE A O     1 
ATOM   1921 C  CB    . PHE A 1 250 ? 59.418 -19.843 8.789   1.00 8.25  ? 247 PHE A CB    1 
ATOM   1922 C  CG    . PHE A 1 250 ? 59.035 -19.067 7.557   1.00 9.50  ? 247 PHE A CG    1 
ATOM   1923 C  CD1   . PHE A 1 250 ? 58.486 -19.722 6.462   1.00 9.08  ? 247 PHE A CD1   1 
ATOM   1924 C  CD2   . PHE A 1 250 ? 59.227 -17.692 7.487   1.00 9.64  ? 247 PHE A CD2   1 
ATOM   1925 C  CE1   . PHE A 1 250 ? 58.132 -19.022 5.323   1.00 10.72 ? 247 PHE A CE1   1 
ATOM   1926 C  CE2   . PHE A 1 250 ? 58.886 -16.984 6.345   1.00 10.05 ? 247 PHE A CE2   1 
ATOM   1927 C  CZ    . PHE A 1 250 ? 58.337 -17.652 5.261   1.00 10.11 ? 247 PHE A CZ    1 
ATOM   1928 N  N     . SER A 1 251 ? 60.487 -20.212 11.977  1.00 7.47  ? 248 SER A N     1 
ATOM   1929 C  CA    . SER A 1 251 ? 60.264 -21.097 13.122  1.00 9.83  ? 248 SER A CA    1 
ATOM   1930 C  C     . SER A 1 251 ? 59.507 -20.380 14.241  1.00 10.78 ? 248 SER A C     1 
ATOM   1931 O  O     . SER A 1 251 ? 58.811 -21.017 15.035  1.00 8.66  ? 248 SER A O     1 
ATOM   1932 C  CB    . SER A 1 251 ? 61.581 -21.701 13.648  1.00 10.06 ? 248 SER A CB    1 
ATOM   1933 O  OG    . SER A 1 251 ? 62.371 -20.729 14.324  1.00 6.42  ? 248 SER A OG    1 
ATOM   1934 N  N     . GLN A 1 252 ? 59.628 -19.057 14.298  1.00 7.47  ? 249 GLN A N     1 
ATOM   1935 C  CA    . GLN A 1 252 ? 58.875 -18.292 15.292  1.00 10.98 ? 249 GLN A CA    1 
ATOM   1936 C  C     . GLN A 1 252 ? 58.010 -17.186 14.684  1.00 13.54 ? 249 GLN A C     1 
ATOM   1937 O  O     . GLN A 1 252 ? 57.674 -16.217 15.364  1.00 13.19 ? 249 GLN A O     1 
ATOM   1938 C  CB    . GLN A 1 252 ? 59.823 -17.647 16.299  1.00 13.98 ? 249 GLN A CB    1 
ATOM   1939 C  CG    . GLN A 1 252 ? 60.691 -18.613 17.065  1.00 15.44 ? 249 GLN A CG    1 
ATOM   1940 C  CD    . GLN A 1 252 ? 61.513 -17.874 18.092  1.00 22.68 ? 249 GLN A CD    1 
ATOM   1941 O  OE1   . GLN A 1 252 ? 61.054 -17.625 19.209  1.00 21.13 ? 249 GLN A OE1   1 
ATOM   1942 N  NE2   . GLN A 1 252 ? 62.714 -17.471 17.704  1.00 21.46 ? 249 GLN A NE2   1 
ATOM   1943 N  N     . MET A 1 253 ? 57.649 -17.328 13.415  1.00 10.95 ? 250 MET A N     1 
ATOM   1944 C  CA    . MET A 1 253 ? 56.955 -16.262 12.699  1.00 12.68 ? 250 MET A CA    1 
ATOM   1945 C  C     . MET A 1 253 ? 55.464 -16.564 12.740  1.00 9.00  ? 250 MET A C     1 
ATOM   1946 O  O     . MET A 1 253 ? 55.020 -17.553 12.169  1.00 9.09  ? 250 MET A O     1 
ATOM   1947 C  CB    . MET A 1 253 ? 57.470 -16.181 11.251  1.00 9.52  ? 250 MET A CB    1 
ATOM   1948 C  CG    . MET A 1 253 ? 56.800 -15.119 10.340  1.00 13.82 ? 250 MET A CG    1 
ATOM   1949 S  SD    . MET A 1 253 ? 57.121 -13.408 10.838  1.00 18.73 ? 250 MET A SD    1 
ATOM   1950 C  CE    . MET A 1 253 ? 58.917 -13.303 10.773  1.00 14.69 ? 250 MET A CE    1 
ATOM   1951 N  N     . PRO A 1 254 ? 54.681 -15.711 13.428  1.00 11.01 ? 251 PRO A N     1 
ATOM   1952 C  CA    . PRO A 1 254 ? 53.230 -15.934 13.465  1.00 11.66 ? 251 PRO A CA    1 
ATOM   1953 C  C     . PRO A 1 254 ? 52.679 -16.000 12.051  1.00 10.16 ? 251 PRO A C     1 
ATOM   1954 O  O     . PRO A 1 254 ? 53.049 -15.211 11.200  1.00 8.47  ? 251 PRO A O     1 
ATOM   1955 C  CB    . PRO A 1 254 ? 52.697 -14.698 14.207  1.00 10.41 ? 251 PRO A CB    1 
ATOM   1956 C  CG    . PRO A 1 254 ? 53.867 -14.241 15.045  1.00 14.31 ? 251 PRO A CG    1 
ATOM   1957 C  CD    . PRO A 1 254 ? 55.066 -14.478 14.136  1.00 12.87 ? 251 PRO A CD    1 
ATOM   1958 N  N     . ILE A 1 255 ? 51.812 -16.967 11.810  1.00 9.14  ? 252 ILE A N     1 
ATOM   1959 C  CA    . ILE A 1 255 ? 51.197 -17.134 10.503  1.00 9.89  ? 252 ILE A CA    1 
ATOM   1960 C  C     . ILE A 1 255 ? 50.619 -15.826 9.934   1.00 11.39 ? 252 ILE A C     1 
ATOM   1961 O  O     . ILE A 1 255 ? 50.776 -15.548 8.745   1.00 9.00  ? 252 ILE A O     1 
ATOM   1962 C  CB    . ILE A 1 255 ? 50.154 -18.261 10.570  1.00 11.41 ? 252 ILE A CB    1 
ATOM   1963 C  CG1   . ILE A 1 255 ? 50.890 -19.607 10.595  1.00 12.87 ? 252 ILE A CG1   1 
ATOM   1964 C  CG2   . ILE A 1 255 ? 49.198 -18.212 9.405   1.00 11.22 ? 252 ILE A CG2   1 
ATOM   1965 C  CD1   . ILE A 1 255 ? 50.073 -20.731 11.119  1.00 14.19 ? 252 ILE A CD1   1 
ATOM   1966 N  N     . ARG A 1 256 ? 50.000 -15.013 10.791  1.00 11.32 ? 253 ARG A N     1 
ATOM   1967 C  CA    . ARG A 1 256 ? 49.328 -13.791 10.341  1.00 12.40 ? 253 ARG A CA    1 
ATOM   1968 C  C     . ARG A 1 256 ? 50.259 -12.745 9.730   1.00 13.18 ? 253 ARG A C     1 
ATOM   1969 O  O     . ARG A 1 256 ? 49.794 -11.808 9.077   1.00 12.51 ? 253 ARG A O     1 
ATOM   1970 C  CB    . ARG A 1 256 ? 48.523 -13.155 11.477  1.00 11.04 ? 253 ARG A CB    1 
ATOM   1971 C  CG    . ARG A 1 256 ? 49.392 -12.599 12.591  1.00 11.38 ? 253 ARG A CG    1 
ATOM   1972 C  CD    . ARG A 1 256 ? 48.584 -11.868 13.674  1.00 15.86 ? 253 ARG A CD    1 
ATOM   1973 N  NE    . ARG A 1 256 ? 49.461 -11.435 14.771  1.00 18.35 ? 253 ARG A NE    1 
ATOM   1974 C  CZ    . ARG A 1 256 ? 49.870 -12.231 15.756  1.00 24.74 ? 253 ARG A CZ    1 
ATOM   1975 N  NH1   . ARG A 1 256 ? 49.474 -13.499 15.795  1.00 18.98 ? 253 ARG A NH1   1 
ATOM   1976 N  NH2   . ARG A 1 256 ? 50.673 -11.764 16.706  1.00 22.87 ? 253 ARG A NH2   1 
ATOM   1977 N  N     . LYS A 1 257 ? 51.567 -12.892 9.939   1.00 12.19 ? 254 LYS A N     1 
ATOM   1978 C  CA    . LYS A 1 257 ? 52.518 -11.904 9.443   1.00 11.52 ? 254 LYS A CA    1 
ATOM   1979 C  C     . LYS A 1 257 ? 52.769 -12.012 7.940   1.00 16.20 ? 254 LYS A C     1 
ATOM   1980 O  O     . LYS A 1 257 ? 53.282 -11.077 7.321   1.00 12.00 ? 254 LYS A O     1 
ATOM   1981 C  CB    . LYS A 1 257 ? 53.846 -12.001 10.197  1.00 11.87 ? 254 LYS A CB    1 
ATOM   1982 C  CG    . LYS A 1 257 ? 53.717 -11.823 11.704  1.00 18.23 ? 254 LYS A CG    1 
ATOM   1983 C  CD    . LYS A 1 257 ? 53.129 -10.478 12.073  1.00 20.89 ? 254 LYS A CD    1 
ATOM   1984 C  CE    . LYS A 1 257 ? 53.175 -10.265 13.594  1.00 29.08 ? 254 LYS A CE    1 
ATOM   1985 N  NZ    . LYS A 1 257 ? 52.658 -8.926  13.999  1.00 30.76 ? 254 LYS A NZ    1 
ATOM   1986 N  N     . ILE A 1 258 ? 52.414 -13.158 7.361   1.00 9.37  ? 255 ILE A N     1 
ATOM   1987 C  CA    . ILE A 1 258 ? 52.673 -13.406 5.946   1.00 9.13  ? 255 ILE A CA    1 
ATOM   1988 C  C     . ILE A 1 258 ? 51.518 -12.868 5.115   1.00 13.79 ? 255 ILE A C     1 
ATOM   1989 O  O     . ILE A 1 258 ? 50.350 -13.052 5.453   1.00 11.94 ? 255 ILE A O     1 
ATOM   1990 C  CB    . ILE A 1 258 ? 52.864 -14.912 5.670   1.00 14.04 ? 255 ILE A CB    1 
ATOM   1991 C  CG1   . ILE A 1 258 ? 54.250 -15.371 6.136   1.00 19.77 ? 255 ILE A CG1   1 
ATOM   1992 C  CG2   . ILE A 1 258 ? 52.716 -15.211 4.184   1.00 10.68 ? 255 ILE A CG2   1 
ATOM   1993 C  CD1   . ILE A 1 258 ? 54.522 -15.151 7.595   1.00 19.42 ? 255 ILE A CD1   1 
ATOM   1994 N  N     . ARG A 1 259 ? 51.847 -12.189 4.029   1.00 12.12 ? 256 ARG A N     1 
ATOM   1995 C  CA    . ARG A 1 259 ? 50.832 -11.521 3.231   1.00 12.44 ? 256 ARG A CA    1 
ATOM   1996 C  C     . ARG A 1 259 ? 49.798 -12.506 2.682   1.00 13.13 ? 256 ARG A C     1 
ATOM   1997 O  O     . ARG A 1 259 ? 50.158 -13.509 2.064   1.00 13.37 ? 256 ARG A O     1 
ATOM   1998 C  CB    . ARG A 1 259 ? 51.496 -10.744 2.095   1.00 14.12 ? 256 ARG A CB    1 
ATOM   1999 C  CG    . ARG A 1 259 ? 50.552 -9.807  1.375   1.00 20.52 ? 256 ARG A CG    1 
ATOM   2000 C  CD    . ARG A 1 259 ? 50.288 -10.286 -0.029  1.00 33.10 ? 256 ARG A CD    1 
ATOM   2001 N  NE    . ARG A 1 259 ? 51.347 -9.891  -0.950  1.00 35.22 ? 256 ARG A NE    1 
ATOM   2002 C  CZ    . ARG A 1 259 ? 51.466 -10.359 -2.189  1.00 37.20 ? 256 ARG A CZ    1 
ATOM   2003 N  NH1   . ARG A 1 259 ? 50.591 -11.246 -2.651  1.00 42.32 ? 256 ARG A NH1   1 
ATOM   2004 N  NH2   . ARG A 1 259 ? 52.457 -9.943  -2.969  1.00 26.75 ? 256 ARG A NH2   1 
ATOM   2005 N  N     . SER A 1 260 ? 48.524 -12.197 2.934   1.00 14.92 ? 257 SER A N     1 
ATOM   2006 C  CA    . SER A 1 260 ? 47.352 -12.990 2.530   1.00 14.70 ? 257 SER A CA    1 
ATOM   2007 C  C     . SER A 1 260 ? 46.842 -13.884 3.666   1.00 16.37 ? 257 SER A C     1 
ATOM   2008 O  O     . SER A 1 260 ? 45.737 -14.431 3.596   1.00 11.68 ? 257 SER A O     1 
ATOM   2009 C  CB    . SER A 1 260 ? 47.589 -13.805 1.251   1.00 14.06 ? 257 SER A CB    1 
ATOM   2010 O  OG    . SER A 1 260 ? 48.141 -15.086 1.539   1.00 14.66 ? 257 SER A OG    1 
ATOM   2011 N  N     . LEU A 1 261 ? 47.648 -14.020 4.714   1.00 11.97 ? 258 LEU A N     1 
ATOM   2012 C  CA    . LEU A 1 261 ? 47.261 -14.828 5.862   1.00 8.89  ? 258 LEU A CA    1 
ATOM   2013 C  C     . LEU A 1 261 ? 46.865 -13.969 7.065   1.00 12.48 ? 258 LEU A C     1 
ATOM   2014 O  O     . LEU A 1 261 ? 46.686 -14.483 8.170   1.00 14.21 ? 258 LEU A O     1 
ATOM   2015 C  CB    . LEU A 1 261 ? 48.393 -15.796 6.233   1.00 10.87 ? 258 LEU A CB    1 
ATOM   2016 C  CG    . LEU A 1 261 ? 48.789 -16.779 5.115   1.00 12.09 ? 258 LEU A CG    1 
ATOM   2017 C  CD1   . LEU A 1 261 ? 49.915 -17.716 5.544   1.00 10.31 ? 258 LEU A CD1   1 
ATOM   2018 C  CD2   . LEU A 1 261 ? 47.596 -17.591 4.607   1.00 13.78 ? 258 LEU A CD2   1 
ATOM   2019 N  N     . GLY A 1 262 ? 46.726 -12.658 6.852   1.00 12.39 ? 259 GLY A N     1 
ATOM   2020 C  CA    . GLY A 1 262 ? 46.383 -11.749 7.936   1.00 13.44 ? 259 GLY A CA    1 
ATOM   2021 C  C     . GLY A 1 262 ? 44.923 -11.772 8.374   1.00 15.37 ? 259 GLY A C     1 
ATOM   2022 O  O     . GLY A 1 262 ? 44.547 -11.111 9.343   1.00 17.35 ? 259 GLY A O     1 
ATOM   2023 N  N     . GLY A 1 263 ? 44.097 -12.532 7.663   1.00 12.55 ? 260 GLY A N     1 
ATOM   2024 C  CA    . GLY A 1 263 ? 42.659 -12.512 7.876   1.00 12.60 ? 260 GLY A CA    1 
ATOM   2025 C  C     . GLY A 1 263 ? 42.062 -13.872 8.213   1.00 17.46 ? 260 GLY A C     1 
ATOM   2026 O  O     . GLY A 1 263 ? 42.647 -14.650 8.972   1.00 16.10 ? 260 GLY A O     1 
ATOM   2027 N  N     . LYS A 1 264 ? 40.892 -14.163 7.649   1.00 12.98 ? 261 LYS A N     1 
ATOM   2028 C  CA    . LYS A 1 264 ? 40.154 -15.386 7.990   1.00 17.33 ? 261 LYS A CA    1 
ATOM   2029 C  C     . LYS A 1 264 ? 40.872 -16.708 7.633   1.00 14.82 ? 261 LYS A C     1 
ATOM   2030 O  O     . LYS A 1 264 ? 40.820 -17.673 8.403   1.00 15.37 ? 261 LYS A O     1 
ATOM   2031 C  CB    . LYS A 1 264 ? 38.741 -15.351 7.384   1.00 18.13 ? 261 LYS A CB    1 
ATOM   2032 C  CG    . LYS A 1 264 ? 37.823 -14.302 8.028   1.00 19.10 ? 261 LYS A CG    1 
ATOM   2033 C  CD    . LYS A 1 264 ? 36.465 -14.233 7.322   1.00 27.00 ? 261 LYS A CD    1 
ATOM   2034 C  CE    . LYS A 1 264 ? 35.559 -13.170 7.945   1.00 37.89 ? 261 LYS A CE    1 
ATOM   2035 N  NZ    . LYS A 1 264 ? 34.243 -13.070 7.243   1.00 39.87 ? 261 LYS A NZ    1 
ATOM   2036 N  N     . LEU A 1 265 ? 41.523 -16.760 6.474   1.00 12.93 ? 262 LEU A N     1 
ATOM   2037 C  CA    . LEU A 1 265 ? 42.268 -17.955 6.086   1.00 14.10 ? 262 LEU A CA    1 
ATOM   2038 C  C     . LEU A 1 265 ? 43.377 -18.245 7.095   1.00 14.90 ? 262 LEU A C     1 
ATOM   2039 O  O     . LEU A 1 265 ? 43.514 -19.373 7.557   1.00 14.58 ? 262 LEU A O     1 
ATOM   2040 C  CB    . LEU A 1 265 ? 42.895 -17.800 4.703   1.00 12.27 ? 262 LEU A CB    1 
ATOM   2041 C  CG    . LEU A 1 265 ? 43.751 -18.974 4.203   1.00 13.06 ? 262 LEU A CG    1 
ATOM   2042 C  CD1   . LEU A 1 265 ? 42.877 -20.215 4.074   1.00 16.93 ? 262 LEU A CD1   1 
ATOM   2043 C  CD2   . LEU A 1 265 ? 44.393 -18.639 2.867   1.00 14.61 ? 262 LEU A CD2   1 
ATOM   2044 N  N     . GLY A 1 266 ? 44.180 -17.231 7.418   1.00 12.08 ? 263 GLY A N     1 
ATOM   2045 C  CA    . GLY A 1 266 ? 45.246 -17.400 8.391   1.00 12.52 ? 263 GLY A CA    1 
ATOM   2046 C  C     . GLY A 1 266 ? 44.690 -17.890 9.710   1.00 14.17 ? 263 GLY A C     1 
ATOM   2047 O  O     . GLY A 1 266 ? 45.252 -18.787 10.349  1.00 11.40 ? 263 GLY A O     1 
ATOM   2048 N  N     . ALA A 1 267 ? 43.556 -17.318 10.112  1.00 12.26 ? 264 ALA A N     1 
ATOM   2049 C  CA    . ALA A 1 267 ? 42.902 -17.735 11.342  1.00 14.11 ? 264 ALA A CA    1 
ATOM   2050 C  C     . ALA A 1 267 ? 42.488 -19.200 11.242  1.00 12.01 ? 264 ALA A C     1 
ATOM   2051 O  O     . ALA A 1 267 ? 42.602 -19.946 12.205  1.00 15.42 ? 264 ALA A O     1 
ATOM   2052 C  CB    . ALA A 1 267 ? 41.679 -16.863 11.625  1.00 14.36 ? 264 ALA A CB    1 
ATOM   2053 N  N     . SER A 1 268 ? 42.007 -19.606 10.068  1.00 14.01 ? 265 SER A N     1 
ATOM   2054 C  CA    . SER A 1 268 ? 41.560 -20.980 9.859   1.00 13.56 ? 265 SER A CA    1 
ATOM   2055 C  C     . SER A 1 268 ? 42.739 -21.949 9.887   1.00 13.24 ? 265 SER A C     1 
ATOM   2056 O  O     . SER A 1 268 ? 42.633 -23.058 10.416  1.00 10.45 ? 265 SER A O     1 
ATOM   2057 C  CB    . SER A 1 268 ? 40.784 -21.115 8.546   1.00 12.69 ? 265 SER A CB    1 
ATOM   2058 O  OG    A SER A 1 268 ? 39.821 -20.089 8.409   0.23 15.01 ? 265 SER A OG    1 
ATOM   2059 O  OG    B SER A 1 268 ? 41.653 -21.330 7.458   0.48 12.74 ? 265 SER A OG    1 
ATOM   2060 O  OG    C SER A 1 268 ? 40.350 -22.448 8.360   0.30 13.62 ? 265 SER A OG    1 
ATOM   2061 N  N     . VAL A 1 269 ? 43.863 -21.525 9.322   1.00 11.56 ? 266 VAL A N     1 
ATOM   2062 C  CA    . VAL A 1 269 ? 45.078 -22.340 9.348   1.00 10.61 ? 266 VAL A CA    1 
ATOM   2063 C  C     . VAL A 1 269 ? 45.486 -22.644 10.799  1.00 13.85 ? 266 VAL A C     1 
ATOM   2064 O  O     . VAL A 1 269 ? 45.782 -23.789 11.164  1.00 12.13 ? 266 VAL A O     1 
ATOM   2065 C  CB    . VAL A 1 269 ? 46.232 -21.649 8.575   1.00 11.91 ? 266 VAL A CB    1 
ATOM   2066 C  CG1   . VAL A 1 269 ? 47.548 -22.377 8.799   1.00 13.04 ? 266 VAL A CG1   1 
ATOM   2067 C  CG2   . VAL A 1 269 ? 45.895 -21.591 7.074   1.00 10.43 ? 266 VAL A CG2   1 
ATOM   2068 N  N     . ILE A 1 270 ? 45.467 -21.616 11.634  1.00 10.94 ? 267 ILE A N     1 
ATOM   2069 C  CA    . ILE A 1 270 ? 45.837 -21.758 13.035  1.00 11.35 ? 267 ILE A CA    1 
ATOM   2070 C  C     . ILE A 1 270 ? 44.866 -22.681 13.743  1.00 13.91 ? 267 ILE A C     1 
ATOM   2071 O  O     . ILE A 1 270 ? 45.275 -23.596 14.477  1.00 16.90 ? 267 ILE A O     1 
ATOM   2072 C  CB    . ILE A 1 270 ? 45.842 -20.378 13.718  1.00 12.65 ? 267 ILE A CB    1 
ATOM   2073 C  CG1   . ILE A 1 270 ? 47.009 -19.546 13.174  1.00 14.05 ? 267 ILE A CG1   1 
ATOM   2074 C  CG2   . ILE A 1 270 ? 45.912 -20.519 15.226  1.00 18.00 ? 267 ILE A CG2   1 
ATOM   2075 C  CD1   . ILE A 1 270 ? 46.940 -18.088 13.522  1.00 18.26 ? 267 ILE A CD1   1 
ATOM   2076 N  N     . GLU A 1 271 ? 43.576 -22.453 13.511  1.00 11.84 ? 268 GLU A N     1 
ATOM   2077 C  CA    . GLU A 1 271 ? 42.529 -23.184 14.211  1.00 14.21 ? 268 GLU A CA    1 
ATOM   2078 C  C     . GLU A 1 271 ? 42.478 -24.638 13.795  1.00 16.27 ? 268 GLU A C     1 
ATOM   2079 O  O     . GLU A 1 271 ? 42.519 -25.535 14.637  1.00 16.08 ? 268 GLU A O     1 
ATOM   2080 C  CB    . GLU A 1 271 ? 41.160 -22.534 13.983  1.00 21.60 ? 268 GLU A CB    1 
ATOM   2081 C  CG    . GLU A 1 271 ? 40.003 -23.345 14.557  1.00 29.62 ? 268 GLU A CG    1 
ATOM   2082 C  CD    . GLU A 1 271 ? 38.738 -22.524 14.716  1.00 44.50 ? 268 GLU A CD    1 
ATOM   2083 O  OE1   . GLU A 1 271 ? 38.461 -21.677 13.840  1.00 52.16 ? 268 GLU A OE1   1 
ATOM   2084 O  OE2   . GLU A 1 271 ? 38.023 -22.722 15.723  1.00 49.28 ? 268 GLU A OE2   1 
ATOM   2085 N  N     . ILE A 1 272 ? 42.390 -24.874 12.491  1.00 13.31 ? 269 ILE A N     1 
ATOM   2086 C  CA    . ILE A 1 272 ? 42.236 -26.230 11.993  1.00 12.55 ? 269 ILE A CA    1 
ATOM   2087 C  C     . ILE A 1 272 ? 43.472 -27.084 12.261  1.00 14.18 ? 269 ILE A C     1 
ATOM   2088 O  O     . ILE A 1 272 ? 43.357 -28.252 12.625  1.00 15.21 ? 269 ILE A O     1 
ATOM   2089 C  CB    . ILE A 1 272 ? 41.897 -26.245 10.483  1.00 14.20 ? 269 ILE A CB    1 
ATOM   2090 C  CG1   . ILE A 1 272 ? 40.490 -25.686 10.242  1.00 19.64 ? 269 ILE A CG1   1 
ATOM   2091 C  CG2   . ILE A 1 272 ? 42.019 -27.658 9.921   1.00 19.96 ? 269 ILE A CG2   1 
ATOM   2092 C  CD1   . ILE A 1 272 ? 40.082 -25.662 8.780   1.00 22.48 ? 269 ILE A CD1   1 
ATOM   2093 N  N     . LEU A 1 273 ? 44.663 -26.514 12.089  1.00 12.92 ? 270 LEU A N     1 
ATOM   2094 C  CA    . LEU A 1 273 ? 45.871 -27.325 12.194  1.00 12.13 ? 270 LEU A CA    1 
ATOM   2095 C  C     . LEU A 1 273 ? 46.463 -27.319 13.603  1.00 11.77 ? 270 LEU A C     1 
ATOM   2096 O  O     . LEU A 1 273 ? 47.340 -28.119 13.913  1.00 14.53 ? 270 LEU A O     1 
ATOM   2097 C  CB    . LEU A 1 273 ? 46.913 -26.882 11.171  1.00 12.71 ? 270 LEU A CB    1 
ATOM   2098 C  CG    . LEU A 1 273 ? 46.496 -27.055 9.708   1.00 15.10 ? 270 LEU A CG    1 
ATOM   2099 C  CD1   . LEU A 1 273 ? 47.600 -26.572 8.780   1.00 12.56 ? 270 LEU A CD1   1 
ATOM   2100 C  CD2   . LEU A 1 273 ? 46.149 -28.504 9.414   1.00 18.05 ? 270 LEU A CD2   1 
ATOM   2101 N  N     . GLY A 1 274 ? 45.981 -26.412 14.450  1.00 12.19 ? 271 GLY A N     1 
ATOM   2102 C  CA    . GLY A 1 274 ? 46.482 -26.294 15.809  1.00 13.69 ? 271 GLY A CA    1 
ATOM   2103 C  C     . GLY A 1 274 ? 47.928 -25.836 15.878  1.00 18.77 ? 271 GLY A C     1 
ATOM   2104 O  O     . GLY A 1 274 ? 48.689 -26.303 16.730  1.00 18.95 ? 271 GLY A O     1 
ATOM   2105 N  N     . ILE A 1 275 ? 48.311 -24.919 14.993  1.00 12.10 ? 272 ILE A N     1 
ATOM   2106 C  CA    . ILE A 1 275 ? 49.687 -24.413 14.967  1.00 10.73 ? 272 ILE A CA    1 
ATOM   2107 C  C     . ILE A 1 275 ? 49.716 -22.892 15.121  1.00 14.34 ? 272 ILE A C     1 
ATOM   2108 O  O     . ILE A 1 275 ? 48.683 -22.246 15.010  1.00 14.87 ? 272 ILE A O     1 
ATOM   2109 C  CB    . ILE A 1 275 ? 50.402 -24.786 13.658  1.00 13.01 ? 272 ILE A CB    1 
ATOM   2110 C  CG1   . ILE A 1 275 ? 49.668 -24.178 12.456  1.00 12.20 ? 272 ILE A CG1   1 
ATOM   2111 C  CG2   . ILE A 1 275 ? 50.496 -26.294 13.518  1.00 13.13 ? 272 ILE A CG2   1 
ATOM   2112 C  CD1   . ILE A 1 275 ? 50.377 -24.435 11.130  1.00 14.15 ? 272 ILE A CD1   1 
ATOM   2113 N  N     . GLU A 1 276 ? 50.904 -22.333 15.357  1.00 9.53  ? 273 GLU A N     1 
ATOM   2114 C  CA    . GLU A 1 276 ? 51.066 -20.889 15.537  1.00 12.58 ? 273 GLU A CA    1 
ATOM   2115 C  C     . GLU A 1 276 ? 52.017 -20.245 14.528  1.00 14.18 ? 273 GLU A C     1 
ATOM   2116 O  O     . GLU A 1 276 ? 51.848 -19.080 14.175  1.00 10.58 ? 273 GLU A O     1 
ATOM   2117 C  CB    . GLU A 1 276 ? 51.598 -20.572 16.944  1.00 14.84 ? 273 GLU A CB    1 
ATOM   2118 C  CG    . GLU A 1 276 ? 50.775 -21.150 18.090  1.00 25.85 ? 273 GLU A CG    1 
ATOM   2119 C  CD    . GLU A 1 276 ? 51.363 -20.829 19.461  1.00 34.70 ? 273 GLU A CD    1 
ATOM   2120 O  OE1   . GLU A 1 276 ? 51.142 -21.623 20.403  1.00 45.84 ? 273 GLU A OE1   1 
ATOM   2121 O  OE2   . GLU A 1 276 ? 52.033 -19.782 19.601  1.00 34.21 ? 273 GLU A OE2   1 
ATOM   2122 N  N     . TYR A 1 277 ? 53.038 -20.983 14.100  1.00 10.61 ? 274 TYR A N     1 
ATOM   2123 C  CA    . TYR A 1 277 ? 54.121 -20.383 13.324  1.00 10.05 ? 274 TYR A CA    1 
ATOM   2124 C  C     . TYR A 1 277 ? 54.188 -20.954 11.919  1.00 7.08  ? 274 TYR A C     1 
ATOM   2125 O  O     . TYR A 1 277 ? 53.816 -22.112 11.682  1.00 8.57  ? 274 TYR A O     1 
ATOM   2126 C  CB    . TYR A 1 277 ? 55.472 -20.587 14.024  1.00 12.17 ? 274 TYR A CB    1 
ATOM   2127 C  CG    . TYR A 1 277 ? 55.474 -20.087 15.455  1.00 10.69 ? 274 TYR A CG    1 
ATOM   2128 C  CD1   . TYR A 1 277 ? 55.710 -20.947 16.520  1.00 14.40 ? 274 TYR A CD1   1 
ATOM   2129 C  CD2   . TYR A 1 277 ? 55.208 -18.757 15.735  1.00 12.62 ? 274 TYR A CD2   1 
ATOM   2130 C  CE1   . TYR A 1 277 ? 55.692 -20.483 17.842  1.00 14.98 ? 274 TYR A CE1   1 
ATOM   2131 C  CE2   . TYR A 1 277 ? 55.180 -18.288 17.034  1.00 13.77 ? 274 TYR A CE2   1 
ATOM   2132 C  CZ    . TYR A 1 277 ? 55.420 -19.153 18.087  1.00 20.67 ? 274 TYR A CZ    1 
ATOM   2133 O  OH    . TYR A 1 277 ? 55.393 -18.674 19.386  1.00 18.99 ? 274 TYR A OH    1 
ATOM   2134 N  N     . MET A 1 278 ? 54.689 -20.138 11.001  1.00 8.43  ? 275 MET A N     1 
ATOM   2135 C  CA    . MET A 1 278 ? 54.775 -20.520 9.603   1.00 10.85 ? 275 MET A CA    1 
ATOM   2136 C  C     . MET A 1 278 ? 55.555 -21.828 9.399   1.00 8.50  ? 275 MET A C     1 
ATOM   2137 O  O     . MET A 1 278 ? 55.174 -22.664 8.581   1.00 7.62  ? 275 MET A O     1 
ATOM   2138 C  CB    . MET A 1 278 ? 55.395 -19.383 8.789   1.00 11.45 ? 275 MET A CB    1 
ATOM   2139 C  CG    . MET A 1 278 ? 55.066 -19.435 7.322   1.00 18.12 ? 275 MET A CG    1 
ATOM   2140 S  SD    . MET A 1 278 ? 53.331 -19.053 7.009   1.00 17.66 ? 275 MET A SD    1 
ATOM   2141 C  CE    . MET A 1 278 ? 53.274 -19.481 5.276   1.00 22.47 ? 275 MET A CE    1 
ATOM   2142 N  N     . GLY A 1 279 ? 56.637 -22.005 10.145  1.00 8.07  ? 276 GLY A N     1 
ATOM   2143 C  CA    . GLY A 1 279 ? 57.475 -23.175 9.947   1.00 9.67  ? 276 GLY A CA    1 
ATOM   2144 C  C     . GLY A 1 279 ? 56.769 -24.482 10.284  1.00 12.81 ? 276 GLY A C     1 
ATOM   2145 O  O     . GLY A 1 279 ? 57.110 -25.556 9.756   1.00 11.03 ? 276 GLY A O     1 
ATOM   2146 N  N     . GLU A 1 280 ? 55.775 -24.406 11.168  1.00 6.74  ? 277 GLU A N     1 
ATOM   2147 C  CA    . GLU A 1 280 ? 55.053 -25.605 11.580  1.00 7.69  ? 277 GLU A CA    1 
ATOM   2148 C  C     . GLU A 1 280 ? 54.260 -26.186 10.408  1.00 9.65  ? 277 GLU A C     1 
ATOM   2149 O  O     . GLU A 1 280 ? 53.836 -27.340 10.442  1.00 9.79  ? 277 GLU A O     1 
ATOM   2150 C  CB    . GLU A 1 280 ? 54.105 -25.303 12.750  1.00 7.73  ? 277 GLU A CB    1 
ATOM   2151 C  CG    . GLU A 1 280 ? 54.796 -24.915 14.055  1.00 10.62 ? 277 GLU A CG    1 
ATOM   2152 C  CD    . GLU A 1 280 ? 53.788 -24.676 15.172  1.00 14.25 ? 277 GLU A CD    1 
ATOM   2153 O  OE1   . GLU A 1 280 ? 53.408 -23.511 15.405  1.00 12.17 ? 277 GLU A OE1   1 
ATOM   2154 O  OE2   . GLU A 1 280 ? 53.352 -25.658 15.795  1.00 13.59 ? 277 GLU A OE2   1 
ATOM   2155 N  N     . LEU A 1 281 ? 54.064 -25.396 9.359   1.00 7.98  ? 278 LEU A N     1 
ATOM   2156 C  CA    . LEU A 1 281 ? 53.362 -25.916 8.177   1.00 9.38  ? 278 LEU A CA    1 
ATOM   2157 C  C     . LEU A 1 281 ? 54.100 -27.031 7.428   1.00 10.13 ? 278 LEU A C     1 
ATOM   2158 O  O     . LEU A 1 281 ? 53.469 -27.818 6.715   1.00 9.50  ? 278 LEU A O     1 
ATOM   2159 C  CB    . LEU A 1 281 ? 53.037 -24.774 7.208   1.00 8.10  ? 278 LEU A CB    1 
ATOM   2160 C  CG    . LEU A 1 281 ? 51.833 -23.928 7.623   1.00 11.45 ? 278 LEU A CG    1 
ATOM   2161 C  CD1   . LEU A 1 281 ? 51.839 -22.595 6.863   1.00 16.65 ? 278 LEU A CD1   1 
ATOM   2162 C  CD2   . LEU A 1 281 ? 50.537 -24.702 7.391   1.00 10.75 ? 278 LEU A CD2   1 
ATOM   2163 N  N     . THR A 1 282 ? 55.426 -27.084 7.554   1.00 9.73  ? 279 THR A N     1 
ATOM   2164 C  CA    . THR A 1 282 ? 56.225 -28.026 6.758   1.00 14.14 ? 279 THR A CA    1 
ATOM   2165 C  C     . THR A 1 282 ? 55.873 -29.470 7.086   1.00 13.17 ? 279 THR A C     1 
ATOM   2166 O  O     . THR A 1 282 ? 56.170 -30.375 6.320   1.00 11.55 ? 279 THR A O     1 
ATOM   2167 C  CB    . THR A 1 282 ? 57.744 -27.845 6.970   1.00 12.68 ? 279 THR A CB    1 
ATOM   2168 O  OG1   . THR A 1 282 ? 58.074 -28.081 8.346   1.00 14.14 ? 279 THR A OG1   1 
ATOM   2169 C  CG2   . THR A 1 282 ? 58.187 -26.441 6.575   1.00 10.59 ? 279 THR A CG2   1 
ATOM   2170 N  N     . GLN A 1 283 ? 55.229 -29.678 8.229   1.00 10.95 ? 280 GLN A N     1 
ATOM   2171 C  CA    . GLN A 1 283 ? 54.945 -31.026 8.701   1.00 13.29 ? 280 GLN A CA    1 
ATOM   2172 C  C     . GLN A 1 283 ? 53.715 -31.659 8.056   1.00 16.12 ? 280 GLN A C     1 
ATOM   2173 O  O     . GLN A 1 283 ? 53.428 -32.825 8.283   1.00 22.93 ? 280 GLN A O     1 
ATOM   2174 C  CB    . GLN A 1 283 ? 54.824 -31.025 10.220  1.00 14.20 ? 280 GLN A CB    1 
ATOM   2175 C  CG    A GLN A 1 283 ? 53.503 -30.551 10.718  0.54 14.75 ? 280 GLN A CG    1 
ATOM   2176 C  CG    B GLN A 1 283 ? 56.151 -30.743 10.870  0.46 12.94 ? 280 GLN A CG    1 
ATOM   2177 C  CD    A GLN A 1 283 ? 53.510 -30.336 12.214  0.54 20.32 ? 280 GLN A CD    1 
ATOM   2178 C  CD    B GLN A 1 283 ? 57.230 -31.624 10.281  0.46 16.91 ? 280 GLN A CD    1 
ATOM   2179 O  OE1   A GLN A 1 283 ? 53.732 -31.269 12.990  0.54 22.55 ? 280 GLN A OE1   1 
ATOM   2180 O  OE1   B GLN A 1 283 ? 57.128 -32.850 10.328  0.46 13.96 ? 280 GLN A OE1   1 
ATOM   2181 N  NE2   A GLN A 1 283 ? 53.276 -29.098 12.628  0.54 9.03  ? 280 GLN A NE2   1 
ATOM   2182 N  NE2   B GLN A 1 283 ? 58.257 -31.009 9.696   0.46 16.46 ? 280 GLN A NE2   1 
ATOM   2183 N  N     . PHE A 1 284 ? 52.991 -30.888 7.253   1.00 10.63 ? 281 PHE A N     1 
ATOM   2184 C  CA    . PHE A 1 284 ? 51.810 -31.404 6.579   1.00 10.47 ? 281 PHE A CA    1 
ATOM   2185 C  C     . PHE A 1 284 ? 52.089 -31.696 5.103   1.00 14.00 ? 281 PHE A C     1 
ATOM   2186 O  O     . PHE A 1 284 ? 52.919 -31.035 4.490   1.00 14.16 ? 281 PHE A O     1 
ATOM   2187 C  CB    . PHE A 1 284 ? 50.667 -30.415 6.719   1.00 11.33 ? 281 PHE A CB    1 
ATOM   2188 C  CG    . PHE A 1 284 ? 50.317 -30.130 8.140   1.00 11.18 ? 281 PHE A CG    1 
ATOM   2189 C  CD1   . PHE A 1 284 ? 49.416 -30.942 8.817   1.00 15.78 ? 281 PHE A CD1   1 
ATOM   2190 C  CD2   . PHE A 1 284 ? 50.927 -29.087 8.818   1.00 10.95 ? 281 PHE A CD2   1 
ATOM   2191 C  CE1   . PHE A 1 284 ? 49.100 -30.694 10.138  1.00 20.91 ? 281 PHE A CE1   1 
ATOM   2192 C  CE2   . PHE A 1 284 ? 50.618 -28.835 10.141  1.00 13.38 ? 281 PHE A CE2   1 
ATOM   2193 C  CZ    . PHE A 1 284 ? 49.710 -29.646 10.803  1.00 13.87 ? 281 PHE A CZ    1 
ATOM   2194 N  N     . THR A 1 285 ? 51.409 -32.687 4.536   1.00 12.81 ? 282 THR A N     1 
ATOM   2195 C  CA    . THR A 1 285 ? 51.631 -32.994 3.127   1.00 16.48 ? 282 THR A CA    1 
ATOM   2196 C  C     . THR A 1 285 ? 50.883 -31.980 2.283   1.00 10.36 ? 282 THR A C     1 
ATOM   2197 O  O     . THR A 1 285 ? 49.987 -31.303 2.764   1.00 11.25 ? 282 THR A O     1 
ATOM   2198 C  CB    . THR A 1 285 ? 51.143 -34.400 2.739   1.00 14.81 ? 282 THR A CB    1 
ATOM   2199 O  OG1   . THR A 1 285 ? 49.722 -34.446 2.857   1.00 12.23 ? 282 THR A OG1   1 
ATOM   2200 C  CG2   . THR A 1 285 ? 51.759 -35.450 3.641   1.00 17.35 ? 282 THR A CG2   1 
ATOM   2201 N  N     . GLU A 1 286 ? 51.243 -31.877 1.014   1.00 13.16 ? 283 GLU A N     1 
ATOM   2202 C  CA    . GLU A 1 286 ? 50.517 -30.978 0.140   1.00 13.50 ? 283 GLU A CA    1 
ATOM   2203 C  C     . GLU A 1 286 ? 49.042 -31.372 0.073   1.00 13.27 ? 283 GLU A C     1 
ATOM   2204 O  O     . GLU A 1 286 ? 48.170 -30.508 0.146   1.00 13.01 ? 283 GLU A O     1 
ATOM   2205 C  CB    . GLU A 1 286 ? 51.161 -30.920 -1.249  1.00 13.35 ? 283 GLU A CB    1 
ATOM   2206 C  CG    . GLU A 1 286 ? 50.488 -29.922 -2.172  1.00 13.27 ? 283 GLU A CG    1 
ATOM   2207 C  CD    . GLU A 1 286 ? 51.235 -29.728 -3.487  1.00 24.12 ? 283 GLU A CD    1 
ATOM   2208 O  OE1   . GLU A 1 286 ? 52.166 -30.506 -3.767  1.00 17.87 ? 283 GLU A OE1   1 
ATOM   2209 O  OE2   . GLU A 1 286 ? 50.895 -28.784 -4.231  1.00 22.53 ? 283 GLU A OE2   1 
ATOM   2210 N  N     . SER A 1 287 ? 48.751 -32.673 -0.030  1.00 12.11 ? 284 SER A N     1 
ATOM   2211 C  CA    . SER A 1 287 ? 47.354 -33.115 -0.081  1.00 14.33 ? 284 SER A CA    1 
ATOM   2212 C  C     . SER A 1 287 ? 46.608 -32.769 1.201   1.00 13.30 ? 284 SER A C     1 
ATOM   2213 O  O     . SER A 1 287 ? 45.434 -32.409 1.153   1.00 12.91 ? 284 SER A O     1 
ATOM   2214 C  CB    . SER A 1 287 ? 47.227 -34.619 -0.384  1.00 12.83 ? 284 SER A CB    1 
ATOM   2215 O  OG    A SER A 1 287 ? 47.858 -34.951 -1.611  0.76 13.89 ? 284 SER A OG    1 
ATOM   2216 O  OG    B SER A 1 287 ? 47.988 -35.393 0.525   0.24 13.14 ? 284 SER A OG    1 
ATOM   2217 N  N     . GLN A 1 288 ? 47.285 -32.843 2.350   1.00 12.35 ? 285 GLN A N     1 
ATOM   2218 C  CA    . GLN A 1 288 ? 46.609 -32.498 3.604   1.00 11.01 ? 285 GLN A CA    1 
ATOM   2219 C  C     . GLN A 1 288 ? 46.189 -31.029 3.596   1.00 10.91 ? 285 GLN A C     1 
ATOM   2220 O  O     . GLN A 1 288 ? 45.059 -30.680 3.949   1.00 11.06 ? 285 GLN A O     1 
ATOM   2221 C  CB    . GLN A 1 288 ? 47.510 -32.747 4.808   1.00 9.66  ? 285 GLN A CB    1 
ATOM   2222 C  CG    . GLN A 1 288 ? 47.564 -34.187 5.270   1.00 16.67 ? 285 GLN A CG    1 
ATOM   2223 C  CD    . GLN A 1 288 ? 48.486 -34.352 6.463   1.00 23.33 ? 285 GLN A CD    1 
ATOM   2224 O  OE1   . GLN A 1 288 ? 49.656 -33.974 6.411   1.00 15.68 ? 285 GLN A OE1   1 
ATOM   2225 N  NE2   . GLN A 1 288 ? 47.954 -34.899 7.555   1.00 26.19 ? 285 GLN A NE2   1 
ATOM   2226 N  N     . LEU A 1 289 ? 47.105 -30.156 3.207   1.00 10.16 ? 286 LEU A N     1 
ATOM   2227 C  CA    . LEU A 1 289 ? 46.783 -28.726 3.185   1.00 11.35 ? 286 LEU A CA    1 
ATOM   2228 C  C     . LEU A 1 289 ? 45.693 -28.424 2.161   1.00 11.05 ? 286 LEU A C     1 
ATOM   2229 O  O     . LEU A 1 289 ? 44.803 -27.589 2.388   1.00 13.12 ? 286 LEU A O     1 
ATOM   2230 C  CB    . LEU A 1 289 ? 48.026 -27.896 2.879   1.00 9.44  ? 286 LEU A CB    1 
ATOM   2231 C  CG    . LEU A 1 289 ? 49.176 -27.979 3.890   1.00 12.56 ? 286 LEU A CG    1 
ATOM   2232 C  CD1   . LEU A 1 289 ? 50.395 -27.220 3.355   1.00 9.77  ? 286 LEU A CD1   1 
ATOM   2233 C  CD2   . LEU A 1 289 ? 48.718 -27.432 5.236   1.00 11.16 ? 286 LEU A CD2   1 
ATOM   2234 N  N     . GLN A 1 290 ? 45.770 -29.081 1.016   1.00 11.27 ? 287 GLN A N     1 
ATOM   2235 C  CA    . GLN A 1 290 ? 44.726 -28.907 0.010   1.00 13.41 ? 287 GLN A CA    1 
ATOM   2236 C  C     . GLN A 1 290 ? 43.349 -29.338 0.523   1.00 11.82 ? 287 GLN A C     1 
ATOM   2237 O  O     . GLN A 1 290 ? 42.338 -28.721 0.191   1.00 13.88 ? 287 GLN A O     1 
ATOM   2238 C  CB    . GLN A 1 290 ? 45.074 -29.678 -1.258  1.00 14.34 ? 287 GLN A CB    1 
ATOM   2239 C  CG    . GLN A 1 290 ? 46.284 -29.128 -2.004  1.00 15.16 ? 287 GLN A CG    1 
ATOM   2240 C  CD    . GLN A 1 290 ? 46.609 -29.955 -3.230  1.00 16.68 ? 287 GLN A CD    1 
ATOM   2241 O  OE1   . GLN A 1 290 ? 46.637 -31.188 -3.173  1.00 16.06 ? 287 GLN A OE1   1 
ATOM   2242 N  NE2   . GLN A 1 290 ? 46.866 -29.282 -4.348  1.00 18.13 ? 287 GLN A NE2   1 
ATOM   2243 N  N     . SER A 1 291 ? 43.302 -30.395 1.324   1.00 13.60 ? 288 SER A N     1 
ATOM   2244 C  CA    . SER A 1 291 ? 42.014 -30.865 1.846   1.00 15.10 ? 288 SER A CA    1 
ATOM   2245 C  C     . SER A 1 291 ? 41.343 -29.830 2.744   1.00 18.32 ? 288 SER A C     1 
ATOM   2246 O  O     . SER A 1 291 ? 40.121 -29.678 2.716   1.00 24.41 ? 288 SER A O     1 
