data_4ECS
# 
_entry.id   4ECS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ECS         
NDB   NA1702       
RCSB  RCSB071454   
WWPDB D_1000071454 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ECS 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ECS 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ECS 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ?                                     ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    2   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
9 water       nat water                                                18.015    308 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ECS       4ECS   2 ? ? ? 
3 PDB 4ECS       4ECS   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ECS A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ECS T 1 ? 12  ? 4ECS   1 ? 12  ? 1 12  
3 3 4ECS P 1 ? 9   ? 4ECS   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ECS GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ECS PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ECS HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ?                               'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ECS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ECS 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   30912 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.086 
_reflns.pdbx_netI_over_sigmaI        14.4 
_reflns.B_iso_Wilson_estimate        15.190 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.95 
_reflns_shell.d_res_low                   1.98 
_reflns_shell.percent_possible_all        95.0 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.386 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             3.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ECS 
_refine.ls_number_reflns_obs                     30830 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.102 
_refine.ls_d_res_high                            1.951 
_refine.ls_percent_reflns_obs                    92.51 
_refine.ls_R_factor_obs                          0.1818 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1789 
_refine.ls_R_factor_R_free                       0.2351 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.09 
_refine.ls_number_reflns_R_free                  1568 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               20.8013 
_refine.aniso_B[1][1]                            -0.0506 
_refine.aniso_B[2][2]                            -0.0506 
_refine.aniso_B[3][3]                            0.1011 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.334 
_refine.solvent_model_param_bsol                 25.462 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.23 
_refine.overall_FOM_work_R_set                   0.8464 
_refine.B_iso_max                                91.140 
_refine.B_iso_min                                2.200 
_refine.pdbx_overall_phase_error                 22.7800 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.150 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             308 
_refine_hist.number_atoms_total               4136 
_refine_hist.d_res_high                       1.951 
_refine_hist.d_res_low                        30.102 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4024 0.012  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5514 1.123  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     612  0.069  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      633  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1563 18.786 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.9512 2.0142  11 95.0000 2750 . 0.1800 0.2476 . 126 . 2876 . 'X-RAY DIFFRACTION' . 
2.0142 2.0861  11 94.0000 2681 . 0.2010 0.3003 . 131 . 2812 . 'X-RAY DIFFRACTION' . 
2.0861 2.1696  11 94.0000 2707 . 0.1879 0.2663 . 124 . 2831 . 'X-RAY DIFFRACTION' . 
2.1696 2.2684  11 93.0000 2662 . 0.2051 0.2580 . 143 . 2805 . 'X-RAY DIFFRACTION' . 
2.2684 2.3879  11 94.0000 2681 . 0.1828 0.2598 . 150 . 2831 . 'X-RAY DIFFRACTION' . 
2.3879 2.5374  11 93.0000 2650 . 0.1854 0.2675 . 177 . 2827 . 'X-RAY DIFFRACTION' . 
2.5374 2.7332  11 93.0000 2656 . 0.1856 0.2586 . 150 . 2806 . 'X-RAY DIFFRACTION' . 
2.7332 3.0081  11 92.0000 2668 . 0.1939 0.2457 . 137 . 2805 . 'X-RAY DIFFRACTION' . 
3.0081 3.4428  11 91.0000 2601 . 0.1793 0.2279 . 152 . 2753 . 'X-RAY DIFFRACTION' . 
3.4428 4.3355  11 90.0000 2593 . 0.1517 0.1871 . 152 . 2745 . 'X-RAY DIFFRACTION' . 
4.3355 30.1057 11 88.0000 2613 . 0.1538 0.1997 . 126 . 2739 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ECS 
_struct.title                     'Human DNA polymerase eta - DNA ternary complex: Reaction in the AT crystal at pH 7.0 for 80 sec' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ECS 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 9 ? 
L N N 9 ? 
M N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? SER A 180 ? GLN A 162 SER A 177 1 ? 16 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? J DPO .   O7    B ? ? 1_555 F MG  . MG B ? P DPO 502 A MG  505 1_555 ? ? ? ? ? ? ?            2.143 ? 
metalc2  metalc ? ? J DPO .   O2    B ? ? 1_555 F MG  . MG B ? P DPO 502 A MG  505 1_555 ? ? ? ? ? ? ?            2.146 ? 
metalc3  metalc ? ? I DTP .   O1B   A ? ? 1_555 E CA  . CA A ? P DTP 501 A CA  504 1_555 ? ? ? ? ? ? ?            2.167 ? 
metalc4  metalc ? ? A ASP 16  OD2   B ? ? 1_555 D MG  . MG ? ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.168 ? 
metalc5  metalc ? ? C DT  8   "O3'" A ? ? 1_555 D MG  . MG ? ? P DT  8   A MG  503 1_555 ? ? ? ? ? ? ?            2.172 ? 
metalc6  metalc ? ? I DTP .   O3G   A ? ? 1_555 E CA  . CA A ? P DTP 501 A CA  504 1_555 ? ? ? ? ? ? ?            2.190 ? 
metalc7  metalc ? ? C DA  9   OP1   B ? ? 1_555 D MG  . MG ? ? P DA  9   A MG  503 1_555 ? ? ? ? ? ? ?            2.193 ? 
metalc8  metalc ? ? I DTP .   O2A   A ? ? 1_555 E CA  . CA A ? P DTP 501 A CA  504 1_555 ? ? ? ? ? ? ?            2.196 ? 
metalc9  metalc ? ? A ASP 16  OD1   A ? ? 1_555 E CA  . CA A ? A ASP 13  A CA  504 1_555 ? ? ? ? ? ? ?            2.228 ? 
metalc10 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MG  . MG ? ? A GLU 116 A MG  503 1_555 ? ? ? ? ? ? ?            2.257 ? 
metalc11 metalc ? ? I DTP .   O2A   A ? ? 1_555 D MG  . MG ? ? P DTP 501 A MG  503 1_555 ? ? ? ? ? ? ?            2.258 ? 
metalc12 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D MG  . MG ? ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.282 ? 
metalc13 metalc ? ? A ASP 16  OD1   B ? ? 1_555 F MG  . MG B ? A ASP 13  A MG  505 1_555 ? ? ? ? ? ? ?            2.285 ? 
metalc14 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA A ? A ASP 115 A CA  504 1_555 ? ? ? ? ? ? ?            2.301 ? 
metalc15 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F MG  . MG B ? A ASP 115 A MG  505 1_555 ? ? ? ? ? ? ?            2.301 ? 
metalc16 metalc ? ? D MG  .   MG    ? ? ? 1_555 K HOH . O  ? ? A MG  503 A HOH 603 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc17 metalc ? ? C DT  8   "O3'" B ? ? 1_555 D MG  . MG ? ? P DT  8   A MG  503 1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc18 metalc ? ? C DA  9   OP1   B ? ? 1_555 F MG  . MG B ? P DA  9   A MG  505 1_555 ? ? ? ? ? ? ?            2.356 ? 
metalc19 metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA A ? A MET 14  A CA  504 1_555 ? ? ? ? ? ? ?            2.381 ? 
metalc20 metalc ? ? A MET 17  O     ? ? ? 1_555 F MG  . MG B ? A MET 14  A MG  505 1_555 ? ? ? ? ? ? ?            2.381 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3 A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4 A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -0.04 
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -3.95 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -7.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE DTP P 501' 
AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE DPO P 502' 
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MG A 503'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 504'  
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 505'  
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 506' 
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 507' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 28 ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 28 MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 28 ASP A 18  ? ASP A 15  . ? 1_555 ? 
4  AC1 28 CYS A 19  ? CYS A 16  . ? 1_555 ? 
5  AC1 28 PHE A 20  ? PHE A 17  . ? 1_555 ? 
6  AC1 28 PHE A 21  ? PHE A 18  . ? 1_555 ? 
7  AC1 28 ILE A 51  ? ILE A 48  . ? 1_555 ? 
8  AC1 28 ALA A 52  ? ALA A 49  . ? 1_555 ? 
9  AC1 28 TYR A 55  ? TYR A 52  . ? 1_555 ? 
10 AC1 28 ARG A 58  ? ARG A 55  . ? 1_555 ? 
11 AC1 28 ARG A 64  ? ARG A 61  . ? 1_555 ? 
12 AC1 28 ASP A 118 ? ASP A 115 . ? 1_555 ? 
13 AC1 28 LYS A 234 ? LYS A 231 . ? 1_555 ? 
14 AC1 28 MG  D .   ? MG  A 503 . ? 1_555 ? 
15 AC1 28 CA  E .   ? CA  A 504 . ? 1_555 ? 
16 AC1 28 MG  F .   ? MG  A 505 . ? 1_555 ? 
17 AC1 28 HOH K .   ? HOH A 601 . ? 1_555 ? 
18 AC1 28 HOH K .   ? HOH A 602 . ? 1_555 ? 
19 AC1 28 HOH K .   ? HOH A 603 . ? 1_555 ? 
20 AC1 28 HOH K .   ? HOH A 611 . ? 1_555 ? 
21 AC1 28 HOH K .   ? HOH A 648 . ? 1_555 ? 
22 AC1 28 HOH K .   ? HOH A 714 . ? 1_555 ? 
23 AC1 28 HOH K .   ? HOH A 771 . ? 1_555 ? 
24 AC1 28 DT  C 8   ? DT  P 8   . ? 1_555 ? 
25 AC1 28 HOH M .   ? HOH P 103 . ? 1_555 ? 
26 AC1 28 DT  B 3   ? DT  T 3   . ? 1_555 ? 
27 AC1 28 DT  B 4   ? DT  T 4   . ? 1_555 ? 
28 AC1 28 DA  B 5   ? DA  T 5   . ? 1_555 ? 
29 AC2 16 ASP A 16  ? ASP A 13  . ? 1_555 ? 
30 AC2 16 MET A 17  ? MET A 14  . ? 1_555 ? 
31 AC2 16 ASP A 18  ? ASP A 15  . ? 1_555 ? 
32 AC2 16 CYS A 19  ? CYS A 16  . ? 1_555 ? 
33 AC2 16 PHE A 20  ? PHE A 17  . ? 1_555 ? 
34 AC2 16 TYR A 55  ? TYR A 52  . ? 1_555 ? 
35 AC2 16 ARG A 58  ? ARG A 55  . ? 1_555 ? 
36 AC2 16 ARG A 64  ? ARG A 61  . ? 1_555 ? 
37 AC2 16 ASP A 118 ? ASP A 115 . ? 1_555 ? 
38 AC2 16 LYS A 234 ? LYS A 231 . ? 1_555 ? 
39 AC2 16 CA  E .   ? CA  A 504 . ? 1_555 ? 
40 AC2 16 MG  F .   ? MG  A 505 . ? 1_555 ? 
41 AC2 16 HOH K .   ? HOH A 611 . ? 1_555 ? 
42 AC2 16 HOH K .   ? HOH A 648 . ? 1_555 ? 
43 AC2 16 HOH K .   ? HOH A 714 . ? 1_555 ? 
44 AC2 16 DA  C 9   ? DA  P 9   . ? 1_555 ? 
45 AC3 9  ASP A 16  ? ASP A 13  . ? 1_555 ? 
46 AC3 9  ASP A 118 ? ASP A 115 . ? 1_555 ? 
47 AC3 9  GLU A 119 ? GLU A 116 . ? 1_555 ? 
48 AC3 9  CA  E .   ? CA  A 504 . ? 1_555 ? 
49 AC3 9  MG  F .   ? MG  A 505 . ? 1_555 ? 
50 AC3 9  HOH K .   ? HOH A 603 . ? 1_555 ? 
51 AC3 9  DT  C 8   ? DT  P 8   . ? 1_555 ? 
52 AC3 9  DA  C 9   ? DA  P 9   . ? 1_555 ? 
53 AC3 9  DTP I .   ? DTP P 501 . ? 1_555 ? 
54 AC4 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
55 AC4 7  MET A 17  ? MET A 14  . ? 1_555 ? 
56 AC4 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
57 AC4 7  MG  D .   ? MG  A 503 . ? 1_555 ? 
58 AC4 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
59 AC4 7  DTP I .   ? DTP P 501 . ? 1_555 ? 
60 AC4 7  DPO J .   ? DPO P 502 . ? 1_555 ? 
61 AC5 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
62 AC5 7  MET A 17  ? MET A 14  . ? 1_555 ? 
63 AC5 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
64 AC5 7  MG  D .   ? MG  A 503 . ? 1_555 ? 
65 AC5 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
66 AC5 7  DTP I .   ? DTP P 501 . ? 1_555 ? 
67 AC5 7  DPO J .   ? DPO P 502 . ? 1_555 ? 
68 AC6 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
69 AC6 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
70 AC6 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
71 AC6 10 SER A 251 ? SER A 248 . ? 1_555 ? 
72 AC6 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
73 AC6 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
74 AC6 10 HOH K .   ? HOH A 608 . ? 1_555 ? 
75 AC6 10 HOH K .   ? HOH A 644 . ? 1_555 ? 
76 AC6 10 HOH K .   ? HOH A 655 . ? 6_545 ? 
77 AC6 10 HOH K .   ? HOH A 844 . ? 1_555 ? 
78 AC7 8  GLU A 97  ? GLU A 94  . ? 1_555 ? 
79 AC7 8  ALA A 98  ? ALA A 95  . ? 1_555 ? 
80 AC7 8  GLU A 101 ? GLU A 98  . ? 1_555 ? 
81 AC7 8  ARG A 306 ? ARG A 303 . ? 5_664 ? 
82 AC7 8  HOH K .   ? HOH A 631 . ? 1_555 ? 
83 AC7 8  HOH K .   ? HOH A 652 . ? 1_555 ? 
84 AC7 8  HOH K .   ? HOH A 737 . ? 5_664 ? 
85 AC7 8  HOH K .   ? HOH A 750 . ? 5_664 ? 
# 
_database_PDB_matrix.entry_id          4ECS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ECS 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.774 -34.294 -3.915  1.00 44.47 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.198 -34.362 -4.191  1.00 48.59 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.676 -33.284 -5.147  1.00 46.03 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.573 -32.095 -4.845  1.00 43.27 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.212 -33.700 -6.307  1.00 53.16 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.675 -32.787 -7.360  1.00 49.72 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.516 -32.191 -8.166  1.00 53.39 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.721 -31.250 -8.939  1.00 54.57 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.536 -33.692 -8.247  1.00 45.66 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.948 -35.052 -8.069  1.00 49.74 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.472 -35.113 -6.642  1.00 45.18 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.314 -32.730 -7.973  1.00 43.90 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.133 -32.275 -8.706  1.00 42.48 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.187 -31.429 -7.850  1.00 51.25 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.148 -30.975 -8.330  1.00 39.41 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.380 -33.474 -9.300  1.00 43.91 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.264 -34.441 -10.027 1.00 30.92 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.822 -34.162 -11.256 1.00 44.34 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.689 -35.683 -9.694  1.00 36.36 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.552 -35.191 -11.650 1.00 40.59 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.490 -36.126 -10.720 1.00 36.08 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.549 -31.210 -6.588  1.00 52.83 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.694 -30.451 -5.675  1.00 58.64 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.875 -28.933 -5.822  1.00 45.66 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.884 -28.369 -5.390  1.00 35.37 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.928 -30.883 -4.223  1.00 62.24 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.776 -30.541 -3.288  1.00 68.82 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.281 -31.499 -3.633  1.00 63.44 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.626 -33.011 -2.731  1.00 51.44 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.885 -28.285 -6.433  1.00 54.80 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.914 -26.840 -6.653  1.00 47.93 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.085 -26.088 -5.338  1.00 39.79 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.562 -26.499 -4.300  1.00 38.80 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.654 -26.384 -7.363  1.00 51.98 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.824 -24.985 -5.383  1.00 28.70 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.152 -24.262 -4.163  1.00 25.02 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.680 -22.808 -4.165  1.00 19.46 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.911 -22.084 -3.199  1.00 17.46 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.655 -24.318 -3.886  1.00 22.68 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.364 -23.667 -4.950  1.00 22.24 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.108 -25.772 -3.774  1.00 25.86 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.013 -22.400 -5.245  1.00 21.34 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.490 -21.048 -5.375  1.00 22.24 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.556 -19.969 -5.304  1.00 17.77 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.360 -18.950 -4.642  1.00 16.69 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.682 -20.194 -5.981  1.00 12.21 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.805 -19.258 -5.966  1.00 11.76 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.103 -18.748 -7.375  1.00 11.87 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.199 -18.256 -7.654  1.00 11.35 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.050 -19.928 -5.384  1.00 13.50 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.968 -20.210 -3.893  1.00 12.69 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.174 -20.980 -3.398  1.00 17.07 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.289 -22.178 -3.644  1.00 18.57 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 69.087 -20.297 -2.704  1.00 12.88 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.112 -18.873 -8.250  1.00 17.19 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.243 -18.521 -9.660  1.00 16.06 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.200 -17.011 -9.946  1.00 14.64 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.631 -16.580 -11.007 1.00 17.99 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.150 -19.224 -10.483 1.00 23.14 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.734 -18.910 -9.983  1.00 28.97 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.456 -19.126 -8.783  1.00 25.48 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.894 -18.447 -10.792 1.00 33.69 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.675 -16.223 -9.010  1.00 15.34 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.449 -14.794 -9.231  1.00 12.26 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.081 -13.945 -8.144  1.00 11.15 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.309 -14.421 -7.035  1.00 12.64 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.942 -14.498 -9.227  1.00 9.35  ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.157 -15.030 -10.427 1.00 17.11 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.677 -14.636 -10.299 1.00 8.57  ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.031 -15.300 -9.168  1.00 14.17 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.951 -14.843 -8.534  1.00 10.73 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.424 -15.537 -7.522  1.00 7.16  ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.384 -13.706 -8.919  1.00 12.57 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.339 -12.675 -8.445  1.00 9.67  ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.607 -11.710 -7.388  1.00 6.03  ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.474 -10.688 -7.395  1.00 7.58  ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.219 -10.044 -8.412  1.00 7.69  ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.972 -11.021 -7.530  1.00 9.67  ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.159 -10.006 -6.409  1.00 8.28  ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.095 -12.051 -7.524  1.00 7.40  ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.773 -10.559 -6.269  1.00 6.08  ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.617 -9.662  -6.205  1.00 5.94  ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.770 -8.678  -5.051  1.00 9.77  ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.207 -9.053  -3.976  1.00 9.07  ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.305 -10.450 -6.006  1.00 6.74  ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.160 -9.512  -5.701  1.00 6.28  ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.991 -11.306 -7.230  1.00 9.11  ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.421 -7.414  -5.268  1.00 9.72  ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.448 -6.455  -4.170  1.00 6.63  ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.069 -5.868  -3.941  1.00 8.41  ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.242 -5.826  -4.852  1.00 8.56  ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.482 -5.363  -4.424  1.00 7.71  ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.816 -5.449  -2.706  1.00 2.20  ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.629 -4.667  -2.395  1.00 4.38  ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.088 -3.343  -1.786  1.00 13.85 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.771 -3.324  -0.762  1.00 6.06  ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.713 -5.415  -1.427  1.00 5.77  ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.341 -4.828  -1.045  1.00 17.55 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.442 -3.886  0.158   1.00 9.05  ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.685 -4.114  -2.243  1.00 8.98  ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.743 -2.233  -2.426  1.00 4.66  ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.164 -0.945  -1.902  1.00 5.91  ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.975 -0.275  -1.280  1.00 11.69 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.932 -0.168  -1.916  1.00 9.17  ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.753 -0.032  -2.993  1.00 8.22  ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.126 1.331   -2.390  1.00 6.93  ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.970 -0.698  -3.621  1.00 10.80 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.134 0.171   -0.036  1.00 9.79  ? 13  ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 58.012 0.759   0.754   0.25 9.34  ? 13  ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 58.063 0.818   0.630   0.75 9.30  ? 13  ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.403 2.111   1.357   1.00 6.66  ? 13  ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.281 2.143   2.207   1.00 10.03 ? 13  ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.638 -0.219  1.866   0.25 8.71  ? 13  ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.353 -0.147  1.588   0.75 8.12  ? 13  ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.203 -0.088  2.297   0.25 11.45 ? 13  ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.225 0.530   2.360   0.75 9.70  ? 13  ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 55.795 1.038   2.633   0.25 9.38  ? 13  ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 56.501 1.184   3.370   0.75 14.07 ? 13  ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 55.488 -1.110  2.302   0.25 16.02 ? 13  ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 55.055 0.436   1.945   0.75 21.60 ? 13  ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.721 3.197   0.962   1.00 5.50  ? 14  MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 58.025 4.542   1.466   1.00 7.49  ? 14  MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.748 4.569   2.972   1.00 5.77  ? 14  MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.762 4.002   3.438   1.00 9.36  ? 14  MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.158 5.613   0.776   1.00 6.98  ? 14  MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.204 5.580   -0.744  1.00 9.51  ? 14  MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.892 5.536   -1.378  1.00 14.89 ? 14  MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.489 7.123   -0.871  1.00 12.42 ? 14  MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.629 5.199   3.737   1.00 6.90  ? 15  ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.422 5.282   5.179   1.00 10.21 ? 15  ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.343 6.332   5.448   1.00 11.87 ? 15  ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.316 7.357   4.775   1.00 4.33  ? 15  ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.720 5.656   5.894   1.00 9.59  ? 15  ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.809 4.594   5.735   1.00 8.05  ? 15  ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.477 3.411   5.647   1.00 8.50  ? 15  ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 62.000 4.953   5.714   1.00 11.70 ? 15  ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.473 6.060   6.427   1.00 7.37  ? 16  CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.350 6.936   6.789   1.00 8.32  ? 16  CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.987 7.925   5.684   1.00 5.48  ? 16  CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.138 9.134   5.846   1.00 6.96  ? 16  CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.635 7.687   8.099   1.00 7.09  ? 16  CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.178 8.642   8.156   1.00 13.16 ? 16  CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.490 7.398   4.575   1.00 7.96  ? 17  PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.472 8.127   3.312   1.00 9.70  ? 17  PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.729 9.475   3.322   1.00 7.26  ? 17  PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.314 10.486  2.960   1.00 4.36  ? 17  PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.989 7.219   2.178   1.00 5.11  ? 17  PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 53.992 7.868   0.833   1.00 6.16  ? 17  PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.113 8.538   0.369   1.00 5.64  ? 17  PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.864 7.804   0.020   1.00 11.33 ? 17  PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.113 9.138   -0.892  1.00 10.84 ? 17  PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.859 8.397   -1.243  1.00 11.34 ? 17  PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 53.986 9.060   -1.697  1.00 7.50  ? 17  PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.460 9.500   3.721   1.00 5.07  ? 18  PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.720 10.768  3.698   1.00 5.65  ? 18  PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.374 11.818  4.600   1.00 6.59  ? 18  PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.339 13.007  4.293   1.00 5.12  ? 18  PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.246 10.596  4.087   1.00 5.20  ? 18  PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.418 9.878   3.057   1.00 8.74  ? 18  PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 50.012 9.157   2.040   1.00 5.25  ? 18  PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 48.036 9.927   3.118   1.00 8.92  ? 18  PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.244 8.494   1.103   1.00 8.17  ? 18  PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.256 9.264   2.182   1.00 12.45 ? 18  PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.867 8.542   1.170   1.00 11.80 ? 18  PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.962 11.380  5.714   1.00 6.19  ? 19  VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.705 12.288  6.588   1.00 5.94  ? 19  VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.929 12.921  5.887   1.00 7.38  ? 19  VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.167 14.140  5.992   1.00 4.66  ? 19  VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.136 11.600  7.918   1.00 5.01  ? 19  VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.112 12.464  8.688   1.00 8.06  ? 19  VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.918 11.321  8.791   1.00 9.41  ? 19  VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.700 12.101  5.173   1.00 7.50  ? 20  GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.866 12.619  4.462   1.00 5.07  ? 20  GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.459 13.616  3.380   1.00 7.16  ? 20  GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.177 14.599  3.132   1.00 6.64  ? 20  GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.651 11.490  3.819   1.00 5.91  ? 20  GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.509 10.678  4.764   1.00 6.89  ? 20  GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.627 9.989   4.009   1.00 7.89  ? 20  GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.699 10.548  3.857   1.00 7.84  ? 20  GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.365 8.775   3.506   1.00 14.75 ? 20  GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.337 13.340  2.717   1.00 3.53  ? 21  VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.804 14.246  1.700   1.00 3.19  ? 21  VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.541 15.602  2.338   1.00 4.87  ? 21  VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.993 16.632  1.825   1.00 5.89  ? 21  VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.525 13.683  1.002   1.00 5.00  ? 21  VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.946 14.694  0.026   1.00 2.76  ? 21  VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.852 12.367  0.274   1.00 5.08  ? 21  VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.845 15.605  3.474   1.00 4.91  ? 22  GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.558 16.859  4.180   1.00 7.27  ? 22  GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.816 17.524  4.753   1.00 6.43  ? 22  GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.901 18.755  4.780   1.00 5.66  ? 22  GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.514 16.645  5.288   1.00 5.00  ? 22  GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.197 16.155  4.773   1.00 3.98  ? 22  GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.442 17.223  3.985   1.00 7.91  ? 22  GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.657 18.423  4.246   1.00 9.48  ? 22  GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.633 16.861  3.113   1.00 8.90  ? 22  GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.784 16.724  5.206   1.00 4.29  ? 23  GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.018 17.272  5.790   1.00 5.74  ? 23  GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.929 17.882  4.727   1.00 8.75  ? 23  GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.664 18.835  4.999   1.00 6.99  ? 23  GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.811 16.212  6.561   1.00 8.03  ? 23  GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.154 15.686  7.836   1.00 8.58  ? 23  GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.949 14.539  8.435   1.00 12.07 ? 23  GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.394 13.647  7.716   1.00 12.64 ? 23  GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.161 14.575  9.748   1.00 10.70 ? 23  GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.900 17.325  3.520   1.00 7.60  ? 24  ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.635 17.931  2.422   1.00 7.82  ? 24  ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.093 19.340  2.141   1.00 14.45 ? 24  ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.852 20.295  1.958   1.00 8.90  ? 24  ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.539 17.084  1.155   1.00 5.30  ? 24  ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.372 17.691  0.009   1.00 13.64 ? 24  ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.426 16.805  -1.221  1.00 8.82  ? 24  ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.139 16.746  -1.907  1.00 10.29 ? 24  ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 57.949 16.124  -3.063  1.00 8.03  ? 24  ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 58.961 15.509  -3.668  1.00 5.53  ? 24  ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.754 16.132  -3.621  1.00 7.44  ? 24  ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.770 19.453  2.112   1.00 6.07  ? 25  GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.102 20.713  1.797   1.00 13.16 ? 25  GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.223 21.724  2.931   1.00 9.82  ? 25  GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.359 22.934  2.696   1.00 9.93  ? 25  GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.625 20.466  1.487   1.00 4.84  ? 25  GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.807 21.742  1.232   1.00 9.43  ? 25  GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.334 21.427  0.942   1.00 15.17 ? 25  GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 52.013 20.347  0.471   1.00 13.90 ? 25  GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.445 22.362  1.248   1.00 17.93 ? 25  GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.175 21.227  4.160   1.00 6.88  ? 26  ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.257 22.094  5.331   1.00 15.39 ? 26  ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.404 21.724  6.272   1.00 9.33  ? 26  ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.239 20.893  7.163   1.00 7.90  ? 26  ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.918 22.106  6.086   1.00 11.10 ? 26  ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.942 23.018  7.306   1.00 15.19 ? 26  ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 55.960 23.635  7.614   1.00 8.36  ? 26  ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.812 23.109  8.002   1.00 8.86  ? 26  ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.568 22.365  6.089   1.00 9.15  ? 27  PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.781 22.050  6.847   1.00 10.82 ? 27  PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.600 22.104  8.376   1.00 12.73 ? 27  PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.341 21.419  9.082   1.00 11.04 ? 27  PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.768 23.131  6.389   1.00 13.24 ? 27  PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.300 23.515  5.029   1.00 9.81  ? 27  PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.812 23.389  5.054   1.00 7.27  ? 27  PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.639 22.887  8.860   1.00 8.32  ? 28  HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.311 22.962  10.292  1.00 14.96 ? 28  HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.888 21.620  10.880  1.00 16.23 ? 28  HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 57.924 21.433  12.095  1.00 16.07 ? 28  HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.179 23.973  10.539  1.00 20.13 ? 28  HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.626 25.401  10.527  1.00 23.67 ? 28  HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 56.874 26.412  9.967   1.00 31.17 ? 28  HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.748 25.986  11.007  1.00 26.48 ? 28  HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.518 27.558  10.098  1.00 31.76 ? 28  HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.656 27.328  10.726  1.00 34.06 ? 28  HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.469 20.696  10.021  1.00 13.13 ? 29  LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 57.008 19.382  10.480  1.00 10.55 ? 29  LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.136 18.352  10.483  1.00 11.36 ? 29  LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 57.972 17.242  11.009  1.00 10.42 ? 29  LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.888 18.857  9.579   1.00 9.45  ? 29  LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.642 19.721  9.461   1.00 13.12 ? 29  LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.687 19.084  8.470   1.00 8.79  ? 29  LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 53.993 19.907  10.837  1.00 10.61 ? 29  LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.263 18.704  9.867   1.00 7.30  ? 30  ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.371 17.765  9.722   1.00 8.23  ? 30  ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 60.971 17.422  11.085  1.00 12.73 ? 30  ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.151 18.300  11.927  1.00 9.73  ? 30  ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.457 18.319  8.792   1.00 13.96 ? 30  ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 61.032 18.402  7.327   1.00 8.35  ? 30  ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 62.055 19.111  6.447   1.00 10.30 ? 30  ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.491 19.431  5.131   1.00 13.90 ? 30  ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.182 20.000  4.148   1.00 14.41 ? 30  ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.454 20.312  4.333   1.00 9.35  ? 30  ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.601 20.261  2.989   1.00 7.30  ? 30  ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.281 16.143  11.276  1.00 9.59  ? 31  ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.912 15.650  12.510  1.00 13.39 ? 31  ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.109 15.978  13.762  1.00 21.48 ? 31  ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.673 16.335  14.800  1.00 21.82 ? 31  ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.348 16.174  12.643  1.00 18.24 ? 31  ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.187 15.897  11.400  1.00 18.50 ? 31  ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.445 14.743  11.052  1.00 26.58 ? 31  ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.607 16.960  10.724  1.00 28.87 ? 31  ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.790 15.861  13.644  1.00 10.71 ? 32  LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.872 16.080  14.750  1.00 11.98 ? 32  LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.920 14.895  14.855  1.00 8.91  ? 32  LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.706 14.194  13.876  1.00 12.87 ? 32  LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.044 17.343  14.504  1.00 14.80 ? 32  LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 58.861 18.633  14.433  1.00 16.68 ? 32  LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 59.172 19.129  15.829  1.00 30.62 ? 32  LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 59.730 20.553  15.807  1.00 35.08 ? 32  LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 59.690 21.158  17.175  1.00 34.30 ? 32  LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.343 14.672  16.049  1.00 9.80  ? 33  PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.213 13.739  16.129  1.00 10.01 ? 33  PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.067 14.396  15.373  1.00 8.16  ? 33  PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.610 15.479  15.740  1.00 7.75  ? 33  PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.909 13.669  17.628  1.00 10.90 ? 33  PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.478 14.943  18.205  1.00 16.84 ? 33  PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.659 15.301  17.344  1.00 16.67 ? 33  PRO A CD    1 