ATOM   2247 C  CB    . SER A 1 291 ? 42.132 -32.206 2.581   1.00 11.81 ? 288 SER A CB    1 
ATOM   2248 O  OG    . SER A 1 291 ? 42.831 -32.064 3.814   1.00 23.29 ? 288 SER A OG    1 
ATOM   2249 N  N     . HIS A 1 292 ? 42.137 -29.114 3.533   1.00 15.55 ? 289 HIS A N     1 
ATOM   2250 C  CA    . HIS A 1 292 ? 41.586 -28.128 4.448   1.00 15.31 ? 289 HIS A CA    1 
ATOM   2251 C  C     . HIS A 1 292 ? 41.297 -26.782 3.783   1.00 17.38 ? 289 HIS A C     1 
ATOM   2252 O  O     . HIS A 1 292 ? 40.308 -26.133 4.103   1.00 21.67 ? 289 HIS A O     1 
ATOM   2253 C  CB    . HIS A 1 292 ? 42.548 -27.874 5.603   1.00 18.42 ? 289 HIS A CB    1 
ATOM   2254 C  CG    . HIS A 1 292 ? 42.760 -29.054 6.490   1.00 18.24 ? 289 HIS A CG    1 
ATOM   2255 N  ND1   . HIS A 1 292 ? 41.738 -29.636 7.208   1.00 23.23 ? 289 HIS A ND1   1 
ATOM   2256 C  CD2   . HIS A 1 292 ? 43.879 -29.757 6.785   1.00 18.75 ? 289 HIS A CD2   1 
ATOM   2257 C  CE1   . HIS A 1 292 ? 42.218 -30.649 7.907   1.00 17.13 ? 289 HIS A CE1   1 
ATOM   2258 N  NE2   . HIS A 1 292 ? 43.515 -30.742 7.671   1.00 26.77 ? 289 HIS A NE2   1 
ATOM   2259 N  N     . PHE A 1 293 ? 42.173 -26.347 2.881   1.00 14.87 ? 290 PHE A N     1 
ATOM   2260 C  CA    . PHE A 1 293 ? 42.155 -24.949 2.440   1.00 16.24 ? 290 PHE A CA    1 
ATOM   2261 C  C     . PHE A 1 293 ? 41.927 -24.774 0.934   1.00 17.90 ? 290 PHE A C     1 
ATOM   2262 O  O     . PHE A 1 293 ? 41.987 -23.655 0.408   1.00 17.03 ? 290 PHE A O     1 
ATOM   2263 C  CB    . PHE A 1 293 ? 43.456 -24.263 2.872   1.00 13.29 ? 290 PHE A CB    1 
ATOM   2264 C  CG    . PHE A 1 293 ? 43.829 -24.534 4.308   1.00 13.63 ? 290 PHE A CG    1 
ATOM   2265 C  CD1   . PHE A 1 293 ? 43.056 -24.032 5.343   1.00 14.66 ? 290 PHE A CD1   1 
ATOM   2266 C  CD2   . PHE A 1 293 ? 44.937 -25.300 4.618   1.00 10.30 ? 290 PHE A CD2   1 
ATOM   2267 C  CE1   . PHE A 1 293 ? 43.379 -24.285 6.662   1.00 10.77 ? 290 PHE A CE1   1 
ATOM   2268 C  CE2   . PHE A 1 293 ? 45.269 -25.564 5.943   1.00 11.00 ? 290 PHE A CE2   1 
ATOM   2269 C  CZ    . PHE A 1 293 ? 44.493 -25.058 6.961   1.00 12.87 ? 290 PHE A CZ    1 
ATOM   2270 N  N     . GLY A 1 294 ? 41.670 -25.879 0.244   1.00 15.15 ? 291 GLY A N     1 
ATOM   2271 C  CA    . GLY A 1 294 ? 41.401 -25.829 -1.182  1.00 17.14 ? 291 GLY A CA    1 
ATOM   2272 C  C     . GLY A 1 294 ? 42.657 -26.125 -1.966  1.00 17.50 ? 291 GLY A C     1 
ATOM   2273 O  O     . GLY A 1 294 ? 43.755 -25.988 -1.439  1.00 14.75 ? 291 GLY A O     1 
ATOM   2274 N  N     . GLU A 1 295 ? 42.497 -26.528 -3.225  1.00 15.05 ? 292 GLU A N     1 
ATOM   2275 C  CA    . GLU A 1 295 ? 43.619 -26.914 -4.073  1.00 15.69 ? 292 GLU A CA    1 
ATOM   2276 C  C     . GLU A 1 295 ? 44.666 -25.815 -4.191  1.00 16.59 ? 292 GLU A C     1 
ATOM   2277 O  O     . GLU A 1 295 ? 45.854 -26.064 -4.026  1.00 13.78 ? 292 GLU A O     1 
ATOM   2278 C  CB    . GLU A 1 295 ? 43.110 -27.281 -5.473  1.00 21.27 ? 292 GLU A CB    1 
ATOM   2279 C  CG    . GLU A 1 295 ? 44.132 -27.970 -6.359  1.00 23.44 ? 292 GLU A CG    1 
ATOM   2280 C  CD    . GLU A 1 295 ? 43.542 -28.433 -7.689  1.00 37.60 ? 292 GLU A CD    1 
ATOM   2281 O  OE1   . GLU A 1 295 ? 44.245 -29.146 -8.440  1.00 46.86 ? 292 GLU A OE1   1 
ATOM   2282 O  OE2   . GLU A 1 295 ? 42.374 -28.086 -7.983  1.00 31.08 ? 292 GLU A OE2   1 
ATOM   2283 N  N     . LYS A 1 296 ? 44.217 -24.598 -4.486  1.00 13.00 ? 293 LYS A N     1 
ATOM   2284 C  CA    . LYS A 1 296 ? 45.128 -23.486 -4.734  1.00 16.32 ? 293 LYS A CA    1 
ATOM   2285 C  C     . LYS A 1 296 ? 45.843 -23.036 -3.457  1.00 13.44 ? 293 LYS A C     1 
ATOM   2286 O  O     . LYS A 1 296 ? 47.073 -22.948 -3.420  1.00 14.80 ? 293 LYS A O     1 
ATOM   2287 C  CB    . LYS A 1 296 ? 44.386 -22.317 -5.399  1.00 18.75 ? 293 LYS A CB    1 
ATOM   2288 C  CG    . LYS A 1 296 ? 45.243 -21.079 -5.635  1.00 28.73 ? 293 LYS A CG    1 
ATOM   2289 C  CD    . LYS A 1 296 ? 44.552 -20.082 -6.570  1.00 32.11 ? 293 LYS A CD    1 
ATOM   2290 C  CE    . LYS A 1 296 ? 44.776 -18.633 -6.120  1.00 38.33 ? 293 LYS A CE    1 
ATOM   2291 N  NZ    . LYS A 1 296 ? 44.044 -18.307 -4.850  1.00 31.92 ? 293 LYS A NZ    1 
ATOM   2292 N  N     . ASN A 1 297 ? 45.079 -22.765 -2.404  1.00 12.72 ? 294 ASN A N     1 
ATOM   2293 C  CA    . ASN A 1 297 ? 45.685 -22.370 -1.136  1.00 13.91 ? 294 ASN A CA    1 
ATOM   2294 C  C     . ASN A 1 297 ? 46.579 -23.455 -0.554  1.00 12.11 ? 294 ASN A C     1 
ATOM   2295 O  O     . ASN A 1 297 ? 47.620 -23.155 0.026   1.00 12.37 ? 294 ASN A O     1 
ATOM   2296 C  CB    . ASN A 1 297 ? 44.621 -22.005 -0.099  1.00 18.54 ? 294 ASN A CB    1 
ATOM   2297 C  CG    . ASN A 1 297 ? 43.924 -20.706 -0.407  1.00 19.32 ? 294 ASN A CG    1 
ATOM   2298 O  OD1   . ASN A 1 297 ? 44.512 -19.792 -0.988  1.00 24.96 ? 294 ASN A OD1   1 
ATOM   2299 N  ND2   . ASN A 1 297 ? 42.664 -20.605 0.002   1.00 19.10 ? 294 ASN A ND2   1 
ATOM   2300 N  N     . GLY A 1 298 ? 46.165 -24.712 -0.687  1.00 12.97 ? 295 GLY A N     1 
ATOM   2301 C  CA    . GLY A 1 298 ? 46.946 -25.816 -0.154  1.00 12.37 ? 295 GLY A CA    1 
ATOM   2302 C  C     . GLY A 1 298 ? 48.327 -25.894 -0.792  1.00 12.99 ? 295 GLY A C     1 
ATOM   2303 O  O     . GLY A 1 298 ? 49.347 -26.048 -0.106  1.00 11.60 ? 295 GLY A O     1 
ATOM   2304 N  N     . SER A 1 299 ? 48.359 -25.802 -2.118  1.00 10.99 ? 296 SER A N     1 
ATOM   2305 C  CA    . SER A 1 299 ? 49.617 -25.802 -2.853  1.00 10.44 ? 296 SER A CA    1 
ATOM   2306 C  C     . SER A 1 299 ? 50.469 -24.588 -2.503  1.00 11.90 ? 296 SER A C     1 
ATOM   2307 O  O     . SER A 1 299 ? 51.682 -24.703 -2.356  1.00 10.32 ? 296 SER A O     1 
ATOM   2308 C  CB    . SER A 1 299 ? 49.361 -25.841 -4.362  1.00 17.33 ? 296 SER A CB    1 
ATOM   2309 O  OG    . SER A 1 299 ? 48.887 -27.114 -4.739  1.00 16.70 ? 296 SER A OG    1 
ATOM   2310 N  N     . TRP A 1 300 ? 49.828 -23.431 -2.371  1.00 13.00 ? 297 TRP A N     1 
ATOM   2311 C  CA    . TRP A 1 300 ? 50.548 -22.196 -2.083  1.00 13.70 ? 297 TRP A CA    1 
ATOM   2312 C  C     . TRP A 1 300 ? 51.193 -22.265 -0.694  1.00 9.38  ? 297 TRP A C     1 
ATOM   2313 O  O     . TRP A 1 300 ? 52.364 -21.909 -0.533  1.00 11.57 ? 297 TRP A O     1 
ATOM   2314 C  CB    . TRP A 1 300 ? 49.603 -20.999 -2.188  1.00 12.82 ? 297 TRP A CB    1 
ATOM   2315 C  CG    . TRP A 1 300 ? 50.250 -19.669 -1.965  1.00 14.62 ? 297 TRP A CG    1 
ATOM   2316 C  CD1   . TRP A 1 300 ? 50.842 -18.873 -2.906  1.00 17.98 ? 297 TRP A CD1   1 
ATOM   2317 C  CD2   . TRP A 1 300 ? 50.344 -18.957 -0.723  1.00 13.08 ? 297 TRP A CD2   1 
ATOM   2318 N  NE1   . TRP A 1 300 ? 51.303 -17.714 -2.322  1.00 15.93 ? 297 TRP A NE1   1 
ATOM   2319 C  CE2   . TRP A 1 300 ? 51.015 -17.746 -0.983  1.00 14.51 ? 297 TRP A CE2   1 
ATOM   2320 C  CE3   . TRP A 1 300 ? 49.934 -19.233 0.583   1.00 14.06 ? 297 TRP A CE3   1 
ATOM   2321 C  CZ2   . TRP A 1 300 ? 51.279 -16.809 0.014   1.00 14.74 ? 297 TRP A CZ2   1 
ATOM   2322 C  CZ3   . TRP A 1 300 ? 50.197 -18.298 1.572   1.00 17.29 ? 297 TRP A CZ3   1 
ATOM   2323 C  CH2   . TRP A 1 300 ? 50.864 -17.104 1.279   1.00 12.48 ? 297 TRP A CH2   1 
ATOM   2324 N  N     . LEU A 1 301 ? 50.432 -22.739 0.300   1.00 10.37 ? 298 LEU A N     1 
ATOM   2325 C  CA    . LEU A 1 301 ? 50.951 -22.883 1.665   1.00 10.03 ? 298 LEU A CA    1 
ATOM   2326 C  C     . LEU A 1 301 ? 52.088 -23.909 1.749   1.00 10.83 ? 298 LEU A C     1 
ATOM   2327 O  O     . LEU A 1 301 ? 53.079 -23.720 2.473   1.00 9.84  ? 298 LEU A O     1 
ATOM   2328 C  CB    . LEU A 1 301 ? 49.833 -23.284 2.637   1.00 6.65  ? 298 LEU A CB    1 
ATOM   2329 C  CG    . LEU A 1 301 ? 48.727 -22.252 2.912   1.00 11.26 ? 298 LEU A CG    1 
ATOM   2330 C  CD1   . LEU A 1 301 ? 47.506 -22.915 3.544   1.00 10.05 ? 298 LEU A CD1   1 
ATOM   2331 C  CD2   . LEU A 1 301 ? 49.265 -21.131 3.800   1.00 14.17 ? 298 LEU A CD2   1 
ATOM   2332 N  N     . TYR A 1 302 ? 51.940 -25.001 1.018   1.00 7.63  ? 299 TYR A N     1 
ATOM   2333 C  CA    . TYR A 1 302 ? 52.959 -26.039 1.021   1.00 9.82  ? 299 TYR A CA    1 
ATOM   2334 C  C     . TYR A 1 302 ? 54.312 -25.490 0.562   1.00 10.56 ? 299 TYR A C     1 
ATOM   2335 O  O     . TYR A 1 302 ? 55.342 -25.725 1.196   1.00 8.50  ? 299 TYR A O     1 
ATOM   2336 C  CB    . TYR A 1 302 ? 52.534 -27.235 0.153   1.00 12.32 ? 299 TYR A CB    1 
ATOM   2337 C  CG    . TYR A 1 302 ? 53.540 -28.369 0.185   1.00 10.43 ? 299 TYR A CG    1 
ATOM   2338 C  CD1   . TYR A 1 302 ? 53.509 -29.327 1.193   1.00 9.99  ? 299 TYR A CD1   1 
ATOM   2339 C  CD2   . TYR A 1 302 ? 54.544 -28.460 -0.778  1.00 14.13 ? 299 TYR A CD2   1 
ATOM   2340 C  CE1   . TYR A 1 302 ? 54.445 -30.370 1.237   1.00 15.74 ? 299 TYR A CE1   1 
ATOM   2341 C  CE2   . TYR A 1 302 ? 55.480 -29.486 -0.745  1.00 18.93 ? 299 TYR A CE2   1 
ATOM   2342 C  CZ    . TYR A 1 302 ? 55.425 -30.441 0.265   1.00 21.08 ? 299 TYR A CZ    1 
ATOM   2343 O  OH    . TYR A 1 302 ? 56.368 -31.455 0.297   1.00 22.30 ? 299 TYR A OH    1 
ATOM   2344 N  N     . ALA A 1 303 ? 54.303 -24.745 -0.537  1.00 8.02  ? 300 ALA A N     1 
ATOM   2345 C  CA    . ALA A 1 303 ? 55.510 -24.086 -1.031  1.00 7.87  ? 300 ALA A CA    1 
ATOM   2346 C  C     . ALA A 1 303 ? 55.934 -22.900 -0.152  1.00 7.69  ? 300 ALA A C     1 
ATOM   2347 O  O     . ALA A 1 303 ? 57.122 -22.722 0.145   1.00 9.32  ? 300 ALA A O     1 
ATOM   2348 C  CB    . ALA A 1 303 ? 55.302 -23.623 -2.498  1.00 12.31 ? 300 ALA A CB    1 
ATOM   2349 N  N     . MET A 1 304 ? 54.971 -22.099 0.290   1.00 8.07  ? 301 MET A N     1 
ATOM   2350 C  CA    . MET A 1 304 ? 55.326 -20.866 0.997   1.00 8.09  ? 301 MET A CA    1 
ATOM   2351 C  C     . MET A 1 304 ? 56.060 -21.130 2.298   1.00 8.70  ? 301 MET A C     1 
ATOM   2352 O  O     . MET A 1 304 ? 56.985 -20.388 2.649   1.00 8.00  ? 301 MET A O     1 
ATOM   2353 C  CB    . MET A 1 304 ? 54.106 -20.000 1.290   1.00 7.42  ? 301 MET A CB    1 
ATOM   2354 C  CG    . MET A 1 304 ? 54.492 -18.561 1.730   1.00 10.61 ? 301 MET A CG    1 
ATOM   2355 S  SD    . MET A 1 304 ? 55.249 -17.638 0.366   1.00 13.65 ? 301 MET A SD    1 
ATOM   2356 C  CE    . MET A 1 304 ? 56.973 -17.556 0.885   1.00 10.22 ? 301 MET A CE    1 
ATOM   2357 N  N     . CYS A 1 305 ? 55.637 -22.156 3.032   1.00 6.63  ? 302 CYS A N     1 
ATOM   2358 C  CA    . CYS A 1 305 ? 56.273 -22.438 4.320   1.00 10.38 ? 302 CYS A CA    1 
ATOM   2359 C  C     . CYS A 1 305 ? 57.714 -22.931 4.141   1.00 8.13  ? 302 CYS A C     1 
ATOM   2360 O  O     . CYS A 1 305 ? 58.476 -22.975 5.102   1.00 8.77  ? 302 CYS A O     1 
ATOM   2361 C  CB    . CYS A 1 305 ? 55.446 -23.425 5.159   1.00 9.14  ? 302 CYS A CB    1 
ATOM   2362 S  SG    . CYS A 1 305 ? 55.444 -25.115 4.510   1.00 8.94  ? 302 CYS A SG    1 
ATOM   2363 N  N     . ARG A 1 306 ? 58.080 -23.287 2.909   1.00 6.05  ? 303 ARG A N     1 
ATOM   2364 C  CA    . ARG A 1 306 ? 59.462 -23.629 2.551   1.00 9.33  ? 303 ARG A CA    1 
ATOM   2365 C  C     . ARG A 1 306 ? 60.205 -22.455 1.884   1.00 12.12 ? 303 ARG A C     1 
ATOM   2366 O  O     . ARG A 1 306 ? 61.359 -22.596 1.456   1.00 13.62 ? 303 ARG A O     1 
ATOM   2367 C  CB    . ARG A 1 306 ? 59.489 -24.875 1.649   1.00 10.88 ? 303 ARG A CB    1 
ATOM   2368 C  CG    . ARG A 1 306 ? 58.894 -26.115 2.339   1.00 12.29 ? 303 ARG A CG    1 
ATOM   2369 C  CD    . ARG A 1 306 ? 58.648 -27.306 1.402   1.00 13.59 ? 303 ARG A CD    1 
ATOM   2370 N  NE    . ARG A 1 306 ? 58.475 -28.515 2.206   1.00 15.56 ? 303 ARG A NE    1 
ATOM   2371 C  CZ    . ARG A 1 306 ? 57.367 -28.820 2.876   1.00 15.16 ? 303 ARG A CZ    1 
ATOM   2372 N  NH1   . ARG A 1 306 ? 57.313 -29.935 3.605   1.00 13.20 ? 303 ARG A NH1   1 
ATOM   2373 N  NH2   . ARG A 1 306 ? 56.310 -28.019 2.810   1.00 10.77 ? 303 ARG A NH2   1 
ATOM   2374 N  N     . GLY A 1 307 ? 59.554 -21.297 1.831   1.00 8.83  ? 304 GLY A N     1 
ATOM   2375 C  CA    . GLY A 1 307 ? 60.169 -20.089 1.314   1.00 11.08 ? 304 GLY A CA    1 
ATOM   2376 C  C     . GLY A 1 307 ? 59.986 -19.954 -0.190  1.00 11.59 ? 304 GLY A C     1 
ATOM   2377 O  O     . GLY A 1 307 ? 60.680 -19.169 -0.847  1.00 10.89 ? 304 GLY A O     1 
ATOM   2378 N  N     . ILE A 1 308 ? 59.054 -20.725 -0.742  1.00 10.52 ? 305 ILE A N     1 
ATOM   2379 C  CA    . ILE A 1 308 ? 58.902 -20.815 -2.195  1.00 12.14 ? 305 ILE A CA    1 
ATOM   2380 C  C     . ILE A 1 308 ? 57.552 -20.245 -2.627  1.00 11.58 ? 305 ILE A C     1 
ATOM   2381 O  O     . ILE A 1 308 ? 56.527 -20.598 -2.069  1.00 9.03  ? 305 ILE A O     1 
ATOM   2382 C  CB    . ILE A 1 308 ? 59.018 -22.285 -2.667  1.00 13.92 ? 305 ILE A CB    1 
ATOM   2383 C  CG1   . ILE A 1 308 ? 60.354 -22.879 -2.221  1.00 16.82 ? 305 ILE A CG1   1 
ATOM   2384 C  CG2   . ILE A 1 308 ? 58.858 -22.375 -4.168  1.00 17.30 ? 305 ILE A CG2   1 
ATOM   2385 C  CD1   . ILE A 1 308 ? 60.555 -24.321 -2.616  1.00 21.66 ? 305 ILE A CD1   1 
ATOM   2386 N  N     . GLU A 1 309 ? 57.549 -19.369 -3.628  1.00 9.10  ? 306 GLU A N     1 
ATOM   2387 C  CA    . GLU A 1 309 ? 56.307 -18.738 -4.067  1.00 11.99 ? 306 GLU A CA    1 
ATOM   2388 C  C     . GLU A 1 309 ? 56.560 -18.246 -5.489  1.00 17.28 ? 306 GLU A C     1 
ATOM   2389 O  O     . GLU A 1 309 ? 57.649 -17.761 -5.793  1.00 15.72 ? 306 GLU A O     1 
ATOM   2390 C  CB    . GLU A 1 309 ? 55.957 -17.561 -3.155  1.00 12.71 ? 306 GLU A CB    1 
ATOM   2391 C  CG    . GLU A 1 309 ? 54.498 -17.190 -3.184  1.00 20.77 ? 306 GLU A CG    1 
ATOM   2392 C  CD    . GLU A 1 309 ? 54.240 -15.730 -3.518  1.00 22.59 ? 306 GLU A CD    1 
ATOM   2393 O  OE1   . GLU A 1 309 ? 55.208 -14.938 -3.677  1.00 19.92 ? 306 GLU A OE1   1 
ATOM   2394 O  OE2   . GLU A 1 309 ? 53.046 -15.381 -3.618  1.00 22.48 ? 306 GLU A OE2   1 
ATOM   2395 N  N     . HIS A 1 310 ? 55.575 -18.367 -6.369  1.00 14.86 ? 307 HIS A N     1 
ATOM   2396 C  CA    . HIS A 1 310 ? 55.864 -18.148 -7.789  1.00 18.46 ? 307 HIS A CA    1 
ATOM   2397 C  C     . HIS A 1 310 ? 55.153 -16.958 -8.435  1.00 15.37 ? 307 HIS A C     1 
ATOM   2398 O  O     . HIS A 1 310 ? 55.377 -16.675 -9.611  1.00 17.72 ? 307 HIS A O     1 
ATOM   2399 C  CB    . HIS A 1 310 ? 55.620 -19.430 -8.594  1.00 25.28 ? 307 HIS A CB    1 
ATOM   2400 C  CG    . HIS A 1 310 ? 56.561 -20.543 -8.247  1.00 32.67 ? 307 HIS A CG    1 
ATOM   2401 N  ND1   . HIS A 1 310 ? 57.932 -20.385 -8.236  1.00 31.58 ? 307 HIS A ND1   1 
ATOM   2402 C  CD2   . HIS A 1 310 ? 56.328 -21.829 -7.889  1.00 32.40 ? 307 HIS A CD2   1 
ATOM   2403 C  CE1   . HIS A 1 310 ? 58.502 -21.525 -7.892  1.00 35.92 ? 307 HIS A CE1   1 
ATOM   2404 N  NE2   . HIS A 1 310 ? 57.552 -22.418 -7.676  1.00 37.06 ? 307 HIS A NE2   1 
ATOM   2405 N  N     . ASP A 1 311 ? 54.317 -16.260 -7.672  1.00 15.58 ? 308 ASP A N     1 
ATOM   2406 C  CA    . ASP A 1 311 ? 53.580 -15.110 -8.198  1.00 13.89 ? 308 ASP A CA    1 
ATOM   2407 C  C     . ASP A 1 311 ? 54.519 -14.127 -8.902  1.00 14.95 ? 308 ASP A C     1 
ATOM   2408 O  O     . ASP A 1 311 ? 55.481 -13.647 -8.305  1.00 10.80 ? 308 ASP A O     1 
ATOM   2409 C  CB    . ASP A 1 311 ? 52.852 -14.391 -7.071  1.00 16.25 ? 308 ASP A CB    1 
ATOM   2410 C  CG    . ASP A 1 311 ? 51.861 -13.366 -7.584  1.00 19.71 ? 308 ASP A CG    1 
ATOM   2411 O  OD1   . ASP A 1 311 ? 51.676 -12.332 -6.925  1.00 28.06 ? 308 ASP A OD1   1 
ATOM   2412 O  OD2   . ASP A 1 311 ? 51.254 -13.602 -8.648  1.00 31.76 ? 308 ASP A OD2   1 
ATOM   2413 N  N     . PRO A 1 312 ? 54.239 -13.812 -10.178 1.00 14.78 ? 309 PRO A N     1 
ATOM   2414 C  CA    . PRO A 1 312 ? 55.157 -12.901 -10.870 1.00 10.05 ? 309 PRO A CA    1 
ATOM   2415 C  C     . PRO A 1 312 ? 54.960 -11.439 -10.493 1.00 9.52  ? 309 PRO A C     1 
ATOM   2416 O  O     . PRO A 1 312 ? 53.870 -11.021 -10.115 1.00 13.40 ? 309 PRO A O     1 
ATOM   2417 C  CB    . PRO A 1 312 ? 54.826 -13.123 -12.354 1.00 14.20 ? 309 PRO A CB    1 
ATOM   2418 C  CG    . PRO A 1 312 ? 53.436 -13.626 -12.364 1.00 14.60 ? 309 PRO A CG    1 
ATOM   2419 C  CD    . PRO A 1 312 ? 53.241 -14.402 -11.090 1.00 14.87 ? 309 PRO A CD    1 
ATOM   2420 N  N     . VAL A 1 313 ? 56.043 -10.679 -10.570 1.00 12.85 ? 310 VAL A N     1 
ATOM   2421 C  CA    . VAL A 1 313 ? 55.978 -9.231  -10.541 1.00 11.83 ? 310 VAL A CA    1 
ATOM   2422 C  C     . VAL A 1 313 ? 55.316 -8.807  -11.850 1.00 12.64 ? 310 VAL A C     1 
ATOM   2423 O  O     . VAL A 1 313 ? 55.906 -8.934  -12.917 1.00 14.00 ? 310 VAL A O     1 
ATOM   2424 C  CB    . VAL A 1 313 ? 57.384 -8.631  -10.490 1.00 12.64 ? 310 VAL A CB    1 
ATOM   2425 C  CG1   . VAL A 1 313 ? 57.318 -7.106  -10.491 1.00 13.16 ? 310 VAL A CG1   1 
ATOM   2426 C  CG2   . VAL A 1 313 ? 58.123 -9.137  -9.249  1.00 9.39  ? 310 VAL A CG2   1 
ATOM   2427 N  N     . LYS A 1 314 ? 54.080 -8.338  -11.774 1.00 12.29 ? 311 LYS A N     1 
ATOM   2428 C  CA    . LYS A 1 314 ? 53.343 -8.001  -12.984 1.00 11.62 ? 311 LYS A CA    1 
ATOM   2429 C  C     . LYS A 1 314 ? 53.787 -6.631  -13.461 1.00 11.62 ? 311 LYS A C     1 
ATOM   2430 O  O     . LYS A 1 314 ? 54.018 -5.710  -12.658 1.00 12.42 ? 311 LYS A O     1 
ATOM   2431 C  CB    . LYS A 1 314 ? 51.840 -8.054  -12.702 1.00 17.28 ? 311 LYS A CB    1 
ATOM   2432 C  CG    . LYS A 1 314 ? 51.378 -9.488  -12.424 1.00 16.71 ? 311 LYS A CG    1 
ATOM   2433 C  CD    . LYS A 1 314 ? 50.046 -9.568  -11.706 1.00 29.55 ? 311 LYS A CD    1 
ATOM   2434 C  CE    . LYS A 1 314 ? 49.786 -11.013 -11.279 1.00 27.37 ? 311 LYS A CE    1 
ATOM   2435 N  NZ    . LYS A 1 314 ? 50.917 -11.573 -10.451 1.00 26.27 ? 311 LYS A NZ    1 
ATOM   2436 N  N     . PRO A 1 315 ? 53.954 -6.494  -14.773 1.00 12.10 ? 312 PRO A N     1 
ATOM   2437 C  CA    . PRO A 1 315 ? 54.348 -5.207  -15.333 1.00 10.20 ? 312 PRO A CA    1 
ATOM   2438 C  C     . PRO A 1 315 ? 53.160 -4.252  -15.346 1.00 15.36 ? 312 PRO A C     1 
ATOM   2439 O  O     . PRO A 1 315 ? 52.436 -4.150  -16.350 1.00 13.98 ? 312 PRO A O     1 
ATOM   2440 C  CB    . PRO A 1 315 ? 54.774 -5.579  -16.756 1.00 16.73 ? 312 PRO A CB    1 
ATOM   2441 C  CG    . PRO A 1 315 ? 53.958 -6.785  -17.079 1.00 16.96 ? 312 PRO A CG    1 
ATOM   2442 C  CD    . PRO A 1 315 ? 53.860 -7.549  -15.798 1.00 15.34 ? 312 PRO A CD    1 
ATOM   2443 N  N     . ARG A 1 316 ? 52.942 -3.561  -14.233 1.00 13.20 ? 313 ARG A N     1 
ATOM   2444 C  CA    . ARG A 1 316 ? 51.811 -2.637  -14.142 1.00 14.47 ? 313 ARG A CA    1 
ATOM   2445 C  C     . ARG A 1 316 ? 52.140 -1.516  -13.170 1.00 18.21 ? 313 ARG A C     1 
ATOM   2446 O  O     . ARG A 1 316 ? 52.262 -1.743  -11.976 1.00 12.95 ? 313 ARG A O     1 
ATOM   2447 C  CB    . ARG A 1 316 ? 50.539 -3.361  -13.691 1.00 17.19 ? 313 ARG A CB    1 
ATOM   2448 C  CG    . ARG A 1 316 ? 49.304 -2.456  -13.661 1.00 21.69 ? 313 ARG A CG    1 
ATOM   2449 C  CD    . ARG A 1 316 ? 48.085 -3.161  -13.078 1.00 20.70 ? 313 ARG A CD    1 
ATOM   2450 N  NE    . ARG A 1 316 ? 48.359 -3.695  -11.746 1.00 23.03 ? 313 ARG A NE    1 
ATOM   2451 C  CZ    . ARG A 1 316 ? 48.436 -2.959  -10.640 1.00 28.96 ? 313 ARG A CZ    1 
ATOM   2452 N  NH1   . ARG A 1 316 ? 48.256 -1.640  -10.701 1.00 24.38 ? 313 ARG A NH1   1 
ATOM   2453 N  NH2   . ARG A 1 316 ? 48.695 -3.543  -9.470  1.00 24.53 ? 313 ARG A NH2   1 
ATOM   2454 N  N     . GLN A 1 317 ? 52.289 -0.309  -13.698 1.00 14.72 ? 314 GLN A N     1 
ATOM   2455 C  CA    . GLN A 1 317 ? 52.718 0.829   -12.906 1.00 19.13 ? 314 GLN A CA    1 
ATOM   2456 C  C     . GLN A 1 317 ? 51.538 1.722   -12.547 1.00 20.38 ? 314 GLN A C     1 
ATOM   2457 O  O     . GLN A 1 317 ? 51.585 2.483   -11.571 1.00 20.82 ? 314 GLN A O     1 
ATOM   2458 C  CB    . GLN A 1 317 ? 53.739 1.633   -13.709 1.00 26.64 ? 314 GLN A CB    1 
ATOM   2459 C  CG    . GLN A 1 317 ? 54.581 2.545   -12.872 1.00 26.67 ? 314 GLN A CG    1 
ATOM   2460 C  CD    . GLN A 1 317 ? 55.502 3.397   -13.708 1.00 28.63 ? 314 GLN A CD    1 
ATOM   2461 O  OE1   . GLN A 1 317 ? 55.890 3.014   -14.818 1.00 37.15 ? 314 GLN A OE1   1 
ATOM   2462 N  NE2   . GLN A 1 317 ? 55.856 4.567   -13.187 1.00 22.67 ? 314 GLN A NE2   1 
ATOM   2463 N  N     . LEU A 1 318 ? 50.478 1.624   -13.345 1.00 15.09 ? 315 LEU A N     1 
ATOM   2464 C  CA    . LEU A 1 318 ? 49.275 2.431   -13.153 1.00 16.84 ? 315 LEU A CA    1 
ATOM   2465 C  C     . LEU A 1 318 ? 48.141 1.662   -12.465 1.00 14.82 ? 315 LEU A C     1 
ATOM   2466 O  O     . LEU A 1 318 ? 47.933 0.483   -12.737 1.00 15.28 ? 315 LEU A O     1 
ATOM   2467 C  CB    . LEU A 1 318 ? 48.764 2.909   -14.523 1.00 14.92 ? 315 LEU A CB    1 
ATOM   2468 C  CG    . LEU A 1 318 ? 49.711 3.776   -15.365 1.00 16.42 ? 315 LEU A CG    1 
ATOM   2469 C  CD1   . LEU A 1 318 ? 49.100 4.078   -16.743 1.00 17.78 ? 315 LEU A CD1   1 
ATOM   2470 C  CD2   . LEU A 1 318 ? 50.067 5.065   -14.632 1.00 19.61 ? 315 LEU A CD2   1 
ATOM   2471 N  N     . PRO A 1 319 ? 47.367 2.343   -11.606 1.00 15.08 ? 316 PRO A N     1 
ATOM   2472 C  CA    . PRO A 1 319 ? 46.187 1.683   -11.023 1.00 14.56 ? 316 PRO A CA    1 
ATOM   2473 C  C     . PRO A 1 319 ? 45.205 1.216   -12.111 1.00 16.78 ? 316 PRO A C     1 
ATOM   2474 O  O     . PRO A 1 319 ? 45.161 1.854   -13.162 1.00 18.18 ? 316 PRO A O     1 
ATOM   2475 C  CB    . PRO A 1 319 ? 45.566 2.773   -10.124 1.00 14.35 ? 316 PRO A CB    1 
ATOM   2476 C  CG    . PRO A 1 319 ? 46.237 4.057   -10.506 1.00 25.13 ? 316 PRO A CG    1 
ATOM   2477 C  CD    . PRO A 1 319 ? 47.548 3.731   -11.140 1.00 14.34 ? 316 PRO A CD    1 
ATOM   2478 N  N     . LYS A 1 320 ? 44.474 0.120   -11.867 1.00 15.37 ? 317 LYS A N     1 
ATOM   2479 C  CA    . LYS A 1 320 ? 43.511 -0.478  -12.812 1.00 16.44 ? 317 LYS A CA    1 
ATOM   2480 C  C     . LYS A 1 320 ? 42.119 0.129   -12.681 1.00 17.53 ? 317 LYS A C     1 
ATOM   2481 O  O     . LYS A 1 320 ? 41.225 -0.139  -13.487 1.00 17.68 ? 317 LYS A O     1 
ATOM   2482 C  CB    . LYS A 1 320 ? 43.333 -1.975  -12.514 1.00 19.97 ? 317 LYS A CB    1 
ATOM   2483 C  CG    . LYS A 1 320 ? 44.484 -2.896  -12.865 1.00 21.81 ? 317 LYS A CG    1 
ATOM   2484 C  CD    . LYS A 1 320 ? 44.023 -4.350  -12.727 1.00 24.06 ? 317 LYS A CD    1 
ATOM   2485 C  CE    . LYS A 1 320 ? 45.073 -5.308  -13.247 1.00 32.60 ? 317 LYS A CE    1 
ATOM   2486 N  NZ    . LYS A 1 320 ? 44.550 -6.692  -13.394 1.00 33.48 ? 317 LYS A NZ    1 
ATOM   2487 N  N     . THR A 1 321 ? 41.914 0.892   -11.618 1.00 14.81 ? 318 THR A N     1 
ATOM   2488 C  CA    . THR A 1 321 ? 40.617 1.508   -11.376 1.00 17.11 ? 318 THR A CA    1 
ATOM   2489 C  C     . THR A 1 321 ? 40.841 2.886   -10.786 1.00 14.83 ? 318 THR A C     1 
ATOM   2490 O  O     . THR A 1 321 ? 41.888 3.150   -10.182 1.00 18.54 ? 318 THR A O     1 
ATOM   2491 C  CB    . THR A 1 321 ? 39.730 0.658   -10.420 1.00 21.50 ? 318 THR A CB    1 
ATOM   2492 O  OG1   . THR A 1 321 ? 40.403 0.469   -9.169  1.00 18.40 ? 318 THR A OG1   1 
ATOM   2493 C  CG2   . THR A 1 321 ? 39.426 -0.695  -11.017 1.00 20.98 ? 318 THR A CG2   1 
ATOM   2494 N  N     . ILE A 1 322 ? 39.871 3.772   -10.985 1.00 12.38 ? 319 ILE A N     1 
ATOM   2495 C  CA    . ILE A 1 322 ? 39.897 5.100   -10.396 1.00 15.51 ? 319 ILE A CA    1 
ATOM   2496 C  C     . ILE A 1 322 ? 38.558 5.306   -9.681  1.00 16.64 ? 319 ILE A C     1 
ATOM   2497 O  O     . ILE A 1 322 ? 37.503 5.343   -10.318 1.00 14.22 ? 319 ILE A O     1 
ATOM   2498 C  CB    . ILE A 1 322 ? 40.092 6.184   -11.470 1.00 13.57 ? 319 ILE A CB    1 
ATOM   2499 C  CG1   . ILE A 1 322 ? 41.434 5.979   -12.191 1.00 19.14 ? 319 ILE A CG1   1 
ATOM   2500 C  CG2   . ILE A 1 322 ? 39.991 7.588   -10.863 1.00 15.98 ? 319 ILE A CG2   1 
ATOM   2501 C  CD1   . ILE A 1 322 ? 41.768 7.090   -13.179 1.00 17.15 ? 319 ILE A CD1   1 
ATOM   2502 N  N     . GLY A 1 323 ? 38.604 5.419   -8.359  1.00 12.82 ? 320 GLY A N     1 
ATOM   2503 C  CA    . GLY A 1 323 ? 37.386 5.479   -7.571  1.00 12.90 ? 320 GLY A CA    1 
ATOM   2504 C  C     . GLY A 1 323 ? 37.327 6.641   -6.593  1.00 12.17 ? 320 GLY A C     1 
ATOM   2505 O  O     . GLY A 1 323 ? 38.355 7.197   -6.211  1.00 15.15 ? 320 GLY A O     1 
ATOM   2506 N  N     . CYS A 1 324 ? 36.108 6.965   -6.174  1.00 11.48 ? 321 CYS A N     1 
ATOM   2507 C  CA    . CYS A 1 324 ? 35.805 8.078   -5.279  1.00 13.63 ? 321 CYS A CA    1 
ATOM   2508 C  C     . CYS A 1 324 ? 34.756 7.578   -4.309  1.00 14.08 ? 321 CYS A C     1 
ATOM   2509 O  O     . CYS A 1 324 ? 33.723 7.043   -4.720  1.00 13.83 ? 321 CYS A O     1 
ATOM   2510 C  CB    . CYS A 1 324 ? 35.203 9.243   -6.086  1.00 14.22 ? 321 CYS A CB    1 
ATOM   2511 S  SG    A CYS A 1 324 ? 36.319 10.033  -7.230  0.66 22.50 ? 321 CYS A SG    1 
ATOM   2512 S  SG    B CYS A 1 324 ? 35.481 10.892  -5.421  0.34 20.52 ? 321 CYS A SG    1 
ATOM   2513 N  N     . SER A 1 325 ? 34.997 7.758   -3.021  1.00 12.18 ? 322 SER A N     1 
ATOM   2514 C  CA    A SER A 1 325 ? 34.059 7.240   -2.041  0.44 14.37 ? 322 SER A CA    1 
ATOM   2515 C  CA    B SER A 1 325 ? 34.155 7.169   -1.994  0.56 14.38 ? 322 SER A CA    1 
ATOM   2516 C  C     . SER A 1 325 ? 33.957 8.117   -0.814  1.00 15.02 ? 322 SER A C     1 
ATOM   2517 O  O     . SER A 1 325 ? 34.895 8.815   -0.434  1.00 14.60 ? 322 SER A O     1 
ATOM   2518 C  CB    A SER A 1 325 ? 34.420 5.812   -1.627  0.44 16.65 ? 322 SER A CB    1 
ATOM   2519 C  CB    B SER A 1 325 ? 34.828 5.880   -1.511  0.56 16.87 ? 322 SER A CB    1 
ATOM   2520 O  OG    A SER A 1 325 ? 35.657 5.781   -0.944  0.44 15.95 ? 322 SER A OG    1 
ATOM   2521 O  OG    B SER A 1 325 ? 34.167 5.302   -0.410  0.56 16.42 ? 322 SER A OG    1 
ATOM   2522 N  N     . LYS A 1 326 ? 32.769 8.103   -0.219  1.00 13.71 ? 323 LYS A N     1 
ATOM   2523 C  CA    . LYS A 1 326 ? 32.543 8.841   1.013   1.00 17.87 ? 323 LYS A CA    1 
ATOM   2524 C  C     . LYS A 1 326 ? 31.578 8.090   1.923   1.00 15.88 ? 323 LYS A C     1 
ATOM   2525 O  O     . LYS A 1 326 ? 30.547 7.584   1.468   1.00 11.01 ? 323 LYS A O     1 
ATOM   2526 C  CB    . LYS A 1 326 ? 32.022 10.258  0.752   1.00 14.92 ? 323 LYS A CB    1 
ATOM   2527 C  CG    . LYS A 1 326 ? 31.963 11.070  2.058   1.00 14.89 ? 323 LYS A CG    1 
ATOM   2528 C  CD    . LYS A 1 326 ? 31.712 12.543  1.838   1.00 17.25 ? 323 LYS A CD    1 
ATOM   2529 C  CE    . LYS A 1 326 ? 31.555 13.232  3.184   1.00 16.61 ? 323 LYS A CE    1 
ATOM   2530 N  NZ    . LYS A 1 326 ? 32.646 12.814  4.086   1.00 25.98 ? 323 LYS A NZ    1 
ATOM   2531 N  N     . ASN A 1 327 ? 31.943 8.001   3.199   1.00 13.32 ? 324 ASN A N     1 
ATOM   2532 C  CA    . ASN A 1 327 ? 31.072 7.462   4.229   1.00 17.31 ? 324 ASN A CA    1 
ATOM   2533 C  C     . ASN A 1 327 ? 30.248 8.581   4.831   1.00 16.90 ? 324 ASN A C     1 
ATOM   2534 O  O     . ASN A 1 327 ? 30.696 9.722   4.908   1.00 14.56 ? 324 ASN A O     1 
ATOM   2535 C  CB    . ASN A 1 327 ? 31.876 6.822   5.358   1.00 16.29 ? 324 ASN A CB    1 
ATOM   2536 C  CG    . ASN A 1 327 ? 32.475 5.488   4.980   1.00 22.34 ? 324 ASN A CG    1 
ATOM   2537 O  OD1   . ASN A 1 327 ? 32.308 4.995   3.862   1.00 25.16 ? 324 ASN A OD1   1 
ATOM   2538 N  ND2   . ASN A 1 327 ? 33.195 4.892   5.923   1.00 24.83 ? 324 ASN A ND2   1 
ATOM   2539 N  N     . PHE A 1 328 ? 29.049 8.234   5.284   1.00 15.41 ? 325 PHE A N     1 
ATOM   2540 C  CA    . PHE A 1 328 ? 28.152 9.185   5.913   1.00 18.07 ? 325 PHE A CA    1 
ATOM   2541 C  C     . PHE A 1 328 ? 27.681 8.539   7.203   1.00 24.47 ? 325 PHE A C     1 
ATOM   2542 O  O     . PHE A 1 328 ? 26.589 7.970   7.264   1.00 21.80 ? 325 PHE A O     1 
ATOM   2543 C  CB    . PHE A 1 328 ? 26.985 9.499   4.985   1.00 22.32 ? 325 PHE A CB    1 
ATOM   2544 C  CG    . PHE A 1 328 ? 27.412 10.081  3.675   1.00 18.09 ? 325 PHE A CG    1 
ATOM   2545 C  CD1   . PHE A 1 328 ? 27.564 9.273   2.561   1.00 19.00 ? 325 PHE A CD1   1 
ATOM   2546 C  CD2   . PHE A 1 328 ? 27.694 11.433  3.563   1.00 15.95 ? 325 PHE A CD2   1 
ATOM   2547 C  CE1   . PHE A 1 328 ? 27.965 9.811   1.355   1.00 13.68 ? 325 PHE A CE1   1 
ATOM   2548 C  CE2   . PHE A 1 328 ? 28.093 11.978  2.355   1.00 19.19 ? 325 PHE A CE2   1 
ATOM   2549 C  CZ    . PHE A 1 328 ? 28.237 11.156  1.248   1.00 14.71 ? 325 PHE A CZ    1 
ATOM   2550 N  N     . PRO A 1 329 ? 28.537 8.597   8.229   1.00 23.64 ? 326 PRO A N     1 
ATOM   2551 C  CA    . PRO A 1 329 ? 28.366 7.844   9.474   1.00 32.96 ? 326 PRO A CA    1 
ATOM   2552 C  C     . PRO A 1 329 ? 27.274 8.401   10.369  1.00 32.67 ? 326 PRO A C     1 
ATOM   2553 O  O     . PRO A 1 329 ? 26.899 9.572   10.255  1.00 24.50 ? 326 PRO A O     1 
ATOM   2554 C  CB    . PRO A 1 329 ? 29.727 7.988   10.154  1.00 35.24 ? 326 PRO A CB    1 
ATOM   2555 C  CG    . PRO A 1 329 ? 30.261 9.277   9.636   1.00 33.98 ? 326 PRO A CG    1 
ATOM   2556 C  CD    . PRO A 1 329 ? 29.809 9.337   8.204   1.00 28.97 ? 326 PRO A CD    1 
ATOM   2557 N  N     . GLY A 1 330 ? 26.777 7.536   11.249  1.00 40.56 ? 327 GLY A N     1 
ATOM   2558 C  CA    . GLY A 1 330 ? 25.782 7.895   12.241  1.00 41.40 ? 327 GLY A CA    1 
ATOM   2559 C  C     . GLY A 1 330 ? 24.702 8.829   11.741  1.00 34.91 ? 327 GLY A C     1 
ATOM   2560 O  O     . GLY A 1 330 ? 23.933 8.497   10.841  1.00 36.91 ? 327 GLY A O     1 
ATOM   2561 N  N     . LYS A 1 331 ? 24.661 10.017  12.328  1.00 31.93 ? 328 LYS A N     1 
ATOM   2562 C  CA    . LYS A 1 331 ? 23.560 10.938  12.103  1.00 34.06 ? 328 LYS A CA    1 
ATOM   2563 C  C     . LYS A 1 331 ? 23.667 11.683  10.777  1.00 34.81 ? 328 LYS A C     1 
ATOM   2564 O  O     . LYS A 1 331 ? 22.730 12.369  10.378  1.00 39.08 ? 328 LYS A O     1 
ATOM   2565 C  CB    . LYS A 1 331 ? 23.459 11.919  13.274  1.00 46.04 ? 328 LYS A CB    1 
ATOM   2566 C  CG    . LYS A 1 331 ? 22.107 12.588  13.421  1.00 56.34 ? 328 LYS A CG    1 
ATOM   2567 C  CD    . LYS A 1 331 ? 21.994 13.303  14.762  1.00 60.57 ? 328 LYS A CD    1 
ATOM   2568 C  CE    . LYS A 1 331 ? 20.850 14.306  14.760  1.00 55.83 ? 328 LYS A CE    1 
ATOM   2569 N  NZ    . LYS A 1 331 ? 21.048 15.344  13.706  1.00 49.43 ? 328 LYS A NZ    1 
ATOM   2570 N  N     . THR A 1 332 ? 24.797 11.552  10.084  1.00 31.21 ? 329 THR A N     1 
ATOM   2571 C  CA    . THR A 1 332 ? 24.969 12.273  8.824   1.00 32.17 ? 329 THR A CA    1 
ATOM   2572 C  C     . THR A 1 332 ? 24.466 11.482  7.611   1.00 27.94 ? 329 THR A C     1 
ATOM   2573 O  O     . THR A 1 332 ? 24.560 11.959  6.483   1.00 26.48 ? 329 THR A O     1 
ATOM   2574 C  CB    . THR A 1 332 ? 26.438 12.690  8.566   1.00 27.16 ? 329 THR A CB    1 
ATOM   2575 O  OG1   . THR A 1 332 ? 27.219 11.534  8.242   1.00 25.56 ? 329 THR A OG1   1 
ATOM   2576 C  CG2   . THR A 1 332 ? 27.034 13.397  9.780   1.00 27.56 ? 329 THR A CG2   1 
ATOM   2577 N  N     . ALA A 1 333 ? 23.943 10.281  7.848   1.00 28.07 ? 330 ALA A N     1 
ATOM   2578 C  CA    . ALA A 1 333 ? 23.443 9.432   6.769   1.00 23.28 ? 330 ALA A CA    1 
ATOM   2579 C  C     . ALA A 1 333 ? 22.427 10.161  5.906   1.00 29.52 ? 330 ALA A C     1 
ATOM   2580 O  O     . ALA A 1 333 ? 21.603 10.920  6.412   1.00 30.41 ? 330 ALA A O     1 
ATOM   2581 C  CB    . ALA A 1 333 ? 22.848 8.154   7.331   1.00 26.32 ? 330 ALA A CB    1 
ATOM   2582 N  N     . LEU A 1 334 ? 22.487 9.926   4.599   1.00 27.20 ? 331 LEU A N     1 
ATOM   2583 C  CA    . LEU A 1 334 ? 21.640 10.647  3.653   1.00 28.95 ? 331 LEU A CA    1 
ATOM   2584 C  C     . LEU A 1 334 ? 20.217 10.081  3.676   1.00 30.15 ? 331 LEU A C     1 
ATOM   2585 O  O     . LEU A 1 334 ? 20.020 8.885   3.484   1.00 28.68 ? 331 LEU A O     1 
ATOM   2586 C  CB    . LEU A 1 334 ? 22.221 10.558  2.240   1.00 29.63 ? 331 LEU A CB    1 
ATOM   2587 C  CG    . LEU A 1 334 ? 23.740 10.671  2.112   1.00 23.19 ? 331 LEU A CG    1 
ATOM   2588 C  CD1   . LEU A 1 334 ? 24.152 10.666  0.642   1.00 23.16 ? 331 LEU A CD1   1 
ATOM   2589 C  CD2   . LEU A 1 334 ? 24.245 11.922  2.824   1.00 24.48 ? 331 LEU A CD2   1 
ATOM   2590 N  N     . ALA A 1 335 ? 19.234 10.948  3.903   1.00 34.02 ? 332 ALA A N     1 
ATOM   2591 C  CA    . ALA A 1 335 ? 17.854 10.505  4.098   1.00 34.32 ? 332 ALA A CA    1 
ATOM   2592 C  C     . ALA A 1 335 ? 16.869 11.214  3.172   1.00 35.39 ? 332 ALA A C     1 
ATOM   2593 O  O     . ALA A 1 335 ? 15.656 11.017  3.273   1.00 35.06 ? 332 ALA A O     1 
ATOM   2594 C  CB    . ALA A 1 335 ? 17.443 10.686  5.549   1.00 32.29 ? 332 ALA A CB    1 
ATOM   2595 N  N     . THR A 1 336 ? 17.396 12.040  2.276   1.00 28.89 ? 333 THR A N     1 
ATOM   2596 C  CA    . THR A 1 336 ? 16.581 12.712  1.280   1.00 32.55 ? 333 THR A CA    1 
ATOM   2597 C  C     . THR A 1 336 ? 17.168 12.518  -0.117  1.00 40.56 ? 333 THR A C     1 
ATOM   2598 O  O     . THR A 1 336 ? 18.388 12.452  -0.293  1.00 31.10 ? 333 THR A O     1 
ATOM   2599 C  CB    . THR A 1 336 ? 16.436 14.219  1.573   1.00 37.23 ? 333 THR A CB    1 
ATOM   2600 O  OG1   . THR A 1 336 ? 17.610 14.921  1.137   1.00 34.87 ? 333 THR A OG1   1 
ATOM   2601 C  CG2   . THR A 1 336 ? 16.210 14.461  3.067   1.00 36.07 ? 333 THR A CG2   1 
ATOM   2602 N  N     . ARG A 1 337 ? 16.289 12.428  -1.107  1.00 41.42 ? 334 ARG A N     1 
ATOM   2603 C  CA    . ARG A 1 337 ? 16.707 12.251  -2.489  1.00 38.31 ? 334 ARG A CA    1 
ATOM   2604 C  C     . ARG A 1 337 ? 17.621 13.391  -2.929  1.00 36.84 ? 334 ARG A C     1 
ATOM   2605 O  O     . ARG A 1 337 ? 18.589 13.178  -3.662  1.00 34.61 ? 334 ARG A O     1 
ATOM   2606 C  CB    . ARG A 1 337 ? 15.481 12.142  -3.399  1.00 44.52 ? 334 ARG A CB    1 
ATOM   2607 C  CG    . ARG A 1 337 ? 15.799 11.883  -4.859  1.00 51.05 ? 334 ARG A CG    1 
ATOM   2608 C  CD    . ARG A 1 337 ? 14.552 11.487  -5.649  1.00 53.67 ? 334 ARG A CD    1 
ATOM   2609 N  NE    . ARG A 1 337 ? 13.428 12.392  -5.421  1.00 58.86 ? 334 ARG A NE    1 
ATOM   2610 C  CZ    . ARG A 1 337 ? 13.395 13.662  -5.811  1.00 62.40 ? 334 ARG A CZ    1 
ATOM   2611 N  NH1   . ARG A 1 337 ? 14.434 14.195  -6.442  1.00 57.55 ? 334 ARG A NH1   1 
ATOM   2612 N  NH2   . ARG A 1 337 ? 12.325 14.405  -5.561  1.00 63.67 ? 334 ARG A NH2   1 
ATOM   2613 N  N     . GLU A 1 338 ? 17.318 14.601  -2.475  1.00 37.61 ? 335 GLU A N     1 
ATOM   2614 C  CA    . GLU A 1 338 ? 18.146 15.760  -2.795  1.00 36.61 ? 335 GLU A CA    1 
ATOM   2615 C  C     . GLU A 1 338 ? 19.563 15.593  -2.250  1.00 32.89 ? 335 GLU A C     1 
ATOM   2616 O  O     . GLU A 1 338 ? 20.540 16.001  -2.881  1.00 28.25 ? 335 GLU A O     1 
ATOM   2617 C  CB    . GLU A 1 338 ? 17.523 17.041  -2.236  1.00 35.53 ? 335 GLU A CB    1 
ATOM   2618 C  CG    . GLU A 1 338 ? 16.282 17.509  -2.985  1.00 51.41 ? 335 GLU A CG    1 
ATOM   2619 C  CD    . GLU A 1 338 ? 16.590 17.966  -4.401  1.00 60.54 ? 335 GLU A CD    1 
ATOM   2620 O  OE1   . GLU A 1 338 ? 17.774 17.918  -4.800  1.00 55.43 ? 335 GLU A OE1   1 
ATOM   2621 O  OE2   . GLU A 1 338 ? 15.649 18.375  -5.115  1.00 62.64 ? 335 GLU A OE2   1 
ATOM   2622 N  N     . GLN A 1 339 ? 19.664 14.996  -1.070  1.00 33.22 ? 336 GLN A N     1 
ATOM   2623 C  CA    . GLN A 1 339 ? 20.958 14.756  -0.455  1.00 30.64 ? 336 GLN A CA    1 
ATOM   2624 C  C     . GLN A 1 339 ? 21.749 13.759  -1.286  1.00 31.35 ? 336 GLN A C     1 
ATOM   2625 O  O     . GLN A 1 339 ? 22.894 14.014  -1.658  1.00 26.86 ? 336 GLN A O     1 
ATOM   2626 C  CB    . GLN A 1 339 ? 20.777 14.214  0.956   1.00 30.53 ? 336 GLN A CB    1 
ATOM   2627 C  CG    . GLN A 1 339 ? 21.030 15.225  2.039   1.00 30.28 ? 336 GLN A CG    1 
ATOM   2628 C  CD    . GLN A 1 339 ? 21.065 14.575  3.394   1.00 29.80 ? 336 GLN A CD    1 
ATOM   2629 O  OE1   . GLN A 1 339 ? 20.260 13.686  3.691   1.00 26.36 ? 336 GLN A OE1   1 
ATOM   2630 N  NE2   . GLN A 1 339 ? 22.007 15.000  4.228   1.00 28.19 ? 336 GLN A NE2   1 
ATOM   2631 N  N     . VAL A 1 340 ? 21.125 12.620  -1.570  1.00 28.73 ? 337 VAL A N     1 
ATOM   2632 C  CA    . VAL A 1 340 ? 21.754 11.569  -2.357  1.00 28.47 ? 337 VAL A CA    1 
ATOM   2633 C  C     . VAL A 1 340 ? 22.254 12.090  -3.701  1.00 26.33 ? 337 VAL A C     1 
ATOM   2634 O  O     . VAL A 1 340 ? 23.331 11.709  -4.154  1.00 25.43 ? 337 VAL A O     1 
ATOM   2635 C  CB    . VAL A 1 340 ? 20.794 10.378  -2.572  1.00 31.31 ? 337 VAL A CB    1 
ATOM   2636 C  CG1   . VAL A 1 340 ? 21.420 9.324   -3.489  1.00 18.94 ? 337 VAL A CG1   1 
ATOM   2637 C  CG2   . VAL A 1 340 ? 20.407 9.771   -1.233  1.00 29.40 ? 337 VAL A CG2   1 
ATOM   2638 N  N     . GLN A 1 341 ? 21.481 12.970  -4.329  1.00 24.08 ? 338 GLN A N     1 
ATOM   2639 C  CA    . GLN A 1 341 ? 21.826 13.473  -5.653  1.00 26.53 ? 338 GLN A CA    1 
ATOM   2640 C  C     . GLN A 1 341 ? 22.964 14.477  -5.586  1.00 27.56 ? 338 GLN A C     1 
ATOM   2641 O  O     . GLN A 1 341 ? 23.800 14.546  -6.489  1.00 24.50 ? 338 GLN A O     1 
ATOM   2642 C  CB    . GLN A 1 341 ? 20.607 14.103  -6.335  1.00 32.04 ? 338 GLN A CB    1 
ATOM   2643 C  CG    . GLN A 1 341 ? 19.546 13.094  -6.740  1.00 32.10 ? 338 GLN A CG    1 
ATOM   2644 C  CD    . GLN A 1 341 ? 18.311 13.746  -7.337  1.00 42.53 ? 338 GLN A CD    1 
ATOM   2645 O  OE1   . GLN A 1 341 ? 18.171 14.969  -7.329  1.00 41.73 ? 338 GLN A OE1   1 
ATOM   2646 N  NE2   . GLN A 1 341 ? 17.409 12.925  -7.865  1.00 50.22 ? 338 GLN A NE2   1 
ATOM   2647 N  N     . TRP A 1 342 ? 22.995 15.259  -4.515  1.00 21.27 ? 339 TRP A N     1 
ATOM   2648 C  CA    . TRP A 1 342 ? 24.033 16.261  -4.371  1.00 25.37 ? 339 TRP A CA    1 
ATOM   2649 C  C     . TRP A 1 342 ? 25.392 15.592  -4.159  1.00 16.04 ? 339 TRP A C     1 
ATOM   2650 O  O     . TRP A 1 342 ? 26.393 15.995  -4.743  1.00 20.75 ? 339 TRP A O     1 
ATOM   2651 C  CB    . TRP A 1 342 ? 23.706 17.201  -3.215  1.00 21.90 ? 339 TRP A CB    1 
ATOM   2652 C  CG    . TRP A 1 342 ? 24.632 18.370  -3.136  1.00 23.92 ? 339 TRP A CG    1 
ATOM   2653 C  CD1   . TRP A 1 342 ? 24.549 19.536  -3.843  1.00 26.57 ? 339 TRP A CD1   1 
ATOM   2654 C  CD2   . TRP A 1 342 ? 25.789 18.483  -2.310  1.00 24.03 ? 339 TRP A CD2   1 
ATOM   2655 N  NE1   . TRP A 1 342 ? 25.583 20.367  -3.504  1.00 27.80 ? 339 TRP A NE1   1 
ATOM   2656 C  CE2   . TRP A 1 342 ? 26.358 19.746  -2.561  1.00 23.82 ? 339 TRP A CE2   1 
ATOM   2657 C  CE3   . TRP A 1 342 ? 26.400 17.638  -1.380  1.00 23.16 ? 339 TRP A CE3   1 
ATOM   2658 C  CZ2   . TRP A 1 342 ? 27.513 20.186  -1.918  1.00 31.14 ? 339 TRP A CZ2   1 
ATOM   2659 C  CZ3   . TRP A 1 342 ? 27.541 18.079  -0.737  1.00 27.06 ? 339 TRP A CZ3   1 
ATOM   2660 C  CH2   . TRP A 1 342 ? 28.087 19.341  -1.009  1.00 24.33 ? 339 TRP A CH2   1 
ATOM   2661 N  N     . TRP A 1 343 ? 25.414 14.568  -3.322  1.00 16.98 ? 340 TRP A N     1 
ATOM   2662 C  CA    . TRP A 1 343 ? 26.659 13.871  -3.026  1.00 17.21 ? 340 TRP A CA    1 
ATOM   2663 C  C     . TRP A 1 343 ? 27.132 12.984  -4.174  1.00 17.96 ? 340 TRP A C     1 
ATOM   2664 O  O     . TRP A 1 343 ? 28.327 12.798  -4.357  1.00 16.57 ? 340 TRP A O     1 
ATOM   2665 C  CB    . TRP A 1 343 ? 26.523 13.064  -1.741  1.00 17.82 ? 340 TRP A CB    1 
ATOM   2666 C  CG    . TRP A 1 343 ? 26.656 13.918  -0.515  1.00 19.32 ? 340 TRP A CG    1 
ATOM   2667 C  CD1   . TRP A 1 343 ? 25.666 14.269  0.351   1.00 24.04 ? 340 TRP A CD1   1 
ATOM   2668 C  CD2   . TRP A 1 343 ? 27.854 14.545  -0.034  1.00 18.07 ? 340 TRP A CD2   1 
ATOM   2669 N  NE1   . TRP A 1 343 ? 26.172 15.073  1.349   1.00 22.80 ? 340 TRP A NE1   1 
ATOM   2670 C  CE2   . TRP A 1 343 ? 27.515 15.251  1.137   1.00 21.44 ? 340 TRP A CE2   1 
ATOM   2671 C  CE3   . TRP A 1 343 ? 29.182 14.566  -0.476  1.00 16.26 ? 340 TRP A CE3   1 
ATOM   2672 C  CZ2   . TRP A 1 343 ? 28.455 15.978  1.874   1.00 20.69 ? 340 TRP A CZ2   1 
ATOM   2673 C  CZ3   . TRP A 1 343 ? 30.113 15.288  0.252   1.00 20.46 ? 340 TRP A CZ3   1 
ATOM   2674 C  CH2   . TRP A 1 343 ? 29.743 15.985  1.418   1.00 22.08 ? 340 TRP A CH2   1 
ATOM   2675 N  N     . LEU A 1 344 ? 26.204 12.430  -4.950  1.00 15.10 ? 341 LEU A N     1 
ATOM   2676 C  CA    . LEU A 1 344 ? 26.617 11.658  -6.122  1.00 18.89 ? 341 LEU A CA    1 
ATOM   2677 C  C     . LEU A 1 344 ? 27.287 12.593  -7.114  1.00 16.43 ? 341 LEU A C     1 
ATOM   2678 O  O     . LEU A 1 344 ? 28.267 12.232  -7.769  1.00 15.16 ? 341 LEU A O     1 
ATOM   2679 C  CB    . LEU A 1 344 ? 25.439 10.930  -6.778  1.00 16.04 ? 341 LEU A CB    1 
ATOM   2680 C  CG    . LEU A 1 344 ? 24.832 9.693   -6.106  1.00 24.02 ? 341 LEU A CG    1 
ATOM   2681 C  CD1   . LEU A 1 344 ? 23.560 9.286   -6.836  1.00 25.15 ? 341 LEU A CD1   1 
ATOM   2682 C  CD2   . LEU A 1 344 ? 25.820 8.519   -6.045  1.00 18.25 ? 341 LEU A CD2   1 
ATOM   2683 N  N     . LEU A 1 345 ? 26.767 13.811  -7.206  1.00 16.45 ? 342 LEU A N     1 
ATOM   2684 C  CA    . LEU A 1 345 ? 27.351 14.813  -8.082  1.00 19.00 ? 342 LEU A CA    1 
ATOM   2685 C  C     . LEU A 1 345 ? 28.751 15.224  -7.623  1.00 17.52 ? 342 LEU A C     1 
ATOM   2686 O  O     . LEU A 1 345 ? 29.656 15.371  -8.444  1.00 14.88 ? 342 LEU A O     1 
ATOM   2687 C  CB    . LEU A 1 345 ? 26.446 16.045  -8.184  1.00 20.33 ? 342 LEU A CB    1 
ATOM   2688 C  CG    . LEU A 1 345 ? 26.994 17.197  -9.022  1.00 22.31 ? 342 LEU A CG    1 
ATOM   2689 C  CD1   . LEU A 1 345 ? 27.328 16.728  -10.438 1.00 23.33 ? 342 LEU A CD1   1 
ATOM   2690 C  CD2   . LEU A 1 345 ? 25.991 18.348  -9.070  1.00 25.17 ? 342 LEU A CD2   1 
ATOM   2691 N  N     . GLN A 1 346 ? 28.925 15.425  -6.318  1.00 16.53 ? 343 GLN A N     1 
ATOM   2692 C  CA    . GLN A 1 346 ? 30.227 15.802  -5.783  1.00 17.88 ? 343 GLN A CA    1 
ATOM   2693 C  C     . GLN A 1 346 ? 31.253 14.719  -6.127  1.00 15.02 ? 343 GLN A C     1 
ATOM   2694 O  O     . GLN A 1 346 ? 32.346 15.008  -6.607  1.00 13.61 ? 343 GLN A O     1 
ATOM   2695 C  CB    . GLN A 1 346 ? 30.172 15.995  -4.264  1.00 19.44 ? 343 GLN A CB    1 
ATOM   2696 C  CG    . GLN A 1 346 ? 29.170 17.048  -3.789  1.00 17.23 ? 343 GLN A CG    1 
ATOM   2697 C  CD    . GLN A 1 346 ? 29.198 18.310  -4.621  1.00 19.50 ? 343 GLN A CD    1 
ATOM   2698 O  OE1   . GLN A 1 346 ? 30.202 19.022  -4.673  1.00 23.55 ? 343 GLN A OE1   1 
ATOM   2699 N  NE2   . GLN A 1 346 ? 28.084 18.597  -5.286  1.00 23.90 ? 343 GLN A NE2   1 
ATOM   2700 N  N     . LEU A 1 347 ? 30.889 13.474  -5.861  1.00 16.15 ? 344 LEU A N     1 
ATOM   2701 C  CA    . LEU A 1 347 ? 31.754 12.337  -6.159  1.00 15.56 ? 344 LEU A CA    1 
ATOM   2702 C  C     . LEU A 1 347 ? 32.071 12.249  -7.647  1.00 16.42 ? 344 LEU A C     1 
ATOM   2703 O  O     . LEU A 1 347 ? 33.221 12.013  -8.032  1.00 13.90 ? 344 LEU A O     1 
ATOM   2704 C  CB    . LEU A 1 347 ? 31.099 11.030  -5.709  1.00 12.65 ? 344 LEU A CB    1 
ATOM   2705 C  CG    . LEU A 1 347 ? 31.190 10.691  -4.219  1.00 18.15 ? 344 LEU A CG    1 
ATOM   2706 C  CD1   . LEU A 1 347 ? 30.511 9.353   -3.920  1.00 18.12 ? 344 LEU A CD1   1 
ATOM   2707 C  CD2   . LEU A 1 347 ? 32.625 10.629  -3.816  1.00 18.76 ? 344 LEU A CD2   1 
ATOM   2708 N  N     . ALA A 1 348 ? 31.040 12.413  -8.468  1.00 15.39 ? 345 ALA A N     1 
ATOM   2709 C  CA    . ALA A 1 348 ? 31.174 12.336  -9.921  1.00 15.00 ? 345 ALA A CA    1 
ATOM   2710 C  C     . ALA A 1 348 ? 32.054 13.447  -10.470 1.00 15.94 ? 345 ALA A C     1 
ATOM   2711 O  O     . ALA A 1 348 ? 32.738 13.262  -11.473 1.00 14.02 ? 345 ALA A O     1 
ATOM   2712 C  CB    . ALA A 1 348 ? 29.798 12.386  -10.588 1.00 15.07 ? 345 ALA A CB    1 
ATOM   2713 N  N     . GLN A 1 349 ? 32.026 14.607  -9.820  1.00 15.19 ? 346 GLN A N     1 
ATOM   2714 C  CA    . GLN A 1 349 ? 32.867 15.723  -10.228 1.00 15.96 ? 346 GLN A CA    1 
ATOM   2715 C  C     . GLN A 1 349 ? 34.339 15.456  -9.921  1.00 15.21 ? 346 GLN A C     1 
ATOM   2716 O  O     . GLN A 1 349 ? 35.209 15.771  -10.726 1.00 13.03 ? 346 GLN A O     1 
ATOM   2717 C  CB    . GLN A 1 349 ? 32.408 17.027  -9.570  1.00 15.54 ? 346 GLN A CB    1 
ATOM   2718 C  CG    . GLN A 1 349 ? 31.055 17.501  -10.104 1.00 20.49 ? 346 GLN A CG    1 
ATOM   2719 C  CD    . GLN A 1 349 ? 30.633 18.846  -9.542  1.00 31.38 ? 346 GLN A CD    1 
ATOM   2720 O  OE1   . GLN A 1 349 ? 31.192 19.329  -8.559  1.00 32.83 ? 346 GLN A OE1   1 
ATOM   2721 N  NE2   . GLN A 1 349 ? 29.641 19.460  -10.172 1.00 31.74 ? 346 GLN A NE2   1 
ATOM   2722 N  N     . GLU A 1 350 ? 34.626 14.878  -8.763  1.00 10.94 ? 347 GLU A N     1 
ATOM   2723 C  CA    . GLU A 1 350 ? 36.021 14.535  -8.487  1.00 14.37 ? 347 GLU A CA    1 
ATOM   2724 C  C     . GLU A 1 350 ? 36.457 13.459  -9.475  1.00 11.14 ? 347 GLU A C     1 
ATOM   2725 O  O     . GLU A 1 350 ? 37.567 13.498  -9.989  1.00 14.46 ? 347 GLU A O     1 
ATOM   2726 C  CB    . GLU A 1 350 ? 36.252 14.049  -7.050  1.00 12.63 ? 347 GLU A CB    1 
ATOM   2727 C  CG    . GLU A 1 350 ? 37.727 13.676  -6.813  1.00 15.67 ? 347 GLU A CG    1 
ATOM   2728 C  CD    . GLU A 1 350 ? 38.009 13.065  -5.440  1.00 19.25 ? 347 GLU A CD    1 
ATOM   2729 O  OE1   . GLU A 1 350 ? 37.299 13.383  -4.458  1.00 20.40 ? 347 GLU A OE1   1 
ATOM   2730 O  OE2   . GLU A 1 350 ? 38.954 12.261  -5.350  1.00 16.90 ? 347 GLU A OE2   1 
ATOM   2731 N  N     . LEU A 1 351 ? 35.568 12.510  -9.740  1.00 13.27 ? 348 LEU A N     1 
ATOM   2732 C  CA    . LEU A 1 351 ? 35.898 11.383  -10.607 1.00 12.17 ? 348 LEU A CA    1 
ATOM   2733 C  C     . LEU A 1 351 ? 36.167 11.869  -12.032 1.00 16.63 ? 348 LEU A C     1 
ATOM   2734 O  O     . LEU A 1 351 ? 37.120 11.428  -12.680 1.00 12.10 ? 348 LEU A O     1 
ATOM   2735 C  CB    . LEU A 1 351 ? 34.777 10.350  -10.595 1.00 13.98 ? 348 LEU A CB    1 
ATOM   2736 C  CG    . LEU A 1 351 ? 35.027 9.037   -11.352 1.00 18.75 ? 348 LEU A CG    1 
ATOM   2737 C  CD1   . LEU A 1 351 ? 36.294 8.341   -10.835 1.00 17.49 ? 348 LEU A CD1   1 
ATOM   2738 C  CD2   . LEU A 1 351 ? 33.824 8.102   -11.257 1.00 17.36 ? 348 LEU A CD2   1 
ATOM   2739 N  N     . GLU A 1 352 ? 35.332 12.783  -12.520 1.00 14.86 ? 349 GLU A N     1 
ATOM   2740 C  CA    . GLU A 1 352 ? 35.521 13.331  -13.864 1.00 13.89 ? 349 GLU A CA    1 
ATOM   2741 C  C     . GLU A 1 352 ? 36.880 13.982  -13.990 1.00 14.07 ? 349 GLU A C     1 
ATOM   2742 O  O     . GLU A 1 352 ? 37.582 13.832  -14.998 1.00 13.89 ? 349 GLU A O     1 
ATOM   2743 C  CB    . GLU A 1 352 ? 34.448 14.378  -14.202 1.00 13.00 ? 349 GLU A CB    1 
ATOM   2744 C  CG    . GLU A 1 352 ? 34.790 15.140  -15.477 1.00 21.79 ? 349 GLU A CG    1 
ATOM   2745 C  CD    . GLU A 1 352 ? 33.663 16.031  -15.990 1.00 32.60 ? 349 GLU A CD    1 
ATOM   2746 O  OE1   . GLU A 1 352 ? 33.900 16.763  -16.979 1.00 35.83 ? 349 GLU A OE1   1 
ATOM   2747 O  OE2   . GLU A 1 352 ? 32.546 15.997  -15.422 1.00 30.19 ? 349 GLU A OE2   1 
ATOM   2748 N  N     . GLU A 1 353 ? 37.242 14.724  -12.956 1.00 14.99 ? 350 GLU A N     1 
ATOM   2749 C  CA    . GLU A 1 353 ? 38.508 15.438  -12.922 1.00 15.98 ? 350 GLU A CA    1 
ATOM   2750 C  C     . GLU A 1 353 ? 39.685 14.468  -13.003 1.00 16.15 ? 350 GLU A C     1 
ATOM   2751 O  O     . GLU A 1 353 ? 40.610 14.650  -13.797 1.00 15.31 ? 350 GLU A O     1 
ATOM   2752 C  CB    . GLU A 1 353 ? 38.579 16.238  -11.625 1.00 20.97 ? 350 GLU A CB    1 
ATOM   2753 C  CG    . GLU A 1 353 ? 39.802 17.097  -11.467 1.00 27.39 ? 350 GLU A CG    1 
ATOM   2754 C  CD    . GLU A 1 353 ? 39.597 18.143  -10.389 1.00 37.13 ? 350 GLU A CD    1 
ATOM   2755 O  OE1   . GLU A 1 353 ? 39.497 17.755  -9.204  1.00 42.60 ? 350 GLU A OE1   1 
ATOM   2756 O  OE2   . GLU A 1 353 ? 39.505 19.343  -10.731 1.00 42.48 ? 350 GLU A OE2   1 
ATOM   2757 N  N     . ARG A 1 354 ? 39.646 13.437  -12.169 1.00 13.38 ? 351 ARG A N     1 
ATOM   2758 C  CA    . ARG A 1 354 ? 40.720 12.456  -12.148 1.00 15.59 ? 351 ARG A CA    1 
ATOM   2759 C  C     . ARG A 1 354 ? 40.771 11.653  -13.441 1.00 16.53 ? 351 ARG A C     1 
ATOM   2760 O  O     . ARG A 1 354 ? 41.859 11.352  -13.942 1.00 11.78 ? 351 ARG A O     1 
ATOM   2761 C  CB    . ARG A 1 354 ? 40.588 11.539  -10.933 1.00 15.01 ? 351 ARG A CB    1 
ATOM   2762 C  CG    . ARG A 1 354 ? 40.994 12.238  -9.643  1.00 13.65 ? 351 ARG A CG    1 
ATOM   2763 C  CD    . ARG A 1 354 ? 40.552 11.467  -8.426  1.00 18.52 ? 351 ARG A CD    1 
ATOM   2764 N  NE    . ARG A 1 354 ? 41.099 10.118  -8.375  1.00 14.74 ? 351 ARG A NE    1 
ATOM   2765 C  CZ    . ARG A 1 354 ? 40.662 9.199   -7.522  1.00 20.21 ? 351 ARG A CZ    1 
ATOM   2766 N  NH1   . ARG A 1 354 ? 39.679 9.505   -6.667  1.00 21.39 ? 351 ARG A NH1   1 
ATOM   2767 N  NH2   . ARG A 1 354 ? 41.193 7.986   -7.520  1.00 14.01 ? 351 ARG A NH2   1 
ATOM   2768 N  N     . LEU A 1 355 ? 39.596 11.321  -13.975 1.00 12.00 ? 352 LEU A N     1 
ATOM   2769 C  CA    . LEU A 1 355 ? 39.490 10.582  -15.229 1.00 15.37 ? 352 LEU A CA    1 
ATOM   2770 C  C     . LEU A 1 355 ? 40.058 11.368  -16.407 1.00 18.20 ? 352 LEU A C     1 
ATOM   2771 O  O     . LEU A 1 355 ? 40.789 10.823  -17.235 1.00 17.29 ? 352 LEU A O     1 
ATOM   2772 C  CB    . LEU A 1 355 ? 38.030 10.209  -15.516 1.00 12.22 ? 352 LEU A CB    1 
ATOM   2773 C  CG    . LEU A 1 355 ? 37.452 8.980   -14.819 1.00 16.37 ? 352 LEU A CG    1 
ATOM   2774 C  CD1   . LEU A 1 355 ? 35.978 8.820   -15.146 1.00 17.72 ? 352 LEU A CD1   1 
ATOM   2775 C  CD2   . LEU A 1 355 ? 38.225 7.743   -15.247 1.00 16.06 ? 352 LEU A CD2   1 
ATOM   2776 N  N     . THR A 1 356 ? 39.701 12.645  -16.498 1.00 15.64 ? 353 THR A N     1 
ATOM   2777 C  CA    . THR A 1 356 ? 40.196 13.477  -17.588 1.00 15.82 ? 353 THR A CA    1 
ATOM   2778 C  C     . THR A 1 356 ? 41.724 13.573  -17.560 1.00 18.34 ? 353 THR A C     1 
ATOM   2779 O  O     . THR A 1 356 ? 42.389 13.430  -18.588 1.00 17.81 ? 353 THR A O     1 
ATOM   2780 C  CB    . THR A 1 356 ? 39.536 14.868  -17.576 1.00 18.07 ? 353 THR A CB    1 
ATOM   2781 O  OG1   . THR A 1 356 ? 38.125 14.707  -17.753 1.00 18.24 ? 353 THR A OG1   1 
ATOM   2782 C  CG2   . THR A 1 356 ? 40.069 15.724  -18.702 1.00 18.95 ? 353 THR A CG2   1 
ATOM   2783 N  N     . LYS A 1 357 ? 42.287 13.792  -16.379 1.00 19.26 ? 354 LYS A N     1 
ATOM   2784 C  CA    . LYS A 1 357 ? 43.734 13.837  -16.257 1.00 18.62 ? 354 LYS A CA    1 
ATOM   2785 C  C     . LYS A 1 357 ? 44.344 12.489  -16.636 1.00 18.24 ? 354 LYS A C     1 
ATOM   2786 O  O     . LYS A 1 357 ? 45.360 12.426  -17.337 1.00 17.97 ? 354 LYS A O     1 
ATOM   2787 C  CB    . LYS A 1 357 ? 44.156 14.231  -14.840 1.00 19.04 ? 354 LYS A CB    1 
ATOM   2788 C  CG    . LYS A 1 357 ? 45.658 14.376  -14.699 1.00 28.01 ? 354 LYS A CG    1 
ATOM   2789 C  CD    . LYS A 1 357 ? 46.020 15.343  -13.584 1.00 34.47 ? 354 LYS A CD    1 
ATOM   2790 C  CE    . LYS A 1 357 ? 47.432 15.870  -13.773 1.00 38.97 ? 354 LYS A CE    1 
ATOM   2791 N  NZ    . LYS A 1 357 ? 48.387 14.749  -13.950 1.00 36.00 ? 354 LYS A NZ    1 
ATOM   2792 N  N     . ASP A 1 358 ? 43.707 11.412  -16.190 1.00 15.63 ? 355 ASP A N     1 
ATOM   2793 C  CA    . ASP A 1 358 ? 44.197 10.073  -16.504 1.00 18.06 ? 355 ASP A CA    1 
ATOM   2794 C  C     . ASP A 1 358 ? 44.227 9.854   -18.009 1.00 20.43 ? 355 ASP A C     1 
ATOM   2795 O  O     . ASP A 1 358 ? 45.198 9.313   -18.534 1.00 21.15 ? 355 ASP A O     1 
ATOM   2796 C  CB    . ASP A 1 358 ? 43.347 8.992   -15.839 1.00 16.42 ? 355 ASP A CB    1 
ATOM   2797 C  CG    . ASP A 1 358 ? 43.889 7.585   -16.095 1.00 19.05 ? 355 ASP A CG    1 
ATOM   2798 O  OD1   . ASP A 1 358 ? 44.837 7.161   -15.391 1.00 18.70 ? 355 ASP A OD1   1 
ATOM   2799 O  OD2   . ASP A 1 358 ? 43.377 6.912   -17.009 1.00 18.32 ? 355 ASP A OD2   1 
ATOM   2800 N  N     . ARG A 1 359 ? 43.167 10.265  -18.702 1.00 14.82 ? 356 ARG A N     1 
ATOM   2801 C  CA    . ARG A 1 359 ? 43.096 10.070  -20.147 1.00 17.17 ? 356 ARG A CA    1 
ATOM   2802 C  C     . ARG A 1 359 ? 44.238 10.791  -20.860 1.00 17.73 ? 356 ARG A C     1 
ATOM   2803 O  O     . ARG A 1 359 ? 44.862 10.234  -21.750 1.00 18.42 ? 356 ARG A O     1 
ATOM   2804 C  CB    . ARG A 1 359 ? 41.739 10.538  -20.695 1.00 21.86 ? 356 ARG A CB    1 
ATOM   2805 C  CG    . ARG A 1 359 ? 41.474 10.145  -22.153 1.00 23.68 ? 356 ARG A CG    1 
ATOM   2806 C  CD    . ARG A 1 359 ? 40.065 10.578  -22.594 1.00 21.64 ? 356 ARG A CD    1 
ATOM   2807 N  NE    . ARG A 1 359 ? 39.923 12.033  -22.510 1.00 26.04 ? 356 ARG A NE    1 
ATOM   2808 C  CZ    . ARG A 1 359 ? 38.780 12.679  -22.287 1.00 26.12 ? 356 ARG A CZ    1 
ATOM   2809 N  NH1   . ARG A 1 359 ? 37.646 12.006  -22.121 1.00 28.06 ? 356 ARG A NH1   1 
ATOM   2810 N  NH2   . ARG A 1 359 ? 38.777 14.008  -22.227 1.00 30.17 ? 356 ARG A NH2   1 
ATOM   2811 N  N     . ASN A 1 360 ? 44.508 12.032  -20.465 1.00 16.22 ? 357 ASN A N     1 
ATOM   2812 C  CA    . ASN A 1 360 ? 45.610 12.807  -21.041 1.00 17.74 ? 357 ASN A CA    1 
ATOM   2813 C  C     . ASN A 1 360 ? 47.012 12.261  -20.739 1.00 23.97 ? 357 ASN A C     1 
ATOM   2814 O  O     . ASN A 1 360 ? 47.882 12.255  -21.613 1.00 21.51 ? 357 ASN A O     1 
ATOM   2815 C  CB    . ASN A 1 360 ? 45.542 14.256  -20.564 1.00 21.43 ? 357 ASN A CB    1 
ATOM   2816 C  CG    . ASN A 1 360 ? 44.433 15.033  -21.230 1.00 25.23 ? 357 ASN A CG    1 
ATOM   2817 O  OD1   . ASN A 1 360 ? 44.046 14.739  -22.361 1.00 25.86 ? 357 ASN A OD1   1 
ATOM   2818 N  ND2   . ASN A 1 360 ? 43.927 16.045  -20.542 1.00 27.98 ? 357 ASN A ND2   1 
ATOM   2819 N  N     . ASP A 1 361 ? 47.246 11.845  -19.496 1.00 17.95 ? 358 ASP A N     1 
ATOM   2820 C  CA    . ASP A 1 361 ? 48.571 11.362  -19.111 1.00 20.39 ? 358 ASP A CA    1 
ATOM   2821 C  C     . ASP A 1 361 ? 48.873 9.973   -19.668 1.00 18.69 ? 358 ASP A C     1 
ATOM   2822 O  O     . ASP A 1 361 ? 50.005 9.683   -20.046 1.00 22.23 ? 358 ASP A O     1 
ATOM   2823 C  CB    . ASP A 1 361 ? 48.731 11.313  -17.582 1.00 19.59 ? 358 ASP A CB    1 
ATOM   2824 C  CG    . ASP A 1 361 ? 48.745 12.693  -16.945 1.00 31.85 ? 358 ASP A CG    1 
ATOM   2825 O  OD1   . ASP A 1 361 ? 49.003 13.695  -17.655 1.00 25.34 ? 358 ASP A OD1   1 
ATOM   2826 O  OD2   . ASP A 1 361 ? 48.501 12.766  -15.723 1.00 27.97 ? 358 ASP A OD2   1 
ATOM   2827 N  N     . ASN A 1 362 ? 47.860 9.119   -19.699 1.00 18.13 ? 359 ASN A N     1 
ATOM   2828 C  CA    . ASN A 1 362 ? 48.084 7.683   -19.829 1.00 21.48 ? 359 ASN A CA    1 
ATOM   2829 C  C     . ASN A 1 362 ? 47.439 7.028   -21.046 1.00 19.46 ? 359 ASN A C     1 
ATOM   2830 O  O     . ASN A 1 362 ? 47.494 5.813   -21.194 1.00 19.35 ? 359 ASN A O     1 
ATOM   2831 C  CB    . ASN A 1 362 ? 47.647 6.970   -18.538 1.00 18.98 ? 359 ASN A CB    1 
ATOM   2832 C  CG    . ASN A 1 362 ? 48.440 7.436   -17.312 1.00 20.81 ? 359 ASN A CG    1 
ATOM   2833 O  OD1   . ASN A 1 362 ? 49.654 7.606   -17.372 1.00 18.45 ? 359 ASN A OD1   1 
ATOM   2834 N  ND2   . ASN A 1 362 ? 47.746 7.642   -16.200 1.00 15.56 ? 359 ASN A ND2   1 
ATOM   2835 N  N     . ASP A 1 363 ? 46.816 7.827   -21.906 1.00 20.15 ? 360 ASP A N     1 
ATOM   2836 C  CA    . ASP A 1 363 ? 46.267 7.319   -23.169 1.00 16.22 ? 360 ASP A CA    1 
ATOM   2837 C  C     . ASP A 1 363 ? 45.357 6.127   -23.007 1.00 22.42 ? 360 ASP A C     1 
ATOM   2838 O  O     . ASP A 1 363 ? 45.535 5.114   -23.688 1.00 24.39 ? 360 ASP A O     1 
ATOM   2839 C  CB    . ASP A 1 363 ? 47.396 6.938   -24.129 1.00 23.62 ? 360 ASP A CB    1 
ATOM   2840 C  CG    . ASP A 1 363 ? 48.277 8.109   -24.468 1.00 29.45 ? 360 ASP A CG    1 
ATOM   2841 O  OD1   . ASP A 1 363 ? 47.729 9.185   -24.787 1.00 30.27 ? 360 ASP A OD1   1 
ATOM   2842 O  OD2   . ASP A 1 363 ? 49.512 7.955   -24.395 1.00 33.43 ? 360 ASP A OD2   1 
ATOM   2843 N  N     . ARG A 1 364 ? 44.377 6.247   -22.113 1.00 20.70 ? 361 ARG A N     1 
ATOM   2844 C  CA    . ARG A 1 364 ? 43.387 5.200   -21.924 1.00 20.17 ? 361 ARG A CA    1 
ATOM   2845 C  C     . ARG A 1 364 ? 42.074 5.822   -21.473 1.00 18.97 ? 361 ARG A C     1 
ATOM   2846 O  O     . ARG A 1 364 ? 42.049 6.961   -20.996 1.00 19.85 ? 361 ARG A O     1 
ATOM   2847 C  CB    . ARG A 1 364 ? 43.871 4.200   -20.876 1.00 20.61 ? 361 ARG A CB    1 
ATOM   2848 C  CG    . ARG A 1 364 ? 44.200 4.855   -19.545 1.00 17.35 ? 361 ARG A CG    1 
ATOM   2849 C  CD    . ARG A 1 364 ? 44.681 3.841   -18.524 1.00 17.76 ? 361 ARG A CD    1 
ATOM   2850 N  NE    . ARG A 1 364 ? 44.747 4.415   -17.182 1.00 17.98 ? 361 ARG A NE    1 
ATOM   2851 C  CZ    . ARG A 1 364 ? 44.954 3.699   -16.081 1.00 19.10 ? 361 ARG A CZ    1 
ATOM   2852 N  NH1   . ARG A 1 364 ? 45.009 4.294   -14.887 1.00 17.03 ? 361 ARG A NH1   1 
ATOM   2853 N  NH2   . ARG A 1 364 ? 45.119 2.392   -16.177 1.00 15.47 ? 361 ARG A NH2   1 
ATOM   2854 N  N     . VAL A 1 365 ? 40.989 5.077   -21.629 1.00 18.33 ? 362 VAL A N     1 
ATOM   2855 C  CA    . VAL A 1 365 ? 39.664 5.544   -21.235 1.00 20.72 ? 362 VAL A CA    1 
ATOM   2856 C  C     . VAL A 1 365 ? 38.903 4.442   -20.502 1.00 22.50 ? 362 VAL A C     1 
ATOM   2857 O  O     . VAL A 1 365 ? 38.892 3.290   -20.940 1.00 22.62 ? 362 VAL A O     1 
ATOM   2858 C  CB    . VAL A 1 365 ? 38.848 6.007   -22.463 1.00 23.60 ? 362 VAL A CB    1 
ATOM   2859 C  CG1   A VAL A 1 365 ? 39.495 7.224   -23.105 0.41 20.88 ? 362 VAL A CG1   1 
ATOM   2860 C  CG1   B VAL A 1 365 ? 39.043 5.042   -23.626 0.59 26.97 ? 362 VAL A CG1   1 
ATOM   2861 C  CG2   A VAL A 1 365 ? 38.711 4.878   -23.469 0.41 27.02 ? 362 VAL A CG2   1 
ATOM   2862 C  CG2   B VAL A 1 365 ? 37.377 6.164   -22.114 0.59 23.30 ? 362 VAL A CG2   1 
ATOM   2863 N  N     . ALA A 1 366 ? 38.275 4.787   -19.380 1.00 18.11 ? 363 ALA A N     1 
ATOM   2864 C  CA    . ALA A 1 366 ? 37.467 3.816   -18.644 1.00 18.22 ? 363 ALA A CA    1 
ATOM   2865 C  C     . ALA A 1 366 ? 36.172 3.519   -19.405 1.00 19.71 ? 363 ALA A C     1 
ATOM   2866 O  O     . ALA A 1 366 ? 35.627 4.401   -20.078 1.00 22.44 ? 363 ALA A O     1 
ATOM   2867 C  CB    . ALA A 1 366 ? 37.144 4.358   -17.252 1.00 16.31 ? 363 ALA A CB    1 
ATOM   2868 N  N     . THR A 1 367 ? 35.652 2.302   -19.288 1.00 16.54 ? 364 THR A N     1 
ATOM   2869 C  CA    . THR A 1 367 ? 34.425 1.986   -20.008 1.00 18.46 ? 364 THR A CA    1 
ATOM   2870 C  C     . THR A 1 367 ? 33.266 1.499   -19.147 1.00 18.27 ? 364 THR A C     1 
ATOM   2871 O  O     . THR A 1 367 ? 32.153 1.311   -19.644 1.00 18.14 ? 364 THR A O     1 
ATOM   2872 C  CB    . THR A 1 367 ? 34.690 0.963   -21.131 1.00 19.75 ? 364 THR A CB    1 
ATOM   2873 O  OG1   . THR A 1 367 ? 34.987 -0.312  -20.553 1.00 19.32 ? 364 THR A OG1   1 
ATOM   2874 C  CG2   . THR A 1 367 ? 35.871 1.417   -21.981 1.00 22.19 ? 364 THR A CG2   1 
ATOM   2875 N  N     . GLN A 1 368 ? 33.521 1.287   -17.862 1.00 17.61 ? 365 GLN A N     1 
ATOM   2876 C  CA    . GLN A 1 368 ? 32.495 0.787   -16.960 1.00 20.93 ? 365 GLN A CA    1 
ATOM   2877 C  C     . GLN A 1 368 ? 32.456 1.665   -15.722 1.00 21.24 ? 365 GLN A C     1 
ATOM   2878 O  O     . GLN A 1 368 ? 33.496 2.005   -15.172 1.00 21.35 ? 365 GLN A O     1 
ATOM   2879 C  CB    . GLN A 1 368 ? 32.771 -0.664  -16.563 1.00 23.37 ? 365 GLN A CB    1 
ATOM   2880 C  CG    . GLN A 1 368 ? 31.648 -1.301  -15.763 1.00 29.85 ? 365 GLN A CG    1 
ATOM   2881 C  CD    . GLN A 1 368 ? 31.846 -2.793  -15.528 1.00 34.59 ? 365 GLN A CD    1 
ATOM   2882 O  OE1   . GLN A 1 368 ? 32.607 -3.201  -14.648 1.00 42.68 ? 365 GLN A OE1   1 
ATOM   2883 N  NE2   . GLN A 1 368 ? 31.154 -3.611  -16.310 1.00 32.96 ? 365 GLN A NE2   1 
ATOM   2884 N  N     . LEU A 1 369 ? 31.255 2.048   -15.309 1.00 18.78 ? 366 LEU A N     1 
ATOM   2885 C  CA    . LEU A 1 369 ? 31.071 2.780   -14.056 1.00 26.13 ? 366 LEU A CA    1 
ATOM   2886 C  C     . LEU A 1 369 ? 30.433 1.850   -13.032 1.00 20.87 ? 366 LEU A C     1 
ATOM   2887 O  O     . LEU A 1 369 ? 29.359 1.291   -13.264 1.00 25.33 ? 366 LEU A O     1 
ATOM   2888 C  CB    . LEU A 1 369 ? 30.190 4.018   -14.262 1.00 17.80 ? 366 LEU A CB    1 
ATOM   2889 C  CG    . LEU A 1 369 ? 29.894 4.875   -13.021 1.00 20.32 ? 366 LEU A CG    1 
ATOM   2890 C  CD1   . LEU A 1 369 ? 31.132 5.667   -12.628 1.00 21.79 ? 366 LEU A CD1   1 
ATOM   2891 C  CD2   . LEU A 1 369 ? 28.713 5.821   -13.268 1.00 24.58 ? 366 LEU A CD2   1 
ATOM   2892 N  N     . VAL A 1 370 ? 31.108 1.668   -11.907 1.00 19.29 ? 367 VAL A N     1 
ATOM   2893 C  CA    . VAL A 1 370 ? 30.577 0.853   -10.829 1.00 15.07 ? 367 VAL A CA    1 
ATOM   2894 C  C     . VAL A 1 370 ? 30.044 1.754   -9.717  1.00 20.31 ? 367 VAL A C     1 
ATOM   2895 O  O     . VAL A 1 370 ? 30.707 2.704   -9.312  1.00 19.45 ? 367 VAL A O     1 
ATOM   2896 C  CB    . VAL A 1 370 ? 31.668 -0.072  -10.269 1.00 20.51 ? 367 VAL A CB    1 
ATOM   2897 C  CG1   . VAL A 1 370 ? 31.146 -0.858  -9.073  1.00 22.84 ? 367 VAL A CG1   1 
ATOM   2898 C  CG2   . VAL A 1 370 ? 32.170 -1.007  -11.368 1.00 17.91 ? 367 VAL A CG2   1 
ATOM   2899 N  N     . VAL A 1 371 ? 28.842 1.460   -9.234  1.00 15.93 ? 368 VAL A N     1 