ATOM   294  N  N     A CYS A 1 37  ? 54.611 13.771  14.305  0.56 9.21  ? 34  CYS A N     1 
ATOM   295  N  N     B CYS A 1 37  ? 54.608 13.731  14.316  0.44 9.21  ? 34  CYS A N     1 
ATOM   296  C  CA    A CYS A 1 37  ? 53.514 14.365  13.577  0.56 8.59  ? 34  CYS A CA    1 
ATOM   297  C  CA    B CYS A 1 37  ? 53.697 14.332  13.349  0.44 8.69  ? 34  CYS A CA    1 
ATOM   298  C  C     A CYS A 1 37  ? 52.698 13.276  12.929  0.56 7.85  ? 34  CYS A C     1 
ATOM   299  C  C     B CYS A 1 37  ? 52.739 13.264  12.822  0.44 7.85  ? 34  CYS A C     1 
ATOM   300  O  O     A CYS A 1 37  ? 53.130 12.131  12.837  0.56 8.57  ? 34  CYS A O     1 
ATOM   301  O  O     B CYS A 1 37  ? 53.117 12.101  12.721  0.44 8.57  ? 34  CYS A O     1 
ATOM   302  C  CB    A CYS A 1 37  ? 54.024 15.384  12.555  0.56 9.92  ? 34  CYS A CB    1 
ATOM   303  C  CB    B CYS A 1 37  ? 54.524 14.940  12.205  0.44 9.27  ? 34  CYS A CB    1 
ATOM   304  S  SG    A CYS A 1 37  ? 55.026 14.680  11.242  0.56 8.62  ? 34  CYS A SG    1 
ATOM   305  S  SG    B CYS A 1 37  ? 53.603 15.744  10.868  0.44 7.23  ? 34  CYS A SG    1 
ATOM   306  N  N     . ALA A 1 38  ? 51.500 13.644  12.512  1.00 6.28  ? 35  ALA A N     1 
ATOM   307  C  CA    . ALA A 1 38  ? 50.562 12.710  11.912  1.00 5.22  ? 35  ALA A CA    1 
ATOM   308  C  C     . ALA A 1 38  ? 49.774 13.421  10.841  1.00 7.95  ? 35  ALA A C     1 
ATOM   309  O  O     . ALA A 1 38  ? 49.634 14.647  10.888  1.00 8.31  ? 35  ALA A O     1 
ATOM   310  C  CB    . ALA A 1 38  ? 49.624 12.144  12.959  1.00 8.79  ? 35  ALA A CB    1 
ATOM   311  N  N     . VAL A 1 39  ? 49.249 12.647  9.889   1.00 7.41  ? 36  VAL A N     1 
ATOM   312  C  CA    . VAL A 1 39  ? 48.335 13.175  8.898   1.00 7.85  ? 36  VAL A CA    1 
ATOM   313  C  C     . VAL A 1 39  ? 46.930 12.738  9.265   1.00 12.47 ? 36  VAL A C     1 
ATOM   314  O  O     . VAL A 1 39  ? 46.699 11.568  9.560   1.00 9.20  ? 36  VAL A O     1 
ATOM   315  C  CB    . VAL A 1 39  ? 48.680 12.703  7.474   1.00 8.09  ? 36  VAL A CB    1 
ATOM   316  C  CG1   . VAL A 1 39  ? 47.540 13.055  6.497   1.00 5.58  ? 36  VAL A CG1   1 
ATOM   317  C  CG2   . VAL A 1 39  ? 49.998 13.325  7.029   1.00 7.46  ? 36  VAL A CG2   1 
ATOM   318  N  N     . VAL A 1 40  ? 45.995 13.683  9.240   1.00 8.67  ? 37  VAL A N     1 
ATOM   319  C  CA    . VAL A 1 40  ? 44.647 13.441  9.724   1.00 6.42  ? 37  VAL A CA    1 
ATOM   320  C  C     . VAL A 1 40  ? 43.643 13.812  8.636   1.00 14.46 ? 37  VAL A C     1 
ATOM   321  O  O     . VAL A 1 40  ? 43.903 14.705  7.826   1.00 13.73 ? 37  VAL A O     1 
ATOM   322  C  CB    . VAL A 1 40  ? 44.356 14.308  10.980  1.00 11.81 ? 37  VAL A CB    1 
ATOM   323  C  CG1   A VAL A 1 40  ? 45.463 14.136  12.010  0.34 8.95  ? 37  VAL A CG1   1 
ATOM   324  C  CG1   B VAL A 1 40  ? 44.453 15.787  10.631  0.66 9.24  ? 37  VAL A CG1   1 
ATOM   325  C  CG2   A VAL A 1 40  ? 44.198 15.769  10.595  0.34 9.36  ? 37  VAL A CG2   1 
ATOM   326  C  CG2   B VAL A 1 40  ? 43.005 14.004  11.546  0.66 10.56 ? 37  VAL A CG2   1 
ATOM   327  N  N     . GLN A 1 41  ? 42.497 13.137  8.601   1.00 13.10 ? 38  GLN A N     1 
ATOM   328  C  CA    . GLN A 1 41  ? 41.444 13.571  7.682   1.00 9.34  ? 38  GLN A CA    1 
ATOM   329  C  C     . GLN A 1 41  ? 40.185 13.974  8.448   1.00 12.20 ? 38  GLN A C     1 
ATOM   330  O  O     . GLN A 1 41  ? 39.795 13.315  9.424   1.00 9.17  ? 38  GLN A O     1 
ATOM   331  C  CB    . GLN A 1 41  ? 41.173 12.566  6.552   1.00 17.23 ? 38  GLN A CB    1 
ATOM   332  C  CG    . GLN A 1 41  ? 40.763 11.179  6.968   1.00 23.61 ? 38  GLN A CG    1 
ATOM   333  C  CD    . GLN A 1 41  ? 40.816 10.184  5.805   1.00 22.65 ? 38  GLN A CD    1 
ATOM   334  O  OE1   . GLN A 1 41  ? 41.271 10.506  4.694   1.00 15.95 ? 38  GLN A OE1   1 
ATOM   335  N  NE2   . GLN A 1 41  ? 40.349 8.972   6.059   1.00 22.44 ? 38  GLN A NE2   1 
ATOM   336  N  N     . TYR A 1 42  ? 39.583 15.073  7.993   1.00 13.55 ? 39  TYR A N     1 
ATOM   337  C  CA    . TYR A 1 42  ? 38.477 15.731  8.685   1.00 14.52 ? 39  TYR A CA    1 
ATOM   338  C  C     . TYR A 1 42  ? 38.996 16.228  10.046  1.00 17.33 ? 39  TYR A C     1 
ATOM   339  O  O     . TYR A 1 42  ? 40.197 16.139  10.310  1.00 17.78 ? 39  TYR A O     1 
ATOM   340  C  CB    . TYR A 1 42  ? 37.268 14.801  8.761   1.00 15.93 ? 39  TYR A CB    1 
ATOM   341  C  CG    . TYR A 1 42  ? 36.867 14.273  7.386   1.00 11.71 ? 39  TYR A CG    1 
ATOM   342  C  CD1   . TYR A 1 42  ? 36.497 15.146  6.369   1.00 15.26 ? 39  TYR A CD1   1 
ATOM   343  C  CD2   . TYR A 1 42  ? 36.878 12.907  7.103   1.00 15.06 ? 39  TYR A CD2   1 
ATOM   344  C  CE1   . TYR A 1 42  ? 36.137 14.675  5.111   1.00 17.53 ? 39  TYR A CE1   1 
ATOM   345  C  CE2   . TYR A 1 42  ? 36.518 12.424  5.839   1.00 8.79  ? 39  TYR A CE2   1 
ATOM   346  C  CZ    . TYR A 1 42  ? 36.147 13.313  4.850   1.00 16.09 ? 39  TYR A CZ    1 
ATOM   347  O  OH    . TYR A 1 42  ? 35.779 12.845  3.595   1.00 13.88 ? 39  TYR A OH    1 
ATOM   348  N  N     . LYS A 1 43  ? 38.139 16.787  10.889  1.00 22.92 ? 40  LYS A N     1 
ATOM   349  C  CA    . LYS A 1 43  ? 38.639 17.441  12.106  1.00 24.48 ? 40  LYS A CA    1 
ATOM   350  C  C     . LYS A 1 43  ? 37.580 17.613  13.176  1.00 27.46 ? 40  LYS A C     1 
ATOM   351  O  O     . LYS A 1 43  ? 37.890 17.619  14.369  1.00 23.82 ? 40  LYS A O     1 
ATOM   352  C  CB    . LYS A 1 43  ? 39.243 18.811  11.782  1.00 24.75 ? 40  LYS A CB    1 
ATOM   353  C  CG    . LYS A 1 43  ? 40.176 19.373  12.877  1.00 40.58 ? 40  LYS A CG    1 
ATOM   354  C  CD    . LYS A 1 43  ? 41.657 19.062  12.577  1.00 33.38 ? 40  LYS A CD    1 
ATOM   355  C  CE    . LYS A 1 43  ? 42.599 19.472  13.721  1.00 34.69 ? 40  LYS A CE    1 
ATOM   356  N  NZ    . LYS A 1 43  ? 42.471 18.588  14.929  1.00 28.91 ? 40  LYS A NZ    1 
ATOM   357  N  N     . SER A 1 44  ? 36.334 17.758  12.735  1.00 20.27 ? 41  SER A N     1 
ATOM   358  C  CA    . SER A 1 44  ? 35.219 18.022  13.629  1.00 26.85 ? 41  SER A CA    1 
ATOM   359  C  C     . SER A 1 44  ? 34.981 16.901  14.627  1.00 23.93 ? 41  SER A C     1 
ATOM   360  O  O     . SER A 1 44  ? 34.811 17.157  15.817  1.00 23.36 ? 41  SER A O     1 
ATOM   361  C  CB    . SER A 1 44  ? 33.948 18.270  12.818  1.00 24.99 ? 41  SER A CB    1 
ATOM   362  O  OG    . SER A 1 44  ? 33.999 19.553  12.225  1.00 31.93 ? 41  SER A OG    1 
ATOM   363  N  N     . TRP A 1 45  ? 34.953 15.663  14.139  1.00 20.24 ? 42  TRP A N     1 
ATOM   364  C  CA    . TRP A 1 45  ? 34.712 14.514  15.003  1.00 23.95 ? 42  TRP A CA    1 
ATOM   365  C  C     . TRP A 1 45  ? 36.019 14.057  15.665  1.00 23.80 ? 42  TRP A C     1 
ATOM   366  O  O     . TRP A 1 45  ? 36.840 13.379  15.047  1.00 19.50 ? 42  TRP A O     1 
ATOM   367  C  CB    . TRP A 1 45  ? 34.060 13.368  14.217  1.00 19.94 ? 42  TRP A CB    1 
ATOM   368  C  CG    . TRP A 1 45  ? 33.583 12.221  15.067  1.00 24.58 ? 42  TRP A CG    1 
ATOM   369  C  CD1   . TRP A 1 45  ? 34.261 11.065  15.340  1.00 28.37 ? 42  TRP A CD1   1 
ATOM   370  C  CD2   . TRP A 1 45  ? 32.324 12.113  15.742  1.00 29.27 ? 42  TRP A CD2   1 
ATOM   371  N  NE1   . TRP A 1 45  ? 33.503 10.250  16.143  1.00 29.94 ? 42  TRP A NE1   1 
ATOM   372  C  CE2   . TRP A 1 45  ? 32.310 10.871  16.406  1.00 30.27 ? 42  TRP A CE2   1 
ATOM   373  C  CE3   . TRP A 1 45  ? 31.206 12.947  15.848  1.00 27.86 ? 42  TRP A CE3   1 
ATOM   374  C  CZ2   . TRP A 1 45  ? 31.227 10.445  17.171  1.00 30.92 ? 42  TRP A CZ2   1 
ATOM   375  C  CZ3   . TRP A 1 45  ? 30.129 12.522  16.605  1.00 30.04 ? 42  TRP A CZ3   1 
ATOM   376  C  CH2   . TRP A 1 45  ? 30.146 11.282  17.254  1.00 32.63 ? 42  TRP A CH2   1 
ATOM   377  N  N     . LYS A 1 46  ? 36.207 14.478  16.915  1.00 28.31 ? 43  LYS A N     1 
ATOM   378  C  CA    . LYS A 1 46  ? 37.325 14.051  17.753  1.00 14.60 ? 43  LYS A CA    1 
ATOM   379  C  C     . LYS A 1 46  ? 38.695 14.408  17.189  1.00 14.30 ? 43  LYS A C     1 
ATOM   380  O  O     . LYS A 1 46  ? 39.667 13.683  17.399  1.00 14.43 ? 43  LYS A O     1 
ATOM   381  C  CB    . LYS A 1 46  ? 37.224 12.548  18.048  1.00 21.21 ? 43  LYS A CB    1 
ATOM   382  C  CG    . LYS A 1 46  ? 35.998 12.161  18.867  1.00 31.02 ? 43  LYS A CG    1 
ATOM   383  C  CD    . LYS A 1 46  ? 35.749 10.659  18.829  1.00 30.04 ? 43  LYS A CD    1 
ATOM   384  C  CE    . LYS A 1 46  ? 34.406 10.308  19.458  1.00 39.52 ? 43  LYS A CE    1 
ATOM   385  N  NZ    . LYS A 1 46  ? 34.052 8.875   19.259  1.00 49.74 ? 43  LYS A NZ    1 
ATOM   386  N  N     . GLY A 1 47  ? 38.749 15.530  16.476  1.00 12.91 ? 44  GLY A N     1 
ATOM   387  C  CA    . GLY A 1 47  ? 39.983 16.119  16.006  1.00 13.19 ? 44  GLY A CA    1 
ATOM   388  C  C     . GLY A 1 47  ? 40.459 15.531  14.698  1.00 9.88  ? 44  GLY A C     1 
ATOM   389  O  O     . GLY A 1 47  ? 41.494 15.929  14.185  1.00 14.97 ? 44  GLY A O     1 
ATOM   390  N  N     . GLY A 1 48  ? 39.704 14.574  14.167  1.00 18.15 ? 45  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 48  ? 40.051 13.934  12.911  1.00 15.43 ? 45  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 48  ? 40.629 12.536  13.072  1.00 13.72 ? 45  GLY A C     1 
ATOM   393  O  O     . GLY A 1 48  ? 41.153 12.180  14.119  1.00 14.34 ? 45  GLY A O     1 
ATOM   394  N  N     . GLY A 1 49  ? 40.541 11.738  12.020  1.00 9.75  ? 46  GLY A N     1 
ATOM   395  C  CA    . GLY A 1 49  ? 41.061 10.378  12.061  1.00 8.41  ? 46  GLY A CA    1 
ATOM   396  C  C     . GLY A 1 49  ? 42.488 10.346  11.535  1.00 13.89 ? 46  GLY A C     1 
ATOM   397  O  O     . GLY A 1 49  ? 42.757 10.858  10.449  1.00 10.46 ? 46  GLY A O     1 
ATOM   398  N  N     . ILE A 1 50  ? 43.403 9.747   12.291  1.00 8.78  ? 47  ILE A N     1 
ATOM   399  C  CA    . ILE A 1 50  ? 44.802 9.680   11.868  1.00 8.65  ? 47  ILE A CA    1 
ATOM   400  C  C     . ILE A 1 50  ? 44.974 8.593   10.801  1.00 7.77  ? 47  ILE A C     1 
ATOM   401  O  O     . ILE A 1 50  ? 44.490 7.480   10.974  1.00 7.01  ? 47  ILE A O     1 
ATOM   402  C  CB    . ILE A 1 50  ? 45.740 9.472   13.093  1.00 10.69 ? 47  ILE A CB    1 
ATOM   403  C  CG1   . ILE A 1 50  ? 45.802 10.766  13.921  1.00 14.53 ? 47  ILE A CG1   1 
ATOM   404  C  CG2   . ILE A 1 50  ? 47.134 9.055   12.663  1.00 8.48  ? 47  ILE A CG2   1 
ATOM   405  C  CD1   . ILE A 1 50  ? 46.695 10.671  15.151  1.00 19.97 ? 47  ILE A CD1   1 
ATOM   406  N  N     . ILE A 1 51  ? 45.633 8.934   9.691   1.00 7.83  ? 48  ILE A N     1 
ATOM   407  C  CA    . ILE A 1 51  ? 45.925 7.954   8.636   1.00 6.49  ? 48  ILE A CA    1 
ATOM   408  C  C     . ILE A 1 51  ? 47.418 7.643   8.409   1.00 12.44 ? 48  ILE A C     1 
ATOM   409  O  O     . ILE A 1 51  ? 47.748 6.645   7.766   1.00 10.82 ? 48  ILE A O     1 
ATOM   410  C  CB    . ILE A 1 51  ? 45.223 8.285   7.277   1.00 11.17 ? 48  ILE A CB    1 
ATOM   411  C  CG1   . ILE A 1 51  ? 45.660 9.635   6.707   1.00 8.25  ? 48  ILE A CG1   1 
ATOM   412  C  CG2   . ILE A 1 51  ? 43.701 8.236   7.422   1.00 11.18 ? 48  ILE A CG2   1 
ATOM   413  C  CD1   . ILE A 1 51  ? 45.128 9.870   5.316   1.00 13.57 ? 48  ILE A CD1   1 
ATOM   414  N  N     . ALA A 1 52  ? 48.315 8.478   8.936   1.00 8.70  ? 49  ALA A N     1 
ATOM   415  C  CA    . ALA A 1 52  ? 49.757 8.207   8.851   1.00 5.64  ? 49  ALA A CA    1 
ATOM   416  C  C     . ALA A 1 52  ? 50.486 8.826   10.047  1.00 6.81  ? 49  ALA A C     1 
ATOM   417  O  O     . ALA A 1 52  ? 50.087 9.876   10.527  1.00 5.78  ? 49  ALA A O     1 
ATOM   418  C  CB    . ALA A 1 52  ? 50.349 8.745   7.517   1.00 7.32  ? 49  ALA A CB    1 
ATOM   419  N  N     . VAL A 1 53  ? 51.561 8.191   10.511  1.00 6.52  ? 50  VAL A N     1 
ATOM   420  C  CA    . VAL A 1 53  ? 52.240 8.637   11.737  1.00 6.21  ? 50  VAL A CA    1 
ATOM   421  C  C     . VAL A 1 53  ? 53.766 8.607   11.605  1.00 5.33  ? 50  VAL A C     1 
ATOM   422  O  O     . VAL A 1 53  ? 54.331 7.601   11.181  1.00 6.48  ? 50  VAL A O     1 
ATOM   423  C  CB    . VAL A 1 53  ? 51.830 7.743   12.941  1.00 7.50  ? 50  VAL A CB    1 
ATOM   424  C  CG1   . VAL A 1 53  ? 52.440 8.243   14.213  1.00 8.66  ? 50  VAL A CG1   1 
ATOM   425  C  CG2   . VAL A 1 53  ? 50.322 7.696   13.096  1.00 11.07 ? 50  VAL A CG2   1 
ATOM   426  N  N     . SER A 1 54  ? 54.436 9.701   11.966  1.00 7.65  ? 51  SER A N     1 
ATOM   427  C  CA    . SER A 1 54  ? 55.895 9.752   11.859  1.00 9.60  ? 51  SER A CA    1 
ATOM   428  C  C     . SER A 1 54  ? 56.477 8.825   12.910  1.00 10.59 ? 51  SER A C     1 
ATOM   429  O  O     . SER A 1 54  ? 55.821 8.522   13.913  1.00 9.11  ? 51  SER A O     1 
ATOM   430  C  CB    . SER A 1 54  ? 56.435 11.176  12.061  1.00 8.39  ? 51  SER A CB    1 
ATOM   431  O  OG    . SER A 1 54  ? 56.405 11.542  13.437  1.00 8.55  ? 51  SER A OG    1 
ATOM   432  N  N     . TYR A 1 55  ? 57.701 8.365   12.689  1.00 6.48  ? 52  TYR A N     1 
ATOM   433  C  CA    . TYR A 1 55  ? 58.308 7.439   13.642  1.00 8.77  ? 52  TYR A CA    1 
ATOM   434  C  C     . TYR A 1 55  ? 58.524 8.078   15.014  1.00 11.99 ? 52  TYR A C     1 
ATOM   435  O  O     . TYR A 1 55  ? 58.476 7.403   16.029  1.00 11.36 ? 52  TYR A O     1 
ATOM   436  C  CB    . TYR A 1 55  ? 59.592 6.828   13.073  1.00 11.48 ? 52  TYR A CB    1 
ATOM   437  C  CG    . TYR A 1 55  ? 59.246 5.751   12.080  1.00 10.98 ? 52  TYR A CG    1 
ATOM   438  C  CD1   . TYR A 1 55  ? 58.839 6.075   10.790  1.00 11.30 ? 52  TYR A CD1   1 
ATOM   439  C  CD2   . TYR A 1 55  ? 59.264 4.410   12.445  1.00 11.82 ? 52  TYR A CD2   1 
ATOM   440  C  CE1   . TYR A 1 55  ? 58.472 5.086   9.881   1.00 7.50  ? 52  TYR A CE1   1 
ATOM   441  C  CE2   . TYR A 1 55  ? 58.911 3.409   11.540  1.00 13.99 ? 52  TYR A CE2   1 
ATOM   442  C  CZ    . TYR A 1 55  ? 58.508 3.751   10.268  1.00 11.08 ? 52  TYR A CZ    1 
ATOM   443  O  OH    . TYR A 1 55  ? 58.164 2.760   9.367   1.00 14.00 ? 52  TYR A OH    1 
ATOM   444  N  N     . GLU A 1 56  ? 58.722 9.390   15.040  1.00 9.67  ? 53  GLU A N     1 
ATOM   445  C  CA    . GLU A 1 56  ? 58.833 10.109  16.307  1.00 15.09 ? 53  GLU A CA    1 
ATOM   446  C  C     . GLU A 1 56  ? 57.533 10.026  17.103  1.00 16.05 ? 53  GLU A C     1 
ATOM   447  O  O     . GLU A 1 56  ? 57.548 9.791   18.307  1.00 12.15 ? 53  GLU A O     1 
ATOM   448  C  CB    . GLU A 1 56  ? 59.203 11.576  16.062  1.00 14.09 ? 53  GLU A CB    1 
ATOM   449  C  CG    . GLU A 1 56  ? 60.582 11.809  15.471  1.00 18.03 ? 53  GLU A CG    1 
ATOM   450  C  CD    . GLU A 1 56  ? 60.666 11.617  13.953  1.00 26.81 ? 53  GLU A CD    1 
ATOM   451  O  OE1   . GLU A 1 56  ? 59.703 11.124  13.322  1.00 20.43 ? 53  GLU A OE1   1 
ATOM   452  O  OE2   . GLU A 1 56  ? 61.721 11.965  13.385  1.00 23.92 ? 53  GLU A OE2   1 
ATOM   453  N  N     . ALA A 1 57  ? 56.401 10.220  16.429  1.00 7.85  ? 54  ALA A N     1 
ATOM   454  C  CA    . ALA A 1 57  ? 55.106 10.080  17.084  1.00 10.46 ? 54  ALA A CA    1 
ATOM   455  C  C     . ALA A 1 57  ? 54.799 8.637   17.510  1.00 9.75  ? 54  ALA A C     1 
ATOM   456  O  O     . ALA A 1 57  ? 54.193 8.425   18.558  1.00 8.62  ? 54  ALA A O     1 
ATOM   457  C  CB    . ALA A 1 57  ? 53.980 10.638  16.194  1.00 11.57 ? 54  ALA A CB    1 
ATOM   458  N  N     . ARG A 1 58  ? 55.222 7.643   16.721  1.00 10.76 ? 55  ARG A N     1 
ATOM   459  C  CA    . ARG A 1 58  ? 54.924 6.242   17.071  1.00 13.48 ? 55  ARG A CA    1 
ATOM   460  C  C     . ARG A 1 58  ? 55.540 5.850   18.405  1.00 15.23 ? 55  ARG A C     1 
ATOM   461  O  O     . ARG A 1 58  ? 54.999 4.994   19.114  1.00 11.38 ? 55  ARG A O     1 
ATOM   462  C  CB    . ARG A 1 58  ? 55.413 5.273   15.999  1.00 6.09  ? 55  ARG A CB    1 
ATOM   463  C  CG    . ARG A 1 58  ? 54.784 5.500   14.656  1.00 10.56 ? 55  ARG A CG    1 
ATOM   464  C  CD    . ARG A 1 58  ? 55.393 4.579   13.606  1.00 15.22 ? 55  ARG A CD    1 
ATOM   465  N  NE    . ARG A 1 58  ? 54.962 4.990   12.280  1.00 10.33 ? 55  ARG A NE    1 
ATOM   466  C  CZ    . ARG A 1 58  ? 55.068 4.255   11.182  1.00 12.68 ? 55  ARG A CZ    1 
ATOM   467  N  NH1   . ARG A 1 58  ? 55.597 3.032   11.229  1.00 9.13  ? 55  ARG A NH1   1 
ATOM   468  N  NH2   . ARG A 1 58  ? 54.627 4.755   10.031  1.00 10.44 ? 55  ARG A NH2   1 
ATOM   469  N  N     . ALA A 1 59  ? 56.667 6.478   18.735  1.00 10.50 ? 56  ALA A N     1 
ATOM   470  C  CA    . ALA A 1 59  ? 57.353 6.226   20.001  1.00 17.52 ? 56  ALA A CA    1 
ATOM   471  C  C     . ALA A 1 59  ? 56.488 6.585   21.211  1.00 15.52 ? 56  ALA A C     1 
ATOM   472  O  O     . ALA A 1 59  ? 56.693 6.047   22.305  1.00 15.89 ? 56  ALA A O     1 
ATOM   473  C  CB    . ALA A 1 59  ? 58.691 6.973   20.053  1.00 16.72 ? 56  ALA A CB    1 
ATOM   474  N  N     . PHE A 1 60  ? 55.526 7.487   21.019  1.00 9.51  ? 57  PHE A N     1 
ATOM   475  C  CA    . PHE A 1 60  ? 54.564 7.821   22.067  1.00 9.28  ? 57  PHE A CA    1 
ATOM   476  C  C     . PHE A 1 60  ? 53.344 6.904   22.043  1.00 12.62 ? 57  PHE A C     1 
ATOM   477  O  O     . PHE A 1 60  ? 52.487 6.987   22.936  1.00 15.46 ? 57  PHE A O     1 
ATOM   478  C  CB    . PHE A 1 60  ? 54.081 9.280   21.950  1.00 9.72  ? 57  PHE A CB    1 
ATOM   479  C  CG    . PHE A 1 60  ? 55.138 10.313  22.242  1.00 15.27 ? 57  PHE A CG    1 
ATOM   480  C  CD1   . PHE A 1 60  ? 55.271 10.853  23.514  1.00 26.89 ? 57  PHE A CD1   1 
ATOM   481  C  CD2   . PHE A 1 60  ? 55.979 10.763  21.239  1.00 10.14 ? 57  PHE A CD2   1 
ATOM   482  C  CE1   . PHE A 1 60  ? 56.236 11.819  23.782  1.00 23.24 ? 57  PHE A CE1   1 
ATOM   483  C  CE2   . PHE A 1 60  ? 56.948 11.724  21.490  1.00 11.00 ? 57  PHE A CE2   1 
ATOM   484  C  CZ    . PHE A 1 60  ? 57.074 12.259  22.765  1.00 24.80 ? 57  PHE A CZ    1 
ATOM   485  N  N     . GLY A 1 61  ? 53.245 6.050   21.023  1.00 12.67 ? 58  GLY A N     1 
ATOM   486  C  CA    . GLY A 1 61  ? 52.132 5.116   20.910  1.00 12.04 ? 58  GLY A CA    1 
ATOM   487  C  C     . GLY A 1 61  ? 51.006 5.592   20.010  1.00 13.89 ? 58  GLY A C     1 
ATOM   488  O  O     . GLY A 1 61  ? 49.905 5.036   20.007  1.00 10.01 ? 58  GLY A O     1 
ATOM   489  N  N     . VAL A 1 62  ? 51.270 6.645   19.248  1.00 11.41 ? 59  VAL A N     1 
ATOM   490  C  CA    . VAL A 1 62  ? 50.311 7.136   18.270  1.00 9.37  ? 59  VAL A CA    1 
ATOM   491  C  C     . VAL A 1 62  ? 50.218 6.136   17.132  1.00 11.01 ? 59  VAL A C     1 
ATOM   492  O  O     . VAL A 1 62  ? 51.238 5.637   16.674  1.00 11.49 ? 59  VAL A O     1 
ATOM   493  C  CB    . VAL A 1 62  ? 50.741 8.513   17.714  1.00 6.31  ? 59  VAL A CB    1 
ATOM   494  C  CG1   . VAL A 1 62  ? 49.760 8.984   16.661  1.00 13.29 ? 59  VAL A CG1   1 
ATOM   495  C  CG2   . VAL A 1 62  ? 50.808 9.523   18.850  1.00 10.49 ? 59  VAL A CG2   1 
ATOM   496  N  N     . THR A 1 63  ? 48.996 5.843   16.684  1.00 11.89 ? 60  THR A N     1 
ATOM   497  C  CA    . THR A 1 63  ? 48.791 4.871   15.621  1.00 12.67 ? 60  THR A CA    1 
ATOM   498  C  C     . THR A 1 63  ? 47.810 5.374   14.573  1.00 11.28 ? 60  THR A C     1 
ATOM   499  O  O     . THR A 1 63  ? 47.029 6.294   14.820  1.00 13.34 ? 60  THR A O     1 
ATOM   500  C  CB    . THR A 1 63  ? 48.259 3.520   16.172  1.00 16.04 ? 60  THR A CB    1 
ATOM   501  O  OG1   . THR A 1 63  ? 46.954 3.700   16.747  1.00 17.67 ? 60  THR A OG1   1 
ATOM   502  C  CG2   . THR A 1 63  ? 49.202 2.969   17.227  1.00 9.90  ? 60  THR A CG2   1 
ATOM   503  N  N     . ARG A 1 64  ? 47.870 4.761   13.399  1.00 12.77 ? 61  ARG A N     1 
ATOM   504  C  CA    . ARG A 1 64  ? 46.808 4.858   12.409  1.00 12.09 ? 61  ARG A CA    1 
ATOM   505  C  C     . ARG A 1 64  ? 45.471 4.465   13.041  1.00 17.47 ? 61  ARG A C     1 
ATOM   506  O  O     . ARG A 1 64  ? 45.415 3.589   13.915  1.00 15.89 ? 61  ARG A O     1 
ATOM   507  C  CB    . ARG A 1 64  ? 47.130 3.930   11.235  1.00 16.21 ? 61  ARG A CB    1 
ATOM   508  C  CG    A ARG A 1 64  ? 46.029 3.734   10.204  0.85 27.19 ? 61  ARG A CG    1 
ATOM   509  C  CG    B ARG A 1 64  ? 45.942 3.666   10.320  0.15 26.12 ? 61  ARG A CG    1 
ATOM   510  C  CD    A ARG A 1 64  ? 46.607 3.048   8.964   0.85 20.45 ? 61  ARG A CD    1 
ATOM   511  C  CD    B ARG A 1 64  ? 46.350 2.947   9.042   0.15 20.29 ? 61  ARG A CD    1 
ATOM   512  N  NE    A ARG A 1 64  ? 47.627 3.905   8.366   0.85 20.15 ? 61  ARG A NE    1 
ATOM   513  N  NE    B ARG A 1 64  ? 46.539 1.511   9.227   0.15 19.94 ? 61  ARG A NE    1 
ATOM   514  C  CZ    A ARG A 1 64  ? 48.815 3.493   7.930   0.85 21.21 ? 61  ARG A CZ    1 
ATOM   515  C  CZ    B ARG A 1 64  ? 47.670 0.947   9.641   0.15 19.63 ? 61  ARG A CZ    1 
ATOM   516  N  NH1   A ARG A 1 64  ? 49.155 2.209   7.998   0.85 20.88 ? 61  ARG A NH1   1 
ATOM   517  N  NH1   B ARG A 1 64  ? 48.722 1.696   9.935   0.15 21.58 ? 61  ARG A NH1   1 
ATOM   518  N  NH2   A ARG A 1 64  ? 49.662 4.377   7.411   0.85 14.32 ? 61  ARG A NH2   1 
ATOM   519  N  NH2   B ARG A 1 64  ? 47.746 -0.369  9.771   0.15 23.02 ? 61  ARG A NH2   1 
ATOM   520  N  N     . SER A 1 65  ? 44.407 5.134   12.600  1.00 14.20 ? 62  SER A N     1 
ATOM   521  C  CA    . SER A 1 65  ? 43.021 4.849   12.984  1.00 20.90 ? 62  SER A CA    1 
ATOM   522  C  C     . SER A 1 65  ? 42.622 5.509   14.297  1.00 19.47 ? 62  SER A C     1 
ATOM   523  O  O     . SER A 1 65  ? 41.454 5.525   14.670  1.00 33.41 ? 62  SER A O     1 
ATOM   524  C  CB    . SER A 1 65  ? 42.752 3.348   13.060  1.00 19.84 ? 62  SER A CB    1 
ATOM   525  O  OG    . SER A 1 65  ? 42.812 2.909   14.407  1.00 33.48 ? 62  SER A OG    1 
ATOM   526  N  N     . MET A 1 66  ? 43.607 6.037   15.002  1.00 21.76 ? 63  MET A N     1 
ATOM   527  C  CA    . MET A 1 66  ? 43.382 6.720   16.260  1.00 9.45  ? 63  MET A CA    1 
ATOM   528  C  C     . MET A 1 66  ? 42.780 8.086   15.937  1.00 13.89 ? 63  MET A C     1 
ATOM   529  O  O     . MET A 1 66  ? 43.160 8.703   14.942  1.00 12.71 ? 63  MET A O     1 
ATOM   530  C  CB    . MET A 1 66  ? 44.744 6.877   16.926  1.00 16.74 ? 63  MET A CB    1 
ATOM   531  C  CG    . MET A 1 66  ? 44.783 7.370   18.333  1.00 19.05 ? 63  MET A CG    1 
ATOM   532  S  SD    . MET A 1 66  ? 46.449 7.064   18.970  1.00 14.83 ? 63  MET A SD    1 
ATOM   533  C  CE    . MET A 1 66  ? 46.362 5.356   19.480  1.00 11.76 ? 63  MET A CE    1 
ATOM   534  N  N     . TRP A 1 67  ? 41.831 8.549   16.752  1.00 13.81 ? 64  TRP A N     1 
ATOM   535  C  CA    . TRP A 1 67  ? 41.343 9.930   16.650  1.00 14.34 ? 64  TRP A CA    1 
ATOM   536  C  C     . TRP A 1 67  ? 42.425 10.883  17.132  1.00 12.42 ? 64  TRP A C     1 
ATOM   537  O  O     . TRP A 1 67  ? 43.113 10.588  18.111  1.00 14.27 ? 64  TRP A O     1 
ATOM   538  C  CB    . TRP A 1 67  ? 40.088 10.141  17.508  1.00 11.62 ? 64  TRP A CB    1 
ATOM   539  C  CG    . TRP A 1 67  ? 38.947 9.301   17.092  1.00 17.06 ? 64  TRP A CG    1 
ATOM   540  C  CD1   . TRP A 1 67  ? 38.346 8.314   17.821  1.00 16.61 ? 64  TRP A CD1   1 
ATOM   541  C  CD2   . TRP A 1 67  ? 38.276 9.332   15.823  1.00 20.61 ? 64  TRP A CD2   1 
ATOM   542  N  NE1   . TRP A 1 67  ? 37.339 7.731   17.084  1.00 21.43 ? 64  TRP A NE1   1 
ATOM   543  C  CE2   . TRP A 1 67  ? 37.276 8.337   15.855  1.00 25.62 ? 64  TRP A CE2   1 
ATOM   544  C  CE3   . TRP A 1 67  ? 38.426 10.104  14.663  1.00 18.87 ? 64  TRP A CE3   1 
ATOM   545  C  CZ2   . TRP A 1 67  ? 36.423 8.096   14.775  1.00 25.37 ? 64  TRP A CZ2   1 
ATOM   546  C  CZ3   . TRP A 1 67  ? 37.586 9.859   13.589  1.00 16.06 ? 64  TRP A CZ3   1 
ATOM   547  C  CH2   . TRP A 1 67  ? 36.591 8.864   13.655  1.00 16.78 ? 64  TRP A CH2   1 
ATOM   548  N  N     . ALA A 1 68  ? 42.571 12.032  16.473  1.00 12.43 ? 65  ALA A N     1 
ATOM   549  C  CA    . ALA A 1 68  ? 43.608 12.985  16.871  1.00 15.14 ? 65  ALA A CA    1 
ATOM   550  C  C     . ALA A 1 68  ? 43.460 13.470  18.312  1.00 12.71 ? 65  ALA A C     1 
ATOM   551  O  O     . ALA A 1 68  ? 44.463 13.708  18.993  1.00 11.22 ? 65  ALA A O     1 
ATOM   552  C  CB    . ALA A 1 68  ? 43.673 14.174  15.902  1.00 11.72 ? 65  ALA A CB    1 
ATOM   553  N  N     . ASP A 1 69  ? 42.225 13.628  18.787  1.00 12.34 ? 66  ASP A N     1 
ATOM   554  C  CA    . ASP A 1 69  ? 42.047 14.049  20.175  1.00 15.17 ? 66  ASP A CA    1 
ATOM   555  C  C     . ASP A 1 69  ? 42.681 13.027  21.125  1.00 16.24 ? 66  ASP A C     1 
ATOM   556  O  O     . ASP A 1 69  ? 43.296 13.394  22.124  1.00 14.10 ? 66  ASP A O     1 
ATOM   557  C  CB    . ASP A 1 69  ? 40.573 14.263  20.524  1.00 19.95 ? 66  ASP A CB    1 
ATOM   558  C  CG    . ASP A 1 69  ? 39.993 15.510  19.880  1.00 23.01 ? 66  ASP A CG    1 
ATOM   559  O  OD1   . ASP A 1 69  ? 40.760 16.302  19.282  1.00 22.35 ? 66  ASP A OD1   1 
ATOM   560  O  OD2   . ASP A 1 69  ? 38.769 15.705  19.984  1.00 22.45 ? 66  ASP A OD2   1 
ATOM   561  N  N     . ASP A 1 70  ? 42.543 11.748  20.795  1.00 11.72 ? 67  ASP A N     1 
ATOM   562  C  CA    . ASP A 1 70  ? 43.084 10.682  21.636  1.00 11.47 ? 67  ASP A CA    1 
ATOM   563  C  C     . ASP A 1 70  ? 44.602 10.583  21.504  1.00 10.73 ? 67  ASP A C     1 
ATOM   564  O  O     . ASP A 1 70  ? 45.320 10.362  22.488  1.00 10.40 ? 67  ASP A O     1 
ATOM   565  C  CB    . ASP A 1 70  ? 42.425 9.352   21.281  1.00 12.27 ? 67  ASP A CB    1 
ATOM   566  C  CG    . ASP A 1 70  ? 40.939 9.334   21.605  1.00 22.50 ? 67  ASP A CG    1 
ATOM   567  O  OD1   . ASP A 1 70  ? 40.518 10.060  22.536  1.00 17.92 ? 67  ASP A OD1   1 
ATOM   568  O  OD2   . ASP A 1 70  ? 40.196 8.603   20.919  1.00 22.83 ? 67  ASP A OD2   1 
ATOM   569  N  N     . ALA A 1 71  ? 45.094 10.752  20.279  1.00 9.03  ? 68  ALA A N     1 
ATOM   570  C  CA    . ALA A 1 71  ? 46.529 10.807  20.046  1.00 11.34 ? 68  ALA A CA    1 
ATOM   571  C  C     . ALA A 1 71  ? 47.200 11.902  20.892  1.00 10.63 ? 68  ALA A C     1 
ATOM   572  O  O     . ALA A 1 71  ? 48.273 11.688  21.439  1.00 13.52 ? 68  ALA A O     1 
ATOM   573  C  CB    . ALA A 1 71  ? 46.831 11.016  18.549  1.00 10.18 ? 68  ALA A CB    1 
ATOM   574  N  N     . LYS A 1 72  ? 46.579 13.073  20.967  1.00 8.63  ? 69  LYS A N     1 
ATOM   575  C  CA    . LYS A 1 72  ? 47.122 14.195  21.753  1.00 11.98 ? 69  LYS A CA    1 
ATOM   576  C  C     . LYS A 1 72  ? 47.220 13.857  23.241  1.00 11.62 ? 69  LYS A C     1 
ATOM   577  O  O     . LYS A 1 72  ? 47.988 14.473  23.992  1.00 11.22 ? 69  LYS A O     1 
ATOM   578  C  CB    . LYS A 1 72  ? 46.263 15.453  21.551  1.00 14.61 ? 69  LYS A CB    1 
ATOM   579  C  CG    . LYS A 1 72  ? 46.648 16.294  20.327  1.00 18.84 ? 69  LYS A CG    1 
ATOM   580  C  CD    . LYS A 1 72  ? 47.944 17.069  20.581  1.00 13.87 ? 69  LYS A CD    1 
ATOM   581  C  CE    . LYS A 1 72  ? 48.107 18.265  19.636  1.00 18.01 ? 69  LYS A CE    1 
ATOM   582  N  NZ    . LYS A 1 72  ? 49.426 18.969  19.853  1.00 16.21 ? 69  LYS A NZ    1 
ATOM   583  N  N     . LYS A 1 73  ? 46.442 12.870  23.671  1.00 14.14 ? 70  LYS A N     1 
ATOM   584  C  CA    . LYS A 1 73  ? 46.507 12.427  25.053  1.00 16.25 ? 70  LYS A CA    1 
ATOM   585  C  C     . LYS A 1 73  ? 47.795 11.647  25.282  1.00 16.54 ? 70  LYS A C     1 
ATOM   586  O  O     . LYS A 1 73  ? 48.376 11.709  26.360  1.00 13.77 ? 70  LYS A O     1 
ATOM   587  C  CB    . LYS A 1 73  ? 45.273 11.592  25.413  1.00 11.21 ? 70  LYS A CB    1 
ATOM   588  C  CG    . LYS A 1 73  ? 43.964 12.332  25.241  1.00 7.68  ? 70  LYS A CG    1 
ATOM   589  C  CD    . LYS A 1 73  ? 42.774 11.395  25.554  1.00 12.06 ? 70  LYS A CD    1 
ATOM   590  C  CE    . LYS A 1 73  ? 41.445 12.007  25.127  1.00 13.72 ? 70  LYS A CE    1 
ATOM   591  N  NZ    . LYS A 1 73  ? 40.358 10.983  25.128  1.00 20.88 ? 70  LYS A NZ    1 
ATOM   592  N  N     . LEU A 1 74  ? 48.245 10.927  24.257  1.00 9.46  ? 71  LEU A N     1 
ATOM   593  C  CA    . LEU A 1 74  ? 49.515 10.194  24.338  1.00 11.73 ? 71  LEU A CA    1 
ATOM   594  C  C     . LEU A 1 74  ? 50.698 11.105  24.016  1.00 17.34 ? 71  LEU A C     1 
ATOM   595  O  O     . LEU A 1 74  ? 51.804 10.943  24.548  1.00 10.71 ? 71  LEU A O     1 
ATOM   596  C  CB    . LEU A 1 74  ? 49.526 9.028   23.344  1.00 8.71  ? 71  LEU A CB    1 
ATOM   597  C  CG    . LEU A 1 74  ? 48.500 7.907   23.491  1.00 16.70 ? 71  LEU A CG    1 
ATOM   598  C  CD1   . LEU A 1 74  ? 48.816 6.815   22.476  1.00 11.76 ? 71  LEU A CD1   1 
ATOM   599  C  CD2   . LEU A 1 74  ? 48.510 7.347   24.900  1.00 7.84  ? 71  LEU A CD2   1 
ATOM   600  N  N     . CYS A 1 75  ? 50.464 12.054  23.118  1.00 10.37 ? 72  CYS A N     1 
ATOM   601  C  CA    . CYS A 1 75  ? 51.549 12.856  22.574  1.00 7.14  ? 72  CYS A CA    1 
ATOM   602  C  C     . CYS A 1 75  ? 51.077 14.298  22.435  1.00 14.60 ? 72  CYS A C     1 
ATOM   603  O  O     . CYS A 1 75  ? 50.586 14.713  21.375  1.00 12.55 ? 72  CYS A O     1 
ATOM   604  C  CB    . CYS A 1 75  ? 51.978 12.287  21.225  1.00 15.58 ? 72  CYS A CB    1 
ATOM   605  S  SG    . CYS A 1 75  ? 53.333 13.180  20.485  1.00 17.91 ? 72  CYS A SG    1 
ATOM   606  N  N     . PRO A 1 76  ? 51.181 15.063  23.527  1.00 10.32 ? 73  PRO A N     1 
ATOM   607  C  CA    . PRO A 1 76  ? 50.569 16.398  23.567  1.00 15.03 ? 73  PRO A CA    1 
ATOM   608  C  C     . PRO A 1 76  ? 51.186 17.392  22.576  1.00 11.59 ? 73  PRO A C     1 
ATOM   609  O  O     . PRO A 1 76  ? 50.501 18.319  22.140  1.00 17.53 ? 73  PRO A O     1 