ATOM   2900 C  CA    . VAL A 1 371 ? 28.220 2.279   -8.206  1.00 15.15 ? 368 VAL A CA    1 
ATOM   2901 C  C     . VAL A 1 371 ? 27.916 1.395   -7.031  1.00 19.20 ? 368 VAL A C     1 
ATOM   2902 O  O     . VAL A 1 371 ? 27.287 0.348   -7.182  1.00 20.37 ? 368 VAL A O     1 
ATOM   2903 C  CB    . VAL A 1 371 ? 26.896 2.881   -8.694  1.00 21.96 ? 368 VAL A CB    1 
ATOM   2904 C  CG1   . VAL A 1 371 ? 26.333 3.857   -7.647  1.00 18.22 ? 368 VAL A CG1   1 
ATOM   2905 C  CG2   . VAL A 1 371 ? 27.097 3.577   -10.028 1.00 19.53 ? 368 VAL A CG2   1 
ATOM   2906 N  N     . SER A 1 372 ? 28.369 1.801   -5.852  1.00 17.82 ? 369 SER A N     1 
ATOM   2907 C  CA    . SER A 1 372 ? 28.186 0.980   -4.671  1.00 18.17 ? 369 SER A CA    1 
ATOM   2908 C  C     . SER A 1 372 ? 27.675 1.830   -3.524  1.00 20.45 ? 369 SER A C     1 
ATOM   2909 O  O     . SER A 1 372 ? 28.045 2.998   -3.388  1.00 16.17 ? 369 SER A O     1 
ATOM   2910 C  CB    . SER A 1 372 ? 29.504 0.307   -4.288  1.00 23.31 ? 369 SER A CB    1 
ATOM   2911 O  OG    . SER A 1 372 ? 29.342 -0.520  -3.152  1.00 27.24 ? 369 SER A OG    1 
ATOM   2912 N  N     . ILE A 1 373 ? 26.804 1.249   -2.711  1.00 21.30 ? 370 ILE A N     1 
ATOM   2913 C  CA    . ILE A 1 373 ? 26.269 1.967   -1.564  1.00 20.73 ? 370 ILE A CA    1 
ATOM   2914 C  C     . ILE A 1 373 ? 26.198 1.083   -0.334  1.00 24.31 ? 370 ILE A C     1 
ATOM   2915 O  O     . ILE A 1 373 ? 26.295 -0.146  -0.421  1.00 23.76 ? 370 ILE A O     1 
ATOM   2916 C  CB    . ILE A 1 373 ? 24.868 2.577   -1.837  1.00 21.10 ? 370 ILE A CB    1 
ATOM   2917 C  CG1   . ILE A 1 373 ? 23.815 1.482   -2.006  1.00 24.02 ? 370 ILE A CG1   1 
ATOM   2918 C  CG2   . ILE A 1 373 ? 24.888 3.532   -3.037  1.00 17.94 ? 370 ILE A CG2   1 
ATOM   2919 C  CD1   . ILE A 1 373 ? 22.445 2.031   -2.330  1.00 30.11 ? 370 ILE A CD1   1 
ATOM   2920 N  N     . ARG A 1 374 ? 26.051 1.727   0.819   1.00 22.13 ? 371 ARG A N     1 
ATOM   2921 C  CA    . ARG A 1 374 ? 25.790 1.015   2.053   1.00 26.41 ? 371 ARG A CA    1 
ATOM   2922 C  C     . ARG A 1 374 ? 24.532 1.628   2.645   1.00 29.38 ? 371 ARG A C     1 
ATOM   2923 O  O     . ARG A 1 374 ? 24.296 2.837   2.513   1.00 25.12 ? 371 ARG A O     1 
ATOM   2924 C  CB    . ARG A 1 374 ? 26.970 1.134   3.017   1.00 26.47 ? 371 ARG A CB    1 
ATOM   2925 C  CG    . ARG A 1 374 ? 26.940 0.138   4.172   1.00 30.20 ? 371 ARG A CG    1 
ATOM   2926 C  CD    . ARG A 1 374 ? 28.141 0.330   5.079   1.00 38.30 ? 371 ARG A CD    1 
ATOM   2927 N  NE    . ARG A 1 374 ? 28.132 -0.585  6.217   1.00 48.24 ? 371 ARG A NE    1 
ATOM   2928 C  CZ    . ARG A 1 374 ? 28.891 -0.435  7.299   1.00 51.25 ? 371 ARG A CZ    1 
ATOM   2929 N  NH1   . ARG A 1 374 ? 29.716 0.601   7.397   1.00 43.77 ? 371 ARG A NH1   1 
ATOM   2930 N  NH2   . ARG A 1 374 ? 28.820 -1.315  8.287   1.00 54.89 ? 371 ARG A NH2   1 
ATOM   2931 N  N     . VAL A 1 375 ? 23.709 0.778   3.254   1.00 32.72 ? 372 VAL A N     1 
ATOM   2932 C  CA    . VAL A 1 375 ? 22.493 1.216   3.927   1.00 36.23 ? 372 VAL A CA    1 
ATOM   2933 C  C     . VAL A 1 375 ? 22.631 1.069   5.434   1.00 27.76 ? 372 VAL A C     1 
ATOM   2934 O  O     . VAL A 1 375 ? 23.279 0.140   5.925   1.00 29.83 ? 372 VAL A O     1 
ATOM   2935 C  CB    . VAL A 1 375 ? 21.273 0.413   3.462   1.00 39.05 ? 372 VAL A CB    1 
ATOM   2936 C  CG1   . VAL A 1 375 ? 20.908 0.782   2.034   1.00 38.62 ? 372 VAL A CG1   1 
ATOM   2937 C  CG2   . VAL A 1 375 ? 21.549 -1.074  3.590   1.00 38.78 ? 372 VAL A CG2   1 
ATOM   2938 N  N     . GLN A 1 376 ? 22.030 1.999   6.165   1.00 29.59 ? 373 GLN A N     1 
ATOM   2939 C  CA    . GLN A 1 376 ? 22.095 1.981   7.620   1.00 37.35 ? 373 GLN A CA    1 
ATOM   2940 C  C     . GLN A 1 376 ? 21.659 0.622   8.155   1.00 36.55 ? 373 GLN A C     1 
ATOM   2941 O  O     . GLN A 1 376 ? 20.536 0.190   7.919   1.00 45.15 ? 373 GLN A O     1 
ATOM   2942 C  CB    . GLN A 1 376 ? 21.215 3.086   8.201   1.00 38.60 ? 373 GLN A CB    1 
ATOM   2943 C  CG    . GLN A 1 376 ? 21.623 3.530   9.598   1.00 43.88 ? 373 GLN A CG    1 
ATOM   2944 C  CD    . GLN A 1 376 ? 21.259 4.978   9.867   1.00 44.46 ? 373 GLN A CD    1 
ATOM   2945 O  OE1   . GLN A 1 376 ? 20.097 5.371   9.739   1.00 47.34 ? 373 GLN A OE1   1 
ATOM   2946 N  NE2   . GLN A 1 376 ? 22.258 5.786   10.224  1.00 46.75 ? 373 GLN A NE2   1 
ATOM   2947 N  N     . GLY A 1 377 ? 22.557 -0.056  8.860   1.00 39.11 ? 374 GLY A N     1 
ATOM   2948 C  CA    . GLY A 1 377 ? 22.237 -1.351  9.433   1.00 47.88 ? 374 GLY A CA    1 
ATOM   2949 C  C     . GLY A 1 377 ? 23.209 -2.450  9.045   1.00 52.96 ? 374 GLY A C     1 
ATOM   2950 O  O     . GLY A 1 377 ? 23.589 -3.282  9.873   1.00 44.90 ? 374 GLY A O     1 
ATOM   2951 N  N     . ASP A 1 378 ? 23.623 -2.448  7.782   1.00 45.14 ? 375 ASP A N     1 
ATOM   2952 C  CA    . ASP A 1 378 ? 24.488 -3.498  7.260   1.00 45.85 ? 375 ASP A CA    1 
ATOM   2953 C  C     . ASP A 1 378 ? 25.901 -3.400  7.833   1.00 52.70 ? 375 ASP A C     1 
ATOM   2954 O  O     . ASP A 1 378 ? 26.468 -2.310  7.916   1.00 55.17 ? 375 ASP A O     1 
ATOM   2955 C  CB    . ASP A 1 378 ? 24.529 -3.419  5.735   1.00 47.43 ? 375 ASP A CB    1 
ATOM   2956 C  CG    . ASP A 1 378 ? 25.012 -4.701  5.101   1.00 48.54 ? 375 ASP A CG    1 
ATOM   2957 O  OD1   . ASP A 1 378 ? 25.700 -5.489  5.785   1.00 48.25 ? 375 ASP A OD1   1 
ATOM   2958 O  OD2   . ASP A 1 378 ? 24.699 -4.916  3.915   1.00 47.67 ? 375 ASP A OD2   1 
ATOM   2959 N  N     . LYS A 1 379 ? 26.470 -4.536  8.229   1.00 54.88 ? 376 LYS A N     1 
ATOM   2960 C  CA    . LYS A 1 379 ? 27.824 -4.549  8.782   1.00 63.00 ? 376 LYS A CA    1 
ATOM   2961 C  C     . LYS A 1 379 ? 28.863 -4.777  7.690   1.00 62.90 ? 376 LYS A C     1 
ATOM   2962 O  O     . LYS A 1 379 ? 30.066 -4.800  7.958   1.00 64.62 ? 376 LYS A O     1 
ATOM   2963 C  CB    . LYS A 1 379 ? 27.969 -5.625  9.862   1.00 68.73 ? 376 LYS A CB    1 
ATOM   2964 C  CG    . LYS A 1 379 ? 29.133 -5.377  10.818  1.00 77.63 ? 376 LYS A CG    1 
ATOM   2965 C  CD    . LYS A 1 379 ? 29.771 -6.675  11.291  1.00 77.21 ? 376 LYS A CD    1 
ATOM   2966 C  CE    . LYS A 1 379 ? 30.590 -7.320  10.182  1.00 74.92 ? 376 LYS A CE    1 
ATOM   2967 N  NZ    . LYS A 1 379 ? 31.311 -8.532  10.659  1.00 71.43 ? 376 LYS A NZ    1 
ATOM   2968 N  N     . ARG A 1 380 ? 28.389 -4.951  6.461   1.00 60.34 ? 377 ARG A N     1 
ATOM   2969 C  CA    . ARG A 1 380 ? 29.274 -5.160  5.320   1.00 58.79 ? 377 ARG A CA    1 
ATOM   2970 C  C     . ARG A 1 380 ? 29.716 -3.826  4.728   1.00 55.81 ? 377 ARG A C     1 
ATOM   2971 O  O     . ARG A 1 380 ? 28.943 -2.866  4.705   1.00 55.08 ? 377 ARG A O     1 
ATOM   2972 C  CB    . ARG A 1 380 ? 28.567 -5.993  4.249   1.00 55.09 ? 377 ARG A CB    1 
ATOM   2973 C  CG    . ARG A 1 380 ? 28.026 -7.317  4.757   1.00 58.33 ? 377 ARG A CG    1 
ATOM   2974 C  CD    . ARG A 1 380 ? 27.300 -8.068  3.658   1.00 48.78 ? 377 ARG A CD    1 
ATOM   2975 N  NE    . ARG A 1 380 ? 26.132 -7.340  3.173   1.00 46.58 ? 377 ARG A NE    1 
ATOM   2976 C  CZ    . ARG A 1 380 ? 25.417 -7.714  2.118   1.00 43.26 ? 377 ARG A CZ    1 
ATOM   2977 N  NH1   . ARG A 1 380 ? 25.762 -8.801  1.446   1.00 45.89 ? 377 ARG A NH1   1 
ATOM   2978 N  NH2   . ARG A 1 380 ? 24.367 -7.003  1.732   1.00 42.72 ? 377 ARG A NH2   1 
ATOM   2979 N  N     . LEU A 1 381 ? 30.961 -3.769  4.262   1.00 52.05 ? 378 LEU A N     1 
ATOM   2980 C  CA    . LEU A 1 381 ? 31.457 -2.604  3.544   1.00 50.84 ? 378 LEU A CA    1 
ATOM   2981 C  C     . LEU A 1 381 ? 30.390 -2.159  2.548   1.00 48.70 ? 378 LEU A C     1 
ATOM   2982 O  O     . LEU A 1 381 ? 29.844 -1.060  2.651   1.00 50.31 ? 378 LEU A O     1 
ATOM   2983 C  CB    . LEU A 1 381 ? 32.758 -2.942  2.803   1.00 57.47 ? 378 LEU A CB    1 
ATOM   2984 C  CG    . LEU A 1 381 ? 33.726 -1.824  2.377   1.00 60.88 ? 378 LEU A CG    1 
ATOM   2985 C  CD1   . LEU A 1 381 ? 34.914 -2.401  1.602   1.00 47.95 ? 378 LEU A CD1   1 
ATOM   2986 C  CD2   . LEU A 1 381 ? 33.038 -0.735  1.559   1.00 52.01 ? 378 LEU A CD2   1 
ATOM   2987 N  N     . SER A 1 382 ? 30.087 -3.023  1.586   1.00 51.68 ? 379 SER A N     1 
ATOM   2988 C  CA    . SER A 1 382 ? 29.081 -2.707  0.581   1.00 44.34 ? 379 SER A CA    1 
ATOM   2989 C  C     . SER A 1 382 ? 27.812 -3.514  0.765   1.00 41.56 ? 379 SER A C     1 
ATOM   2990 O  O     . SER A 1 382 ? 27.857 -4.704  1.075   1.00 45.47 ? 379 SER A O     1 
ATOM   2991 C  CB    . SER A 1 382 ? 29.615 -2.940  -0.829  1.00 43.28 ? 379 SER A CB    1 
ATOM   2992 O  OG    . SER A 1 382 ? 28.538 -2.988  -1.755  1.00 36.62 ? 379 SER A OG    1 
ATOM   2993 N  N     . SER A 1 383 ? 26.679 -2.854  0.550   1.00 37.87 ? 380 SER A N     1 
ATOM   2994 C  CA    . SER A 1 383 ? 25.383 -3.510  0.600   1.00 41.19 ? 380 SER A CA    1 
ATOM   2995 C  C     . SER A 1 383 ? 24.960 -3.904  -0.804  1.00 45.86 ? 380 SER A C     1 
ATOM   2996 O  O     . SER A 1 383 ? 24.285 -4.912  -1.000  1.00 41.91 ? 380 SER A O     1 
ATOM   2997 C  CB    . SER A 1 383 ? 24.331 -2.571  1.201   1.00 38.15 ? 380 SER A CB    1 
ATOM   2998 O  OG    . SER A 1 383 ? 24.634 -2.249  2.548   1.00 38.45 ? 380 SER A OG    1 
ATOM   2999 N  N     . LEU A 1 384 ? 25.364 -3.099  -1.781  1.00 40.82 ? 381 LEU A N     1 
ATOM   3000 C  CA    . LEU A 1 384 ? 24.909 -3.281  -3.148  1.00 33.73 ? 381 LEU A CA    1 
ATOM   3001 C  C     . LEU A 1 384 ? 25.881 -2.672  -4.153  1.00 37.84 ? 381 LEU A C     1 
ATOM   3002 O  O     . LEU A 1 384 ? 26.364 -1.554  -3.973  1.00 27.93 ? 381 LEU A O     1 
ATOM   3003 C  CB    . LEU A 1 384 ? 23.525 -2.660  -3.326  1.00 36.05 ? 381 LEU A CB    1 
ATOM   3004 C  CG    . LEU A 1 384 ? 23.001 -2.595  -4.763  1.00 36.40 ? 381 LEU A CG    1 
ATOM   3005 C  CD1   . LEU A 1 384 ? 21.562 -3.075  -4.834  1.00 41.86 ? 381 LEU A CD1   1 
ATOM   3006 C  CD2   . LEU A 1 384 ? 23.125 -1.194  -5.325  1.00 35.29 ? 381 LEU A CD2   1 
ATOM   3007 N  N     . ARG A 1 385 ? 26.152 -3.410  -5.222  1.00 28.06 ? 382 ARG A N     1 
ATOM   3008 C  CA    . ARG A 1 385 ? 27.130 -2.986  -6.208  1.00 26.72 ? 382 ARG A CA    1 
ATOM   3009 C  C     . ARG A 1 385 ? 26.542 -3.271  -7.578  1.00 27.46 ? 382 ARG A C     1 
ATOM   3010 O  O     . ARG A 1 385 ? 26.223 -4.415  -7.897  1.00 32.52 ? 382 ARG A O     1 
ATOM   3011 C  CB    . ARG A 1 385 ? 28.431 -3.768  -6.017  1.00 34.97 ? 382 ARG A CB    1 
ATOM   3012 C  CG    . ARG A 1 385 ? 29.618 -3.227  -6.789  1.00 37.90 ? 382 ARG A CG    1 
ATOM   3013 C  CD    . ARG A 1 385 ? 30.867 -4.075  -6.551  1.00 47.47 ? 382 ARG A CD    1 
ATOM   3014 N  NE    . ARG A 1 385 ? 31.057 -4.412  -5.139  1.00 52.50 ? 382 ARG A NE    1 
ATOM   3015 C  CZ    . ARG A 1 385 ? 32.082 -5.121  -4.665  1.00 55.34 ? 382 ARG A CZ    1 
ATOM   3016 N  NH1   . ARG A 1 385 ? 33.022 -5.571  -5.491  1.00 48.33 ? 382 ARG A NH1   1 
ATOM   3017 N  NH2   . ARG A 1 385 ? 32.169 -5.384  -3.364  1.00 44.89 ? 382 ARG A NH2   1 
ATOM   3018 N  N     . ARG A 1 386 ? 26.374 -2.222  -8.371  1.00 22.20 ? 383 ARG A N     1 
ATOM   3019 C  CA    . ARG A 1 386 ? 25.778 -2.338  -9.689  1.00 25.94 ? 383 ARG A CA    1 
ATOM   3020 C  C     . ARG A 1 386 ? 26.644 -1.593  -10.689 1.00 24.97 ? 383 ARG A C     1 
ATOM   3021 O  O     . ARG A 1 386 ? 27.162 -0.517  -10.395 1.00 20.01 ? 383 ARG A O     1 
ATOM   3022 C  CB    . ARG A 1 386 ? 24.382 -1.728  -9.682  1.00 23.83 ? 383 ARG A CB    1 
ATOM   3023 C  CG    . ARG A 1 386 ? 23.387 -2.453  -8.811  1.00 30.17 ? 383 ARG A CG    1 
ATOM   3024 C  CD    . ARG A 1 386 ? 22.848 -3.666  -9.527  1.00 30.06 ? 383 ARG A CD    1 
ATOM   3025 N  NE    . ARG A 1 386 ? 21.606 -4.139  -8.932  1.00 32.42 ? 383 ARG A NE    1 
ATOM   3026 C  CZ    . ARG A 1 386 ? 21.542 -5.025  -7.946  1.00 36.45 ? 383 ARG A CZ    1 
ATOM   3027 N  NH1   . ARG A 1 386 ? 22.658 -5.538  -7.438  1.00 34.58 ? 383 ARG A NH1   1 
ATOM   3028 N  NH2   . ARG A 1 386 ? 20.360 -5.402  -7.474  1.00 39.71 ? 383 ARG A NH2   1 
ATOM   3029 N  N     . CYS A 1 387 ? 26.801 -2.161  -11.877 1.00 26.14 ? 384 CYS A N     1 
ATOM   3030 C  CA    . CYS A 1 387 ? 27.572 -1.497  -12.919 1.00 22.04 ? 384 CYS A CA    1 
ATOM   3031 C  C     . CYS A 1 387 ? 26.667 -0.926  -14.001 1.00 29.43 ? 384 CYS A C     1 
ATOM   3032 O  O     . CYS A 1 387 ? 25.585 -1.452  -14.258 1.00 31.00 ? 384 CYS A O     1 
ATOM   3033 C  CB    . CYS A 1 387 ? 28.572 -2.471  -13.550 1.00 28.03 ? 384 CYS A CB    1 
ATOM   3034 S  SG    A CYS A 1 387 ? 27.813 -3.815  -14.499 0.67 35.65 ? 384 CYS A SG    1 
ATOM   3035 S  SG    B CYS A 1 387 ? 29.627 -3.311  -12.361 0.33 30.60 ? 384 CYS A SG    1 
ATOM   3036 N  N     . CYS A 1 388 ? 27.116 0.148   -14.639 1.00 25.73 ? 385 CYS A N     1 
ATOM   3037 C  CA    . CYS A 1 388 ? 26.473 0.635   -15.853 1.00 33.49 ? 385 CYS A CA    1 
ATOM   3038 C  C     . CYS A 1 388 ? 27.555 1.094   -16.821 1.00 28.19 ? 385 CYS A C     1 
ATOM   3039 O  O     . CYS A 1 388 ? 28.729 1.166   -16.457 1.00 26.54 ? 385 CYS A O     1 
ATOM   3040 C  CB    . CYS A 1 388 ? 25.488 1.765   -15.545 1.00 27.42 ? 385 CYS A CB    1 
ATOM   3041 S  SG    . CYS A 1 388 ? 26.234 3.278   -14.915 1.00 31.60 ? 385 CYS A SG    1 
ATOM   3042 N  N     . ALA A 1 389 ? 27.171 1.400   -18.053 1.00 25.79 ? 386 ALA A N     1 
ATOM   3043 C  CA    . ALA A 1 389 ? 28.153 1.836   -19.038 1.00 28.25 ? 386 ALA A CA    1 
ATOM   3044 C  C     . ALA A 1 389 ? 28.675 3.230   -18.731 1.00 22.53 ? 386 ALA A C     1 
ATOM   3045 O  O     . ALA A 1 389 ? 27.931 4.106   -18.297 1.00 31.78 ? 386 ALA A O     1 
ATOM   3046 C  CB    . ALA A 1 389 ? 27.573 1.785   -20.445 1.00 31.05 ? 386 ALA A CB    1 
ATOM   3047 N  N     . LEU A 1 390 ? 29.965 3.433   -18.962 1.00 20.46 ? 387 LEU A N     1 
ATOM   3048 C  CA    . LEU A 1 390 ? 30.570 4.745   -18.820 1.00 24.85 ? 387 LEU A CA    1 
ATOM   3049 C  C     . LEU A 1 390 ? 31.015 5.212   -20.195 1.00 25.46 ? 387 LEU A C     1 
ATOM   3050 O  O     . LEU A 1 390 ? 32.094 4.845   -20.658 1.00 24.25 ? 387 LEU A O     1 
ATOM   3051 C  CB    . LEU A 1 390 ? 31.775 4.673   -17.882 1.00 23.78 ? 387 LEU A CB    1 
ATOM   3052 C  CG    . LEU A 1 390 ? 32.223 5.943   -17.156 1.00 25.83 ? 387 LEU A CG    1 
ATOM   3053 C  CD1   . LEU A 1 390 ? 33.410 5.617   -16.253 1.00 21.94 ? 387 LEU A CD1   1 
ATOM   3054 C  CD2   . LEU A 1 390 ? 32.586 7.051   -18.117 1.00 24.38 ? 387 LEU A CD2   1 
ATOM   3055 N  N     . THR A 1 391 ? 30.192 6.035   -20.835 1.00 25.30 ? 388 THR A N     1 
ATOM   3056 C  CA    . THR A 1 391 ? 30.395 6.396   -22.237 1.00 28.29 ? 388 THR A CA    1 
ATOM   3057 C  C     . THR A 1 391 ? 30.975 7.794   -22.450 1.00 30.14 ? 388 THR A C     1 
ATOM   3058 O  O     . THR A 1 391 ? 31.499 8.096   -23.523 1.00 30.96 ? 388 THR A O     1 
ATOM   3059 C  CB    . THR A 1 391 ? 29.066 6.311   -23.005 1.00 32.23 ? 388 THR A CB    1 
ATOM   3060 O  OG1   . THR A 1 391 ? 28.131 7.225   -22.422 1.00 36.12 ? 388 THR A OG1   1 
ATOM   3061 C  CG2   . THR A 1 391 ? 28.495 4.904   -22.928 1.00 28.51 ? 388 THR A CG2   1 
ATOM   3062 N  N     . ARG A 1 392 ? 30.857 8.650   -21.439 1.00 23.71 ? 389 ARG A N     1 
ATOM   3063 C  CA    . ARG A 1 392 ? 31.399 10.004  -21.502 1.00 25.61 ? 389 ARG A CA    1 
ATOM   3064 C  C     . ARG A 1 392 ? 31.915 10.447  -20.139 1.00 23.46 ? 389 ARG A C     1 
ATOM   3065 O  O     . ARG A 1 392 ? 31.305 10.157  -19.115 1.00 28.66 ? 389 ARG A O     1 
ATOM   3066 C  CB    . ARG A 1 392 ? 30.333 11.001  -21.973 1.00 31.69 ? 389 ARG A CB    1 
ATOM   3067 C  CG    . ARG A 1 392 ? 30.206 11.139  -23.482 1.00 36.73 ? 389 ARG A CG    1 
ATOM   3068 C  CD    . ARG A 1 392 ? 29.400 12.385  -23.835 1.00 44.52 ? 389 ARG A CD    1 
ATOM   3069 N  NE    . ARG A 1 392 ? 28.002 12.259  -23.432 1.00 50.84 ? 389 ARG A NE    1 
ATOM   3070 C  CZ    . ARG A 1 392 ? 26.997 12.039  -24.276 1.00 46.56 ? 389 ARG A CZ    1 
ATOM   3071 N  NH1   . ARG A 1 392 ? 27.228 11.929  -25.582 1.00 40.80 ? 389 ARG A NH1   1 
ATOM   3072 N  NH2   . ARG A 1 392 ? 25.756 11.935  -23.814 1.00 46.86 ? 389 ARG A NH2   1 
ATOM   3073 N  N     . TYR A 1 393 ? 33.037 11.155  -20.138 1.00 23.22 ? 390 TYR A N     1 
ATOM   3074 C  CA    . TYR A 1 393 ? 33.584 11.738  -18.919 1.00 21.82 ? 390 TYR A CA    1 
ATOM   3075 C  C     . TYR A 1 393 ? 32.824 13.018  -18.589 1.00 29.24 ? 390 TYR A C     1 
ATOM   3076 O  O     . TYR A 1 393 ? 33.322 14.127  -18.817 1.00 24.22 ? 390 TYR A O     1 
ATOM   3077 C  CB    . TYR A 1 393 ? 35.071 12.048  -19.094 1.00 24.69 ? 390 TYR A CB    1 
ATOM   3078 C  CG    . TYR A 1 393 ? 35.973 10.832  -19.051 1.00 18.83 ? 390 TYR A CG    1 
ATOM   3079 C  CD1   . TYR A 1 393 ? 37.355 10.969  -19.083 1.00 20.12 ? 390 TYR A CD1   1 
ATOM   3080 C  CD2   . TYR A 1 393 ? 35.443 9.550   -18.957 1.00 24.48 ? 390 TYR A CD2   1 
ATOM   3081 C  CE1   . TYR A 1 393 ? 38.188 9.856   -19.036 1.00 19.41 ? 390 TYR A CE1   1 
ATOM   3082 C  CE2   . TYR A 1 393 ? 36.266 8.437   -18.906 1.00 23.65 ? 390 TYR A CE2   1 
ATOM   3083 C  CZ    . TYR A 1 393 ? 37.636 8.596   -18.944 1.00 22.27 ? 390 TYR A CZ    1 
ATOM   3084 O  OH    . TYR A 1 393 ? 38.454 7.484   -18.887 1.00 19.84 ? 390 TYR A OH    1 
ATOM   3085 N  N     . ASP A 1 394 ? 31.606 12.860  -18.082 1.00 25.41 ? 391 ASP A N     1 
ATOM   3086 C  CA    . ASP A 1 394 ? 30.786 14.004  -17.713 1.00 26.12 ? 391 ASP A CA    1 
ATOM   3087 C  C     . ASP A 1 394 ? 30.122 13.748  -16.375 1.00 19.91 ? 391 ASP A C     1 
ATOM   3088 O  O     . ASP A 1 394 ? 29.370 12.783  -16.225 1.00 21.73 ? 391 ASP A O     1 
ATOM   3089 C  CB    . ASP A 1 394 ? 29.725 14.288  -18.774 1.00 27.63 ? 391 ASP A CB    1 
ATOM   3090 C  CG    . ASP A 1 394 ? 28.891 15.508  -18.434 1.00 31.14 ? 391 ASP A CG    1 
ATOM   3091 O  OD1   . ASP A 1 394 ? 27.863 15.350  -17.744 1.00 29.77 ? 391 ASP A OD1   1 
ATOM   3092 O  OD2   . ASP A 1 394 ? 29.280 16.628  -18.833 1.00 41.94 ? 391 ASP A OD2   1 
ATOM   3093 N  N     . ALA A 1 395 ? 30.405 14.613  -15.407 1.00 18.79 ? 392 ALA A N     1 
ATOM   3094 C  CA    . ALA A 1 395 ? 29.974 14.385  -14.028 1.00 22.53 ? 392 ALA A CA    1 
ATOM   3095 C  C     . ALA A 1 395 ? 28.455 14.337  -13.834 1.00 21.07 ? 392 ALA A C     1 
ATOM   3096 O  O     . ALA A 1 395 ? 27.946 13.509  -13.072 1.00 18.45 ? 392 ALA A O     1 
ATOM   3097 C  CB    . ALA A 1 395 ? 30.618 15.404  -13.084 1.00 18.76 ? 392 ALA A CB    1 
ATOM   3098 N  N     . HIS A 1 396 ? 27.730 15.214  -14.520 1.00 22.58 ? 393 HIS A N     1 
ATOM   3099 C  CA    . HIS A 1 396 ? 26.272 15.222  -14.404 1.00 26.67 ? 393 HIS A CA    1 
ATOM   3100 C  C     . HIS A 1 396 ? 25.663 13.935  -14.937 1.00 18.00 ? 393 HIS A C     1 
ATOM   3101 O  O     . HIS A 1 396 ? 24.755 13.362  -14.325 1.00 22.52 ? 393 HIS A O     1 
ATOM   3102 C  CB    . HIS A 1 396 ? 25.667 16.454  -15.089 1.00 24.20 ? 393 HIS A CB    1 
ATOM   3103 C  CG    . HIS A 1 396 ? 25.933 17.733  -14.354 1.00 32.91 ? 393 HIS A CG    1 
ATOM   3104 N  ND1   . HIS A 1 396 ? 26.982 18.570  -14.669 1.00 38.41 ? 393 HIS A ND1   1 
ATOM   3105 C  CD2   . HIS A 1 396 ? 25.309 18.298  -13.294 1.00 37.17 ? 393 HIS A CD2   1 
ATOM   3106 C  CE1   . HIS A 1 396 ? 26.982 19.604  -13.847 1.00 37.89 ? 393 HIS A CE1   1 
ATOM   3107 N  NE2   . HIS A 1 396 ? 25.979 19.462  -13.000 1.00 34.09 ? 393 HIS A NE2   1 
ATOM   3108 N  N     . LYS A 1 397 ? 26.172 13.469  -16.075 1.00 21.17 ? 394 LYS A N     1 
ATOM   3109 C  CA    . LYS A 1 397 ? 25.728 12.189  -16.627 1.00 21.60 ? 394 LYS A CA    1 
ATOM   3110 C  C     . LYS A 1 397 ? 26.070 11.011  -15.732 1.00 21.25 ? 394 LYS A C     1 
ATOM   3111 O  O     . LYS A 1 397 ? 25.245 10.129  -15.507 1.00 23.48 ? 394 LYS A O     1 
ATOM   3112 C  CB    . LYS A 1 397 ? 26.320 11.946  -18.017 1.00 25.58 ? 394 LYS A CB    1 
ATOM   3113 C  CG    . LYS A 1 397 ? 26.103 10.517  -18.516 1.00 31.08 ? 394 LYS A CG    1 
ATOM   3114 C  CD    . LYS A 1 397 ? 26.482 10.362  -19.989 1.00 38.20 ? 394 LYS A CD    1 
ATOM   3115 C  CE    . LYS A 1 397 ? 26.243 8.937   -20.482 1.00 39.56 ? 394 LYS A CE    1 
ATOM   3116 N  NZ    . LYS A 1 397 ? 24.827 8.485   -20.331 1.00 44.22 ? 394 LYS A NZ    1 
ATOM   3117 N  N     . MET A 1 398 ? 27.305 10.971  -15.250 1.00 19.08 ? 395 MET A N     1 
ATOM   3118 C  CA    . MET A 1 398 ? 27.710 9.873   -14.387 1.00 21.47 ? 395 MET A CA    1 
ATOM   3119 C  C     . MET A 1 398 ? 26.863 9.811   -13.119 1.00 20.54 ? 395 MET A C     1 
ATOM   3120 O  O     . MET A 1 398 ? 26.457 8.732   -12.692 1.00 19.93 ? 395 MET A O     1 
ATOM   3121 C  CB    . MET A 1 398 ? 29.199 9.973   -14.059 1.00 19.77 ? 395 MET A CB    1 
ATOM   3122 C  CG    . MET A 1 398 ? 30.079 9.582   -15.235 1.00 18.26 ? 395 MET A CG    1 
ATOM   3123 S  SD    . MET A 1 398 ? 31.799 9.394   -14.758 1.00 27.99 ? 395 MET A SD    1 
ATOM   3124 C  CE    . MET A 1 398 ? 32.278 11.113  -14.635 1.00 18.48 ? 395 MET A CE    1 
ATOM   3125 N  N     . SER A 1 399 ? 26.592 10.970  -12.526 1.00 20.66 ? 396 SER A N     1 
ATOM   3126 C  CA    . SER A 1 399 ? 25.813 11.020  -11.293 1.00 19.84 ? 396 SER A CA    1 
ATOM   3127 C  C     . SER A 1 399 ? 24.346 10.676  -11.556 1.00 21.41 ? 396 SER A C     1 
ATOM   3128 O  O     . SER A 1 399 ? 23.698 10.009  -10.751 1.00 20.10 ? 396 SER A O     1 
ATOM   3129 C  CB    . SER A 1 399 ? 25.941 12.391  -10.617 1.00 20.60 ? 396 SER A CB    1 
ATOM   3130 O  OG    . SER A 1 399 ? 25.437 13.441  -11.434 1.00 26.36 ? 396 SER A OG    1 
ATOM   3131 N  N     . HIS A 1 400 ? 23.830 11.120  -12.695 1.00 22.50 ? 397 HIS A N     1 
ATOM   3132 C  CA    . HIS A 1 400 ? 22.468 10.769  -13.065 1.00 28.55 ? 397 HIS A CA    1 
ATOM   3133 C  C     . HIS A 1 400 ? 22.356 9.254   -13.260 1.00 24.10 ? 397 HIS A C     1 
ATOM   3134 O  O     . HIS A 1 400 ? 21.428 8.617   -12.766 1.00 24.68 ? 397 HIS A O     1 
ATOM   3135 C  CB    . HIS A 1 400 ? 22.035 11.510  -14.329 1.00 30.08 ? 397 HIS A CB    1 
ATOM   3136 C  CG    . HIS A 1 400 ? 20.630 11.208  -14.743 1.00 41.02 ? 397 HIS A CG    1 
ATOM   3137 N  ND1   . HIS A 1 400 ? 20.298 10.103  -15.498 1.00 40.98 ? 397 HIS A ND1   1 
ATOM   3138 C  CD2   . HIS A 1 400 ? 19.468 11.852  -14.487 1.00 42.15 ? 397 HIS A CD2   1 
ATOM   3139 C  CE1   . HIS A 1 400 ? 18.993 10.087  -15.700 1.00 44.52 ? 397 HIS A CE1   1 
ATOM   3140 N  NE2   . HIS A 1 400 ? 18.466 11.138  -15.097 1.00 42.62 ? 397 HIS A NE2   1 
ATOM   3141 N  N     . ASP A 1 401 ? 23.328 8.681   -13.964 1.00 26.57 ? 398 ASP A N     1 
ATOM   3142 C  CA    . ASP A 1 401 ? 23.351 7.241   -14.196 1.00 22.12 ? 398 ASP A CA    1 
ATOM   3143 C  C     . ASP A 1 401 ? 23.465 6.451   -12.905 1.00 26.98 ? 398 ASP A C     1 
ATOM   3144 O  O     . ASP A 1 401 ? 22.790 5.437   -12.728 1.00 28.52 ? 398 ASP A O     1 
ATOM   3145 C  CB    . ASP A 1 401 ? 24.483 6.858   -15.149 1.00 23.60 ? 398 ASP A CB    1 
ATOM   3146 C  CG    . ASP A 1 401 ? 24.222 7.312   -16.569 1.00 31.33 ? 398 ASP A CG    1 
ATOM   3147 O  OD1   . ASP A 1 401 ? 23.068 7.694   -16.863 1.00 30.27 ? 398 ASP A OD1   1 
ATOM   3148 O  OD2   . ASP A 1 401 ? 25.163 7.279   -17.389 1.00 26.97 ? 398 ASP A OD2   1 
ATOM   3149 N  N     . ALA A 1 402 ? 24.328 6.912   -12.006 1.00 25.68 ? 399 ALA A N     1 
ATOM   3150 C  CA    . ALA A 1 402 ? 24.507 6.254   -10.721 1.00 23.54 ? 399 ALA A CA    1 
ATOM   3151 C  C     . ALA A 1 402 ? 23.188 6.244   -9.960  1.00 23.56 ? 399 ALA A C     1 
ATOM   3152 O  O     . ALA A 1 402 ? 22.796 5.233   -9.369  1.00 23.03 ? 399 ALA A O     1 
ATOM   3153 C  CB    . ALA A 1 402 ? 25.590 6.969   -9.909  1.00 19.86 ? 399 ALA A CB    1 
ATOM   3154 N  N     . PHE A 1 403 ? 22.499 7.376   -9.984  1.00 26.80 ? 400 PHE A N     1 
ATOM   3155 C  CA    . PHE A 1 403 ? 21.224 7.484   -9.292  1.00 26.13 ? 400 PHE A CA    1 
ATOM   3156 C  C     . PHE A 1 403 ? 20.227 6.492   -9.871  1.00 29.96 ? 400 PHE A C     1 
ATOM   3157 O  O     . PHE A 1 403 ? 19.578 5.749   -9.141  1.00 32.65 ? 400 PHE A O     1 
ATOM   3158 C  CB    . PHE A 1 403 ? 20.671 8.896   -9.409  1.00 26.74 ? 400 PHE A CB    1 
ATOM   3159 C  CG    . PHE A 1 403 ? 19.380 9.095   -8.678  1.00 37.51 ? 400 PHE A CG    1 
ATOM   3160 C  CD1   . PHE A 1 403 ? 18.209 9.357   -9.372  1.00 41.21 ? 400 PHE A CD1   1 
ATOM   3161 C  CD2   . PHE A 1 403 ? 19.334 9.011   -7.296  1.00 31.59 ? 400 PHE A CD2   1 
ATOM   3162 C  CE1   . PHE A 1 403 ? 17.014 9.541   -8.698  1.00 46.02 ? 400 PHE A CE1   1 
ATOM   3163 C  CE2   . PHE A 1 403 ? 18.147 9.196   -6.617  1.00 42.29 ? 400 PHE A CE2   1 
ATOM   3164 C  CZ    . PHE A 1 403 ? 16.984 9.460   -7.318  1.00 45.73 ? 400 PHE A CZ    1 
ATOM   3165 N  N     . THR A 1 404 ? 20.113 6.483   -11.193 1.00 31.42 ? 401 THR A N     1 
ATOM   3166 C  CA    . THR A 1 404 ? 19.222 5.552   -11.863 1.00 33.54 ? 401 THR A CA    1 
ATOM   3167 C  C     . THR A 1 404 ? 19.444 4.098   -11.390 1.00 31.93 ? 401 THR A C     1 
ATOM   3168 O  O     . THR A 1 404 ? 18.480 3.387   -11.107 1.00 36.87 ? 401 THR A O     1 
ATOM   3169 C  CB    . THR A 1 404 ? 19.399 5.616   -13.389 1.00 29.48 ? 401 THR A CB    1 
ATOM   3170 O  OG1   . THR A 1 404 ? 19.001 6.909   -13.856 1.00 29.11 ? 401 THR A OG1   1 
ATOM   3171 C  CG2   . THR A 1 404 ? 18.553 4.553   -14.074 1.00 37.07 ? 401 THR A CG2   1 
ATOM   3172 N  N     . VAL A 1 405 ? 20.695 3.646   -11.298 1.00 29.64 ? 402 VAL A N     1 
ATOM   3173 C  CA    . VAL A 1 405 ? 20.944 2.235   -10.946 1.00 31.13 ? 402 VAL A CA    1 
ATOM   3174 C  C     . VAL A 1 405 ? 20.705 1.920   -9.480  1.00 29.21 ? 402 VAL A C     1 
ATOM   3175 O  O     . VAL A 1 405 ? 20.531 0.760   -9.120  1.00 34.18 ? 402 VAL A O     1 
ATOM   3176 C  CB    . VAL A 1 405 ? 22.355 1.745   -11.365 1.00 34.92 ? 402 VAL A CB    1 
ATOM   3177 C  CG1   . VAL A 1 405 ? 22.649 2.135   -12.808 1.00 35.45 ? 402 VAL A CG1   1 
ATOM   3178 C  CG2   . VAL A 1 405 ? 23.414 2.284   -10.432 1.00 31.95 ? 402 VAL A CG2   1 
ATOM   3179 N  N     . ILE A 1 406 ? 20.693 2.947   -8.637  1.00 30.90 ? 403 ILE A N     1 
ATOM   3180 C  CA    . ILE A 1 406 ? 20.500 2.723   -7.213  1.00 39.48 ? 403 ILE A CA    1 
ATOM   3181 C  C     . ILE A 1 406 ? 19.102 3.097   -6.728  1.00 35.20 ? 403 ILE A C     1 
ATOM   3182 O  O     . ILE A 1 406 ? 18.697 2.691   -5.638  1.00 38.86 ? 403 ILE A O     1 
ATOM   3183 C  CB    . ILE A 1 406 ? 21.511 3.513   -6.343  1.00 34.31 ? 403 ILE A CB    1 
ATOM   3184 C  CG1   . ILE A 1 406 ? 21.165 5.004   -6.355  1.00 34.45 ? 403 ILE A CG1   1 
ATOM   3185 C  CG2   . ILE A 1 406 ? 22.940 3.241   -6.786  1.00 30.94 ? 403 ILE A CG2   1 
ATOM   3186 C  CD1   . ILE A 1 406 ? 21.870 5.809   -5.275  1.00 32.52 ? 403 ILE A CD1   1 
ATOM   3187 N  N     . LYS A 1 407 ? 18.376 3.870   -7.529  1.00 31.78 ? 404 LYS A N     1 
ATOM   3188 C  CA    . LYS A 1 407 ? 17.106 4.449   -7.090  1.00 40.27 ? 404 LYS A CA    1 
ATOM   3189 C  C     . LYS A 1 407 ? 16.099 3.411   -6.573  1.00 48.28 ? 404 LYS A C     1 
ATOM   3190 O  O     . LYS A 1 407 ? 15.204 3.742   -5.792  1.00 49.57 ? 404 LYS A O     1 
ATOM   3191 C  CB    . LYS A 1 407 ? 16.480 5.297   -8.201  1.00 39.64 ? 404 LYS A CB    1 
ATOM   3192 C  CG    . LYS A 1 407 ? 16.115 4.505   -9.441  1.00 42.59 ? 404 LYS A CG    1 
ATOM   3193 C  CD    . LYS A 1 407 ? 15.582 5.404   -10.549 1.00 47.43 ? 404 LYS A CD    1 
ATOM   3194 C  CE    . LYS A 1 407 ? 15.205 4.587   -11.776 1.00 51.37 ? 404 LYS A CE    1 
ATOM   3195 N  NZ    . LYS A 1 407 ? 14.790 5.450   -12.918 1.00 62.41 ? 404 LYS A NZ    1 
ATOM   3196 N  N     . ASN A 1 408 ? 16.252 2.161   -6.998  1.00 44.36 ? 405 ASN A N     1 
ATOM   3197 C  CA    . ASN A 1 408 ? 15.336 1.099   -6.590  1.00 49.83 ? 405 ASN A CA    1 
ATOM   3198 C  C     . ASN A 1 408 ? 15.591 0.586   -5.179  1.00 47.25 ? 405 ASN A C     1 
ATOM   3199 O  O     . ASN A 1 408 ? 14.830 -0.231  -4.665  1.00 45.67 ? 405 ASN A O     1 
ATOM   3200 C  CB    . ASN A 1 408 ? 15.376 -0.063  -7.584  1.00 51.27 ? 405 ASN A CB    1 
ATOM   3201 C  CG    . ASN A 1 408 ? 14.894 0.338   -8.962  1.00 63.22 ? 405 ASN A CG    1 
ATOM   3202 O  OD1   . ASN A 1 408 ? 15.598 0.156   -9.956  1.00 68.87 ? 405 ASN A OD1   1 
ATOM   3203 N  ND2   . ASN A 1 408 ? 13.689 0.897   -9.027  1.00 62.16 ? 405 ASN A ND2   1 
ATOM   3204 N  N     . CYS A 1 409 ? 16.663 1.060   -4.556  1.00 45.02 ? 406 CYS A N     1 
ATOM   3205 C  CA    . CYS A 1 409 ? 17.000 0.629   -3.205  1.00 49.50 ? 406 CYS A CA    1 
ATOM   3206 C  C     . CYS A 1 409 ? 16.179 1.416   -2.160  1.00 47.13 ? 406 CYS A C     1 
ATOM   3207 O  O     . CYS A 1 409 ? 16.109 1.015   -1.002  1.00 53.38 ? 406 CYS A O     1 
ATOM   3208 C  CB    . CYS A 1 409 ? 18.491 0.809   -2.935  1.00 47.85 ? 406 CYS A CB    1 
ATOM   3209 S  SG    . CYS A 1 409 ? 19.528 -0.286  -3.894  1.00 56.83 ? 406 CYS A SG    1 
ATOM   3210 N  N     . ASN A 1 410 ? 15.565 2.528   -2.574  1.00 41.78 ? 407 ASN A N     1 
ATOM   3211 C  CA    . ASN A 1 410 ? 14.772 3.396   -1.683  1.00 43.46 ? 407 ASN A CA    1 
ATOM   3212 C  C     . ASN A 1 410 ? 13.459 2.738   -1.248  1.00 51.04 ? 407 ASN A C     1 
ATOM   3213 O  O     . ASN A 1 410 ? 12.502 2.661   -2.020  1.00 48.67 ? 407 ASN A O     1 
ATOM   3214 C  CB    . ASN A 1 410 ? 14.502 4.723   -2.384  1.00 43.96 ? 407 ASN A CB    1 
ATOM   3215 C  CG    . ASN A 1 410 ? 13.894 5.743   -1.468  1.00 44.16 ? 407 ASN A CG    1 
ATOM   3216 O  OD1   . ASN A 1 410 ? 13.710 5.487   -0.278  1.00 45.91 ? 407 ASN A OD1   1 
ATOM   3217 N  ND2   . ASN A 1 410 ? 13.583 6.919   -2.011  1.00 45.41 ? 407 ASN A ND2   1 
ATOM   3218 N  N     . THR A 1 411 ? 13.433 2.264   -0.006  1.00 50.25 ? 408 THR A N     1 
ATOM   3219 C  CA    . THR A 1 411 ? 12.255 1.631   0.579   1.00 51.68 ? 408 THR A CA    1 
ATOM   3220 C  C     . THR A 1 411 ? 11.111 2.616   0.768   1.00 54.74 ? 408 THR A C     1 
ATOM   3221 O  O     . THR A 1 411 ? 9.944  2.267   0.588   1.00 60.56 ? 408 THR A O     1 
ATOM   3222 C  CB    . THR A 1 411 ? 12.589 0.984   1.941   1.00 50.44 ? 408 THR A CB    1 
ATOM   3223 O  OG1   . THR A 1 411 ? 13.335 -0.221  1.731   1.00 58.43 ? 408 THR A OG1   1 
ATOM   3224 C  CG2   . THR A 1 411 ? 11.319 0.656   2.709   1.00 64.06 ? 408 THR A CG2   1 
ATOM   3225 N  N     . SER A 1 412 ? 11.457 3.844   1.137   1.00 55.01 ? 409 SER A N     1 
ATOM   3226 C  CA    . SER A 1 412 ? 10.474 4.900   1.344   1.00 57.77 ? 409 SER A CA    1 
ATOM   3227 C  C     . SER A 1 412 ? 9.396  4.880   0.273   1.00 60.91 ? 409 SER A C     1 
ATOM   3228 O  O     . SER A 1 412 ? 9.695  4.847   -0.921  1.00 62.07 ? 409 SER A O     1 
ATOM   3229 C  CB    . SER A 1 412 ? 11.161 6.269   1.346   1.00 56.09 ? 409 SER A CB    1 
ATOM   3230 O  OG    . SER A 1 412 ? 10.222 7.324   1.209   1.00 58.43 ? 409 SER A OG    1 
ATOM   3231 N  N     . GLY A 1 413 ? 8.139  4.897   0.705   1.00 65.56 ? 410 GLY A N     1 
ATOM   3232 C  CA    . GLY A 1 413 ? 7.027  5.005   -0.219  1.00 69.24 ? 410 GLY A CA    1 
ATOM   3233 C  C     . GLY A 1 413 ? 6.960  6.414   -0.774  1.00 71.12 ? 410 GLY A C     1 
ATOM   3234 O  O     . GLY A 1 413 ? 6.371  6.661   -1.828  1.00 62.82 ? 410 GLY A O     1 
ATOM   3235 N  N     . ILE A 1 414 ? 7.581  7.341   -0.049  1.00 69.98 ? 411 ILE A N     1 
ATOM   3236 C  CA    . ILE A 1 414 ? 7.651  8.734   -0.462  1.00 66.11 ? 411 ILE A CA    1 
ATOM   3237 C  C     . ILE A 1 414 ? 8.779  8.938   -1.470  1.00 68.23 ? 411 ILE A C     1 
ATOM   3238 O  O     . ILE A 1 414 ? 9.850  8.340   -1.351  1.00 66.59 ? 411 ILE A O     1 
ATOM   3239 C  CB    . ILE A 1 414 ? 7.864  9.659   0.749   1.00 66.06 ? 411 ILE A CB    1 
ATOM   3240 C  CG1   . ILE A 1 414 ? 7.084  9.134   1.956   1.00 65.45 ? 411 ILE A CG1   1 
ATOM   3241 C  CG2   . ILE A 1 414 ? 7.461  11.088  0.409   1.00 63.57 ? 411 ILE A CG2   1 
ATOM   3242 C  CD1   . ILE A 1 414 ? 7.341  9.897   3.229   1.00 66.13 ? 411 ILE A CD1   1 
ATOM   3243 N  N     . GLN A 1 415 ? 8.528  9.789   -2.459  1.00 73.78 ? 412 GLN A N     1 
ATOM   3244 C  CA    . GLN A 1 415 ? 9.485  10.052  -3.530  1.00 71.58 ? 412 GLN A CA    1 
ATOM   3245 C  C     . GLN A 1 415 ? 10.689 10.824  -3.019  1.00 67.32 ? 412 GLN A C     1 
ATOM   3246 O  O     . GLN A 1 415 ? 11.835 10.531  -3.367  1.00 66.21 ? 412 GLN A O     1 
ATOM   3247 C  CB    . GLN A 1 415 ? 8.800  10.840  -4.652  1.00 73.27 ? 412 GLN A CB    1 
ATOM   3248 C  CG    . GLN A 1 415 ? 9.576  10.896  -5.960  1.00 77.23 ? 412 GLN A CG    1 
ATOM   3249 C  CD    . GLN A 1 415 ? 9.602  9.562   -6.688  1.00 79.77 ? 412 GLN A CD    1 
ATOM   3250 O  OE1   . GLN A 1 415 ? 9.730  8.504   -6.072  1.00 76.83 ? 412 GLN A OE1   1 
ATOM   3251 N  NE2   . GLN A 1 415 ? 9.474  9.610   -8.010  1.00 82.02 ? 412 GLN A NE2   1 
ATOM   3252 N  N     . THR A 1 416 ? 10.411 11.810  -2.179  1.00 62.41 ? 413 THR A N     1 
ATOM   3253 C  CA    . THR A 1 416 ? 11.420 12.737  -1.705  1.00 60.98 ? 413 THR A CA    1 
ATOM   3254 C  C     . THR A 1 416 ? 12.341 12.135  -0.668  1.00 55.61 ? 413 THR A C     1 
ATOM   3255 O  O     . THR A 1 416 ? 13.497 12.532  -0.546  1.00 54.22 ? 413 THR A O     1 
ATOM   3256 C  CB    . THR A 1 416 ? 10.746 13.964  -1.069  1.00 64.10 ? 413 THR A CB    1 
ATOM   3257 O  OG1   . THR A 1 416 ? 9.799  14.520  -1.989  1.00 69.50 ? 413 THR A OG1   1 
ATOM   3258 C  CG2   . THR A 1 416 ? 11.779 15.018  -0.693  1.00 68.29 ? 413 THR A CG2   1 
ATOM   3259 N  N     . GLU A 1 417 ? 11.824 11.183  0.092   1.00 55.42 ? 414 GLU A N     1 
ATOM   3260 C  CA    . GLU A 1 417 ? 12.591 10.630  1.189   1.00 51.73 ? 414 GLU A CA    1 
ATOM   3261 C  C     . GLU A 1 417 ? 13.381 9.426   0.797   1.00 51.97 ? 414 GLU A C     1 
ATOM   3262 O  O     . GLU A 1 417 ? 13.055 8.726   -0.165  1.00 51.17 ? 414 GLU A O     1 
ATOM   3263 C  CB    . GLU A 1 417 ? 11.675 10.274  2.367   1.00 53.55 ? 414 GLU A CB    1 
ATOM   3264 C  CG    . GLU A 1 417 ? 10.741 11.396  2.805   1.00 58.23 ? 414 GLU A CG    1 
ATOM   3265 C  CD    . GLU A 1 417 ? 11.479 12.672  3.154   1.00 55.68 ? 414 GLU A CD    1 
ATOM   3266 O  OE1   . GLU A 1 417 ? 12.146 12.712  4.214   1.00 47.34 ? 414 GLU A OE1   1 
ATOM   3267 O  OE2   . GLU A 1 417 ? 11.394 13.631  2.357   1.00 57.51 ? 414 GLU A OE2   1 
ATOM   3268 N  N     . TRP A 1 418 ? 14.428 9.182   1.566   1.00 37.39 ? 415 TRP A N     1 
ATOM   3269 C  CA    . TRP A 1 418 ? 15.238 8.026   1.310   1.00 40.16 ? 415 TRP A CA    1 
ATOM   3270 C  C     . TRP A 1 418 ? 15.362 7.130   2.522   1.00 42.93 ? 415 TRP A C     1 
ATOM   3271 O  O     . TRP A 1 418 ? 15.883 7.532   3.562   1.00 40.51 ? 415 TRP A O     1 
ATOM   3272 C  CB    . TRP A 1 418 ? 16.632 8.426   0.808   1.00 38.01 ? 415 TRP A CB    1 
ATOM   3273 C  CG    . TRP A 1 418 ? 17.299 7.310   0.086   1.00 33.94 ? 415 TRP A CG    1 
ATOM   3274 C  CD1   . TRP A 1 418 ? 17.828 6.183   0.635   1.00 32.75 ? 415 TRP A CD1   1 
ATOM   3275 C  CD2   . TRP A 1 418 ? 17.482 7.193   -1.327  1.00 31.78 ? 415 TRP A CD2   1 
ATOM   3276 N  NE1   . TRP A 1 418 ? 18.338 5.371   -0.347  1.00 35.95 ? 415 TRP A NE1   1 
ATOM   3277 C  CE2   . TRP A 1 418 ? 18.137 5.970   -1.563  1.00 36.16 ? 415 TRP A CE2   1 
ATOM   3278 C  CE3   . TRP A 1 418 ? 17.158 8.007   -2.417  1.00 36.85 ? 415 TRP A CE3   1 
ATOM   3279 C  CZ2   . TRP A 1 418 ? 18.478 5.539   -2.841  1.00 35.25 ? 415 TRP A CZ2   1 
ATOM   3280 C  CZ3   . TRP A 1 418 ? 17.499 7.578   -3.688  1.00 36.94 ? 415 TRP A CZ3   1 
ATOM   3281 C  CH2   . TRP A 1 418 ? 18.154 6.356   -3.888  1.00 31.29 ? 415 TRP A CH2   1 
ATOM   3282 N  N     . SER A 1 419 ? 14.880 5.904   2.380   1.00 44.56 ? 416 SER A N     1 
ATOM   3283 C  CA    . SER A 1 419 ? 14.993 4.944   3.457   1.00 43.13 ? 416 SER A CA    1 
ATOM   3284 C  C     . SER A 1 419 ? 15.325 3.548   2.942   1.00 45.40 ? 416 SER A C     1 
ATOM   3285 O  O     . SER A 1 419 ? 14.913 3.175   1.847   1.00 43.19 ? 416 SER A O     1 
ATOM   3286 C  CB    . SER A 1 419 ? 13.721 4.922   4.314   1.00 50.69 ? 416 SER A CB    1 
ATOM   3287 O  OG    . SER A 1 419 ? 12.579 4.609   3.536   1.00 56.17 ? 416 SER A OG    1 
ATOM   3288 N  N     . PRO A 1 420 ? 16.121 2.795   3.717   1.00 42.43 ? 417 PRO A N     1 
ATOM   3289 C  CA    . PRO A 1 420 ? 16.795 3.367   4.886   1.00 46.23 ? 417 PRO A CA    1 
ATOM   3290 C  C     . PRO A 1 420 ? 17.902 4.304   4.421   1.00 40.81 ? 417 PRO A C     1 
ATOM   3291 O  O     . PRO A 1 420 ? 18.355 4.171   3.285   1.00 42.30 ? 417 PRO A O     1 
ATOM   3292 C  CB    . PRO A 1 420 ? 17.395 2.141   5.579   1.00 43.27 ? 417 PRO A CB    1 
ATOM   3293 C  CG    . PRO A 1 420 ? 17.553 1.135   4.494   1.00 46.48 ? 417 PRO A CG    1 
ATOM   3294 C  CD    . PRO A 1 420 ? 16.404 1.358   3.561   1.00 42.07 ? 417 PRO A CD    1 
ATOM   3295 N  N     . PRO A 1 421 ? 18.325 5.246   5.280   1.00 37.71 ? 418 PRO A N     1 
ATOM   3296 C  CA    . PRO A 1 421 ? 19.349 6.218   4.882   1.00 36.86 ? 418 PRO A CA    1 
ATOM   3297 C  C     . PRO A 1 421 ? 20.637 5.540   4.415   1.00 24.70 ? 418 PRO A C     1 
ATOM   3298 O  O     . PRO A 1 421 ? 20.934 4.411   4.819   1.00 28.19 ? 418 PRO A O     1 
ATOM   3299 C  CB    . PRO A 1 421 ? 19.604 7.013   6.169   1.00 33.54 ? 418 PRO A CB    1 
ATOM   3300 C  CG    . PRO A 1 421 ? 18.364 6.824   6.987   1.00 41.37 ? 418 PRO A CG    1 
ATOM   3301 C  CD    . PRO A 1 421 ? 17.885 5.439   6.672   1.00 43.18 ? 418 PRO A CD    1 
ATOM   3302 N  N     . LEU A 1 422 ? 21.389 6.244   3.574   1.00 28.42 ? 419 LEU A N     1 
ATOM   3303 C  CA    . LEU A 1 422 ? 22.625 5.725   2.995   1.00 26.36 ? 419 LEU A CA    1 
ATOM   3304 C  C     . LEU A 1 422 ? 23.844 6.176   3.799   1.00 22.37 ? 419 LEU A C     1 
ATOM   3305 O  O     . LEU A 1 422 ? 23.994 7.360   4.101   1.00 26.45 ? 419 LEU A O     1 
ATOM   3306 C  CB    . LEU A 1 422 ? 22.760 6.183   1.535   1.00 22.11 ? 419 LEU A CB    1 
ATOM   3307 C  CG    . LEU A 1 422 ? 21.648 5.743   0.579   1.00 29.02 ? 419 LEU A CG    1 
ATOM   3308 C  CD1   . LEU A 1 422 ? 21.965 6.150   -0.863  1.00 22.35 ? 419 LEU A CD1   1 
ATOM   3309 C  CD2   . LEU A 1 422 ? 21.413 4.242   0.684   1.00 27.51 ? 419 LEU A CD2   1 
ATOM   3310 N  N     . THR A 1 423 ? 24.716 5.230   4.138   1.00 24.29 ? 420 THR A N     1 
ATOM   3311 C  CA    . THR A 1 423 ? 25.892 5.533   4.952   1.00 25.79 ? 420 THR A CA    1 
ATOM   3312 C  C     . THR A 1 423 ? 27.206 5.450   4.165   1.00 22.87 ? 420 THR A C     1 
ATOM   3313 O  O     . THR A 1 423 ? 28.290 5.577   4.737   1.00 21.15 ? 420 THR A O     1 
ATOM   3314 C  CB    . THR A 1 423 ? 25.980 4.592   6.153   1.00 25.62 ? 420 THR A CB    1 
ATOM   3315 O  OG1   . THR A 1 423 ? 25.922 3.236   5.689   1.00 29.95 ? 420 THR A OG1   1 
ATOM   3316 C  CG2   . THR A 1 423 ? 24.812 4.852   7.113   1.00 28.28 ? 420 THR A CG2   1 
ATOM   3317 N  N     . MET A 1 424 ? 27.106 5.237   2.857   1.00 17.09 ? 421 MET A N     1 
ATOM   3318 C  CA    . MET A 1 424 ? 28.289 5.234   1.992   1.00 14.97 ? 421 MET A CA    1 
ATOM   3319 C  C     . MET A 1 424 ? 27.860 5.306   0.539   1.00 18.07 ? 421 MET A C     1 
ATOM   3320 O  O     . MET A 1 424 ? 26.865 4.689   0.155   1.00 17.35 ? 421 MET A O     1 
ATOM   3321 C  CB    . MET A 1 424 ? 29.141 3.983   2.233   1.00 17.12 ? 421 MET A CB    1 
ATOM   3322 C  CG    . MET A 1 424 ? 30.431 3.894   1.386   1.00 19.31 ? 421 MET A CG    1 
ATOM   3323 S  SD    . MET A 1 424 ? 30.163 3.183   -0.256  1.00 23.49 ? 421 MET A SD    1 
ATOM   3324 C  CE    . MET A 1 424 ? 29.720 1.509   0.204   1.00 21.03 ? 421 MET A CE    1 
ATOM   3325 N  N     . LEU A 1 425 ? 28.593 6.095   -0.246  1.00 13.64 ? 422 LEU A N     1 
ATOM   3326 C  CA    . LEU A 1 425 ? 28.442 6.148   -1.692  1.00 14.45 ? 422 LEU A CA    1 
ATOM   3327 C  C     . LEU A 1 425 ? 29.824 5.928   -2.284  1.00 16.26 ? 422 LEU A C     1 
ATOM   3328 O  O     . LEU A 1 425 ? 30.840 6.315   -1.688  1.00 14.60 ? 422 LEU A O     1 
ATOM   3329 C  CB    . LEU A 1 425 ? 27.911 7.504   -2.155  1.00 14.48 ? 422 LEU A CB    1 
ATOM   3330 C  CG    . LEU A 1 425 ? 26.520 7.968   -1.714  1.00 16.91 ? 422 LEU A CG    1 
ATOM   3331 C  CD1   . LEU A 1 425 ? 26.250 9.376   -2.252  1.00 18.67 ? 422 LEU A CD1   1 
ATOM   3332 C  CD2   . LEU A 1 425 ? 25.422 6.999   -2.157  1.00 14.69 ? 422 LEU A CD2   1 
ATOM   3333 N  N     . PHE A 1 426 ? 29.860 5.323   -3.461  1.00 13.31 ? 423 PHE A N     1 
ATOM   3334 C  CA    . PHE A 1 426 ? 31.119 4.911   -4.066  1.00 13.80 ? 423 PHE A CA    1 
ATOM   3335 C  C     . PHE A 1 426 ? 30.931 4.855   -5.575  1.00 17.01 ? 423 PHE A C     1 
ATOM   3336 O  O     . PHE A 1 426 ? 30.047 4.151   -6.072  1.00 20.60 ? 423 PHE A O     1 
ATOM   3337 C  CB    . PHE A 1 426 ? 31.516 3.539   -3.505  1.00 17.62 ? 423 PHE A CB    1 
ATOM   3338 C  CG    A PHE A 1 426 ? 32.904 3.097   -3.888  0.43 17.61 ? 423 PHE A CG    1 
ATOM   3339 C  CG    B PHE A 1 426 ? 32.583 2.843   -4.286  0.57 17.59 ? 423 PHE A CG    1 
ATOM   3340 C  CD1   A PHE A 1 426 ? 33.357 1.832   -3.549  0.43 21.11 ? 423 PHE A CD1   1 
ATOM   3341 C  CD1   B PHE A 1 426 ? 33.922 3.085   -4.028  0.57 18.46 ? 423 PHE A CD1   1 
ATOM   3342 C  CD2   A PHE A 1 426 ? 33.761 3.945   -4.576  0.43 17.80 ? 423 PHE A CD2   1 
ATOM   3343 C  CD2   B PHE A 1 426 ? 32.247 1.926   -5.268  0.57 19.90 ? 423 PHE A CD2   1 
ATOM   3344 C  CE1   A PHE A 1 426 ? 34.631 1.419   -3.899  0.43 21.06 ? 423 PHE A CE1   1 
ATOM   3345 C  CE1   B PHE A 1 426 ? 34.907 2.432   -4.745  0.57 19.17 ? 423 PHE A CE1   1 
ATOM   3346 C  CE2   A PHE A 1 426 ? 35.039 3.539   -4.923  0.43 17.16 ? 423 PHE A CE2   1 
ATOM   3347 C  CE2   B PHE A 1 426 ? 33.221 1.269   -5.984  0.57 21.52 ? 423 PHE A CE2   1 
ATOM   3348 C  CZ    A PHE A 1 426 ? 35.474 2.275   -4.586  0.43 18.58 ? 423 PHE A CZ    1 
ATOM   3349 C  CZ    B PHE A 1 426 ? 34.554 1.518   -5.720  0.57 20.05 ? 423 PHE A CZ    1 
ATOM   3350 N  N     . LEU A 1 427 ? 31.724 5.635   -6.299  1.00 14.11 ? 424 LEU A N     1 
ATOM   3351 C  CA    . LEU A 1 427 ? 31.748 5.553   -7.754  1.00 14.24 ? 424 LEU A CA    1 
ATOM   3352 C  C     . LEU A 1 427 ? 33.131 5.123   -8.167  1.00 14.39 ? 424 LEU A C     1 
ATOM   3353 O  O     . LEU A 1 427 ? 34.112 5.680   -7.689  1.00 14.60 ? 424 LEU A O     1 
ATOM   3354 C  CB    . LEU A 1 427 ? 31.451 6.903   -8.394  1.00 12.14 ? 424 LEU A CB    1 
ATOM   3355 C  CG    . LEU A 1 427 ? 30.091 7.531   -8.111  1.00 15.92 ? 424 LEU A CG    1 
ATOM   3356 C  CD1   . LEU A 1 427 ? 30.015 8.897   -8.782  1.00 18.87 ? 424 LEU A CD1   1 
ATOM   3357 C  CD2   . LEU A 1 427 ? 28.963 6.626   -8.584  1.00 16.44 ? 424 LEU A CD2   1 
ATOM   3358 N  N     . CYS A 1 428 ? 33.209 4.144   -9.063  1.00 16.85 ? 425 CYS A N     1 
ATOM   3359 C  CA    . CYS A 1 428 ? 34.496 3.623   -9.511  1.00 14.02 ? 425 CYS A CA    1 
ATOM   3360 C  C     . CYS A 1 428 ? 34.505 3.397   -11.025 1.00 16.60 ? 425 CYS A C     1 
ATOM   3361 O  O     . CYS A 1 428 ? 33.613 2.737   -11.575 1.00 17.89 ? 425 CYS A O     1 
ATOM   3362 C  CB    . CYS A 1 428 ? 34.829 2.324   -8.777  1.00 17.73 ? 425 CYS A CB    1 
ATOM   3363 S  SG    . CYS A 1 428 ? 36.494 1.641   -9.124  1.00 26.11 ? 425 CYS A SG    1 
ATOM   3364 N  N     . ALA A 1 429 ? 35.506 3.961   -11.690 1.00 14.69 ? 426 ALA A N     1 
ATOM   3365 C  CA    . ALA A 1 429 ? 35.664 3.769   -13.119 1.00 17.10 ? 426 ALA A CA    1 
ATOM   3366 C  C     . ALA A 1 429 ? 36.616 2.597   -13.336 1.00 19.33 ? 426 ALA A C     1 
ATOM   3367 O  O     . ALA A 1 429 ? 37.661 2.492   -12.677 1.00 13.18 ? 426 ALA A O     1 
ATOM   3368 C  CB    . ALA A 1 429 ? 36.205 5.024   -13.778 1.00 15.21 ? 426 ALA A CB    1 
ATOM   3369 N  N     . THR A 1 430 ? 36.249 1.718   -14.263 1.00 21.13 ? 427 THR A N     1 
ATOM   3370 C  CA    . THR A 1 430 ? 36.980 0.477   -14.464 1.00 21.55 ? 427 THR A CA    1 
ATOM   3371 C  C     . THR A 1 430 ? 36.966 0.080   -15.935 1.00 21.29 ? 427 THR A C     1 
ATOM   3372 O  O     . THR A 1 430 ? 36.311 0.727   -16.763 1.00 16.15 ? 427 THR A O     1 
ATOM   3373 C  CB    . THR A 1 430 ? 36.330 -0.678  -13.679 1.00 20.41 ? 427 THR A CB    1 
ATOM   3374 O  OG1   . THR A 1 430 ? 35.043 -0.962  -14.241 1.00 25.96 ? 427 THR A OG1   1 
ATOM   3375 C  CG2   . THR A 1 430 ? 36.154 -0.313  -12.203 1.00 23.38 ? 427 THR A CG2   1 
ATOM   3376 N  N     . LYS A 1 431 ? 37.673 -1.005  -16.243 1.00 20.76 ? 428 LYS A N     1 
ATOM   3377 C  CA    . LYS A 1 431 ? 37.686 -1.572  -17.590 1.00 22.88 ? 428 LYS A CA    1 
ATOM   3378 C  C     . LYS A 1 431 ? 38.231 -0.577  -18.610 1.00 18.92 ? 428 LYS A C     1 
ATOM   3379 O  O     . LYS A 1 431 ? 37.537 -0.159  -19.543 1.00 21.52 ? 428 LYS A O     1 
ATOM   3380 C  CB    . LYS A 1 431 ? 36.288 -2.051  -17.980 1.00 20.31 ? 428 LYS A CB    1 
ATOM   3381 C  CG    . LYS A 1 431 ? 35.781 -3.197  -17.109 1.00 30.69 ? 428 LYS A CG    1 
ATOM   3382 C  CD    . LYS A 1 431 ? 34.590 -3.898  -17.761 1.00 39.42 ? 428 LYS A CD    1 
ATOM   3383 C  CE    . LYS A 1 431 ? 34.054 -5.031  -16.895 1.00 43.96 ? 428 LYS A CE    1 
ATOM   3384 N  NZ    . LYS A 1 431 ? 35.109 -6.019  -16.536 1.00 41.92 ? 428 LYS A NZ    1 
ATOM   3385 N  N     . PHE A 1 432 ? 39.486 -0.197  -18.418 1.00 19.68 ? 429 PHE A N     1 
ATOM   3386 C  CA    . PHE A 1 432 ? 40.126 0.760   -19.300 1.00 18.04 ? 429 PHE A CA    1 
ATOM   3387 C  C     . PHE A 1 432 ? 40.457 0.134   -20.646 1.00 25.29 ? 429 PHE A C     1 
ATOM   3388 O  O     . PHE A 1 432 ? 40.721 -1.075  -20.738 1.00 22.85 ? 429 PHE A O     1 
ATOM   3389 C  CB    . PHE A 1 432 ? 41.398 1.305   -18.649 1.00 19.29 ? 429 PHE A CB    1 
ATOM   3390 C  CG    . PHE A 1 432 ? 41.137 2.289   -17.553 1.00 17.49 ? 429 PHE A CG    1 
ATOM   3391 C  CD1   . PHE A 1 432 ? 41.030 3.637   -17.833 1.00 15.75 ? 429 PHE A CD1   1 
ATOM   3392 C  CD2   . PHE A 1 432 ? 40.978 1.865   -16.240 1.00 23.45 ? 429 PHE A CD2   1 
ATOM   3393 C  CE1   . PHE A 1 432 ? 40.777 4.550   -16.831 1.00 15.27 ? 429 PHE A CE1   1 
ATOM   3394 C  CE2   . PHE A 1 432 ? 40.728 2.773   -15.227 1.00 22.85 ? 429 PHE A CE2   1 
ATOM   3395 C  CZ    . PHE A 1 432 ? 40.630 4.122   -15.522 1.00 19.19 ? 429 PHE A CZ    1 
ATOM   3396 N  N     . SER A 1 433 ? 40.430 0.973   -21.680 1.00 23.15 ? 430 SER A N     1 
ATOM   3397 C  CA    . SER A 1 433 ? 40.888 0.618   -23.024 1.00 23.41 ? 430 SER A CA    1 
ATOM   3398 C  C     . SER A 1 433 ? 41.848 1.686   -23.524 1.00 27.03 ? 430 SER A C     1 
ATOM   3399 O  O     . SER A 1 433 ? 41.749 2.851   -23.130 1.00 21.10 ? 430 SER A O     1 
ATOM   3400 C  CB    . SER A 1 433 ? 39.707 0.523   -23.995 1.00 29.41 ? 430 SER A CB    1 
ATOM   3401 O  OG    . SER A 1 433 ? 38.842 -0.545  -23.664 1.00 37.63 ? 430 SER A OG    1 
ATOM   3402 N  N     . ALA A 1 434 ? 42.778 1.295   -24.390 1.00 22.58 ? 431 ALA A N     1 
ATOM   3403 C  CA    . ALA A 1 434 ? 43.728 2.250   -24.936 1.00 24.65 ? 431 ALA A CA    1 
ATOM   3404 C  C     . ALA A 1 434 ? 42.986 3.307   -25.744 1.00 24.85 ? 431 ALA A C     1 
ATOM   3405 O  O     . ALA A 1 434 ? 41.947 3.027   -26.352 1.00 29.45 ? 431 ALA A O     1 
ATOM   3406 C  CB    . ALA A 1 434 ? 44.782 1.550   -25.787 1.00 31.10 ? 431 ALA A CB    1 
ATOM   3407 N  N     . SER A 1 435 ? 43.508 4.528   -25.719 1.00 24.56 ? 432 SER A N     1 
ATOM   3408 C  CA    . SER A 1 435 ? 42.925 5.627   -26.480 1.00 28.26 ? 432 SER A CA    1 
ATOM   3409 C  C     . SER A 1 435 ? 44.036 6.522   -27.002 1.00 33.82 ? 432 SER A C     1 
ATOM   3410 O  O     . SER A 1 435 ? 43.773 7.589   -27.549 1.00 35.01 ? 432 SER A O     1 
ATOM   3411 C  CB    . SER A 1 435 ? 41.969 6.440   -25.609 1.00 28.32 ? 432 SER A CB    1 
ATOM   3412 O  OG    . SER A 1 435 ? 42.669 7.033   -24.527 1.00 38.65 ? 432 SER A OG    1 
ATOM   3413 O  OXT   . SER A 1 435 ? 45.220 6.197   -26.878 1.00 39.71 ? 432 SER A OXT   1 
ATOM   3414 O  "O3'" . DC  B 2 1   ? 27.865 4.798   11.745  1.00 47.69 ? 1   DC  T "O3'" 1 
ATOM   3415 P  P     . DA  B 2 2   ? 28.307 4.413   13.245  1.00 73.03 ? 2   DA  T P     1 
ATOM   3416 O  OP1   . DA  B 2 2   ? 28.432 2.936   13.322  1.00 62.00 ? 2   DA  T OP1   1 
ATOM   3417 O  OP2   . DA  B 2 2   ? 27.419 5.140   14.185  1.00 61.04 ? 2   DA  T OP2   1 
ATOM   3418 O  "O5'" . DA  B 2 2   ? 29.762 5.064   13.388  1.00 50.75 ? 2   DA  T "O5'" 1 
ATOM   3419 C  "C5'" . DA  B 2 2   ? 30.818 4.732   12.498  1.00 45.29 ? 2   DA  T "C5'" 1 
ATOM   3420 C  "C4'" . DA  B 2 2   ? 32.082 5.442   12.946  1.00 43.58 ? 2   DA  T "C4'" 1 
ATOM   3421 O  "O4'" . DA  B 2 2   ? 31.958 6.862   12.679  1.00 43.11 ? 2   DA  T "O4'" 1 
ATOM   3422 C  "C3'" . DA  B 2 2   ? 32.368 5.324   14.441  1.00 43.46 ? 2   DA  T "C3'" 1 
ATOM   3423 O  "O3'" . DA  B 2 2   ? 33.766 5.301   14.664  1.00 41.90 ? 2   DA  T "O3'" 1 
ATOM   3424 C  "C2'" . DA  B 2 2   ? 31.735 6.583   15.023  1.00 43.12 ? 2   DA  T "C2'" 1 
ATOM   3425 C  "C1'" . DA  B 2 2   ? 31.966 7.585   13.896  1.00 40.07 ? 2   DA  T "C1'" 1 
ATOM   3426 N  N9    . DA  B 2 2   ? 30.947 8.630   13.830  1.00 36.25 ? 2   DA  T N9    1 
ATOM   3427 C  C8    . DA  B 2 2   ? 29.683 8.619   14.355  1.00 39.72 ? 2   DA  T C8    1 
ATOM   3428 N  N7    . DA  B 2 2   ? 29.003 9.722   14.127  1.00 36.69 ? 2   DA  T N7    1 
ATOM   3429 C  C5    . DA  B 2 2   ? 29.885 10.508  13.405  1.00 35.09 ? 2   DA  T C5    1 
ATOM   3430 C  C6    . DA  B 2 2   ? 29.785 11.803  12.853  1.00 39.39 ? 2   DA  T C6    1 
ATOM   3431 N  N6    . DA  B 2 2   ? 28.697 12.576  12.946  1.00 41.20 ? 2   DA  T N6    1 
ATOM   3432 N  N1    . DA  B 2 2   ? 30.860 12.278  12.190  1.00 37.78 ? 2   DA  T N1    1 
ATOM   3433 C  C2    . DA  B 2 2   ? 31.956 11.518  12.085  1.00 31.09 ? 2   DA  T C2    1 
ATOM   3434 N  N3    . DA  B 2 2   ? 32.167 10.295  12.563  1.00 35.31 ? 2   DA  T N3    1 
ATOM   3435 C  C4    . DA  B 2 2   ? 31.084 9.848   13.215  1.00 34.97 ? 2   DA  T C4    1 
ATOM   3436 P  P     A DT  B 2 3   ? 34.489 3.928   15.084  0.40 42.58 ? 3   DT  T P     1 
ATOM   3437 P  P     B DT  B 2 3   ? 34.512 3.918   14.996  0.60 42.65 ? 3   DT  T P     1 
ATOM   3438 O  OP1   A DT  B 2 3   ? 33.522 2.825   14.887  0.40 43.15 ? 3   DT  T OP1   1 
ATOM   3439 O  OP1   B DT  B 2 3   ? 33.521 2.999   15.595  0.60 44.08 ? 3   DT  T OP1   1 
ATOM   3440 O  OP2   A DT  B 2 3   ? 35.124 4.132   16.402  0.40 39.62 ? 3   DT  T OP2   1 
ATOM   3441 O  OP2   B DT  B 2 3   ? 35.762 4.241   15.719  0.60 39.41 ? 3   DT  T OP2   1 
ATOM   3442 O  "O5'" A DT  B 2 3   ? 35.654 3.766   14.000  0.40 39.08 ? 3   DT  T "O5'" 1 
ATOM   3443 O  "O5'" B DT  B 2 3   ? 34.920 3.355   13.553  0.60 40.77 ? 3   DT  T "O5'" 1 
ATOM   3444 C  "C5'" A DT  B 2 3   ? 36.564 4.825   13.752  0.40 37.05 ? 3   DT  T "C5'" 1 
ATOM   3445 C  "C5'" B DT  B 2 3   ? 36.237 3.570   13.040  0.60 35.56 ? 3   DT  T "C5'" 1 
ATOM   3446 C  "C4'" A DT  B 2 3   ? 37.396 4.505   12.525  0.40 34.27 ? 3   DT  T "C4'" 1 
ATOM   3447 C  "C4'" B DT  B 2 3   ? 36.365 4.905   12.323  0.60 35.11 ? 3   DT  T "C4'" 1 
ATOM   3448 O  "O4'" A DT  B 2 3   ? 38.470 3.604   12.883  0.40 34.72 ? 3   DT  T "O4'" 1 
ATOM   3449 O  "O4'" B DT  B 2 3   ? 37.776 5.211   12.146  0.60 34.08 ? 3   DT  T "O4'" 1 
ATOM   3450 C  "C3'" A DT  B 2 3   ? 36.603 3.822   11.413  0.40 35.47 ? 3   DT  T "C3'" 1 
ATOM   3451 C  "C3'" B DT  B 2 3   ? 35.716 4.964   10.939  0.60 32.74 ? 3   DT  T "C3'" 1 
ATOM   3452 O  "O3'" A DT  B 2 3   ? 36.663 4.598   10.218  0.40 33.96 ? 3   DT  T "O3'" 1 
ATOM   3453 O  "O3'" B DT  B 2 3   ? 34.894 6.137   10.809  0.60 32.89 ? 3   DT  T "O3'" 1 
ATOM   3454 C  "C2'" A DT  B 2 3   ? 37.256 2.450   11.254  0.40 32.49 ? 3   DT  T "C2'" 1 
ATOM   3455 C  "C2'" B DT  B 2 3   ? 36.914 4.947   9.983   0.60 33.46 ? 3   DT  T "C2'" 1 
ATOM   3456 C  "C1'" A DT  B 2 3   ? 38.646 2.685   11.827  0.40 33.11 ? 3   DT  T "C1'" 1 
ATOM   3457 C  "C1'" B DT  B 2 3   ? 38.045 5.561   10.801  0.60 32.00 ? 3   DT  T "C1'" 1 
ATOM   3458 N  N1    A DT  B 2 3   ? 39.281 1.465   12.385  0.40 36.38 ? 3   DT  T N1    1 
ATOM   3459 N  N1    B DT  B 2 3   ? 39.418 5.050   10.441  0.60 33.41 ? 3   DT  T N1    1 
ATOM   3460 C  C2    A DT  B 2 3   ? 40.522 1.089   11.920  0.40 35.05 ? 3   DT  T C2    1 
ATOM   3461 C  C2    B DT  B 2 3   ? 40.437 5.927   10.091  0.60 31.93 ? 3   DT  T C2    1 
ATOM   3462 O  O2    A DT  B 2 3   ? 41.129 1.705   11.063  0.40 35.13 ? 3   DT  T O2    1 
ATOM   3463 O  O2    B DT  B 2 3   ? 40.312 7.143   10.046  0.60 33.97 ? 3   DT  T O2    1 
ATOM   3464 N  N3    A DT  B 2 3   ? 41.027 -0.047  12.498  0.40 36.52 ? 3   DT  T N3    1 
ATOM   3465 N  N3    B DT  B 2 3   ? 41.636 5.322   9.792   0.60 25.70 ? 3   DT  T N3    1 
ATOM   3466 C  C4    A DT  B 2 3   ? 40.424 -0.819  13.474  0.40 40.10 ? 3   DT  T C4    1 
ATOM   3467 C  C4    B DT  B 2 3   ? 41.914 3.966   9.807   0.60 29.79 ? 3   DT  T C4    1 
ATOM   3468 O  O4    A DT  B 2 3   ? 40.956 -1.824  13.933  0.40 41.27 ? 3   DT  T O4    1 
ATOM   3469 O  O4    B DT  B 2 3   ? 43.018 3.514   9.526   0.60 29.85 ? 3   DT  T O4    1 
ATOM   3470 C  C5    A DT  B 2 3   ? 39.129 -0.367  13.914  0.40 39.46 ? 3   DT  T C5    1 
ATOM   3471 C  C5    B DT  B 2 3   ? 40.814 3.114   10.180  0.60 30.85 ? 3   DT  T C5    1 
ATOM   3472 C  C7    A DT  B 2 3   ? 38.386 -1.132  14.968  0.40 39.81 ? 3   DT  T C7    1 
ATOM   3473 C  C7    B DT  B 2 3   ? 41.005 1.628   10.228  0.60 33.27 ? 3   DT  T C7    1 
ATOM   3474 C  C6    A DT  B 2 3   ? 38.624 0.741   13.358  0.40 36.98 ? 3   DT  T C6    1 
ATOM   3475 C  C6    B DT  B 2 3   ? 39.640 3.686   10.476  0.60 31.33 ? 3   DT  T C6    1 
ATOM   3476 P  P     A DT  B 2 4   ? 35.318 5.225   9.598   0.45 33.81 ? 4   DT  T P     1 
ATOM   3477 P  P     B DT  B 2 4   ? 33.991 6.358   9.491   0.55 31.10 ? 4   DT  T P     1 
ATOM   3478 O  OP1   A DT  B 2 4   ? 34.662 6.028   10.655  0.45 33.20 ? 4   DT  T OP1   1 
ATOM   3479 O  OP1   B DT  B 2 4   ? 33.073 7.487   9.746   0.55 32.48 ? 4   DT  T OP1   1 
ATOM   3480 O  OP2   A DT  B 2 4   ? 34.576 4.134   8.931   0.45 28.23 ? 4   DT  T OP2   1 
ATOM   3481 O  OP2   B DT  B 2 4   ? 33.461 5.045   9.070   0.55 29.55 ? 4   DT  T OP2   1 
ATOM   3482 O  "O5'" A DT  B 2 4   ? 35.855 6.203   8.441   0.45 27.38 ? 4   DT  T "O5'" 1 
ATOM   3483 O  "O5'" B DT  B 2 4   ? 35.050 6.800   8.384   0.55 27.13 ? 4   DT  T "O5'" 1 
ATOM   3484 C  "C5'" A DT  B 2 4   ? 35.983 7.628   8.597   0.45 26.95 ? 4   DT  T "C5'" 1 
ATOM   3485 C  "C5'" B DT  B 2 4   ? 35.933 7.867   8.648   0.55 26.80 ? 4   DT  T "C5'" 1 
ATOM   3486 C  "C4'" . DT  B 2 4   ? 36.691 8.206   7.381   1.00 26.34 ? 4   DT  T "C4'" 1 
ATOM   3487 O  "O4'" . DT  B 2 4   ? 37.943 7.486   7.266   1.00 21.17 ? 4   DT  T "O4'" 1 
ATOM   3488 C  "C3'" . DT  B 2 4   ? 35.968 7.934   6.070   1.00 21.07 ? 4   DT  T "C3'" 1 
ATOM   3489 O  "O3'" A DT  B 2 4   ? 36.350 8.923   5.143   0.45 19.32 ? 4   DT  T "O3'" 1 
ATOM   3490 O  "O3'" B DT  B 2 4   ? 36.350 8.923   5.142   0.55 19.32 ? 4   DT  T "O3'" 1 
ATOM   3491 C  "C2'" . DT  B 2 4   ? 36.507 6.564   5.668   1.00 20.96 ? 4   DT  T "C2'" 1 
ATOM   3492 C  "C1'" . DT  B 2 4   ? 37.964 6.740   6.065   1.00 23.08 ? 4   DT  T "C1'" 1 
ATOM   3493 N  N1    . DT  B 2 4   ? 38.720 5.487   6.342   1.00 20.05 ? 4   DT  T N1    1 
ATOM   3494 C  C2    . DT  B 2 4   ? 40.047 5.459   5.982   1.00 20.99 ? 4   DT  T C2    1 
ATOM   3495 O  O2    . DT  B 2 4   ? 40.601 6.402   5.442   1.00 15.63 ? 4   DT  T O2    1 
ATOM   3496 N  N3    . DT  B 2 4   ? 40.691 4.283   6.271   1.00 22.32 ? 4   DT  T N3    1 
ATOM   3497 C  C4    . DT  B 2 4   ? 40.159 3.160   6.879   1.00 21.67 ? 4   DT  T C4    1 
ATOM   3498 O  O4    . DT  B 2 4   ? 40.844 2.159   7.089   1.00 20.42 ? 4   DT  T O4    1 
ATOM   3499 C  C5    . DT  B 2 4   ? 38.762 3.260   7.239   1.00 28.09 ? 4   DT  T C5    1 
ATOM   3500 C  C7    . DT  B 2 4   ? 38.060 2.109   7.904   1.00 22.69 ? 4   DT  T C7    1 
ATOM   3501 C  C6    . DT  B 2 4   ? 38.119 4.404   6.958   1.00 22.76 ? 4   DT  T C6    1 
ATOM   3502 P  P     . DA  B 2 5   ? 35.701 8.950   3.676   1.00 16.77 ? 5   DA  T P     1 
ATOM   3503 O  OP1   . DA  B 2 5   ? 35.380 10.348  3.352   1.00 16.66 ? 5   DA  T OP1   1 
ATOM   3504 O  OP2   . DA  B 2 5   ? 34.649 7.912   3.618   1.00 15.85 ? 5   DA  T OP2   1 
ATOM   3505 O  "O5'" . DA  B 2 5   ? 36.900 8.454   2.731   1.00 14.14 ? 5   DA  T "O5'" 1 
ATOM   3506 C  "C5'" . DA  B 2 5   ? 38.060 9.275   2.591   1.00 13.66 ? 5   DA  T "C5'" 1 
ATOM   3507 C  "C4'" . DA  B 2 5   ? 39.028 8.641   1.617   1.00 13.30 ? 5   DA  T "C4'" 1 
ATOM   3508 O  "O4'" . DA  B 2 5   ? 39.614 7.436   2.194   1.00 12.78 ? 5   DA  T "O4'" 1 
ATOM   3509 C  "C3'" . DA  B 2 5   ? 38.369 8.217   0.313   1.00 12.41 ? 5   DA  T "C3'" 1 
ATOM   3510 O  "O3'" . DA  B 2 5   ? 39.272 8.474   -0.752  1.00 14.61 ? 5   DA  T "O3'" 1 
ATOM   3511 C  "C2'" . DA  B 2 5   ? 38.180 6.718   0.515   1.00 15.98 ? 5   DA  T "C2'" 1 
ATOM   3512 C  "C1'" . DA  B 2 5   ? 39.461 6.377   1.281   1.00 16.97 ? 5   DA  T "C1'" 1 
ATOM   3513 N  N9    . DA  B 2 5   ? 39.398 5.130   2.040   1.00 15.37 ? 5   DA  T N9    1 
ATOM   3514 C  C8    . DA  B 2 5   ? 38.318 4.618   2.699   1.00 17.18 ? 5   DA  T C8    1 
ATOM   3515 N  N7    . DA  B 2 5   ? 38.565 3.478   3.310   1.00 18.89 ? 5   DA  T N7    1 
ATOM   3516 C  C5    . DA  B 2 5   ? 39.896 3.224   3.032   1.00 17.57 ? 5   DA  T C5    1 
ATOM   3517 C  C6    . DA  B 2 5   ? 40.757 2.163   3.384   1.00 20.02 ? 5   DA  T C6    1 
ATOM   3518 N  N6    . DA  B 2 5   ? 40.377 1.118   4.127   1.00 16.95 ? 5   DA  T N6    1 
ATOM   3519 N  N1    . DA  B 2 5   ? 42.031 2.220   2.941   1.00 18.19 ? 5   DA  T N1    1 
ATOM   3520 C  C2    . DA  B 2 5   ? 42.411 3.265   2.194   1.00 18.84 ? 5   DA  T C2    1 
ATOM   3521 N  N3    . DA  B 2 5   ? 41.688 4.313   1.797   1.00 18.49 ? 5   DA  T N3    1 
ATOM   3522 C  C4    . DA  B 2 5   ? 40.427 4.233   2.252   1.00 15.39 ? 5   DA  T C4    1 
ATOM   3523 P  P     . DT  B 2 6   ? 38.754 8.480   -2.277  1.00 13.95 ? 6   DT  T P     1 
ATOM   3524 O  OP1   . DT  B 2 6   ? 39.886 8.871   -3.128  1.00 14.98 ? 6   DT  T OP1   1 
ATOM   3525 O  OP2   . DT  B 2 6   ? 37.479 9.229   -2.332  1.00 15.85 ? 6   DT  T OP2   1 
ATOM   3526 O  "O5'" . DT  B 2 6   ? 38.381 6.952   -2.544  1.00 16.55 ? 6   DT  T "O5'" 1 
ATOM   3527 C  "C5'" . DT  B 2 6   ? 39.156 6.138   -3.424  1.00 16.36 ? 6   DT  T "C5'" 1 
ATOM   3528 C  "C4'" . DT  B 2 6   ? 40.405 5.533   -2.800  1.00 16.08 ? 6   DT  T "C4'" 1 
ATOM   3529 O  "O4'" . DT  B 2 6   ? 40.094 4.836   -1.575  1.00 16.48 ? 6   DT  T "O4'" 1 
ATOM   3530 C  "C3'" . DT  B 2 6   ? 41.002 4.467   -3.714  1.00 16.10 ? 6   DT  T "C3'" 1 
ATOM   3531 O  "O3'" . DT  B 2 6   ? 42.000 5.069   -4.498  1.00 17.88 ? 6   DT  T "O3'" 1 
ATOM   3532 C  "C2'" . DT  B 2 6   ? 41.587 3.410   -2.779  1.00 23.44 ? 6   DT  T "C2'" 1 
ATOM   3533 C  "C1'" . DT  B 2 6   ? 41.006 3.773   -1.415  1.00 18.65 ? 6   DT  T "C1'" 1 
ATOM   3534 N  N1    . DT  B 2 6   ? 40.296 2.682   -0.728  1.00 18.42 ? 6   DT  T N1    1 
ATOM   3535 C  C2    . DT  B 2 6   ? 41.031 1.606   -0.283  1.00 17.87 ? 6   DT  T C2    1 
ATOM   3536 O  O2    . DT  B 2 6   ? 42.224 1.499   -0.471  1.00 18.13 ? 6   DT  T O2    1 
ATOM   3537 N  N3    . DT  B 2 6   ? 40.307 0.655   0.386   1.00 16.11 ? 6   DT  T N3    1 
ATOM   3538 C  C4    . DT  B 2 6   ? 38.950 0.683   0.652   1.00 22.38 ? 6   DT  T C4    1 
ATOM   3539 O  O4    . DT  B 2 6   ? 38.376 -0.213  1.261   1.00 21.44 ? 6   DT  T O4    1 
ATOM   3540 C  C5    . DT  B 2 6   ? 38.245 1.841   0.173   1.00 21.39 ? 6   DT  T C5    1 
ATOM   3541 C  C7    . DT  B 2 6   ? 36.768 1.945   0.425   1.00 22.55 ? 6   DT  T C7    1 
ATOM   3542 C  C6    . DT  B 2 6   ? 38.940 2.781   -0.482  1.00 17.98 ? 6   DT  T C6    1 
ATOM   3543 P  P     . DG  B 2 7   ? 42.159 4.671   -6.045  1.00 16.18 ? 7   DG  T P     1 
ATOM   3544 O  OP1   . DG  B 2 7   ? 43.312 5.416   -6.582  1.00 18.76 ? 7   DG  T OP1   1 
ATOM   3545 O  OP2   . DG  B 2 7   ? 40.828 4.747   -6.682  1.00 12.64 ? 7   DG  T OP2   1 
ATOM   3546 O  "O5'" . DG  B 2 7   ? 42.489 3.100   -6.001  1.00 17.83 ? 7   DG  T "O5'" 1 
ATOM   3547 C  "C5'" . DG  B 2 7   ? 43.816 2.633   -5.776  1.00 21.54 ? 7   DG  T "C5'" 1 
ATOM   3548 C  "C4'" . DG  B 2 7   ? 43.839 1.114   -5.657  1.00 15.10 ? 7   DG  T "C4'" 1 
ATOM   3549 O  "O4'" . DG  B 2 7   ? 43.152 0.708   -4.452  1.00 17.43 ? 7   DG  T "O4'" 1 
ATOM   3550 C  "C3'" . DG  B 2 7   ? 43.181 0.347   -6.809  1.00 20.82 ? 7   DG  T "C3'" 1 
ATOM   3551 O  "O3'" . DG  B 2 7   ? 44.210 -0.352  -7.483  1.00 22.05 ? 7   DG  T "O3'" 1 
ATOM   3552 C  "C2'" . DG  B 2 7   ? 42.203 -0.596  -6.116  1.00 20.16 ? 7   DG  T "C2'" 1 