ATOM   610  C  CB    . PRO A 1 76  ? 50.803 16.844  25.015  1.00 16.54 ? 73  PRO A CB    1 
ATOM   611  C  CG    . PRO A 1 76  ? 50.918 15.554  25.783  1.00 21.01 ? 73  PRO A CG    1 
ATOM   612  C  CD    . PRO A 1 76  ? 51.665 14.636  24.852  1.00 16.55 ? 73  PRO A CD    1 
ATOM   613  N  N     . ASP A 1 77  ? 52.449 17.208  22.227  1.00 14.84 ? 74  ASP A N     1 
ATOM   614  C  CA    . ASP A 1 77  ? 53.083 18.098  21.252  1.00 16.10 ? 74  ASP A CA    1 
ATOM   615  C  C     . ASP A 1 77  ? 52.964 17.584  19.820  1.00 19.31 ? 74  ASP A C     1 
ATOM   616  O  O     . ASP A 1 77  ? 53.641 18.098  18.924  1.00 15.56 ? 74  ASP A O     1 
ATOM   617  C  CB    . ASP A 1 77  ? 54.559 18.307  21.582  1.00 17.64 ? 74  ASP A CB    1 
ATOM   618  C  CG    . ASP A 1 77  ? 54.764 18.986  22.916  1.00 34.64 ? 74  ASP A CG    1 
ATOM   619  O  OD1   . ASP A 1 77  ? 55.643 18.534  23.678  1.00 39.61 ? 74  ASP A OD1   1 
ATOM   620  O  OD2   . ASP A 1 77  ? 54.043 19.966  23.204  1.00 33.70 ? 74  ASP A OD2   1 
ATOM   621  N  N     . LEU A 1 78  ? 52.122 16.573  19.609  1.00 9.78  ? 75  LEU A N     1 
ATOM   622  C  CA    . LEU A 1 78  ? 51.904 16.022  18.273  1.00 9.09  ? 75  LEU A CA    1 
ATOM   623  C  C     . LEU A 1 78  ? 51.550 17.129  17.292  1.00 9.52  ? 75  LEU A C     1 
ATOM   624  O  O     . LEU A 1 78  ? 50.676 17.936  17.562  1.00 10.28 ? 75  LEU A O     1 
ATOM   625  C  CB    . LEU A 1 78  ? 50.773 14.991  18.300  1.00 10.39 ? 75  LEU A CB    1 
ATOM   626  C  CG    . LEU A 1 78  ? 50.396 14.301  16.990  1.00 7.21  ? 75  LEU A CG    1 
ATOM   627  C  CD1   . LEU A 1 78  ? 51.539 13.450  16.452  1.00 5.78  ? 75  LEU A CD1   1 
ATOM   628  C  CD2   . LEU A 1 78  ? 49.133 13.438  17.184  1.00 10.83 ? 75  LEU A CD2   1 
ATOM   629  N  N     . LEU A 1 79  ? 52.219 17.164  16.147  1.00 7.09  ? 76  LEU A N     1 
ATOM   630  C  CA    . LEU A 1 79  ? 51.863 18.130  15.119  1.00 6.68  ? 76  LEU A CA    1 
ATOM   631  C  C     . LEU A 1 79  ? 50.989 17.419  14.106  1.00 11.29 ? 76  LEU A C     1 
ATOM   632  O  O     . LEU A 1 79  ? 51.119 16.221  13.918  1.00 7.13  ? 76  LEU A O     1 
ATOM   633  C  CB    . LEU A 1 79  ? 53.116 18.686  14.440  1.00 3.12  ? 76  LEU A CB    1 
ATOM   634  C  CG    . LEU A 1 79  ? 54.062 19.431  15.387  1.00 8.57  ? 76  LEU A CG    1 
ATOM   635  C  CD1   . LEU A 1 79  ? 55.225 20.077  14.622  1.00 10.32 ? 76  LEU A CD1   1 
ATOM   636  C  CD2   . LEU A 1 79  ? 53.316 20.455  16.233  1.00 6.34  ? 76  LEU A CD2   1 
ATOM   637  N  N     . LEU A 1 80  ? 50.093 18.151  13.455  1.00 10.88 ? 77  LEU A N     1 
ATOM   638  C  CA    . LEU A 1 80  ? 49.198 17.530  12.483  1.00 8.23  ? 77  LEU A CA    1 
ATOM   639  C  C     . LEU A 1 80  ? 49.169 18.251  11.140  1.00 17.21 ? 77  LEU A C     1 
ATOM   640  O  O     . LEU A 1 80  ? 49.311 19.470  11.075  1.00 17.00 ? 77  LEU A O     1 
ATOM   641  C  CB    . LEU A 1 80  ? 47.784 17.466  13.040  1.00 10.52 ? 77  LEU A CB    1 
ATOM   642  C  CG    . LEU A 1 80  ? 47.639 16.724  14.358  1.00 10.53 ? 77  LEU A CG    1 
ATOM   643  C  CD1   . LEU A 1 80  ? 46.237 16.911  14.849  1.00 9.99  ? 77  LEU A CD1   1 
ATOM   644  C  CD2   . LEU A 1 80  ? 47.967 15.228  14.180  1.00 12.57 ? 77  LEU A CD2   1 
ATOM   645  N  N     . ALA A 1 81  ? 48.983 17.479  10.076  1.00 8.89  ? 78  ALA A N     1 
ATOM   646  C  CA    . ALA A 1 81  ? 48.734 18.025  8.748   1.00 10.59 ? 78  ALA A CA    1 
ATOM   647  C  C     . ALA A 1 81  ? 47.416 17.424  8.297   1.00 7.26  ? 78  ALA A C     1 
ATOM   648  O  O     . ALA A 1 81  ? 47.182 16.231  8.476   1.00 12.35 ? 78  ALA A O     1 
ATOM   649  C  CB    . ALA A 1 81  ? 49.854 17.660  7.792   1.00 12.61 ? 78  ALA A CB    1 
ATOM   650  N  N     . GLN A 1 82  ? 46.532 18.247  7.751   1.00 6.55  ? 79  GLN A N     1 
ATOM   651  C  CA    . GLN A 1 82  ? 45.212 17.769  7.346   1.00 10.35 ? 79  GLN A CA    1 
ATOM   652  C  C     . GLN A 1 82  ? 45.172 17.439  5.867   1.00 7.55  ? 79  GLN A C     1 
ATOM   653  O  O     . GLN A 1 82  ? 45.743 18.159  5.050   1.00 10.62 ? 79  GLN A O     1 
ATOM   654  C  CB    . GLN A 1 82  ? 44.147 18.829  7.614   1.00 16.84 ? 79  GLN A CB    1 
ATOM   655  C  CG    . GLN A 1 82  ? 43.720 18.978  9.052   1.00 32.49 ? 79  GLN A CG    1 
ATOM   656  C  CD    . GLN A 1 82  ? 42.581 19.969  9.181   1.00 40.90 ? 79  GLN A CD    1 
ATOM   657  O  OE1   . GLN A 1 82  ? 42.799 21.148  9.464   1.00 33.90 ? 79  GLN A OE1   1 
ATOM   658  N  NE2   . GLN A 1 82  ? 41.355 19.498  8.946   1.00 31.87 ? 79  GLN A NE2   1 
ATOM   659  N  N     . VAL A 1 83  ? 44.483 16.355  5.528   1.00 7.36  ? 80  VAL A N     1 
ATOM   660  C  CA    . VAL A 1 83  ? 44.249 16.012  4.139   1.00 9.71  ? 80  VAL A CA    1 
ATOM   661  C  C     . VAL A 1 83  ? 43.357 17.094  3.531   1.00 16.13 ? 80  VAL A C     1 
ATOM   662  O  O     . VAL A 1 83  ? 42.418 17.580  4.168   1.00 7.39  ? 80  VAL A O     1 
ATOM   663  C  CB    . VAL A 1 83  ? 43.565 14.649  4.002   1.00 12.22 ? 80  VAL A CB    1 
ATOM   664  C  CG1   . VAL A 1 83  ? 43.227 14.361  2.552   1.00 8.20  ? 80  VAL A CG1   1 
ATOM   665  C  CG2   . VAL A 1 83  ? 44.455 13.543  4.593   1.00 12.66 ? 80  VAL A CG2   1 
ATOM   666  N  N     . ARG A 1 84  ? 43.662 17.463  2.296   1.00 10.15 ? 81  ARG A N     1 
ATOM   667  C  CA    . ARG A 1 84  ? 42.897 18.473  1.575   1.00 11.62 ? 81  ARG A CA    1 
ATOM   668  C  C     . ARG A 1 84  ? 41.431 18.071  1.440   1.00 9.20  ? 81  ARG A C     1 
ATOM   669  O  O     . ARG A 1 84  ? 41.102 16.901  1.287   1.00 12.97 ? 81  ARG A O     1 
ATOM   670  C  CB    . ARG A 1 84  ? 43.505 18.679  0.187   1.00 16.09 ? 81  ARG A CB    1 
ATOM   671  C  CG    . ARG A 1 84  ? 42.675 19.561  -0.763  1.00 18.32 ? 81  ARG A CG    1 
ATOM   672  C  CD    . ARG A 1 84  ? 43.214 19.433  -2.202  1.00 32.01 ? 81  ARG A CD    1 
ATOM   673  N  NE    . ARG A 1 84  ? 42.324 20.028  -3.197  1.00 46.68 ? 81  ARG A NE    1 
ATOM   674  C  CZ    . ARG A 1 84  ? 42.417 19.834  -4.513  1.00 53.17 ? 81  ARG A CZ    1 
ATOM   675  N  NH1   . ARG A 1 84  ? 43.367 19.050  -5.014  1.00 38.18 ? 81  ARG A NH1   1 
ATOM   676  N  NH2   . ARG A 1 84  ? 41.551 20.423  -5.335  1.00 37.22 ? 81  ARG A NH2   1 
ATOM   677  N  N     . GLU A 1 85  ? 40.547 19.054  1.491   1.00 12.26 ? 82  GLU A N     1 
ATOM   678  C  CA    . GLU A 1 85  ? 39.133 18.800  1.298   1.00 14.98 ? 82  GLU A CA    1 
ATOM   679  C  C     . GLU A 1 85  ? 38.666 19.533  0.053   1.00 17.91 ? 82  GLU A C     1 
ATOM   680  O  O     . GLU A 1 85  ? 38.898 20.731  -0.079  1.00 14.03 ? 82  GLU A O     1 
ATOM   681  C  CB    . GLU A 1 85  ? 38.335 19.276  2.514   1.00 19.42 ? 82  GLU A CB    1 
ATOM   682  C  CG    . GLU A 1 85  ? 38.079 18.177  3.532   1.00 29.82 ? 82  GLU A CG    1 
ATOM   683  C  CD    . GLU A 1 85  ? 37.302 18.664  4.749   1.00 37.73 ? 82  GLU A CD    1 
ATOM   684  O  OE1   . GLU A 1 85  ? 36.067 18.874  4.646   1.00 27.01 ? 82  GLU A OE1   1 
ATOM   685  O  OE2   . GLU A 1 85  ? 37.940 18.835  5.810   1.00 45.36 ? 82  GLU A OE2   1 
ATOM   686  N  N     . SER A 1 86  ? 38.025 18.808  -0.859  1.00 13.31 ? 83  SER A N     1 
ATOM   687  C  CA    . SER A 1 86  ? 37.413 19.412  -2.035  1.00 12.09 ? 83  SER A CA    1 
ATOM   688  C  C     . SER A 1 86  ? 36.042 18.802  -2.266  1.00 12.20 ? 83  SER A C     1 
ATOM   689  O  O     . SER A 1 86  ? 35.851 17.603  -2.094  1.00 10.50 ? 83  SER A O     1 
ATOM   690  C  CB    . SER A 1 86  ? 38.264 19.191  -3.285  1.00 15.03 ? 83  SER A CB    1 
ATOM   691  O  OG    . SER A 1 86  ? 39.636 19.377  -3.004  1.00 32.61 ? 83  SER A OG    1 
ATOM   692  N  N     . ARG A 1 87  ? 35.086 19.639  -2.659  1.00 14.29 ? 84  ARG A N     1 
ATOM   693  C  CA    . ARG A 1 87  ? 33.723 19.185  -2.930  1.00 17.68 ? 84  ARG A CA    1 
ATOM   694  C  C     . ARG A 1 87  ? 33.124 18.405  -1.773  1.00 18.91 ? 84  ARG A C     1 
ATOM   695  O  O     . ARG A 1 87  ? 32.371 17.447  -1.975  1.00 17.96 ? 84  ARG A O     1 
ATOM   696  C  CB    . ARG A 1 87  ? 33.665 18.369  -4.221  1.00 21.51 ? 84  ARG A CB    1 
ATOM   697  C  CG    . ARG A 1 87  ? 34.272 19.084  -5.427  1.00 17.35 ? 84  ARG A CG    1 
ATOM   698  C  CD    . ARG A 1 87  ? 34.146 18.232  -6.696  1.00 28.06 ? 84  ARG A CD    1 
ATOM   699  N  NE    . ARG A 1 87  ? 35.400 18.188  -7.450  1.00 28.69 ? 84  ARG A NE    1 
ATOM   700  C  CZ    . ARG A 1 87  ? 35.691 18.996  -8.463  1.00 35.66 ? 84  ARG A CZ    1 
ATOM   701  N  NH1   . ARG A 1 87  ? 34.813 19.913  -8.858  1.00 40.99 ? 84  ARG A NH1   1 
ATOM   702  N  NH2   . ARG A 1 87  ? 36.859 18.887  -9.081  1.00 35.77 ? 84  ARG A NH2   1 
ATOM   703  N  N     . GLY A 1 88  ? 33.468 18.827  -0.560  1.00 14.20 ? 85  GLY A N     1 
ATOM   704  C  CA    . GLY A 1 88  ? 32.914 18.249  0.647   1.00 12.89 ? 85  GLY A CA    1 
ATOM   705  C  C     . GLY A 1 88  ? 33.582 16.979  1.148   1.00 19.00 ? 85  GLY A C     1 
ATOM   706  O  O     . GLY A 1 88  ? 33.123 16.396  2.129   1.00 14.83 ? 85  GLY A O     1 
ATOM   707  N  N     . LYS A 1 89  ? 34.658 16.542  0.496   1.00 10.36 ? 86  LYS A N     1 
ATOM   708  C  CA    . LYS A 1 89  ? 35.281 15.275  0.870   1.00 9.55  ? 86  LYS A CA    1 
ATOM   709  C  C     . LYS A 1 89  ? 36.805 15.319  0.878   1.00 12.15 ? 86  LYS A C     1 
ATOM   710  O  O     . LYS A 1 89  ? 37.427 16.232  0.315   1.00 15.05 ? 86  LYS A O     1 
ATOM   711  C  CB    . LYS A 1 89  ? 34.828 14.156  -0.071  1.00 13.51 ? 86  LYS A CB    1 
ATOM   712  C  CG    . LYS A 1 89  ? 35.390 14.263  -1.488  1.00 10.59 ? 86  LYS A CG    1 
ATOM   713  C  CD    . LYS A 1 89  ? 34.861 13.156  -2.410  1.00 19.12 ? 86  LYS A CD    1 
ATOM   714  C  CE    . LYS A 1 89  ? 35.493 11.802  -2.111  1.00 10.17 ? 86  LYS A CE    1 
ATOM   715  N  NZ    . LYS A 1 89  ? 36.996 11.849  -2.207  1.00 13.70 ? 86  LYS A NZ    1 
ATOM   716  N  N     . ALA A 1 90  ? 37.407 14.305  1.494   1.00 13.89 ? 87  ALA A N     1 
ATOM   717  C  CA    . ALA A 1 90  ? 38.861 14.174  1.483   1.00 9.69  ? 87  ALA A CA    1 
ATOM   718  C  C     . ALA A 1 90  ? 39.321 13.983  0.062   1.00 10.30 ? 87  ALA A C     1 
ATOM   719  O  O     . ALA A 1 90  ? 38.666 13.301  -0.722  1.00 15.44 ? 87  ALA A O     1 
ATOM   720  C  CB    . ALA A 1 90  ? 39.312 13.014  2.336   1.00 15.76 ? 87  ALA A CB    1 
ATOM   721  N  N     . ASN A 1 91  ? 40.449 14.601  -0.273  1.00 10.74 ? 88  ASN A N     1 
ATOM   722  C  CA    . ASN A 1 91  ? 40.984 14.509  -1.621  1.00 15.31 ? 88  ASN A CA    1 
ATOM   723  C  C     . ASN A 1 91  ? 42.457 14.128  -1.572  1.00 9.38  ? 88  ASN A C     1 
ATOM   724  O  O     . ASN A 1 91  ? 43.280 14.892  -1.073  1.00 10.88 ? 88  ASN A O     1 
ATOM   725  C  CB    . ASN A 1 91  ? 40.799 15.838  -2.362  1.00 14.56 ? 88  ASN A CB    1 
ATOM   726  C  CG    . ASN A 1 91  ? 41.209 15.748  -3.825  1.00 20.67 ? 88  ASN A CG    1 
ATOM   727  O  OD1   . ASN A 1 91  ? 42.346 15.435  -4.130  1.00 13.12 ? 88  ASN A OD1   1 
ATOM   728  N  ND2   . ASN A 1 91  ? 40.266 15.988  -4.731  1.00 26.64 ? 88  ASN A ND2   1 
ATOM   729  N  N     . LEU A 1 92  ? 42.785 12.952  -2.094  1.00 10.96 ? 89  LEU A N     1 
ATOM   730  C  CA    . LEU A 1 92  ? 44.130 12.387  -1.920  1.00 10.06 ? 89  LEU A CA    1 
ATOM   731  C  C     . LEU A 1 92  ? 45.111 12.717  -3.039  1.00 11.11 ? 89  LEU A C     1 
ATOM   732  O  O     . LEU A 1 92  ? 46.183 12.119  -3.120  1.00 8.91  ? 89  LEU A O     1 
ATOM   733  C  CB    . LEU A 1 92  ? 44.044 10.867  -1.746  1.00 7.28  ? 89  LEU A CB    1 
ATOM   734  C  CG    . LEU A 1 92  ? 43.040 10.453  -0.673  1.00 10.21 ? 89  LEU A CG    1 
ATOM   735  C  CD1   . LEU A 1 92  ? 42.784 8.967   -0.772  1.00 14.25 ? 89  LEU A CD1   1 
ATOM   736  C  CD2   . LEU A 1 92  ? 43.540 10.842  0.715   1.00 13.59 ? 89  LEU A CD2   1 
ATOM   737  N  N     . THR A 1 93  ? 44.763 13.682  -3.881  1.00 8.13  ? 90  THR A N     1 
ATOM   738  C  CA    . THR A 1 93  ? 45.545 13.971  -5.079  1.00 7.98  ? 90  THR A CA    1 
ATOM   739  C  C     . THR A 1 93  ? 47.027 14.191  -4.814  1.00 11.26 ? 90  THR A C     1 
ATOM   740  O  O     . THR A 1 93  ? 47.876 13.609  -5.496  1.00 7.58  ? 90  THR A O     1 
ATOM   741  C  CB    . THR A 1 93  ? 44.977 15.185  -5.862  1.00 12.14 ? 90  THR A CB    1 
ATOM   742  O  OG1   . THR A 1 93  ? 43.659 14.872  -6.325  1.00 17.28 ? 90  THR A OG1   1 
ATOM   743  C  CG2   . THR A 1 93  ? 45.846 15.493  -7.070  1.00 10.57 ? 90  THR A CG2   1 
ATOM   744  N  N     . LYS A 1 94  ? 47.345 15.029  -3.832  1.00 8.20  ? 91  LYS A N     1 
ATOM   745  C  CA    . LYS A 1 94  ? 48.739 15.304  -3.501  1.00 4.95  ? 91  LYS A CA    1 
ATOM   746  C  C     . LYS A 1 94  ? 49.569 14.024  -3.275  1.00 7.20  ? 91  LYS A C     1 
ATOM   747  O  O     . LYS A 1 94  ? 50.740 13.949  -3.665  1.00 8.90  ? 91  LYS A O     1 
ATOM   748  C  CB    . LYS A 1 94  ? 48.813 16.216  -2.258  1.00 11.92 ? 91  LYS A CB    1 
ATOM   749  C  CG    . LYS A 1 94  ? 50.223 16.669  -1.881  1.00 13.51 ? 91  LYS A CG    1 
ATOM   750  C  CD    . LYS A 1 94  ? 50.284 17.214  -0.436  1.00 8.63  ? 91  LYS A CD    1 
ATOM   751  C  CE    . LYS A 1 94  ? 49.322 18.371  -0.211  1.00 13.41 ? 91  LYS A CE    1 
ATOM   752  N  NZ    . LYS A 1 94  ? 49.487 18.984  1.154   1.00 4.07  ? 91  LYS A NZ    1 
ATOM   753  N  N     . TYR A 1 95  ? 48.961 13.024  -2.651  1.00 4.75  ? 92  TYR A N     1 
ATOM   754  C  CA    . TYR A 1 95  ? 49.666 11.787  -2.327  1.00 8.16  ? 92  TYR A CA    1 
ATOM   755  C  C     . TYR A 1 95  ? 49.764 10.877  -3.544  1.00 9.20  ? 92  TYR A C     1 
ATOM   756  O  O     . TYR A 1 95  ? 50.777 10.208  -3.743  1.00 7.49  ? 92  TYR A O     1 
ATOM   757  C  CB    . TYR A 1 95  ? 48.993 11.081  -1.137  1.00 5.99  ? 92  TYR A CB    1 
ATOM   758  C  CG    . TYR A 1 95  ? 48.686 12.064  -0.030  1.00 6.48  ? 92  TYR A CG    1 
ATOM   759  C  CD1   . TYR A 1 95  ? 47.382 12.480  0.213   1.00 8.92  ? 92  TYR A CD1   1 
ATOM   760  C  CD2   . TYR A 1 95  ? 49.704 12.620  0.733   1.00 6.30  ? 92  TYR A CD2   1 
ATOM   761  C  CE1   . TYR A 1 95  ? 47.099 13.407  1.193   1.00 8.82  ? 92  TYR A CE1   1 
ATOM   762  C  CE2   . TYR A 1 95  ? 49.432 13.542  1.721   1.00 6.35  ? 92  TYR A CE2   1 
ATOM   763  C  CZ    . TYR A 1 95  ? 48.123 13.941  1.943   1.00 8.28  ? 92  TYR A CZ    1 
ATOM   764  O  OH    . TYR A 1 95  ? 47.825 14.872  2.918   1.00 10.80 ? 92  TYR A OH    1 
ATOM   765  N  N     . ARG A 1 96  ? 48.719 10.867  -4.369  1.00 8.11  ? 93  ARG A N     1 
ATOM   766  C  CA    . ARG A 1 96  ? 48.782 10.144  -5.642  1.00 10.98 ? 93  ARG A CA    1 
ATOM   767  C  C     . ARG A 1 96  ? 49.884 10.736  -6.538  1.00 12.46 ? 93  ARG A C     1 
ATOM   768  O  O     . ARG A 1 96  ? 50.649 9.997   -7.168  1.00 7.69  ? 93  ARG A O     1 
ATOM   769  C  CB    . ARG A 1 96  ? 47.434 10.165  -6.363  1.00 10.67 ? 93  ARG A CB    1 
ATOM   770  C  CG    . ARG A 1 96  ? 46.344 9.343   -5.675  1.00 11.10 ? 93  ARG A CG    1 
ATOM   771  C  CD    . ARG A 1 96  ? 45.108 9.180   -6.553  1.00 13.16 ? 93  ARG A CD    1 
ATOM   772  N  NE    . ARG A 1 96  ? 44.073 8.465   -5.817  1.00 16.00 ? 93  ARG A NE    1 
ATOM   773  C  CZ    . ARG A 1 96  ? 43.039 9.037   -5.204  1.00 10.48 ? 93  ARG A CZ    1 
ATOM   774  N  NH1   . ARG A 1 96  ? 42.183 8.274   -4.529  1.00 11.44 ? 93  ARG A NH1   1 
ATOM   775  N  NH2   . ARG A 1 96  ? 42.864 10.362  -5.255  1.00 12.28 ? 93  ARG A NH2   1 
ATOM   776  N  N     . GLU A 1 97  ? 49.978 12.064  -6.591  1.00 7.07  ? 94  GLU A N     1 
ATOM   777  C  CA    . GLU A 1 97  ? 51.035 12.688  -7.385  1.00 7.49  ? 94  GLU A CA    1 
ATOM   778  C  C     . GLU A 1 97  ? 52.451 12.423  -6.835  1.00 8.92  ? 94  GLU A C     1 
ATOM   779  O  O     . GLU A 1 97  ? 53.382 12.156  -7.602  1.00 10.06 ? 94  GLU A O     1 
ATOM   780  C  CB    . GLU A 1 97  ? 50.776 14.179  -7.626  1.00 10.38 ? 94  GLU A CB    1 
ATOM   781  C  CG    . GLU A 1 97  ? 49.450 14.462  -8.332  1.00 13.09 ? 94  GLU A CG    1 
ATOM   782  C  CD    . GLU A 1 97  ? 49.165 15.950  -8.536  1.00 25.02 ? 94  GLU A CD    1 
ATOM   783  O  OE1   . GLU A 1 97  ? 49.921 16.799  -8.025  1.00 34.21 ? 94  GLU A OE1   1 
ATOM   784  O  OE2   . GLU A 1 97  ? 48.166 16.272  -9.212  1.00 27.20 ? 94  GLU A OE2   1 
ATOM   785  N  N     . ALA A 1 98  ? 52.623 12.486  -5.522  1.00 9.45  ? 95  ALA A N     1 
ATOM   786  C  CA    . ALA A 1 98  ? 53.914 12.123  -4.957  1.00 10.55 ? 95  ALA A CA    1 
ATOM   787  C  C     . ALA A 1 98  ? 54.263 10.675  -5.317  1.00 8.79  ? 95  ALA A C     1 
ATOM   788  O  O     . ALA A 1 98  ? 55.424 10.354  -5.594  1.00 11.00 ? 95  ALA A O     1 
ATOM   789  C  CB    . ALA A 1 98  ? 53.931 12.324  -3.448  1.00 5.18  ? 95  ALA A CB    1 
ATOM   790  N  N     . SER A 1 99  ? 53.261 9.801   -5.297  1.00 8.13  ? 96  SER A N     1 
ATOM   791  C  CA    . SER A 1 99  ? 53.464 8.397   -5.631  1.00 12.24 ? 96  SER A CA    1 
ATOM   792  C  C     . SER A 1 99  ? 54.012 8.227   -7.044  1.00 11.46 ? 96  SER A C     1 
ATOM   793  O  O     . SER A 1 99  ? 54.968 7.486   -7.265  1.00 9.08  ? 96  SER A O     1 
ATOM   794  C  CB    . SER A 1 99  ? 52.152 7.627   -5.500  1.00 10.46 ? 96  SER A CB    1 
ATOM   795  O  OG    . SER A 1 99  ? 52.334 6.275   -5.847  1.00 14.47 ? 96  SER A OG    1 
ATOM   796  N  N     . VAL A 1 100 ? 53.394 8.908   -8.003  1.00 8.78  ? 97  VAL A N     1 
ATOM   797  C  CA    . VAL A 1 100 ? 53.897 8.902   -9.377  1.00 8.09  ? 97  VAL A CA    1 
ATOM   798  C  C     . VAL A 1 100 ? 55.370 9.290   -9.442  1.00 11.20 ? 97  VAL A C     1 
ATOM   799  O  O     . VAL A 1 100 ? 56.136 8.692   -10.207 1.00 10.26 ? 97  VAL A O     1 
ATOM   800  C  CB    . VAL A 1 100 ? 53.068 9.845   -10.281 1.00 13.39 ? 97  VAL A CB    1 
ATOM   801  C  CG1   . VAL A 1 100 ? 53.766 10.052  -11.643 1.00 12.98 ? 97  VAL A CG1   1 
ATOM   802  C  CG2   . VAL A 1 100 ? 51.661 9.285   -10.455 1.00 14.11 ? 97  VAL A CG2   1 
ATOM   803  N  N     . GLU A 1 101 ? 55.769 10.288  -8.649  1.00 9.02  ? 98  GLU A N     1 
ATOM   804  C  CA    . GLU A 1 101 ? 57.172 10.728  -8.621  1.00 11.58 ? 98  GLU A CA    1 
ATOM   805  C  C     . GLU A 1 101 ? 58.103 9.566   -8.319  1.00 10.16 ? 98  GLU A C     1 
ATOM   806  O  O     . GLU A 1 101 ? 59.135 9.377   -8.981  1.00 7.95  ? 98  GLU A O     1 
ATOM   807  C  CB    . GLU A 1 101 ? 57.414 11.781  -7.531  1.00 11.03 ? 98  GLU A CB    1 
ATOM   808  C  CG    . GLU A 1 101 ? 56.965 13.201  -7.844  1.00 13.71 ? 98  GLU A CG    1 
ATOM   809  C  CD    . GLU A 1 101 ? 57.344 14.176  -6.728  1.00 13.53 ? 98  GLU A CD    1 
ATOM   810  O  OE1   . GLU A 1 101 ? 58.545 14.480  -6.582  1.00 10.59 ? 98  GLU A OE1   1 
ATOM   811  O  OE2   . GLU A 1 101 ? 56.438 14.624  -5.987  1.00 17.71 ? 98  GLU A OE2   1 
ATOM   812  N  N     . VAL A 1 102 ? 57.764 8.825   -7.270  1.00 5.05  ? 99  VAL A N     1 
ATOM   813  C  CA    . VAL A 1 102 ? 58.597 7.712   -6.832  1.00 10.14 ? 99  VAL A CA    1 
ATOM   814  C  C     . VAL A 1 102 ? 58.579 6.562   -7.818  1.00 8.56  ? 99  VAL A C     1 
ATOM   815  O  O     . VAL A 1 102 ? 59.632 5.990   -8.134  1.00 10.64 ? 99  VAL A O     1 
ATOM   816  C  CB    . VAL A 1 102 ? 58.175 7.198   -5.439  1.00 9.21  ? 99  VAL A CB    1 
ATOM   817  C  CG1   . VAL A 1 102 ? 58.937 5.906   -5.086  1.00 11.11 ? 99  VAL A CG1   1 
ATOM   818  C  CG2   . VAL A 1 102 ? 58.424 8.292   -4.397  1.00 10.21 ? 99  VAL A CG2   1 
ATOM   819  N  N     . MET A 1 103 ? 57.395 6.230   -8.317  1.00 5.82  ? 100 MET A N     1 
ATOM   820  C  CA    . MET A 1 103 ? 57.265 5.089   -9.218  1.00 8.03  ? 100 MET A CA    1 
ATOM   821  C  C     . MET A 1 103 ? 58.025 5.333   -10.518 1.00 15.47 ? 100 MET A C     1 
ATOM   822  O  O     . MET A 1 103 ? 58.582 4.403   -11.088 1.00 10.31 ? 100 MET A O     1 
ATOM   823  C  CB    . MET A 1 103 ? 55.797 4.772   -9.520  1.00 12.89 ? 100 MET A CB    1 
ATOM   824  C  CG    A MET A 1 103 ? 54.926 4.598   -8.258  0.49 16.87 ? 100 MET A CG    1 
ATOM   825  C  CG    B MET A 1 103 ? 54.948 4.508   -8.302  0.51 16.85 ? 100 MET A CG    1 
ATOM   826  S  SD    A MET A 1 103 ? 54.353 2.920   -7.867  0.49 14.84 ? 100 MET A SD    1 
ATOM   827  S  SD    B MET A 1 103 ? 55.515 3.030   -7.467  0.51 13.37 ? 100 MET A SD    1 
ATOM   828  C  CE    A MET A 1 103 ? 54.008 3.074   -6.113  0.49 7.92  ? 100 MET A CE    1 
ATOM   829  C  CE    B MET A 1 103 ? 54.513 3.064   -5.977  0.51 6.87  ? 100 MET A CE    1 
ATOM   830  N  N     . GLU A 1 104 ? 58.040 6.579   -10.989 1.00 9.21  ? 101 GLU A N     1 
ATOM   831  C  CA    . GLU A 1 104 ? 58.730 6.898   -12.237 1.00 17.63 ? 101 GLU A CA    1 
ATOM   832  C  C     . GLU A 1 104 ? 60.248 6.754   -12.081 1.00 12.25 ? 101 GLU A C     1 
ATOM   833  O  O     . GLU A 1 104 ? 60.944 6.322   -13.006 1.00 12.23 ? 101 GLU A O     1 
ATOM   834  C  CB    . GLU A 1 104 ? 58.295 8.275   -12.782 1.00 8.52  ? 101 GLU A CB    1 
ATOM   835  C  CG    . GLU A 1 104 ? 56.837 8.268   -13.244 1.00 13.45 ? 101 GLU A CG    1 
ATOM   836  C  CD    . GLU A 1 104 ? 56.395 9.534   -13.985 1.00 37.77 ? 101 GLU A CD    1 
ATOM   837  O  OE1   . GLU A 1 104 ? 57.115 10.556  -13.949 1.00 31.95 ? 101 GLU A OE1   1 
ATOM   838  O  OE2   . GLU A 1 104 ? 55.307 9.500   -14.608 1.00 36.74 ? 101 GLU A OE2   1 
ATOM   839  N  N     . ILE A 1 105 ? 60.755 7.082   -10.897 1.00 13.85 ? 102 ILE A N     1 
ATOM   840  C  CA    . ILE A 1 105 ? 62.150 6.827   -10.577 1.00 8.85  ? 102 ILE A CA    1 
ATOM   841  C  C     . ILE A 1 105 ? 62.458 5.325   -10.505 1.00 9.55  ? 102 ILE A C     1 
ATOM   842  O  O     . ILE A 1 105 ? 63.411 4.854   -11.127 1.00 8.98  ? 102 ILE A O     1 
ATOM   843  C  CB    . ILE A 1 105 ? 62.580 7.536   -9.272  1.00 6.89  ? 102 ILE A CB    1 
ATOM   844  C  CG1   . ILE A 1 105 ? 62.341 9.041   -9.397  1.00 10.61 ? 102 ILE A CG1   1 
ATOM   845  C  CG2   . ILE A 1 105 ? 64.039 7.239   -8.931  1.00 13.17 ? 102 ILE A CG2   1 
ATOM   846  C  CD1   . ILE A 1 105 ? 62.503 9.784   -8.109  1.00 17.51 ? 102 ILE A CD1   1 
ATOM   847  N  N     . MET A 1 106 ? 61.657 4.558   -9.774  1.00 7.69  ? 103 MET A N     1 
ATOM   848  C  CA    . MET A 1 106 ? 61.910 3.115   -9.694  1.00 13.32 ? 103 MET A CA    1 
ATOM   849  C  C     . MET A 1 106 ? 61.888 2.457   -11.068 1.00 9.94  ? 103 MET A C     1 
ATOM   850  O  O     . MET A 1 106 ? 62.663 1.547   -11.342 1.00 10.19 ? 103 MET A O     1 
ATOM   851  C  CB    . MET A 1 106 ? 60.896 2.427   -8.771  1.00 9.60  ? 103 MET A CB    1 
ATOM   852  C  CG    . MET A 1 106 ? 61.114 2.751   -7.300  1.00 9.30  ? 103 MET A CG    1 
ATOM   853  S  SD    . MET A 1 106 ? 59.840 1.975   -6.281  1.00 18.98 ? 103 MET A SD    1 
ATOM   854  C  CE    . MET A 1 106 ? 58.410 2.658   -7.057  1.00 19.14 ? 103 MET A CE    1 
ATOM   855  N  N     . SER A 1 107 ? 60.977 2.906   -11.922 1.00 8.65  ? 104 SER A N     1 
ATOM   856  C  CA    . SER A 1 107 ? 60.865 2.363   -13.267 1.00 11.38 ? 104 SER A CA    1 
ATOM   857  C  C     . SER A 1 107 ? 62.131 2.523   -14.110 1.00 15.80 ? 104 SER A C     1 
ATOM   858  O  O     . SER A 1 107 ? 62.263 1.852   -15.129 1.00 16.72 ? 104 SER A O     1 
ATOM   859  C  CB    . SER A 1 107 ? 59.673 2.992   -14.009 1.00 11.84 ? 104 SER A CB    1 
ATOM   860  O  OG    . SER A 1 107 ? 58.449 2.558   -13.450 1.00 20.69 ? 104 SER A OG    1 
ATOM   861  N  N     . ARG A 1 108 ? 63.052 3.400   -13.709 1.00 11.63 ? 105 ARG A N     1 
ATOM   862  C  CA    . ARG A 1 108 ? 64.291 3.579   -14.469 1.00 16.32 ? 105 ARG A CA    1 
ATOM   863  C  C     . ARG A 1 108 ? 65.218 2.390   -14.256 1.00 21.09 ? 105 ARG A C     1 
ATOM   864  O  O     . ARG A 1 108 ? 66.083 2.115   -15.086 1.00 14.90 ? 105 ARG A O     1 
ATOM   865  C  CB    . ARG A 1 108 ? 65.041 4.871   -14.091 1.00 18.19 ? 105 ARG A CB    1 
ATOM   866  C  CG    . ARG A 1 108 ? 64.293 6.178   -14.334 1.00 19.31 ? 105 ARG A CG    1 
ATOM   867  C  CD    . ARG A 1 108 ? 65.263 7.351   -14.474 1.00 23.98 ? 105 ARG A CD    1 
ATOM   868  N  NE    . ARG A 1 108 ? 66.249 7.422   -13.398 1.00 21.32 ? 105 ARG A NE    1 
ATOM   869  C  CZ    . ARG A 1 108 ? 66.209 8.300   -12.398 1.00 26.70 ? 105 ARG A CZ    1 
ATOM   870  N  NH1   . ARG A 1 108 ? 67.152 8.290   -11.466 1.00 17.58 ? 105 ARG A NH1   1 
ATOM   871  N  NH2   . ARG A 1 108 ? 65.229 9.189   -12.328 1.00 15.80 ? 105 ARG A NH2   1 
ATOM   872  N  N     . PHE A 1 109 ? 65.039 1.691   -13.139 1.00 19.22 ? 106 PHE A N     1 
ATOM   873  C  CA    . PHE A 1 109 ? 65.932 0.584   -12.787 1.00 20.48 ? 106 PHE A CA    1 
ATOM   874  C  C     . PHE A 1 109 ? 65.396 -0.752  -13.271 1.00 20.39 ? 106 PHE A C     1 
ATOM   875  O  O     . PHE A 1 109 ? 66.151 -1.626  -13.697 1.00 22.77 ? 106 PHE A O     1 
ATOM   876  C  CB    . PHE A 1 109 ? 66.172 0.535   -11.281 1.00 12.18 ? 106 PHE A CB    1 
ATOM   877  C  CG    . PHE A 1 109 ? 66.879 1.733   -10.747 1.00 19.58 ? 106 PHE A CG    1 
ATOM   878  C  CD1   . PHE A 1 109 ? 66.218 2.939   -10.619 1.00 11.19 ? 106 PHE A CD1   1 
ATOM   879  C  CD2   . PHE A 1 109 ? 68.210 1.657   -10.361 1.00 12.19 ? 106 PHE A CD2   1 
ATOM   880  C  CE1   . PHE A 1 109 ? 66.878 4.051   -10.132 1.00 11.99 ? 106 PHE A CE1   1 
ATOM   881  C  CE2   . PHE A 1 109 ? 68.865 2.762   -9.870  1.00 13.76 ? 106 PHE A CE2   1 
ATOM   882  C  CZ    . PHE A 1 109 ? 68.200 3.960   -9.754  1.00 12.49 ? 106 PHE A CZ    1 
ATOM   883  N  N     . ALA A 1 110 ? 64.082 -0.897  -13.230 1.00 16.88 ? 107 ALA A N     1 
ATOM   884  C  CA    . ALA A 1 110 ? 63.462 -2.167  -13.552 1.00 13.71 ? 107 ALA A CA    1 
ATOM   885  C  C     . ALA A 1 110 ? 61.967 -2.022  -13.704 1.00 24.88 ? 107 ALA A C     1 
ATOM   886  O  O     . ALA A 1 110 ? 61.376 -1.027  -13.275 1.00 20.38 ? 107 ALA A O     1 
ATOM   887  C  CB    . ALA A 1 110 ? 63.767 -3.188  -12.462 1.00 21.46 ? 107 ALA A CB    1 
ATOM   888  N  N     . VAL A 1 111 ? 61.373 -3.037  -14.321 1.00 20.35 ? 108 VAL A N     1 
ATOM   889  C  CA    . VAL A 1 111 ? 59.932 -3.213  -14.384 1.00 25.70 ? 108 VAL A CA    1 
ATOM   890  C  C     . VAL A 1 111 ? 59.346 -3.262  -12.981 1.00 19.20 ? 108 VAL A C     1 
ATOM   891  O  O     . VAL A 1 111 ? 59.847 -3.980  -12.111 1.00 22.11 ? 108 VAL A O     1 
ATOM   892  C  CB    . VAL A 1 111 ? 59.597 -4.531  -15.091 1.00 27.56 ? 108 VAL A CB    1 
ATOM   893  C  CG1   . VAL A 1 111 ? 58.116 -4.869  -14.936 1.00 32.94 ? 108 VAL A CG1   1 
ATOM   894  C  CG2   . VAL A 1 111 ? 59.998 -4.450  -16.560 1.00 43.63 ? 108 VAL A CG2   1 
ATOM   895  N  N     . ILE A 1 112 ? 58.291 -2.495  -12.746 1.00 19.67 ? 109 ILE A N     1 
ATOM   896  C  CA    . ILE A 1 112 ? 57.687 -2.513  -11.418 1.00 15.72 ? 109 ILE A CA    1 
ATOM   897  C  C     . ILE A 1 112 ? 56.224 -2.898  -11.457 1.00 9.65  ? 109 ILE A C     1 
ATOM   898  O  O     . ILE A 1 112 ? 55.557 -2.730  -12.481 1.00 8.90  ? 109 ILE A O     1 
ATOM   899  C  CB    . ILE A 1 112 ? 57.856 -1.158  -10.694 1.00 15.35 ? 109 ILE A CB    1 
ATOM   900  C  CG1   . ILE A 1 112 ? 57.015 -0.078  -11.368 1.00 17.38 ? 109 ILE A CG1   1 
ATOM   901  C  CG2   . ILE A 1 112 ? 59.342 -0.753  -10.653 1.00 18.00 ? 109 ILE A CG2   1 
ATOM   902  C  CD1   . ILE A 1 112 ? 56.927 1.214   -10.552 1.00 14.76 ? 109 ILE A CD1   1 
ATOM   903  N  N     . GLU A 1 113 ? 55.744 -3.442  -10.335 1.00 9.49  ? 110 GLU A N     1 
ATOM   904  C  CA    . GLU A 1 113 ? 54.326 -3.658  -10.094 1.00 14.73 ? 110 GLU A CA    1 
ATOM   905  C  C     . GLU A 1 113 ? 53.880 -2.736  -8.971  1.00 11.32 ? 110 GLU A C     1 
ATOM   906  O  O     . GLU A 1 113 ? 54.338 -2.873  -7.845  1.00 7.09  ? 110 GLU A O     1 
ATOM   907  C  CB    . GLU A 1 113 ? 54.051 -5.107  -9.667  1.00 9.15  ? 110 GLU A CB    1 
ATOM   908  C  CG    . GLU A 1 113 ? 52.586 -5.401  -9.315  1.00 11.48 ? 110 GLU A CG    1 
ATOM   909  C  CD    . GLU A 1 113 ? 52.336 -6.868  -8.940  1.00 14.84 ? 110 GLU A CD    1 
ATOM   910  O  OE1   . GLU A 1 113 ? 51.240 -7.169  -8.422  1.00 20.26 ? 110 GLU A OE1   1 
ATOM   911  O  OE2   . GLU A 1 113 ? 53.225 -7.725  -9.178  1.00 11.85 ? 110 GLU A OE2   1 
ATOM   912  N  N     . ARG A 1 114 ? 52.980 -1.809  -9.273  1.00 10.92 ? 111 ARG A N     1 
ATOM   913  C  CA    . ARG A 1 114 ? 52.459 -0.908  -8.251  1.00 13.69 ? 111 ARG A CA    1 
ATOM   914  C  C     . ARG A 1 114 ? 51.530 -1.693  -7.355  1.00 18.60 ? 111 ARG A C     1 
ATOM   915  O  O     . ARG A 1 114 ? 50.470 -2.150  -7.798  1.00 18.77 ? 111 ARG A O     1 
ATOM   916  C  CB    . ARG A 1 114 ? 51.696 0.252   -8.889  1.00 13.63 ? 111 ARG A CB    1 
ATOM   917  C  CG    . ARG A 1 114 ? 51.111 1.224   -7.887  1.00 13.36 ? 111 ARG A CG    1 
ATOM   918  C  CD    . ARG A 1 114 ? 49.957 1.991   -8.489  1.00 21.89 ? 111 ARG A CD    1 
ATOM   919  N  NE    . ARG A 1 114 ? 49.685 3.259   -7.815  1.00 17.76 ? 111 ARG A NE    1 
ATOM   920  C  CZ    . ARG A 1 114 ? 48.755 3.433   -6.878  1.00 21.52 ? 111 ARG A CZ    1 
ATOM   921  N  NH1   . ARG A 1 114 ? 48.008 2.416   -6.473  1.00 20.42 ? 111 ARG A NH1   1 
ATOM   922  N  NH2   . ARG A 1 114 ? 48.579 4.633   -6.338  1.00 18.18 ? 111 ARG A NH2   1 
ATOM   923  N  N     . ALA A 1 115 ? 51.924 -1.851  -6.095  1.00 9.18  ? 112 ALA A N     1 
ATOM   924  C  CA    . ALA A 1 115 ? 51.191 -2.697  -5.171  1.00 10.09 ? 112 ALA A CA    1 
ATOM   925  C  C     . ALA A 1 115 ? 50.225 -1.870  -4.326  1.00 16.19 ? 112 ALA A C     1 
ATOM   926  O  O     . ALA A 1 115 ? 49.197 -2.374  -3.868  1.00 13.99 ? 112 ALA A O     1 
ATOM   927  C  CB    . ALA A 1 115 ? 52.165 -3.481  -4.271  1.00 12.90 ? 112 ALA A CB    1 
ATOM   928  N  N     . SER A 1 116 ? 50.577 -0.607  -4.114  1.00 13.54 ? 113 SER A N     1 
ATOM   929  C  CA    . SER A 1 116 ? 49.748 0.326   -3.356  1.00 9.80  ? 113 SER A CA    1 
ATOM   930  C  C     . SER A 1 116 ? 50.222 1.737   -3.657  1.00 11.19 ? 113 SER A C     1 
ATOM   931  O  O     . SER A 1 116 ? 51.166 1.928   -4.420  1.00 13.95 ? 113 SER A O     1 
ATOM   932  C  CB    . SER A 1 116 ? 49.873 0.066   -1.856  1.00 16.40 ? 113 SER A CB    1 
ATOM   933  O  OG    . SER A 1 116 ? 51.127 0.532   -1.366  1.00 13.51 ? 113 SER A OG    1 
ATOM   934  N  N     . ILE A 1 117 ? 49.585 2.733   -3.051  1.00 7.34  ? 114 ILE A N     1 
ATOM   935  C  CA    . ILE A 1 117 ? 50.020 4.107   -3.273  1.00 8.01  ? 114 ILE A CA    1 
ATOM   936  C  C     . ILE A 1 117 ? 51.509 4.329   -2.953  1.00 10.39 ? 114 ILE A C     1 
ATOM   937  O  O     . ILE A 1 117 ? 52.145 5.221   -3.527  1.00 9.06  ? 114 ILE A O     1 
ATOM   938  C  CB    . ILE A 1 117 ? 49.170 5.117   -2.484  1.00 10.65 ? 114 ILE A CB    1 
ATOM   939  C  CG1   . ILE A 1 117 ? 49.315 6.518   -3.087  1.00 10.71 ? 114 ILE A CG1   1 
ATOM   940  C  CG2   . ILE A 1 117 ? 49.560 5.108   -1.020  1.00 12.46 ? 114 ILE A CG2   1 
ATOM   941  C  CD1   . ILE A 1 117 ? 48.165 7.459   -2.714  1.00 11.43 ? 114 ILE A CD1   1 
ATOM   942  N  N     . ASP A 1 118 ? 52.083 3.530   -2.055  1.00 9.50  ? 115 ASP A N     1 
ATOM   943  C  CA    . ASP A 1 118 ? 53.458 3.813   -1.660  1.00 10.86 ? 115 ASP A CA    1 
ATOM   944  C  C     . ASP A 1 118 ? 54.404 2.628   -1.710  1.00 12.21 ? 115 ASP A C     1 
ATOM   945  O  O     . ASP A 1 118 ? 55.494 2.669   -1.121  1.00 9.15  ? 115 ASP A O     1 
ATOM   946  C  CB    . ASP A 1 118 ? 53.498 4.465   -0.266  1.00 6.40  ? 115 ASP A CB    1 
ATOM   947  C  CG    . ASP A 1 118 ? 53.563 3.452   0.871   1.00 13.48 ? 115 ASP A CG    1 
ATOM   948  O  OD1   . ASP A 1 118 ? 54.265 3.770   1.846   1.00 8.98  ? 115 ASP A OD1   1 
ATOM   949  O  OD2   . ASP A 1 118 ? 52.925 2.366   0.811   1.00 10.66 ? 115 ASP A OD2   1 
ATOM   950  N  N     . GLU A 1 119 ? 54.014 1.578   -2.413  1.00 8.92  ? 116 GLU A N     1 
ATOM   951  C  CA    . GLU A 1 119 ? 54.945 0.467   -2.568  1.00 9.10  ? 116 GLU A CA    1 
ATOM   952  C  C     . GLU A 1 119 ? 54.904 -0.200  -3.934  1.00 8.80  ? 116 GLU A C     1 
ATOM   953  O  O     . GLU A 1 119 ? 53.878 -0.210  -4.622  1.00 5.79  ? 116 GLU A O     1 
ATOM   954  C  CB    . GLU A 1 119 ? 54.787 -0.551  -1.441  1.00 16.00 ? 116 GLU A CB    1 
ATOM   955  C  CG    . GLU A 1 119 ? 53.532 -1.370  -1.467  1.00 14.88 ? 116 GLU A CG    1 
ATOM   956  C  CD    . GLU A 1 119 ? 53.188 -1.914  -0.080  1.00 28.47 ? 116 GLU A CD    1 
ATOM   957  O  OE1   . GLU A 1 119 ? 53.679 -3.005  0.295   1.00 23.80 ? 116 GLU A OE1   1 
ATOM   958  O  OE2   . GLU A 1 119 ? 52.445 -1.232  0.651   1.00 22.01 ? 116 GLU A OE2   1 
ATOM   959  N  N     . ALA A 1 120 ? 56.041 -0.754  -4.323  1.00 8.78  ? 117 ALA A N     1 
ATOM   960  C  CA    . ALA A 1 120 ? 56.124 -1.425  -5.595  1.00 13.56 ? 117 ALA A CA    1 
ATOM   961  C  C     . ALA A 1 120 ? 57.034 -2.630  -5.473  1.00 10.70 ? 117 ALA A C     1 
ATOM   962  O  O     . ALA A 1 120 ? 58.030 -2.598  -4.750  1.00 11.45 ? 117 ALA A O     1 
ATOM   963  C  CB    . ALA A 1 120 ? 56.637 -0.474  -6.656  1.00 8.08  ? 117 ALA A CB    1 
ATOM   964  N  N     . TYR A 1 121 ? 56.668 -3.699  -6.169  1.00 8.25  ? 118 TYR A N     1 
ATOM   965  C  CA    . TYR A 1 121 ? 57.580 -4.809  -6.344  1.00 5.95  ? 118 TYR A CA    1 
ATOM   966  C  C     . TYR A 1 121 ? 58.445 -4.570  -7.567  1.00 13.14 ? 118 TYR A C     1 
ATOM   967  O  O     . TYR A 1 121 ? 58.013 -3.954  -8.546  1.00 9.41  ? 118 TYR A O     1 
ATOM   968  C  CB    . TYR A 1 121 ? 56.812 -6.119  -6.473  1.00 4.94  ? 118 TYR A CB    1 
ATOM   969  C  CG    . TYR A 1 121 ? 56.092 -6.503  -5.208  1.00 10.41 ? 118 TYR A CG    1 
ATOM   970  C  CD1   . TYR A 1 121 ? 54.766 -6.151  -5.009  1.00 10.14 ? 118 TYR A CD1   1 
ATOM   971  C  CD2   . TYR A 1 121 ? 56.740 -7.214  -4.207  1.00 15.37 ? 118 TYR A CD2   1 
ATOM   972  C  CE1   . TYR A 1 121 ? 54.093 -6.511  -3.851  1.00 16.18 ? 118 TYR A CE1   1 
ATOM   973  C  CE2   . TYR A 1 121 ? 56.072 -7.576  -3.040  1.00 10.56 ? 118 TYR A CE2   1 
ATOM   974  C  CZ    . TYR A 1 121 ? 54.763 -7.216  -2.869  1.00 10.64 ? 118 TYR A CZ    1 
ATOM   975  O  OH    . TYR A 1 121 ? 54.102 -7.585  -1.725  1.00 18.10 ? 118 TYR A OH    1 
ATOM   976  N  N     . VAL A 1 122 ? 59.675 -5.067  -7.494  1.00 10.11 ? 119 VAL A N     1 
ATOM   977  C  CA    . VAL A 1 122 ? 60.653 -4.899  -8.541  1.00 9.89  ? 119 VAL A CA    1 
ATOM   978  C  C     . VAL A 1 122 ? 61.187 -6.272  -8.874  1.00 13.12 ? 119 VAL A C     1 
ATOM   979  O  O     . VAL A 1 122 ? 61.631 -6.982  -7.972  1.00 9.04  ? 119 VAL A O     1 
ATOM   980  C  CB    . VAL A 1 122 ? 61.860 -4.080  -8.014  1.00 13.81 ? 119 VAL A CB    1 
ATOM   981  C  CG1   . VAL A 1 122 ? 62.764 -3.696  -9.150  1.00 20.83 ? 119 VAL A CG1   1 
ATOM   982  C  CG2   . VAL A 1 122 ? 61.394 -2.834  -7.247  1.00 19.90 ? 119 VAL A CG2   1 
ATOM   983  N  N     . ASP A 1 123 ? 61.168 -6.656  -10.147 1.00 9.15  ? 120 ASP A N     1 
ATOM   984  C  CA    . ASP A 1 123 ? 61.854 -7.888  -10.569 1.00 12.39 ? 120 ASP A CA    1 
ATOM   985  C  C     . ASP A 1 123 ? 63.268 -7.546  -11.031 1.00 15.47 ? 120 ASP A C     1 
ATOM   986  O  O     . ASP A 1 123 ? 63.465 -6.989  -12.107 1.00 17.03 ? 120 ASP A O     1 
ATOM   987  C  CB    . ASP A 1 123 ? 61.087 -8.585  -11.692 1.00 18.64 ? 120 ASP A CB    1 
ATOM   988  C  CG    . ASP A 1 123 ? 61.593 -10.002 -11.971 1.00 20.67 ? 120 ASP A CG    1 
ATOM   989  O  OD1   . ASP A 1 123 ? 62.820 -10.243 -11.995 1.00 18.48 ? 120 ASP A OD1   1 
ATOM   990  O  OD2   . ASP A 1 123 ? 60.744 -10.894 -12.182 1.00 46.48 ? 120 ASP A OD2   1 
ATOM   991  N  N     . LEU A 1 124 ? 64.257 -7.872  -10.212 1.00 8.94  ? 121 LEU A N     1 
ATOM   992  C  CA    . LEU A 1 124 ? 65.625 -7.486  -10.498 1.00 11.66 ? 121 LEU A CA    1 
ATOM   993  C  C     . LEU A 1 124 ? 66.454 -8.563  -11.193 1.00 9.51  ? 121 LEU A C     1 
ATOM   994  O  O     . LEU A 1 124 ? 67.650 -8.397  -11.351 1.00 9.79  ? 121 LEU A O     1 
ATOM   995  C  CB    . LEU A 1 124 ? 66.320 -7.116  -9.197  1.00 6.65  ? 121 LEU A CB    1 
ATOM   996  C  CG    . LEU A 1 124 ? 65.756 -5.894  -8.474  1.00 17.43 ? 121 LEU A CG    1 
ATOM   997  C  CD1   . LEU A 1 124 ? 66.216 -5.856  -7.021  1.00 18.12 ? 121 LEU A CD1   1 
ATOM   998  C  CD2   . LEU A 1 124 ? 66.187 -4.651  -9.215  1.00 22.58 ? 121 LEU A CD2   1 
ATOM   999  N  N     . THR A 1 125 ? 65.830 -9.666  -11.588 1.00 13.84 ? 122 THR A N     1 
ATOM   1000 C  CA    . THR A 1 125 ? 66.599 -10.806 -12.079 1.00 9.29  ? 122 THR A CA    1 
ATOM   1001 C  C     . THR A 1 125 ? 67.560 -10.424 -13.221 1.00 11.52 ? 122 THR A C     1 
ATOM   1002 O  O     . THR A 1 125 ? 68.746 -10.735 -13.160 1.00 12.92 ? 122 THR A O     1 
ATOM   1003 C  CB    . THR A 1 125 ? 65.698 -11.990 -12.465 1.00 13.13 ? 122 THR A CB    1 
ATOM   1004 O  OG1   . THR A 1 125 ? 64.818 -12.289 -11.369 1.00 12.14 ? 122 THR A OG1   1 
ATOM   1005 C  CG2   . THR A 1 125 ? 66.558 -13.235 -12.782 1.00 15.15 ? 122 THR A CG2   1 
ATOM   1006 N  N     . SER A 1 126 ? 67.042 -9.749  -14.244 1.00 14.45 ? 123 SER A N     1 
ATOM   1007 C  CA    . SER A 1 126 ? 67.855 -9.347  -15.394 1.00 15.79 ? 123 SER A CA    1 
ATOM   1008 C  C     . SER A 1 126 ? 68.912 -8.295  -15.044 1.00 19.11 ? 123 SER A C     1 
ATOM   1009 O  O     . SER A 1 126 ? 70.037 -8.349  -15.539 1.00 18.25 ? 123 SER A O     1 
ATOM   1010 C  CB    . SER A 1 126 ? 66.972 -8.849  -16.543 1.00 19.90 ? 123 SER A CB    1 
ATOM   1011 O  OG    A SER A 1 126 ? 66.328 -9.926  -17.205 0.56 23.99 ? 123 SER A OG    1 
ATOM   1012 O  OG    B SER A 1 126 ? 66.126 -7.796  -16.125 0.44 20.61 ? 123 SER A OG    1 
ATOM   1013 N  N     . ALA A 1 127 ? 68.544 -7.345  -14.193 1.00 14.45 ? 124 ALA A N     1 
ATOM   1014 C  CA    . ALA A 1 127 ? 69.455 -6.288  -13.778 1.00 16.10 ? 124 ALA A CA    1 
ATOM   1015 C  C     . ALA A 1 127 ? 70.636 -6.858  -13.001 1.00 14.71 ? 124 ALA A C     1 
ATOM   1016 O  O     . ALA A 1 127 ? 71.766 -6.446  -13.196 1.00 12.91 ? 124 ALA A O     1 
ATOM   1017 C  CB    . ALA A 1 127 ? 68.711 -5.237  -12.948 1.00 11.06 ? 124 ALA A CB    1 
ATOM   1018 N  N     . VAL A 1 128 ? 70.367 -7.833  -12.135 1.00 9.72  ? 125 VAL A N     1 
ATOM   1019 C  CA    . VAL A 1 128 ? 71.422 -8.519  -11.403 1.00 10.24 ? 125 VAL A CA    1 
ATOM   1020 C  C     . VAL A 1 128 ? 72.391 -9.272  -12.324 1.00 14.54 ? 125 VAL A C     1 
ATOM   1021 O  O     . VAL A 1 128 ? 73.604 -9.221  -12.119 1.00 17.21 ? 125 VAL A O     1 
ATOM   1022 C  CB    . VAL A 1 128 ? 70.822 -9.477  -10.341 1.00 12.35 ? 125 VAL A CB    1 
ATOM   1023 C  CG1   . VAL A 1 128 ? 71.813 -10.550 -9.931  1.00 11.33 ? 125 VAL A CG1   1 
ATOM   1024 C  CG2   . VAL A 1 128 ? 70.358 -8.669  -9.130  1.00 9.75  ? 125 VAL A CG2   1 
ATOM   1025 N  N     . GLN A 1 129 ? 71.864 -9.958  -13.333 1.00 13.51 ? 126 GLN A N     1 
ATOM   1026 C  CA    . GLN A 1 129 ? 72.733 -10.622 -14.300 1.00 22.70 ? 126 GLN A CA    1 
ATOM   1027 C  C     . GLN A 1 129 ? 73.673 -9.607  -14.953 1.00 22.12 ? 126 GLN A C     1 
ATOM   1028 O  O     . GLN A 1 129 ? 74.891 -9.787  -14.966 1.00 24.79 ? 126 GLN A O     1 
ATOM   1029 C  CB    . GLN A 1 129 ? 71.921 -11.355 -15.370 1.00 25.30 ? 126 GLN A CB    1 
ATOM   1030 C  CG    . GLN A 1 129 ? 70.889 -12.348 -14.836 1.00 32.18 ? 126 GLN A CG    1 
ATOM   1031 C  CD    . GLN A 1 129 ? 71.503 -13.646 -14.321 1.00 51.92 ? 126 GLN A CD    1 
ATOM   1032 O  OE1   . GLN A 1 129 ? 72.088 -13.689 -13.236 1.00 53.30 ? 126 GLN A OE1   1 
ATOM   1033 N  NE2   . GLN A 1 129 ? 71.357 -14.714 -15.097 1.00 54.04 ? 126 GLN A NE2   1 
ATOM   1034 N  N     . GLU A 1 130 ? 73.103 -8.537  -15.491 1.00 19.16 ? 127 GLU A N     1 
ATOM   1035 C  CA    . GLU A 1 130 ? 73.908 -7.477  -16.083 1.00 29.00 ? 127 GLU A CA    1 
ATOM   1036 C  C     . GLU A 1 130 ? 75.009 -7.007  -15.129 1.00 31.18 ? 127 GLU A C     1 
ATOM   1037 O  O     . GLU A 1 130 ? 76.193 -7.017  -15.483 1.00 31.04 ? 127 GLU A O     1 
ATOM   1038 C  CB    . GLU A 1 130 ? 73.038 -6.288  -16.476 1.00 25.51 ? 127 GLU A CB    1 
ATOM   1039 C  CG    . GLU A 1 130 ? 72.007 -6.586  -17.546 1.00 40.23 ? 127 GLU A CG    1 
ATOM   1040 C  CD    . GLU A 1 130 ? 71.241 -5.339  -17.960 1.00 65.59 ? 127 GLU A CD    1 
ATOM   1041 O  OE1   . GLU A 1 130 ? 71.893 -4.339  -18.335 1.00 60.81 ? 127 GLU A OE1   1 
ATOM   1042 O  OE2   . GLU A 1 130 ? 69.991 -5.356  -17.899 1.00 65.18 ? 127 GLU A OE2   1 
ATOM   1043 N  N     . ARG A 1 131 ? 74.622 -6.596  -13.925 1.00 19.04 ? 128 ARG A N     1 
ATOM   1044 C  CA    . ARG A 1 131 ? 75.581 -6.042  -12.971 1.00 17.60 ? 128 ARG A CA    1 
ATOM   1045 C  C     . ARG A 1 131 ? 76.693 -7.045  -12.675 1.00 21.38 ? 128 ARG A C     1 
ATOM   1046 O  O     . ARG A 1 131 ? 77.861 -6.667  -12.544 1.00 23.85 ? 128 ARG A O     1 
ATOM   1047 C  CB    . ARG A 1 131 ? 74.883 -5.597  -11.682 1.00 14.76 ? 128 ARG A CB    1 
ATOM   1048 C  CG    A ARG A 1 131 ? 75.756 -4.820  -10.713 0.62 17.68 ? 128 ARG A CG    1 
ATOM   1049 C  CG    B ARG A 1 131 ? 75.808 -4.892  -10.690 0.38 17.71 ? 128 ARG A CG    1 
ATOM   1050 C  CD    A ARG A 1 131 ? 76.256 -3.520  -11.327 0.62 18.42 ? 128 ARG A CD    1 
ATOM   1051 C  CD    B ARG A 1 131 ? 76.386 -3.609  -11.282 0.38 18.58 ? 128 ARG A CD    1 
ATOM   1052 N  NE    A ARG A 1 131 ? 77.009 -2.728  -10.364 0.62 23.80 ? 128 ARG A NE    1 
ATOM   1053 N  NE    B ARG A 1 131 ? 75.325 -2.781  -11.838 0.38 17.91 ? 128 ARG A NE    1 
ATOM   1054 C  CZ    A ARG A 1 131 ? 76.451 -1.902  -9.487  0.62 18.37 ? 128 ARG A CZ    1 
ATOM   1055 C  CZ    B ARG A 1 131 ? 74.520 -2.020  -11.106 0.38 19.04 ? 128 ARG A CZ    1 
ATOM   1056 N  NH1   A ARG A 1 131 ? 77.202 -1.207  -8.642  0.62 13.69 ? 128 ARG A NH1   1 
ATOM   1057 N  NH1   B ARG A 1 131 ? 73.563 -1.312  -11.686 0.38 14.94 ? 128 ARG A NH1   1 
ATOM   1058 N  NH2   A ARG A 1 131 ? 75.137 -1.768  -9.464  0.62 18.69 ? 128 ARG A NH2   1 
ATOM   1059 N  NH2   B ARG A 1 131 ? 74.673 -1.973  -9.792  0.38 19.24 ? 128 ARG A NH2   1 
ATOM   1060 N  N     . LEU A 1 132 ? 76.327 -8.322  -12.586 1.00 18.26 ? 129 LEU A N     1 
ATOM   1061 C  CA    . LEU A 1 132 ? 77.291 -9.403  -12.352 1.00 16.59 ? 129 LEU A CA    1 
ATOM   1062 C  C     . LEU A 1 132 ? 78.319 -9.534  -13.479 1.00 34.72 ? 129 LEU A C     1 
ATOM   1063 O  O     . LEU A 1 132 ? 79.461 -9.933  -13.235 1.00 25.74 ? 129 LEU A O     1 
ATOM   1064 C  CB    . LEU A 1 132 ? 76.578 -10.746 -12.144 1.00 26.62 ? 129 LEU A CB    1 
ATOM   1065 C  CG    . LEU A 1 132 ? 76.248 -11.138 -10.698 1.00 27.72 ? 129 LEU A CG    1 
ATOM   1066 C  CD1   . LEU A 1 132 ? 75.344 -12.353 -10.651 1.00 20.86 ? 129 LEU A CD1   1 
ATOM   1067 C  CD2   . LEU A 1 132 ? 77.528 -11.385 -9.901  1.00 26.81 ? 129 LEU A CD2   1 
ATOM   1068 N  N     . GLN A 1 133 ? 77.904 -9.212  -14.705 1.00 32.25 ? 130 GLN A N     1 
ATOM   1069 C  CA    . GLN A 1 133 ? 78.808 -9.199  -15.860 1.00 31.51 ? 130 GLN A CA    1 
ATOM   1070 C  C     . GLN A 1 133 ? 79.803 -8.048  -15.787 1.00 43.65 ? 130 GLN A C     1 
ATOM   1071 O  O     . GLN A 1 133 ? 80.967 -8.203  -16.154 1.00 48.26 ? 130 GLN A O     1 
ATOM   1072 C  CB    . GLN A 1 133 ? 78.027 -9.112  -17.176 1.00 29.11 ? 130 GLN A CB    1 
ATOM   1073 C  CG    . GLN A 1 133 ? 77.196 -10.348 -17.499 1.00 42.05 ? 130 GLN A CG    1 
ATOM   1074 C  CD    . GLN A 1 133 ? 78.020 -11.623 -17.503 1.00 58.84 ? 130 GLN A CD    1 
ATOM   1075 O  OE1   . GLN A 1 133 ? 79.251 -11.585 -17.428 1.00 59.51 ? 130 GLN A OE1   1 
ATOM   1076 N  NE2   . GLN A 1 133 ? 77.342 -12.764 -17.586 1.00 64.42 ? 130 GLN A NE2   1 
ATOM   1077 N  N     . LYS A 1 134 ? 79.340 -6.890  -15.323 1.00 37.44 ? 131 LYS A N     1 
ATOM   1078 C  CA    . LYS A 1 134 ? 80.217 -5.732  -15.172 1.00 37.54 ? 131 LYS A CA    1 
ATOM   1079 C  C     . LYS A 1 134 ? 81.215 -5.936  -14.068 1.00 51.01 ? 131 LYS A C     1 
ATOM   1080 O  O     . LYS A 1 134 ? 82.296 -5.343  -14.065 1.00 47.90 ? 131 LYS A O     1 
ATOM   1081 C  CB    . LYS A 1 134 ? 79.414 -4.449  -14.942 1.00 47.42 ? 131 LYS A CB    1 
ATOM   1082 C  CG    . LYS A 1 134 ? 79.035 -3.726  -16.228 1.00 54.15 ? 131 LYS A CG    1 
ATOM   1083 C  CD    . LYS A 1 134 ? 78.411 -2.369  -15.943 1.00 51.65 ? 131 LYS A CD    1 
ATOM   1084 C  CE    . LYS A 1 134 ? 77.122 -2.514  -15.145 1.00 50.05 ? 131 LYS A CE    1 
ATOM   1085 N  NZ    . LYS A 1 134 ? 76.550 -1.193  -14.756 1.00 50.75 ? 131 LYS A NZ    1 
ATOM   1086 N  N     . LEU A 1 135 ? 80.852 -6.795  -13.130 1.00 30.75 ? 132 LEU A N     1 
ATOM   1087 C  CA    . LEU A 1 135 ? 81.675 -6.956  -11.960 1.00 44.20 ? 132 LEU A CA    1 
ATOM   1088 C  C     . LEU A 1 135 ? 82.930 -7.784  -12.197 1.00 52.38 ? 132 LEU A C     1 
ATOM   1089 O  O     . LEU A 1 135 ? 83.976 -7.519  -11.603 1.00 52.11 ? 132 LEU A O     1 
ATOM   1090 C  CB    . LEU A 1 135 ? 80.859 -7.506  -10.792 1.00 44.48 ? 132 LEU A CB    1 
ATOM   1091 C  CG    . LEU A 1 135 ? 80.135 -6.404  -10.020 1.00 43.93 ? 132 LEU A CG    1 
ATOM   1092 C  CD1   . LEU A 1 135 ? 78.952 -6.976  -9.268  1.00 37.57 ? 132 LEU A CD1   1 
ATOM   1093 C  CD2   . LEU A 1 135 ? 81.099 -5.674  -9.079  1.00 40.48 ? 132 LEU A CD2   1 
ATOM   1094 N  N     . GLN A 1 136 ? 82.821 -8.779  -13.068 1.00 48.70 ? 133 GLN A N     1 
ATOM   1095 C  CA    . GLN A 1 136 ? 83.960 -9.621  -13.417 1.00 57.34 ? 133 GLN A CA    1 
ATOM   1096 C  C     . GLN A 1 136 ? 84.576 -10.348 -12.227 1.00 55.15 ? 133 GLN A C     1 
ATOM   1097 O  O     . GLN A 1 136 ? 85.764 -10.200 -11.943 1.00 46.09 ? 133 GLN A O     1 
ATOM   1098 C  CB    . GLN A 1 136 ? 85.013 -8.827  -14.200 1.00 60.09 ? 133 GLN A CB    1 
ATOM   1099 C  CG    . GLN A 1 136 ? 84.512 -8.280  -15.542 1.00 63.42 ? 133 GLN A CG    1 
ATOM   1100 C  CD    . GLN A 1 136 ? 83.950 -9.359  -16.464 1.00 74.31 ? 133 GLN A CD    1 
ATOM   1101 O  OE1   . GLN A 1 136 ? 83.306 -10.310 -16.016 1.00 74.41 ? 133 GLN A OE1   1 
ATOM   1102 N  NE2   . GLN A 1 136 ? 84.193 -9.210  -17.762 1.00 74.16 ? 133 GLN A NE2   1 
ATOM   1103 N  N     . GLY A 1 137 ? 83.753 -11.142 -11.545 1.00 47.87 ? 134 GLY A N     1 
ATOM   1104 C  CA    . GLY A 1 137 ? 84.202 -11.932 -10.411 1.00 46.38 ? 134 GLY A CA    1 
ATOM   1105 C  C     . GLY A 1 137 ? 84.685 -11.091 -9.241  1.00 40.80 ? 134 GLY A C     1 
ATOM   1106 O  O     . GLY A 1 137 ? 85.111 -11.625 -8.219  1.00 48.48 ? 134 GLY A O     1 
ATOM   1107 N  N     . GLN A 1 138 ? 84.618 -9.771  -9.387  1.00 31.31 ? 135 GLN A N     1 
ATOM   1108 C  CA    . GLN A 1 138 ? 85.062 -8.863  -8.334  1.00 41.90 ? 135 GLN A CA    1 
ATOM   1109 C  C     . GLN A 1 138 ? 84.135 -8.864  -7.118  1.00 44.65 ? 135 GLN A C     1 
ATOM   1110 O  O     . GLN A 1 138 ? 82.917 -8.730  -7.253  1.00 41.37 ? 135 GLN A O     1 
ATOM   1111 C  CB    . GLN A 1 138 ? 85.205 -7.441  -8.872  1.00 47.53 ? 135 GLN A CB    1 
ATOM   1112 C  CG    . GLN A 1 138 ? 85.604 -6.419  -7.825  1.00 47.48 ? 135 GLN A CG    1 
ATOM   1113 C  CD    . GLN A 1 138 ? 85.741 -5.025  -8.410  1.00 67.07 ? 135 GLN A CD    1 
ATOM   1114 O  OE1   . GLN A 1 138 ? 85.664 -4.844  -9.627  1.00 59.51 ? 135 GLN A OE1   1 
ATOM   1115 N  NE2   . GLN A 1 138 ? 85.943 -4.032  -7.547  1.00 52.40 ? 135 GLN A NE2   1 
ATOM   1116 N  N     . PRO A 1 139 ? 84.721 -8.993  -5.920  1.00 41.89 ? 136 PRO A N     1 
ATOM   1117 C  CA    . PRO A 1 139 ? 83.980 -9.042  -4.658  1.00 37.39 ? 136 PRO A CA    1 
ATOM   1118 C  C     . PRO A 1 139 ? 83.126 -7.801  -4.432  1.00 33.40 ? 136 PRO A C     1 
ATOM   1119 O  O     . PRO A 1 139 ? 83.368 -6.750  -5.026  1.00 28.28 ? 136 PRO A O     1 
ATOM   1120 C  CB    . PRO A 1 139 ? 85.092 -9.110  -3.606  1.00 43.64 ? 136 PRO A CB    1 
ATOM   1121 C  CG    . PRO A 1 139 ? 86.293 -8.555  -4.286  1.00 41.12 ? 136 PRO A CG    1 
ATOM   1122 C  CD    . PRO A 1 139 ? 86.175 -9.013  -5.697  1.00 39.31 ? 136 PRO A CD    1 
ATOM   1123 N  N     . ILE A 1 140 ? 82.127 -7.937  -3.570  1.00 33.90 ? 137 ILE A N     1 
ATOM   1124 C  CA    . ILE A 1 140 ? 81.260 -6.821  -3.218  1.00 24.24 ? 137 ILE A CA    1 
ATOM   1125 C  C     . ILE A 1 140 ? 81.652 -6.275  -1.860  1.00 19.40 ? 137 ILE A C     1 
ATOM   1126 O  O     . ILE A 1 140 ? 81.663 -6.999  -0.864  1.00 22.44 ? 137 ILE A O     1 
ATOM   1127 C  CB    . ILE A 1 140 ? 79.788 -7.242  -3.220  1.00 28.97 ? 137 ILE A CB    1 
ATOM   1128 C  CG1   . ILE A 1 140 ? 79.360 -7.576  -4.651  1.00 34.72 ? 137 ILE A CG1   1 
ATOM   1129 C  CG2   . ILE A 1 140 ? 78.921 -6.140  -2.644  1.00 22.54 ? 137 ILE A CG2   1 
ATOM   1130 C  CD1   . ILE A 1 140 ? 78.166 -8.482  -4.740  1.00 31.16 ? 137 ILE A CD1   1 
ATOM   1131 N  N     . SER A 1 141 ? 81.989 -4.990  -1.842  1.00 25.87 ? 138 SER A N     1 
ATOM   1132 C  CA    . SER A 1 141 ? 82.398 -4.280  -0.636  1.00 16.69 ? 138 SER A CA    1 
ATOM   1133 C  C     . SER A 1 141 ? 81.196 -3.976  0.254   1.00 19.72 ? 138 SER A C     1 
ATOM   1134 O  O     . SER A 1 141 ? 80.117 -3.644  -0.240  1.00 16.58 ? 138 SER A O     1 
ATOM   1135 C  CB    . SER A 1 141 ? 83.087 -2.966  -1.043  1.00 18.78 ? 138 SER A CB    1 
ATOM   1136 O  OG    . SER A 1 141 ? 83.122 -2.022  0.015   1.00 34.33 ? 138 SER A OG    1 
ATOM   1137 N  N     . ALA A 1 142 ? 81.393 -4.074  1.564   1.00 11.98 ? 139 ALA A N     1 
ATOM   1138 C  CA    . ALA A 1 142 ? 80.386 -3.650  2.521   1.00 20.26 ? 139 ALA A CA    1 
ATOM   1139 C  C     . ALA A 1 142 ? 79.979 -2.188  2.275   1.00 22.03 ? 139 ALA A C     1 
ATOM   1140 O  O     . ALA A 1 142 ? 78.880 -1.764  2.650   1.00 17.64 ? 139 ALA A O     1 
ATOM   1141 C  CB    . ALA A 1 142 ? 80.899 -3.827  3.930   1.00 23.18 ? 139 ALA A CB    1 
ATOM   1142 N  N     . ASP A 1 143 ? 80.871 -1.425  1.649   1.00 21.96 ? 140 ASP A N     1 
ATOM   1143 C  CA    . ASP A 1 143 ? 80.604 -0.018  1.350   1.00 22.16 ? 140 ASP A CA    1 
ATOM   1144 C  C     . ASP A 1 143 ? 79.449 0.176   0.371   1.00 18.92 ? 140 ASP A C     1 
ATOM   1145 O  O     . ASP A 1 143 ? 78.830 1.239   0.341   1.00 17.50 ? 140 ASP A O     1 
ATOM   1146 C  CB    . ASP A 1 143 ? 81.850 0.671   0.792   1.00 22.97 ? 140 ASP A CB    1 
ATOM   1147 C  CG    . ASP A 1 143 ? 82.924 0.874   1.844   1.00 47.99 ? 140 ASP A CG    1 
ATOM   1148 O  OD1   . ASP A 1 143 ? 82.621 0.708   3.050   1.00 33.14 ? 140 ASP A OD1   1 
ATOM   1149 O  OD2   . ASP A 1 143 ? 84.069 1.208   1.461   1.00 51.29 ? 140 ASP A OD2   1 
ATOM   1150 N  N     . LEU A 1 144 ? 79.171 -0.839  -0.436  1.00 14.45 ? 141 LEU A N     1 
ATOM   1151 C  CA    . LEU A 1 144 ? 78.085 -0.757  -1.408  1.00 14.01 ? 141 LEU A CA    1 
ATOM   1152 C  C     . LEU A 1 144 ? 76.720 -1.097  -0.800  1.00 14.18 ? 141 LEU A C     1 
ATOM   1153 O  O     . LEU A 1 144 ? 75.706 -1.092  -1.500  1.00 12.04 ? 141 LEU A O     1 
ATOM   1154 C  CB    . LEU A 1 144 ? 78.365 -1.684  -2.579  1.00 10.57 ? 141 LEU A CB    1 
ATOM   1155 C  CG    . LEU A 1 144 ? 79.717 -1.431  -3.234  1.00 18.58 ? 141 LEU A CG    1 
ATOM   1156 C  CD1   . LEU A 1 144 ? 79.908 -2.346  -4.419  1.00 22.83 ? 141 LEU A CD1   1 
ATOM   1157 C  CD2   . LEU A 1 144 ? 79.807 0.025   -3.647  1.00 24.00 ? 141 LEU A CD2   1 
ATOM   1158 N  N     . LEU A 1 145 ? 76.715 -1.385  0.496   1.00 13.32 ? 142 LEU A N     1 
ATOM   1159 C  CA    . LEU A 1 145 ? 75.533 -1.876  1.206   1.00 11.60 ? 142 LEU A CA    1 
ATOM   1160 C  C     . LEU A 1 145 ? 75.408 -1.157  2.554   1.00 13.14 ? 142 LEU A C     1 
ATOM   1161 O  O     . LEU A 1 145 ? 75.288 -1.790  3.605   1.00 12.28 ? 142 LEU A O     1 
ATOM   1162 C  CB    . LEU A 1 145 ? 75.650 -3.404  1.402   1.00 11.04 ? 142 LEU A CB    1 
ATOM   1163 C  CG    . LEU A 1 145 ? 75.521 -4.286  0.154   1.00 9.88  ? 142 LEU A CG    1 
ATOM   1164 C  CD1   . LEU A 1 145 ? 75.941 -5.749  0.403   1.00 10.90 ? 142 LEU A CD1   1 
ATOM   1165 C  CD2   . LEU A 1 145 ? 74.107 -4.240  -0.403  1.00 10.09 ? 142 LEU A CD2   1 
ATOM   1166 N  N     . PRO A 1 146 ? 75.422 0.187   2.527   1.00 15.63 ? 143 PRO A N     1 
ATOM   1167 C  CA    . PRO A 1 146 ? 75.506 0.998   3.748   1.00 16.97 ? 143 PRO A CA    1 
ATOM   1168 C  C     . PRO A 1 146 ? 74.253 0.969   4.617   1.00 13.89 ? 143 PRO A C     1 
ATOM   1169 O  O     . PRO A 1 146 ? 74.338 1.371   5.775   1.00 17.75 ? 143 PRO A O     1 
ATOM   1170 C  CB    . PRO A 1 146 ? 75.738 2.414   3.211   1.00 18.50 ? 143 PRO A CB    1 
ATOM   1171 C  CG    . PRO A 1 146 ? 75.144 2.396   1.839   1.00 17.84 ? 143 PRO A CG    1 
ATOM   1172 C  CD    . PRO A 1 146 ? 75.384 1.017   1.308   1.00 13.59 ? 143 PRO A CD    1 
ATOM   1173 N  N     . SER A 1 147 ? 73.119 0.512   4.081   1.00 14.20 ? 144 SER A N     1 
ATOM   1174 C  CA    . SER A 1 147 ? 71.880 0.482   4.862   1.00 11.35 ? 144 SER A CA    1 
ATOM   1175 C  C     . SER A 1 147 ? 71.227 -0.906  4.876   1.00 12.46 ? 144 SER A C     1 
ATOM   1176 O  O     . SER A 1 147 ? 70.056 -1.058  5.241   1.00 7.07  ? 144 SER A O     1 
ATOM   1177 C  CB    . SER A 1 147 ? 70.885 1.538   4.363   1.00 17.79 ? 144 SER A CB    1 
ATOM   1178 O  OG    . SER A 1 147 ? 70.558 1.354   2.993   1.00 15.50 ? 144 SER A OG    1 
ATOM   1179 N  N     . THR A 1 148 ? 72.005 -1.915  4.510   1.00 9.52  ? 145 THR A N     1 
ATOM   1180 C  CA    . THR A 1 148 ? 71.499 -3.284  4.380   1.00 11.53 ? 145 THR A CA    1 
ATOM   1181 C  C     . THR A 1 148 ? 71.659 -4.132  5.644   1.00 7.78  ? 145 THR A C     1 
ATOM   1182 O  O     . THR A 1 148 ? 72.716 -4.115  6.295   1.00 10.74 ? 145 THR A O     1 
ATOM   1183 C  CB    . THR A 1 148 ? 72.169 -3.985  3.175   1.00 10.29 ? 145 THR A CB    1 
ATOM   1184 O  OG1   . THR A 1 148 ? 71.820 -3.278  1.982   1.00 9.12  ? 145 THR A OG1   1 
ATOM   1185 C  CG2   . THR A 1 148 ? 71.732 -5.470  3.043   1.00 7.65  ? 145 THR A CG2   1 
ATOM   1186 N  N     . TYR A 1 149 ? 70.591 -4.849  5.994   1.00 8.21  ? 146 TYR A N     1 
ATOM   1187 C  CA    . TYR A 1 149 ? 70.619 -5.869  7.035   1.00 9.62  ? 146 TYR A CA    1 
ATOM   1188 C  C     . TYR A 1 149 ? 70.553 -7.237  6.386   1.00 13.77 ? 146 TYR A C     1 
ATOM   1189 O  O     . TYR A 1 149 ? 69.822 -7.432  5.398   1.00 11.24 ? 146 TYR A O     1 
ATOM   1190 C  CB    . TYR A 1 149 ? 69.423 -5.722  7.970   1.00 8.72  ? 146 TYR A CB    1 
ATOM   1191 C  CG    . TYR A 1 149 ? 69.624 -4.676  9.039   1.00 12.85 ? 146 TYR A CG    1 
ATOM   1192 C  CD1   . TYR A 1 149 ? 70.038 -5.044  10.318  1.00 15.61 ? 146 TYR A CD1   1 
ATOM   1193 C  CD2   . TYR A 1 149 ? 69.404 -3.318  8.772   1.00 9.55  ? 146 TYR A CD2   1 
ATOM   1194 C  CE1   . TYR A 1 149 ? 70.226 -4.098  11.304  1.00 15.51 ? 146 TYR A CE1   1 
ATOM   1195 C  CE2   . TYR A 1 149 ? 69.596 -2.353  9.762   1.00 12.03 ? 146 TYR A CE2   1 
ATOM   1196 C  CZ    . TYR A 1 149 ? 70.013 -2.753  11.020  1.00 15.12 ? 146 TYR A CZ    1 
ATOM   1197 O  OH    . TYR A 1 149 ? 70.206 -1.829  12.020  1.00 25.66 ? 146 TYR A OH    1 
ATOM   1198 N  N     . ILE A 1 150 ? 71.304 -8.184  6.937   1.00 8.88  ? 147 ILE A N     1 
ATOM   1199 C  CA    . ILE A 1 150 ? 71.214 -9.578  6.501   1.00 4.58  ? 147 ILE A CA    1 
ATOM   1200 C  C     . ILE A 1 150 ? 70.461 -10.382 7.565   1.00 6.82  ? 147 ILE A C     1 
ATOM   1201 O  O     . ILE A 1 150 ? 70.979 -10.617 8.656   1.00 11.71 ? 147 ILE A O     1 
ATOM   1202 C  CB    . ILE A 1 150 ? 72.594 -10.210 6.282   1.00 5.65  ? 147 ILE A CB    1 
ATOM   1203 C  CG1   . ILE A 1 150 ? 73.456 -9.353  5.345   1.00 12.66 ? 147 ILE A CG1   1 
ATOM   1204 C  CG2   . ILE A 1 150 ? 72.443 -11.640 5.724   1.00 10.34 ? 147 ILE A CG2   1 
ATOM   1205 C  CD1   . ILE A 1 150 ? 72.898 -9.171  3.911   1.00 8.00  ? 147 ILE A CD1   1 
ATOM   1206 N  N     . GLU A 1 151 ? 69.233 -10.781 7.252   1.00 7.05  ? 148 GLU A N     1 
ATOM   1207 C  CA    . GLU A 1 151 ? 68.384 -11.432 8.238   1.00 8.02  ? 148 GLU A CA    1 
ATOM   1208 C  C     . GLU A 1 151 ? 69.011 -12.753 8.693   1.00 15.52 ? 148 GLU A C     1 
ATOM   1209 O  O     . GLU A 1 151 ? 69.449 -13.553 7.866   1.00 9.47  ? 148 GLU A O     1 
ATOM   1210 C  CB    . GLU A 1 151 ? 66.984 -11.664 7.662   1.00 12.89 ? 148 GLU A CB    1 
ATOM   1211 C  CG    . GLU A 1 151 ? 66.028 -12.409 8.606   1.00 11.16 ? 148 GLU A CG    1 
ATOM   1212 C  CD    . GLU A 1 151 ? 65.891 -11.742 9.948   1.00 21.38 ? 148 GLU A CD    1 
ATOM   1213 O  OE1   . GLU A 1 151 ? 65.679 -12.468 10.944  1.00 14.77 ? 148 GLU A OE1   1 
ATOM   1214 O  OE2   . GLU A 1 151 ? 65.979 -10.494 10.003  1.00 21.52 ? 148 GLU A OE2   1 
ATOM   1215 N  N     . GLY A 1 152 ? 69.066 -12.967 10.005  1.00 8.74  ? 149 GLY A N     1 
ATOM   1216 C  CA    . GLY A 1 152 ? 69.687 -14.160 10.558  1.00 11.19 ? 149 GLY A CA    1 
ATOM   1217 C  C     . GLY A 1 152 ? 71.113 -13.979 11.059  1.00 16.66 ? 149 GLY A C     1 
ATOM   1218 O  O     . GLY A 1 152 ? 71.625 -14.814 11.805  1.00 14.15 ? 149 GLY A O     1 
ATOM   1219 N  N     . LEU A 1 153 ? 71.765 -12.903 10.634  1.00 14.78 ? 150 LEU A N     1 
ATOM   1220 C  CA    . LEU A 1 153 ? 73.136 -12.611 11.051  1.00 11.31 ? 150 LEU A CA    1 
ATOM   1221 C  C     . LEU A 1 153 ? 73.183 -11.325 11.883  1.00 15.08 ? 150 LEU A C     1 
ATOM   1222 O  O     . LEU A 1 153 ? 72.314 -10.480 11.758  1.00 12.23 ? 150 LEU A O     1 
ATOM   1223 C  CB    . LEU A 1 153 ? 74.038 -12.490 9.826   1.00 9.16  ? 150 LEU A CB    1 
ATOM   1224 C  CG    . LEU A 1 153 ? 74.135 -13.754 8.971   1.00 11.11 ? 150 LEU A CG    1 
ATOM   1225 C  CD1   . LEU A 1 153 ? 75.066 -13.563 7.771   1.00 10.13 ? 150 LEU A CD1   1 
ATOM   1226 C  CD2   . LEU A 1 153 ? 74.600 -14.925 9.835   1.00 16.39 ? 150 LEU A CD2   1 
ATOM   1227 N  N     . PRO A 1 154 ? 74.198 -11.182 12.750  1.00 14.24 ? 151 PRO A N     1 
ATOM   1228 C  CA    . PRO A 1 154 ? 75.265 -12.165 12.961  1.00 16.72 ? 151 PRO A CA    1 
ATOM   1229 C  C     . PRO A 1 154 ? 74.817 -13.336 13.842  1.00 17.27 ? 151 PRO A C     1 
ATOM   1230 O  O     . PRO A 1 154 ? 73.826 -13.242 14.573  1.00 17.75 ? 151 PRO A O     1 
ATOM   1231 C  CB    . PRO A 1 154 ? 76.364 -11.344 13.649  1.00 17.64 ? 151 PRO A CB    1 
ATOM   1232 C  CG    . PRO A 1 154 ? 75.614 -10.282 14.394  1.00 22.90 ? 151 PRO A CG    1 
ATOM   1233 C  CD    . PRO A 1 154 ? 74.380 -9.974  13.572  1.00 17.39 ? 151 PRO A CD    1 
ATOM   1234 N  N     . GLN A 1 155 ? 75.551 -14.438 13.749  1.00 16.35 ? 152 GLN A N     1 
ATOM   1235 C  CA    . GLN A 1 155 ? 75.264 -15.646 14.508  1.00 23.64 ? 152 GLN A CA    1 
ATOM   1236 C  C     . GLN A 1 155 ? 76.570 -16.233 15.029  1.00 38.94 ? 152 GLN A C     1 
ATOM   1237 O  O     . GLN A 1 155 ? 77.644 -15.914 14.516  1.00 40.93 ? 152 GLN A O     1 
ATOM   1238 C  CB    . GLN A 1 155 ? 74.592 -16.682 13.611  1.00 26.22 ? 152 GLN A CB    1 
ATOM   1239 C  CG    . GLN A 1 155 ? 75.113 -18.095 13.858  1.00 40.88 ? 152 GLN A CG    1 
ATOM   1240 C  CD    . GLN A 1 155 ? 74.955 -19.002 12.663  1.00 34.71 ? 152 GLN A CD    1 
ATOM   1241 O  OE1   . GLN A 1 155 ? 73.837 -19.353 12.283  1.00 35.86 ? 152 GLN A OE1   1 
ATOM   1242 N  NE2   . GLN A 1 155 ? 76.074 -19.390 12.060  1.00 21.87 ? 152 GLN A NE2   1 
ATOM   1243 N  N     . GLY A 1 156 ? 76.476 -17.075 16.054  1.00 41.10 ? 153 GLY A N     1 
ATOM   1244 C  CA    . GLY A 1 156 ? 77.571 -17.959 16.424  1.00 57.02 ? 153 GLY A CA    1 
ATOM   1245 C  C     . GLY A 1 156 ? 78.659 -17.410 17.328  1.00 59.28 ? 153 GLY A C     1 
ATOM   1246 O  O     . GLY A 1 156 ? 78.475 -16.386 17.988  1.00 58.17 ? 153 GLY A O     1 
ATOM   1247 N  N     . PRO A 1 157 ? 79.807 -18.111 17.365  1.00 63.46 ? 154 PRO A N     1 
ATOM   1248 C  CA    . PRO A 1 157 ? 80.979 -17.796 18.191  1.00 58.53 ? 154 PRO A CA    1 
ATOM   1249 C  C     . PRO A 1 157 ? 81.890 -16.722 17.587  1.00 45.69 ? 154 PRO A C     1 
ATOM   1250 O  O     . PRO A 1 157 ? 81.764 -16.379 16.411  1.00 57.48 ? 154 PRO A O     1 
ATOM   1251 C  CB    . PRO A 1 157 ? 81.716 -19.137 18.263  1.00 50.24 ? 154 PRO A CB    1 
ATOM   1252 C  CG    . PRO A 1 157 ? 81.382 -19.808 16.969  1.00 34.75 ? 154 PRO A CG    1 
ATOM   1253 C  CD    . PRO A 1 157 ? 79.974 -19.381 16.629  1.00 50.08 ? 154 PRO A CD    1 
ATOM   1254 N  N     . THR A 1 163 ? 79.780 -6.153  20.397  1.00 78.70 ? 160 THR A N     1 
ATOM   1255 C  CA    . THR A 1 163 ? 79.159 -4.878  20.051  1.00 81.47 ? 160 THR A CA    1 
ATOM   1256 C  C     . THR A 1 163 ? 77.719 -4.810  20.553  1.00 71.58 ? 160 THR A C     1 
ATOM   1257 O  O     . THR A 1 163 ? 76.946 -5.756  20.393  1.00 73.03 ? 160 THR A O     1 
ATOM   1258 C  CB    . THR A 1 163 ? 79.184 -4.629  18.528  1.00 70.68 ? 160 THR A CB    1 
ATOM   1259 O  OG1   . THR A 1 163 ? 78.402 -3.468  18.217  1.00 60.17 ? 160 THR A OG1   1 
ATOM   1260 C  CG2   . THR A 1 163 ? 78.624 -5.834  17.781  1.00 62.29 ? 160 THR A CG2   1 
ATOM   1261 N  N     . VAL A 1 164 ? 77.364 -3.682  21.158  1.00 69.61 ? 161 VAL A N     1 
ATOM   1262 C  CA    . VAL A 1 164 ? 76.048 -3.522  21.762  1.00 64.55 ? 161 VAL A CA    1 
ATOM   1263 C  C     . VAL A 1 164 ? 75.248 -2.417  21.076  1.00 59.30 ? 161 VAL A C     1 
ATOM   1264 O  O     . VAL A 1 164 ? 74.211 -1.991  21.582  1.00 65.85 ? 161 VAL A O     1 
ATOM   1265 C  CB    . VAL A 1 164 ? 76.162 -3.193  23.268  1.00 62.67 ? 161 VAL A CB    1 
ATOM   1266 C  CG1   . VAL A 1 164 ? 76.960 -4.270  23.991  1.00 45.61 ? 161 VAL A CG1   1 
ATOM   1267 C  CG2   . VAL A 1 164 ? 76.804 -1.823  23.468  1.00 62.88 ? 161 VAL A CG2   1 
ATOM   1268 N  N     . GLN A 1 165 ? 75.732 -1.955  19.927  1.00 50.21 ? 162 GLN A N     1 
ATOM   1269 C  CA    . GLN A 1 165 ? 75.079 -0.865  19.203  1.00 49.48 ? 162 GLN A CA    1 
ATOM   1270 C  C     . GLN A 1 165 ? 74.385 -1.351  17.934  1.00 46.20 ? 162 GLN A C     1 
ATOM   1271 O  O     . GLN A 1 165 ? 74.898 -2.215  17.224  1.00 34.71 ? 162 GLN A O     1 
ATOM   1272 C  CB    . GLN A 1 165 ? 76.097 0.216   18.833  1.00 45.10 ? 162 GLN A CB    1 
ATOM   1273 C  CG    . GLN A 1 165 ? 77.313 -0.313  18.072  1.00 60.68 ? 162 GLN A CG    1 
ATOM   1274 C  CD    . GLN A 1 165 ? 78.080 0.781   17.340  1.00 60.83 ? 162 GLN A CD    1 
ATOM   1275 O  OE1   . GLN A 1 165 ? 77.628 1.925   17.261  1.00 70.59 ? 162 GLN A OE1   1 
ATOM   1276 N  NE2   . GLN A 1 165 ? 79.244 0.430   16.797  1.00 48.23 ? 162 GLN A NE2   1 
ATOM   1277 N  N     . LYS A 1 166 ? 73.225 -0.771  17.648  1.00 29.39 ? 163 LYS A N     1 
ATOM   1278 C  CA    . LYS A 1 166 ? 72.434 -1.151  16.484  1.00 39.82 ? 163 LYS A CA    1 
ATOM   1279 C  C     . LYS A 1 166 ? 73.253 -1.210  15.184  1.00 27.82 ? 163 LYS A C     1 
ATOM   1280 O  O     . LYS A 1 166 ? 73.280 -2.237  14.511  1.00 21.51 ? 163 LYS A O     1 
ATOM   1281 C  CB    . LYS A 1 166 ? 71.250 -0.196  16.333  1.00 44.57 ? 163 LYS A CB    1 
ATOM   1282 C  CG    . LYS A 1 166 ? 70.239 -0.599  15.285  1.00 43.10 ? 163 LYS A CG    1 
ATOM   1283 C  CD    . LYS A 1 166 ? 69.072 0.380   15.283  1.00 55.03 ? 163 LYS A CD    1 
ATOM   1284 C  CE    . LYS A 1 166 ? 69.553 1.823   15.134  1.00 55.85 ? 163 LYS A CE    1 
ATOM   1285 N  NZ    . LYS A 1 166 ? 68.418 2.797   15.080  1.00 57.82 ? 163 LYS A NZ    1 
ATOM   1286 N  N     . GLU A 1 167 ? 73.918 -0.111  14.837  1.00 23.24 ? 164 GLU A N     1 
ATOM   1287 C  CA    . GLU A 1 167 ? 74.679 -0.038  13.594  1.00 26.99 ? 164 GLU A CA    1 
ATOM   1288 C  C     . GLU A 1 167 ? 75.845 -1.033  13.575  1.00 29.70 ? 164 GLU A C     1 
ATOM   1289 O  O     . GLU A 1 167 ? 76.254 -1.516  12.513  1.00 22.96 ? 164 GLU A O     1 
ATOM   1290 C  CB    . GLU A 1 167 ? 75.188 1.393   13.366  1.00 30.10 ? 164 GLU A CB    1 
ATOM   1291 C  CG    . GLU A 1 167 ? 76.175 1.549   12.210  1.00 24.61 ? 164 GLU A CG    1 
ATOM   1292 C  CD    . GLU A 1 167 ? 75.584 1.175   10.851  1.00 30.64 ? 164 GLU A CD    1 
ATOM   1293 O  OE1   . GLU A 1 167 ? 76.360 1.044   9.882   1.00 30.86 ? 164 GLU A OE1   1 
ATOM   1294 O  OE2   . GLU A 1 167 ? 74.348 1.023   10.746  1.00 28.42 ? 164 GLU A OE2   1 
ATOM   1295 N  N     . GLY A 1 168 ? 76.379 -1.331  14.755  1.00 32.52 ? 165 GLY A N     1 
ATOM   1296 C  CA    . GLY A 1 168 ? 77.504 -2.239  14.871  1.00 32.64 ? 165 GLY A CA    1 
ATOM   1297 C  C     . GLY A 1 168 ? 77.091 -3.675  14.610  1.00 24.16 ? 165 GLY A C     1 
ATOM   1298 O  O     . GLY A 1 168 ? 77.826 -4.447  14.000  1.00 23.63 ? 165 GLY A O     1 
ATOM   1299 N  N     . MET A 1 169 ? 75.904 -4.029  15.084  1.00 27.16 ? 166 MET A N     1 
ATOM   1300 C  CA    . MET A 1 169 ? 75.342 -5.346  14.836  1.00 23.85 ? 166 MET A CA    1 
ATOM   1301 C  C     . MET A 1 169 ? 75.087 -5.496  13.339  1.00 23.84 ? 166 MET A C     1 
ATOM   1302 O  O     . MET A 1 169 ? 75.422 -6.517  12.740  1.00 19.94 ? 166 MET A O     1 
ATOM   1303 C  CB    . MET A 1 169 ? 74.035 -5.516  15.612  1.00 32.54 ? 166 MET A CB    1 
ATOM   1304 C  CG    . MET A 1 169 ? 73.507 -6.945  15.644  1.00 35.44 ? 166 MET A CG    1 
ATOM   1305 S  SD    . MET A 1 169 ? 73.790 -7.777  17.225  1.00 76.83 ? 166 MET A SD    1 
ATOM   1306 C  CE    . MET A 1 169 ? 75.492 -7.326  17.566  1.00 43.82 ? 166 MET A CE    1 
ATOM   1307 N  N     . ARG A 1 170 ? 74.509 -4.463  12.734  1.00 18.50 ? 167 ARG A N     1 
ATOM   1308 C  CA    . ARG A 1 170 ? 74.245 -4.479  11.299  1.00 14.22 ? 167 ARG A CA    1 
ATOM   1309 C  C     . ARG A 1 170 ? 75.506 -4.854  10.534  1.00 20.12 ? 167 ARG A C     1 
ATOM   1310 O  O     . ARG A 1 170 ? 75.463 -5.712  9.660   1.00 11.56 ? 167 ARG A O     1 
ATOM   1311 C  CB    . ARG A 1 170 ? 73.714 -3.120  10.809  1.00 14.70 ? 167 ARG A CB    1 
ATOM   1312 C  CG    . ARG A 1 170 ? 73.341 -3.109  9.329   1.00 11.01 ? 167 ARG A CG    1 
ATOM   1313 C  CD    . ARG A 1 170 ? 73.216 -1.696  8.766   1.00 20.63 ? 167 ARG A CD    1 
ATOM   1314 N  NE    . ARG A 1 170 ? 74.518 -1.094  8.473   1.00 15.27 ? 167 ARG A NE    1 
ATOM   1315 C  CZ    . ARG A 1 170 ? 75.227 -1.338  7.376   1.00 17.59 ? 167 ARG A CZ    1 
ATOM   1316 N  NH1   . ARG A 1 170 ? 74.781 -2.188  6.467   1.00 12.59 ? 167 ARG A NH1   1 
ATOM   1317 N  NH2   . ARG A 1 170 ? 76.392 -0.735  7.188   1.00 19.54 ? 167 ARG A NH2   1 
ATOM   1318 N  N     . LYS A 1 171 ? 76.624 -4.211  10.873  1.00 14.95 ? 168 LYS A N     1 
ATOM   1319 C  CA    . LYS A 1 171 ? 77.886 -4.425  10.164  1.00 14.60 ? 168 LYS A CA    1 
ATOM   1320 C  C     . LYS A 1 171 ? 78.502 -5.814  10.394  1.00 15.55 ? 168 LYS A C     1 
ATOM   1321 O  O     . LYS A 1 171 ? 79.071 -6.409  9.467   1.00 12.44 ? 168 LYS A O     1 
ATOM   1322 C  CB    . LYS A 1 171 ? 78.911 -3.338  10.511  1.00 23.15 ? 168 LYS A CB    1 
ATOM   1323 C  CG    . LYS A 1 171 ? 78.632 -1.967  9.897   1.00 26.22 ? 168 LYS A CG    1 
ATOM   1324 C  CD    . LYS A 1 171 ? 79.908 -1.111  9.942   1.00 37.84 ? 168 LYS A CD    1 
ATOM   1325 C  CE    . LYS A 1 171 ? 79.705 0.297   9.394   1.00 49.68 ? 168 LYS A CE    1 
ATOM   1326 N  NZ    . LYS A 1 171 ? 79.127 1.246   10.399  1.00 37.18 ? 168 LYS A NZ    1 
ATOM   1327 N  N     . GLN A 1 172 ? 78.402 -6.311  11.626  1.00 13.31 ? 169 GLN A N     1 
ATOM   1328 C  CA    . GLN A 1 172 ? 78.886 -7.646  11.961  1.00 17.66 ? 169 GLN A CA    1 
ATOM   1329 C  C     . GLN A 1 172 ? 78.153 -8.664  11.094  1.00 19.99 ? 169 GLN A C     1 
ATOM   1330 O  O     . GLN A 1 172 ? 78.761 -9.573  10.533  1.00 13.22 ? 169 GLN A O     1 
ATOM   1331 C  CB    . GLN A 1 172 ? 78.648 -7.975  13.437  1.00 16.84 ? 169 GLN A CB    1 
ATOM   1332 C  CG    . GLN A 1 172 ? 79.564 -7.267  14.409  1.00 38.14 ? 169 GLN A CG    1 
ATOM   1333 C  CD    . GLN A 1 172 ? 80.135 -8.213  15.451  1.00 73.88 ? 169 GLN A CD    1 
ATOM   1334 O  OE1   . GLN A 1 172 ? 79.938 -9.430  15.378  1.00 69.92 ? 169 GLN A OE1   1 
ATOM   1335 N  NE2   . GLN A 1 172 ? 80.851 -7.660  16.427  1.00 73.82 ? 169 GLN A NE2   1 
ATOM   1336 N  N     . GLY A 1 173 ? 76.835 -8.506  10.989  1.00 18.39 ? 170 GLY A N     1 
ATOM   1337 C  CA    . GLY A 1 173 ? 76.035 -9.428  10.210  1.00 12.04 ? 170 GLY A CA    1 
ATOM   1338 C  C     . GLY A 1 173 ? 76.442 -9.366  8.763   1.00 8.59  ? 170 GLY A C     1 
ATOM   1339 O  O     . GLY A 1 173 ? 76.657 -10.391 8.112   1.00 13.55 ? 170 GLY A O     1 
ATOM   1340 N  N     . LEU A 1 174 ? 76.545 -8.147  8.250   1.00 17.96 ? 171 LEU A N     1 
ATOM   1341 C  CA    . LEU A 1 174 ? 76.940 -7.935  6.864   1.00 16.08 ? 171 LEU A CA    1 
ATOM   1342 C  C     . LEU A 1 174 ? 78.307 -8.564  6.566   1.00 14.24 ? 171 LEU A C     1 
ATOM   1343 O  O     . LEU A 1 174 ? 78.493 -9.210  5.535   1.00 13.19 ? 171 LEU A O     1 
ATOM   1344 C  CB    . LEU A 1 174 ? 76.963 -6.437  6.547   1.00 11.07 ? 171 LEU A CB    1 
ATOM   1345 C  CG    . LEU A 1 174 ? 77.311 -6.062  5.109   1.00 11.91 ? 171 LEU A CG    1 