ATOM   3553 C  "C1'" . DG  B 2 7   ? 42.685 -0.593  -4.667  1.00 19.19 ? 7   DG  T "C1'" 1 
ATOM   3554 N  N9    . DG  B 2 7   ? 41.616 -0.932  -3.734  1.00 19.16 ? 7   DG  T N9    1 
ATOM   3555 C  C8    . DG  B 2 7   ? 40.411 -0.295  -3.544  1.00 16.06 ? 7   DG  T C8    1 
ATOM   3556 N  N7    . DG  B 2 7   ? 39.664 -0.872  -2.636  1.00 20.63 ? 7   DG  T N7    1 
ATOM   3557 C  C5    . DG  B 2 7   ? 40.419 -1.963  -2.224  1.00 20.76 ? 7   DG  T C5    1 
ATOM   3558 C  C6    . DG  B 2 7   ? 40.135 -2.963  -1.270  1.00 17.36 ? 7   DG  T C6    1 
ATOM   3559 O  O6    . DG  B 2 7   ? 39.120 -3.084  -0.572  1.00 17.57 ? 7   DG  T O6    1 
ATOM   3560 N  N1    . DG  B 2 7   ? 41.177 -3.882  -1.166  1.00 18.09 ? 7   DG  T N1    1 
ATOM   3561 C  C2    . DG  B 2 7   ? 42.350 -3.848  -1.881  1.00 21.00 ? 7   DG  T C2    1 
ATOM   3562 N  N2    . DG  B 2 7   ? 43.243 -4.824  -1.636  1.00 18.09 ? 7   DG  T N2    1 
ATOM   3563 N  N3    . DG  B 2 7   ? 42.628 -2.914  -2.776  1.00 18.09 ? 7   DG  T N3    1 
ATOM   3564 C  C4    . DG  B 2 7   ? 41.621 -2.011  -2.886  1.00 19.47 ? 7   DG  T C4    1 
ATOM   3565 P  P     . DA  B 2 8   ? 43.882 -1.301  -8.745  1.00 20.65 ? 8   DA  T P     1 
ATOM   3566 O  OP1   . DA  B 2 8   ? 44.952 -1.117  -9.728  1.00 19.28 ? 8   DA  T OP1   1 
ATOM   3567 O  OP2   . DA  B 2 8   ? 42.453 -1.149  -9.106  1.00 22.60 ? 8   DA  T OP2   1 
ATOM   3568 O  "O5'" . DA  B 2 8   ? 44.077 -2.781  -8.164  1.00 22.55 ? 8   DA  T "O5'" 1 
ATOM   3569 C  "C5'" . DA  B 2 8   ? 45.341 -3.074  -7.577  1.00 16.91 ? 8   DA  T "C5'" 1 
ATOM   3570 C  "C4'" . DA  B 2 8   ? 45.436 -4.537  -7.188  1.00 22.39 ? 8   DA  T "C4'" 1 
ATOM   3571 O  "O4'" . DA  B 2 8   ? 44.610 -4.754  -6.017  1.00 22.47 ? 8   DA  T "O4'" 1 
ATOM   3572 C  "C3'" . DA  B 2 8   ? 44.955 -5.512  -8.259  1.00 22.29 ? 8   DA  T "C3'" 1 
ATOM   3573 O  "O3'" . DA  B 2 8   ? 45.829 -6.624  -8.313  1.00 21.89 ? 8   DA  T "O3'" 1 
ATOM   3574 C  "C2'" . DA  B 2 8   ? 43.570 -5.926  -7.785  1.00 23.55 ? 8   DA  T "C2'" 1 
ATOM   3575 C  "C1'" . DA  B 2 8   ? 43.684 -5.787  -6.270  1.00 28.47 ? 8   DA  T "C1'" 1 
ATOM   3576 N  N9    . DA  B 2 8   ? 42.400 -5.417  -5.699  1.00 22.86 ? 8   DA  T N9    1 
ATOM   3577 C  C8    . DA  B 2 8   ? 41.614 -4.375  -6.105  1.00 21.82 ? 8   DA  T C8    1 
ATOM   3578 N  N7    . DA  B 2 8   ? 40.495 -4.278  -5.442  1.00 20.16 ? 8   DA  T N7    1 
ATOM   3579 C  C5    . DA  B 2 8   ? 40.550 -5.331  -4.540  1.00 21.05 ? 8   DA  T C5    1 
ATOM   3580 C  C6    . DA  B 2 8   ? 39.657 -5.767  -3.545  1.00 21.83 ? 8   DA  T C6    1 
ATOM   3581 N  N6    . DA  B 2 8   ? 38.489 -5.156  -3.294  1.00 18.84 ? 8   DA  T N6    1 
ATOM   3582 N  N1    . DA  B 2 8   ? 40.011 -6.858  -2.819  1.00 19.51 ? 8   DA  T N1    1 
ATOM   3583 C  C2    . DA  B 2 8   ? 41.181 -7.450  -3.079  1.00 17.53 ? 8   DA  T C2    1 
ATOM   3584 N  N3    . DA  B 2 8   ? 42.103 -7.133  -3.989  1.00 17.85 ? 8   DA  T N3    1 
ATOM   3585 C  C4    . DA  B 2 8   ? 41.720 -6.050  -4.689  1.00 22.96 ? 8   DA  T C4    1 
ATOM   3586 P  P     . DC  B 2 9   ? 45.693 -7.709  -9.492  1.00 27.08 ? 9   DC  T P     1 
ATOM   3587 O  OP1   . DC  B 2 9   ? 47.053 -8.144  -9.859  1.00 24.38 ? 9   DC  T OP1   1 
ATOM   3588 O  OP2   . DC  B 2 9   ? 44.782 -7.164  -10.525 1.00 24.36 ? 9   DC  T OP2   1 
ATOM   3589 O  "O5'" . DC  B 2 9   ? 44.907 -8.914  -8.801  1.00 22.00 ? 9   DC  T "O5'" 1 
ATOM   3590 C  "C5'" . DC  B 2 9   ? 45.478 -9.543  -7.658  1.00 22.42 ? 9   DC  T "C5'" 1 
ATOM   3591 C  "C4'" . DC  B 2 9   ? 44.431 -10.440 -7.044  1.00 23.29 ? 9   DC  T "C4'" 1 
ATOM   3592 O  "O4'" . DC  B 2 9   ? 43.348 -9.626  -6.537  1.00 26.79 ? 9   DC  T "O4'" 1 
ATOM   3593 C  "C3'" . DC  B 2 9   ? 43.787 -11.410 -8.031  1.00 24.08 ? 9   DC  T "C3'" 1 
ATOM   3594 O  "O3'" . DC  B 2 9   ? 43.693 -12.652 -7.389  1.00 31.41 ? 9   DC  T "O3'" 1 
ATOM   3595 C  "C2'" . DC  B 2 9   ? 42.399 -10.822 -8.254  1.00 23.24 ? 9   DC  T "C2'" 1 
ATOM   3596 C  "C1'" . DC  B 2 9   ? 42.145 -10.284 -6.853  1.00 26.22 ? 9   DC  T "C1'" 1 
ATOM   3597 N  N1    . DC  B 2 9   ? 41.022 -9.329  -6.776  1.00 22.97 ? 9   DC  T N1    1 
ATOM   3598 C  C2    . DC  B 2 9   ? 40.089 -9.462  -5.751  1.00 22.77 ? 9   DC  T C2    1 
ATOM   3599 O  O2    . DC  B 2 9   ? 40.233 -10.367 -4.917  1.00 23.12 ? 9   DC  T O2    1 
ATOM   3600 N  N3    . DC  B 2 9   ? 39.055 -8.588  -5.695  1.00 21.17 ? 9   DC  T N3    1 
ATOM   3601 C  C4    . DC  B 2 9   ? 38.934 -7.624  -6.607  1.00 23.85 ? 9   DC  T C4    1 
ATOM   3602 N  N4    . DC  B 2 9   ? 37.893 -6.790  -6.499  1.00 22.36 ? 9   DC  T N4    1 
ATOM   3603 C  C5    . DC  B 2 9   ? 39.874 -7.478  -7.665  1.00 28.28 ? 9   DC  T C5    1 
ATOM   3604 C  C6    . DC  B 2 9   ? 40.895 -8.345  -7.712  1.00 24.52 ? 9   DC  T C6    1 
ATOM   3605 P  P     . DG  B 2 10  ? 43.448 -13.992 -8.238  1.00 32.95 ? 10  DG  T P     1 
ATOM   3606 O  OP1   . DG  B 2 10  ? 44.736 -14.686 -8.359  1.00 31.90 ? 10  DG  T OP1   1 
ATOM   3607 O  OP2   . DG  B 2 10  ? 42.673 -13.639 -9.453  1.00 28.35 ? 10  DG  T OP2   1 
ATOM   3608 O  "O5'" . DG  B 2 10  ? 42.485 -14.850 -7.302  1.00 25.69 ? 10  DG  T "O5'" 1 
ATOM   3609 C  "C5'" . DG  B 2 10  ? 42.523 -14.673 -5.895  1.00 26.82 ? 10  DG  T "C5'" 1 
ATOM   3610 C  "C4'" . DG  B 2 10  ? 41.350 -15.393 -5.267  1.00 25.70 ? 10  DG  T "C4'" 1 
ATOM   3611 O  "O4'" . DG  B 2 10  ? 40.258 -14.462 -5.042  1.00 28.18 ? 10  DG  T "O4'" 1 
ATOM   3612 C  "C3'" . DG  B 2 10  ? 40.787 -16.522 -6.128  1.00 31.10 ? 10  DG  T "C3'" 1 
ATOM   3613 O  "O3'" . DG  B 2 10  ? 40.295 -17.560 -5.273  1.00 34.51 ? 10  DG  T "O3'" 1 
ATOM   3614 C  "C2'" . DG  B 2 10  ? 39.692 -15.803 -6.912  1.00 28.34 ? 10  DG  T "C2'" 1 
ATOM   3615 C  "C1'" . DG  B 2 10  ? 39.177 -14.795 -5.886  1.00 27.13 ? 10  DG  T "C1'" 1 
ATOM   3616 N  N9    . DG  B 2 10  ? 38.663 -13.563 -6.483  1.00 22.70 ? 10  DG  T N9    1 
ATOM   3617 C  C8    . DG  B 2 10  ? 39.258 -12.763 -7.428  1.00 24.29 ? 10  DG  T C8    1 
ATOM   3618 N  N7    . DG  B 2 10  ? 38.539 -11.728 -7.760  1.00 22.02 ? 10  DG  T N7    1 
ATOM   3619 C  C5    . DG  B 2 10  ? 37.393 -11.854 -6.984  1.00 24.27 ? 10  DG  T C5    1 
ATOM   3620 C  C6    . DG  B 2 10  ? 36.244 -11.034 -6.911  1.00 22.90 ? 10  DG  T C6    1 
ATOM   3621 O  O6    . DG  B 2 10  ? 36.010 -9.992  -7.537  1.00 24.56 ? 10  DG  T O6    1 
ATOM   3622 N  N1    . DG  B 2 10  ? 35.319 -11.524 -5.990  1.00 24.96 ? 10  DG  T N1    1 
ATOM   3623 C  C2    . DG  B 2 10  ? 35.479 -12.676 -5.245  1.00 24.35 ? 10  DG  T C2    1 
ATOM   3624 N  N2    . DG  B 2 10  ? 34.480 -13.003 -4.413  1.00 22.66 ? 10  DG  T N2    1 
ATOM   3625 N  N3    . DG  B 2 10  ? 36.551 -13.455 -5.306  1.00 25.06 ? 10  DG  T N3    1 
ATOM   3626 C  C4    . DG  B 2 10  ? 37.460 -12.978 -6.191  1.00 21.93 ? 10  DG  T C4    1 
ATOM   3627 P  P     . DC  B 2 11  ? 39.627 -18.886 -5.897  1.00 33.11 ? 11  DC  T P     1 
ATOM   3628 O  OP1   . DC  B 2 11  ? 40.097 -20.042 -5.113  1.00 36.04 ? 11  DC  T OP1   1 
ATOM   3629 O  OP2   . DC  B 2 11  ? 39.873 -18.888 -7.353  1.00 33.90 ? 11  DC  T OP2   1 
ATOM   3630 O  "O5'" . DC  B 2 11  ? 38.065 -18.648 -5.675  1.00 28.48 ? 11  DC  T "O5'" 1 
ATOM   3631 C  "C5'" . DC  B 2 11  ? 37.538 -18.412 -4.390  1.00 26.55 ? 11  DC  T "C5'" 1 
ATOM   3632 C  "C4'" . DC  B 2 11  ? 36.020 -18.320 -4.455  1.00 27.14 ? 11  DC  T "C4'" 1 
ATOM   3633 O  "O4'" . DC  B 2 11  ? 35.609 -17.041 -5.002  1.00 25.37 ? 11  DC  T "O4'" 1 
ATOM   3634 C  "C3'" . DC  B 2 11  ? 35.315 -19.392 -5.292  1.00 19.19 ? 11  DC  T "C3'" 1 
ATOM   3635 O  "O3'" . DC  B 2 11  ? 34.239 -19.910 -4.502  1.00 16.49 ? 11  DC  T "O3'" 1 
ATOM   3636 C  "C2'" . DC  B 2 11  ? 34.825 -18.641 -6.532  1.00 19.77 ? 11  DC  T "C2'" 1 
ATOM   3637 C  "C1'" . DC  B 2 11  ? 34.624 -17.227 -6.001  1.00 23.48 ? 11  DC  T "C1'" 1 
ATOM   3638 N  N1    . DC  B 2 11  ? 34.823 -16.128 -6.999  1.00 20.72 ? 11  DC  T N1    1 
ATOM   3639 C  C2    . DC  B 2 11  ? 33.817 -15.178 -7.194  1.00 21.64 ? 11  DC  T C2    1 
ATOM   3640 O  O2    . DC  B 2 11  ? 32.768 -15.272 -6.557  1.00 21.37 ? 11  DC  T O2    1 
ATOM   3641 N  N3    . DC  B 2 11  ? 34.007 -14.174 -8.089  1.00 20.98 ? 11  DC  T N3    1 
ATOM   3642 C  C4    . DC  B 2 11  ? 35.144 -14.104 -8.773  1.00 23.38 ? 11  DC  T C4    1 
ATOM   3643 N  N4    . DC  B 2 11  ? 35.272 -13.090 -9.639  1.00 21.45 ? 11  DC  T N4    1 
ATOM   3644 C  C5    . DC  B 2 11  ? 36.191 -15.058 -8.587  1.00 19.21 ? 11  DC  T C5    1 
ATOM   3645 C  C6    . DC  B 2 11  ? 35.990 -16.043 -7.700  1.00 20.78 ? 11  DC  T C6    1 
ATOM   3646 P  P     . DT  B 2 12  ? 33.504 -21.278 -4.924  1.00 18.68 ? 12  DT  T P     1 
ATOM   3647 O  OP1   . DT  B 2 12  ? 32.989 -21.913 -3.688  1.00 19.57 ? 12  DT  T OP1   1 
ATOM   3648 O  OP2   . DT  B 2 12  ? 34.400 -22.021 -5.827  1.00 18.44 ? 12  DT  T OP2   1 
ATOM   3649 O  "O5'" . DT  B 2 12  ? 32.254 -20.775 -5.787  1.00 20.64 ? 12  DT  T "O5'" 1 
ATOM   3650 C  "C5'" . DT  B 2 12  ? 31.159 -20.160 -5.114  1.00 19.23 ? 12  DT  T "C5'" 1 
ATOM   3651 C  "C4'" . DT  B 2 12  ? 30.168 -19.669 -6.141  1.00 21.59 ? 12  DT  T "C4'" 1 
ATOM   3652 O  "O4'" . DT  B 2 12  ? 30.773 -18.558 -6.846  1.00 21.58 ? 12  DT  T "O4'" 1 
ATOM   3653 C  "C3'" . DT  B 2 12  ? 29.836 -20.731 -7.193  1.00 20.46 ? 12  DT  T "C3'" 1 
ATOM   3654 O  "O3'" . DT  B 2 12  ? 28.435 -20.742 -7.490  1.00 22.07 ? 12  DT  T "O3'" 1 
ATOM   3655 C  "C2'" . DT  B 2 12  ? 30.692 -20.313 -8.385  1.00 18.54 ? 12  DT  T "C2'" 1 
ATOM   3656 C  "C1'" . DT  B 2 12  ? 30.597 -18.802 -8.225  1.00 24.18 ? 12  DT  T "C1'" 1 
ATOM   3657 N  N1    . DT  B 2 12  ? 31.583 -18.017 -9.012  1.00 25.89 ? 12  DT  T N1    1 
ATOM   3658 C  C2    . DT  B 2 12  ? 31.190 -16.766 -9.397  1.00 20.11 ? 12  DT  T C2    1 
ATOM   3659 O  O2    . DT  B 2 12  ? 30.106 -16.307 -9.108  1.00 26.94 ? 12  DT  T O2    1 
ATOM   3660 N  N3    . DT  B 2 12  ? 32.106 -16.076 -10.124 1.00 20.33 ? 12  DT  T N3    1 
ATOM   3661 C  C4    . DT  B 2 12  ? 33.359 -16.503 -10.510 1.00 22.43 ? 12  DT  T C4    1 
ATOM   3662 O  O4    . DT  B 2 12  ? 34.083 -15.775 -11.177 1.00 22.40 ? 12  DT  T O4    1 
ATOM   3663 C  C5    . DT  B 2 12  ? 33.720 -17.836 -10.077 1.00 21.82 ? 12  DT  T C5    1 
ATOM   3664 C  C7    . DT  B 2 12  ? 35.055 -18.428 -10.419 1.00 21.85 ? 12  DT  T C7    1 
ATOM   3665 C  C6    . DT  B 2 12  ? 32.820 -18.526 -9.358  1.00 23.41 ? 12  DT  T C6    1 
ATOM   3666 O  "O5'" . DA  C 3 1   ? 29.283 -7.935  -15.147 1.00 41.15 ? 1   DA  P "O5'" 1 
ATOM   3667 C  "C5'" . DA  C 3 1   ? 27.969 -8.182  -15.619 1.00 31.05 ? 1   DA  P "C5'" 1 
ATOM   3668 C  "C4'" . DA  C 3 1   ? 27.086 -8.654  -14.483 1.00 28.65 ? 1   DA  P "C4'" 1 
ATOM   3669 O  "O4'" . DA  C 3 1   ? 27.419 -10.026 -14.155 1.00 32.72 ? 1   DA  P "O4'" 1 
ATOM   3670 C  "C3'" . DA  C 3 1   ? 27.183 -7.850  -13.185 1.00 25.51 ? 1   DA  P "C3'" 1 
ATOM   3671 O  "O3'" . DA  C 3 1   ? 25.888 -7.714  -12.626 1.00 28.11 ? 1   DA  P "O3'" 1 
ATOM   3672 C  "C2'" . DA  C 3 1   ? 28.060 -8.693  -12.271 1.00 29.42 ? 1   DA  P "C2'" 1 
ATOM   3673 C  "C1'" . DA  C 3 1   ? 28.011 -10.100 -12.874 1.00 30.68 ? 1   DA  P "C1'" 1 
ATOM   3674 N  N9    . DA  C 3 1   ? 29.354 -10.664 -12.995 1.00 27.11 ? 1   DA  P N9    1 
ATOM   3675 C  C8    . DA  C 3 1   ? 30.369 -10.260 -13.819 1.00 27.29 ? 1   DA  P C8    1 
ATOM   3676 N  N7    . DA  C 3 1   ? 31.473 -10.966 -13.687 1.00 29.28 ? 1   DA  P N7    1 
ATOM   3677 C  C5    . DA  C 3 1   ? 31.155 -11.893 -12.707 1.00 24.27 ? 1   DA  P C5    1 
ATOM   3678 C  C6    . DA  C 3 1   ? 31.888 -12.932 -12.102 1.00 26.17 ? 1   DA  P C6    1 
ATOM   3679 N  N6    . DA  C 3 1   ? 33.152 -13.226 -12.415 1.00 23.92 ? 1   DA  P N6    1 
ATOM   3680 N  N1    . DA  C 3 1   ? 31.264 -13.666 -11.159 1.00 29.22 ? 1   DA  P N1    1 
ATOM   3681 C  C2    . DA  C 3 1   ? 29.994 -13.377 -10.842 1.00 24.17 ? 1   DA  P C2    1 
ATOM   3682 N  N3    . DA  C 3 1   ? 29.204 -12.430 -11.338 1.00 24.53 ? 1   DA  P N3    1 
ATOM   3683 C  C4    . DA  C 3 1   ? 29.854 -11.719 -12.271 1.00 27.05 ? 1   DA  P C4    1 
ATOM   3684 P  P     . DG  C 3 2   ? 25.565 -6.504  -11.614 1.00 34.34 ? 2   DG  P P     1 
ATOM   3685 O  OP1   . DG  C 3 2   ? 24.110 -6.263  -11.648 1.00 29.12 ? 2   DG  P OP1   1 
ATOM   3686 O  OP2   . DG  C 3 2   ? 26.541 -5.419  -11.869 1.00 31.01 ? 2   DG  P OP2   1 
ATOM   3687 O  "O5'" . DG  C 3 2   ? 25.926 -7.108  -10.184 1.00 27.01 ? 2   DG  P "O5'" 1 
ATOM   3688 C  "C5'" . DG  C 3 2   ? 25.030 -8.039  -9.619  1.00 29.57 ? 2   DG  P "C5'" 1 
ATOM   3689 C  "C4'" . DG  C 3 2   ? 25.699 -8.661  -8.416  1.00 29.14 ? 2   DG  P "C4'" 1 
ATOM   3690 O  "O4'" . DG  C 3 2   ? 26.914 -9.333  -8.817  1.00 24.04 ? 2   DG  P "O4'" 1 
ATOM   3691 C  "C3'" . DG  C 3 2   ? 26.084 -7.667  -7.327  1.00 26.00 ? 2   DG  P "C3'" 1 
ATOM   3692 O  "O3'" . DG  C 3 2   ? 25.357 -8.112  -6.201  1.00 29.31 ? 2   DG  P "O3'" 1 
ATOM   3693 C  "C2'" . DG  C 3 2   ? 27.601 -7.793  -7.196  1.00 25.30 ? 2   DG  P "C2'" 1 
ATOM   3694 C  "C1'" . DG  C 3 2   ? 27.888 -9.156  -7.814  1.00 24.65 ? 2   DG  P "C1'" 1 
ATOM   3695 N  N9    . DG  C 3 2   ? 29.205 -9.301  -8.431  1.00 20.03 ? 2   DG  P N9    1 
ATOM   3696 C  C8    . DG  C 3 2   ? 29.867 -8.427  -9.265  1.00 27.01 ? 2   DG  P C8    1 
ATOM   3697 N  N7    . DG  C 3 2   ? 31.038 -8.867  -9.655  1.00 25.10 ? 2   DG  P N7    1 
ATOM   3698 C  C5    . DG  C 3 2   ? 31.154 -10.119 -9.051  1.00 23.39 ? 2   DG  P C5    1 
ATOM   3699 C  C6    . DG  C 3 2   ? 32.193 -11.085 -9.090  1.00 22.37 ? 2   DG  P C6    1 
ATOM   3700 O  O6    . DG  C 3 2   ? 33.269 -11.045 -9.700  1.00 20.32 ? 2   DG  P O6    1 
ATOM   3701 N  N1    . DG  C 3 2   ? 31.890 -12.212 -8.326  1.00 20.19 ? 2   DG  P N1    1 
ATOM   3702 C  C2    . DG  C 3 2   ? 30.730 -12.384 -7.613  1.00 22.64 ? 2   DG  P C2    1 
ATOM   3703 N  N2    . DG  C 3 2   ? 30.595 -13.532 -6.931  1.00 24.40 ? 2   DG  P N2    1 
ATOM   3704 N  N3    . DG  C 3 2   ? 29.753 -11.492 -7.572  1.00 24.72 ? 2   DG  P N3    1 
ATOM   3705 C  C4    . DG  C 3 2   ? 30.032 -10.391 -8.302  1.00 24.51 ? 2   DG  P C4    1 
ATOM   3706 P  P     . DC  C 3 3   ? 25.571 -7.441  -4.759  1.00 33.50 ? 3   DC  P P     1 
ATOM   3707 O  OP1   . DC  C 3 3   ? 24.299 -7.555  -4.022  1.00 39.95 ? 3   DC  P OP1   1 
ATOM   3708 O  OP2   . DC  C 3 3   ? 26.236 -6.134  -4.945  1.00 33.65 ? 3   DC  P OP2   1 
ATOM   3709 O  "O5'" . DC  C 3 3   ? 26.651 -8.395  -4.066  1.00 37.41 ? 3   DC  P "O5'" 1 
ATOM   3710 C  "C5'" . DC  C 3 3   ? 26.338 -9.759  -3.820  1.00 40.50 ? 3   DC  P "C5'" 1 
ATOM   3711 C  "C4'" . DC  C 3 3   ? 27.571 -10.494 -3.331  1.00 37.68 ? 3   DC  P "C4'" 1 
ATOM   3712 O  "O4'" . DC  C 3 3   ? 28.548 -10.492 -4.399  1.00 35.54 ? 3   DC  P "O4'" 1 
ATOM   3713 C  "C3'" . DC  C 3 3   ? 28.251 -9.875  -2.106  1.00 34.53 ? 3   DC  P "C3'" 1 
ATOM   3714 O  "O3'" . DC  C 3 3   ? 28.083 -10.717 -0.971  1.00 37.89 ? 3   DC  P "O3'" 1 
ATOM   3715 C  "C2'" . DC  C 3 3   ? 29.727 -9.753  -2.485  1.00 34.44 ? 3   DC  P "C2'" 1 
ATOM   3716 C  "C1'" . DC  C 3 3   ? 29.832 -10.499 -3.815  1.00 34.07 ? 3   DC  P "C1'" 1 
ATOM   3717 N  N1    . DC  C 3 3   ? 30.793 -9.842  -4.732  1.00 30.93 ? 3   DC  P N1    1 
ATOM   3718 C  C2    . DC  C 3 3   ? 31.971 -10.514 -5.036  1.00 25.69 ? 3   DC  P C2    1 
ATOM   3719 O  O2    . DC  C 3 3   ? 32.138 -11.631 -4.534  1.00 28.58 ? 3   DC  P O2    1 
ATOM   3720 N  N3    . DC  C 3 3   ? 32.873 -9.929  -5.865  1.00 26.33 ? 3   DC  P N3    1 
ATOM   3721 C  C4    . DC  C 3 3   ? 32.621 -8.717  -6.365  1.00 26.65 ? 3   DC  P C4    1 
ATOM   3722 N  N4    . DC  C 3 3   ? 33.530 -8.167  -7.176  1.00 30.63 ? 3   DC  P N4    1 
ATOM   3723 C  C5    . DC  C 3 3   ? 31.415 -8.017  -6.058  1.00 31.62 ? 3   DC  P C5    1 
ATOM   3724 C  C6    . DC  C 3 3   ? 30.538 -8.604  -5.238  1.00 30.94 ? 3   DC  P C6    1 
ATOM   3725 P  P     . DG  C 3 4   ? 28.673 -10.279 0.461   1.00 38.02 ? 4   DG  P P     1 
ATOM   3726 O  OP1   . DG  C 3 4   ? 27.891 -10.983 1.506   1.00 47.92 ? 4   DG  P OP1   1 
ATOM   3727 O  OP2   . DG  C 3 4   ? 28.781 -8.803  0.484   1.00 37.48 ? 4   DG  P OP2   1 
ATOM   3728 O  "O5'" . DG  C 3 4   ? 30.170 -10.858 0.447   1.00 33.04 ? 4   DG  P "O5'" 1 
ATOM   3729 C  "C5'" . DG  C 3 4   ? 30.379 -12.248 0.229   1.00 36.15 ? 4   DG  P "C5'" 1 
ATOM   3730 C  "C4'" . DG  C 3 4   ? 31.859 -12.587 0.282   1.00 39.86 ? 4   DG  P "C4'" 1 
ATOM   3731 O  "O4'" . DG  C 3 4   ? 32.533 -12.040 -0.882  1.00 33.64 ? 4   DG  P "O4'" 1 
ATOM   3732 C  "C3'" . DG  C 3 4   ? 32.575 -12.050 1.521   1.00 31.26 ? 4   DG  P "C3'" 1 
ATOM   3733 O  "O3'" . DG  C 3 4   ? 33.266 -13.116 2.173   1.00 34.86 ? 4   DG  P "O3'" 1 
ATOM   3734 C  "C2'" . DG  C 3 4   ? 33.511 -10.972 0.979   1.00 30.03 ? 4   DG  P "C2'" 1 
ATOM   3735 C  "C1'" . DG  C 3 4   ? 33.724 -11.401 -0.470  1.00 31.06 ? 4   DG  P "C1'" 1 
ATOM   3736 N  N9    . DG  C 3 4   ? 33.980 -10.283 -1.372  1.00 25.47 ? 4   DG  P N9    1 
ATOM   3737 C  C8    . DG  C 3 4   ? 33.183 -9.189  -1.602  1.00 29.19 ? 4   DG  P C8    1 
ATOM   3738 N  N7    . DG  C 3 4   ? 33.682 -8.354  -2.471  1.00 29.27 ? 4   DG  P N7    1 
ATOM   3739 C  C5    . DG  C 3 4   ? 34.889 -8.925  -2.835  1.00 23.34 ? 4   DG  P C5    1 
ATOM   3740 C  C6    . DG  C 3 4   ? 35.870 -8.477  -3.743  1.00 24.76 ? 4   DG  P C6    1 
ATOM   3741 O  O6    . DG  C 3 4   ? 35.869 -7.441  -4.421  1.00 25.88 ? 4   DG  P O6    1 
ATOM   3742 N  N1    . DG  C 3 4   ? 36.942 -9.367  -3.815  1.00 25.68 ? 4   DG  P N1    1 
ATOM   3743 C  C2    . DG  C 3 4   ? 37.045 -10.541 -3.099  1.00 22.61 ? 4   DG  P C2    1 
ATOM   3744 N  N2    . DG  C 3 4   ? 38.148 -11.284 -3.289  1.00 20.84 ? 4   DG  P N2    1 
ATOM   3745 N  N3    . DG  C 3 4   ? 36.129 -10.966 -2.249  1.00 23.68 ? 4   DG  P N3    1 
ATOM   3746 C  C4    . DG  C 3 4   ? 35.084 -10.112 -2.169  1.00 24.19 ? 4   DG  P C4    1 
ATOM   3747 P  P     . DT  C 3 5   ? 34.008 -12.858 3.576   1.00 41.77 ? 5   DT  P P     1 
ATOM   3748 O  OP1   . DT  C 3 5   ? 33.949 -14.110 4.358   1.00 38.90 ? 5   DT  P OP1   1 
ATOM   3749 O  OP2   . DT  C 3 5   ? 33.486 -11.598 4.140   1.00 30.77 ? 5   DT  P OP2   1 
ATOM   3750 O  "O5'" . DT  C 3 5   ? 35.524 -12.578 3.149   1.00 35.83 ? 5   DT  P "O5'" 1 
ATOM   3751 C  "C5'" . DT  C 3 5   ? 36.149 -13.498 2.279   1.00 30.40 ? 5   DT  P "C5'" 1 
ATOM   3752 C  "C4'" . DT  C 3 5   ? 37.577 -13.092 1.957   1.00 24.49 ? 5   DT  P "C4'" 1 
ATOM   3753 O  "O4'" . DT  C 3 5   ? 37.618 -12.119 0.884   1.00 21.26 ? 5   DT  P "O4'" 1 
ATOM   3754 C  "C3'" . DT  C 3 5   ? 38.393 -12.525 3.117   1.00 21.13 ? 5   DT  P "C3'" 1 
ATOM   3755 O  "O3'" . DT  C 3 5   ? 39.570 -13.291 3.141   1.00 19.50 ? 5   DT  P "O3'" 1 
ATOM   3756 C  "C2'" . DT  C 3 5   ? 38.669 -11.080 2.707   1.00 15.64 ? 5   DT  P "C2'" 1 
ATOM   3757 C  "C1'" . DT  C 3 5   ? 38.600 -11.148 1.192   1.00 19.10 ? 5   DT  P "C1'" 1 
ATOM   3758 N  N1    . DT  C 3 5   ? 38.167 -9.882  0.549   1.00 20.67 ? 5   DT  P N1    1 
ATOM   3759 C  C2    . DT  C 3 5   ? 38.983 -9.298  -0.386  1.00 19.01 ? 5   DT  P C2    1 
ATOM   3760 O  O2    . DT  C 3 5   ? 40.056 -9.773  -0.710  1.00 20.52 ? 5   DT  P O2    1 
ATOM   3761 N  N3    . DT  C 3 5   ? 38.493 -8.134  -0.930  1.00 17.63 ? 5   DT  P N3    1 
ATOM   3762 C  C4    . DT  C 3 5   ? 37.295 -7.517  -0.637  1.00 19.13 ? 5   DT  P C4    1 
ATOM   3763 O  O4    . DT  C 3 5   ? 36.943 -6.466  -1.182  1.00 19.45 ? 5   DT  P O4    1 
ATOM   3764 C  C5    . DT  C 3 5   ? 36.492 -8.183  0.362   1.00 23.24 ? 5   DT  P C5    1 
ATOM   3765 C  C7    . DT  C 3 5   ? 35.171 -7.599  0.771   1.00 20.90 ? 5   DT  P C7    1 
ATOM   3766 C  C6    . DT  C 3 5   ? 36.958 -9.319  0.904   1.00 20.01 ? 5   DT  P C6    1 
ATOM   3767 P  P     . DC  C 3 6   ? 40.581 -13.214 4.391   1.00 14.17 ? 6   DC  P P     1 
ATOM   3768 O  OP1   . DC  C 3 6   ? 41.296 -14.514 4.472   1.00 17.33 ? 6   DC  P OP1   1 
ATOM   3769 O  OP2   . DC  C 3 6   ? 39.875 -12.633 5.536   1.00 12.76 ? 6   DC  P OP2   1 
ATOM   3770 O  "O5'" . DC  C 3 6   ? 41.637 -12.108 3.933   1.00 13.81 ? 6   DC  P "O5'" 1 
ATOM   3771 C  "C5'" . DC  C 3 6   ? 42.509 -12.386 2.870   1.00 12.09 ? 6   DC  P "C5'" 1 
ATOM   3772 C  "C4'" . DC  C 3 6   ? 43.247 -11.102 2.546   1.00 16.46 ? 6   DC  P "C4'" 1 
ATOM   3773 O  "O4'" . DC  C 3 6   ? 42.336 -10.212 1.865   1.00 17.27 ? 6   DC  P "O4'" 1 
ATOM   3774 C  "C3'" . DC  C 3 6   ? 43.809 -10.328 3.745   1.00 13.71 ? 6   DC  P "C3'" 1 
ATOM   3775 O  "O3'" . DC  C 3 6   ? 45.235 -10.494 3.688   1.00 12.89 ? 6   DC  P "O3'" 1 
ATOM   3776 C  "C2'" . DC  C 3 6   ? 43.350 -8.887  3.487   1.00 14.30 ? 6   DC  P "C2'" 1 
ATOM   3777 C  "C1'" . DC  C 3 6   ? 42.800 -8.903  2.060   1.00 14.31 ? 6   DC  P "C1'" 1 
ATOM   3778 N  N1    . DC  C 3 6   ? 41.667 -7.944  1.858   1.00 14.46 ? 6   DC  P N1    1 
ATOM   3779 C  C2    . DC  C 3 6   ? 41.734 -6.983  0.841   1.00 18.50 ? 6   DC  P C2    1 
ATOM   3780 O  O2    . DC  C 3 6   ? 42.729 -6.973  0.103   1.00 13.98 ? 6   DC  P O2    1 
ATOM   3781 N  N3    . DC  C 3 6   ? 40.700 -6.105  0.687   1.00 15.66 ? 6   DC  P N3    1 
ATOM   3782 C  C4    . DC  C 3 6   ? 39.647 -6.174  1.512   1.00 18.47 ? 6   DC  P C4    1 
ATOM   3783 N  N4    . DC  C 3 6   ? 38.653 -5.304  1.334   1.00 15.62 ? 6   DC  P N4    1 
ATOM   3784 C  C5    . DC  C 3 6   ? 39.561 -7.141  2.558   1.00 16.61 ? 6   DC  P C5    1 
ATOM   3785 C  C6    . DC  C 3 6   ? 40.583 -8.000  2.691   1.00 16.90 ? 6   DC  P C6    1 
ATOM   3786 P  P     . DA  C 3 7   ? 46.200 -9.769  4.753   1.00 14.40 ? 7   DA  P P     1 
ATOM   3787 O  OP1   . DA  C 3 7   ? 47.424 -10.594 4.882   1.00 16.25 ? 7   DA  P OP1   1 
ATOM   3788 O  OP2   . DA  C 3 7   ? 45.402 -9.454  5.954   1.00 13.19 ? 7   DA  P OP2   1 
ATOM   3789 O  "O5'" . DA  C 3 7   ? 46.533 -8.356  4.077   1.00 16.82 ? 7   DA  P "O5'" 1 
ATOM   3790 C  "C5'" . DA  C 3 7   ? 47.188 -8.224  2.836   1.00 17.87 ? 7   DA  P "C5'" 1 
ATOM   3791 C  "C4'" . DA  C 3 7   ? 47.063 -6.793  2.307   1.00 21.92 ? 7   DA  P "C4'" 1 
ATOM   3792 O  "O4'" . DA  C 3 7   ? 45.691 -6.534  1.906   1.00 22.11 ? 7   DA  P "O4'" 1 
ATOM   3793 C  "C3'" . DA  C 3 7   ? 47.301 -5.627  3.269   1.00 22.60 ? 7   DA  P "C3'" 1 
ATOM   3794 O  "O3'" . DA  C 3 7   ? 48.669 -5.510  3.788   1.00 29.32 ? 7   DA  P "O3'" 1 
ATOM   3795 C  "C2'" . DA  C 3 7   ? 46.731 -4.455  2.470   1.00 20.76 ? 7   DA  P "C2'" 1 
ATOM   3796 C  "C1'" . DA  C 3 7   ? 45.557 -5.133  1.763   1.00 21.54 ? 7   DA  P "C1'" 1 
ATOM   3797 N  N9    . DA  C 3 7   ? 44.243 -4.706  2.238   1.00 17.46 ? 7   DA  P N9    1 
ATOM   3798 C  C8    . DA  C 3 7   ? 43.430 -5.278  3.181   1.00 15.28 ? 7   DA  P C8    1 
ATOM   3799 N  N7    . DA  C 3 7   ? 42.303 -4.620  3.362   1.00 14.99 ? 7   DA  P N7    1 
ATOM   3800 C  C5    . DA  C 3 7   ? 42.395 -3.546  2.481   1.00 16.82 ? 7   DA  P C5    1 
ATOM   3801 C  C6    . DA  C 3 7   ? 41.535 -2.471  2.184   1.00 18.09 ? 7   DA  P C6    1 
ATOM   3802 N  N6    . DA  C 3 7   ? 40.351 -2.307  2.768   1.00 16.03 ? 7   DA  P N6    1 
ATOM   3803 N  N1    . DA  C 3 7   ? 41.931 -1.569  1.262   1.00 14.90 ? 7   DA  P N1    1 
ATOM   3804 C  C2    . DA  C 3 7   ? 43.119 -1.742  0.671   1.00 18.54 ? 7   DA  P C2    1 
ATOM   3805 N  N3    . DA  C 3 7   ? 44.013 -2.705  0.869   1.00 18.10 ? 7   DA  P N3    1 
ATOM   3806 C  C4    . DA  C 3 7   ? 43.585 -3.584  1.791   1.00 16.60 ? 7   DA  P C4    1 
ATOM   3807 P  P     A DT  C 3 8   ? 49.849 -4.851  2.923   0.50 30.39 ? 8   DT  P P     1 
ATOM   3808 P  P     B DT  C 3 8   ? 49.203 -4.108  4.392   0.50 17.82 ? 8   DT  P P     1 
ATOM   3809 O  OP1   A DT  C 3 8   ? 49.908 -5.532  1.612   0.50 20.39 ? 8   DT  P OP1   1 
ATOM   3810 O  OP1   B DT  C 3 8   ? 50.680 -4.190  4.497   0.50 17.83 ? 8   DT  P OP1   1 
ATOM   3811 O  OP2   A DT  C 3 8   ? 51.052 -4.782  3.786   0.50 25.51 ? 8   DT  P OP2   1 
ATOM   3812 O  OP2   B DT  C 3 8   ? 48.415 -3.810  5.608   0.50 15.13 ? 8   DT  P OP2   1 
ATOM   3813 O  "O5'" A DT  C 3 8   ? 49.374 -3.351  2.736   0.50 23.99 ? 8   DT  P "O5'" 1 
ATOM   3814 O  "O5'" B DT  C 3 8   ? 48.827 -3.014  3.266   0.50 23.27 ? 8   DT  P "O5'" 1 
ATOM   3815 C  "C5'" A DT  C 3 8   ? 49.822 -2.707  1.603   0.50 21.24 ? 8   DT  P "C5'" 1 
ATOM   3816 C  "C5'" B DT  C 3 8   ? 49.599 -2.714  2.058   0.50 21.41 ? 8   DT  P "C5'" 1 
ATOM   3817 C  "C4'" . DT  C 3 8   ? 49.349 -1.272  1.614   1.00 20.47 ? 8   DT  P "C4'" 1 
ATOM   3818 O  "O4'" . DT  C 3 8   ? 47.910 -1.132  1.581   1.00 19.33 ? 8   DT  P "O4'" 1 
ATOM   3819 C  "C3'" . DT  C 3 8   ? 49.872 -0.334  2.693   1.00 21.26 ? 8   DT  P "C3'" 1 
ATOM   3820 O  "O3'" . DT  C 3 8   ? 50.703 0.644   2.084   1.00 18.96 ? 8   DT  P "O3'" 1 
ATOM   3821 C  "C2'" . DT  C 3 8   ? 48.619 0.287   3.324   1.00 20.90 ? 8   DT  P "C2'" 1 
ATOM   3822 C  "C1'" . DT  C 3 8   ? 47.521 0.027   2.294   1.00 20.85 ? 8   DT  P "C1'" 1 
ATOM   3823 N  N1    . DT  C 3 8   ? 46.202 -0.188  2.963   1.00 19.49 ? 8   DT  P N1    1 
ATOM   3824 C  C2    . DT  C 3 8   ? 45.154 0.676   2.698   1.00 19.34 ? 8   DT  P C2    1 
ATOM   3825 O  O2    . DT  C 3 8   ? 45.231 1.604   1.918   1.00 21.45 ? 8   DT  P O2    1 
ATOM   3826 N  N3    . DT  C 3 8   ? 43.992 0.409   3.372   1.00 19.46 ? 8   DT  P N3    1 
ATOM   3827 C  C4    . DT  C 3 8   ? 43.776 -0.607  4.270   1.00 18.30 ? 8   DT  P C4    1 
ATOM   3828 O  O4    . DT  C 3 8   ? 42.697 -0.755  4.827   1.00 19.56 ? 8   DT  P O4    1 
ATOM   3829 C  C5    . DT  C 3 8   ? 44.910 -1.464  4.520   1.00 19.84 ? 8   DT  P C5    1 
ATOM   3830 C  C7    . DT  C 3 8   ? 44.778 -2.604  5.488   1.00 18.51 ? 8   DT  P C7    1 
ATOM   3831 C  C6    . DT  C 3 8   ? 46.052 -1.214  3.867   1.00 17.67 ? 8   DT  P C6    1 
HETATM 3832 MG MG    . MG  D 4 .   ? 52.909 0.434   2.110   0.90 15.73 ? 501 MG  A MG    1 
HETATM 3833 CA CA    A CA  E 5 .   ? 54.850 2.673   3.808   0.50 11.08 ? 502 CA  A CA    1 
HETATM 3834 MG MG    B MG  F 4 .   ? 54.828 2.662   3.804   0.50 11.15 ? 503 MG  A MG    1 
HETATM 3835 C  C1    . GOL G 6 .   ? 60.680 -24.894 12.051  1.00 19.92 ? 505 GOL A C1    1 
HETATM 3836 O  O1    . GOL G 6 .   ? 59.329 -24.881 12.435  1.00 13.24 ? 505 GOL A O1    1 
HETATM 3837 C  C2    . GOL G 6 .   ? 60.698 -24.502 10.581  1.00 18.87 ? 505 GOL A C2    1 
HETATM 3838 O  O2    . GOL G 6 .   ? 60.857 -23.111 10.527  1.00 13.72 ? 505 GOL A O2    1 
HETATM 3839 C  C3    . GOL G 6 .   ? 61.777 -25.246 9.793   1.00 24.45 ? 505 GOL A C3    1 
HETATM 3840 O  O3    . GOL G 6 .   ? 61.651 -24.957 8.413   1.00 16.66 ? 505 GOL A O3    1 
HETATM 3841 C  C1    . GOL H 6 .   ? 54.430 28.119  4.565   1.00 32.22 ? 506 GOL A C1    1 
HETATM 3842 O  O1    . GOL H 6 .   ? 53.085 27.822  4.225   1.00 29.21 ? 506 GOL A O1    1 
HETATM 3843 C  C2    . GOL H 6 .   ? 54.935 27.207  5.686   1.00 37.40 ? 506 GOL A C2    1 
HETATM 3844 O  O2    . GOL H 6 .   ? 54.158 26.029  5.736   1.00 38.40 ? 506 GOL A O2    1 
HETATM 3845 C  C3    . GOL H 6 .   ? 56.401 26.836  5.451   1.00 32.22 ? 506 GOL A C3    1 
HETATM 3846 O  O3    . GOL H 6 .   ? 56.931 26.102  6.546   1.00 24.43 ? 506 GOL A O3    1 
HETATM 3847 P  PG    . DTP I 7 .   ? 55.350 2.700   7.234   1.00 13.86 ? 504 DTP P PG    1 
HETATM 3848 O  O1G   . DTP I 7 .   ? 55.064 1.810   8.427   1.00 14.15 ? 504 DTP P O1G   1 
HETATM 3849 O  O2G   . DTP I 7 .   ? 56.613 3.514   7.389   1.00 11.15 ? 504 DTP P O2G   1 
HETATM 3850 O  O3G   . DTP I 7 .   ? 55.226 1.975   5.928   1.00 12.55 ? 504 DTP P O3G   1 
HETATM 3851 P  PB    . DTP I 7 .   ? 53.145 4.235   6.120   1.00 10.11 ? 504 DTP P PB    1 
HETATM 3852 O  O1B   . DTP I 7 .   ? 53.907 4.432   4.841   1.00 9.76  ? 504 DTP P O1B   1 
HETATM 3853 O  O2B   . DTP I 7 .   ? 52.389 5.445   6.634   1.00 10.29 ? 504 DTP P O2B   1 
HETATM 3854 O  O3B   . DTP I 7 .   ? 54.136 3.782   7.319   1.00 11.08 ? 504 DTP P O3B   1 
HETATM 3855 P  PA    . DTP I 7 .   ? 51.613 2.086   4.797   1.00 16.59 ? 504 DTP P PA    1 
HETATM 3856 O  O1A   . DTP I 7 .   ? 50.721 0.996   5.368   1.00 15.19 ? 504 DTP P O1A   1 
HETATM 3857 O  O2A   . DTP I 7 .   ? 52.744 1.662   3.880   1.00 13.60 ? 504 DTP P O2A   1 
HETATM 3858 O  O3A   . DTP I 7 .   ? 52.169 2.935   6.082   1.00 13.01 ? 504 DTP P O3A   1 
HETATM 3859 O  "O5'" . DTP I 7 .   ? 50.622 3.065   3.998   1.00 14.27 ? 504 DTP P "O5'" 1 
HETATM 3860 C  "C5'" . DTP I 7 .   ? 51.089 4.042   3.065   1.00 12.34 ? 504 DTP P "C5'" 1 
HETATM 3861 C  "C4'" . DTP I 7 .   ? 50.156 5.259   3.081   1.00 10.12 ? 504 DTP P "C4'" 1 
HETATM 3862 O  "O4'" . DTP I 7 .   ? 48.827 4.895   2.704   1.00 10.87 ? 504 DTP P "O4'" 1 
HETATM 3863 C  "C3'" . DTP I 7 .   ? 50.026 5.873   4.467   1.00 10.97 ? 504 DTP P "C3'" 1 
HETATM 3864 O  "O3'" . DTP I 7 .   ? 51.020 6.884   4.658   1.00 9.24  ? 504 DTP P "O3'" 1 
HETATM 3865 C  "C2'" . DTP I 7 .   ? 48.609 6.438   4.487   1.00 6.85  ? 504 DTP P "C2'" 1 
HETATM 3866 C  "C1'" . DTP I 7 .   ? 47.842 5.531   3.527   1.00 11.73 ? 504 DTP P "C1'" 1 
HETATM 3867 N  N9    . DTP I 7 .   ? 47.095 4.493   4.273   1.00 15.31 ? 504 DTP P N9    1 
HETATM 3868 C  C8    . DTP I 7 .   ? 47.576 3.317   4.707   1.00 15.71 ? 504 DTP P C8    1 
HETATM 3869 N  N7    . DTP I 7 .   ? 46.576 2.644   5.334   1.00 15.19 ? 504 DTP P N7    1 
HETATM 3870 C  C5    . DTP I 7 .   ? 45.471 3.411   5.278   1.00 14.82 ? 504 DTP P C5    1 
HETATM 3871 C  C6    . DTP I 7 .   ? 44.171 3.254   5.742   1.00 18.33 ? 504 DTP P C6    1 
HETATM 3872 N  N6    . DTP I 7 .   ? 43.827 2.126   6.400   1.00 16.47 ? 504 DTP P N6    1 
HETATM 3873 N  N1    . DTP I 7 .   ? 43.259 4.231   5.529   1.00 15.79 ? 504 DTP P N1    1 
HETATM 3874 C  C2    . DTP I 7 .   ? 43.604 5.349   4.881   1.00 14.71 ? 504 DTP P C2    1 
HETATM 3875 N  N3    . DTP I 7 .   ? 44.855 5.525   4.413   1.00 14.92 ? 504 DTP P N3    1 
HETATM 3876 C  C4    . DTP I 7 .   ? 45.799 4.565   4.598   1.00 13.87 ? 504 DTP P C4    1 
HETATM 3877 O  O     . HOH J 8 .   ? 52.912 -1.053  3.685   1.00 20.65 ? 601 HOH A O     1 
HETATM 3878 O  O     . HOH J 8 .   ? 56.488 -13.913 -5.928  1.00 10.30 ? 602 HOH A O     1 
HETATM 3879 O  O     . HOH J 8 .   ? 64.101 -3.466  6.013   1.00 9.10  ? 603 HOH A O     1 