ATOM   1346 C  CD1   . LEU A 1 174 ? 76.354 -6.768  4.158   1.00 13.01 ? 171 LEU A CD1   1 
ATOM   1347 C  CD2   . LEU A 1 174 ? 77.241 -4.540  4.929   1.00 11.89 ? 171 LEU A CD2   1 
ATOM   1348 N  N     . PHE A 1 175 ? 79.263 -8.368  7.465   1.00 15.67 ? 172 PHE A N     1 
ATOM   1349 C  CA    . PHE A 1 175 ? 80.606 -8.909  7.261   1.00 16.98 ? 172 PHE A CA    1 
ATOM   1350 C  C     . PHE A 1 175 ? 80.595 -10.434 7.161   1.00 13.42 ? 172 PHE A C     1 
ATOM   1351 O  O     . PHE A 1 175 ? 81.225 -11.004 6.264   1.00 21.29 ? 172 PHE A O     1 
ATOM   1352 C  CB    . PHE A 1 175 ? 81.541 -8.461  8.381   1.00 13.26 ? 172 PHE A CB    1 
ATOM   1353 C  CG    . PHE A 1 175 ? 82.053 -7.060  8.218   1.00 43.16 ? 172 PHE A CG    1 
ATOM   1354 C  CD1   . PHE A 1 175 ? 82.371 -6.565  6.961   1.00 38.62 ? 172 PHE A CD1   1 
ATOM   1355 C  CD2   . PHE A 1 175 ? 82.215 -6.234  9.323   1.00 40.87 ? 172 PHE A CD2   1 
ATOM   1356 C  CE1   . PHE A 1 175 ? 82.845 -5.269  6.808   1.00 39.14 ? 172 PHE A CE1   1 
ATOM   1357 C  CE2   . PHE A 1 175 ? 82.692 -4.938  9.177   1.00 45.93 ? 172 PHE A CE2   1 
ATOM   1358 C  CZ    . PHE A 1 175 ? 83.007 -4.457  7.918   1.00 45.48 ? 172 PHE A CZ    1 
ATOM   1359 N  N     . GLN A 1 176 ? 79.883 -11.092 8.075   1.00 15.51 ? 173 GLN A N     1 
ATOM   1360 C  CA    . GLN A 1 176 ? 79.752 -12.551 8.033   1.00 16.63 ? 173 GLN A CA    1 
ATOM   1361 C  C     . GLN A 1 176 ? 79.191 -12.986 6.690   1.00 17.84 ? 173 GLN A C     1 
ATOM   1362 O  O     . GLN A 1 176 ? 79.708 -13.904 6.057   1.00 18.00 ? 173 GLN A O     1 
ATOM   1363 C  CB    . GLN A 1 176 ? 78.878 -13.081 9.182   1.00 15.21 ? 173 GLN A CB    1 
ATOM   1364 C  CG    . GLN A 1 176 ? 79.474 -12.841 10.562  1.00 17.61 ? 173 GLN A CG    1 
ATOM   1365 C  CD    . GLN A 1 176 ? 78.693 -13.506 11.678  1.00 22.40 ? 173 GLN A CD    1 
ATOM   1366 O  OE1   . GLN A 1 176 ? 77.594 -14.014 11.469  1.00 20.20 ? 173 GLN A OE1   1 
ATOM   1367 N  NE2   . GLN A 1 176 ? 79.271 -13.519 12.877  1.00 23.94 ? 173 GLN A NE2   1 
ATOM   1368 N  N     . TRP A 1 177 ? 78.147 -12.297 6.242   1.00 11.87 ? 174 TRP A N     1 
ATOM   1369 C  CA    . TRP A 1 177 ? 77.516 -12.601 4.962   1.00 14.78 ? 174 TRP A CA    1 
ATOM   1370 C  C     . TRP A 1 177 ? 78.511 -12.511 3.805   1.00 14.50 ? 174 TRP A C     1 
ATOM   1371 O  O     . TRP A 1 177 ? 78.692 -13.469 3.049   1.00 12.75 ? 174 TRP A O     1 
ATOM   1372 C  CB    . TRP A 1 177 ? 76.319 -11.661 4.730   1.00 8.69  ? 174 TRP A CB    1 
ATOM   1373 C  CG    . TRP A 1 177 ? 75.640 -11.828 3.378   1.00 11.01 ? 174 TRP A CG    1 
ATOM   1374 C  CD1   . TRP A 1 177 ? 75.750 -10.995 2.304   1.00 11.48 ? 174 TRP A CD1   1 
ATOM   1375 C  CD2   . TRP A 1 177 ? 74.753 -12.888 2.973   1.00 12.74 ? 174 TRP A CD2   1 
ATOM   1376 N  NE1   . TRP A 1 177 ? 74.984 -11.458 1.259   1.00 12.06 ? 174 TRP A NE1   1 
ATOM   1377 C  CE2   . TRP A 1 177 ? 74.368 -12.622 1.638   1.00 15.47 ? 174 TRP A CE2   1 
ATOM   1378 C  CE3   . TRP A 1 177 ? 74.257 -14.038 3.603   1.00 13.25 ? 174 TRP A CE3   1 
ATOM   1379 C  CZ2   . TRP A 1 177 ? 73.504 -13.456 0.923   1.00 12.63 ? 174 TRP A CZ2   1 
ATOM   1380 C  CZ3   . TRP A 1 177 ? 73.399 -14.869 2.895   1.00 12.24 ? 174 TRP A CZ3   1 
ATOM   1381 C  CH2   . TRP A 1 177 ? 73.023 -14.571 1.566   1.00 10.62 ? 174 TRP A CH2   1 
ATOM   1382 N  N     . LEU A 1 178 ? 79.168 -11.364 3.679   1.00 11.99 ? 175 LEU A N     1 
ATOM   1383 C  CA    . LEU A 1 178 ? 80.102 -11.145 2.577   1.00 17.43 ? 175 LEU A CA    1 
ATOM   1384 C  C     . LEU A 1 178 ? 81.337 -12.033 2.699   1.00 24.52 ? 175 LEU A C     1 
ATOM   1385 O  O     . LEU A 1 178 ? 81.952 -12.392 1.700   1.00 19.97 ? 175 LEU A O     1 
ATOM   1386 C  CB    . LEU A 1 178 ? 80.532 -9.678  2.518   1.00 13.11 ? 175 LEU A CB    1 
ATOM   1387 C  CG    . LEU A 1 178 ? 79.400 -8.680  2.264   1.00 13.09 ? 175 LEU A CG    1 
ATOM   1388 C  CD1   . LEU A 1 178 ? 79.910 -7.249  2.407   1.00 17.33 ? 175 LEU A CD1   1 
ATOM   1389 C  CD2   . LEU A 1 178 ? 78.795 -8.903  0.879   1.00 13.19 ? 175 LEU A CD2   1 
ATOM   1390 N  N     . ASP A 1 179 ? 81.704 -12.369 3.927   1.00 18.46 ? 176 ASP A N     1 
ATOM   1391 C  CA    . ASP A 1 179 ? 82.862 -13.232 4.146   1.00 33.89 ? 176 ASP A CA    1 
ATOM   1392 C  C     . ASP A 1 179 ? 82.619 -14.612 3.568   1.00 30.04 ? 176 ASP A C     1 
ATOM   1393 O  O     . ASP A 1 179 ? 83.563 -15.333 3.245   1.00 30.01 ? 176 ASP A O     1 
ATOM   1394 C  CB    . ASP A 1 179 ? 83.198 -13.343 5.639   1.00 20.62 ? 176 ASP A CB    1 
ATOM   1395 C  CG    . ASP A 1 179 ? 83.976 -12.140 6.148   1.00 34.76 ? 176 ASP A CG    1 
ATOM   1396 O  OD1   . ASP A 1 179 ? 84.737 -11.550 5.349   1.00 48.82 ? 176 ASP A OD1   1 
ATOM   1397 O  OD2   . ASP A 1 179 ? 83.828 -11.778 7.339   1.00 49.14 ? 176 ASP A OD2   1 
ATOM   1398 N  N     . SER A 1 180 ? 81.345 -14.961 3.428   1.00 20.11 ? 177 SER A N     1 
ATOM   1399 C  CA    . SER A 1 180 ? 80.951 -16.313 3.052   1.00 29.56 ? 177 SER A CA    1 
ATOM   1400 C  C     . SER A 1 180 ? 80.487 -16.438 1.606   1.00 34.15 ? 177 SER A C     1 
ATOM   1401 O  O     . SER A 1 180 ? 80.163 -17.539 1.152   1.00 35.04 ? 177 SER A O     1 
ATOM   1402 C  CB    . SER A 1 180 ? 79.831 -16.803 3.973   1.00 21.93 ? 177 SER A CB    1 
ATOM   1403 O  OG    . SER A 1 180 ? 80.205 -16.677 5.332   1.00 30.74 ? 177 SER A OG    1 
ATOM   1404 N  N     . LEU A 1 181 ? 80.431 -15.319 0.891   1.00 18.52 ? 178 LEU A N     1 
ATOM   1405 C  CA    . LEU A 1 181 ? 79.897 -15.326 -0.469  1.00 16.59 ? 178 LEU A CA    1 
ATOM   1406 C  C     . LEU A 1 181 ? 80.854 -15.979 -1.450  1.00 33.78 ? 178 LEU A C     1 
ATOM   1407 O  O     . LEU A 1 181 ? 82.048 -15.697 -1.422  1.00 27.11 ? 178 LEU A O     1 
ATOM   1408 C  CB    . LEU A 1 181 ? 79.634 -13.897 -0.947  1.00 25.38 ? 178 LEU A CB    1 
ATOM   1409 C  CG    . LEU A 1 181 ? 78.274 -13.266 -0.679  1.00 20.01 ? 178 LEU A CG    1 
ATOM   1410 C  CD1   . LEU A 1 181 ? 78.153 -11.932 -1.431  1.00 9.67  ? 178 LEU A CD1   1 
ATOM   1411 C  CD2   . LEU A 1 181 ? 77.160 -14.213 -1.090  1.00 17.65 ? 178 LEU A CD2   1 
ATOM   1412 N  N     . GLN A 1 182 ? 80.324 -16.833 -2.325  1.00 35.61 ? 179 GLN A N     1 
ATOM   1413 C  CA    . GLN A 1 182 ? 81.098 -17.363 -3.445  1.00 43.26 ? 179 GLN A CA    1 
ATOM   1414 C  C     . GLN A 1 182 ? 80.867 -16.508 -4.694  1.00 53.02 ? 179 GLN A C     1 
ATOM   1415 O  O     . GLN A 1 182 ? 79.854 -16.661 -5.379  1.00 53.44 ? 179 GLN A O     1 
ATOM   1416 C  CB    . GLN A 1 182 ? 80.724 -18.820 -3.723  1.00 52.64 ? 179 GLN A CB    1 
ATOM   1417 C  CG    . GLN A 1 182 ? 81.682 -19.542 -4.669  1.00 65.99 ? 179 GLN A CG    1 
ATOM   1418 C  CD    . GLN A 1 182 ? 83.099 -19.634 -4.119  1.00 64.14 ? 179 GLN A CD    1 
ATOM   1419 O  OE1   . GLN A 1 182 ? 83.857 -18.660 -4.146  1.00 64.21 ? 179 GLN A OE1   1 
ATOM   1420 N  NE2   . GLN A 1 182 ? 83.463 -20.809 -3.616  1.00 62.60 ? 179 GLN A NE2   1 
ATOM   1421 N  N     . ILE A 1 183 ? 81.819 -15.622 -4.988  1.00 46.92 ? 180 ILE A N     1 
ATOM   1422 C  CA    . ILE A 1 183 ? 81.656 -14.614 -6.040  1.00 52.87 ? 180 ILE A CA    1 
ATOM   1423 C  C     . ILE A 1 183 ? 82.087 -15.066 -7.443  1.00 56.12 ? 180 ILE A C     1 
ATOM   1424 O  O     . ILE A 1 183 ? 81.752 -14.419 -8.442  1.00 48.30 ? 180 ILE A O     1 
ATOM   1425 C  CB    . ILE A 1 183 ? 82.404 -13.311 -5.681  1.00 39.41 ? 180 ILE A CB    1 
ATOM   1426 C  CG1   . ILE A 1 183 ? 83.900 -13.588 -5.514  1.00 52.38 ? 180 ILE A CG1   1 
ATOM   1427 C  CG2   . ILE A 1 183 ? 81.833 -12.702 -4.413  1.00 42.02 ? 180 ILE A CG2   1 
ATOM   1428 C  CD1   . ILE A 1 183 ? 84.692 -12.408 -4.990  1.00 49.71 ? 180 ILE A CD1   1 
ATOM   1429 N  N     . ASP A 1 184 ? 82.834 -16.164 -7.519  1.00 60.98 ? 181 ASP A N     1 
ATOM   1430 C  CA    . ASP A 1 184 ? 83.259 -16.689 -8.813  1.00 58.05 ? 181 ASP A CA    1 
ATOM   1431 C  C     . ASP A 1 184 ? 82.108 -17.412 -9.510  1.00 57.94 ? 181 ASP A C     1 
ATOM   1432 O  O     . ASP A 1 184 ? 82.179 -17.718 -10.700 1.00 60.67 ? 181 ASP A O     1 
ATOM   1433 C  CB    . ASP A 1 184 ? 84.482 -17.606 -8.674  1.00 63.70 ? 181 ASP A CB    1 
ATOM   1434 C  CG    . ASP A 1 184 ? 84.188 -18.878 -7.892  1.00 65.53 ? 181 ASP A CG    1 
ATOM   1435 O  OD1   . ASP A 1 184 ? 83.013 -19.119 -7.537  1.00 63.06 ? 181 ASP A OD1   1 
ATOM   1436 O  OD2   . ASP A 1 184 ? 85.141 -19.650 -7.645  1.00 60.99 ? 181 ASP A OD2   1 
ATOM   1437 N  N     . ASN A 1 185 ? 81.044 -17.675 -8.758  1.00 50.90 ? 182 ASN A N     1 
ATOM   1438 C  CA    . ASN A 1 185 ? 79.878 -18.358 -9.303  1.00 53.87 ? 182 ASN A CA    1 
ATOM   1439 C  C     . ASN A 1 185 ? 78.746 -17.387 -9.634  1.00 48.99 ? 182 ASN A C     1 
ATOM   1440 O  O     . ASN A 1 185 ? 78.100 -16.845 -8.738  1.00 42.42 ? 182 ASN A O     1 
ATOM   1441 C  CB    . ASN A 1 185 ? 79.392 -19.436 -8.335  1.00 43.97 ? 182 ASN A CB    1 
ATOM   1442 C  CG    . ASN A 1 185 ? 78.201 -20.196 -8.868  1.00 40.12 ? 182 ASN A CG    1 
ATOM   1443 O  OD1   . ASN A 1 185 ? 77.834 -20.057 -10.038 1.00 43.93 ? 182 ASN A OD1   1 
ATOM   1444 N  ND2   . ASN A 1 185 ? 77.587 -21.011 -8.015  1.00 49.04 ? 182 ASN A ND2   1 
ATOM   1445 N  N     . LEU A 1 186 ? 78.510 -17.179 -10.927 1.00 47.56 ? 183 LEU A N     1 
ATOM   1446 C  CA    . LEU A 1 186 ? 77.504 -16.225 -11.393 1.00 43.36 ? 183 LEU A CA    1 
ATOM   1447 C  C     . LEU A 1 186 ? 76.065 -16.729 -11.233 1.00 39.64 ? 183 LEU A C     1 
ATOM   1448 O  O     . LEU A 1 186 ? 75.113 -16.018 -11.559 1.00 40.49 ? 183 LEU A O     1 
ATOM   1449 C  CB    . LEU A 1 186 ? 77.765 -15.849 -12.855 1.00 44.97 ? 183 LEU A CB    1 
ATOM   1450 C  CG    . LEU A 1 186 ? 78.576 -14.580 -13.150 1.00 53.17 ? 183 LEU A CG    1 
ATOM   1451 C  CD1   . LEU A 1 186 ? 79.747 -14.408 -12.184 1.00 54.91 ? 183 LEU A CD1   1 
ATOM   1452 C  CD2   . LEU A 1 186 ? 79.054 -14.591 -14.596 1.00 47.66 ? 183 LEU A CD2   1 
ATOM   1453 N  N     . THR A 1 187 ? 75.908 -17.952 -10.735 1.00 39.86 ? 184 THR A N     1 
ATOM   1454 C  CA    . THR A 1 187 ? 74.574 -18.517 -10.537 1.00 41.21 ? 184 THR A CA    1 
ATOM   1455 C  C     . THR A 1 187 ? 74.231 -18.761 -9.068  1.00 32.12 ? 184 THR A C     1 
ATOM   1456 O  O     . THR A 1 187 ? 73.121 -19.198 -8.759  1.00 38.67 ? 184 THR A O     1 
ATOM   1457 C  CB    . THR A 1 187 ? 74.366 -19.834 -11.335 1.00 47.12 ? 184 THR A CB    1 
ATOM   1458 O  OG1   . THR A 1 187 ? 75.343 -20.808 -10.939 1.00 49.03 ? 184 THR A OG1   1 
ATOM   1459 C  CG2   . THR A 1 187 ? 74.477 -19.579 -12.833 1.00 54.75 ? 184 THR A CG2   1 
ATOM   1460 N  N     . SER A 1 188 ? 75.172 -18.492 -8.165  1.00 28.99 ? 185 SER A N     1 
ATOM   1461 C  CA    . SER A 1 188 ? 74.873 -18.572 -6.732  1.00 21.47 ? 185 SER A CA    1 
ATOM   1462 C  C     . SER A 1 188 ? 73.694 -17.659 -6.397  1.00 15.52 ? 185 SER A C     1 
ATOM   1463 O  O     . SER A 1 188 ? 73.766 -16.447 -6.605  1.00 13.40 ? 185 SER A O     1 
ATOM   1464 C  CB    . SER A 1 188 ? 76.085 -18.176 -5.888  1.00 27.38 ? 185 SER A CB    1 
ATOM   1465 O  OG    . SER A 1 188 ? 75.761 -18.152 -4.501  1.00 25.78 ? 185 SER A OG    1 
ATOM   1466 N  N     . PRO A 1 189 ? 72.591 -18.242 -5.907  1.00 14.29 ? 186 PRO A N     1 
ATOM   1467 C  CA    . PRO A 1 189 ? 71.429 -17.437 -5.504  1.00 10.41 ? 186 PRO A CA    1 
ATOM   1468 C  C     . PRO A 1 189 ? 71.790 -16.395 -4.452  1.00 9.54  ? 186 PRO A C     1 
ATOM   1469 O  O     . PRO A 1 189 ? 71.239 -15.303 -4.504  1.00 9.76  ? 186 PRO A O     1 
ATOM   1470 C  CB    . PRO A 1 189 ? 70.470 -18.477 -4.930  1.00 13.09 ? 186 PRO A CB    1 
ATOM   1471 C  CG    . PRO A 1 189 ? 70.808 -19.735 -5.732  1.00 10.50 ? 186 PRO A CG    1 
ATOM   1472 C  CD    . PRO A 1 189 ? 72.308 -19.686 -5.874  1.00 10.52 ? 186 PRO A CD    1 
ATOM   1473 N  N     . ASP A 1 190 ? 72.704 -16.707 -3.534  1.00 8.37  ? 187 ASP A N     1 
ATOM   1474 C  CA    . ASP A 1 190 ? 73.028 -15.761 -2.469  1.00 12.88 ? 187 ASP A CA    1 
ATOM   1475 C  C     . ASP A 1 190 ? 73.759 -14.555 -3.014  1.00 8.94  ? 187 ASP A C     1 
ATOM   1476 O  O     . ASP A 1 190 ? 73.567 -13.432 -2.547  1.00 10.09 ? 187 ASP A O     1 
ATOM   1477 C  CB    . ASP A 1 190 ? 73.883 -16.423 -1.408  1.00 8.77  ? 187 ASP A CB    1 
ATOM   1478 C  CG    . ASP A 1 190 ? 73.100 -17.413 -0.581  1.00 16.03 ? 187 ASP A CG    1 
ATOM   1479 O  OD1   . ASP A 1 190 ? 71.863 -17.296 -0.545  1.00 9.42  ? 187 ASP A OD1   1 
ATOM   1480 O  OD2   . ASP A 1 190 ? 73.721 -18.307 0.014   1.00 16.78 ? 187 ASP A OD2   1 
ATOM   1481 N  N     . LEU A 1 191 ? 74.612 -14.809 -4.000  1.00 6.17  ? 188 LEU A N     1 
ATOM   1482 C  CA    . LEU A 1 191 ? 75.336 -13.745 -4.665  1.00 14.62 ? 188 LEU A CA    1 
ATOM   1483 C  C     . LEU A 1 191 ? 74.349 -12.870 -5.419  1.00 8.25  ? 188 LEU A C     1 
ATOM   1484 O  O     . LEU A 1 191 ? 74.414 -11.640 -5.354  1.00 12.02 ? 188 LEU A O     1 
ATOM   1485 C  CB    . LEU A 1 191 ? 76.358 -14.338 -5.644  1.00 13.35 ? 188 LEU A CB    1 
ATOM   1486 C  CG    . LEU A 1 191 ? 77.137 -13.333 -6.503  1.00 12.50 ? 188 LEU A CG    1 
ATOM   1487 C  CD1   . LEU A 1 191 ? 77.764 -12.268 -5.646  1.00 13.26 ? 188 LEU A CD1   1 
ATOM   1488 C  CD2   . LEU A 1 191 ? 78.212 -14.047 -7.325  1.00 18.56 ? 188 LEU A CD2   1 
ATOM   1489 N  N     . GLN A 1 192 ? 73.453 -13.512 -6.156  1.00 7.79  ? 189 GLN A N     1 
ATOM   1490 C  CA    . GLN A 1 192 ? 72.431 -12.798 -6.919  1.00 11.74 ? 189 GLN A CA    1 
ATOM   1491 C  C     . GLN A 1 192 ? 71.619 -11.845 -6.037  1.00 13.03 ? 189 GLN A C     1 
ATOM   1492 O  O     . GLN A 1 192 ? 71.388 -10.691 -6.407  1.00 10.28 ? 189 GLN A O     1 
ATOM   1493 C  CB    . GLN A 1 192 ? 71.517 -13.786 -7.645  1.00 13.59 ? 189 GLN A CB    1 
ATOM   1494 C  CG    . GLN A 1 192 ? 72.205 -14.486 -8.813  1.00 18.17 ? 189 GLN A CG    1 
ATOM   1495 C  CD    . GLN A 1 192 ? 71.390 -15.628 -9.389  1.00 27.24 ? 189 GLN A CD    1 
ATOM   1496 O  OE1   . GLN A 1 192 ? 70.461 -16.127 -8.757  1.00 27.06 ? 189 GLN A OE1   1 
ATOM   1497 N  NE2   . GLN A 1 192 ? 71.744 -16.056 -10.597 1.00 41.64 ? 189 GLN A NE2   1 
ATOM   1498 N  N     . LEU A 1 193 ? 71.201 -12.332 -4.868  1.00 9.66  ? 190 LEU A N     1 
ATOM   1499 C  CA    . LEU A 1 193 ? 70.471 -11.518 -3.896  1.00 5.23  ? 190 LEU A CA    1 
ATOM   1500 C  C     . LEU A 1 193 ? 71.320 -10.336 -3.435  1.00 11.18 ? 190 LEU A C     1 
ATOM   1501 O  O     . LEU A 1 193 ? 70.808 -9.240  -3.258  1.00 8.53  ? 190 LEU A O     1 
ATOM   1502 C  CB    . LEU A 1 193 ? 70.069 -12.346 -2.662  1.00 7.24  ? 190 LEU A CB    1 
ATOM   1503 C  CG    . LEU A 1 193 ? 68.966 -13.402 -2.776  1.00 11.48 ? 190 LEU A CG    1 
ATOM   1504 C  CD1   . LEU A 1 193 ? 68.657 -13.995 -1.401  1.00 8.80  ? 190 LEU A CD1   1 
ATOM   1505 C  CD2   . LEU A 1 193 ? 67.703 -12.778 -3.390  1.00 6.00  ? 190 LEU A CD2   1 
ATOM   1506 N  N     . THR A 1 194 ? 72.608 -10.583 -3.210  1.00 6.90  ? 191 THR A N     1 
ATOM   1507 C  CA    . THR A 1 194 ? 73.533 -9.564  -2.743  1.00 9.33  ? 191 THR A CA    1 
ATOM   1508 C  C     . THR A 1 194 ? 73.668 -8.435  -3.765  1.00 9.28  ? 191 THR A C     1 
ATOM   1509 O  O     . THR A 1 194 ? 73.643 -7.249  -3.412  1.00 10.21 ? 191 THR A O     1 
ATOM   1510 C  CB    . THR A 1 194 ? 74.918 -10.171 -2.446  1.00 9.08  ? 191 THR A CB    1 
ATOM   1511 O  OG1   . THR A 1 194 ? 74.768 -11.210 -1.472  1.00 12.12 ? 191 THR A OG1   1 
ATOM   1512 C  CG2   . THR A 1 194 ? 75.869 -9.101  -1.903  1.00 7.21  ? 191 THR A CG2   1 
ATOM   1513 N  N     . VAL A 1 195 ? 73.788 -8.809  -5.030  1.00 10.40 ? 192 VAL A N     1 
ATOM   1514 C  CA    . VAL A 1 195 ? 73.871 -7.815  -6.087  1.00 17.66 ? 192 VAL A CA    1 
ATOM   1515 C  C     . VAL A 1 195 ? 72.533 -7.080  -6.171  1.00 10.73 ? 192 VAL A C     1 
ATOM   1516 O  O     . VAL A 1 195 ? 72.498 -5.873  -6.420  1.00 10.32 ? 192 VAL A O     1 
ATOM   1517 C  CB    . VAL A 1 195 ? 74.272 -8.448  -7.447  1.00 14.51 ? 192 VAL A CB    1 
ATOM   1518 C  CG1   . VAL A 1 195 ? 74.054 -7.457  -8.600  1.00 14.51 ? 192 VAL A CG1   1 
ATOM   1519 C  CG2   . VAL A 1 195 ? 75.728 -8.923  -7.422  1.00 11.21 ? 192 VAL A CG2   1 
ATOM   1520 N  N     . GLY A 1 196 ? 71.433 -7.801  -5.945  1.00 10.68 ? 193 GLY A N     1 
ATOM   1521 C  CA    . GLY A 1 196 ? 70.117 -7.173  -5.917  1.00 8.98  ? 193 GLY A CA    1 
ATOM   1522 C  C     . GLY A 1 196 ? 70.062 -6.081  -4.864  1.00 8.54  ? 193 GLY A C     1 
ATOM   1523 O  O     . GLY A 1 196 ? 69.574 -4.970  -5.105  1.00 9.57  ? 193 GLY A O     1 
ATOM   1524 N  N     . ALA A 1 197 ? 70.582 -6.392  -3.683  1.00 6.21  ? 194 ALA A N     1 
ATOM   1525 C  CA    . ALA A 1 197 ? 70.653 -5.415  -2.607  1.00 5.82  ? 194 ALA A CA    1 
ATOM   1526 C  C     . ALA A 1 197 ? 71.519 -4.188  -2.966  1.00 11.42 ? 194 ALA A C     1 
ATOM   1527 O  O     . ALA A 1 197 ? 71.204 -3.068  -2.552  1.00 6.37  ? 194 ALA A O     1 
ATOM   1528 C  CB    . ALA A 1 197 ? 71.133 -6.077  -1.307  1.00 9.08  ? 194 ALA A CB    1 
ATOM   1529 N  N     . VAL A 1 198 ? 72.594 -4.391  -3.733  1.00 8.78  ? 195 VAL A N     1 
ATOM   1530 C  CA    . VAL A 1 198 ? 73.422 -3.255  -4.178  1.00 8.04  ? 195 VAL A CA    1 
ATOM   1531 C  C     . VAL A 1 198 ? 72.611 -2.318  -5.073  1.00 13.06 ? 195 VAL A C     1 
ATOM   1532 O  O     . VAL A 1 198 ? 72.655 -1.083  -4.918  1.00 8.20  ? 195 VAL A O     1 
ATOM   1533 C  CB    . VAL A 1 198 ? 74.685 -3.716  -4.927  1.00 10.32 ? 195 VAL A CB    1 
ATOM   1534 C  CG1   . VAL A 1 198 ? 75.441 -2.520  -5.529  1.00 10.91 ? 195 VAL A CG1   1 
ATOM   1535 C  CG2   . VAL A 1 198 ? 75.590 -4.516  -3.999  1.00 11.01 ? 195 VAL A CG2   1 
ATOM   1536 N  N     . ILE A 1 199 ? 71.867 -2.907  -6.009  1.00 6.76  ? 196 ILE A N     1 
ATOM   1537 C  CA    . ILE A 1 199 ? 71.012 -2.135  -6.900  1.00 13.84 ? 196 ILE A CA    1 
ATOM   1538 C  C     . ILE A 1 199 ? 69.899 -1.385  -6.147  1.00 9.62  ? 196 ILE A C     1 
ATOM   1539 O  O     . ILE A 1 199 ? 69.614 -0.242  -6.461  1.00 11.10 ? 196 ILE A O     1 
ATOM   1540 C  CB    . ILE A 1 199 ? 70.423 -3.020  -8.027  1.00 7.36  ? 196 ILE A CB    1 
ATOM   1541 C  CG1   . ILE A 1 199 ? 71.558 -3.567  -8.898  1.00 9.48  ? 196 ILE A CG1   1 
ATOM   1542 C  CG2   . ILE A 1 199 ? 69.462 -2.250  -8.870  1.00 9.13  ? 196 ILE A CG2   1 
ATOM   1543 C  CD1   . ILE A 1 199 ? 71.129 -4.606  -9.924  1.00 15.95 ? 196 ILE A CD1   1 
ATOM   1544 N  N     . VAL A 1 200 ? 69.305 -2.022  -5.143  1.00 8.13  ? 197 VAL A N     1 
ATOM   1545 C  CA    . VAL A 1 200 ? 68.226 -1.418  -4.370  1.00 6.75  ? 197 VAL A CA    1 
ATOM   1546 C  C     . VAL A 1 200 ? 68.765 -0.281  -3.512  1.00 10.92 ? 197 VAL A C     1 
ATOM   1547 O  O     . VAL A 1 200 ? 68.086 0.735   -3.331  1.00 8.00  ? 197 VAL A O     1 
ATOM   1548 C  CB    . VAL A 1 200 ? 67.457 -2.474  -3.524  1.00 6.57  ? 197 VAL A CB    1 
ATOM   1549 C  CG1   . VAL A 1 200 ? 66.416 -1.807  -2.628  1.00 5.04  ? 197 VAL A CG1   1 
ATOM   1550 C  CG2   . VAL A 1 200 ? 66.780 -3.477  -4.442  1.00 12.55 ? 197 VAL A CG2   1 
ATOM   1551 N  N     . GLU A 1 201 ? 70.001 -0.419  -3.030  1.00 9.25  ? 198 GLU A N     1 
ATOM   1552 C  CA    . GLU A 1 201 ? 70.682 0.709   -2.399  1.00 10.68 ? 198 GLU A CA    1 
ATOM   1553 C  C     . GLU A 1 201 ? 70.700 1.902   -3.373  1.00 12.51 ? 198 GLU A C     1 
ATOM   1554 O  O     . GLU A 1 201 ? 70.377 3.032   -3.000  1.00 10.20 ? 198 GLU A O     1 
ATOM   1555 C  CB    . GLU A 1 201 ? 72.121 0.352   -1.972  1.00 13.54 ? 198 GLU A CB    1 
ATOM   1556 C  CG    . GLU A 1 201 ? 72.282 -0.630  -0.773  1.00 11.91 ? 198 GLU A CG    1 
ATOM   1557 C  CD    . GLU A 1 201 ? 72.124 0.022   0.601   1.00 17.57 ? 198 GLU A CD    1 
ATOM   1558 O  OE1   . GLU A 1 201 ? 71.800 1.232   0.680   1.00 16.24 ? 198 GLU A OE1   1 
ATOM   1559 O  OE2   . GLU A 1 201 ? 72.324 -0.681  1.616   1.00 12.60 ? 198 GLU A OE2   1 
ATOM   1560 N  N     . GLU A 1 202 ? 71.079 1.634   -4.619  1.00 10.67 ? 199 GLU A N     1 
ATOM   1561 C  CA    . GLU A 1 202 ? 71.161 2.673   -5.649  1.00 15.14 ? 199 GLU A CA    1 
ATOM   1562 C  C     . GLU A 1 202 ? 69.777 3.272   -5.967  1.00 12.76 ? 199 GLU A C     1 
ATOM   1563 O  O     . GLU A 1 202 ? 69.630 4.495   -6.083  1.00 8.83  ? 199 GLU A O     1 
ATOM   1564 C  CB    . GLU A 1 202 ? 71.853 2.119   -6.905  1.00 12.55 ? 199 GLU A CB    1 
ATOM   1565 C  CG    . GLU A 1 202 ? 73.337 1.816   -6.684  1.00 16.54 ? 199 GLU A CG    1 
ATOM   1566 C  CD    . GLU A 1 202 ? 73.968 0.921   -7.757  1.00 21.67 ? 199 GLU A CD    1 
ATOM   1567 O  OE1   . GLU A 1 202 ? 75.184 0.636   -7.644  1.00 26.74 ? 199 GLU A OE1   1 
ATOM   1568 O  OE2   . GLU A 1 202 ? 73.269 0.501   -8.702  1.00 26.79 ? 199 GLU A OE2   1 
ATOM   1569 N  N     . MET A 1 203 ? 68.765 2.414   -6.097  1.00 10.23 ? 200 MET A N     1 
ATOM   1570 C  CA    . MET A 1 203 ? 67.394 2.880   -6.286  1.00 10.79 ? 200 MET A CA    1 
ATOM   1571 C  C     . MET A 1 203 ? 66.950 3.775   -5.136  1.00 11.25 ? 200 MET A C     1 
ATOM   1572 O  O     . MET A 1 203 ? 66.378 4.855   -5.359  1.00 8.80  ? 200 MET A O     1 
ATOM   1573 C  CB    . MET A 1 203 ? 66.432 1.691   -6.378  1.00 11.42 ? 200 MET A CB    1 
ATOM   1574 C  CG    A MET A 1 203 ? 65.022 2.064   -6.809  0.51 11.35 ? 200 MET A CG    1 
ATOM   1575 C  CG    B MET A 1 203 ? 66.736 0.697   -7.484  0.49 13.35 ? 200 MET A CG    1 
ATOM   1576 S  SD    A MET A 1 203 ? 63.948 0.619   -6.978  0.51 17.93 ? 200 MET A SD    1 
ATOM   1577 S  SD    B MET A 1 203 ? 65.561 -0.676  -7.489  0.49 16.36 ? 200 MET A SD    1 
ATOM   1578 C  CE    A MET A 1 203 ? 64.782 -0.318  -8.250  0.51 14.34 ? 200 MET A CE    1 
ATOM   1579 C  CE    B MET A 1 203 ? 64.032 0.171   -7.894  0.49 10.09 ? 200 MET A CE    1 
ATOM   1580 N  N     . ARG A 1 204 ? 67.193 3.322   -3.903  1.00 8.13  ? 201 ARG A N     1 
ATOM   1581 C  CA    . ARG A 1 204 ? 66.765 4.079   -2.732  1.00 12.31 ? 201 ARG A CA    1 
ATOM   1582 C  C     . ARG A 1 204 ? 67.509 5.417   -2.629  1.00 13.35 ? 201 ARG A C     1 
ATOM   1583 O  O     . ARG A 1 204 ? 66.922 6.420   -2.247  1.00 9.61  ? 201 ARG A O     1 
ATOM   1584 C  CB    . ARG A 1 204 ? 66.852 3.240   -1.447  1.00 11.03 ? 201 ARG A CB    1 
ATOM   1585 C  CG    . ARG A 1 204 ? 65.884 2.030   -1.454  1.00 5.60  ? 201 ARG A CG    1 
ATOM   1586 C  CD    . ARG A 1 204 ? 65.957 1.206   -0.170  1.00 9.49  ? 201 ARG A CD    1 
ATOM   1587 N  NE    . ARG A 1 204 ? 66.015 2.067   1.008   1.00 7.64  ? 201 ARG A NE    1 
ATOM   1588 C  CZ    . ARG A 1 204 ? 67.080 2.166   1.796   1.00 14.35 ? 201 ARG A CZ    1 
ATOM   1589 N  NH1   . ARG A 1 204 ? 67.070 2.991   2.833   1.00 9.63  ? 201 ARG A NH1   1 
ATOM   1590 N  NH2   . ARG A 1 204 ? 68.156 1.431   1.546   1.00 16.90 ? 201 ARG A NH2   1 
ATOM   1591 N  N     . ALA A 1 205 ? 68.783 5.442   -3.008  1.00 8.30  ? 202 ALA A N     1 
ATOM   1592 C  CA    . ALA A 1 205 ? 69.512 6.711   -3.006  1.00 11.34 ? 202 ALA A CA    1 
ATOM   1593 C  C     . ALA A 1 205 ? 68.927 7.681   -4.038  1.00 8.51  ? 202 ALA A C     1 
ATOM   1594 O  O     . ALA A 1 205 ? 68.782 8.880   -3.768  1.00 6.69  ? 202 ALA A O     1 
ATOM   1595 C  CB    . ALA A 1 205 ? 71.007 6.489   -3.252  1.00 13.67 ? 202 ALA A CB    1 
ATOM   1596 N  N     . ALA A 1 206 ? 68.577 7.159   -5.210  1.00 9.19  ? 203 ALA A N     1 
ATOM   1597 C  CA    . ALA A 1 206 ? 67.999 7.979   -6.268  1.00 11.54 ? 203 ALA A CA    1 
ATOM   1598 C  C     . ALA A 1 206 ? 66.633 8.541   -5.859  1.00 10.87 ? 203 ALA A C     1 
ATOM   1599 O  O     . ALA A 1 206 ? 66.306 9.704   -6.142  1.00 6.17  ? 203 ALA A O     1 
ATOM   1600 C  CB    . ALA A 1 206 ? 67.878 7.181   -7.556  1.00 9.16  ? 203 ALA A CB    1 
ATOM   1601 N  N     . ILE A 1 207 ? 65.830 7.713   -5.208  1.00 6.56  ? 204 ILE A N     1 
ATOM   1602 C  CA    . ILE A 1 207 ? 64.524 8.167   -4.747  1.00 9.63  ? 204 ILE A CA    1 
ATOM   1603 C  C     . ILE A 1 207 ? 64.699 9.318   -3.765  1.00 10.83 ? 204 ILE A C     1 
ATOM   1604 O  O     . ILE A 1 207 ? 64.038 10.352  -3.884  1.00 5.82  ? 204 ILE A O     1 
ATOM   1605 C  CB    . ILE A 1 207 ? 63.685 7.046   -4.088  1.00 3.98  ? 204 ILE A CB    1 
ATOM   1606 C  CG1   . ILE A 1 207 ? 63.276 6.012   -5.128  1.00 8.02  ? 204 ILE A CG1   1 
ATOM   1607 C  CG2   . ILE A 1 207 ? 62.434 7.643   -3.417  1.00 5.50  ? 204 ILE A CG2   1 
ATOM   1608 C  CD1   . ILE A 1 207 ? 62.622 4.759   -4.543  1.00 5.36  ? 204 ILE A CD1   1 
ATOM   1609 N  N     . GLU A 1 208 ? 65.596 9.147   -2.800  1.00 8.90  ? 205 GLU A N     1 
ATOM   1610 C  CA    . GLU A 1 208 ? 65.794 10.186  -1.793  1.00 9.57  ? 205 GLU A CA    1 
ATOM   1611 C  C     . GLU A 1 208 ? 66.365 11.470  -2.389  1.00 10.77 ? 205 GLU A C     1 
ATOM   1612 O  O     . GLU A 1 208 ? 65.864 12.552  -2.113  1.00 8.77  ? 205 GLU A O     1 
ATOM   1613 C  CB    . GLU A 1 208 ? 66.676 9.707   -0.636  1.00 9.11  ? 205 GLU A CB    1 
ATOM   1614 C  CG    . GLU A 1 208 ? 66.744 10.737  0.495   1.00 15.96 ? 205 GLU A CG    1 
ATOM   1615 C  CD    . GLU A 1 208 ? 67.506 10.250  1.721   1.00 14.45 ? 205 GLU A CD    1 
ATOM   1616 O  OE1   . GLU A 1 208 ? 67.392 10.903  2.774   1.00 17.13 ? 205 GLU A OE1   1 
ATOM   1617 O  OE2   . GLU A 1 208 ? 68.213 9.226   1.636   1.00 16.02 ? 205 GLU A OE2   1 
ATOM   1618 N  N     . ARG A 1 209 ? 67.391 11.340  -3.226  1.00 11.31 ? 206 ARG A N     1 
ATOM   1619 C  CA    . ARG A 1 209 ? 68.035 12.497  -3.853  1.00 10.32 ? 206 ARG A CA    1 
ATOM   1620 C  C     . ARG A 1 209 ? 67.035 13.307  -4.668  1.00 10.09 ? 206 ARG A C     1 
ATOM   1621 O  O     . ARG A 1 209 ? 67.055 14.537  -4.652  1.00 8.58  ? 206 ARG A O     1 
ATOM   1622 C  CB    . ARG A 1 209 ? 69.194 12.060  -4.788  1.00 11.02 ? 206 ARG A CB    1 
ATOM   1623 C  CG    . ARG A 1 209 ? 69.967 13.270  -5.407  1.00 12.34 ? 206 ARG A CG    1 
ATOM   1624 C  CD    . ARG A 1 209 ? 71.014 12.915  -6.487  1.00 18.17 ? 206 ARG A CD    1 
ATOM   1625 N  NE    . ARG A 1 209 ? 70.449 12.628  -7.815  1.00 23.20 ? 206 ARG A NE    1 
ATOM   1626 C  CZ    . ARG A 1 209 ? 70.085 13.551  -8.708  1.00 26.31 ? 206 ARG A CZ    1 
ATOM   1627 N  NH1   . ARG A 1 209 ? 69.594 13.178  -9.884  1.00 17.71 ? 206 ARG A NH1   1 
ATOM   1628 N  NH2   . ARG A 1 209 ? 70.206 14.847  -8.432  1.00 13.91 ? 206 ARG A NH2   1 
ATOM   1629 N  N     . GLU A 1 210 ? 66.179 12.602  -5.397  1.00 7.98  ? 207 GLU A N     1 
ATOM   1630 C  CA    . GLU A 1 210 ? 65.309 13.238  -6.375  1.00 10.56 ? 207 GLU A CA    1 
ATOM   1631 C  C     . GLU A 1 210 ? 63.926 13.609  -5.835  1.00 7.01  ? 207 GLU A C     1 
ATOM   1632 O  O     . GLU A 1 210 ? 63.189 14.356  -6.480  1.00 8.72  ? 207 GLU A O     1 
ATOM   1633 C  CB    . GLU A 1 210 ? 65.197 12.369  -7.631  1.00 11.02 ? 207 GLU A CB    1 
ATOM   1634 C  CG    . GLU A 1 210 ? 66.535 12.144  -8.307  1.00 11.17 ? 207 GLU A CG    1 
ATOM   1635 C  CD    . GLU A 1 210 ? 66.457 11.217  -9.508  1.00 16.23 ? 207 GLU A CD    1 
ATOM   1636 O  OE1   . GLU A 1 210 ? 65.430 11.231  -10.211 1.00 17.62 ? 207 GLU A OE1   1 
ATOM   1637 O  OE2   . GLU A 1 210 ? 67.435 10.479  -9.743  1.00 18.64 ? 207 GLU A OE2   1 
ATOM   1638 N  N     . THR A 1 211 ? 63.559 13.107  -4.654  1.00 8.08  ? 208 THR A N     1 
ATOM   1639 C  CA    . THR A 1 211 ? 62.247 13.454  -4.120  1.00 9.22  ? 208 THR A CA    1 
ATOM   1640 C  C     . THR A 1 211 ? 62.287 13.991  -2.703  1.00 9.28  ? 208 THR A C     1 
ATOM   1641 O  O     . THR A 1 211 ? 61.346 14.630  -2.271  1.00 8.35  ? 208 THR A O     1 
ATOM   1642 C  CB    . THR A 1 211 ? 61.279 12.250  -4.120  1.00 13.55 ? 208 THR A CB    1 
ATOM   1643 O  OG1   . THR A 1 211 ? 61.740 11.273  -3.180  1.00 7.22  ? 208 THR A OG1   1 
ATOM   1644 C  CG2   . THR A 1 211 ? 61.173 11.641  -5.503  1.00 6.78  ? 208 THR A CG2   1 
ATOM   1645 N  N     . GLY A 1 212 ? 63.355 13.697  -1.973  1.00 7.15  ? 209 GLY A N     1 
ATOM   1646 C  CA    . GLY A 1 212 ? 63.401 13.986  -0.554  1.00 10.65 ? 209 GLY A CA    1 
ATOM   1647 C  C     . GLY A 1 212 ? 62.827 12.880  0.334   1.00 11.89 ? 209 GLY A C     1 
ATOM   1648 O  O     . GLY A 1 212 ? 62.977 12.932  1.543   1.00 11.99 ? 209 GLY A O     1 
ATOM   1649 N  N     . PHE A 1 213 ? 62.187 11.881  -0.264  1.00 10.82 ? 210 PHE A N     1 
ATOM   1650 C  CA    . PHE A 1 213 ? 61.500 10.832  0.497   1.00 7.86  ? 210 PHE A CA    1 
ATOM   1651 C  C     . PHE A 1 213 ? 62.423 9.655   0.801   1.00 6.89  ? 210 PHE A C     1 
ATOM   1652 O  O     . PHE A 1 213 ? 63.212 9.243   -0.036  1.00 8.41  ? 210 PHE A O     1 
ATOM   1653 C  CB    . PHE A 1 213 ? 60.273 10.310  -0.256  1.00 5.35  ? 210 PHE A CB    1 
ATOM   1654 C  CG    . PHE A 1 213 ? 59.273 11.371  -0.634  1.00 6.01  ? 210 PHE A CG    1 
ATOM   1655 C  CD1   . PHE A 1 213 ? 58.662 11.347  -1.875  1.00 5.62  ? 210 PHE A CD1   1 
ATOM   1656 C  CD2   . PHE A 1 213 ? 58.916 12.373  0.267   1.00 9.75  ? 210 PHE A CD2   1 
ATOM   1657 C  CE1   . PHE A 1 213 ? 57.722 12.337  -2.229  1.00 8.68  ? 210 PHE A CE1   1 
ATOM   1658 C  CE2   . PHE A 1 213 ? 57.986 13.337  -0.075  1.00 4.29  ? 210 PHE A CE2   1 
ATOM   1659 C  CZ    . PHE A 1 213 ? 57.387 13.319  -1.323  1.00 3.08  ? 210 PHE A CZ    1 
ATOM   1660 N  N     . GLN A 1 214 ? 62.310 9.117   2.010   1.00 7.75  ? 211 GLN A N     1 
ATOM   1661 C  CA    . GLN A 1 214 ? 63.033 7.910   2.382   1.00 7.48  ? 211 GLN A CA    1 
ATOM   1662 C  C     . GLN A 1 214 ? 62.125 6.673   2.332   1.00 7.31  ? 211 GLN A C     1 
ATOM   1663 O  O     . GLN A 1 214 ? 60.904 6.790   2.425   1.00 10.71 ? 211 GLN A O     1 
ATOM   1664 C  CB    . GLN A 1 214 ? 63.616 8.085   3.780   1.00 9.18  ? 211 GLN A CB    1 
ATOM   1665 C  CG    . GLN A 1 214 ? 64.823 9.018   3.805   1.00 14.47 ? 211 GLN A CG    1 
ATOM   1666 C  CD    . GLN A 1 214 ? 65.370 9.215   5.203   1.00 19.54 ? 211 GLN A CD    1 
ATOM   1667 O  OE1   . GLN A 1 214 ? 64.764 8.789   6.175   1.00 13.04 ? 211 GLN A OE1   1 
ATOM   1668 N  NE2   . GLN A 1 214 ? 66.522 9.862   5.305   1.00 17.49 ? 211 GLN A NE2   1 
ATOM   1669 N  N     . CYS A 1 215 ? 62.719 5.494   2.208   1.00 8.54  ? 212 CYS A N     1 
ATOM   1670 C  CA    . CYS A 1 215 ? 61.940 4.264   2.153   1.00 9.57  ? 212 CYS A CA    1 
ATOM   1671 C  C     . CYS A 1 215 ? 62.705 3.102   2.750   1.00 11.99 ? 212 CYS A C     1 
ATOM   1672 O  O     . CYS A 1 215 ? 63.915 3.185   2.993   1.00 9.02  ? 212 CYS A O     1 
ATOM   1673 C  CB    . CYS A 1 215 ? 61.571 3.917   0.703   1.00 7.85  ? 212 CYS A CB    1 
ATOM   1674 S  SG    . CYS A 1 215 ? 63.004 3.760   -0.414  1.00 14.11 ? 212 CYS A SG    1 
ATOM   1675 N  N     . SER A 1 216 ? 61.993 2.007   2.981   1.00 6.61  ? 213 SER A N     1 
ATOM   1676 C  CA    . SER A 1 216 ? 62.653 0.759   3.314   1.00 11.11 ? 213 SER A CA    1 
ATOM   1677 C  C     . SER A 1 216 ? 62.463 -0.201  2.155   1.00 11.60 ? 213 SER A C     1 
ATOM   1678 O  O     . SER A 1 216 ? 61.673 0.068   1.246   1.00 8.02  ? 213 SER A O     1 
ATOM   1679 C  CB    . SER A 1 216 ? 62.091 0.179   4.608   1.00 8.13  ? 213 SER A CB    1 
ATOM   1680 O  OG    . SER A 1 216 ? 62.153 1.154   5.639   1.00 7.03  ? 213 SER A OG    1 
ATOM   1681 N  N     . ALA A 1 217 ? 63.183 -1.320  2.172   1.00 5.47  ? 214 ALA A N     1 
ATOM   1682 C  CA    . ALA A 1 217 ? 63.030 -2.292  1.102   1.00 3.24  ? 214 ALA A CA    1 
ATOM   1683 C  C     . ALA A 1 217 ? 63.373 -3.682  1.593   1.00 7.92  ? 214 ALA A C     1 
ATOM   1684 O  O     . ALA A 1 217 ? 64.111 -3.828  2.570   1.00 4.77  ? 214 ALA A O     1 
ATOM   1685 C  CB    . ALA A 1 217 ? 63.895 -1.912  -0.097  1.00 5.89  ? 214 ALA A CB    1 
ATOM   1686 N  N     . GLY A 1 218 ? 62.796 -4.688  0.937   1.00 6.80  ? 215 GLY A N     1 
ATOM   1687 C  CA    . GLY A 1 218 ? 63.120 -6.083  1.199   1.00 5.78  ? 215 GLY A CA    1 
ATOM   1688 C  C     . GLY A 1 218 ? 63.662 -6.668  -0.094  1.00 7.34  ? 215 GLY A C     1 
ATOM   1689 O  O     . GLY A 1 218 ? 63.164 -6.342  -1.170  1.00 4.60  ? 215 GLY A O     1 
ATOM   1690 N  N     . ILE A 1 219 ? 64.719 -7.470  0.008   1.00 4.41  ? 216 ILE A N     1 
ATOM   1691 C  CA    . ILE A 1 219 ? 65.265 -8.197  -1.126  1.00 6.76  ? 216 ILE A CA    1 
ATOM   1692 C  C     . ILE A 1 219 ? 65.278 -9.702  -0.858  1.00 9.83  ? 216 ILE A C     1 
ATOM   1693 O  O     . ILE A 1 219 ? 65.911 -10.187 0.094   1.00 7.37  ? 216 ILE A O     1 
ATOM   1694 C  CB    . ILE A 1 219 ? 66.691 -7.712  -1.460  1.00 9.60  ? 216 ILE A CB    1 
ATOM   1695 C  CG1   . ILE A 1 219 ? 66.699 -6.192  -1.658  1.00 6.96  ? 216 ILE A CG1   1 
ATOM   1696 C  CG2   . ILE A 1 219 ? 67.221 -8.405  -2.709  1.00 3.92  ? 216 ILE A CG2   1 
ATOM   1697 C  CD1   . ILE A 1 219 ? 67.214 -5.413  -0.438  1.00 12.03 ? 216 ILE A CD1   1 
ATOM   1698 N  N     . SER A 1 220 ? 64.570 -10.440 -1.701  1.00 7.99  ? 217 SER A N     1 
ATOM   1699 C  CA    . SER A 1 220 ? 64.546 -11.878 -1.581  1.00 9.28  ? 217 SER A CA    1 
ATOM   1700 C  C     . SER A 1 220 ? 64.294 -12.530 -2.928  1.00 11.28 ? 217 SER A C     1 
ATOM   1701 O  O     . SER A 1 220 ? 64.571 -11.942 -3.982  1.00 9.78  ? 217 SER A O     1 
ATOM   1702 C  CB    . SER A 1 220 ? 63.485 -12.310 -0.569  1.00 9.32  ? 217 SER A CB    1 
ATOM   1703 O  OG    . SER A 1 220 ? 63.745 -13.632 -0.156  1.00 9.44  ? 217 SER A OG    1 
ATOM   1704 N  N     . HIS A 1 221 ? 63.764 -13.747 -2.889  1.00 5.62  ? 218 HIS A N     1 
ATOM   1705 C  CA    . HIS A 1 221 ? 63.579 -14.522 -4.100  1.00 7.06  ? 218 HIS A CA    1 
ATOM   1706 C  C     . HIS A 1 221 ? 62.147 -14.478 -4.612  1.00 8.67  ? 218 HIS A C     1 
ATOM   1707 O  O     . HIS A 1 221 ? 61.849 -14.986 -5.686  1.00 6.67  ? 218 HIS A O     1 
ATOM   1708 C  CB    . HIS A 1 221 ? 64.016 -15.976 -3.862  1.00 6.42  ? 218 HIS A CB    1 
ATOM   1709 C  CG    . HIS A 1 221 ? 65.500 -16.157 -3.847  1.00 12.39 ? 218 HIS A CG    1 
ATOM   1710 N  ND1   . HIS A 1 221 ? 66.290 -15.876 -4.940  1.00 10.47 ? 218 HIS A ND1   1 
ATOM   1711 C  CD2   . HIS A 1 221 ? 66.340 -16.594 -2.877  1.00 8.97  ? 218 HIS A CD2   1 
ATOM   1712 C  CE1   . HIS A 1 221 ? 67.554 -16.130 -4.646  1.00 11.94 ? 218 HIS A CE1   1 
ATOM   1713 N  NE2   . HIS A 1 221 ? 67.611 -16.568 -3.401  1.00 11.44 ? 218 HIS A NE2   1 
ATOM   1714 N  N     . ASN A 1 222 ? 61.253 -13.867 -3.846  1.00 4.46  ? 219 ASN A N     1 
ATOM   1715 C  CA    . ASN A 1 222 ? 59.861 -13.743 -4.280  1.00 4.76  ? 219 ASN A CA    1 
ATOM   1716 C  C     . ASN A 1 222 ? 59.169 -12.604 -3.545  1.00 7.17  ? 219 ASN A C     1 
ATOM   1717 O  O     . ASN A 1 222 ? 59.716 -12.041 -2.583  1.00 8.46  ? 219 ASN A O     1 
ATOM   1718 C  CB    . ASN A 1 222 ? 59.098 -15.065 -4.059  1.00 6.54  ? 219 ASN A CB    1 
ATOM   1719 C  CG    . ASN A 1 222 ? 59.203 -15.569 -2.623  1.00 9.78  ? 219 ASN A CG    1 
ATOM   1720 O  OD1   . ASN A 1 222 ? 58.707 -14.925 -1.699  1.00 6.57  ? 219 ASN A OD1   1 
ATOM   1721 N  ND2   . ASN A 1 222 ? 59.833 -16.740 -2.432  1.00 6.58  ? 219 ASN A ND2   1 
ATOM   1722 N  N     . LYS A 1 223 ? 57.972 -12.262 -4.005  1.00 6.47  ? 220 LYS A N     1 
ATOM   1723 C  CA    . LYS A 1 223 ? 57.238 -11.119 -3.468  1.00 13.08 ? 220 LYS A CA    1 
ATOM   1724 C  C     . LYS A 1 223 ? 56.918 -11.239 -1.975  1.00 6.77  ? 220 LYS A C     1 
ATOM   1725 O  O     . LYS A 1 223 ? 57.056 -10.269 -1.229  1.00 6.52  ? 220 LYS A O     1 
ATOM   1726 C  CB    . LYS A 1 223 ? 55.948 -10.914 -4.265  1.00 8.71  ? 220 LYS A CB    1 
ATOM   1727 C  CG    . LYS A 1 223 ? 56.196 -10.615 -5.732  1.00 10.09 ? 220 LYS A CG    1 
ATOM   1728 C  CD    . LYS A 1 223 ? 54.920 -10.807 -6.583  1.00 19.90 ? 220 LYS A CD    1 
ATOM   1729 C  CE    . LYS A 1 223 ? 54.040 -9.584  -6.557  1.00 14.57 ? 220 LYS A CE    1 
ATOM   1730 N  NZ    . LYS A 1 223 ? 52.787 -9.769  -7.373  1.00 16.79 ? 220 LYS A NZ    1 
ATOM   1731 N  N     . VAL A 1 224 ? 56.459 -12.412 -1.553  1.00 6.02  ? 221 VAL A N     1 
ATOM   1732 C  CA    . VAL A 1 224 ? 56.091 -12.618 -0.145  1.00 5.48  ? 221 VAL A CA    1 
ATOM   1733 C  C     . VAL A 1 224 ? 57.295 -12.438 0.797   1.00 5.81  ? 221 VAL A C     1 
ATOM   1734 O  O     . VAL A 1 224 ? 57.194 -11.719 1.804   1.00 9.00  ? 221 VAL A O     1 
ATOM   1735 C  CB    . VAL A 1 224 ? 55.408 -13.989 0.091   1.00 7.19  ? 221 VAL A CB    1 
ATOM   1736 C  CG1   . VAL A 1 224 ? 55.290 -14.283 1.564   1.00 8.62  ? 221 VAL A CG1   1 
ATOM   1737 C  CG2   . VAL A 1 224 ? 54.030 -14.010 -0.535  1.00 12.10 ? 221 VAL A CG2   1 
ATOM   1738 N  N     . LEU A 1 225 ? 58.430 -13.060 0.464   1.00 5.10  ? 222 LEU A N     1 
ATOM   1739 C  CA    . LEU A 1 225 ? 59.634 -12.913 1.292   1.00 6.58  ? 222 LEU A CA    1 
ATOM   1740 C  C     . LEU A 1 225 ? 60.169 -11.466 1.222   1.00 8.71  ? 222 LEU A C     1 
ATOM   1741 O  O     . LEU A 1 225 ? 60.641 -10.916 2.216   1.00 7.92  ? 222 LEU A O     1 
ATOM   1742 C  CB    . LEU A 1 225 ? 60.739 -13.925 0.916   1.00 3.66  ? 222 LEU A CB    1 
ATOM   1743 C  CG    . LEU A 1 225 ? 60.452 -15.418 1.236   1.00 4.61  ? 222 LEU A CG    1 
ATOM   1744 C  CD1   . LEU A 1 225 ? 61.655 -16.322 0.906   1.00 8.57  ? 222 LEU A CD1   1 
ATOM   1745 C  CD2   . LEU A 1 225 ? 60.071 -15.596 2.692   1.00 8.07  ? 222 LEU A CD2   1 
ATOM   1746 N  N     . ALA A 1 226 ? 60.089 -10.859 0.046   1.00 7.32  ? 223 ALA A N     1 
ATOM   1747 C  CA    . ALA A 1 226 ? 60.506 -9.465  -0.112  1.00 7.77  ? 223 ALA A CA    1 
ATOM   1748 C  C     . ALA A 1 226 ? 59.703 -8.536  0.776   1.00 8.34  ? 223 ALA A C     1 
ATOM   1749 O  O     . ALA A 1 226 ? 60.257 -7.676  1.465   1.00 6.46  ? 223 ALA A O     1 
ATOM   1750 C  CB    . ALA A 1 226 ? 60.400 -9.036  -1.586  1.00 7.89  ? 223 ALA A CB    1 
ATOM   1751 N  N     . LYS A 1 227 ? 58.389 -8.713  0.745   1.00 9.16  ? 224 LYS A N     1 
ATOM   1752 C  CA    . LYS A 1 227 ? 57.483 -7.925  1.560   1.00 5.97  ? 224 LYS A CA    1 
ATOM   1753 C  C     . LYS A 1 227 ? 57.755 -8.100  3.070   1.00 10.28 ? 224 LYS A C     1 
ATOM   1754 O  O     . LYS A 1 227 ? 57.840 -7.126  3.820   1.00 7.40  ? 224 LYS A O     1 
ATOM   1755 C  CB    A LYS A 1 227 ? 56.027 -8.302  1.253   0.50 8.03  ? 224 LYS A CB    1 
ATOM   1756 C  CB    B LYS A 1 227 ? 56.023 -8.277  1.241   0.50 7.91  ? 224 LYS A CB    1 
ATOM   1757 C  CG    A LYS A 1 227 ? 55.007 -7.662  2.191   0.50 12.85 ? 224 LYS A CG    1 
ATOM   1758 C  CG    B LYS A 1 227 ? 55.003 -7.643  2.186   0.50 12.85 ? 224 LYS A CG    1 
ATOM   1759 C  CD    A LYS A 1 227 ? 54.725 -6.216  1.799   0.50 14.87 ? 224 LYS A CD    1 
ATOM   1760 C  CD    B LYS A 1 227 ? 55.083 -6.117  2.160   0.50 13.97 ? 224 LYS A CD    1 
ATOM   1761 C  CE    A LYS A 1 227 ? 53.793 -5.535  2.801   0.50 21.86 ? 224 LYS A CE    1 
ATOM   1762 C  CE    B LYS A 1 227 ? 53.904 -5.482  2.902   0.50 21.95 ? 224 LYS A CE    1 
ATOM   1763 N  NZ    A LYS A 1 227 ? 52.608 -6.374  3.129   0.50 14.59 ? 224 LYS A NZ    1 
ATOM   1764 N  NZ    B LYS A 1 227 ? 54.036 -4.001  3.025   0.50 17.85 ? 224 LYS A NZ    1 
ATOM   1765 N  N     . LEU A 1 228 ? 57.891 -9.348  3.507   1.00 6.47  ? 225 LEU A N     1 
ATOM   1766 C  CA    . LEU A 1 228 ? 58.242 -9.655  4.891   1.00 11.39 ? 225 LEU A CA    1 
ATOM   1767 C  C     . LEU A 1 228 ? 59.581 -9.020  5.302   1.00 12.39 ? 225 LEU A C     1 
ATOM   1768 O  O     . LEU A 1 228 ? 59.670 -8.354  6.338   1.00 8.47  ? 225 LEU A O     1 
ATOM   1769 C  CB    . LEU A 1 228 ? 58.279 -11.168 5.090   1.00 5.97  ? 225 LEU A CB    1 
ATOM   1770 C  CG    . LEU A 1 228 ? 58.432 -11.681 6.529   1.00 15.70 ? 225 LEU A CG    1 
ATOM   1771 C  CD1   . LEU A 1 228 ? 57.294 -11.179 7.412   1.00 13.63 ? 225 LEU A CD1   1 
ATOM   1772 C  CD2   . LEU A 1 228 ? 58.509 -13.201 6.540   1.00 9.91  ? 225 LEU A CD2   1 
ATOM   1773 N  N     . ALA A 1 229 ? 60.609 -9.227  4.485   1.00 5.84  ? 226 ALA A N     1 
ATOM   1774 C  CA    . ALA A 1 229 ? 61.923 -8.627  4.710   1.00 8.86  ? 226 ALA A CA    1 
ATOM   1775 C  C     . ALA A 1 229 ? 61.841 -7.115  4.896   1.00 12.94 ? 226 ALA A C     1 
ATOM   1776 O  O     . ALA A 1 229 ? 62.415 -6.566  5.839   1.00 10.40 ? 226 ALA A O     1 
ATOM   1777 C  CB    . ALA A 1 229 ? 62.882 -8.971  3.549   1.00 6.39  ? 226 ALA A CB    1 
ATOM   1778 N  N     . CYS A 1 230 ? 61.116 -6.451  4.001   1.00 6.00  ? 227 CYS A N     1 
ATOM   1779 C  CA    . CYS A 1 230 ? 61.016 -5.000  4.038   1.00 7.05  ? 227 CYS A CA    1 
ATOM   1780 C  C     . CYS A 1 230 ? 60.654 -4.490  5.435   1.00 8.57  ? 227 CYS A C     1 
ATOM   1781 O  O     . CYS A 1 230 ? 61.211 -3.498  5.905   1.00 11.35 ? 227 CYS A O     1 
ATOM   1782 C  CB    . CYS A 1 230 ? 59.999 -4.514  3.000   1.00 7.99  ? 227 CYS A CB    1 
ATOM   1783 S  SG    . CYS A 1 230 ? 59.900 -2.714  2.834   1.00 9.02  ? 227 CYS A SG    1 
ATOM   1784 N  N     . GLY A 1 231 ? 59.727 -5.173  6.096   1.00 7.84  ? 228 GLY A N     1 
ATOM   1785 C  CA    . GLY A 1 231 ? 59.241 -4.721  7.386   1.00 9.68  ? 228 GLY A CA    1 
ATOM   1786 C  C     . GLY A 1 231 ? 60.168 -5.054  8.546   1.00 13.18 ? 228 GLY A C     1 
ATOM   1787 O  O     . GLY A 1 231 ? 59.918 -4.631  9.670   1.00 10.87 ? 228 GLY A O     1 
ATOM   1788 N  N     . LEU A 1 232 ? 61.233 -5.811  8.295   1.00 11.01 ? 229 LEU A N     1 
ATOM   1789 C  CA    . LEU A 1 232 ? 62.060 -6.305  9.401   1.00 9.44  ? 229 LEU A CA    1 
ATOM   1790 C  C     . LEU A 1 232 ? 62.906 -5.198  10.023  1.00 11.70 ? 229 LEU A C     1 
ATOM   1791 O  O     . LEU A 1 232 ? 63.153 -5.203  11.221  1.00 13.45 ? 229 LEU A O     1 
ATOM   1792 C  CB    . LEU A 1 232 ? 62.933 -7.496  8.973   1.00 10.97 ? 229 LEU A CB    1 
ATOM   1793 C  CG    . LEU A 1 232 ? 62.109 -8.763  8.692   1.00 8.30  ? 229 LEU A CG    1 
ATOM   1794 C  CD1   . LEU A 1 232 ? 63.019 -9.942  8.371   1.00 9.44  ? 229 LEU A CD1   1 
ATOM   1795 C  CD2   . LEU A 1 232 ? 61.157 -9.079  9.846   1.00 12.85 ? 229 LEU A CD2   1 
ATOM   1796 N  N     . ASN A 1 233 ? 63.327 -4.243  9.201   1.00 9.76  ? 230 ASN A N     1 
ATOM   1797 C  CA    . ASN A 1 233 ? 64.161 -3.146  9.657   1.00 14.65 ? 230 ASN A CA    1 
ATOM   1798 C  C     . ASN A 1 233 ? 63.668 -1.838  9.030   1.00 13.67 ? 230 ASN A C     1 
ATOM   1799 O  O     . ASN A 1 233 ? 64.044 -1.500  7.918   1.00 25.74 ? 230 ASN A O     1 
ATOM   1800 C  CB    . ASN A 1 233 ? 65.625 -3.417  9.267   1.00 9.20  ? 230 ASN A CB    1 
ATOM   1801 C  CG    . ASN A 1 233 ? 66.211 -4.636  9.980   1.00 14.37 ? 230 ASN A CG    1 
ATOM   1802 O  OD1   . ASN A 1 233 ? 66.616 -4.544  11.130  1.00 9.96  ? 230 ASN A OD1   1 
ATOM   1803 N  ND2   . ASN A 1 233 ? 66.272 -5.770  9.292   1.00 5.36  ? 230 ASN A ND2   1 
ATOM   1804 N  N     . LYS A 1 234 ? 62.780 -1.147  9.735   1.00 15.33 ? 231 LYS A N     1 
ATOM   1805 C  CA    . LYS A 1 234 ? 62.241 0.136   9.303   1.00 15.33 ? 231 LYS A CA    1 
ATOM   1806 C  C     . LYS A 1 234 ? 62.522 1.124   10.410  1.00 18.83 ? 231 LYS A C     1 
ATOM   1807 O  O     . LYS A 1 234 ? 62.687 0.720   11.565  1.00 21.72 ? 231 LYS A O     1 
ATOM   1808 C  CB    . LYS A 1 234 ? 60.718 0.054   9.074   1.00 19.53 ? 231 LYS A CB    1 
ATOM   1809 C  CG    . LYS A 1 234 ? 60.253 -0.341  7.665   1.00 17.50 ? 231 LYS A CG    1 
ATOM   1810 C  CD    . LYS A 1 234 ? 58.803 0.204   7.395   1.00 23.19 ? 231 LYS A CD    1 
ATOM   1811 C  CE    . LYS A 1 234 ? 58.401 0.212   5.900   1.00 27.26 ? 231 LYS A CE    1 
ATOM   1812 N  NZ    . LYS A 1 234 ? 58.360 1.596   5.260   1.00 11.14 ? 231 LYS A NZ    1 
ATOM   1813 N  N     . PRO A 1 235 ? 62.594 2.423   10.074  1.00 7.60  ? 232 PRO A N     1 
ATOM   1814 C  CA    . PRO A 1 235 ? 62.506 2.978   8.714   1.00 13.08 ? 232 PRO A CA    1 
ATOM   1815 C  C     . PRO A 1 235 ? 63.885 3.160   8.089   1.00 13.53 ? 232 PRO A C     1 
ATOM   1816 O  O     . PRO A 1 235 ? 64.891 2.927   8.747   1.00 8.76  ? 232 PRO A O     1 
ATOM   1817 C  CB    . PRO A 1 235 ? 61.917 4.362   8.970   1.00 14.45 ? 232 PRO A CB    1 
ATOM   1818 C  CG    . PRO A 1 235 ? 62.605 4.776   10.267  1.00 15.51 ? 232 PRO A CG    1 
ATOM   1819 C  CD    . PRO A 1 235 ? 62.749 3.491   11.082  1.00 18.07 ? 232 PRO A CD    1 
ATOM   1820 N  N     . ASN A 1 236 ? 63.917 3.563   6.823   1.00 7.57  ? 233 ASN A N     1 
ATOM   1821 C  CA    . ASN A 1 236 ? 65.150 4.006   6.173   1.00 9.90  ? 233 ASN A CA    1 
ATOM   1822 C  C     . ASN A 1 236 ? 66.238 2.943   6.062   1.00 5.87  ? 233 ASN A C     1 
ATOM   1823 O  O     . ASN A 1 236 ? 67.424 3.265   6.056   1.00 9.89  ? 233 ASN A O     1 
ATOM   1824 C  CB    . ASN A 1 236 ? 65.706 5.269   6.861   1.00 13.64 ? 233 ASN A CB    1 
ATOM   1825 C  CG    . ASN A 1 236 ? 66.725 6.004   6.000   1.00 13.72 ? 233 ASN A CG    1 
ATOM   1826 O  OD1   . ASN A 1 236 ? 66.685 5.925   4.774   1.00 12.01 ? 233 ASN A OD1   1 
ATOM   1827 N  ND2   . ASN A 1 236 ? 67.653 6.708   6.642   1.00 16.62 ? 233 ASN A ND2   1 
ATOM   1828 N  N     . ARG A 1 237 ? 65.836 1.674   5.985   1.00 8.85  ? 234 ARG A N     1 
ATOM   1829 C  CA    . ARG A 1 237 ? 66.791 0.564   5.903   1.00 12.40 ? 234 ARG A CA    1 
ATOM   1830 C  C     . ARG A 1 237 ? 66.287 -0.501  4.940   1.00 11.47 ? 234 ARG A C     1 
ATOM   1831 O  O     . ARG A 1 237 ? 65.116 -0.516  4.578   1.00 6.95  ? 234 ARG A O     1 
ATOM   1832 C  CB    . ARG A 1 237 ? 67.010 -0.092  7.275   1.00 10.44 ? 234 ARG A CB    1 
ATOM   1833 C  CG    . ARG A 1 237 ? 67.722 0.806   8.289   1.00 8.13  ? 234 ARG A CG    1 
ATOM   1834 C  CD    . ARG A 1 237 ? 69.213 0.964   7.974   1.00 15.38 ? 234 ARG A CD    1 
ATOM   1835 N  NE    . ARG A 1 237 ? 69.883 1.766   9.000   1.00 20.46 ? 234 ARG A NE    1 
ATOM   1836 C  CZ    . ARG A 1 237 ? 69.955 3.096   9.000   1.00 25.25 ? 234 ARG A CZ    1 
ATOM   1837 N  NH1   . ARG A 1 237 ? 69.417 3.808   8.015   1.00 12.73 ? 234 ARG A NH1   1 
ATOM   1838 N  NH2   . ARG A 1 237 ? 70.576 3.718   9.994   1.00 20.47 ? 234 ARG A NH2   1 
ATOM   1839 N  N     . GLN A 1 238 ? 67.162 -1.410  4.539   1.00 5.92  ? 235 GLN A N     1 
ATOM   1840 C  CA    . GLN A 1 238 ? 66.722 -2.480  3.657   1.00 6.53  ? 235 GLN A CA    1 
ATOM   1841 C  C     . GLN A 1 238 ? 67.257 -3.827  4.145   1.00 5.21  ? 235 GLN A C     1 
ATOM   1842 O  O     . GLN A 1 238 ? 68.333 -3.889  4.724   1.00 9.99  ? 235 GLN A O     1 
ATOM   1843 C  CB    . GLN A 1 238 ? 67.152 -2.205  2.216   1.00 6.20  ? 235 GLN A CB    1 
ATOM   1844 C  CG    . GLN A 1 238 ? 68.655 -2.190  2.016   1.00 6.90  ? 235 GLN A CG    1 
ATOM   1845 C  CD    . GLN A 1 238 ? 69.019 -1.912  0.568   1.00 10.74 ? 235 GLN A CD    1 
ATOM   1846 O  OE1   . GLN A 1 238 ? 68.655 -0.874  0.010   1.00 11.08 ? 235 GLN A OE1   1 
ATOM   1847 N  NE2   . GLN A 1 238 ? 69.714 -2.843  -0.052  1.00 8.73  ? 235 GLN A NE2   1 
ATOM   1848 N  N     . THR A 1 239 ? 66.495 -4.895  3.913   1.00 6.10  ? 236 THR A N     1 
ATOM   1849 C  CA    . THR A 1 239 ? 66.781 -6.209  4.505   1.00 6.95  ? 236 THR A CA    1 
ATOM   1850 C  C     . THR A 1 239 ? 66.819 -7.281  3.418   1.00 10.28 ? 236 THR A C     1 
ATOM   1851 O  O     . THR A 1 239 ? 65.936 -7.343  2.559   1.00 6.43  ? 236 THR A O     1 
ATOM   1852 C  CB    . THR A 1 239 ? 65.726 -6.592  5.562   1.00 8.21  ? 236 THR A CB    1 
ATOM   1853 O  OG1   . THR A 1 239 ? 65.610 -5.549  6.529   1.00 9.39  ? 236 THR A OG1   1 
ATOM   1854 C  CG2   . THR A 1 239 ? 66.093 -7.900  6.303   1.00 9.21  ? 236 THR A CG2   1 
ATOM   1855 N  N     . LEU A 1 240 ? 67.860 -8.107  3.457   1.00 8.23  ? 237 LEU A N     1 
ATOM   1856 C  CA    . LEU A 1 240 ? 68.024 -9.223  2.543   1.00 6.29  ? 237 LEU A CA    1 
ATOM   1857 C  C     . LEU A 1 240 ? 67.617 -10.521 3.257   1.00 10.63 ? 237 LEU A C     1 
ATOM   1858 O  O     . LEU A 1 240 ? 68.187 -10.883 4.288   1.00 4.84  ? 237 LEU A O     1 
ATOM   1859 C  CB    . LEU A 1 240 ? 69.474 -9.275  2.059   1.00 7.77  ? 237 LEU A CB    1 
ATOM   1860 C  CG    . LEU A 1 240 ? 69.909 -10.278 0.982   1.00 10.98 ? 237 LEU A CG    1 
ATOM   1861 C  CD1   . LEU A 1 240 ? 71.252 -9.838  0.401   1.00 11.89 ? 237 LEU A CD1   1 
ATOM   1862 C  CD2   . LEU A 1 240 ? 69.973 -11.736 1.494   1.00 7.17  ? 237 LEU A CD2   1 
ATOM   1863 N  N     . VAL A 1 241 ? 66.595 -11.197 2.734   1.00 8.40  ? 238 VAL A N     1 
ATOM   1864 C  CA    . VAL A 1 241 ? 66.195 -12.485 3.292   1.00 9.49  ? 238 VAL A CA    1 
ATOM   1865 C  C     . VAL A 1 241 ? 66.586 -13.593 2.334   1.00 9.53  ? 238 VAL A C     1 
ATOM   1866 O  O     . VAL A 1 241 ? 65.997 -13.745 1.269   1.00 8.72  ? 238 VAL A O     1 
ATOM   1867 C  CB    . VAL A 1 241 ? 64.688 -12.543 3.596   1.00 9.39  ? 238 VAL A CB    1 
ATOM   1868 C  CG1   . VAL A 1 241 ? 64.235 -14.008 3.802   1.00 8.33  ? 238 VAL A CG1   1 
ATOM   1869 C  CG2   . VAL A 1 241 ? 64.391 -11.687 4.820   1.00 6.44  ? 238 VAL A CG2   1 
ATOM   1870 N  N     . SER A 1 242 ? 67.606 -14.356 2.703   1.00 7.03  ? 239 SER A N     1 
ATOM   1871 C  CA    . SER A 1 242 ? 68.085 -15.406 1.818   1.00 5.97  ? 239 SER A CA    1 
ATOM   1872 C  C     . SER A 1 242 ? 67.241 -16.673 1.936   1.00 3.80  ? 239 SER A C     1 
ATOM   1873 O  O     . SER A 1 242 ? 66.491 -16.854 2.902   1.00 3.98  ? 239 SER A O     1 
ATOM   1874 C  CB    . SER A 1 242 ? 69.546 -15.737 2.132   1.00 7.52  ? 239 SER A CB    1 
ATOM   1875 O  OG    . SER A 1 242 ? 69.626 -16.305 3.426   1.00 10.13 ? 239 SER A OG    1 
ATOM   1876 N  N     . HIS A 1 243 ? 67.362 -17.559 0.954   1.00 6.69  ? 240 HIS A N     1 
ATOM   1877 C  CA    . HIS A 1 243 ? 66.642 -18.818 1.032   1.00 11.08 ? 240 HIS A CA    1 
ATOM   1878 C  C     . HIS A 1 243 ? 67.032 -19.555 2.314   1.00 11.18 ? 240 HIS A C     1 
ATOM   1879 O  O     . HIS A 1 243 ? 66.187 -20.150 2.985   1.00 6.14  ? 240 HIS A O     1 
ATOM   1880 C  CB    . HIS A 1 243 ? 66.953 -19.713 -0.164  1.00 8.96  ? 240 HIS A CB    1 
ATOM   1881 C  CG    . HIS A 1 243 ? 66.235 -21.027 -0.118  1.00 11.87 ? 240 HIS A CG    1 
ATOM   1882 N  ND1   . HIS A 1 243 ? 64.900 -21.153 -0.432  1.00 10.18 ? 240 HIS A ND1   1 
ATOM   1883 C  CD2   . HIS A 1 243 ? 66.657 -22.266 0.233   1.00 18.03 ? 240 HIS A CD2   1 
ATOM   1884 C  CE1   . HIS A 1 243 ? 64.532 -22.415 -0.295  1.00 16.37 ? 240 HIS A CE1   1 
ATOM   1885 N  NE2   . HIS A 1 243 ? 65.580 -23.111 0.113   1.00 14.85 ? 240 HIS A NE2   1 
ATOM   1886 N  N     . GLY A 1 244 ? 68.321 -19.505 2.627   1.00 7.47  ? 241 GLY A N     1 
ATOM   1887 C  CA    . GLY A 1 244 ? 68.874 -20.155 3.802   1.00 6.81  ? 241 GLY A CA    1 
ATOM   1888 C  C     . GLY A 1 244 ? 68.334 -19.669 5.129   1.00 9.55  ? 241 GLY A C     1 
ATOM   1889 O  O     . GLY A 1 244 ? 68.276 -20.445 6.084   1.00 6.30  ? 241 GLY A O     1 
ATOM   1890 N  N     . SER A 1 245 ? 67.936 -18.397 5.192   1.00 9.12  ? 242 SER A N     1 
ATOM   1891 C  CA    . SER A 1 245 ? 67.435 -17.798 6.432   1.00 6.97  ? 242 SER A CA    1 
ATOM   1892 C  C     . SER A 1 245 ? 66.018 -18.231 6.761   1.00 10.55 ? 242 SER A C     1 
ATOM   1893 O  O     . SER A 1 245 ? 65.558 -18.043 7.891   1.00 6.26  ? 242 SER A O     1 
ATOM   1894 C  CB    . SER A 1 245 ? 67.500 -16.269 6.375   1.00 10.07 ? 242 SER A CB    1 
ATOM   1895 O  OG    . SER A 1 245 ? 66.526 -15.752 5.471   1.00 11.50 ? 242 SER A OG    1 
ATOM   1896 N  N     . VAL A 1 246 ? 65.343 -18.840 5.790   1.00 6.23  ? 243 VAL A N     1 
ATOM   1897 C  CA    . VAL A 1 246 ? 63.933 -19.160 5.953   1.00 7.23  ? 243 VAL A CA    1 
ATOM   1898 C  C     . VAL A 1 246 ? 63.571 -20.072 7.152   1.00 6.34  ? 243 VAL A C     1 
ATOM   1899 O  O     . VAL A 1 246 ? 62.737 -19.687 7.966   1.00 5.92  ? 243 VAL A O     1 
ATOM   1900 C  CB    . VAL A 1 246 ? 63.289 -19.642 4.630   1.00 8.19  ? 243 VAL A CB    1 
ATOM   1901 C  CG1   . VAL A 1 246 ? 61.861 -20.147 4.881   1.00 6.31  ? 243 VAL A CG1   1 
ATOM   1902 C  CG2   . VAL A 1 246 ? 63.285 -18.491 3.616   1.00 9.14  ? 243 VAL A CG2   1 
ATOM   1903 N  N     . PRO A 1 247 ? 64.199 -21.263 7.282   1.00 7.31  ? 244 PRO A N     1 
ATOM   1904 C  CA    . PRO A 1 247 ? 63.799 -22.105 8.427   1.00 5.88  ? 244 PRO A CA    1 
ATOM   1905 C  C     . PRO A 1 247 ? 63.838 -21.414 9.801   1.00 6.20  ? 244 PRO A C     1 
ATOM   1906 O  O     . PRO A 1 247 ? 62.873 -21.516 10.553  1.00 7.95  ? 244 PRO A O     1 
ATOM   1907 C  CB    . PRO A 1 247 ? 64.779 -23.294 8.381   1.00 8.01  ? 244 PRO A CB    1 
ATOM   1908 C  CG    . PRO A 1 247 ? 65.215 -23.362 6.929   1.00 10.39 ? 244 PRO A CG    1 
ATOM   1909 C  CD    . PRO A 1 247 ? 65.200 -21.924 6.418   1.00 8.42  ? 244 PRO A CD    1 
ATOM   1910 N  N     . GLN A 1 248 ? 64.911 -20.710 10.120  1.00 8.96  ? 245 GLN A N     1 
ATOM   1911 C  CA    . GLN A 1 248 ? 64.960 -20.035 11.406  1.00 5.46  ? 245 GLN A CA    1 
ATOM   1912 C  C     . GLN A 1 248 ? 63.975 -18.865 11.496  1.00 7.41  ? 245 GLN A C     1 
ATOM   1913 O  O     . GLN A 1 248 ? 63.333 -18.667 12.530  1.00 5.39  ? 245 GLN A O     1 
ATOM   1914 C  CB    . GLN A 1 248 ? 66.379 -19.583 11.715  1.00 8.28  ? 245 GLN A CB    1 
ATOM   1915 C  CG    . GLN A 1 248 ? 67.284 -20.757 12.099  1.00 11.89 ? 245 GLN A CG    1 
ATOM   1916 C  CD    . GLN A 1 248 ? 68.341 -20.374 13.113  1.00 28.13 ? 245 GLN A CD    1 
ATOM   1917 O  OE1   . GLN A 1 248 ? 68.048 -20.262 14.310  1.00 28.63 ? 245 GLN A OE1   1 
ATOM   1918 N  NE2   . GLN A 1 248 ? 69.583 -20.175 12.645  1.00 15.55 ? 245 GLN A NE2   1 
ATOM   1919 N  N     . LEU A 1 249 ? 63.850 -18.097 10.413  1.00 9.03  ? 246 LEU A N     1 
ATOM   1920 C  CA    . LEU A 1 249 ? 62.915 -16.968 10.404  1.00 8.03  ? 246 LEU A CA    1 
ATOM   1921 C  C     . LEU A 1 249 ? 61.478 -17.455 10.595  1.00 6.21  ? 246 LEU A C     1 
ATOM   1922 O  O     . LEU A 1 249 ? 60.704 -16.885 11.364  1.00 6.55  ? 246 LEU A O     1 
ATOM   1923 C  CB    . LEU A 1 249 ? 63.056 -16.177 9.093   1.00 5.89  ? 246 LEU A CB    1 
ATOM   1924 C  CG    . LEU A 1 249 ? 62.103 -14.996 8.890   1.00 11.79 ? 246 LEU A CG    1 
ATOM   1925 C  CD1   . LEU A 1 249 ? 62.366 -13.916 9.934   1.00 9.15  ? 246 LEU A CD1   1 
ATOM   1926 C  CD2   . LEU A 1 249 ? 62.197 -14.425 7.469   1.00 7.99  ? 246 LEU A CD2   1 
ATOM   1927 N  N     . PHE A 1 250 ? 61.119 -18.531 9.911   1.00 9.79  ? 247 PHE A N     1 
ATOM   1928 C  CA    . PHE A 1 250 ? 59.747 -19.014 9.965   1.00 8.90  ? 247 PHE A CA    1 
ATOM   1929 C  C     . PHE A 1 250 ? 59.430 -19.803 11.231  1.00 7.99  ? 247 PHE A C     1 
ATOM   1930 O  O     . PHE A 1 250 ? 58.256 -20.010 11.545  1.00 5.47  ? 247 PHE A O     1 
ATOM   1931 C  CB    . PHE A 1 250 ? 59.413 -19.858 8.730   1.00 7.90  ? 247 PHE A CB    1 
ATOM   1932 C  CG    . PHE A 1 250 ? 59.035 -19.045 7.516   1.00 7.80  ? 247 PHE A CG    1 
ATOM   1933 C  CD1   . PHE A 1 250 ? 58.539 -19.672 6.380   1.00 6.62  ? 247 PHE A CD1   1 
ATOM   1934 C  CD2   . PHE A 1 250 ? 59.180 -17.659 7.510   1.00 10.11 ? 247 PHE A CD2   1 
ATOM   1935 C  CE1   . PHE A 1 250 ? 58.178 -18.938 5.257   1.00 9.96  ? 247 PHE A CE1   1 
ATOM   1936 C  CE2   . PHE A 1 250 ? 58.836 -16.907 6.383   1.00 10.63 ? 247 PHE A CE2   1 
ATOM   1937 C  CZ    . PHE A 1 250 ? 58.327 -17.551 5.253   1.00 4.99  ? 247 PHE A CZ    1 
ATOM   1938 N  N     . SER A 1 251 ? 60.458 -20.242 11.957  1.00 6.34  ? 248 SER A N     1 
ATOM   1939 C  CA    . SER A 1 251 ? 60.238 -21.104 13.117  1.00 7.69  ? 248 SER A CA    1 
ATOM   1940 C  C     . SER A 1 251 ? 59.502 -20.355 14.225  1.00 6.48  ? 248 SER A C     1 
ATOM   1941 O  O     . SER A 1 251 ? 58.823 -20.972 15.046  1.00 6.47  ? 248 SER A O     1 
ATOM   1942 C  CB    . SER A 1 251 ? 61.559 -21.704 13.658  1.00 6.28  ? 248 SER A CB    1 
ATOM   1943 O  OG    . SER A 1 251 ? 62.296 -20.746 14.398  1.00 6.16  ? 248 SER A OG    1 
ATOM   1944 N  N     . GLN A 1 252 ? 59.629 -19.028 14.243  1.00 5.07  ? 249 GLN A N     1 
ATOM   1945 C  CA    . GLN A 1 252 ? 58.925 -18.229 15.237  1.00 8.22  ? 249 GLN A CA    1 
ATOM   1946 C  C     . GLN A 1 252 ? 58.041 -17.144 14.622  1.00 11.92 ? 249 GLN A C     1 
ATOM   1947 O  O     . GLN A 1 252 ? 57.691 -16.183 15.298  1.00 10.26 ? 249 GLN A O     1 
ATOM   1948 C  CB    . GLN A 1 252 ? 59.925 -17.576 16.199  1.00 11.67 ? 249 GLN A CB    1 
ATOM   1949 C  CG    . GLN A 1 252 ? 60.652 -18.559 17.077  1.00 7.59  ? 249 GLN A CG    1 
ATOM   1950 C  CD    . GLN A 1 252 ? 61.468 -17.850 18.122  1.00 22.83 ? 249 GLN A CD    1 
ATOM   1951 O  OE1   . GLN A 1 252 ? 61.013 -17.649 19.249  1.00 16.55 ? 249 GLN A OE1   1 
ATOM   1952 N  NE2   . GLN A 1 252 ? 62.665 -17.426 17.746  1.00 14.96 ? 249 GLN A NE2   1 
ATOM   1953 N  N     . MET A 1 253 ? 57.706 -17.288 13.342  1.00 8.08  ? 250 MET A N     1 
ATOM   1954 C  CA    . MET A 1 253 ? 56.988 -16.245 12.613  1.00 9.45  ? 250 MET A CA    1 
ATOM   1955 C  C     . MET A 1 253 ? 55.495 -16.513 12.694  1.00 9.06  ? 250 MET A C     1 
ATOM   1956 O  O     . MET A 1 253 ? 55.012 -17.475 12.114  1.00 7.24  ? 250 MET A O     1 
ATOM   1957 C  CB    . MET A 1 253 ? 57.440 -16.199 11.143  1.00 5.44  ? 250 MET A CB    1 
ATOM   1958 C  CG    . MET A 1 253 ? 56.773 -15.085 10.300  1.00 7.17  ? 250 MET A CG    1 
ATOM   1959 S  SD    . MET A 1 253 ? 57.141 -13.396 10.830  1.00 14.84 ? 250 MET A SD    1 
ATOM   1960 C  CE    . MET A 1 253 ? 58.922 -13.293 10.651  1.00 7.58  ? 250 MET A CE    1 
ATOM   1961 N  N     . PRO A 1 254 ? 54.755 -15.672 13.433  1.00 8.34  ? 251 PRO A N     1 
ATOM   1962 C  CA    . PRO A 1 254 ? 53.316 -15.964 13.509  1.00 13.48 ? 251 PRO A CA    1 
ATOM   1963 C  C     . PRO A 1 254 ? 52.702 -15.998 12.101  1.00 9.73  ? 251 PRO A C     1 
ATOM   1964 O  O     . PRO A 1 254 ? 53.058 -15.186 11.261  1.00 8.18  ? 251 PRO A O     1 
ATOM   1965 C  CB    . PRO A 1 254 ? 52.761 -14.789 14.330  1.00 8.64  ? 251 PRO A CB    1 
ATOM   1966 C  CG    . PRO A 1 254 ? 53.936 -14.336 15.164  1.00 14.23 ? 251 PRO A CG    1 
ATOM   1967 C  CD    . PRO A 1 254 ? 55.125 -14.485 14.224  1.00 12.07 ? 251 PRO A CD    1 
ATOM   1968 N  N     . ILE A 1 255 ? 51.800 -16.940 11.858  1.00 11.78 ? 252 ILE A N     1 
ATOM   1969 C  CA    . ILE A 1 255 ? 51.216 -17.121 10.529  1.00 11.35 ? 252 ILE A CA    1 
ATOM   1970 C  C     . ILE A 1 255 ? 50.632 -15.823 9.923   1.00 9.47  ? 252 ILE A C     1 
ATOM   1971 O  O     . ILE A 1 255 ? 50.779 -15.572 8.723   1.00 5.77  ? 252 ILE A O     1 
ATOM   1972 C  CB    . ILE A 1 255 ? 50.210 -18.305 10.554  1.00 12.36 ? 252 ILE A CB    1 
ATOM   1973 C  CG1   . ILE A 1 255 ? 51.002 -19.624 10.568  1.00 13.03 ? 252 ILE A CG1   1 
ATOM   1974 C  CG2   . ILE A 1 255 ? 49.202 -18.239 9.385   1.00 8.33  ? 252 ILE A CG2   1 
ATOM   1975 C  CD1   . ILE A 1 255 ? 50.239 -20.810 11.063  1.00 14.09 ? 252 ILE A CD1   1 
ATOM   1976 N  N     . ARG A 1 256 ? 50.012 -14.987 10.758  1.00 6.60  ? 253 ARG A N     1 
ATOM   1977 C  CA    . ARG A 1 256 ? 49.351 -13.772 10.286  1.00 12.82 ? 253 ARG A CA    1 
ATOM   1978 C  C     . ARG A 1 256 ? 50.298 -12.747 9.658   1.00 12.00 ? 253 ARG A C     1 
ATOM   1979 O  O     . ARG A 1 256 ? 49.842 -11.778 9.049   1.00 8.94  ? 253 ARG A O     1 
ATOM   1980 C  CB    . ARG A 1 256 ? 48.546 -13.116 11.420  1.00 6.81  ? 253 ARG A CB    1 
ATOM   1981 C  CG    . ARG A 1 256 ? 49.414 -12.580 12.546  1.00 12.14 ? 253 ARG A CG    1 
ATOM   1982 C  CD    . ARG A 1 256 ? 48.592 -11.973 13.691  1.00 16.53 ? 253 ARG A CD    1 
ATOM   1983 N  NE    . ARG A 1 256 ? 49.462 -11.496 14.774  1.00 18.48 ? 253 ARG A NE    1 
ATOM   1984 C  CZ    . ARG A 1 256 ? 49.862 -12.239 15.804  1.00 23.46 ? 253 ARG A CZ    1 
ATOM   1985 N  NH1   . ARG A 1 256 ? 49.461 -13.500 15.909  1.00 16.14 ? 253 ARG A NH1   1 
ATOM   1986 N  NH2   . ARG A 1 256 ? 50.658 -11.719 16.736  1.00 20.80 ? 253 ARG A NH2   1 
ATOM   1987 N  N     . LYS A 1 257 ? 51.607 -12.956 9.802   1.00 11.25 ? 254 LYS A N     1 
ATOM   1988 C  CA    . LYS A 1 257 ? 52.578 -11.997 9.277   1.00 10.23 ? 254 LYS A CA    1 
ATOM   1989 C  C     . LYS A 1 257 ? 52.789 -12.125 7.792   1.00 13.40 ? 254 LYS A C     1 
ATOM   1990 O  O     . LYS A 1 257 ? 53.236 -11.157 7.150   1.00 9.19  ? 254 LYS A O     1 
ATOM   1991 C  CB    . LYS A 1 257 ? 53.924 -12.070 10.018  1.00 9.58  ? 254 LYS A CB    1 
ATOM   1992 C  CG    . LYS A 1 257 ? 53.823 -11.884 11.516  1.00 15.91 ? 254 LYS A CG    1 
ATOM   1993 C  CD    . LYS A 1 257 ? 53.205 -10.556 11.901  1.00 14.82 ? 254 LYS A CD    1 
ATOM   1994 C  CE    . LYS A 1 257 ? 53.281 -10.361 13.421  1.00 24.52 ? 254 LYS A CE    1 
ATOM   1995 N  NZ    . LYS A 1 257 ? 52.526 -9.172  13.914  1.00 29.51 ? 254 LYS A NZ    1 
ATOM   1996 N  N     . ILE A 1 258 ? 52.473 -13.317 7.269   1.00 10.11 ? 255 ILE A N     1 
ATOM   1997 C  CA    . ILE A 1 258 ? 52.618 -13.645 5.849   1.00 9.97  ? 255 ILE A CA    1 
ATOM   1998 C  C     . ILE A 1 258 ? 51.491 -12.970 5.059   1.00 15.69 ? 255 ILE A C     1 
ATOM   1999 O  O     . ILE A 1 258 ? 50.324 -13.063 5.419   1.00 10.63 ? 255 ILE A O     1 
ATOM   2000 C  CB    . ILE A 1 258 ? 52.754 -15.127 5.548   1.00 11.16 ? 255 ILE A CB    1 
ATOM   2001 C  CG1   . ILE A 1 258 ? 54.155 -15.605 5.936   1.00 17.32 ? 255 ILE A CG1   1 
ATOM   2002 C  CG2   . ILE A 1 258 ? 52.582 -15.351 4.062   1.00 15.40 ? 255 ILE A CG2   1 
ATOM   2003 C  CD1   . ILE A 1 258 ? 54.531 -15.349 7.370   1.00 17.42 ? 255 ILE A CD1   1 
ATOM   2004 N  N     . ARG A 1 259 ? 51.854 -12.263 3.998   1.00 11.63 ? 256 ARG A N     1 
ATOM   2005 C  CA    . ARG A 1 259 ? 50.861 -11.582 3.179   1.00 10.81 ? 256 ARG A CA    1 
ATOM   2006 C  C     . ARG A 1 259 ? 49.826 -12.552 2.616   1.00 8.89  ? 256 ARG A C     1 
ATOM   2007 O  O     . ARG A 1 259 ? 50.169 -13.571 2.003   1.00 9.16  ? 256 ARG A O     1 
ATOM   2008 C  CB    . ARG A 1 259 ? 51.547 -10.835 2.037   1.00 13.50 ? 256 ARG A CB    1 
ATOM   2009 C  CG    . ARG A 1 259 ? 50.604 -9.922  1.270   1.00 16.61 ? 256 ARG A CG    1 
ATOM   2010 C  CD    . ARG A 1 259 ? 50.475 -10.364 -0.166  1.00 35.53 ? 256 ARG A CD    1 
ATOM   2011 N  NE    . ARG A 1 259 ? 51.620 -9.963  -0.979  1.00 41.05 ? 256 ARG A NE    1 
ATOM   2012 C  CZ    . ARG A 1 259 ? 51.795 -10.322 -2.250  1.00 49.12 ? 256 ARG A CZ    1 
ATOM   2013 N  NH1   . ARG A 1 259 ? 52.860 -9.904  -2.923  1.00 31.69 ? 256 ARG A NH1   1 
ATOM   2014 N  NH2   . ARG A 1 259 ? 50.901 -11.096 -2.852  1.00 56.26 ? 256 ARG A NH2   1 
ATOM   2015 N  N     . SER A 1 260 ? 48.565 -12.218 2.849   1.00 10.13 ? 257 SER A N     1 
ATOM   2016 C  CA    . SER A 1 260 ? 47.419 -13.027 2.448   1.00 10.94 ? 257 SER A CA    1 
ATOM   2017 C  C     . SER A 1 260 ? 46.904 -13.878 3.618   1.00 12.68 ? 257 SER A C     1 
ATOM   2018 O  O     . SER A 1 260 ? 45.767 -14.371 3.605   1.00 11.74 ? 257 SER A O     1 
ATOM   2019 C  CB    . SER A 1 260 ? 47.684 -13.901 1.209   1.00 13.16 ? 257 SER A CB    1 
ATOM   2020 O  OG    . SER A 1 260 ? 48.222 -15.174 1.557   1.00 13.40 ? 257 SER A OG    1 
ATOM   2021 N  N     . LEU A 1 261 ? 47.738 -14.041 4.638   1.00 8.98  ? 258 LEU A N     1 
ATOM   2022 C  CA    . LEU A 1 261 ? 47.349 -14.836 5.793   1.00 5.94  ? 258 LEU A CA    1 
ATOM   2023 C  C     . LEU A 1 261 ? 46.916 -14.023 7.018   1.00 8.33  ? 258 LEU A C     1 
ATOM   2024 O  O     . LEU A 1 261 ? 46.765 -14.567 8.111   1.00 13.46 ? 258 LEU A O     1 
ATOM   2025 C  CB    . LEU A 1 261 ? 48.461 -15.819 6.172   1.00 8.64  ? 258 LEU A CB    1 
ATOM   2026 C  CG    . LEU A 1 261 ? 48.881 -16.813 5.083   1.00 10.65 ? 258 LEU A CG    1 
ATOM   2027 C  CD1   . LEU A 1 261 ? 49.910 -17.769 5.649   1.00 8.57  ? 258 LEU A CD1   1 
ATOM   2028 C  CD2   . LEU A 1 261 ? 47.664 -17.587 4.534   1.00 11.39 ? 258 LEU A CD2   1 
ATOM   2029 N  N     . GLY A 1 262 ? 46.714 -12.725 6.833   1.00 12.06 ? 259 GLY A N     1 
ATOM   2030 C  CA    . GLY A 1 262 ? 46.434 -11.845 7.949   1.00 12.97 ? 259 GLY A CA    1 
ATOM   2031 C  C     . GLY A 1 262 ? 44.984 -11.819 8.407   1.00 13.67 ? 259 GLY A C     1 
ATOM   2032 O  O     . GLY A 1 262 ? 44.658 -11.196 9.421   1.00 12.94 ? 259 GLY A O     1 
ATOM   2033 N  N     . GLY A 1 263 ? 44.114 -12.501 7.669   1.00 11.27 ? 260 GLY A N     1 
ATOM   2034 C  CA    . GLY A 1 263 ? 42.685 -12.464 7.942   1.00 7.93  ? 260 GLY A CA    1 
ATOM   2035 C  C     . GLY A 1 263 ? 42.103 -13.833 8.254   1.00 15.88 ? 260 GLY A C     1 
ATOM   2036 O  O     . GLY A 1 263 ? 42.680 -14.598 9.036   1.00 11.57 ? 260 GLY A O     1 
ATOM   2037 N  N     . LYS A 1 264 ? 40.957 -14.148 7.650   1.00 15.36 ? 261 LYS A N     1 
ATOM   2038 C  CA    . LYS A 1 264 ? 40.206 -15.358 8.004   1.00 13.21 ? 261 LYS A CA    1 
ATOM   2039 C  C     . LYS A 1 264 ? 40.898 -16.688 7.654   1.00 10.96 ? 261 LYS A C     1 
ATOM   2040 O  O     . LYS A 1 264 ? 40.806 -17.647 8.419   1.00 15.12 ? 261 LYS A O     1 
ATOM   2041 C  CB    . LYS A 1 264 ? 38.795 -15.320 7.396   1.00 14.95 ? 261 LYS A CB    1 
ATOM   2042 C  CG    . LYS A 1 264 ? 37.856 -14.340 8.094   1.00 13.88 ? 261 LYS A CG    1 
ATOM   2043 C  CD    . LYS A 1 264 ? 36.515 -14.216 7.352   1.00 26.66 ? 261 LYS A CD    1 
ATOM   2044 C  CE    . LYS A 1 264 ? 35.607 -13.171 7.995   1.00 43.08 ? 261 LYS A CE    1 
ATOM   2045 N  NZ    . LYS A 1 264 ? 34.249 -13.133 7.363   1.00 31.41 ? 261 LYS A NZ    1 
ATOM   2046 N  N     . LEU A 1 265 ? 41.561 -16.751 6.503   1.00 11.78 ? 262 LEU A N     1 
ATOM   2047 C  CA    . LEU A 1 265 ? 42.282 -17.966 6.099   1.00 12.91 ? 262 LEU A CA    1 
ATOM   2048 C  C     . LEU A 1 265 ? 43.394 -18.252 7.095   1.00 13.24 ? 262 LEU A C     1 
ATOM   2049 O  O     . LEU A 1 265 ? 43.543 -19.382 7.574   1.00 11.81 ? 262 LEU A O     1 
ATOM   2050 C  CB    . LEU A 1 265 ? 42.873 -17.812 4.702   1.00 11.50 ? 262 LEU A CB    1 
ATOM   2051 C  CG    . LEU A 1 265 ? 43.653 -18.969 4.060   1.00 13.67 ? 262 LEU A CG    1 
ATOM   2052 C  CD1   . LEU A 1 265 ? 42.743 -20.170 3.842   1.00 13.72 ? 262 LEU A CD1   1 
ATOM   2053 C  CD2   . LEU A 1 265 ? 44.247 -18.521 2.729   1.00 11.89 ? 262 LEU A CD2   1 
ATOM   2054 N  N     . GLY A 1 266 ? 44.175 -17.222 7.406   1.00 9.89  ? 263 GLY A N     1 
ATOM   2055 C  CA    . GLY A 1 266 ? 45.255 -17.361 8.365   1.00 16.49 ? 263 GLY A CA    1 
ATOM   2056 C  C     . GLY A 1 266 ? 44.748 -17.859 9.703   1.00 12.83 ? 263 GLY A C     1 
ATOM   2057 O  O     . GLY A 1 266 ? 45.376 -18.708 10.346  1.00 11.43 ? 263 GLY A O     1 
ATOM   2058 N  N     . ALA A 1 267 ? 43.598 -17.334 10.120  1.00 10.24 ? 264 ALA A N     1 
ATOM   2059 C  CA    . ALA A 1 267 ? 42.980 -17.763 11.368  1.00 13.98 ? 264 ALA A CA    1 
ATOM   2060 C  C     . ALA A 1 267 ? 42.541 -19.222 11.273  1.00 9.69  ? 264 ALA A C     1 
ATOM   2061 O  O     . ALA A 1 267 ? 42.662 -19.977 12.225  1.00 12.94 ? 264 ALA A O     1 
ATOM   2062 C  CB    . ALA A 1 267 ? 41.795 -16.872 11.717  1.00 18.67 ? 264 ALA A CB    1 
ATOM   2063 N  N     . SER A 1 268 ? 42.034 -19.631 10.118  1.00 12.35 ? 265 SER A N     1 
ATOM   2064 C  CA    . SER A 1 268 ? 41.585 -21.010 9.996   1.00 11.50 ? 265 SER A CA    1 
ATOM   2065 C  C     . SER A 1 268 ? 42.766 -21.980 9.940   1.00 10.69 ? 265 SER A C     1 
ATOM   2066 O  O     . SER A 1 268 ? 42.672 -23.092 10.453  1.00 9.29  ? 265 SER A O     1 
ATOM   2067 C  CB    . SER A 1 268 ? 40.653 -21.206 8.798   1.00 10.56 ? 265 SER A CB    1 
ATOM   2068 O  OG    . SER A 1 268 ? 41.381 -21.372 7.602   1.00 24.12 ? 265 SER A OG    1 
ATOM   2069 N  N     . VAL A 1 269 ? 43.862 -21.566 9.309   1.00 10.59 ? 266 VAL A N     1 
ATOM   2070 C  CA    . VAL A 1 269 ? 45.077 -22.390 9.267   1.00 9.75  ? 266 VAL A CA    1 
ATOM   2071 C  C     . VAL A 1 269 ? 45.490 -22.702 10.714  1.00 11.25 ? 266 VAL A C     1 
ATOM   2072 O  O     . VAL A 1 269 ? 45.758 -23.851 11.089  1.00 11.41 ? 266 VAL A O     1 
ATOM   2073 C  CB    . VAL A 1 269 ? 46.232 -21.664 8.531   1.00 10.13 ? 266 VAL A CB    1 
ATOM   2074 C  CG1   . VAL A 1 269 ? 47.582 -22.313 8.869   1.00 13.85 ? 266 VAL A CG1   1 
ATOM   2075 C  CG2   . VAL A 1 269 ? 46.000 -21.653 7.020   1.00 9.55  ? 266 VAL A CG2   1 
ATOM   2076 N  N     . ILE A 1 270 ? 45.490 -21.660 11.531  1.00 10.94 ? 267 ILE A N     1 
ATOM   2077 C  CA    . ILE A 1 270 ? 45.885 -21.754 12.929  1.00 11.70 ? 267 ILE A CA    1 
ATOM   2078 C  C     . ILE A 1 270 ? 44.929 -22.646 13.713  1.00 11.69 ? 267 ILE A C     1 
ATOM   2079 O  O     . ILE A 1 270 ? 45.357 -23.488 14.521  1.00 11.74 ? 267 ILE A O     1 
ATOM   2080 C  CB    . ILE A 1 270 ? 45.894 -20.354 13.563  1.00 11.31 ? 267 ILE A CB    1 
ATOM   2081 C  CG1   . ILE A 1 270 ? 47.078 -19.527 13.031  1.00 10.86 ? 267 ILE A CG1   1 
ATOM   2082 C  CG2   . ILE A 1 270 ? 45.892 -20.446 15.083  1.00 16.72 ? 267 ILE A CG2   1 