HETATM 3880 O  O     . HOH J 8 .   ? 43.882 -14.460 5.691   1.00 9.77  ? 604 HOH A O     1 
HETATM 3881 O  O     . HOH J 8 .   ? 67.528 -20.739 8.729   1.00 11.49 ? 605 HOH A O     1 
HETATM 3882 O  O     . HOH J 8 .   ? 58.004 -23.561 14.226  1.00 8.37  ? 606 HOH A O     1 
HETATM 3883 O  O     . HOH J 8 .   ? 59.517 9.607   10.686  1.00 10.30 ? 607 HOH A O     1 
HETATM 3884 O  O     . HOH J 8 .   ? 73.197 -7.370  8.956   1.00 14.17 ? 608 HOH A O     1 
HETATM 3885 O  O     . HOH J 8 .   ? 51.924 5.762   9.161   1.00 11.74 ? 609 HOH A O     1 
HETATM 3886 O  O     . HOH J 8 .   ? 68.925 16.292  -4.051  1.00 10.68 ? 610 HOH A O     1 
HETATM 3887 O  O     . HOH J 8 .   ? 67.149 -16.598 9.582   1.00 12.99 ? 611 HOH A O     1 
HETATM 3888 O  O     . HOH J 8 .   ? 69.219 -17.569 -1.296  1.00 10.11 ? 612 HOH A O     1 
HETATM 3889 O  O     . HOH J 8 .   ? 60.477 -18.505 -4.686  1.00 11.50 ? 613 HOH A O     1 
HETATM 3890 O  O     . HOH J 8 .   ? 53.975 -28.613 4.128   1.00 12.73 ? 614 HOH A O     1 
HETATM 3891 O  O     . HOH J 8 .   ? 43.630 12.139  -7.177  1.00 14.23 ? 615 HOH A O     1 
HETATM 3892 O  O     . HOH J 8 .   ? 54.701 -11.433 3.478   1.00 10.27 ? 616 HOH A O     1 
HETATM 3893 O  O     . HOH J 8 .   ? 62.470 7.416   7.026   1.00 12.00 ? 617 HOH A O     1 
HETATM 3894 O  O     . HOH J 8 .   ? 69.242 -13.576 5.047   1.00 11.89 ? 618 HOH A O     1 
HETATM 3895 O  O     . HOH J 8 .   ? 59.370 11.209  8.482   1.00 13.19 ? 619 HOH A O     1 
HETATM 3896 O  O     . HOH J 8 .   ? 62.700 14.879  -9.174  1.00 12.22 ? 620 HOH A O     1 
HETATM 3897 O  O     . HOH J 8 .   ? 45.619 16.013  -1.560  1.00 14.72 ? 621 HOH A O     1 
HETATM 3898 O  O     . HOH J 8 .   ? 53.774 -20.433 -2.448  1.00 13.63 ? 622 HOH A O     1 
HETATM 3899 O  O     . HOH J 8 .   ? 53.396 -28.297 15.173  1.00 15.97 ? 623 HOH A O     1 
HETATM 3900 O  O     . HOH J 8 .   ? 40.692 11.580  -3.496  1.00 13.03 ? 624 HOH A O     1 
HETATM 3901 O  O     . HOH J 8 .   ? 49.050 6.829   -11.696 1.00 15.41 ? 625 HOH A O     1 
HETATM 3902 O  O     . HOH J 8 .   ? 65.670 -6.720  -13.839 1.00 17.80 ? 626 HOH A O     1 
HETATM 3903 O  O     . HOH J 8 .   ? 59.985 11.428  -10.309 1.00 13.45 ? 627 HOH A O     1 
HETATM 3904 O  O     . HOH J 8 .   ? 46.193 16.756  1.185   1.00 9.96  ? 628 HOH A O     1 
HETATM 3905 O  O     . HOH J 8 .   ? 51.396 5.562   -8.288  1.00 15.79 ? 629 HOH A O     1 
HETATM 3906 O  O     . HOH J 8 .   ? 43.460 -33.195 -0.424  1.00 14.34 ? 630 HOH A O     1 
HETATM 3907 O  O     . HOH J 8 .   ? 49.307 7.363   -7.656  1.00 18.49 ? 631 HOH A O     1 
HETATM 3908 O  O     . HOH J 8 .   ? 55.534 17.370  -0.658  1.00 11.85 ? 632 HOH A O     1 
HETATM 3909 O  O     . HOH J 8 .   ? 40.632 16.711  5.972   1.00 16.85 ? 633 HOH A O     1 
HETATM 3910 O  O     . HOH J 8 .   ? 71.133 3.643   -0.237  1.00 15.53 ? 634 HOH A O     1 
HETATM 3911 O  O     . HOH J 8 .   ? 61.252 -30.189 10.626  1.00 18.12 ? 635 HOH A O     1 
HETATM 3912 O  O     . HOH J 8 .   ? 49.144 -15.601 13.625  1.00 15.06 ? 636 HOH A O     1 
HETATM 3913 O  O     . HOH J 8 .   ? 42.269 -22.579 -2.562  1.00 16.75 ? 637 HOH A O     1 
HETATM 3914 O  O     . HOH J 8 .   ? 52.347 15.841  -4.642  1.00 14.09 ? 638 HOH A O     1 
HETATM 3915 O  O     . HOH J 8 .   ? 41.533 17.014  -14.751 1.00 16.97 ? 639 HOH A O     1 
HETATM 3916 O  O     . HOH J 8 .   ? 59.936 14.123  -8.630  1.00 16.55 ? 640 HOH A O     1 
HETATM 3917 O  O     . HOH J 8 .   ? 45.090 7.456   -10.347 1.00 18.16 ? 641 HOH A O     1 
HETATM 3918 O  O     . HOH J 8 .   ? 35.085 5.682   2.043   1.00 16.06 ? 642 HOH A O     1 
HETATM 3919 O  O     . HOH J 8 .   ? 52.748 1.369   9.494   1.00 16.89 ? 643 HOH A O     1 
HETATM 3920 O  O     . HOH J 8 .   ? 54.294 -9.543  5.348   1.00 15.21 ? 644 HOH A O     1 
HETATM 3921 O  O     . HOH J 8 .   ? 33.297 10.638  5.592   1.00 22.76 ? 645 HOH A O     1 
HETATM 3922 O  O     . HOH J 8 .   ? 52.473 20.194  5.033   1.00 15.69 ? 646 HOH A O     1 
HETATM 3923 O  O     . HOH J 8 .   ? 50.238 -17.219 15.482  1.00 13.12 ? 647 HOH A O     1 
HETATM 3924 O  O     . HOH J 8 .   ? 60.466 -17.760 -7.387  1.00 23.18 ? 648 HOH A O     1 
HETATM 3925 O  O     . HOH J 8 .   ? 53.706 13.542  -9.884  1.00 14.31 ? 649 HOH A O     1 
HETATM 3926 O  O     . HOH J 8 .   ? 64.105 -9.402  -14.311 1.00 18.18 ? 650 HOH A O     1 
HETATM 3927 O  O     . HOH J 8 .   ? 60.766 -23.473 6.426   1.00 17.32 ? 651 HOH A O     1 
HETATM 3928 O  O     . HOH J 8 .   ? 51.489 5.261   -10.927 1.00 19.45 ? 652 HOH A O     1 
HETATM 3929 O  O     . HOH J 8 .   ? 43.724 9.781   -9.998  1.00 17.77 ? 653 HOH A O     1 
HETATM 3930 O  O     . HOH J 8 .   ? 48.594 -22.274 -5.664  1.00 18.62 ? 654 HOH A O     1 
HETATM 3931 O  O     . HOH J 8 .   ? 70.881 16.211  -5.897  1.00 16.51 ? 655 HOH A O     1 
HETATM 3932 O  O     . HOH J 8 .   ? 58.644 -12.137 -11.372 1.00 13.16 ? 656 HOH A O     1 
HETATM 3933 O  O     . HOH J 8 .   ? 46.762 -0.300  -15.103 1.00 19.83 ? 657 HOH A O     1 
HETATM 3934 O  O     . HOH J 8 .   ? 68.372 -15.846 -7.541  1.00 22.42 ? 658 HOH A O     1 
HETATM 3935 O  O     . HOH J 8 .   ? 42.643 15.629  23.709  1.00 19.96 ? 659 HOH A O     1 
HETATM 3936 O  O     . HOH J 8 .   ? 63.300 -26.639 7.044   1.00 15.94 ? 660 HOH A O     1 
HETATM 3937 O  O     . HOH J 8 .   ? 41.113 6.964   19.089  1.00 16.51 ? 661 HOH A O     1 
HETATM 3938 O  O     . HOH J 8 .   ? 57.840 -7.621  8.111   1.00 15.92 ? 662 HOH A O     1 
HETATM 3939 O  O     . HOH J 8 .   ? 49.018 2.869   21.278  1.00 18.88 ? 663 HOH A O     1 
HETATM 3940 O  O     . HOH J 8 .   ? 42.260 -18.965 14.758  1.00 18.99 ? 664 HOH A O     1 
HETATM 3941 O  O     . HOH J 8 .   ? 65.790 -22.968 3.281   1.00 14.28 ? 665 HOH A O     1 
HETATM 3942 O  O     . HOH J 8 .   ? 50.138 2.951   12.797  1.00 18.67 ? 666 HOH A O     1 
HETATM 3943 O  O     . HOH J 8 .   ? 45.032 -14.256 10.448  1.00 14.04 ? 667 HOH A O     1 
HETATM 3944 O  O     . HOH J 8 .   ? 50.539 -34.803 -0.746  1.00 20.86 ? 668 HOH A O     1 
HETATM 3945 O  O     . HOH J 8 .   ? 71.628 6.030   -7.219  1.00 18.98 ? 669 HOH A O     1 
HETATM 3946 O  O     . HOH J 8 .   ? 51.270 3.516   10.419  1.00 21.94 ? 670 HOH A O     1 
HETATM 3947 O  O     . HOH J 8 .   ? 41.210 7.652   -18.577 1.00 15.03 ? 671 HOH A O     1 
HETATM 3948 O  O     . HOH J 8 .   ? 65.977 -15.256 11.738  1.00 15.85 ? 672 HOH A O     1 
HETATM 3949 O  O     . HOH J 8 .   ? 43.956 10.987  -12.435 1.00 22.87 ? 673 HOH A O     1 
HETATM 3950 O  O     . HOH J 8 .   ? 49.935 -3.202  -17.346 1.00 18.46 ? 674 HOH A O     1 
HETATM 3951 O  O     . HOH J 8 .   ? 59.415 4.961   16.726  1.00 23.71 ? 675 HOH A O     1 
HETATM 3952 O  O     . HOH J 8 .   ? 48.080 10.702  -9.550  1.00 23.10 ? 676 HOH A O     1 
HETATM 3953 O  O     . HOH J 8 .   ? 47.286 2.486   -1.291  1.00 18.32 ? 677 HOH A O     1 
HETATM 3954 O  O     . HOH J 8 .   ? 63.449 12.846  -10.857 1.00 19.28 ? 678 HOH A O     1 
HETATM 3955 O  O     . HOH J 8 .   ? 49.041 -9.460  10.457  1.00 25.82 ? 679 HOH A O     1 
HETATM 3956 O  O     . HOH J 8 .   ? 59.774 10.411  19.745  1.00 18.73 ? 680 HOH A O     1 
HETATM 3957 O  O     . HOH J 8 .   ? 44.114 -15.134 1.389   1.00 15.06 ? 681 HOH A O     1 
HETATM 3958 O  O     . HOH J 8 .   ? 44.524 7.327   2.319   1.00 14.70 ? 682 HOH A O     1 
HETATM 3959 O  O     . HOH J 8 .   ? 42.104 8.194   3.361   1.00 20.87 ? 683 HOH A O     1 
HETATM 3960 O  O     . HOH J 8 .   ? 34.704 15.056  11.392  1.00 19.21 ? 684 HOH A O     1 
HETATM 3961 O  O     . HOH J 8 .   ? 63.385 -19.002 -1.651  1.00 19.15 ? 685 HOH A O     1 
HETATM 3962 O  O     . HOH J 8 .   ? 48.716 -36.894 2.530   1.00 19.93 ? 686 HOH A O     1 
HETATM 3963 O  O     . HOH J 8 .   ? 61.722 14.672  8.636   1.00 23.40 ? 687 HOH A O     1 
HETATM 3964 O  O     . HOH J 8 .   ? 53.173 -33.435 -0.091  1.00 16.25 ? 688 HOH A O     1 
HETATM 3965 O  O     . HOH J 8 .   ? 70.864 -19.097 1.323   1.00 15.62 ? 689 HOH A O     1 
HETATM 3966 O  O     . HOH J 8 .   ? 36.929 16.055  -4.193  1.00 18.48 ? 690 HOH A O     1 
HETATM 3967 O  O     . HOH J 8 .   ? 58.464 -8.944  -14.173 1.00 23.40 ? 691 HOH A O     1 
HETATM 3968 O  O     . HOH J 8 .   ? 64.624 6.600   -0.405  1.00 17.13 ? 692 HOH A O     1 
HETATM 3969 O  O     . HOH J 8 .   ? 48.394 20.053  4.643   1.00 27.69 ? 693 HOH A O     1 
HETATM 3970 O  O     . HOH J 8 .   ? 69.437 4.556   3.817   1.00 19.27 ? 694 HOH A O     1 
HETATM 3971 O  O     . HOH J 8 .   ? 45.081 17.017  -18.268 1.00 28.01 ? 695 HOH A O     1 
HETATM 3972 O  O     . HOH J 8 .   ? 51.233 0.589   -16.056 1.00 21.24 ? 696 HOH A O     1 
HETATM 3973 O  O     . HOH J 8 .   ? 47.708 7.821   -9.588  1.00 21.36 ? 697 HOH A O     1 
HETATM 3974 O  O     . HOH J 8 .   ? 55.804 13.744  -11.549 1.00 21.87 ? 698 HOH A O     1 
HETATM 3975 O  O     . HOH J 8 .   ? 53.283 -20.228 -5.042  1.00 26.72 ? 699 HOH A O     1 
HETATM 3976 O  O     . HOH J 8 .   ? 49.559 -10.209 6.732   1.00 16.56 ? 700 HOH A O     1 
HETATM 3977 O  O     . HOH J 8 .   ? 60.009 13.056  11.263  1.00 21.67 ? 701 HOH A O     1 
HETATM 3978 O  O     . HOH J 8 .   ? 83.965 -5.039  2.560   1.00 25.08 ? 702 HOH A O     1 
HETATM 3979 O  O     . HOH J 8 .   ? 23.231 14.192  -9.068  1.00 24.15 ? 703 HOH A O     1 
HETATM 3980 O  O     . HOH J 8 .   ? 41.493 20.241  4.981   1.00 18.76 ? 704 HOH A O     1 
HETATM 3981 O  O     . HOH J 8 .   ? 51.306 -8.822  -5.323  1.00 22.61 ? 705 HOH A O     1 
HETATM 3982 O  O     . HOH J 8 .   ? 54.147 15.472  -6.759  1.00 17.95 ? 706 HOH A O     1 
HETATM 3983 O  O     . HOH J 8 .   ? 41.469 23.744  8.754   1.00 20.01 ? 707 HOH A O     1 
HETATM 3984 O  O     . HOH J 8 .   ? 58.088 -14.307 -13.042 1.00 24.38 ? 708 HOH A O     1 
HETATM 3985 O  O     . HOH J 8 .   ? 47.937 -27.081 -7.215  1.00 24.47 ? 709 HOH A O     1 
HETATM 3986 O  O     . HOH J 8 .   ? 73.575 4.650   -0.810  1.00 30.65 ? 710 HOH A O     1 
HETATM 3987 O  O     . HOH J 8 .   ? 51.256 8.757   -15.381 1.00 25.18 ? 711 HOH A O     1 
HETATM 3988 O  O     . HOH J 8 .   ? 53.992 16.093  -9.288  1.00 24.68 ? 712 HOH A O     1 
HETATM 3989 O  O     . HOH J 8 .   ? 41.720 15.726  -22.942 1.00 23.78 ? 713 HOH A O     1 
HETATM 3990 O  O     . HOH J 8 .   ? 46.842 -14.570 14.736  1.00 26.55 ? 714 HOH A O     1 
HETATM 3991 O  O     . HOH J 8 .   ? 60.640 -28.412 8.390   1.00 23.89 ? 715 HOH A O     1 
HETATM 3992 O  O     . HOH J 8 .   ? 51.457 -29.316 16.485  1.00 26.98 ? 716 HOH A O     1 
HETATM 3993 O  O     . HOH J 8 .   ? 78.047 -0.817  5.420   1.00 22.71 ? 717 HOH A O     1 
HETATM 3994 O  O     . HOH J 8 .   ? 53.664 7.480   -14.709 1.00 27.59 ? 718 HOH A O     1 
HETATM 3995 O  O     . HOH J 8 .   ? 51.707 -8.651  4.680   1.00 24.82 ? 719 HOH A O     1 
HETATM 3996 O  O     . HOH J 8 .   ? 47.577 -16.704 -0.746  1.00 22.73 ? 720 HOH A O     1 
HETATM 3997 O  O     . HOH J 8 .   ? 47.183 20.938  7.277   1.00 24.31 ? 721 HOH A O     1 
HETATM 3998 O  O     . HOH J 8 .   ? 54.388 -0.602  5.955   1.00 25.17 ? 722 HOH A O     1 
HETATM 3999 O  O     . HOH J 8 .   ? 46.808 19.545  1.587   1.00 22.99 ? 723 HOH A O     1 
HETATM 4000 O  O     . HOH J 8 .   ? 47.338 -20.154 18.369  1.00 26.54 ? 724 HOH A O     1 
HETATM 4001 O  O     . HOH J 8 .   ? 65.682 5.679   2.007   1.00 21.90 ? 725 HOH A O     1 
HETATM 4002 O  O     . HOH J 8 .   ? 63.063 9.470   -13.385 1.00 25.92 ? 726 HOH A O     1 
HETATM 4003 O  O     . HOH J 8 .   ? 64.453 -24.676 -7.904  1.00 35.69 ? 727 HOH A O     1 
HETATM 4004 O  O     . HOH J 8 .   ? 62.651 -25.780 4.772   1.00 22.55 ? 728 HOH A O     1 
HETATM 4005 O  O     . HOH J 8 .   ? 75.294 0.361   -3.676  1.00 25.53 ? 729 HOH A O     1 
HETATM 4006 O  O     . HOH J 8 .   ? 49.834 -9.329  -8.513  1.00 19.46 ? 730 HOH A O     1 
HETATM 4007 O  O     . HOH J 8 .   ? 49.397 8.493   -13.622 1.00 23.36 ? 731 HOH A O     1 
HETATM 4008 O  O     . HOH J 8 .   ? 45.566 1.991   18.254  1.00 29.97 ? 732 HOH A O     1 
HETATM 4009 O  O     . HOH J 8 .   ? 36.761 13.031  12.200  1.00 22.14 ? 733 HOH A O     1 
HETATM 4010 O  O     . HOH J 8 .   ? 44.690 13.528  -10.564 1.00 27.92 ? 734 HOH A O     1 
HETATM 4011 O  O     . HOH J 8 .   ? 34.261 5.892   -21.813 1.00 28.80 ? 735 HOH A O     1 
HETATM 4012 O  O     . HOH J 8 .   ? 63.217 -7.383  12.802  1.00 24.92 ? 736 HOH A O     1 
HETATM 4013 O  O     . HOH J 8 .   ? 58.376 -17.997 19.875  1.00 26.72 ? 737 HOH A O     1 
HETATM 4014 O  O     . HOH J 8 .   ? 76.454 2.850   6.720   1.00 23.67 ? 738 HOH A O     1 
HETATM 4015 O  O     . HOH J 8 .   ? 61.696 -31.557 -10.647 1.00 31.30 ? 739 HOH A O     1 
HETATM 4016 O  O     . HOH J 8 .   ? 43.058 -1.401  -24.966 1.00 26.28 ? 740 HOH A O     1 
HETATM 4017 O  O     . HOH J 8 .   ? 52.784 -12.656 -3.921  1.00 26.15 ? 741 HOH A O     1 
HETATM 4018 O  O     . HOH J 8 .   ? 29.449 4.029   6.761   1.00 34.67 ? 742 HOH A O     1 
HETATM 4019 O  O     . HOH J 8 .   ? 57.416 -34.767 8.800   1.00 26.92 ? 743 HOH A O     1 
HETATM 4020 O  O     . HOH J 8 .   ? 72.380 2.098   12.436  1.00 38.92 ? 744 HOH A O     1 
HETATM 4021 O  O     . HOH J 8 .   ? 58.665 15.196  -10.758 1.00 23.47 ? 745 HOH A O     1 
HETATM 4022 O  O     . HOH J 8 .   ? 80.835 -15.927 7.614   1.00 28.65 ? 746 HOH A O     1 
HETATM 4023 O  O     . HOH J 8 .   ? 56.669 21.679  18.123  1.00 23.76 ? 747 HOH A O     1 
HETATM 4024 O  O     . HOH J 8 .   ? 56.210 18.657  18.092  1.00 21.36 ? 748 HOH A O     1 
HETATM 4025 O  O     . HOH J 8 .   ? 48.318 -17.828 17.132  1.00 25.46 ? 749 HOH A O     1 
HETATM 4026 O  O     . HOH J 8 .   ? 57.970 -0.003  -14.472 1.00 25.19 ? 750 HOH A O     1 
HETATM 4027 O  O     . HOH J 8 .   ? 58.997 4.780   23.113  1.00 26.65 ? 751 HOH A O     1 
HETATM 4028 O  O     . HOH J 8 .   ? 42.318 -8.972  9.481   1.00 32.00 ? 752 HOH A O     1 
HETATM 4029 O  O     . HOH J 8 .   ? 62.175 -13.136 -13.331 1.00 29.79 ? 753 HOH A O     1 
HETATM 4030 O  O     . HOH J 8 .   ? 46.075 7.571   -12.948 1.00 30.84 ? 754 HOH A O     1 
HETATM 4031 O  O     . HOH J 8 .   ? 33.233 2.606   -0.429  1.00 23.29 ? 755 HOH A O     1 
HETATM 4032 O  O     . HOH J 8 .   ? 61.319 20.982  11.915  1.00 25.12 ? 756 HOH A O     1 
HETATM 4033 O  O     . HOH J 8 .   ? 65.748 -22.385 -7.927  1.00 28.10 ? 757 HOH A O     1 
HETATM 4034 O  O     . HOH J 8 .   ? 70.602 0.405   11.360  1.00 31.18 ? 758 HOH A O     1 
HETATM 4035 O  O     . HOH J 8 .   ? 29.129 8.029   -18.587 1.00 28.37 ? 759 HOH A O     1 
HETATM 4036 O  O     . HOH J 8 .   ? 72.312 -3.846  -13.653 1.00 21.12 ? 760 HOH A O     1 
HETATM 4037 O  O     . HOH J 8 .   ? 41.000 14.152  -6.506  1.00 26.79 ? 761 HOH A O     1 
HETATM 4038 O  O     . HOH J 8 .   ? 53.477 5.910   -12.341 1.00 26.01 ? 762 HOH A O     1 
HETATM 4039 O  O     . HOH J 8 .   ? 35.367 20.907  0.658   1.00 25.76 ? 763 HOH A O     1 
HETATM 4040 O  O     . HOH J 8 .   ? 50.958 17.793  -5.933  1.00 29.34 ? 764 HOH A O     1 
HETATM 4041 O  O     . HOH J 8 .   ? 39.735 7.142   13.565  1.00 23.56 ? 765 HOH A O     1 
HETATM 4042 O  O     . HOH J 8 .   ? 44.053 0.357   -21.067 1.00 26.42 ? 766 HOH A O     1 
HETATM 4043 O  O     . HOH J 8 .   ? 70.541 -17.141 12.535  1.00 20.29 ? 767 HOH A O     1 
HETATM 4044 O  O     . HOH J 8 .   ? 65.564 13.087  2.980   1.00 26.38 ? 768 HOH A O     1 
HETATM 4045 O  O     . HOH J 8 .   ? 37.752 11.017  21.672  1.00 33.17 ? 769 HOH A O     1 
HETATM 4046 O  O     . HOH J 8 .   ? 59.993 9.570   22.347  1.00 29.59 ? 770 HOH A O     1 
HETATM 4047 O  O     . HOH J 8 .   ? 38.970 -19.689 12.330  1.00 28.41 ? 771 HOH A O     1 
HETATM 4048 O  O     . HOH J 8 .   ? 47.759 16.095  -17.856 1.00 32.47 ? 772 HOH A O     1 
HETATM 4049 O  O     . HOH J 8 .   ? 65.984 -4.130  -15.180 1.00 30.61 ? 773 HOH A O     1 
HETATM 4050 O  O     . HOH J 8 .   ? 45.835 18.331  -3.337  1.00 27.03 ? 774 HOH A O     1 
HETATM 4051 O  O     . HOH J 8 .   ? 52.553 3.549   17.768  1.00 25.74 ? 775 HOH A O     1 
HETATM 4052 O  O     . HOH J 8 .   ? 51.262 21.703  7.050   1.00 23.81 ? 776 HOH A O     1 
HETATM 4053 O  O     . HOH J 8 .   ? 38.603 -17.993 10.173  1.00 22.75 ? 777 HOH A O     1 
HETATM 4054 O  O     . HOH J 8 .   ? 46.334 -9.475  10.863  1.00 29.07 ? 778 HOH A O     1 
HETATM 4055 O  O     . HOH J 8 .   ? 55.415 -1.160  -14.690 1.00 22.31 ? 779 HOH A O     1 
HETATM 4056 O  O     . HOH J 8 .   ? 51.656 -35.331 7.701   1.00 26.19 ? 780 HOH A O     1 
HETATM 4057 O  O     . HOH J 8 .   ? 37.468 15.156  -20.293 1.00 35.06 ? 781 HOH A O     1 
HETATM 4058 O  O     . HOH J 8 .   ? 63.060 -23.776 3.173   1.00 19.92 ? 782 HOH A O     1 
HETATM 4059 O  O     . HOH J 8 .   ? 71.722 1.421   19.028  1.00 39.67 ? 783 HOH A O     1 
HETATM 4060 O  O     . HOH J 8 .   ? 60.620 13.976  6.233   1.00 25.14 ? 784 HOH A O     1 
HETATM 4061 O  O     . HOH J 8 .   ? 55.694 -7.337  6.459   1.00 23.49 ? 785 HOH A O     1 
HETATM 4062 O  O     . HOH J 8 .   ? 57.374 -18.988 22.079  1.00 26.26 ? 786 HOH A O     1 
HETATM 4063 O  O     . HOH J 8 .   ? 72.348 -7.768  11.693  1.00 19.53 ? 787 HOH A O     1 
HETATM 4064 O  O     . HOH J 8 .   ? 65.705 -21.441 14.708  1.00 31.25 ? 788 HOH A O     1 
HETATM 4065 O  O     . HOH J 8 .   ? 52.631 8.323   25.493  1.00 23.84 ? 789 HOH A O     1 
HETATM 4066 O  O     . HOH J 8 .   ? 47.089 16.515  25.484  1.00 23.60 ? 790 HOH A O     1 
HETATM 4067 O  O     . HOH J 8 .   ? 31.974 -1.397  -3.069  1.00 31.03 ? 791 HOH A O     1 
HETATM 4068 O  O     . HOH J 8 .   ? 78.042 -16.713 10.725  1.00 28.32 ? 792 HOH A O     1 
HETATM 4069 O  O     . HOH J 8 .   ? 67.410 -6.400  12.805  1.00 23.76 ? 793 HOH A O     1 
HETATM 4070 O  O     . HOH J 8 .   ? 48.467 -0.004  9.664   1.00 37.51 ? 794 HOH A O     1 
HETATM 4071 O  O     . HOH J 8 .   ? 61.899 1.695   14.021  1.00 31.63 ? 795 HOH A O     1 
HETATM 4072 O  O     . HOH J 8 .   ? 44.006 -33.440 5.635   1.00 28.86 ? 796 HOH A O     1 
HETATM 4073 O  O     . HOH J 8 .   ? 53.770 -8.522  8.592   1.00 26.90 ? 797 HOH A O     1 
HETATM 4074 O  O     . HOH J 8 .   ? 19.242 17.271  12.728  1.00 40.78 ? 798 HOH A O     1 
HETATM 4075 O  O     . HOH J 8 .   ? 19.089 14.213  6.603   1.00 35.89 ? 799 HOH A O     1 
HETATM 4076 O  O     . HOH J 8 .   ? 55.368 2.616   21.021  1.00 25.47 ? 800 HOH A O     1 
HETATM 4077 O  O     . HOH J 8 .   ? 79.080 3.441   2.155   1.00 32.80 ? 801 HOH A O     1 
HETATM 4078 O  O     . HOH J 8 .   ? 55.482 -20.696 21.243  1.00 29.06 ? 802 HOH A O     1 
HETATM 4079 O  O     . HOH J 8 .   ? 62.901 -17.056 -7.233  1.00 22.93 ? 803 HOH A O     1 
HETATM 4080 O  O     . HOH J 8 .   ? 80.590 -3.928  14.029  1.00 32.36 ? 804 HOH A O     1 
HETATM 4081 O  O     . HOH J 8 .   ? 45.127 0.646   -18.358 1.00 21.46 ? 805 HOH A O     1 
HETATM 4082 O  O     . HOH J 8 .   ? 65.117 -34.671 -5.948  1.00 33.13 ? 806 HOH A O     1 
HETATM 4083 O  O     . HOH J 8 .   ? 50.133 -8.896  13.087  1.00 30.25 ? 807 HOH A O     1 
HETATM 4084 O  O     . HOH J 8 .   ? 27.629 6.622   -16.795 1.00 26.13 ? 808 HOH A O     1 
HETATM 4085 O  O     . HOH J 8 .   ? 60.017 14.476  3.410   1.00 20.26 ? 809 HOH A O     1 
HETATM 4086 O  O     . HOH J 8 .   ? 55.748 -32.875 4.836   1.00 26.14 ? 810 HOH A O     1 
HETATM 4087 O  O     . HOH J 8 .   ? 57.448 -16.396 -11.266 1.00 23.95 ? 811 HOH A O     1 
HETATM 4088 O  O     . HOH J 8 .   ? 38.962 -3.449  -20.119 1.00 27.21 ? 812 HOH A O     1 
HETATM 4089 O  O     . HOH J 8 .   ? 61.407 8.168   9.778   1.00 24.89 ? 813 HOH A O     1 
HETATM 4090 O  O     . HOH J 8 .   ? 47.259 -22.695 17.247  1.00 26.49 ? 814 HOH A O     1 
HETATM 4091 O  O     . HOH J 8 .   ? 34.487 19.794  -16.208 1.00 32.37 ? 815 HOH A O     1 
HETATM 4092 O  O     . HOH J 8 .   ? 65.764 8.621   8.988   1.00 28.22 ? 816 HOH A O     1 
HETATM 4093 O  O     . HOH J 8 .   ? 46.758 0.346   6.884   1.00 25.95 ? 817 HOH A O     1 
HETATM 4094 O  O     . HOH J 8 .   ? 57.722 23.470  14.072  1.00 28.67 ? 818 HOH A O     1 
HETATM 4095 O  O     . HOH J 8 .   ? 51.493 -34.108 10.543  1.00 34.81 ? 819 HOH A O     1 
HETATM 4096 O  O     . HOH J 8 .   ? 40.901 -1.800  -16.430 1.00 26.67 ? 820 HOH A O     1 
HETATM 4097 O  O     . HOH J 8 .   ? 43.621 -28.555 15.683  1.00 31.49 ? 821 HOH A O     1 
HETATM 4098 O  O     . HOH J 8 .   ? 69.736 5.361   1.163   1.00 30.83 ? 822 HOH A O     1 
HETATM 4099 O  O     . HOH J 8 .   ? 45.023 20.712  3.827   1.00 29.57 ? 823 HOH A O     1 
HETATM 4100 O  O     . HOH J 8 .   ? 47.086 16.278  -23.753 1.00 26.40 ? 824 HOH A O     1 
HETATM 4101 O  O     . HOH J 8 .   ? 50.161 -27.774 18.479  1.00 31.14 ? 825 HOH A O     1 
HETATM 4102 O  O     . HOH J 8 .   ? 59.714 -31.433 3.837   1.00 27.49 ? 826 HOH A O     1 
HETATM 4103 O  O     . HOH J 8 .   ? 69.699 10.151  -8.466  1.00 26.67 ? 827 HOH A O     1 
HETATM 4104 O  O     . HOH J 8 .   ? 48.320 -33.362 -3.667  1.00 27.78 ? 828 HOH A O     1 
HETATM 4105 O  O     . HOH J 8 .   ? 70.268 -21.699 0.729   1.00 21.94 ? 829 HOH A O     1 
HETATM 4106 O  O     . HOH J 8 .   ? 65.214 19.664  1.834   1.00 21.56 ? 830 HOH A O     1 
HETATM 4107 O  O     . HOH J 8 .   ? 60.860 -15.651 13.667  1.00 25.69 ? 831 HOH A O     1 
HETATM 4108 O  O     . HOH J 8 .   ? 51.617 13.464  -11.494 1.00 29.77 ? 832 HOH A O     1 
HETATM 4109 O  O     . HOH J 8 .   ? 68.236 -14.686 -10.023 1.00 22.30 ? 833 HOH A O     1 
HETATM 4110 O  O     . HOH J 8 .   ? 42.823 17.278  -17.389 1.00 27.61 ? 834 HOH A O     1 
HETATM 4111 O  O     . HOH J 8 .   ? 50.568 -13.210 -0.776  1.00 22.09 ? 835 HOH A O     1 
HETATM 4112 O  O     . HOH J 8 .   ? 77.773 -17.135 8.358   1.00 34.73 ? 836 HOH A O     1 
HETATM 4113 O  O     . HOH J 8 .   ? 44.393 10.270  -24.625 1.00 29.28 ? 837 HOH A O     1 
HETATM 4114 O  O     . HOH J 8 .   ? 52.327 -5.650  -0.845  1.00 25.38 ? 838 HOH A O     1 
HETATM 4115 O  O     . HOH J 8 .   ? 62.340 -6.794  -14.940 1.00 33.81 ? 839 HOH A O     1 
HETATM 4116 O  O     . HOH J 8 .   ? 67.757 -5.252  -17.401 1.00 38.49 ? 840 HOH A O     1 
HETATM 4117 O  O     . HOH J 8 .   ? 58.280 -27.539 11.249  1.00 18.85 ? 841 HOH A O     1 
HETATM 4118 O  O     . HOH J 8 .   ? 61.642 -17.689 -13.075 1.00 36.53 ? 842 HOH A O     1 
HETATM 4119 O  O     . HOH J 8 .   ? 48.901 -29.615 15.979  1.00 34.37 ? 843 HOH A O     1 
HETATM 4120 O  O     . HOH J 8 .   ? 49.454 12.121  -11.670 1.00 29.61 ? 844 HOH A O     1 
HETATM 4121 O  O     . HOH J 8 .   ? 58.032 17.902  19.824  1.00 27.21 ? 845 HOH A O     1 
HETATM 4122 O  O     . HOH J 8 .   ? 35.633 22.523  -3.244  1.00 28.43 ? 846 HOH A O     1 
HETATM 4123 O  O     . HOH J 8 .   ? 58.008 12.185  -12.179 1.00 32.68 ? 847 HOH A O     1 
HETATM 4124 O  O     . HOH J 8 .   ? 53.204 19.454  -1.511  1.00 22.90 ? 848 HOH A O     1 
HETATM 4125 O  O     . HOH J 8 .   ? 50.132 -14.799 -3.463  1.00 37.19 ? 849 HOH A O     1 
HETATM 4126 O  O     . HOH J 8 .   ? 50.608 -7.436  6.592   1.00 34.31 ? 850 HOH A O     1 
HETATM 4127 O  O     . HOH J 8 .   ? 48.759 -34.520 10.223  1.00 32.71 ? 851 HOH A O     1 
HETATM 4128 O  O     . HOH J 8 .   ? 66.017 -26.146 0.500   1.00 29.02 ? 852 HOH A O     1 
HETATM 4129 O  O     . HOH J 8 .   ? 41.353 21.853  2.253   1.00 21.98 ? 853 HOH A O     1 
HETATM 4130 O  O     . HOH J 8 .   ? 60.421 6.297   -15.644 1.00 24.09 ? 854 HOH A O     1 
HETATM 4131 O  O     . HOH J 8 .   ? 52.928 -26.436 -3.912  1.00 20.57 ? 855 HOH A O     1 
HETATM 4132 O  O     . HOH J 8 .   ? 52.658 2.479   -17.556 1.00 33.18 ? 856 HOH A O     1 
HETATM 4133 O  O     . HOH J 8 .   ? 21.709 13.787  6.732   1.00 33.25 ? 857 HOH A O     1 
HETATM 4134 O  O     . HOH J 8 .   ? 49.258 14.893  -22.584 1.00 29.98 ? 858 HOH A O     1 
HETATM 4135 O  O     . HOH J 8 .   ? 61.944 23.889  9.825   1.00 23.78 ? 859 HOH A O     1 
HETATM 4136 O  O     . HOH J 8 .   ? 50.544 0.944   20.331  1.00 30.96 ? 860 HOH A O     1 
HETATM 4137 O  O     . HOH J 8 .   ? 69.911 -8.754  10.676  1.00 25.18 ? 861 HOH A O     1 
HETATM 4138 O  O     . HOH J 8 .   ? 69.070 -10.890 12.099  1.00 26.05 ? 862 HOH A O     1 
HETATM 4139 O  O     . HOH J 8 .   ? 49.150 -23.967 19.025  1.00 32.26 ? 863 HOH A O     1 
HETATM 4140 O  O     . HOH J 8 .   ? 62.094 7.937   16.004  1.00 31.75 ? 864 HOH A O     1 
HETATM 4141 O  O     . HOH J 8 .   ? 52.844 -19.732 22.195  1.00 26.65 ? 865 HOH A O     1 
HETATM 4142 O  O     . HOH J 8 .   ? 67.623 6.476   0.712   1.00 25.74 ? 866 HOH A O     1 
HETATM 4143 O  O     . HOH J 8 .   ? 50.721 -6.467  -5.508  1.00 28.71 ? 867 HOH A O     1 
HETATM 4144 O  O     . HOH J 8 .   ? 38.259 10.433  9.590   1.00 24.18 ? 868 HOH A O     1 
HETATM 4145 O  O     . HOH J 8 .   ? 67.933 2.013   12.362  1.00 29.64 ? 869 HOH A O     1 
HETATM 4146 O  O     . HOH J 8 .   ? 34.027 3.132   2.710   1.00 31.07 ? 870 HOH A O     1 
HETATM 4147 O  O     . HOH J 8 .   ? 48.147 -19.167 -5.679  1.00 32.20 ? 871 HOH A O     1 
HETATM 4148 O  O     . HOH J 8 .   ? 76.713 1.367   -5.499  1.00 31.68 ? 872 HOH A O     1 
HETATM 4149 O  O     . HOH J 8 .   ? 66.023 21.941  1.498   1.00 27.75 ? 873 HOH A O     1 
HETATM 4150 O  O     . HOH J 8 .   ? 77.149 -19.249 7.173   1.00 26.96 ? 874 HOH A O     1 
HETATM 4151 O  O     . HOH J 8 .   ? 47.690 21.861  9.839   1.00 26.90 ? 875 HOH A O     1 
HETATM 4152 O  O     . HOH J 8 .   ? 38.885 21.342  5.786   1.00 32.81 ? 876 HOH A O     1 
HETATM 4153 O  O     . HOH J 8 .   ? 67.410 -8.383  9.751   1.00 21.81 ? 877 HOH A O     1 
HETATM 4154 O  O     . HOH J 8 .   ? 39.631 18.703  18.159  1.00 23.01 ? 878 HOH A O     1 
HETATM 4155 O  O     . HOH J 8 .   ? 39.531 -2.053  -14.162 1.00 28.10 ? 879 HOH A O     1 
HETATM 4156 O  O     . HOH J 8 .   ? 46.681 -18.745 -2.509  1.00 32.87 ? 880 HOH A O     1 
HETATM 4157 O  O     . HOH J 8 .   ? 50.815 -0.953  22.174  1.00 32.21 ? 881 HOH A O     1 
HETATM 4158 O  O     . HOH J 8 .   ? 46.322 1.856   20.792  1.00 33.89 ? 882 HOH A O     1 
HETATM 4159 O  O     . HOH J 8 .   ? 34.692 17.684  -12.733 1.00 27.13 ? 883 HOH A O     1 
HETATM 4160 O  O     . HOH J 8 .   ? 49.053 -0.313  -16.713 1.00 29.76 ? 884 HOH A O     1 
HETATM 4161 O  O     . HOH J 8 .   ? 51.516 6.211   -18.991 1.00 31.18 ? 885 HOH A O     1 
HETATM 4162 O  O     . HOH J 8 .   ? 41.153 -29.811 13.010  1.00 27.13 ? 886 HOH A O     1 
HETATM 4163 O  O     . HOH J 8 .   ? 43.210 -25.535 17.319  1.00 32.08 ? 887 HOH A O     1 
HETATM 4164 O  O     . HOH J 8 .   ? 56.138 1.110   13.152  1.00 28.73 ? 888 HOH A O     1 
HETATM 4165 O  O     . HOH J 8 .   ? 22.106 -4.416  3.337   1.00 42.11 ? 889 HOH A O     1 
HETATM 4166 O  O     . HOH J 8 .   ? 47.467 -4.715  -16.283 1.00 26.06 ? 890 HOH A O     1 
HETATM 4167 O  O     . HOH J 8 .   ? 66.595 3.812   10.733  1.00 25.64 ? 891 HOH A O     1 
HETATM 4168 O  O     . HOH J 8 .   ? 38.613 13.704  24.608  1.00 33.40 ? 892 HOH A O     1 
HETATM 4169 O  O     . HOH J 8 .   ? 47.558 13.921  -11.087 1.00 35.81 ? 893 HOH A O     1 
HETATM 4170 O  O     . HOH J 8 .   ? 47.953 10.989  -13.706 1.00 33.01 ? 894 HOH A O     1 
HETATM 4171 O  O     . HOH J 8 .   ? 42.608 13.334  -23.796 1.00 28.95 ? 895 HOH A O     1 
HETATM 4172 O  O     . HOH J 8 .   ? 81.327 -10.851 -8.253  1.00 38.70 ? 896 HOH A O     1 
HETATM 4173 O  O     . HOH J 8 .   ? 35.930 11.050  10.351  1.00 28.93 ? 897 HOH A O     1 
HETATM 4174 O  O     . HOH J 8 .   ? 69.747 -13.055 -11.376 1.00 26.05 ? 898 HOH A O     1 
HETATM 4175 O  O     . HOH J 8 .   ? 33.588 7.767   17.355  1.00 30.61 ? 899 HOH A O     1 
HETATM 4176 O  O     . HOH J 8 .   ? 50.784 10.939  -13.581 1.00 33.95 ? 900 HOH A O     1 
HETATM 4177 O  O     . HOH J 8 .   ? 63.455 -4.517  -15.739 1.00 35.47 ? 901 HOH A O     1 
HETATM 4178 O  O     . HOH J 8 .   ? 75.193 -22.459 -6.447  1.00 34.10 ? 902 HOH A O     1 
HETATM 4179 O  O     . HOH J 8 .   ? 20.621 17.924  -5.203  1.00 38.04 ? 903 HOH A O     1 
HETATM 4180 O  O     . HOH J 8 .   ? 61.963 -18.802 21.933  1.00 35.96 ? 904 HOH A O     1 
HETATM 4181 O  O     . HOH J 8 .   ? 44.251 15.738  26.013  1.00 27.67 ? 905 HOH A O     1 
HETATM 4182 O  O     . HOH J 8 .   ? 61.623 11.414  -12.404 1.00 28.25 ? 906 HOH A O     1 
HETATM 4183 O  O     . HOH J 8 .   ? 62.179 12.334  9.698   1.00 29.47 ? 907 HOH A O     1 
HETATM 4184 O  O     . HOH J 8 .   ? 57.696 3.134   18.091  1.00 24.67 ? 908 HOH A O     1 
HETATM 4185 O  O     . HOH J 8 .   ? 50.987 -22.969 -5.635  1.00 31.30 ? 909 HOH A O     1 
HETATM 4186 O  O     . HOH J 8 .   ? 50.020 -15.905 -9.088  1.00 31.10 ? 910 HOH A O     1 
HETATM 4187 O  O     . HOH J 8 .   ? 68.376 -26.287 -0.695  1.00 25.65 ? 911 HOH A O     1 
HETATM 4188 O  O     . HOH J 8 .   ? 30.856 2.005   -21.986 1.00 27.07 ? 912 HOH A O     1 
HETATM 4189 O  O     . HOH J 8 .   ? 65.324 20.108  6.691   1.00 36.60 ? 913 HOH A O     1 
HETATM 4190 O  O     . HOH J 8 .   ? 42.257 15.626  -8.754  1.00 28.97 ? 914 HOH A O     1 
HETATM 4191 O  O     . HOH J 8 .   ? 52.966 24.133  4.255   1.00 29.42 ? 915 HOH A O     1 
HETATM 4192 O  O     . HOH J 8 .   ? 34.785 14.445  21.824  1.00 32.46 ? 916 HOH A O     1 
HETATM 4193 O  O     . HOH J 8 .   ? 67.756 -25.938 -6.379  1.00 38.67 ? 917 HOH A O     1 
HETATM 4194 O  O     . HOH J 8 .   ? 62.739 11.888  5.629   1.00 29.04 ? 918 HOH A O     1 
HETATM 4195 O  O     . HOH J 8 .   ? 69.796 -10.075 14.716  1.00 37.91 ? 919 HOH A O     1 
HETATM 4196 O  O     . HOH J 8 .   ? 69.056 -14.950 -14.773 1.00 37.59 ? 920 HOH A O     1 
HETATM 4197 O  O     . HOH J 8 .   ? 69.833 -18.718 -9.423  1.00 34.74 ? 921 HOH A O     1 
HETATM 4198 O  O     . HOH J 8 .   ? 37.225 18.716  16.794  1.00 33.44 ? 922 HOH A O     1 
HETATM 4199 O  O     . HOH J 8 .   ? 73.171 2.238   7.961   1.00 32.30 ? 923 HOH A O     1 
HETATM 4200 O  O     . HOH J 8 .   ? 61.795 -2.466  12.019  1.00 27.20 ? 924 HOH A O     1 
HETATM 4201 O  O     . HOH J 8 .   ? 63.591 -11.772 12.753  1.00 39.49 ? 925 HOH A O     1 
HETATM 4202 O  O     . HOH J 8 .   ? 37.461 13.901  21.746  1.00 31.28 ? 926 HOH A O     1 
HETATM 4203 O  O     . HOH J 8 .   ? 53.814 -32.540 -2.902  1.00 29.07 ? 927 HOH A O     1 
HETATM 4204 O  O     . HOH J 8 .   ? 44.213 -1.513  -16.483 1.00 34.99 ? 928 HOH A O     1 
HETATM 4205 O  O     . HOH J 8 .   ? 50.925 15.819  -12.524 1.00 42.23 ? 929 HOH A O     1 
HETATM 4206 O  O     . HOH J 8 .   ? 59.736 -28.168 -2.047  1.00 37.92 ? 930 HOH A O     1 
HETATM 4207 O  O     . HOH J 8 .   ? 71.185 6.337   7.647   1.00 33.97 ? 931 HOH A O     1 
HETATM 4208 O  O     . HOH J 8 .   ? 12.041 3.365   -5.496  1.00 44.37 ? 932 HOH A O     1 
HETATM 4209 O  O     . HOH J 8 .   ? 63.076 24.541  12.305  1.00 30.97 ? 933 HOH A O     1 
HETATM 4210 O  O     . HOH J 8 .   ? 33.798 22.640  -0.669  1.00 33.93 ? 934 HOH A O     1 
HETATM 4211 O  O     . HOH J 8 .   ? 58.171 -7.790  -16.796 1.00 31.52 ? 935 HOH A O     1 
HETATM 4212 O  O     . HOH J 8 .   ? 68.716 -21.956 -8.207  1.00 34.07 ? 936 HOH A O     1 
HETATM 4213 O  O     . HOH J 8 .   ? 61.940 9.092   18.883  1.00 32.80 ? 937 HOH A O     1 
HETATM 4214 O  O     . HOH J 8 .   ? 65.131 -9.289  12.355  1.00 28.85 ? 938 HOH A O     1 
HETATM 4215 O  O     . HOH J 8 .   ? 48.556 -6.275  -12.023 1.00 36.13 ? 939 HOH A O     1 
HETATM 4216 O  O     . HOH J 8 .   ? 11.892 0.583   -4.329  1.00 43.68 ? 940 HOH A O     1 
HETATM 4217 O  O     . HOH J 8 .   ? 58.811 -30.834 -0.826  1.00 38.83 ? 941 HOH A O     1 
HETATM 4218 O  O     . HOH J 8 .   ? 30.815 1.290   3.335   1.00 37.45 ? 942 HOH A O     1 
HETATM 4219 O  O     . HOH J 8 .   ? 55.429 -17.464 -13.370 1.00 33.85 ? 943 HOH A O     1 
HETATM 4220 O  O     . HOH J 8 .   ? 54.609 -35.078 1.187   1.00 30.80 ? 944 HOH A O     1 
HETATM 4221 O  O     . HOH J 8 .   ? 48.489 22.329  3.026   1.00 35.29 ? 945 HOH A O     1 
HETATM 4222 O  O     . HOH J 8 .   ? 38.196 -15.779 12.189  1.00 36.86 ? 946 HOH A O     1 
HETATM 4223 O  O     . HOH J 8 .   ? 68.270 -28.003 -7.709  1.00 41.82 ? 947 HOH A O     1 
HETATM 4224 O  O     . HOH J 8 .   ? 58.852 -33.876 2.443   1.00 37.04 ? 948 HOH A O     1 
HETATM 4225 O  O     . HOH J 8 .   ? 55.490 1.557   -17.427 1.00 38.71 ? 949 HOH A O     1 
HETATM 4226 O  O     . HOH J 8 .   ? 42.499 5.553   20.985  1.00 33.79 ? 950 HOH A O     1 
HETATM 4227 O  O     . HOH J 8 .   ? 43.583 16.335  -10.794 1.00 38.32 ? 951 HOH A O     1 
HETATM 4228 O  O     . HOH J 8 .   ? 20.119 10.301  8.891   1.00 38.93 ? 952 HOH A O     1 
HETATM 4229 O  O     . HOH J 8 .   ? 78.022 3.489   -1.183  1.00 38.54 ? 953 HOH A O     1 
HETATM 4230 O  O     . HOH J 8 .   ? 61.573 7.495   22.714  1.00 39.95 ? 954 HOH A O     1 
HETATM 4231 O  O     . HOH J 8 .   ? 31.493 -5.645  1.529   1.00 44.12 ? 955 HOH A O     1 
HETATM 4232 O  O     . HOH J 8 .   ? 62.588 -29.542 -12.325 1.00 33.58 ? 956 HOH A O     1 
HETATM 4233 O  O     . HOH J 8 .   ? 68.650 -17.048 -11.831 1.00 32.77 ? 957 HOH A O     1 
HETATM 4234 O  O     . HOH J 8 .   ? 35.808 22.063  12.551  1.00 33.33 ? 958 HOH A O     1 
HETATM 4235 O  O     . HOH J 8 .   ? 44.697 -18.838 18.967  1.00 35.13 ? 959 HOH A O     1 
HETATM 4236 O  O     . HOH J 8 .   ? 61.025 -0.136  -16.317 1.00 31.44 ? 960 HOH A O     1 
HETATM 4237 O  O     . HOH J 8 .   ? 40.783 -29.376 -2.261  1.00 23.93 ? 961 HOH A O     1 
HETATM 4238 O  O     . HOH J 8 .   ? 38.359 -22.729 10.744  1.00 29.91 ? 962 HOH A O     1 
HETATM 4239 O  O     . HOH J 8 .   ? 62.573 0.763   16.570  1.00 34.13 ? 963 HOH A O     1 
HETATM 4240 O  O     . HOH J 8 .   ? 64.629 -15.644 13.850  1.00 31.50 ? 964 HOH A O     1 
HETATM 4241 O  O     . HOH J 8 .   ? 44.816 -15.047 13.143  1.00 28.88 ? 965 HOH A O     1 
HETATM 4242 O  O     . HOH J 8 .   ? 43.696 18.162  23.031  1.00 35.42 ? 966 HOH A O     1 
HETATM 4243 O  O     . HOH J 8 .   ? 45.516 -32.937 8.738   1.00 36.13 ? 967 HOH A O     1 
HETATM 4244 O  O     . HOH J 8 .   ? 53.701 -37.908 1.637   1.00 35.84 ? 968 HOH A O     1 
HETATM 4245 O  O     . HOH J 8 .   ? 61.914 16.052  2.347   1.00 27.32 ? 969 HOH A O     1 
HETATM 4246 O  O     . HOH J 8 .   ? 61.223 10.075  7.164   1.00 29.20 ? 970 HOH A O     1 
HETATM 4247 O  O     . HOH J 8 .   ? 53.284 -0.077  12.316  1.00 28.36 ? 971 HOH A O     1 
HETATM 4248 O  O     . HOH J 8 .   ? 54.432 15.404  23.381  1.00 27.23 ? 972 HOH A O     1 
HETATM 4249 O  O     . HOH J 8 .   ? 47.359 -0.293  -8.370  1.00 23.10 ? 973 HOH A O     1 
HETATM 4250 O  O     . HOH J 8 .   ? 83.731 -7.977  0.867   1.00 29.96 ? 974 HOH A O     1 
HETATM 4251 O  O     . HOH J 8 .   ? 56.486 -3.328  4.326   1.00 27.99 ? 975 HOH A O     1 
HETATM 4252 O  O     . HOH J 8 .   ? 73.343 -19.727 -2.819  1.00 19.63 ? 976 HOH A O     1 
HETATM 4253 O  O     . HOH K 8 .   ? 36.046 11.046  0.815   1.00 19.37 ? 101 HOH T O     1 
HETATM 4254 O  O     . HOH K 8 .   ? 43.482 5.525   -9.100  1.00 23.12 ? 102 HOH T O     1 
HETATM 4255 O  O     . HOH K 8 .   ? 42.108 -7.138  -10.461 1.00 30.30 ? 103 HOH T O     1 
HETATM 4256 O  O     . HOH K 8 .   ? 37.027 -23.227 -5.196  1.00 24.89 ? 104 HOH T O     1 
HETATM 4257 O  O     . HOH K 8 .   ? 33.919 9.000   11.582  1.00 35.86 ? 105 HOH T O     1 
HETATM 4258 O  O     . HOH K 8 .   ? 40.887 -3.409  -9.405  1.00 23.46 ? 106 HOH T O     1 
HETATM 4259 O  O     . HOH K 8 .   ? 44.439 -8.530  -3.668  1.00 24.96 ? 107 HOH T O     1 
HETATM 4260 O  O     . HOH K 8 .   ? 46.923 -8.632  -4.591  1.00 29.61 ? 108 HOH T O     1 
HETATM 4261 O  O     . HOH K 8 .   ? 33.395 10.581  8.418   1.00 31.42 ? 109 HOH T O     1 
HETATM 4262 O  O     . HOH K 8 .   ? 36.329 2.489   4.572   1.00 27.11 ? 110 HOH T O     1 
HETATM 4263 O  O     . HOH K 8 .   ? 39.550 4.810   18.370  1.00 27.65 ? 111 HOH T O     1 
HETATM 4264 O  O     . HOH K 8 .   ? 32.203 14.150  10.737  1.00 34.41 ? 112 HOH T O     1 
HETATM 4265 O  O     . HOH K 8 .   ? 35.155 5.919   18.093  1.00 37.66 ? 113 HOH T O     1 
HETATM 4266 O  O     . HOH K 8 .   ? 37.678 -12.879 -11.105 1.00 26.89 ? 114 HOH T O     1 
HETATM 4267 O  O     . HOH K 8 .   ? 38.874 -10.338 -9.972  1.00 32.97 ? 115 HOH T O     1 
HETATM 4268 O  O     . HOH K 8 .   ? 43.701 5.633   0.522   1.00 22.85 ? 116 HOH T O     1 
HETATM 4269 O  O     . HOH K 8 .   ? 38.812 -2.359  -6.509  1.00 33.03 ? 117 HOH T O     1 
HETATM 4270 O  O     . HOH K 8 .   ? 37.978 -18.367 -8.844  1.00 35.39 ? 118 HOH T O     1 
HETATM 4271 O  O     . HOH K 8 .   ? 42.914 -11.624 -11.538 1.00 35.25 ? 119 HOH T O     1 
HETATM 4272 O  O     . HOH K 8 .   ? 36.599 -3.005  -4.192  1.00 29.00 ? 120 HOH T O     1 
HETATM 4273 O  O     . HOH K 8 .   ? 41.888 -19.993 -3.372  1.00 29.54 ? 121 HOH T O     1 
HETATM 4274 O  O     . HOH K 8 .   ? 40.027 -0.455  7.683   1.00 32.57 ? 122 HOH T O     1 
HETATM 4275 O  O     . HOH K 8 .   ? 45.451 -5.017  -3.317  1.00 27.46 ? 123 HOH T O     1 
HETATM 4276 O  O     . HOH K 8 .   ? 38.386 -1.870  6.140   1.00 32.28 ? 124 HOH T O     1 
HETATM 4277 O  O     . HOH K 8 .   ? 30.848 5.277   8.635   1.00 37.82 ? 125 HOH T O     1 
HETATM 4278 O  O     . HOH K 8 .   ? 40.184 -18.245 -1.596  1.00 33.14 ? 126 HOH T O     1 
HETATM 4279 O  O     . HOH K 8 .   ? 37.651 0.049   4.514   1.00 30.62 ? 127 HOH T O     1 
HETATM 4280 O  O     . HOH K 8 .   ? 36.642 -2.092  -1.201  1.00 30.03 ? 128 HOH T O     1 
HETATM 4281 O  O     . HOH K 8 .   ? 45.643 5.340   -5.088  1.00 25.69 ? 129 HOH T O     1 
HETATM 4282 O  O     . HOH K 8 .   ? 40.957 -10.008 -11.439 1.00 36.68 ? 130 HOH T O     1 
HETATM 4283 O  O     . HOH K 8 .   ? 39.077 -0.728  10.324  1.00 38.66 ? 131 HOH T O     1 
HETATM 4284 O  O     . HOH K 8 .   ? 37.321 0.302   -3.199  1.00 26.39 ? 132 HOH T O     1 
HETATM 4285 O  O     . HOH K 8 .   ? 37.909 -4.298  -8.440  1.00 40.19 ? 133 HOH T O     1 
HETATM 4286 O  O     . HOH K 8 .   ? 38.432 4.475   16.073  1.00 38.00 ? 134 HOH T O     1 
HETATM 4287 O  O     . HOH K 8 .   ? 34.437 -15.797 -14.250 1.00 36.60 ? 135 HOH T O     1 
HETATM 4288 O  O     . HOH K 8 .   ? 38.169 -21.675 -3.305  1.00 32.19 ? 136 HOH T O     1 
HETATM 4289 O  O     . HOH K 8 .   ? 37.537 -20.883 -9.467  1.00 31.25 ? 137 HOH T O     1 
HETATM 4290 O  O     . HOH L 8 .   ? 42.967 -9.023  7.082   1.00 16.59 ? 101 HOH P O     1 
HETATM 4291 O  O     . HOH L 8 .   ? 45.068 -8.064  -0.983  1.00 23.57 ? 102 HOH P O     1 
HETATM 4292 O  O     . HOH L 8 .   ? 41.871 -11.624 -0.776  1.00 20.01 ? 103 HOH P O     1 
HETATM 4293 O  O     . HOH L 8 .   ? 41.557 -15.707 1.806   1.00 17.49 ? 104 HOH P O     1 
HETATM 4294 O  O     . HOH L 8 .   ? 44.161 -12.956 -0.254  1.00 22.62 ? 105 HOH P O     1 
HETATM 4295 O  O     . HOH L 8 .   ? 46.326 3.826   1.071   1.00 25.38 ? 106 HOH P O     1 
HETATM 4296 O  O     . HOH L 8 .   ? 40.577 -9.110  5.842   1.00 22.07 ? 107 HOH P O     1 
HETATM 4297 O  O     . HOH L 8 .   ? 46.244 -2.448  -0.488  1.00 21.23 ? 108 HOH P O     1 
HETATM 4298 O  O     . HOH L 8 .   ? 28.109 -5.120  -9.884  1.00 37.14 ? 109 HOH P O     1 
HETATM 4299 O  O     . HOH L 8 .   ? 26.292 -12.899 -10.365 1.00 26.91 ? 110 HOH P O     1 
HETATM 4300 O  O     . HOH L 8 .   ? 46.030 -10.765 -0.087  1.00 23.03 ? 111 HOH P O     1 
HETATM 4301 O  O     . HOH L 8 .   ? 38.310 -10.696 6.352   1.00 31.26 ? 112 HOH P O     1 
HETATM 4302 O  O     . HOH L 8 .   ? 31.246 -13.856 -3.009  1.00 33.56 ? 113 HOH P O     1 
HETATM 4303 O  O     . HOH L 8 .   ? 25.500 -14.839 -8.661  1.00 30.69 ? 114 HOH P O     1 
HETATM 4304 O  O     . HOH L 8 .   ? 30.910 -5.219  -9.803  1.00 38.98 ? 115 HOH P O     1 
HETATM 4305 O  O     . HOH L 8 .   ? 40.558 -5.251  5.534   1.00 24.84 ? 116 HOH P O     1 
HETATM 4306 O  O     . HOH L 8 .   ? 30.631 -6.261  -13.080 1.00 40.22 ? 117 HOH P O     1 
HETATM 4307 O  O     . HOH L 8 .   ? 35.230 -9.213  -10.866 1.00 41.15 ? 118 HOH P O     1 
HETATM 4308 O  O     . HOH L 8 .   ? 32.508 -7.273  -11.362 1.00 38.65 ? 119 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   501 501 MG  MG  A . 
E 5 CA  1   502 502 CA  CA  A . 
F 4 MG  1   503 502 MG  MG  A . 
G 6 GOL 1   505 436 GOL GOL A . 
H 6 GOL 1   506 439 GOL GOL A . 
I 7 DTP 1   504 9   DTP DTP P . 
J 8 HOH 1   601 1   HOH HOH A . 
J 8 HOH 2   602 2   HOH HOH A . 
J 8 HOH 3   603 3   HOH HOH A . 
J 8 HOH 4   604 4   HOH HOH A . 
J 8 HOH 5   605 5   HOH HOH A . 
J 8 HOH 6   606 6   HOH HOH A . 
J 8 HOH 7   607 7   HOH HOH A . 
J 8 HOH 8   608 8   HOH HOH A . 
J 8 HOH 9   609 9   HOH HOH A . 
J 8 HOH 10  610 10  HOH HOH A . 
J 8 HOH 11  611 11  HOH HOH A . 
J 8 HOH 12  612 12  HOH HOH A . 
J 8 HOH 13  613 13  HOH HOH A . 
J 8 HOH 14  614 14  HOH HOH A . 
J 8 HOH 15  615 15  HOH HOH A . 
J 8 HOH 16  616 16  HOH HOH A . 
J 8 HOH 17  617 17  HOH HOH A . 
J 8 HOH 18  618 18  HOH HOH A . 
J 8 HOH 19  619 19  HOH HOH A . 
J 8 HOH 20  620 20  HOH HOH A . 
J 8 HOH 21  621 21  HOH HOH A . 
J 8 HOH 22  622 22  HOH HOH A . 
J 8 HOH 23  623 23  HOH HOH A . 
J 8 HOH 24  624 24  HOH HOH A . 
J 8 HOH 25  625 25  HOH HOH A . 
J 8 HOH 26  626 26  HOH HOH A . 
J 8 HOH 27  627 27  HOH HOH A . 
J 8 HOH 28  628 28  HOH HOH A . 
J 8 HOH 29  629 29  HOH HOH A . 
J 8 HOH 30  630 30  HOH HOH A . 
J 8 HOH 31  631 31  HOH HOH A . 
J 8 HOH 32  632 32  HOH HOH A . 
J 8 HOH 33  633 33  HOH HOH A . 
J 8 HOH 34  634 34  HOH HOH A . 
J 8 HOH 35  635 35  HOH HOH A . 
J 8 HOH 36  636 36  HOH HOH A . 
J 8 HOH 37  637 37  HOH HOH A . 
J 8 HOH 38  638 40  HOH HOH A . 
J 8 HOH 39  639 41  HOH HOH A . 
J 8 HOH 40  640 42  HOH HOH A . 
J 8 HOH 41  641 43  HOH HOH A . 
J 8 HOH 42  642 44  HOH HOH A . 
J 8 HOH 43  643 45  HOH HOH A . 
J 8 HOH 44  644 46  HOH HOH A . 
J 8 HOH 45  645 47  HOH HOH A . 
J 8 HOH 46  646 48  HOH HOH A . 
J 8 HOH 47  647 49  HOH HOH A . 
J 8 HOH 48  648 50  HOH HOH A . 
J 8 HOH 49  649 51  HOH HOH A . 
J 8 HOH 50  650 52  HOH HOH A . 
J 8 HOH 51  651 53  HOH HOH A . 
J 8 HOH 52  652 54  HOH HOH A . 
J 8 HOH 53  653 55  HOH HOH A . 
J 8 HOH 54  654 56  HOH HOH A . 
J 8 HOH 55  655 57  HOH HOH A . 
J 8 HOH 56  656 58  HOH HOH A . 
J 8 HOH 57  657 59  HOH HOH A . 
J 8 HOH 58  658 61  HOH HOH A . 
J 8 HOH 59  659 62  HOH HOH A . 
J 8 HOH 60  660 63  HOH HOH A . 
J 8 HOH 61  661 64  HOH HOH A . 
J 8 HOH 62  662 65  HOH HOH A . 
J 8 HOH 63  663 66  HOH HOH A . 
J 8 HOH 64  664 68  HOH HOH A . 
J 8 HOH 65  665 69  HOH HOH A . 
J 8 HOH 66  666 70  HOH HOH A . 
J 8 HOH 67  667 71  HOH HOH A . 
J 8 HOH 68  668 72  HOH HOH A . 
J 8 HOH 69  669 73  HOH HOH A . 
J 8 HOH 70  670 74  HOH HOH A . 
J 8 HOH 71  671 75  HOH HOH A . 
J 8 HOH 72  672 76  HOH HOH A . 
J 8 HOH 73  673 77  HOH HOH A . 
J 8 HOH 74  674 78  HOH HOH A . 
J 8 HOH 75  675 79  HOH HOH A . 
J 8 HOH 76  676 80  HOH HOH A . 
J 8 HOH 77  677 81  HOH HOH A . 
J 8 HOH 78  678 82  HOH HOH A . 
J 8 HOH 79  679 83  HOH HOH A . 
J 8 HOH 80  680 84  HOH HOH A . 
J 8 HOH 81  681 85  HOH HOH A . 
J 8 HOH 82  682 86  HOH HOH A . 
J 8 HOH 83  683 88  HOH HOH A . 
J 8 HOH 84  684 89  HOH HOH A . 
J 8 HOH 85  685 90  HOH HOH A . 
J 8 HOH 86  686 91  HOH HOH A . 
J 8 HOH 87  687 92  HOH HOH A . 
J 8 HOH 88  688 93  HOH HOH A . 
J 8 HOH 89  689 94  HOH HOH A . 
J 8 HOH 90  690 97  HOH HOH A . 
J 8 HOH 91  691 98  HOH HOH A . 
J 8 HOH 92  692 99  HOH HOH A . 
J 8 HOH 93  693 101 HOH HOH A . 
J 8 HOH 94  694 102 HOH HOH A . 
J 8 HOH 95  695 103 HOH HOH A . 
J 8 HOH 96  696 104 HOH HOH A . 
J 8 HOH 97  697 105 HOH HOH A . 
J 8 HOH 98  698 106 HOH HOH A . 
J 8 HOH 99  699 107 HOH HOH A . 
J 8 HOH 100 700 108 HOH HOH A . 
J 8 HOH 101 701 110 HOH HOH A . 
J 8 HOH 102 702 113 HOH HOH A . 
J 8 HOH 103 703 114 HOH HOH A . 
J 8 HOH 104 704 115 HOH HOH A . 
J 8 HOH 105 705 116 HOH HOH A . 
J 8 HOH 106 706 117 HOH HOH A . 
J 8 HOH 107 707 118 HOH HOH A . 
J 8 HOH 108 708 120 HOH HOH A . 
J 8 HOH 109 709 121 HOH HOH A . 
J 8 HOH 110 710 122 HOH HOH A . 
J 8 HOH 111 711 123 HOH HOH A . 
J 8 HOH 112 712 124 HOH HOH A . 
J 8 HOH 113 713 125 HOH HOH A . 
J 8 HOH 114 714 126 HOH HOH A . 
J 8 HOH 115 715 127 HOH HOH A . 
J 8 HOH 116 716 128 HOH HOH A . 
J 8 HOH 117 717 129 HOH HOH A . 
J 8 HOH 118 718 130 HOH HOH A . 
J 8 HOH 119 719 131 HOH HOH A . 
J 8 HOH 120 720 132 HOH HOH A . 
J 8 HOH 121 721 133 HOH HOH A . 
J 8 HOH 122 722 134 HOH HOH A . 
J 8 HOH 123 723 135 HOH HOH A . 
J 8 HOH 124 724 136 HOH HOH A . 
J 8 HOH 125 725 137 HOH HOH A . 
J 8 HOH 126 726 138 HOH HOH A . 
J 8 HOH 127 727 139 HOH HOH A . 
J 8 HOH 128 728 140 HOH HOH A . 
J 8 HOH 129 729 141 HOH HOH A . 
J 8 HOH 130 730 142 HOH HOH A . 
J 8 HOH 131 731 143 HOH HOH A . 
J 8 HOH 132 732 144 HOH HOH A . 
J 8 HOH 133 733 145 HOH HOH A . 
J 8 HOH 134 734 146 HOH HOH A . 
J 8 HOH 135 735 147 HOH HOH A . 
J 8 HOH 136 736 148 HOH HOH A . 
J 8 HOH 137 737 149 HOH HOH A . 
J 8 HOH 138 738 150 HOH HOH A . 
J 8 HOH 139 739 151 HOH HOH A . 
J 8 HOH 140 740 152 HOH HOH A . 
J 8 HOH 141 741 153 HOH HOH A . 
J 8 HOH 142 742 154 HOH HOH A . 
J 8 HOH 143 743 155 HOH HOH A . 
J 8 HOH 144 744 157 HOH HOH A . 
J 8 HOH 145 745 158 HOH HOH A . 
J 8 HOH 146 746 159 HOH HOH A . 
J 8 HOH 147 747 160 HOH HOH A . 
J 8 HOH 148 748 161 HOH HOH A . 
J 8 HOH 149 749 162 HOH HOH A . 
J 8 HOH 150 750 164 HOH HOH A . 
J 8 HOH 151 751 165 HOH HOH A . 
J 8 HOH 152 752 166 HOH HOH A . 
J 8 HOH 153 753 167 HOH HOH A . 
J 8 HOH 154 754 168 HOH HOH A . 
J 8 HOH 155 755 170 HOH HOH A . 
J 8 HOH 156 756 172 HOH HOH A . 
J 8 HOH 157 757 173 HOH HOH A . 
J 8 HOH 158 758 174 HOH HOH A . 
J 8 HOH 159 759 175 HOH HOH A . 
J 8 HOH 160 760 176 HOH HOH A . 
J 8 HOH 161 761 177 HOH HOH A . 
J 8 HOH 162 762 178 HOH HOH A . 
J 8 HOH 163 763 179 HOH HOH A . 
J 8 HOH 164 764 181 HOH HOH A . 
J 8 HOH 165 765 182 HOH HOH A . 
J 8 HOH 166 766 183 HOH HOH A . 
J 8 HOH 167 767 185 HOH HOH A . 
J 8 HOH 168 768 186 HOH HOH A . 
J 8 HOH 169 769 188 HOH HOH A . 
J 8 HOH 170 770 189 HOH HOH A . 
J 8 HOH 171 771 190 HOH HOH A . 
J 8 HOH 172 772 191 HOH HOH A . 
J 8 HOH 173 773 192 HOH HOH A . 
J 8 HOH 174 774 194 HOH HOH A . 
J 8 HOH 175 775 195 HOH HOH A . 
J 8 HOH 176 776 196 HOH HOH A . 
J 8 HOH 177 777 197 HOH HOH A . 
J 8 HOH 178 778 199 HOH HOH A . 
J 8 HOH 179 779 201 HOH HOH A . 
J 8 HOH 180 780 202 HOH HOH A . 
J 8 HOH 181 781 203 HOH HOH A . 
J 8 HOH 182 782 204 HOH HOH A . 
J 8 HOH 183 783 205 HOH HOH A . 
J 8 HOH 184 784 206 HOH HOH A . 
J 8 HOH 185 785 207 HOH HOH A . 
J 8 HOH 186 786 208 HOH HOH A . 
J 8 HOH 187 787 209 HOH HOH A . 
J 8 HOH 188 788 210 HOH HOH A . 
J 8 HOH 189 789 211 HOH HOH A . 
J 8 HOH 190 790 212 HOH HOH A . 
J 8 HOH 191 791 213 HOH HOH A . 
J 8 HOH 192 792 214 HOH HOH A . 
J 8 HOH 193 793 215 HOH HOH A . 
J 8 HOH 194 794 216 HOH HOH A . 
J 8 HOH 195 795 217 HOH HOH A . 
J 8 HOH 196 796 218 HOH HOH A . 
J 8 HOH 197 797 219 HOH HOH A . 
J 8 HOH 198 798 220 HOH HOH A . 
J 8 HOH 199 799 221 HOH HOH A . 
J 8 HOH 200 800 223 HOH HOH A . 
J 8 HOH 201 801 224 HOH HOH A . 
J 8 HOH 202 802 225 HOH HOH A . 
J 8 HOH 203 803 226 HOH HOH A . 
J 8 HOH 204 804 227 HOH HOH A . 
J 8 HOH 205 805 228 HOH HOH A . 
J 8 HOH 206 806 229 HOH HOH A . 
J 8 HOH 207 807 230 HOH HOH A . 
J 8 HOH 208 808 232 HOH HOH A . 
J 8 HOH 209 809 233 HOH HOH A . 
J 8 HOH 210 810 234 HOH HOH A . 
J 8 HOH 211 811 237 HOH HOH A . 
J 8 HOH 212 812 238 HOH HOH A . 
J 8 HOH 213 813 240 HOH HOH A . 
J 8 HOH 214 814 241 HOH HOH A . 
J 8 HOH 215 815 243 HOH HOH A . 
J 8 HOH 216 816 244 HOH HOH A . 
J 8 HOH 217 817 246 HOH HOH A . 
J 8 HOH 218 818 247 HOH HOH A . 
J 8 HOH 219 819 248 HOH HOH A . 
J 8 HOH 220 820 249 HOH HOH A . 
J 8 HOH 221 821 251 HOH HOH A . 
J 8 HOH 222 822 252 HOH HOH A . 
J 8 HOH 223 823 253 HOH HOH A . 
J 8 HOH 224 824 254 HOH HOH A . 
J 8 HOH 225 825 255 HOH HOH A . 
J 8 HOH 226 826 257 HOH HOH A . 
J 8 HOH 227 827 258 HOH HOH A . 
J 8 HOH 228 828 259 HOH HOH A . 
J 8 HOH 229 829 261 HOH HOH A . 
J 8 HOH 230 830 262 HOH HOH A . 
J 8 HOH 231 831 263 HOH HOH A . 
J 8 HOH 232 832 264 HOH HOH A . 
J 8 HOH 233 833 265 HOH HOH A . 
J 8 HOH 234 834 266 HOH HOH A . 
J 8 HOH 235 835 267 HOH HOH A . 
J 8 HOH 236 836 273 HOH HOH A . 
J 8 HOH 237 837 274 HOH HOH A . 
J 8 HOH 238 838 276 HOH HOH A . 
J 8 HOH 239 839 278 HOH HOH A . 
J 8 HOH 240 840 280 HOH HOH A . 
J 8 HOH 241 841 281 HOH HOH A . 
J 8 HOH 242 842 283 HOH HOH A . 
J 8 HOH 243 843 284 HOH HOH A . 
J 8 HOH 244 844 285 HOH HOH A . 
J 8 HOH 245 845 286 HOH HOH A . 
J 8 HOH 246 846 287 HOH HOH A . 
J 8 HOH 247 847 288 HOH HOH A . 
J 8 HOH 248 848 289 HOH HOH A . 
J 8 HOH 249 849 290 HOH HOH A . 
J 8 HOH 250 850 291 HOH HOH A . 
J 8 HOH 251 851 292 HOH HOH A . 
J 8 HOH 252 852 293 HOH HOH A . 
J 8 HOH 253 853 295 HOH HOH A . 
J 8 HOH 254 854 297 HOH HOH A . 
J 8 HOH 255 855 298 HOH HOH A . 
J 8 HOH 256 856 300 HOH HOH A . 
J 8 HOH 257 857 301 HOH HOH A . 
J 8 HOH 258 858 302 HOH HOH A . 
J 8 HOH 259 859 304 HOH HOH A . 
J 8 HOH 260 860 305 HOH HOH A . 
J 8 HOH 261 861 306 HOH HOH A . 
J 8 HOH 262 862 307 HOH HOH A . 
J 8 HOH 263 863 308 HOH HOH A . 
J 8 HOH 264 864 310 HOH HOH A . 
J 8 HOH 265 865 311 HOH HOH A . 
J 8 HOH 266 866 313 HOH HOH A . 
J 8 HOH 267 867 314 HOH HOH A . 
J 8 HOH 268 868 316 HOH HOH A . 
J 8 HOH 269 869 317 HOH HOH A . 
J 8 HOH 270 870 318 HOH HOH A . 
J 8 HOH 271 871 319 HOH HOH A . 
J 8 HOH 272 872 320 HOH HOH A . 
J 8 HOH 273 873 322 HOH HOH A . 
J 8 HOH 274 874 323 HOH HOH A . 
J 8 HOH 275 875 324 HOH HOH A . 
J 8 HOH 276 876 325 HOH HOH A . 
J 8 HOH 277 877 326 HOH HOH A . 
J 8 HOH 278 878 327 HOH HOH A . 
J 8 HOH 279 879 328 HOH HOH A . 
J 8 HOH 280 880 330 HOH HOH A . 
J 8 HOH 281 881 331 HOH HOH A . 
J 8 HOH 282 882 332 HOH HOH A . 
J 8 HOH 283 883 333 HOH HOH A . 
J 8 HOH 284 884 334 HOH HOH A . 
J 8 HOH 285 885 335 HOH HOH A . 
J 8 HOH 286 886 337 HOH HOH A . 
J 8 HOH 287 887 338 HOH HOH A . 
J 8 HOH 288 888 339 HOH HOH A . 
J 8 HOH 289 889 340 HOH HOH A . 
J 8 HOH 290 890 343 HOH HOH A . 
J 8 HOH 291 891 344 HOH HOH A . 
J 8 HOH 292 892 345 HOH HOH A . 
J 8 HOH 293 893 348 HOH HOH A . 
J 8 HOH 294 894 349 HOH HOH A . 
J 8 HOH 295 895 350 HOH HOH A . 
J 8 HOH 296 896 351 HOH HOH A . 
J 8 HOH 297 897 352 HOH HOH A . 
J 8 HOH 298 898 355 HOH HOH A . 
J 8 HOH 299 899 358 HOH HOH A . 
J 8 HOH 300 900 359 HOH HOH A . 
J 8 HOH 301 901 360 HOH HOH A . 
J 8 HOH 302 902 361 HOH HOH A . 
J 8 HOH 303 903 362 HOH HOH A . 
J 8 HOH 304 904 364 HOH HOH A . 
J 8 HOH 305 905 365 HOH HOH A . 
J 8 HOH 306 906 366 HOH HOH A . 
J 8 HOH 307 907 367 HOH HOH A . 
J 8 HOH 308 908 369 HOH HOH A . 
J 8 HOH 309 909 370 HOH HOH A . 
J 8 HOH 310 910 372 HOH HOH A . 
J 8 HOH 311 911 373 HOH HOH A . 
J 8 HOH 312 912 374 HOH HOH A . 
J 8 HOH 313 913 375 HOH HOH A . 
J 8 HOH 314 914 376 HOH HOH A . 
J 8 HOH 315 915 377 HOH HOH A . 
J 8 HOH 316 916 378 HOH HOH A . 
J 8 HOH 317 917 380 HOH HOH A . 
J 8 HOH 318 918 382 HOH HOH A . 
J 8 HOH 319 919 383 HOH HOH A . 
J 8 HOH 320 920 384 HOH HOH A . 
J 8 HOH 321 921 386 HOH HOH A . 
J 8 HOH 322 922 388 HOH HOH A . 
J 8 HOH 323 923 391 HOH HOH A . 
J 8 HOH 324 924 392 HOH HOH A . 
J 8 HOH 325 925 393 HOH HOH A . 
J 8 HOH 326 926 394 HOH HOH A . 
J 8 HOH 327 927 395 HOH HOH A . 
J 8 HOH 328 928 396 HOH HOH A . 
J 8 HOH 329 929 397 HOH HOH A . 
J 8 HOH 330 930 398 HOH HOH A . 
J 8 HOH 331 931 399 HOH HOH A . 
J 8 HOH 332 932 400 HOH HOH A . 
J 8 HOH 333 933 401 HOH HOH A . 
J 8 HOH 334 934 402 HOH HOH A . 
J 8 HOH 335 935 403 HOH HOH A . 
J 8 HOH 336 936 404 HOH HOH A . 
J 8 HOH 337 937 405 HOH HOH A . 
J 8 HOH 338 938 407 HOH HOH A . 
J 8 HOH 339 939 408 HOH HOH A . 
J 8 HOH 340 940 409 HOH HOH A . 
J 8 HOH 341 941 410 HOH HOH A . 
J 8 HOH 342 942 411 HOH HOH A . 
J 8 HOH 343 943 412 HOH HOH A . 
J 8 HOH 344 944 413 HOH HOH A . 
J 8 HOH 345 945 414 HOH HOH A . 
J 8 HOH 346 946 415 HOH HOH A . 
J 8 HOH 347 947 416 HOH HOH A . 
J 8 HOH 348 948 417 HOH HOH A . 
J 8 HOH 349 949 418 HOH HOH A . 
J 8 HOH 350 950 419 HOH HOH A . 
J 8 HOH 351 951 420 HOH HOH A . 
J 8 HOH 352 952 421 HOH HOH A . 
J 8 HOH 353 953 422 HOH HOH A . 
J 8 HOH 354 954 423 HOH HOH A . 
J 8 HOH 355 955 424 HOH HOH A . 
J 8 HOH 356 956 425 HOH HOH A . 
J 8 HOH 357 957 426 HOH HOH A . 
J 8 HOH 358 958 427 HOH HOH A . 
J 8 HOH 359 959 428 HOH HOH A . 
J 8 HOH 360 960 429 HOH HOH A . 
J 8 HOH 361 961 430 HOH HOH A . 
J 8 HOH 362 962 431 HOH HOH A . 
J 8 HOH 363 963 433 HOH HOH A . 
J 8 HOH 364 964 434 HOH HOH A . 
J 8 HOH 365 965 435 HOH HOH A . 
J 8 HOH 366 966 436 HOH HOH A . 
J 8 HOH 367 967 437 HOH HOH A . 
J 8 HOH 368 968 438 HOH HOH A . 
J 8 HOH 369 969 439 HOH HOH A . 
J 8 HOH 370 970 440 HOH HOH A . 
J 8 HOH 371 971 441 HOH HOH A . 
J 8 HOH 372 972 442 HOH HOH A . 
J 8 HOH 373 973 443 HOH HOH A . 
J 8 HOH 374 974 444 HOH HOH A . 
J 8 HOH 375 975 445 HOH HOH A . 
J 8 HOH 376 976 446 HOH HOH A . 
K 8 HOH 1   101 87  HOH HOH T . 
K 8 HOH 2   102 96  HOH HOH T . 
K 8 HOH 3   103 100 HOH HOH T . 
K 8 HOH 4   104 109 HOH HOH T . 
K 8 HOH 5   105 111 HOH HOH T . 
K 8 HOH 6   106 163 HOH HOH T . 
K 8 HOH 7   107 171 HOH HOH T . 
K 8 HOH 8   108 180 HOH HOH T . 
K 8 HOH 9   109 187 HOH HOH T . 
K 8 HOH 10  110 198 HOH HOH T . 
K 8 HOH 11  111 222 HOH HOH T . 
K 8 HOH 12  112 236 HOH HOH T . 
K 8 HOH 13  113 239 HOH HOH T . 
K 8 HOH 14  114 242 HOH HOH T . 
K 8 HOH 15  115 245 HOH HOH T . 
K 8 HOH 16  116 260 HOH HOH T . 
K 8 HOH 17  117 268 HOH HOH T . 
K 8 HOH 18  118 269 HOH HOH T . 
K 8 HOH 19  119 270 HOH HOH T . 
K 8 HOH 20  120 272 HOH HOH T . 
K 8 HOH 21  121 275 HOH HOH T . 
K 8 HOH 22  122 277 HOH HOH T . 
K 8 HOH 23  123 279 HOH HOH T . 
K 8 HOH 24  124 282 HOH HOH T . 
K 8 HOH 25  125 294 HOH HOH T . 
K 8 HOH 26  126 309 HOH HOH T . 
K 8 HOH 27  127 329 HOH HOH T . 
K 8 HOH 28  128 336 HOH HOH T . 
K 8 HOH 29  129 341 HOH HOH T . 
K 8 HOH 30  130 354 HOH HOH T . 
K 8 HOH 31  131 356 HOH HOH T . 
K 8 HOH 32  132 368 HOH HOH T . 
K 8 HOH 33  133 371 HOH HOH T . 
K 8 HOH 34  134 381 HOH HOH T . 
K 8 HOH 35  135 389 HOH HOH T . 
K 8 HOH 36  136 390 HOH HOH T . 
K 8 HOH 37  137 432 HOH HOH T . 
L 8 HOH 1   101 38  HOH HOH P . 
L 8 HOH 2   102 60  HOH HOH P . 
L 8 HOH 3   103 67  HOH HOH P . 
L 8 HOH 4   104 95  HOH HOH P . 
L 8 HOH 5   105 112 HOH HOH P . 
L 8 HOH 6   106 156 HOH HOH P . 
L 8 HOH 7   107 169 HOH HOH P . 
L 8 HOH 8   108 184 HOH HOH P . 
L 8 HOH 9   109 200 HOH HOH P . 
L 8 HOH 10  110 231 HOH HOH P . 
L 8 HOH 11  111 250 HOH HOH P . 
L 8 HOH 12  112 256 HOH HOH P . 
L 8 HOH 13  113 271 HOH HOH P . 
L 8 HOH 14  114 342 HOH HOH P . 
L 8 HOH 15  115 346 HOH HOH P . 
L 8 HOH 16  116 347 HOH HOH P . 
L 8 HOH 17  117 379 HOH HOH P . 
L 8 HOH 18  118 385 HOH HOH P . 
L 8 HOH 19  119 406 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5810  ? 
1 MORE         -69   ? 
1 'SSA (A^2)'  21770 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 94.9  ? 
2  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? J HOH .   ? A HOH 601 ? 1_555 92.9  ? 
3  O2A   ? I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? J HOH .   ? A HOH 601 ? 1_555 78.1  ? 
4  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 97.4  ? 
5  O2A   ? I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 165.9 ? 
6  O     ? J HOH .   ? A HOH 601 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 94.5  ? 
7  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 172.0 ? 
8  O2A   ? I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 83.1  ? 
9  O     ? J HOH .   ? A HOH 601 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 94.3  ? 
10 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 85.5  ? 
11 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 88.3  ? 
12 O2A   ? I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 88.9  ? 
13 O     ? J HOH .   ? A HOH 601 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 167.1 ? 
14 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 98.1  ? 
15 "O3'" ? C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 84.0  ? 
16 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   ? I DTP .   ? P DTP 504 ? 1_555 177.9 ? 
17 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   ? I DTP .   ? P DTP 504 ? 1_555 95.0  ? 
18 O1B   ? I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   ? I DTP .   ? P DTP 504 ? 1_555 83.1  ? 
19 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 95.0  ? 
20 O1B   ? I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 86.8  ? 
21 O3G   ? I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 170.0 ? 
22 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 91.0  ? 
23 O1B   ? I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 88.4  ? 
24 O3G   ? I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 98.4  ? 
25 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 81.0  ? 
26 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 94.0  ? 
27 O1B   ? I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 86.9  ? 
28 O3G   ? I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 89.3  ? 
29 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 90.4  ? 
30 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 170.5 ? 
31 O1B   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 152.8 ? 
32 O1B   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O3G   ? I DTP .   ? P DTP 504 ? 1_555 83.0  ? 
33 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O3G   ? I DTP .   ? P DTP 504 ? 1_555 79.1  ? 
34 O1B   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 86.9  ? 
35 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 109.8 ? 
36 O3G   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 169.8 ? 
37 O1B   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 87.5  ? 
38 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 112.6 ? 
39 O3G   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 89.8  ? 
40 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O2A   ? I DTP .   ? P DTP 504 ? 1_555 91.1  ? 
41 O1B   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 87.8  ? 
42 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 74.6  ? 
43 O3G   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 97.6  ? 
44 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 80.6  ? 
45 O2A   ? I DTP .   ? P DTP 504 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 170.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ECR 
_pdbx_entry_details.nonpolymer_details   'CA A 502 AND MG A 503 ARE IN ALTERNATE CONFORMATIONS OF EACH OTHER.' 
_pdbx_entry_details.sequence_details     ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 7 ? ? "C1'" T DG 7 ? ? N9    T DG 7 ? ? 111.25 108.30 2.95  0.30 N 
2 1 "O4'" P DA 7 ? ? "C4'" P DA 7 ? ? "C3'" P DA 7 ? ? 100.64 104.50 -3.86 0.40 N 
3 1 "O4'" P DT 8 ? ? "C1'" P DT 8 ? ? N1    P DT 8 ? ? 110.50 108.30 2.20  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 22.14   67.94   
2 1 TYR A 39  ? ? 68.43   179.51  
3 1 LYS A 40  ? ? -156.16 -31.72  
4 1 SER A 62  ? ? 83.41   -9.58   
5 1 SER A 217 ? ? -153.08 -155.73 
6 1 SER A 257 ? ? 97.88   -12.80  
7 1 LYS A 428 ? ? 60.87   62.11   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ECR 'double helix'        
4ECR 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 6  1_555 C DA 7 1_555 0.075  -0.043 0.222  -0.076 -17.318 2.904 1 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.239 -0.113 -0.368 -6.374 -2.307  0.227 2 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.187  -0.195 -0.004 3.892  -2.795  1.115 3 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.329  -0.112 -0.337 10.284 -7.730  1.365 4 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.513 -0.125 -0.178 -2.456 -7.136  4.141 5 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.184  -0.116 0.094  -8.302 -4.711  0.132 6 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.115 -0.135 -0.165 17.189 0.718   4.032 7 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.285 -1.196 3.443 5.988  9.544 28.027 -4.218 1.752  2.778 18.774 -11.780 
30.165 1 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.585 -0.469 3.143 -2.152 1.657 35.621 -0.995 0.654  3.148 2.704  3.512   
35.721 2 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.283  -0.675 3.262 3.315  1.604 30.708 -1.576 0.110  3.235 3.015  -6.231  
30.923 3 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.370 -0.607 3.741 -5.052 6.260 33.530 -2.131 -0.269 3.589 10.661 8.604   
34.455 4 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.609 -0.530 3.491 -1.998 0.137 37.174 -0.850 0.669  3.516 0.215  3.132   
37.226 5 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.329  0.210  2.892 -1.664 3.009 25.872 -0.260 -1.129 2.871 6.683  3.695   
26.096 6 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 water                               HOH 
#