ATOM   2083 C  CD1   . ILE A 1 270 ? 47.077 -18.096 13.525  1.00 17.63 ? 267 ILE A CD1   1 
ATOM   2084 N  N     . GLU A 1 271 ? 43.631 -22.462 13.477  1.00 10.83 ? 268 GLU A N     1 
ATOM   2085 C  CA    . GLU A 1 271 ? 42.619 -23.187 14.240  1.00 11.44 ? 268 GLU A CA    1 
ATOM   2086 C  C     . GLU A 1 271 ? 42.503 -24.656 13.836  1.00 17.50 ? 268 GLU A C     1 
ATOM   2087 O  O     . GLU A 1 271 ? 42.497 -25.542 14.689  1.00 10.49 ? 268 GLU A O     1 
ATOM   2088 C  CB    . GLU A 1 271 ? 41.259 -22.489 14.135  1.00 21.76 ? 268 GLU A CB    1 
ATOM   2089 C  CG    . GLU A 1 271 ? 40.114 -23.255 14.779  1.00 35.41 ? 268 GLU A CG    1 
ATOM   2090 C  CD    . GLU A 1 271 ? 39.036 -22.335 15.324  1.00 58.01 ? 268 GLU A CD    1 
ATOM   2091 O  OE1   . GLU A 1 271 ? 37.912 -22.325 14.770  1.00 51.43 ? 268 GLU A OE1   1 
ATOM   2092 O  OE2   . GLU A 1 271 ? 39.319 -21.620 16.310  1.00 66.27 ? 268 GLU A OE2   1 
ATOM   2093 N  N     . ILE A 1 272 ? 42.409 -24.909 12.536  1.00 10.68 ? 269 ILE A N     1 
ATOM   2094 C  CA    . ILE A 1 272 ? 42.283 -26.269 12.022  1.00 10.82 ? 269 ILE A CA    1 
ATOM   2095 C  C     . ILE A 1 272 ? 43.521 -27.127 12.271  1.00 14.91 ? 269 ILE A C     1 
ATOM   2096 O  O     . ILE A 1 272 ? 43.429 -28.313 12.599  1.00 11.90 ? 269 ILE A O     1 
ATOM   2097 C  CB    . ILE A 1 272 ? 42.019 -26.235 10.491  1.00 11.31 ? 269 ILE A CB    1 
ATOM   2098 C  CG1   . ILE A 1 272 ? 40.650 -25.619 10.203  1.00 17.60 ? 269 ILE A CG1   1 
ATOM   2099 C  CG2   . ILE A 1 272 ? 42.121 -27.630 9.882   1.00 14.81 ? 269 ILE A CG2   1 
ATOM   2100 C  CD1   . ILE A 1 272 ? 40.310 -25.541 8.725   1.00 22.31 ? 269 ILE A CD1   1 
ATOM   2101 N  N     . LEU A 1 273 ? 44.696 -26.540 12.081  1.00 15.61 ? 270 LEU A N     1 
ATOM   2102 C  CA    . LEU A 1 273 ? 45.920 -27.313 12.184  1.00 10.86 ? 270 LEU A CA    1 
ATOM   2103 C  C     . LEU A 1 273 ? 46.491 -27.301 13.601  1.00 13.93 ? 270 LEU A C     1 
ATOM   2104 O  O     . LEU A 1 273 ? 47.333 -28.127 13.943  1.00 12.25 ? 270 LEU A O     1 
ATOM   2105 C  CB    . LEU A 1 273 ? 46.955 -26.807 11.181  1.00 13.86 ? 270 LEU A CB    1 
ATOM   2106 C  CG    . LEU A 1 273 ? 46.585 -26.993 9.712   1.00 16.08 ? 270 LEU A CG    1 
ATOM   2107 C  CD1   . LEU A 1 273 ? 47.745 -26.548 8.808   1.00 9.64  ? 270 LEU A CD1   1 
ATOM   2108 C  CD2   . LEU A 1 273 ? 46.220 -28.439 9.448   1.00 13.40 ? 270 LEU A CD2   1 
ATOM   2109 N  N     . GLY A 1 274 ? 46.036 -26.356 14.416  1.00 14.65 ? 271 GLY A N     1 
ATOM   2110 C  CA    . GLY A 1 274 ? 46.502 -26.240 15.786  1.00 12.75 ? 271 GLY A CA    1 
ATOM   2111 C  C     . GLY A 1 274 ? 47.961 -25.831 15.882  1.00 21.79 ? 271 GLY A C     1 
ATOM   2112 O  O     . GLY A 1 274 ? 48.700 -26.344 16.725  1.00 18.20 ? 271 GLY A O     1 
ATOM   2113 N  N     . ILE A 1 275 ? 48.372 -24.914 15.009  1.00 10.77 ? 272 ILE A N     1 
ATOM   2114 C  CA    . ILE A 1 275 ? 49.741 -24.388 14.993  1.00 10.13 ? 272 ILE A CA    1 
ATOM   2115 C  C     . ILE A 1 275 ? 49.735 -22.867 15.171  1.00 15.39 ? 272 ILE A C     1 
ATOM   2116 O  O     . ILE A 1 275 ? 48.676 -22.248 15.099  1.00 13.21 ? 272 ILE A O     1 
ATOM   2117 C  CB    . ILE A 1 275 ? 50.457 -24.744 13.673  1.00 8.81  ? 272 ILE A CB    1 
ATOM   2118 C  CG1   . ILE A 1 275 ? 49.678 -24.214 12.461  1.00 11.66 ? 272 ILE A CG1   1 
ATOM   2119 C  CG2   . ILE A 1 275 ? 50.639 -26.254 13.558  1.00 9.79  ? 272 ILE A CG2   1 
ATOM   2120 C  CD1   . ILE A 1 275 ? 50.404 -24.491 11.111  1.00 14.20 ? 272 ILE A CD1   1 
ATOM   2121 N  N     . GLU A 1 276 ? 50.912 -22.277 15.410  1.00 11.28 ? 273 GLU A N     1 
ATOM   2122 C  CA    . GLU A 1 276 ? 51.061 -20.817 15.533  1.00 10.87 ? 273 GLU A CA    1 
ATOM   2123 C  C     . GLU A 1 276 ? 51.989 -20.208 14.482  1.00 13.18 ? 273 GLU A C     1 
ATOM   2124 O  O     . GLU A 1 276 ? 51.787 -19.075 14.040  1.00 11.02 ? 273 GLU A O     1 
ATOM   2125 C  CB    . GLU A 1 276 ? 51.641 -20.434 16.905  1.00 9.84  ? 273 GLU A CB    1 
ATOM   2126 C  CG    . GLU A 1 276 ? 50.798 -20.833 18.112  1.00 27.00 ? 273 GLU A CG    1 
ATOM   2127 C  CD    . GLU A 1 276 ? 51.451 -20.431 19.429  1.00 35.49 ? 273 GLU A CD    1 
ATOM   2128 O  OE1   . GLU A 1 276 ? 51.461 -21.254 20.369  1.00 47.49 ? 273 GLU A OE1   1 
ATOM   2129 O  OE2   . GLU A 1 276 ? 51.950 -19.287 19.522  1.00 40.17 ? 273 GLU A OE2   1 
ATOM   2130 N  N     . TYR A 1 277 ? 53.027 -20.947 14.115  1.00 11.56 ? 274 TYR A N     1 
ATOM   2131 C  CA    . TYR A 1 277 ? 54.117 -20.371 13.331  1.00 7.84  ? 274 TYR A CA    1 
ATOM   2132 C  C     . TYR A 1 277 ? 54.187 -20.940 11.927  1.00 7.25  ? 274 TYR A C     1 
ATOM   2133 O  O     . TYR A 1 277 ? 53.894 -22.123 11.698  1.00 6.67  ? 274 TYR A O     1 
ATOM   2134 C  CB    . TYR A 1 277 ? 55.460 -20.584 14.043  1.00 8.07  ? 274 TYR A CB    1 
ATOM   2135 C  CG    . TYR A 1 277 ? 55.462 -20.071 15.469  1.00 7.49  ? 274 TYR A CG    1 
ATOM   2136 C  CD1   . TYR A 1 277 ? 55.642 -20.936 16.549  1.00 10.72 ? 274 TYR A CD1   1 
ATOM   2137 C  CD2   . TYR A 1 277 ? 55.249 -18.733 15.732  1.00 9.95  ? 274 TYR A CD2   1 
ATOM   2138 C  CE1   . TYR A 1 277 ? 55.632 -20.455 17.877  1.00 12.65 ? 274 TYR A CE1   1 
ATOM   2139 C  CE2   . TYR A 1 277 ? 55.227 -18.242 17.031  1.00 11.57 ? 274 TYR A CE2   1 
ATOM   2140 C  CZ    . TYR A 1 277 ? 55.414 -19.103 18.103  1.00 19.07 ? 274 TYR A CZ    1 
ATOM   2141 O  OH    . TYR A 1 277 ? 55.393 -18.590 19.387  1.00 14.15 ? 274 TYR A OH    1 
ATOM   2142 N  N     . MET A 1 278 ? 54.600 -20.090 10.997  1.00 5.69  ? 275 MET A N     1 
ATOM   2143 C  CA    . MET A 1 278 ? 54.749 -20.465 9.590   1.00 7.77  ? 275 MET A CA    1 
ATOM   2144 C  C     . MET A 1 278 ? 55.510 -21.775 9.357   1.00 9.00  ? 275 MET A C     1 
ATOM   2145 O  O     . MET A 1 278 ? 55.107 -22.610 8.537   1.00 8.33  ? 275 MET A O     1 
ATOM   2146 C  CB    . MET A 1 278 ? 55.429 -19.317 8.847   1.00 12.23 ? 275 MET A CB    1 
ATOM   2147 C  CG    . MET A 1 278 ? 55.084 -19.225 7.390   1.00 16.34 ? 275 MET A CG    1 
ATOM   2148 S  SD    . MET A 1 278 ? 53.326 -19.094 7.004   1.00 15.18 ? 275 MET A SD    1 
ATOM   2149 C  CE    . MET A 1 278 ? 53.446 -19.659 5.311   1.00 14.86 ? 275 MET A CE    1 
ATOM   2150 N  N     . GLY A 1 279 ? 56.616 -21.949 10.071  1.00 6.49  ? 276 GLY A N     1 
ATOM   2151 C  CA    . GLY A 1 279 ? 57.460 -23.115 9.888   1.00 10.05 ? 276 GLY A CA    1 
ATOM   2152 C  C     . GLY A 1 279 ? 56.783 -24.426 10.269  1.00 11.70 ? 276 GLY A C     1 
ATOM   2153 O  O     . GLY A 1 279 ? 57.134 -25.491 9.753   1.00 12.07 ? 276 GLY A O     1 
ATOM   2154 N  N     . GLU A 1 280 ? 55.811 -24.365 11.176  1.00 7.75  ? 277 GLU A N     1 
ATOM   2155 C  CA    . GLU A 1 280 ? 55.076 -25.570 11.546  1.00 7.46  ? 277 GLU A CA    1 
ATOM   2156 C  C     . GLU A 1 280 ? 54.304 -26.147 10.367  1.00 8.00  ? 277 GLU A C     1 
ATOM   2157 O  O     . GLU A 1 280 ? 53.896 -27.315 10.389  1.00 8.62  ? 277 GLU A O     1 
ATOM   2158 C  CB    . GLU A 1 280 ? 54.115 -25.297 12.715  1.00 12.62 ? 277 GLU A CB    1 
ATOM   2159 C  CG    . GLU A 1 280 ? 54.826 -24.957 14.027  1.00 9.67  ? 277 GLU A CG    1 
ATOM   2160 C  CD    . GLU A 1 280 ? 53.851 -24.713 15.168  1.00 12.54 ? 277 GLU A CD    1 
ATOM   2161 O  OE1   . GLU A 1 280 ? 53.532 -23.542 15.431  1.00 9.46  ? 277 GLU A OE1   1 
ATOM   2162 O  OE2   . GLU A 1 280 ? 53.409 -25.690 15.798  1.00 8.96  ? 277 GLU A OE2   1 
ATOM   2163 N  N     . LEU A 1 281 ? 54.092 -25.343 9.333   1.00 7.99  ? 278 LEU A N     1 
ATOM   2164 C  CA    . LEU A 1 281 ? 53.394 -25.841 8.141   1.00 9.05  ? 278 LEU A CA    1 
ATOM   2165 C  C     . LEU A 1 281 ? 54.134 -26.965 7.401   1.00 8.07  ? 278 LEU A C     1 
ATOM   2166 O  O     . LEU A 1 281 ? 53.517 -27.739 6.670   1.00 6.90  ? 278 LEU A O     1 
ATOM   2167 C  CB    . LEU A 1 281 ? 53.046 -24.687 7.183   1.00 3.24  ? 278 LEU A CB    1 
ATOM   2168 C  CG    . LEU A 1 281 ? 51.803 -23.890 7.617   1.00 7.95  ? 278 LEU A CG    1 
ATOM   2169 C  CD1   . LEU A 1 281 ? 51.720 -22.537 6.889   1.00 10.35 ? 278 LEU A CD1   1 
ATOM   2170 C  CD2   . LEU A 1 281 ? 50.530 -24.719 7.407   1.00 6.41  ? 278 LEU A CD2   1 
ATOM   2171 N  N     . THR A 1 282 ? 55.451 -27.060 7.578   1.00 9.89  ? 279 THR A N     1 
ATOM   2172 C  CA    . THR A 1 282 ? 56.236 -28.012 6.786   1.00 11.06 ? 279 THR A CA    1 
ATOM   2173 C  C     . THR A 1 282 ? 55.882 -29.464 7.103   1.00 9.26  ? 279 THR A C     1 
ATOM   2174 O  O     . THR A 1 282 ? 56.157 -30.351 6.308   1.00 9.33  ? 279 THR A O     1 
ATOM   2175 C  CB    . THR A 1 282 ? 57.755 -27.837 6.960   1.00 10.10 ? 279 THR A CB    1 
ATOM   2176 O  OG1   . THR A 1 282 ? 58.102 -28.023 8.339   1.00 13.16 ? 279 THR A OG1   1 
ATOM   2177 C  CG2   . THR A 1 282 ? 58.204 -26.456 6.480   1.00 9.30  ? 279 THR A CG2   1 
ATOM   2178 N  N     . GLN A 1 283 ? 55.251 -29.697 8.248   1.00 8.15  ? 280 GLN A N     1 
ATOM   2179 C  CA    . GLN A 1 283 ? 54.957 -31.059 8.680   1.00 11.53 ? 280 GLN A CA    1 
ATOM   2180 C  C     . GLN A 1 283 ? 53.711 -31.667 8.026   1.00 8.84  ? 280 GLN A C     1 
ATOM   2181 O  O     . GLN A 1 283 ? 53.377 -32.814 8.283   1.00 18.34 ? 280 GLN A O     1 
ATOM   2182 C  CB    . GLN A 1 283 ? 54.845 -31.107 10.209  1.00 13.31 ? 280 GLN A CB    1 
ATOM   2183 C  CG    A GLN A 1 283 ? 56.161 -30.825 10.857  0.54 12.22 ? 280 GLN A CG    1 
ATOM   2184 C  CG    B GLN A 1 283 ? 53.567 -30.525 10.766  0.46 12.20 ? 280 GLN A CG    1 
ATOM   2185 C  CD    A GLN A 1 283 ? 57.260 -31.600 10.168  0.54 16.60 ? 280 GLN A CD    1 
ATOM   2186 C  CD    B GLN A 1 283 ? 53.818 -29.636 11.970  0.46 12.86 ? 280 GLN A CD    1 
ATOM   2187 O  OE1   A GLN A 1 283 ? 57.241 -32.832 10.147  0.54 13.93 ? 280 GLN A OE1   1 
ATOM   2188 O  OE1   B GLN A 1 283 ? 54.923 -29.596 12.504  0.46 24.86 ? 280 GLN A OE1   1 
ATOM   2189 N  NE2   A GLN A 1 283 ? 58.207 -30.887 9.570   0.54 16.36 ? 280 GLN A NE2   1 
ATOM   2190 N  NE2   B GLN A 1 283 ? 52.798 -28.913 12.392  0.46 9.42  ? 280 GLN A NE2   1 
ATOM   2191 N  N     . PHE A 1 284 ? 53.029 -30.904 7.183   1.00 7.88  ? 281 PHE A N     1 
ATOM   2192 C  CA    . PHE A 1 284 ? 51.845 -31.410 6.517   1.00 6.09  ? 281 PHE A CA    1 
ATOM   2193 C  C     . PHE A 1 284 ? 52.135 -31.694 5.041   1.00 14.67 ? 281 PHE A C     1 
ATOM   2194 O  O     . PHE A 1 284 ? 52.945 -31.004 4.415   1.00 13.68 ? 281 PHE A O     1 
ATOM   2195 C  CB    . PHE A 1 284 ? 50.693 -30.417 6.673   1.00 7.62  ? 281 PHE A CB    1 
ATOM   2196 C  CG    . PHE A 1 284 ? 50.380 -30.099 8.099   1.00 10.08 ? 281 PHE A CG    1 
ATOM   2197 C  CD1   . PHE A 1 284 ? 49.536 -30.917 8.837   1.00 14.73 ? 281 PHE A CD1   1 
ATOM   2198 C  CD2   . PHE A 1 284 ? 50.946 -29.001 8.718   1.00 10.30 ? 281 PHE A CD2   1 
ATOM   2199 C  CE1   . PHE A 1 284 ? 49.255 -30.624 10.159  1.00 15.35 ? 281 PHE A CE1   1 
ATOM   2200 C  CE2   . PHE A 1 284 ? 50.678 -28.716 10.035  1.00 11.29 ? 281 PHE A CE2   1 
ATOM   2201 C  CZ    . PHE A 1 284 ? 49.839 -29.523 10.758  1.00 12.02 ? 281 PHE A CZ    1 
ATOM   2202 N  N     . THR A 1 285 ? 51.497 -32.716 4.483   1.00 12.87 ? 282 THR A N     1 
ATOM   2203 C  CA    . THR A 1 285 ? 51.706 -33.005 3.069   1.00 15.65 ? 282 THR A CA    1 
ATOM   2204 C  C     . THR A 1 285 ? 50.936 -31.970 2.268   1.00 7.95  ? 282 THR A C     1 
ATOM   2205 O  O     . THR A 1 285 ? 50.080 -31.284 2.797   1.00 10.01 ? 282 THR A O     1 
ATOM   2206 C  CB    . THR A 1 285 ? 51.246 -34.424 2.675   1.00 8.64  ? 282 THR A CB    1 
ATOM   2207 O  OG1   . THR A 1 285 ? 49.828 -34.493 2.751   1.00 9.25  ? 282 THR A OG1   1 
ATOM   2208 C  CG2   . THR A 1 285 ? 51.845 -35.459 3.616   1.00 14.79 ? 282 THR A CG2   1 
ATOM   2209 N  N     . GLU A 1 286 ? 51.260 -31.831 0.995   1.00 10.08 ? 283 GLU A N     1 
ATOM   2210 C  CA    . GLU A 1 286 ? 50.516 -30.921 0.151   1.00 10.98 ? 283 GLU A CA    1 
ATOM   2211 C  C     . GLU A 1 286 ? 49.035 -31.334 0.092   1.00 10.31 ? 283 GLU A C     1 
ATOM   2212 O  O     . GLU A 1 286 ? 48.158 -30.479 0.124   1.00 10.82 ? 283 GLU A O     1 
ATOM   2213 C  CB    . GLU A 1 286 ? 51.159 -30.839 -1.241  1.00 11.65 ? 283 GLU A CB    1 
ATOM   2214 C  CG    . GLU A 1 286 ? 50.546 -29.811 -2.151  1.00 18.01 ? 283 GLU A CG    1 
ATOM   2215 C  CD    . GLU A 1 286 ? 51.309 -29.683 -3.464  1.00 27.37 ? 283 GLU A CD    1 
ATOM   2216 O  OE1   . GLU A 1 286 ? 52.358 -30.339 -3.601  1.00 15.29 ? 283 GLU A OE1   1 
ATOM   2217 O  OE2   . GLU A 1 286 ? 50.864 -28.932 -4.354  1.00 25.14 ? 283 GLU A OE2   1 
ATOM   2218 N  N     . SER A 1 287 ? 48.760 -32.639 0.040   1.00 10.30 ? 284 SER A N     1 
ATOM   2219 C  CA    . SER A 1 287 ? 47.369 -33.096 -0.028  1.00 13.66 ? 284 SER A CA    1 
ATOM   2220 C  C     . SER A 1 287 ? 46.584 -32.732 1.228   1.00 9.77  ? 284 SER A C     1 
ATOM   2221 O  O     . SER A 1 287 ? 45.427 -32.342 1.142   1.00 13.13 ? 284 SER A O     1 
ATOM   2222 C  CB    . SER A 1 287 ? 47.273 -34.606 -0.312  1.00 10.65 ? 284 SER A CB    1 
ATOM   2223 O  OG    A SER A 1 287 ? 47.701 -34.894 -1.632  0.79 13.09 ? 284 SER A OG    1 
ATOM   2224 O  OG    B SER A 1 287 ? 47.856 -35.363 0.730   0.21 10.51 ? 284 SER A OG    1 
ATOM   2225 N  N     . GLN A 1 288 ? 47.230 -32.835 2.387   1.00 12.50 ? 285 GLN A N     1 
ATOM   2226 C  CA    . GLN A 1 288 ? 46.595 -32.448 3.640   1.00 8.02  ? 285 GLN A CA    1 
ATOM   2227 C  C     . GLN A 1 288 ? 46.217 -30.976 3.590   1.00 11.78 ? 285 GLN A C     1 
ATOM   2228 O  O     . GLN A 1 288 ? 45.100 -30.594 3.928   1.00 11.92 ? 285 GLN A O     1 
ATOM   2229 C  CB    . GLN A 1 288 ? 47.517 -32.699 4.827   1.00 7.68  ? 285 GLN A CB    1 
ATOM   2230 C  CG    . GLN A 1 288 ? 47.579 -34.149 5.263   1.00 18.60 ? 285 GLN A CG    1 
ATOM   2231 C  CD    . GLN A 1 288 ? 48.515 -34.343 6.434   1.00 19.44 ? 285 GLN A CD    1 
ATOM   2232 O  OE1   . GLN A 1 288 ? 49.649 -33.895 6.404   1.00 14.20 ? 285 GLN A OE1   1 
ATOM   2233 N  NE2   . GLN A 1 288 ? 48.031 -34.993 7.483   1.00 26.85 ? 285 GLN A NE2   1 
ATOM   2234 N  N     . LEU A 1 289 ? 47.154 -30.148 3.156   1.00 9.14  ? 286 LEU A N     1 
ATOM   2235 C  CA    . LEU A 1 289 ? 46.891 -28.721 3.075   1.00 8.96  ? 286 LEU A CA    1 
ATOM   2236 C  C     . LEU A 1 289 ? 45.754 -28.404 2.102   1.00 8.78  ? 286 LEU A C     1 
ATOM   2237 O  O     . LEU A 1 289 ? 44.887 -27.573 2.405   1.00 10.93 ? 286 LEU A O     1 
ATOM   2238 C  CB    . LEU A 1 289 ? 48.158 -27.951 2.711   1.00 9.26  ? 286 LEU A CB    1 
ATOM   2239 C  CG    . LEU A 1 289 ? 49.280 -28.034 3.759   1.00 9.80  ? 286 LEU A CG    1 
ATOM   2240 C  CD1   . LEU A 1 289 ? 50.514 -27.229 3.308   1.00 8.17  ? 286 LEU A CD1   1 
ATOM   2241 C  CD2   . LEU A 1 289 ? 48.765 -27.539 5.091   1.00 7.90  ? 286 LEU A CD2   1 
ATOM   2242 N  N     . GLN A 1 290 ? 45.756 -29.066 0.945   1.00 12.30 ? 287 GLN A N     1 
ATOM   2243 C  CA    . GLN A 1 290 ? 44.708 -28.850 -0.056  1.00 12.77 ? 287 GLN A CA    1 
ATOM   2244 C  C     . GLN A 1 290 ? 43.331 -29.317 0.443   1.00 12.98 ? 287 GLN A C     1 
ATOM   2245 O  O     . GLN A 1 290 ? 42.300 -28.738 0.080   1.00 11.10 ? 287 GLN A O     1 
ATOM   2246 C  CB    . GLN A 1 290 ? 45.050 -29.560 -1.362  1.00 14.35 ? 287 GLN A CB    1 
ATOM   2247 C  CG    . GLN A 1 290 ? 46.225 -28.968 -2.135  1.00 13.32 ? 287 GLN A CG    1 
ATOM   2248 C  CD    . GLN A 1 290 ? 46.622 -29.853 -3.303  1.00 18.14 ? 287 GLN A CD    1 
ATOM   2249 O  OE1   . GLN A 1 290 ? 46.642 -31.083 -3.176  1.00 16.37 ? 287 GLN A OE1   1 
ATOM   2250 N  NE2   . GLN A 1 290 ? 46.916 -29.239 -4.456  1.00 18.56 ? 287 GLN A NE2   1 
ATOM   2251 N  N     . SER A 1 291 ? 43.314 -30.362 1.269   1.00 11.97 ? 288 SER A N     1 
ATOM   2252 C  CA    . SER A 1 291 ? 42.058 -30.852 1.834   1.00 8.07  ? 288 SER A CA    1 
ATOM   2253 C  C     . SER A 1 291 ? 41.392 -29.802 2.722   1.00 15.76 ? 288 SER A C     1 
ATOM   2254 O  O     . SER A 1 291 ? 40.178 -29.617 2.669   1.00 24.04 ? 288 SER A O     1 
ATOM   2255 C  CB    . SER A 1 291 ? 42.243 -32.167 2.594   1.00 10.08 ? 288 SER A CB    1 
ATOM   2256 O  OG    A SER A 1 291 ? 42.930 -31.977 3.829   0.59 15.24 ? 288 SER A OG    1 
ATOM   2257 O  OG    B SER A 1 291 ? 41.001 -32.617 3.073   0.41 9.62  ? 288 SER A OG    1 
ATOM   2258 N  N     . HIS A 1 292 ? 42.189 -29.106 3.522   1.00 11.74 ? 289 HIS A N     1 
ATOM   2259 C  CA    . HIS A 1 292 ? 41.647 -28.113 4.439   1.00 11.17 ? 289 HIS A CA    1 
ATOM   2260 C  C     . HIS A 1 292 ? 41.355 -26.774 3.778   1.00 18.45 ? 289 HIS A C     1 
ATOM   2261 O  O     . HIS A 1 292 ? 40.354 -26.135 4.080   1.00 22.79 ? 289 HIS A O     1 
ATOM   2262 C  CB    . HIS A 1 292 ? 42.601 -27.880 5.608   1.00 13.45 ? 289 HIS A CB    1 
ATOM   2263 C  CG    . HIS A 1 292 ? 42.760 -29.068 6.511   1.00 17.90 ? 289 HIS A CG    1 
ATOM   2264 N  ND1   . HIS A 1 292 ? 41.714 -29.601 7.232   1.00 20.79 ? 289 HIS A ND1   1 
ATOM   2265 C  CD2   . HIS A 1 292 ? 43.848 -29.811 6.822   1.00 21.08 ? 289 HIS A CD2   1 
ATOM   2266 C  CE1   . HIS A 1 292 ? 42.149 -30.629 7.942   1.00 13.66 ? 289 HIS A CE1   1 
ATOM   2267 N  NE2   . HIS A 1 292 ? 43.442 -30.777 7.711   1.00 21.50 ? 289 HIS A NE2   1 
ATOM   2268 N  N     . PHE A 1 293 ? 42.239 -26.343 2.883   1.00 14.54 ? 290 PHE A N     1 
ATOM   2269 C  CA    . PHE A 1 293 ? 42.232 -24.948 2.443   1.00 13.03 ? 290 PHE A CA    1 
ATOM   2270 C  C     . PHE A 1 293 ? 42.003 -24.778 0.942   1.00 19.91 ? 290 PHE A C     1 
ATOM   2271 O  O     . PHE A 1 293 ? 42.104 -23.663 0.403   1.00 18.27 ? 290 PHE A O     1 
ATOM   2272 C  CB    . PHE A 1 293 ? 43.534 -24.272 2.881   1.00 10.58 ? 290 PHE A CB    1 
ATOM   2273 C  CG    . PHE A 1 293 ? 43.905 -24.560 4.311   1.00 10.57 ? 290 PHE A CG    1 
ATOM   2274 C  CD1   . PHE A 1 293 ? 43.126 -24.077 5.348   1.00 11.88 ? 290 PHE A CD1   1 
ATOM   2275 C  CD2   . PHE A 1 293 ? 45.023 -25.319 4.616   1.00 8.04  ? 290 PHE A CD2   1 
ATOM   2276 C  CE1   . PHE A 1 293 ? 43.442 -24.348 6.655   1.00 8.54  ? 290 PHE A CE1   1 
ATOM   2277 C  CE2   . PHE A 1 293 ? 45.353 -25.592 5.932   1.00 7.33  ? 290 PHE A CE2   1 
ATOM   2278 C  CZ    . PHE A 1 293 ? 44.571 -25.099 6.950   1.00 10.93 ? 290 PHE A CZ    1 
ATOM   2279 N  N     . GLY A 1 294 ? 41.699 -25.883 0.268   1.00 13.23 ? 291 GLY A N     1 
ATOM   2280 C  CA    . GLY A 1 294 ? 41.428 -25.847 -1.157  1.00 15.67 ? 291 GLY A CA    1 
ATOM   2281 C  C     . GLY A 1 294 ? 42.677 -26.096 -1.969  1.00 12.07 ? 291 GLY A C     1 
ATOM   2282 O  O     . GLY A 1 294 ? 43.781 -25.985 -1.456  1.00 14.13 ? 291 GLY A O     1 
ATOM   2283 N  N     . GLU A 1 295 ? 42.496 -26.433 -3.246  1.00 13.99 ? 292 GLU A N     1 
ATOM   2284 C  CA    . GLU A 1 295 ? 43.597 -26.851 -4.115  1.00 16.51 ? 292 GLU A CA    1 
ATOM   2285 C  C     . GLU A 1 295 ? 44.682 -25.787 -4.256  1.00 16.96 ? 292 GLU A C     1 
ATOM   2286 O  O     . GLU A 1 295 ? 45.856 -26.059 -4.046  1.00 10.63 ? 292 GLU A O     1 
ATOM   2287 C  CB    . GLU A 1 295 ? 43.057 -27.229 -5.497  1.00 18.98 ? 292 GLU A CB    1 
ATOM   2288 C  CG    . GLU A 1 295 ? 44.117 -27.715 -6.483  1.00 22.45 ? 292 GLU A CG    1 
ATOM   2289 C  CD    . GLU A 1 295 ? 43.525 -28.174 -7.817  1.00 35.05 ? 292 GLU A CD    1 
ATOM   2290 O  OE1   . GLU A 1 295 ? 44.302 -28.351 -8.782  1.00 31.43 ? 292 GLU A OE1   1 
ATOM   2291 O  OE2   . GLU A 1 295 ? 42.288 -28.361 -7.904  1.00 27.56 ? 292 GLU A OE2   1 
ATOM   2292 N  N     . LYS A 1 296 ? 44.278 -24.573 -4.614  1.00 13.49 ? 293 LYS A N     1 
ATOM   2293 C  CA    . LYS A 1 296 ? 45.217 -23.486 -4.851  1.00 15.93 ? 293 LYS A CA    1 
ATOM   2294 C  C     . LYS A 1 296 ? 45.919 -23.032 -3.553  1.00 11.83 ? 293 LYS A C     1 
ATOM   2295 O  O     . LYS A 1 296 ? 47.147 -22.991 -3.499  1.00 10.75 ? 293 LYS A O     1 
ATOM   2296 C  CB    . LYS A 1 296 ? 44.509 -22.315 -5.541  1.00 10.38 ? 293 LYS A CB    1 
ATOM   2297 C  CG    . LYS A 1 296 ? 45.439 -21.251 -6.090  1.00 28.09 ? 293 LYS A CG    1 
ATOM   2298 C  CD    . LYS A 1 296 ? 44.635 -20.131 -6.743  1.00 28.86 ? 293 LYS A CD    1 
ATOM   2299 C  CE    . LYS A 1 296 ? 45.234 -18.762 -6.439  1.00 33.35 ? 293 LYS A CE    1 
ATOM   2300 N  NZ    . LYS A 1 296 ? 44.377 -17.666 -6.966  1.00 41.24 ? 293 LYS A NZ    1 
ATOM   2301 N  N     . ASN A 1 297 ? 45.146 -22.712 -2.519  1.00 12.42 ? 294 ASN A N     1 
ATOM   2302 C  CA    . ASN A 1 297 ? 45.717 -22.322 -1.230  1.00 14.24 ? 294 ASN A CA    1 
ATOM   2303 C  C     . ASN A 1 297 ? 46.635 -23.405 -0.663  1.00 13.43 ? 294 ASN A C     1 
ATOM   2304 O  O     . ASN A 1 297 ? 47.635 -23.102 -0.021  1.00 13.40 ? 294 ASN A O     1 
ATOM   2305 C  CB    . ASN A 1 297 ? 44.632 -22.065 -0.179  1.00 17.99 ? 294 ASN A CB    1 
ATOM   2306 C  CG    . ASN A 1 297 ? 43.861 -20.783 -0.406  1.00 15.82 ? 294 ASN A CG    1 
ATOM   2307 O  OD1   . ASN A 1 297 ? 44.355 -19.835 -1.021  1.00 24.15 ? 294 ASN A OD1   1 
ATOM   2308 N  ND2   . ASN A 1 297 ? 42.640 -20.736 0.128   1.00 18.84 ? 294 ASN A ND2   1 
ATOM   2309 N  N     . GLY A 1 298 ? 46.255 -24.666 -0.842  1.00 14.68 ? 295 GLY A N     1 
ATOM   2310 C  CA    . GLY A 1 298 ? 47.013 -25.772 -0.281  1.00 11.87 ? 295 GLY A CA    1 
ATOM   2311 C  C     . GLY A 1 298 ? 48.397 -25.857 -0.898  1.00 15.35 ? 295 GLY A C     1 
ATOM   2312 O  O     . GLY A 1 298 ? 49.411 -25.988 -0.198  1.00 13.19 ? 295 GLY A O     1 
ATOM   2313 N  N     . SER A 1 299 ? 48.439 -25.780 -2.224  1.00 7.96  ? 296 SER A N     1 
ATOM   2314 C  CA    . SER A 1 299 ? 49.700 -25.814 -2.940  1.00 11.01 ? 296 SER A CA    1 
ATOM   2315 C  C     . SER A 1 299 ? 50.512 -24.587 -2.582  1.00 15.44 ? 296 SER A C     1 
ATOM   2316 O  O     . SER A 1 299 ? 51.716 -24.681 -2.378  1.00 6.94  ? 296 SER A O     1 
ATOM   2317 C  CB    . SER A 1 299 ? 49.455 -25.875 -4.445  1.00 16.20 ? 296 SER A CB    1 
ATOM   2318 O  OG    . SER A 1 299 ? 49.002 -27.162 -4.791  1.00 17.36 ? 296 SER A OG    1 
ATOM   2319 N  N     . TRP A 1 300 ? 49.837 -23.445 -2.475  1.00 9.86  ? 297 TRP A N     1 
ATOM   2320 C  CA    . TRP A 1 300 ? 50.516 -22.206 -2.129  1.00 12.70 ? 297 TRP A CA    1 
ATOM   2321 C  C     . TRP A 1 300 ? 51.200 -22.310 -0.768  1.00 10.75 ? 297 TRP A C     1 
ATOM   2322 O  O     . TRP A 1 300 ? 52.378 -21.982 -0.638  1.00 9.38  ? 297 TRP A O     1 
ATOM   2323 C  CB    . TRP A 1 300 ? 49.542 -21.022 -2.149  1.00 12.21 ? 297 TRP A CB    1 
ATOM   2324 C  CG    . TRP A 1 300 ? 50.219 -19.701 -1.903  1.00 15.09 ? 297 TRP A CG    1 
ATOM   2325 C  CD1   . TRP A 1 300 ? 50.858 -18.918 -2.827  1.00 17.27 ? 297 TRP A CD1   1 
ATOM   2326 C  CD2   . TRP A 1 300 ? 50.323 -19.006 -0.650  1.00 9.64  ? 297 TRP A CD2   1 
ATOM   2327 N  NE1   . TRP A 1 300 ? 51.360 -17.785 -2.222  1.00 12.05 ? 297 TRP A NE1   1 
ATOM   2328 C  CE2   . TRP A 1 300 ? 51.041 -17.814 -0.890  1.00 11.96 ? 297 TRP A CE2   1 
ATOM   2329 C  CE3   . TRP A 1 300 ? 49.883 -19.278 0.646   1.00 14.21 ? 297 TRP A CE3   1 
ATOM   2330 C  CZ2   . TRP A 1 300 ? 51.320 -16.899 0.115   1.00 9.70  ? 297 TRP A CZ2   1 
ATOM   2331 C  CZ3   . TRP A 1 300 ? 50.161 -18.364 1.644   1.00 20.81 ? 297 TRP A CZ3   1 
ATOM   2332 C  CH2   . TRP A 1 300 ? 50.876 -17.192 1.371   1.00 11.66 ? 297 TRP A CH2   1 
ATOM   2333 N  N     . LEU A 1 301 ? 50.450 -22.785 0.226   1.00 10.69 ? 298 LEU A N     1 
ATOM   2334 C  CA    . LEU A 1 301 ? 50.945 -22.932 1.593   1.00 11.02 ? 298 LEU A CA    1 
ATOM   2335 C  C     . LEU A 1 301 ? 52.093 -23.924 1.683   1.00 9.08  ? 298 LEU A C     1 
ATOM   2336 O  O     . LEU A 1 301 ? 53.069 -23.711 2.410   1.00 7.67  ? 298 LEU A O     1 
ATOM   2337 C  CB    . LEU A 1 301 ? 49.809 -23.390 2.513   1.00 6.40  ? 298 LEU A CB    1 
ATOM   2338 C  CG    . LEU A 1 301 ? 48.807 -22.277 2.846   1.00 7.82  ? 298 LEU A CG    1 
ATOM   2339 C  CD1   . LEU A 1 301 ? 47.489 -22.850 3.354   1.00 7.46  ? 298 LEU A CD1   1 
ATOM   2340 C  CD2   . LEU A 1 301 ? 49.417 -21.296 3.859   1.00 7.66  ? 298 LEU A CD2   1 
ATOM   2341 N  N     . TYR A 1 302 ? 51.976 -25.015 0.944   1.00 10.36 ? 299 TYR A N     1 
ATOM   2342 C  CA    . TYR A 1 302 ? 53.018 -26.031 0.951   1.00 7.50  ? 299 TYR A CA    1 
ATOM   2343 C  C     . TYR A 1 302 ? 54.366 -25.476 0.493   1.00 10.36 ? 299 TYR A C     1 
ATOM   2344 O  O     . TYR A 1 302 ? 55.394 -25.692 1.147   1.00 8.60  ? 299 TYR A O     1 
ATOM   2345 C  CB    . TYR A 1 302 ? 52.611 -27.236 0.104   1.00 8.08  ? 299 TYR A CB    1 
ATOM   2346 C  CG    . TYR A 1 302 ? 53.610 -28.372 0.175   1.00 8.20  ? 299 TYR A CG    1 
ATOM   2347 C  CD1   . TYR A 1 302 ? 53.459 -29.400 1.092   1.00 12.05 ? 299 TYR A CD1   1 
ATOM   2348 C  CD2   . TYR A 1 302 ? 54.716 -28.402 -0.669  1.00 19.43 ? 299 TYR A CD2   1 
ATOM   2349 C  CE1   . TYR A 1 302 ? 54.373 -30.444 1.156   1.00 10.21 ? 299 TYR A CE1   1 
ATOM   2350 C  CE2   . TYR A 1 302 ? 55.640 -29.436 -0.611  1.00 18.16 ? 299 TYR A CE2   1 
ATOM   2351 C  CZ    . TYR A 1 302 ? 55.460 -30.455 0.310   1.00 22.61 ? 299 TYR A CZ    1 
ATOM   2352 O  OH    . TYR A 1 302 ? 56.377 -31.483 0.385   1.00 25.84 ? 299 TYR A OH    1 
ATOM   2353 N  N     . ALA A 1 303 ? 54.363 -24.751 -0.622  1.00 7.72  ? 300 ALA A N     1 
ATOM   2354 C  CA    . ALA A 1 303 ? 55.578 -24.097 -1.095  1.00 8.34  ? 300 ALA A CA    1 
ATOM   2355 C  C     . ALA A 1 303 ? 55.997 -22.925 -0.193  1.00 9.49  ? 300 ALA A C     1 
ATOM   2356 O  O     . ALA A 1 303 ? 57.185 -22.770 0.114   1.00 9.38  ? 300 ALA A O     1 
ATOM   2357 C  CB    . ALA A 1 303 ? 55.408 -23.624 -2.545  1.00 16.74 ? 300 ALA A CB    1 
ATOM   2358 N  N     . MET A 1 304 ? 55.033 -22.134 0.267   1.00 9.71  ? 301 MET A N     1 
ATOM   2359 C  CA    . MET A 1 304 ? 55.375 -20.887 0.969   1.00 7.92  ? 301 MET A CA    1 
ATOM   2360 C  C     . MET A 1 304 ? 56.067 -21.124 2.286   1.00 7.14  ? 301 MET A C     1 
ATOM   2361 O  O     . MET A 1 304 ? 56.961 -20.349 2.660   1.00 6.38  ? 301 MET A O     1 
ATOM   2362 C  CB    . MET A 1 304 ? 54.150 -20.027 1.241   1.00 7.15  ? 301 MET A CB    1 
ATOM   2363 C  CG    . MET A 1 304 ? 54.522 -18.600 1.693   1.00 9.81  ? 301 MET A CG    1 
ATOM   2364 S  SD    . MET A 1 304 ? 55.297 -17.671 0.337   1.00 13.46 ? 301 MET A SD    1 
ATOM   2365 C  CE    . MET A 1 304 ? 57.002 -17.518 0.900   1.00 13.35 ? 301 MET A CE    1 
ATOM   2366 N  N     . CYS A 1 305 ? 55.636 -22.154 3.018   1.00 5.01  ? 302 CYS A N     1 
ATOM   2367 C  CA    . CYS A 1 305 ? 56.261 -22.440 4.311   1.00 9.34  ? 302 CYS A CA    1 
ATOM   2368 C  C     . CYS A 1 305 ? 57.699 -22.931 4.132   1.00 6.55  ? 302 CYS A C     1 
ATOM   2369 O  O     . CYS A 1 305 ? 58.452 -23.004 5.098   1.00 5.15  ? 302 CYS A O     1 
ATOM   2370 C  CB    . CYS A 1 305 ? 55.440 -23.441 5.142   1.00 5.52  ? 302 CYS A CB    1 
ATOM   2371 S  SG    . CYS A 1 305 ? 55.498 -25.140 4.531   1.00 8.35  ? 302 CYS A SG    1 
ATOM   2372 N  N     . ARG A 1 306 ? 58.075 -23.256 2.896   1.00 4.29  ? 303 ARG A N     1 
ATOM   2373 C  CA    . ARG A 1 306 ? 59.457 -23.588 2.557   1.00 6.58  ? 303 ARG A CA    1 
ATOM   2374 C  C     . ARG A 1 306 ? 60.192 -22.394 1.918   1.00 7.59  ? 303 ARG A C     1 
ATOM   2375 O  O     . ARG A 1 306 ? 61.348 -22.498 1.522   1.00 13.04 ? 303 ARG A O     1 
ATOM   2376 C  CB    . ARG A 1 306 ? 59.518 -24.848 1.662   1.00 6.02  ? 303 ARG A CB    1 
ATOM   2377 C  CG    . ARG A 1 306 ? 58.959 -26.105 2.352   1.00 5.88  ? 303 ARG A CG    1 
ATOM   2378 C  CD    . ARG A 1 306 ? 58.707 -27.297 1.398   1.00 12.00 ? 303 ARG A CD    1 
ATOM   2379 N  NE    . ARG A 1 306 ? 58.521 -28.523 2.177   1.00 14.39 ? 303 ARG A NE    1 
ATOM   2380 C  CZ    . ARG A 1 306 ? 57.415 -28.827 2.848   1.00 11.91 ? 303 ARG A CZ    1 
ATOM   2381 N  NH1   . ARG A 1 306 ? 57.348 -29.957 3.551   1.00 10.34 ? 303 ARG A NH1   1 
ATOM   2382 N  NH2   . ARG A 1 306 ? 56.369 -28.014 2.799   1.00 6.07  ? 303 ARG A NH2   1 
ATOM   2383 N  N     . GLY A 1 307 ? 59.527 -21.247 1.850   1.00 7.08  ? 304 GLY A N     1 
ATOM   2384 C  CA    . GLY A 1 307 ? 60.154 -20.045 1.337   1.00 9.26  ? 304 GLY A CA    1 
ATOM   2385 C  C     . GLY A 1 307 ? 59.995 -19.946 -0.167  1.00 9.05  ? 304 GLY A C     1 
ATOM   2386 O  O     . GLY A 1 307 ? 60.679 -19.172 -0.826  1.00 9.22  ? 304 GLY A O     1 
ATOM   2387 N  N     . ILE A 1 308 ? 59.073 -20.727 -0.715  1.00 10.16 ? 305 ILE A N     1 
ATOM   2388 C  CA    . ILE A 1 308 ? 58.911 -20.773 -2.167  1.00 11.28 ? 305 ILE A CA    1 
ATOM   2389 C  C     . ILE A 1 308 ? 57.561 -20.209 -2.584  1.00 10.56 ? 305 ILE A C     1 
ATOM   2390 O  O     . ILE A 1 308 ? 56.540 -20.526 -1.984  1.00 8.08  ? 305 ILE A O     1 
ATOM   2391 C  CB    . ILE A 1 308 ? 59.057 -22.214 -2.697  1.00 17.13 ? 305 ILE A CB    1 
ATOM   2392 C  CG1   . ILE A 1 308 ? 60.425 -22.781 -2.304  1.00 15.86 ? 305 ILE A CG1   1 
ATOM   2393 C  CG2   . ILE A 1 308 ? 58.832 -22.266 -4.205  1.00 13.01 ? 305 ILE A CG2   1 
ATOM   2394 C  CD1   . ILE A 1 308 ? 60.585 -24.243 -2.626  1.00 23.16 ? 305 ILE A CD1   1 
ATOM   2395 N  N     . GLU A 1 309 ? 57.569 -19.366 -3.617  1.00 8.55  ? 306 GLU A N     1 
ATOM   2396 C  CA    . GLU A 1 309 ? 56.364 -18.679 -4.067  1.00 10.37 ? 306 GLU A CA    1 
ATOM   2397 C  C     . GLU A 1 309 ? 56.630 -18.230 -5.515  1.00 14.06 ? 306 GLU A C     1 
ATOM   2398 O  O     . GLU A 1 309 ? 57.724 -17.782 -5.820  1.00 12.76 ? 306 GLU A O     1 
ATOM   2399 C  CB    . GLU A 1 309 ? 56.089 -17.480 -3.163  1.00 13.12 ? 306 GLU A CB    1 
ATOM   2400 C  CG    . GLU A 1 309 ? 54.640 -17.085 -3.103  1.00 16.60 ? 306 GLU A CG    1 
ATOM   2401 C  CD    . GLU A 1 309 ? 54.355 -15.690 -3.628  1.00 19.22 ? 306 GLU A CD    1 
ATOM   2402 O  OE1   . GLU A 1 309 ? 55.294 -14.859 -3.757  1.00 14.95 ? 306 GLU A OE1   1 
ATOM   2403 O  OE2   . GLU A 1 309 ? 53.163 -15.427 -3.897  1.00 26.38 ? 306 GLU A OE2   1 
ATOM   2404 N  N     . HIS A 1 310 ? 55.660 -18.371 -6.412  1.00 12.39 ? 307 HIS A N     1 
ATOM   2405 C  CA    . HIS A 1 310 ? 55.952 -18.147 -7.838  1.00 15.45 ? 307 HIS A CA    1 
ATOM   2406 C  C     . HIS A 1 310 ? 55.207 -16.991 -8.514  1.00 14.62 ? 307 HIS A C     1 
ATOM   2407 O  O     . HIS A 1 310 ? 55.382 -16.758 -9.714  1.00 15.50 ? 307 HIS A O     1 
ATOM   2408 C  CB    . HIS A 1 310 ? 55.750 -19.437 -8.642  1.00 25.21 ? 307 HIS A CB    1 
ATOM   2409 C  CG    . HIS A 1 310 ? 56.735 -20.513 -8.305  1.00 32.99 ? 307 HIS A CG    1 
ATOM   2410 N  ND1   . HIS A 1 310 ? 58.098 -20.340 -8.434  1.00 27.23 ? 307 HIS A ND1   1 
ATOM   2411 C  CD2   . HIS A 1 310 ? 56.558 -21.769 -7.832  1.00 31.15 ? 307 HIS A CD2   1 
ATOM   2412 C  CE1   . HIS A 1 310 ? 58.717 -21.446 -8.062  1.00 36.44 ? 307 HIS A CE1   1 
ATOM   2413 N  NE2   . HIS A 1 310 ? 57.805 -22.328 -7.690  1.00 31.82 ? 307 HIS A NE2   1 
ATOM   2414 N  N     . ASP A 1 311 ? 54.381 -16.279 -7.757  1.00 11.56 ? 308 ASP A N     1 
ATOM   2415 C  CA    . ASP A 1 311 ? 53.607 -15.158 -8.302  1.00 13.28 ? 308 ASP A CA    1 
ATOM   2416 C  C     . ASP A 1 311 ? 54.539 -14.138 -8.982  1.00 16.47 ? 308 ASP A C     1 
ATOM   2417 O  O     . ASP A 1 311 ? 55.522 -13.707 -8.380  1.00 12.01 ? 308 ASP A O     1 
ATOM   2418 C  CB    . ASP A 1 311 ? 52.825 -14.485 -7.176  1.00 11.82 ? 308 ASP A CB    1 
ATOM   2419 C  CG    . ASP A 1 311 ? 51.899 -13.378 -7.672  1.00 19.61 ? 308 ASP A CG    1 
ATOM   2420 O  OD1   . ASP A 1 311 ? 51.840 -12.324 -7.020  1.00 27.76 ? 308 ASP A OD1   1 
ATOM   2421 O  OD2   . ASP A 1 311 ? 51.207 -13.566 -8.694  1.00 30.15 ? 308 ASP A OD2   1 
ATOM   2422 N  N     . PRO A 1 312 ? 54.244 -13.755 -10.242 1.00 14.51 ? 309 PRO A N     1 
ATOM   2423 C  CA    . PRO A 1 312 ? 55.167 -12.827 -10.906 1.00 13.42 ? 309 PRO A CA    1 
ATOM   2424 C  C     . PRO A 1 312 ? 54.991 -11.363 -10.497 1.00 7.85  ? 309 PRO A C     1 
ATOM   2425 O  O     . PRO A 1 312 ? 53.917 -10.935 -10.083 1.00 10.15 ? 309 PRO A O     1 
ATOM   2426 C  CB    . PRO A 1 312 ? 54.853 -13.025 -12.395 1.00 12.34 ? 309 PRO A CB    1 
ATOM   2427 C  CG    . PRO A 1 312 ? 53.421 -13.459 -12.409 1.00 11.59 ? 309 PRO A CG    1 
ATOM   2428 C  CD    . PRO A 1 312 ? 53.248 -14.310 -11.181 1.00 11.52 ? 309 PRO A CD    1 
ATOM   2429 N  N     . VAL A 1 313 ? 56.089 -10.615 -10.568 1.00 12.37 ? 310 VAL A N     1 
ATOM   2430 C  CA    . VAL A 1 313 ? 56.032 -9.165  -10.505 1.00 11.70 ? 310 VAL A CA    1 
ATOM   2431 C  C     . VAL A 1 313 ? 55.329 -8.726  -11.781 1.00 11.23 ? 310 VAL A C     1 
ATOM   2432 O  O     . VAL A 1 313 ? 55.885 -8.857  -12.866 1.00 14.06 ? 310 VAL A O     1 
ATOM   2433 C  CB    . VAL A 1 313 ? 57.440 -8.547  -10.484 1.00 12.15 ? 310 VAL A CB    1 
ATOM   2434 C  CG1   . VAL A 1 313 ? 57.365 -7.013  -10.426 1.00 9.47  ? 310 VAL A CG1   1 
ATOM   2435 C  CG2   . VAL A 1 313 ? 58.236 -9.089  -9.302  1.00 8.71  ? 310 VAL A CG2   1 
ATOM   2436 N  N     . LYS A 1 314 ? 54.098 -8.243  -11.657 1.00 14.36 ? 311 LYS A N     1 
ATOM   2437 C  CA    . LYS A 1 314 ? 53.321 -7.868  -12.830 1.00 11.46 ? 311 LYS A CA    1 
ATOM   2438 C  C     . LYS A 1 314 ? 53.768 -6.522  -13.374 1.00 13.19 ? 311 LYS A C     1 
ATOM   2439 O  O     . LYS A 1 314 ? 53.964 -5.569  -12.610 1.00 12.63 ? 311 LYS A O     1 
ATOM   2440 C  CB    . LYS A 1 314 ? 51.822 -7.885  -12.523 1.00 12.02 ? 311 LYS A CB    1 
ATOM   2441 C  CG    . LYS A 1 314 ? 51.307 -9.297  -12.262 1.00 18.70 ? 311 LYS A CG    1 
ATOM   2442 C  CD    . LYS A 1 314 ? 49.927 -9.321  -11.627 1.00 31.73 ? 311 LYS A CD    1 
ATOM   2443 C  CE    . LYS A 1 314 ? 49.548 -10.756 -11.271 1.00 34.41 ? 311 LYS A CE    1 
ATOM   2444 N  NZ    . LYS A 1 314 ? 50.682 -11.494 -10.604 1.00 27.11 ? 311 LYS A NZ    1 
ATOM   2445 N  N     . PRO A 1 315 ? 53.965 -6.451  -14.699 1.00 13.52 ? 312 PRO A N     1 
ATOM   2446 C  CA    . PRO A 1 315 ? 54.356 -5.206  -15.359 1.00 7.92  ? 312 PRO A CA    1 
ATOM   2447 C  C     . PRO A 1 315 ? 53.172 -4.245  -15.355 1.00 16.87 ? 312 PRO A C     1 
ATOM   2448 O  O     . PRO A 1 315 ? 52.427 -4.160  -16.339 1.00 11.82 ? 312 PRO A O     1 
ATOM   2449 C  CB    . PRO A 1 315 ? 54.688 -5.655  -16.787 1.00 16.14 ? 312 PRO A CB    1 
ATOM   2450 C  CG    . PRO A 1 315 ? 53.872 -6.904  -16.993 1.00 17.39 ? 312 PRO A CG    1 
ATOM   2451 C  CD    . PRO A 1 315 ? 53.880 -7.582  -15.645 1.00 17.35 ? 312 PRO A CD    1 
ATOM   2452 N  N     . ARG A 1 316 ? 52.990 -3.544  -14.239 1.00 14.29 ? 313 ARG A N     1 
ATOM   2453 C  CA    . ARG A 1 316 ? 51.845 -2.642  -14.079 1.00 17.90 ? 313 ARG A CA    1 
ATOM   2454 C  C     . ARG A 1 316 ? 52.212 -1.513  -13.126 1.00 15.98 ? 313 ARG A C     1 
ATOM   2455 O  O     . ARG A 1 316 ? 52.354 -1.732  -11.928 1.00 15.42 ? 313 ARG A O     1 
ATOM   2456 C  CB    . ARG A 1 316 ? 50.631 -3.397  -13.541 1.00 17.46 ? 313 ARG A CB    1 
ATOM   2457 C  CG    . ARG A 1 316 ? 49.311 -2.629  -13.654 1.00 17.22 ? 313 ARG A CG    1 
ATOM   2458 C  CD    . ARG A 1 316 ? 48.208 -3.289  -12.821 1.00 14.83 ? 313 ARG A CD    1 
ATOM   2459 N  NE    . ARG A 1 316 ? 48.478 -3.163  -11.384 1.00 24.61 ? 313 ARG A NE    1 
ATOM   2460 C  CZ    . ARG A 1 316 ? 48.720 -4.180  -10.559 1.00 38.20 ? 313 ARG A CZ    1 
ATOM   2461 N  NH1   . ARG A 1 316 ? 48.962 -3.941  -9.270  1.00 21.23 ? 313 ARG A NH1   1 
ATOM   2462 N  NH2   . ARG A 1 316 ? 48.708 -5.436  -11.009 1.00 39.28 ? 313 ARG A NH2   1 
ATOM   2463 N  N     . GLN A 1 317 ? 52.365 -0.314  -13.673 1.00 9.84  ? 314 GLN A N     1 
ATOM   2464 C  CA    . GLN A 1 317 ? 52.760 0.858   -12.896 1.00 18.01 ? 314 GLN A CA    1 
ATOM   2465 C  C     . GLN A 1 317 ? 51.569 1.774   -12.579 1.00 21.94 ? 314 GLN A C     1 
ATOM   2466 O  O     . GLN A 1 317 ? 51.630 2.589   -11.651 1.00 21.68 ? 314 GLN A O     1 
ATOM   2467 C  CB    . GLN A 1 317 ? 53.837 1.633   -13.654 1.00 24.36 ? 314 GLN A CB    1 
ATOM   2468 C  CG    . GLN A 1 317 ? 54.413 2.826   -12.915 1.00 36.09 ? 314 GLN A CG    1 
ATOM   2469 C  CD    . GLN A 1 317 ? 55.433 3.575   -13.750 1.00 23.47 ? 314 GLN A CD    1 
ATOM   2470 O  OE1   . GLN A 1 317 ? 55.813 3.124   -14.831 1.00 36.07 ? 314 GLN A OE1   1 
ATOM   2471 N  NE2   . GLN A 1 317 ? 55.879 4.728   -13.256 1.00 29.12 ? 314 GLN A NE2   1 
ATOM   2472 N  N     . LEU A 1 318 ? 50.492 1.642   -13.354 1.00 14.99 ? 315 LEU A N     1 
ATOM   2473 C  CA    . LEU A 1 318 ? 49.286 2.448   -13.163 1.00 15.04 ? 315 LEU A CA    1 
ATOM   2474 C  C     . LEU A 1 318 ? 48.173 1.677   -12.448 1.00 14.90 ? 315 LEU A C     1 
ATOM   2475 O  O     . LEU A 1 318 ? 47.996 0.481   -12.664 1.00 11.03 ? 315 LEU A O     1 
ATOM   2476 C  CB    . LEU A 1 318 ? 48.734 2.908   -14.526 1.00 13.37 ? 315 LEU A CB    1 
ATOM   2477 C  CG    . LEU A 1 318 ? 49.626 3.778   -15.422 1.00 21.21 ? 315 LEU A CG    1 
ATOM   2478 C  CD1   . LEU A 1 318 ? 48.986 3.974   -16.804 1.00 17.33 ? 315 LEU A CD1   1 
ATOM   2479 C  CD2   . LEU A 1 318 ? 49.948 5.132   -14.767 1.00 15.99 ? 315 LEU A CD2   1 
ATOM   2480 N  N     . PRO A 1 319 ? 47.386 2.372   -11.620 1.00 14.93 ? 316 PRO A N     1 
ATOM   2481 C  CA    . PRO A 1 319 ? 46.197 1.698   -11.081 1.00 12.79 ? 316 PRO A CA    1 
ATOM   2482 C  C     . PRO A 1 319 ? 45.272 1.195   -12.208 1.00 17.17 ? 316 PRO A C     1 
ATOM   2483 O  O     . PRO A 1 319 ? 45.291 1.768   -13.296 1.00 15.92 ? 316 PRO A O     1 
ATOM   2484 C  CB    . PRO A 1 319 ? 45.521 2.789   -10.241 1.00 18.41 ? 316 PRO A CB    1 
ATOM   2485 C  CG    . PRO A 1 319 ? 46.176 4.086   -10.643 1.00 27.69 ? 316 PRO A CG    1 
ATOM   2486 C  CD    . PRO A 1 319 ? 47.540 3.754   -11.127 1.00 14.51 ? 316 PRO A CD    1 
ATOM   2487 N  N     . LYS A 1 320 ? 44.514 0.130   -11.938 1.00 15.54 ? 317 LYS A N     1 
ATOM   2488 C  CA    . LYS A 1 320 ? 43.554 -0.488  -12.866 1.00 18.23 ? 317 LYS A CA    1 
ATOM   2489 C  C     . LYS A 1 320 ? 42.172 0.142   -12.758 1.00 17.91 ? 317 LYS A C     1 
ATOM   2490 O  O     . LYS A 1 320 ? 41.309 -0.066  -13.612 1.00 18.92 ? 317 LYS A O     1 
ATOM   2491 C  CB    . LYS A 1 320 ? 43.374 -1.974  -12.523 1.00 20.10 ? 317 LYS A CB    1 
ATOM   2492 C  CG    . LYS A 1 320 ? 44.475 -2.905  -12.978 1.00 23.89 ? 317 LYS A CG    1 
ATOM   2493 C  CD    . LYS A 1 320 ? 44.074 -4.358  -12.725 1.00 24.23 ? 317 LYS A CD    1 
ATOM   2494 C  CE    . LYS A 1 320 ? 44.781 -5.295  -13.694 1.00 31.71 ? 317 LYS A CE    1 
ATOM   2495 N  NZ    . LYS A 1 320 ? 44.742 -6.713  -13.240 1.00 35.03 ? 317 LYS A NZ    1 
ATOM   2496 N  N     . THR A 1 321 ? 41.946 0.871   -11.673 1.00 14.82 ? 318 THR A N     1 
ATOM   2497 C  CA    . THR A 1 321 ? 40.654 1.503   -11.446 1.00 14.31 ? 318 THR A CA    1 
ATOM   2498 C  C     . THR A 1 321 ? 40.898 2.881   -10.860 1.00 12.87 ? 318 THR A C     1 
ATOM   2499 O  O     . THR A 1 321 ? 41.977 3.174   -10.331 1.00 20.42 ? 318 THR A O     1 
ATOM   2500 C  CB    . THR A 1 321 ? 39.724 0.686   -10.487 1.00 24.43 ? 318 THR A CB    1 
ATOM   2501 O  OG1   . THR A 1 321 ? 40.389 0.435   -9.242  1.00 19.72 ? 318 THR A OG1   1 
ATOM   2502 C  CG2   . THR A 1 321 ? 39.298 -0.634  -11.106 1.00 19.08 ? 318 THR A CG2   1 
ATOM   2503 N  N     . ILE A 1 322 ? 39.902 3.737   -10.978 1.00 11.37 ? 319 ILE A N     1 
ATOM   2504 C  CA    . ILE A 1 322 ? 39.954 5.064   -10.377 1.00 13.47 ? 319 ILE A CA    1 
ATOM   2505 C  C     . ILE A 1 322 ? 38.616 5.262   -9.674  1.00 15.52 ? 319 ILE A C     1 
ATOM   2506 O  O     . ILE A 1 322 ? 37.569 5.228   -10.314 1.00 11.28 ? 319 ILE A O     1 
ATOM   2507 C  CB    . ILE A 1 322 ? 40.140 6.147   -11.443 1.00 10.37 ? 319 ILE A CB    1 
ATOM   2508 C  CG1   . ILE A 1 322 ? 41.429 5.891   -12.230 1.00 18.60 ? 319 ILE A CG1   1 
ATOM   2509 C  CG2   . ILE A 1 322 ? 40.142 7.562   -10.812 1.00 14.10 ? 319 ILE A CG2   1 
ATOM   2510 C  CD1   . ILE A 1 322 ? 41.784 7.003   -13.196 1.00 17.32 ? 319 ILE A CD1   1 
ATOM   2511 N  N     . GLY A 1 323 ? 38.646 5.447   -8.361  1.00 13.75 ? 320 GLY A N     1 
ATOM   2512 C  CA    . GLY A 1 323 ? 37.409 5.495   -7.600  1.00 15.69 ? 320 GLY A CA    1 
ATOM   2513 C  C     . GLY A 1 323 ? 37.357 6.632   -6.601  1.00 15.45 ? 320 GLY A C     1 
ATOM   2514 O  O     . GLY A 1 323 ? 38.391 7.149   -6.180  1.00 15.22 ? 320 GLY A O     1 
ATOM   2515 N  N     . CYS A 1 324 ? 36.138 7.000   -6.218  1.00 14.00 ? 321 CYS A N     1 
ATOM   2516 C  CA    . CYS A 1 324 ? 35.881 8.071   -5.259  1.00 10.80 ? 321 CYS A CA    1 
ATOM   2517 C  C     . CYS A 1 324 ? 34.822 7.535   -4.311  1.00 14.22 ? 321 CYS A C     1 
ATOM   2518 O  O     . CYS A 1 324 ? 33.799 7.027   -4.761  1.00 12.30 ? 321 CYS A O     1 
ATOM   2519 C  CB    . CYS A 1 324 ? 35.298 9.296   -5.973  0.99 21.89 ? 321 CYS A CB    1 
ATOM   2520 S  SG    . CYS A 1 324 ? 36.335 10.041  -7.221  0.83 23.44 ? 321 CYS A SG    1 
ATOM   2521 N  N     . SER A 1 325 ? 35.054 7.642   -3.010  1.00 12.01 ? 322 SER A N     1 
ATOM   2522 C  CA    A SER A 1 325 ? 34.087 7.135   -2.045  0.65 15.84 ? 322 SER A CA    1 
ATOM   2523 C  CA    B SER A 1 325 ? 34.140 7.090   -2.018  0.35 15.84 ? 322 SER A CA    1 
ATOM   2524 C  C     . SER A 1 325 ? 33.998 8.026   -0.819  1.00 12.65 ? 322 SER A C     1 
ATOM   2525 O  O     . SER A 1 325 ? 34.960 8.697   -0.439  1.00 15.41 ? 322 SER A O     1 
ATOM   2526 C  CB    A SER A 1 325 ? 34.430 5.708   -1.613  0.65 16.25 ? 322 SER A CB    1 
ATOM   2527 C  CB    B SER A 1 325 ? 34.650 5.717   -1.564  0.35 16.39 ? 322 SER A CB    1 
ATOM   2528 O  OG    A SER A 1 325 ? 35.478 5.712   -0.663  0.65 16.05 ? 322 SER A OG    1 
ATOM   2529 O  OG    B SER A 1 325 ? 34.087 5.321   -0.328  0.35 16.28 ? 322 SER A OG    1 
ATOM   2530 N  N     . LYS A 1 326 ? 32.815 8.049   -0.217  1.00 13.47 ? 323 LYS A N     1 
ATOM   2531 C  CA    . LYS A 1 326 ? 32.602 8.821   0.999   1.00 18.60 ? 323 LYS A CA    1 
ATOM   2532 C  C     . LYS A 1 326 ? 31.643 8.100   1.929   1.00 14.72 ? 323 LYS A C     1 
ATOM   2533 O  O     . LYS A 1 326 ? 30.567 7.667   1.507   1.00 9.82  ? 323 LYS A O     1 
ATOM   2534 C  CB    . LYS A 1 326 ? 32.078 10.233  0.701   1.00 12.18 ? 323 LYS A CB    1 
ATOM   2535 C  CG    . LYS A 1 326 ? 31.875 11.041  1.987   1.00 16.76 ? 323 LYS A CG    1 
ATOM   2536 C  CD    . LYS A 1 326 ? 31.755 12.533  1.750   1.00 19.68 ? 323 LYS A CD    1 
ATOM   2537 C  CE    . LYS A 1 326 ? 31.621 13.287  3.074   1.00 14.92 ? 323 LYS A CE    1 
ATOM   2538 N  NZ    . LYS A 1 326 ? 32.748 12.993  3.977   1.00 29.19 ? 323 LYS A NZ    1 
ATOM   2539 N  N     . ASN A 1 327 ? 32.061 7.950   3.185   1.00 17.02 ? 324 ASN A N     1 
ATOM   2540 C  CA    . ASN A 1 327 ? 31.198 7.468   4.254   1.00 21.99 ? 324 ASN A CA    1 
ATOM   2541 C  C     . ASN A 1 327 ? 30.375 8.588   4.860   1.00 13.45 ? 324 ASN A C     1 
ATOM   2542 O  O     . ASN A 1 327 ? 30.827 9.730   4.929   1.00 9.67  ? 324 ASN A O     1 
ATOM   2543 C  CB    . ASN A 1 327 ? 32.010 6.819   5.368   1.00 17.31 ? 324 ASN A CB    1 
ATOM   2544 C  CG    . ASN A 1 327 ? 32.560 5.476   4.979   1.00 20.83 ? 324 ASN A CG    1 
ATOM   2545 O  OD1   . ASN A 1 327 ? 32.249 4.941   3.917   1.00 22.12 ? 324 ASN A OD1   1 
ATOM   2546 N  ND2   . ASN A 1 327 ? 33.378 4.908   5.852   1.00 20.40 ? 324 ASN A ND2   1 
ATOM   2547 N  N     . PHE A 1 328 ? 29.167 8.242   5.303   1.00 16.65 ? 325 PHE A N     1 
ATOM   2548 C  CA    . PHE A 1 328 ? 28.242 9.183   5.926   1.00 21.11 ? 325 PHE A CA    1 
ATOM   2549 C  C     . PHE A 1 328 ? 27.766 8.554   7.222   1.00 23.39 ? 325 PHE A C     1 
ATOM   2550 O  O     . PHE A 1 328 ? 26.676 7.993   7.279   1.00 25.82 ? 325 PHE A O     1 
ATOM   2551 C  CB    . PHE A 1 328 ? 27.064 9.478   4.996   1.00 22.41 ? 325 PHE A CB    1 
ATOM   2552 C  CG    . PHE A 1 328 ? 27.479 10.054  3.678   1.00 21.07 ? 325 PHE A CG    1 
ATOM   2553 C  CD1   . PHE A 1 328 ? 27.637 9.235   2.569   1.00 14.52 ? 325 PHE A CD1   1 
ATOM   2554 C  CD2   . PHE A 1 328 ? 27.750 11.408  3.555   1.00 14.56 ? 325 PHE A CD2   1 
ATOM   2555 C  CE1   . PHE A 1 328 ? 28.032 9.763   1.368   1.00 11.53 ? 325 PHE A CE1   1 
ATOM   2556 C  CE2   . PHE A 1 328 ? 28.152 11.941  2.351   1.00 15.01 ? 325 PHE A CE2   1 
ATOM   2557 C  CZ    . PHE A 1 328 ? 28.304 11.109  1.253   1.00 10.51 ? 325 PHE A CZ    1 
ATOM   2558 N  N     . PRO A 1 329 ? 28.605 8.635   8.264   1.00 28.10 ? 326 PRO A N     1 
ATOM   2559 C  CA    . PRO A 1 329 ? 28.453 7.856   9.497   1.00 35.77 ? 326 PRO A CA    1 
ATOM   2560 C  C     . PRO A 1 329 ? 27.422 8.407   10.470  1.00 33.00 ? 326 PRO A C     1 
ATOM   2561 O  O     . PRO A 1 329 ? 27.081 9.589   10.432  1.00 26.37 ? 326 PRO A O     1 
ATOM   2562 C  CB    . PRO A 1 329 ? 29.845 7.938   10.124  1.00 39.81 ? 326 PRO A CB    1 
ATOM   2563 C  CG    . PRO A 1 329 ? 30.362 9.255   9.673   1.00 35.49 ? 326 PRO A CG    1 
ATOM   2564 C  CD    . PRO A 1 329 ? 29.848 9.427   8.267   1.00 29.42 ? 326 PRO A CD    1 
ATOM   2565 N  N     . GLY A 1 330 ? 26.942 7.523   11.341  1.00 44.15 ? 327 GLY A N     1 
ATOM   2566 C  CA    . GLY A 1 330 ? 26.003 7.877   12.386  1.00 43.27 ? 327 GLY A CA    1 
ATOM   2567 C  C     . GLY A 1 330 ? 24.878 8.775   11.917  1.00 34.21 ? 327 GLY A C     1 
ATOM   2568 O  O     . GLY A 1 330 ? 24.046 8.385   11.101  1.00 29.87 ? 327 GLY A O     1 
ATOM   2569 N  N     . LYS A 1 331 ? 24.870 9.997   12.432  1.00 26.47 ? 328 LYS A N     1 
ATOM   2570 C  CA    . LYS A 1 331 ? 23.765 10.906  12.215  1.00 35.53 ? 328 LYS A CA    1 
ATOM   2571 C  C     . LYS A 1 331 ? 23.800 11.559  10.836  1.00 29.85 ? 328 LYS A C     1 
ATOM   2572 O  O     . LYS A 1 331 ? 22.777 12.048  10.366  1.00 33.50 ? 328 LYS A O     1 
ATOM   2573 C  CB    . LYS A 1 331 ? 23.747 11.969  13.320  1.00 38.16 ? 328 LYS A CB    1 
ATOM   2574 C  CG    . LYS A 1 331 ? 22.405 12.646  13.527  1.00 59.30 ? 328 LYS A CG    1 
ATOM   2575 C  CD    . LYS A 1 331 ? 22.434 13.560  14.749  1.00 68.28 ? 328 LYS A CD    1 
ATOM   2576 C  CE    . LYS A 1 331 ? 21.242 14.509  14.770  1.00 56.78 ? 328 LYS A CE    1 
ATOM   2577 N  NZ    . LYS A 1 331 ? 21.255 15.423  13.592  1.00 46.63 ? 328 LYS A NZ    1 
ATOM   2578 N  N     . THR A 1 332 ? 24.963 11.574  10.183  1.00 30.14 ? 329 THR A N     1 
ATOM   2579 C  CA    . THR A 1 332 ? 25.079 12.260  8.887   1.00 28.38 ? 329 THR A CA    1 
ATOM   2580 C  C     . THR A 1 332 ? 24.527 11.449  7.705   1.00 20.98 ? 329 THR A C     1 
ATOM   2581 O  O     . THR A 1 332 ? 24.575 11.910  6.566   1.00 22.83 ? 329 THR A O     1 
ATOM   2582 C  CB    . THR A 1 332 ? 26.531 12.707  8.554   1.00 26.44 ? 329 THR A CB    1 
ATOM   2583 O  OG1   . THR A 1 332 ? 27.353 11.560  8.307   1.00 22.15 ? 329 THR A OG1   1 
ATOM   2584 C  CG2   . THR A 1 332 ? 27.126 13.536  9.691   1.00 16.93 ? 329 THR A CG2   1 
ATOM   2585 N  N     . ALA A 1 333 ? 24.008 10.255  7.976   1.00 21.03 ? 330 ALA A N     1 
ATOM   2586 C  CA    . ALA A 1 333 ? 23.514 9.376   6.910   1.00 23.50 ? 330 ALA A CA    1 
ATOM   2587 C  C     . ALA A 1 333 ? 22.478 10.058  6.021   1.00 27.33 ? 330 ALA A C     1 
ATOM   2588 O  O     . ALA A 1 333 ? 21.589 10.750  6.513   1.00 26.99 ? 330 ALA A O     1 
ATOM   2589 C  CB    . ALA A 1 333 ? 22.964 8.079   7.499   1.00 31.69 ? 330 ALA A CB    1 
ATOM   2590 N  N     . LEU A 1 334 ? 22.592 9.854   4.710   1.00 28.25 ? 331 LEU A N     1 
ATOM   2591 C  CA    . LEU A 1 334 ? 21.762 10.563  3.732   1.00 27.70 ? 331 LEU A CA    1 
ATOM   2592 C  C     . LEU A 1 334 ? 20.321 10.032  3.688   1.00 33.22 ? 331 LEU A C     1 
ATOM   2593 O  O     . LEU A 1 334 ? 20.092 8.865   3.376   1.00 29.76 ? 331 LEU A O     1 
ATOM   2594 C  CB    . LEU A 1 334 ? 22.389 10.464  2.339   1.00 24.82 ? 331 LEU A CB    1 
ATOM   2595 C  CG    . LEU A 1 334 ? 23.899 10.689  2.241   1.00 26.10 ? 331 LEU A CG    1 
ATOM   2596 C  CD1   . LEU A 1 334 ? 24.314 10.735  0.773   1.00 18.20 ? 331 LEU A CD1   1 
ATOM   2597 C  CD2   . LEU A 1 334 ? 24.321 11.966  2.982   1.00 17.74 ? 331 LEU A CD2   1 
ATOM   2598 N  N     . ALA A 1 335 ? 19.354 10.899  3.978   1.00 33.81 ? 332 ALA A N     1 
ATOM   2599 C  CA    . ALA A 1 335 ? 17.970 10.453  4.158   1.00 33.49 ? 332 ALA A CA    1 
ATOM   2600 C  C     . ALA A 1 335 ? 16.974 11.122  3.216   1.00 38.26 ? 332 ALA A C     1 
ATOM   2601 O  O     . ALA A 1 335 ? 15.765 10.926  3.346   1.00 39.86 ? 332 ALA A O     1 
ATOM   2602 C  CB    . ALA A 1 335 ? 17.540 10.644  5.606   1.00 29.23 ? 332 ALA A CB    1 
ATOM   2603 N  N     . THR A 1 336 ? 17.481 11.913  2.278   1.00 29.88 ? 333 THR A N     1 
ATOM   2604 C  CA    . THR A 1 336 ? 16.636 12.557  1.287   1.00 31.42 ? 333 THR A CA    1 
ATOM   2605 C  C     . THR A 1 336 ? 17.213 12.370  -0.110  1.00 47.06 ? 333 THR A C     1 
ATOM   2606 O  O     . THR A 1 336 ? 18.422 12.198  -0.277  1.00 33.39 ? 333 THR A O     1 
ATOM   2607 C  CB    . THR A 1 336 ? 16.492 14.058  1.554   1.00 33.47 ? 333 THR A CB    1 
ATOM   2608 O  OG1   . THR A 1 336 ? 17.668 14.740  1.100   1.00 33.17 ? 333 THR A OG1   1 
ATOM   2609 C  CG2   . THR A 1 336 ? 16.273 14.323  3.043   1.00 36.69 ? 333 THR A CG2   1 
ATOM   2610 N  N     . ARG A 1 337 ? 16.341 12.414  -1.110  1.00 48.53 ? 334 ARG A N     1 
ATOM   2611 C  CA    . ARG A 1 337 ? 16.743 12.186  -2.490  1.00 43.96 ? 334 ARG A CA    1 
ATOM   2612 C  C     . ARG A 1 337 ? 17.667 13.297  -2.963  1.00 40.40 ? 334 ARG A C     1 
ATOM   2613 O  O     . ARG A 1 337 ? 18.632 13.049  -3.681  1.00 37.14 ? 334 ARG A O     1 
ATOM   2614 C  CB    . ARG A 1 337 ? 15.512 12.090  -3.394  1.00 47.19 ? 334 ARG A CB    1 
ATOM   2615 C  CG    . ARG A 1 337 ? 15.828 11.852  -4.859  1.00 55.28 ? 334 ARG A CG    1 
ATOM   2616 C  CD    . ARG A 1 337 ? 14.556 11.728  -5.695  1.00 59.57 ? 334 ARG A CD    1 
ATOM   2617 N  NE    . ARG A 1 337 ? 13.601 12.799  -5.411  1.00 76.96 ? 334 ARG A NE    1 
ATOM   2618 C  CZ    . ARG A 1 337 ? 13.742 14.059  -5.814  1.00 72.76 ? 334 ARG A CZ    1 
ATOM   2619 N  NH1   . ARG A 1 337 ? 14.808 14.421  -6.517  1.00 68.22 ? 334 ARG A NH1   1 
ATOM   2620 N  NH2   . ARG A 1 337 ? 12.820 14.962  -5.507  1.00 65.04 ? 334 ARG A NH2   1 
ATOM   2621 N  N     . GLU A 1 338 ? 17.368 14.523  -2.553  1.00 39.73 ? 335 GLU A N     1 
ATOM   2622 C  CA    . GLU A 1 338 ? 18.211 15.662  -2.886  1.00 33.71 ? 335 GLU A CA    1 
ATOM   2623 C  C     . GLU A 1 338 ? 19.625 15.475  -2.334  1.00 41.23 ? 335 GLU A C     1 
ATOM   2624 O  O     . GLU A 1 338 ? 20.611 15.828  -2.983  1.00 29.12 ? 335 GLU A O     1 
ATOM   2625 C  CB    . GLU A 1 338 ? 17.606 16.954  -2.336  1.00 36.40 ? 335 GLU A CB    1 
ATOM   2626 C  CG    . GLU A 1 338 ? 16.379 17.446  -3.094  1.00 56.14 ? 335 GLU A CG    1 
ATOM   2627 C  CD    . GLU A 1 338 ? 16.705 17.892  -4.511  1.00 65.95 ? 335 GLU A CD    1 
ATOM   2628 O  OE1   . GLU A 1 338 ? 17.893 17.836  -4.895  1.00 63.02 ? 335 GLU A OE1   1 
ATOM   2629 O  OE2   . GLU A 1 338 ? 15.774 18.300  -5.240  1.00 59.01 ? 335 GLU A OE2   1 
ATOM   2630 N  N     . GLN A 1 339 ? 19.718 14.924  -1.128  1.00 34.15 ? 336 GLN A N     1 
ATOM   2631 C  CA    . GLN A 1 339 ? 21.012 14.684  -0.507  1.00 35.64 ? 336 GLN A CA    1 
ATOM   2632 C  C     . GLN A 1 339 ? 21.837 13.700  -1.331  1.00 25.75 ? 336 GLN A C     1 
ATOM   2633 O  O     . GLN A 1 339 ? 22.958 14.008  -1.743  1.00 25.56 ? 336 GLN A O     1 
ATOM   2634 C  CB    . GLN A 1 339 ? 20.830 14.140  0.904   1.00 23.54 ? 336 GLN A CB    1 
ATOM   2635 C  CG    . GLN A 1 339 ? 20.890 15.186  1.986   1.00 31.32 ? 336 GLN A CG    1 
ATOM   2636 C  CD    . GLN A 1 339 ? 21.139 14.570  3.340   1.00 29.77 ? 336 GLN A CD    1 
ATOM   2637 O  OE1   . GLN A 1 339 ? 20.452 13.629  3.744   1.00 29.19 ? 336 GLN A OE1   1 
ATOM   2638 N  NE2   . GLN A 1 339 ? 22.138 15.084  4.046   1.00 29.72 ? 336 GLN A NE2   1 
ATOM   2639 N  N     . VAL A 1 340 ? 21.267 12.518  -1.553  1.00 27.70 ? 337 VAL A N     1 
ATOM   2640 C  CA    . VAL A 1 340 ? 21.916 11.451  -2.313  1.00 26.78 ? 337 VAL A CA    1 
ATOM   2641 C  C     . VAL A 1 340 ? 22.371 11.950  -3.676  1.00 25.50 ? 337 VAL A C     1 
ATOM   2642 O  O     . VAL A 1 340 ? 23.442 11.586  -4.152  1.00 28.07 ? 337 VAL A O     1 
ATOM   2643 C  CB    . VAL A 1 340 ? 20.973 10.250  -2.510  1.00 27.44 ? 337 VAL A CB    1 
ATOM   2644 C  CG1   . VAL A 1 340 ? 21.609 9.203   -3.419  1.00 14.07 ? 337 VAL A CG1   1 
ATOM   2645 C  CG2   . VAL A 1 340 ? 20.595 9.644   -1.168  1.00 29.25 ? 337 VAL A CG2   1 
ATOM   2646 N  N     . GLN A 1 341 ? 21.555 12.789  -4.298  1.00 23.43 ? 338 GLN A N     1 
ATOM   2647 C  CA    . GLN A 1 341 ? 21.876 13.296  -5.618  1.00 31.17 ? 338 GLN A CA    1 
ATOM   2648 C  C     . GLN A 1 341 ? 23.036 14.268  -5.536  1.00 27.54 ? 338 GLN A C     1 
ATOM   2649 O  O     . GLN A 1 341 ? 23.956 14.210  -6.339  1.00 26.71 ? 338 GLN A O     1 
ATOM   2650 C  CB    . GLN A 1 341 ? 20.657 13.964  -6.267  1.00 32.18 ? 338 GLN A CB    1 
ATOM   2651 C  CG    . GLN A 1 341 ? 19.558 12.983  -6.656  1.00 35.82 ? 338 GLN A CG    1 
ATOM   2652 C  CD    . GLN A 1 341 ? 18.401 13.644  -7.388  1.00 41.54 ? 338 GLN A CD    1 
ATOM   2653 O  OE1   . GLN A 1 341 ? 18.197 14.856  -7.296  1.00 44.14 ? 338 GLN A OE1   1 
ATOM   2654 N  NE2   . GLN A 1 341 ? 17.645 12.846  -8.133  1.00 46.18 ? 338 GLN A NE2   1 
ATOM   2655 N  N     . TRP A 1 342 ? 22.994 15.158  -4.555  1.00 26.90 ? 339 TRP A N     1 
ATOM   2656 C  CA    . TRP A 1 342 ? 24.048 16.149  -4.408  1.00 24.78 ? 339 TRP A CA    1 
ATOM   2657 C  C     . TRP A 1 342 ? 25.425 15.508  -4.165  1.00 16.48 ? 339 TRP A C     1 
ATOM   2658 O  O     . TRP A 1 342 ? 26.416 15.901  -4.772  1.00 20.45 ? 339 TRP A O     1 
ATOM   2659 C  CB    . TRP A 1 342 ? 23.696 17.138  -3.306  1.00 16.96 ? 339 TRP A CB    1 
ATOM   2660 C  CG    . TRP A 1 342 ? 24.658 18.271  -3.221  1.00 20.96 ? 339 TRP A CG    1 
ATOM   2661 C  CD1   . TRP A 1 342 ? 24.662 19.406  -3.975  1.00 23.47 ? 339 TRP A CD1   1 
ATOM   2662 C  CD2   . TRP A 1 342 ? 25.768 18.371  -2.336  1.00 19.25 ? 339 TRP A CD2   1 
ATOM   2663 N  NE1   . TRP A 1 342 ? 25.707 20.212  -3.610  1.00 25.79 ? 339 TRP A NE1   1 
ATOM   2664 C  CE2   . TRP A 1 342 ? 26.407 19.595  -2.605  1.00 23.83 ? 339 TRP A CE2   1 
ATOM   2665 C  CE3   . TRP A 1 342 ? 26.290 17.538  -1.340  1.00 18.40 ? 339 TRP A CE3   1 
ATOM   2666 C  CZ2   . TRP A 1 342 ? 27.534 20.018  -1.909  1.00 23.95 ? 339 TRP A CZ2   1 
ATOM   2667 C  CZ3   . TRP A 1 342 ? 27.408 17.955  -0.654  1.00 23.24 ? 339 TRP A CZ3   1 
ATOM   2668 C  CH2   . TRP A 1 342 ? 28.022 19.185  -0.943  1.00 25.95 ? 339 TRP A CH2   1 
ATOM   2669 N  N     . TRP A 1 343 ? 25.476 14.503  -3.300  1.00 16.19 ? 340 TRP A N     1 
ATOM   2670 C  CA    . TRP A 1 343 ? 26.734 13.823  -3.028  1.00 16.19 ? 340 TRP A CA    1 
ATOM   2671 C  C     . TRP A 1 343 ? 27.182 12.956  -4.205  1.00 17.04 ? 340 TRP A C     1 
ATOM   2672 O  O     . TRP A 1 343 ? 28.370 12.817  -4.448  1.00 16.21 ? 340 TRP A O     1 
ATOM   2673 C  CB    . TRP A 1 343 ? 26.642 12.996  -1.747  1.00 12.49 ? 340 TRP A CB    1 
ATOM   2674 C  CG    . TRP A 1 343 ? 26.781 13.844  -0.497  1.00 16.87 ? 340 TRP A CG    1 
ATOM   2675 C  CD1   . TRP A 1 343 ? 25.806 14.136  0.400   1.00 23.09 ? 340 TRP A CD1   1 
ATOM   2676 C  CD2   . TRP A 1 343 ? 27.966 14.515  -0.036  1.00 16.14 ? 340 TRP A CD2   1 
ATOM   2677 N  NE1   . TRP A 1 343 ? 26.303 14.939  1.403   1.00 18.25 ? 340 TRP A NE1   1 
ATOM   2678 C  CE2   . TRP A 1 343 ? 27.628 15.184  1.159   1.00 23.95 ? 340 TRP A CE2   1 
ATOM   2679 C  CE3   . TRP A 1 343 ? 29.277 14.600  -0.508  1.00 13.30 ? 340 TRP A CE3   1 
ATOM   2680 C  CZ2   . TRP A 1 343 ? 28.550 15.933  1.884   1.00 19.92 ? 340 TRP A CZ2   1 
ATOM   2681 C  CZ3   . TRP A 1 343 ? 30.191 15.346  0.209   1.00 17.38 ? 340 TRP A CZ3   1 
ATOM   2682 C  CH2   . TRP A 1 343 ? 29.824 16.005  1.395   1.00 27.79 ? 340 TRP A CH2   1 
ATOM   2683 N  N     . LEU A 1 344 ? 26.242 12.371  -4.941  1.00 16.11 ? 341 LEU A N     1 
ATOM   2684 C  CA    . LEU A 1 344 ? 26.648 11.604  -6.116  1.00 19.57 ? 341 LEU A CA    1 
ATOM   2685 C  C     . LEU A 1 344 ? 27.333 12.563  -7.070  1.00 12.82 ? 341 LEU A C     1 
ATOM   2686 O  O     . LEU A 1 344 ? 28.361 12.230  -7.666  1.00 11.40 ? 341 LEU A O     1 
ATOM   2687 C  CB    . LEU A 1 344 ? 25.469 10.903  -6.797  1.00 14.96 ? 341 LEU A CB    1 
ATOM   2688 C  CG    . LEU A 1 344 ? 24.883 9.663   -6.113  1.00 23.88 ? 341 LEU A CG    1 
ATOM   2689 C  CD1   . LEU A 1 344 ? 23.623 9.205   -6.829  1.00 24.76 ? 341 LEU A CD1   1 
ATOM   2690 C  CD2   . LEU A 1 344 ? 25.890 8.523   -6.022  1.00 15.63 ? 341 LEU A CD2   1 
ATOM   2691 N  N     . LEU A 1 345 ? 26.794 13.776  -7.171  1.00 15.18 ? 342 LEU A N     1 
ATOM   2692 C  CA    . LEU A 1 345 ? 27.389 14.790  -8.034  1.00 17.40 ? 342 LEU A CA    1 
ATOM   2693 C  C     . LEU A 1 345 ? 28.803 15.189  -7.598  1.00 17.51 ? 342 LEU A C     1 
ATOM   2694 O  O     . LEU A 1 345 ? 29.703 15.319  -8.437  1.00 17.34 ? 342 LEU A O     1 
ATOM   2695 C  CB    . LEU A 1 345 ? 26.497 16.028  -8.120  1.00 19.92 ? 342 LEU A CB    1 
ATOM   2696 C  CG    . LEU A 1 345 ? 27.002 17.140  -9.039  1.00 21.52 ? 342 LEU A CG    1 
ATOM   2697 C  CD1   . LEU A 1 345 ? 27.320 16.589  -10.437 1.00 23.13 ? 342 LEU A CD1   1 
ATOM   2698 C  CD2   . LEU A 1 345 ? 25.986 18.289  -9.126  1.00 19.64 ? 342 LEU A CD2   1 
ATOM   2699 N  N     . GLN A 1 346 ? 28.998 15.391  -6.297  1.00 15.48 ? 343 GLN A N     1 
ATOM   2700 C  CA    . GLN A 1 346 ? 30.319 15.750  -5.780  1.00 16.32 ? 343 GLN A CA    1 
ATOM   2701 C  C     . GLN A 1 346 ? 31.341 14.667  -6.130  1.00 17.55 ? 343 GLN A C     1 
ATOM   2702 O  O     . GLN A 1 346 ? 32.428 14.960  -6.620  1.00 13.26 ? 343 GLN A O     1 
ATOM   2703 C  CB    . GLN A 1 346 ? 30.292 15.943  -4.255  1.00 18.57 ? 343 GLN A CB    1 
ATOM   2704 C  CG    . GLN A 1 346 ? 29.273 16.960  -3.765  1.00 17.39 ? 343 GLN A CG    1 
ATOM   2705 C  CD    . GLN A 1 346 ? 29.224 18.205  -4.626  1.00 15.75 ? 343 GLN A CD    1 
ATOM   2706 O  OE1   . GLN A 1 346 ? 30.209 18.936  -4.754  1.00 25.89 ? 343 GLN A OE1   1 
ATOM   2707 N  NE2   . GLN A 1 346 ? 28.070 18.447  -5.235  1.00 17.72 ? 343 GLN A NE2   1 
ATOM   2708 N  N     . LEU A 1 347 ? 30.980 13.419  -5.847  1.00 18.25 ? 344 LEU A N     1 
ATOM   2709 C  CA    . LEU A 1 347 ? 31.840 12.281  -6.135  1.00 23.05 ? 344 LEU A CA    1 
ATOM   2710 C  C     . LEU A 1 347 ? 32.132 12.187  -7.619  1.00 19.01 ? 344 LEU A C     1 
ATOM   2711 O  O     . LEU A 1 347 ? 33.276 11.944  -8.017  1.00 11.04 ? 344 LEU A O     1 
ATOM   2712 C  CB    . LEU A 1 347 ? 31.198 10.982  -5.653  1.00 16.63 ? 344 LEU A CB    1 
ATOM   2713 C  CG    . LEU A 1 347 ? 31.370 10.684  -4.164  1.00 15.90 ? 344 LEU A CG    1 
ATOM   2714 C  CD1   . LEU A 1 347 ? 30.606 9.415   -3.805  1.00 17.48 ? 344 LEU A CD1   1 
ATOM   2715 C  CD2   . LEU A 1 347 ? 32.824 10.516  -3.849  1.00 19.54 ? 344 LEU A CD2   1 
ATOM   2716 N  N     . ALA A 1 348 ? 31.088 12.369  -8.422  1.00 15.89 ? 345 ALA A N     1 
ATOM   2717 C  CA    . ALA A 1 348 ? 31.182 12.258  -9.874  1.00 18.82 ? 345 ALA A CA    1 
ATOM   2718 C  C     . ALA A 1 348 ? 32.062 13.354  -10.438 1.00 12.40 ? 345 ALA A C     1 
ATOM   2719 O  O     . ALA A 1 348 ? 32.816 13.131  -11.391 1.00 12.68 ? 345 ALA A O     1 
ATOM   2720 C  CB    . ALA A 1 348 ? 29.788 12.308  -10.513 1.00 15.78 ? 345 ALA A CB    1 
ATOM   2721 N  N     . GLN A 1 349 ? 31.966 14.538  -9.841  1.00 15.89 ? 346 GLN A N     1 
ATOM   2722 C  CA    . GLN A 1 349 ? 32.820 15.657  -10.202 1.00 11.84 ? 346 GLN A CA    1 
ATOM   2723 C  C     . GLN A 1 349 ? 34.302 15.413  -9.899  1.00 16.19 ? 346 GLN A C     1 
ATOM   2724 O  O     . GLN A 1 349 ? 35.161 15.779  -10.699 1.00 10.94 ? 346 GLN A O     1 
ATOM   2725 C  CB    . GLN A 1 349 ? 32.327 16.961  -9.549  1.00 15.54 ? 346 GLN A CB    1 
ATOM   2726 C  CG    . GLN A 1 349 ? 31.020 17.484  -10.165 1.00 19.97 ? 346 GLN A CG    1 
ATOM   2727 C  CD    . GLN A 1 349 ? 30.572 18.827  -9.600  1.00 31.89 ? 346 GLN A CD    1 
ATOM   2728 O  OE1   . GLN A 1 349 ? 31.060 19.278  -8.567  1.00 24.84 ? 346 GLN A OE1   1 
ATOM   2729 N  NE2   . GLN A 1 349 ? 29.629 19.468  -10.283 1.00 27.37 ? 346 GLN A NE2   1 
ATOM   2730 N  N     . GLU A 1 350 ? 34.619 14.808  -8.757  1.00 12.78 ? 347 GLU A N     1 
ATOM   2731 C  CA    . GLU A 1 350 ? 36.022 14.483  -8.509  1.00 11.97 ? 347 GLU A CA    1 
ATOM   2732 C  C     . GLU A 1 350 ? 36.483 13.419  -9.501  1.00 12.51 ? 347 GLU A C     1 
ATOM   2733 O  O     . GLU A 1 350 ? 37.611 13.461  -9.977  1.00 12.79 ? 347 GLU A O     1 
ATOM   2734 C  CB    . GLU A 1 350 ? 36.285 13.980  -7.088  1.00 11.88 ? 347 GLU A CB    1 
ATOM   2735 C  CG    . GLU A 1 350 ? 37.751 13.565  -6.897  1.00 15.20 ? 347 GLU A CG    1 
ATOM   2736 C  CD    . GLU A 1 350 ? 38.085 13.055  -5.490  1.00 21.28 ? 347 GLU A CD    1 
ATOM   2737 O  OE1   . GLU A 1 350 ? 37.437 13.470  -4.503  1.00 18.04 ? 347 GLU A OE1   1 
ATOM   2738 O  OE2   . GLU A 1 350 ? 39.003 12.225  -5.379  1.00 19.32 ? 347 GLU A OE2   1 
ATOM   2739 N  N     . LEU A 1 351 ? 35.607 12.464  -9.789  1.00 12.58 ? 348 LEU A N     1 
ATOM   2740 C  CA    . LEU A 1 351 ? 35.944 11.344  -10.672 1.00 12.25 ? 348 LEU A CA    1 
ATOM   2741 C  C     . LEU A 1 351 ? 36.192 11.832  -12.100 1.00 17.56 ? 348 LEU A C     1 
ATOM   2742 O  O     . LEU A 1 351 ? 37.140 11.403  -12.763 1.00 12.53 ? 348 LEU A O     1 
ATOM   2743 C  CB    . LEU A 1 351 ? 34.835 10.291  -10.653 1.00 11.77 ? 348 LEU A CB    1 
ATOM   2744 C  CG    . LEU A 1 351 ? 35.075 8.953   -11.382 1.00 16.56 ? 348 LEU A CG    1 
ATOM   2745 C  CD1   . LEU A 1 351 ? 36.353 8.277   -10.879 1.00 13.36 ? 348 LEU A CD1   1 
ATOM   2746 C  CD2   . LEU A 1 351 ? 33.891 8.002   -11.208 1.00 16.71 ? 348 LEU A CD2   1 
ATOM   2747 N  N     . GLU A 1 352 ? 35.345 12.739  -12.572 1.00 13.80 ? 349 GLU A N     1 
ATOM   2748 C  CA    . GLU A 1 352 ? 35.529 13.297  -13.906 1.00 13.04 ? 349 GLU A CA    1 
ATOM   2749 C  C     . GLU A 1 352 ? 36.891 13.960  -14.028 1.00 10.68 ? 349 GLU A C     1 
ATOM   2750 O  O     . GLU A 1 352 ? 37.598 13.808  -15.030 1.00 13.80 ? 349 GLU A O     1 
ATOM   2751 C  CB    . GLU A 1 352 ? 34.427 14.313  -14.241 1.00 14.26 ? 349 GLU A CB    1 
ATOM   2752 C  CG    . GLU A 1 352 ? 34.564 14.853  -15.651 1.00 24.69 ? 349 GLU A CG    1 
ATOM   2753 C  CD    . GLU A 1 352 ? 33.602 15.982  -15.961 1.00 39.87 ? 349 GLU A CD    1 
ATOM   2754 O  OE1   . GLU A 1 352 ? 33.936 16.815  -16.832 1.00 43.84 ? 349 GLU A OE1   1 
ATOM   2755 O  OE2   . GLU A 1 352 ? 32.511 16.033  -15.351 1.00 34.24 ? 349 GLU A OE2   1 
ATOM   2756 N  N     . GLU A 1 353 ? 37.263 14.696  -12.992 1.00 11.91 ? 350 GLU A N     1 
ATOM   2757 C  CA    . GLU A 1 353 ? 38.525 15.416  -12.978 1.00 16.20 ? 350 GLU A CA    1 
ATOM   2758 C  C     . GLU A 1 353 ? 39.701 14.444  -13.082 1.00 12.36 ? 350 GLU A C     1 
ATOM   2759 O  O     . GLU A 1 353 ? 40.632 14.649  -13.860 1.00 17.97 ? 350 GLU A O     1 
ATOM   2760 C  CB    . GLU A 1 353 ? 38.616 16.217  -11.678 1.00 22.63 ? 350 GLU A CB    1 
ATOM   2761 C  CG    . GLU A 1 353 ? 39.785 17.165  -11.571 1.00 29.40 ? 350 GLU A CG    1 
ATOM   2762 C  CD    . GLU A 1 353 ? 39.652 18.080  -10.364 1.00 42.81 ? 350 GLU A CD    1 
ATOM   2763 O  OE1   . GLU A 1 353 ? 39.734 17.574  -9.224  1.00 50.95 ? 350 GLU A OE1   1 
ATOM   2764 O  OE2   . GLU A 1 353 ? 39.440 19.297  -10.556 1.00 44.86 ? 350 GLU A OE2   1 
ATOM   2765 N  N     . ARG A 1 354 ? 39.649 13.382  -12.293 1.00 12.49 ? 351 ARG A N     1 
ATOM   2766 C  CA    . ARG A 1 354 ? 40.729 12.396  -12.276 1.00 15.60 ? 351 ARG A CA    1 
ATOM   2767 C  C     . ARG A 1 354 ? 40.744 11.555  -13.546 1.00 12.12 ? 351 ARG A C     1 
ATOM   2768 O  O     . ARG A 1 354 ? 41.805 11.178  -14.025 1.00 13.01 ? 351 ARG A O     1 
ATOM   2769 C  CB    . ARG A 1 354 ? 40.630 11.522  -11.032 1.00 12.52 ? 351 ARG A CB    1 
ATOM   2770 C  CG    . ARG A 1 354 ? 41.014 12.269  -9.764  1.00 12.51 ? 351 ARG A CG    1 
ATOM   2771 C  CD    . ARG A 1 354 ? 40.553 11.533  -8.517  1.00 25.04 ? 351 ARG A CD    1 
ATOM   2772 N  NE    . ARG A 1 354 ? 41.071 10.175  -8.435  1.00 16.94 ? 351 ARG A NE    1 
ATOM   2773 C  CZ    . ARG A 1 354 ? 40.620 9.270   -7.569  1.00 23.54 ? 351 ARG A CZ    1 
ATOM   2774 N  NH1   . ARG A 1 354 ? 39.641 9.589   -6.715  1.00 18.12 ? 351 ARG A NH1   1 
ATOM   2775 N  NH2   . ARG A 1 354 ? 41.141 8.051   -7.556  1.00 9.66  ? 351 ARG A NH2   1 
ATOM   2776 N  N     . LEU A 1 355 ? 39.570 11.280  -14.107 1.00 14.55 ? 352 LEU A N     1 
ATOM   2777 C  CA    . LEU A 1 355 ? 39.510 10.532  -15.359 1.00 13.93 ? 352 LEU A CA    1 
ATOM   2778 C  C     . LEU A 1 355 ? 40.083 11.308  -16.544 1.00 17.40 ? 352 LEU A C     1 
ATOM   2779 O  O     . LEU A 1 355 ? 40.757 10.736  -17.405 1.00 13.79 ? 352 LEU A O     1 
ATOM   2780 C  CB    . LEU A 1 355 ? 38.079 10.102  -15.679 1.00 11.13 ? 352 LEU A CB    1 
ATOM   2781 C  CG    . LEU A 1 355 ? 37.495 8.935   -14.891 1.00 14.52 ? 352 LEU A CG    1 
ATOM   2782 C  CD1   . LEU A 1 355 ? 36.015 8.796   -15.197 1.00 15.49 ? 352 LEU A CD1   1 
ATOM   2783 C  CD2   . LEU A 1 355 ? 38.229 7.647   -15.226 1.00 17.96 ? 352 LEU A CD2   1 
ATOM   2784 N  N     . THR A 1 356 ? 39.794 12.602  -16.603 1.00 12.65 ? 353 THR A N     1 
ATOM   2785 C  CA    . THR A 1 356 ? 40.254 13.420  -17.714 1.00 14.52 ? 353 THR A CA    1 
ATOM   2786 C  C     . THR A 1 356 ? 41.773 13.543  -17.698 1.00 18.11 ? 353 THR A C     1 
ATOM   2787 O  O     . THR A 1 356 ? 42.426 13.416  -18.734 1.00 17.17 ? 353 THR A O     1 
ATOM   2788 C  CB    . THR A 1 356 ? 39.583 14.811  -17.693 1.00 20.21 ? 353 THR A CB    1 
ATOM   2789 O  OG1   . THR A 1 356 ? 38.169 14.642  -17.829 1.00 16.63 ? 353 THR A OG1   1 
ATOM   2790 C  CG2   . THR A 1 356 ? 40.078 15.662  -18.832 1.00 15.86 ? 353 THR A CG2   1 
ATOM   2791 N  N     . LYS A 1 357 ? 42.328 13.781  -16.516 1.00 14.29 ? 354 LYS A N     1 
ATOM   2792 C  CA    . LYS A 1 357 ? 43.773 13.799  -16.330 1.00 16.89 ? 354 LYS A CA    1 
ATOM   2793 C  C     . LYS A 1 357 ? 44.375 12.449  -16.709 1.00 15.81 ? 354 LYS A C     1 
ATOM   2794 O  O     . LYS A 1 357 ? 45.421 12.375  -17.358 1.00 12.59 ? 354 LYS A O     1 
ATOM   2795 C  CB    . LYS A 1 357 ? 44.102 14.105  -14.872 1.00 24.79 ? 354 LYS A CB    1 
ATOM   2796 C  CG    . LYS A 1 357 ? 45.587 14.175  -14.564 1.00 27.28 ? 354 LYS A CG    1 
ATOM   2797 C  CD    . LYS A 1 357 ? 46.212 15.406  -15.206 1.00 39.04 ? 354 LYS A CD    1 
ATOM   2798 C  CE    . LYS A 1 357 ? 47.315 16.003  -14.329 1.00 44.73 ? 354 LYS A CE    1 
ATOM   2799 N  NZ    . LYS A 1 357 ? 48.455 15.064  -14.145 1.00 31.16 ? 354 LYS A NZ    1 
ATOM   2800 N  N     . ASP A 1 358 ? 43.704 11.379  -16.304 1.00 14.81 ? 355 ASP A N     1 
ATOM   2801 C  CA    . ASP A 1 358 ? 44.205 10.044  -16.585 1.00 19.54 ? 355 ASP A CA    1 
ATOM   2802 C  C     . ASP A 1 358 ? 44.259 9.795   -18.084 1.00 16.42 ? 355 ASP A C     1 
ATOM   2803 O  O     . ASP A 1 358 ? 45.211 9.196   -18.580 1.00 20.90 ? 355 ASP A O     1 
ATOM   2804 C  CB    . ASP A 1 358 ? 43.356 8.969   -15.898 1.00 11.55 ? 355 ASP A CB    1 
ATOM   2805 C  CG    . ASP A 1 358 ? 43.909 7.570   -16.115 1.00 21.08 ? 355 ASP A CG    1 
ATOM   2806 O  OD1   . ASP A 1 358 ? 44.898 7.205   -15.436 1.00 19.72 ? 355 ASP A OD1   1 
ATOM   2807 O  OD2   . ASP A 1 358 ? 43.364 6.840   -16.968 1.00 18.61 ? 355 ASP A OD2   1 
ATOM   2808 N  N     . ARG A 1 359 ? 43.239 10.251  -18.804 1.00 14.32 ? 356 ARG A N     1 
ATOM   2809 C  CA    . ARG A 1 359 ? 43.185 10.055  -20.245 1.00 16.78 ? 356 ARG A CA    1 
ATOM   2810 C  C     . ARG A 1 359 ? 44.299 10.814  -20.964 1.00 18.61 ? 356 ARG A C     1 
ATOM   2811 O  O     . ARG A 1 359 ? 44.881 10.303  -21.914 1.00 19.53 ? 356 ARG A O     1 
ATOM   2812 C  CB    . ARG A 1 359 ? 41.819 10.466  -20.809 1.00 19.38 ? 356 ARG A CB    1 
ATOM   2813 C  CG    . ARG A 1 359 ? 41.664 10.195  -22.318 1.00 20.85 ? 356 ARG A CG    1 
ATOM   2814 C  CD    . ARG A 1 359 ? 40.281 10.618  -22.835 1.00 23.56 ? 356 ARG A CD    1 
ATOM   2815 N  NE    . ARG A 1 359 ? 40.054 12.056  -22.661 1.00 24.65 ? 356 ARG A NE    1 
ATOM   2816 C  CZ    . ARG A 1 359 ? 38.864 12.605  -22.436 1.00 28.17 ? 356 ARG A CZ    1 
ATOM   2817 N  NH1   . ARG A 1 359 ? 37.782 11.837  -22.357 1.00 32.87 ? 356 ARG A NH1   1 
ATOM   2818 N  NH2   . ARG A 1 359 ? 38.755 13.921  -22.289 1.00 23.31 ? 356 ARG A NH2   1 
ATOM   2819 N  N     . ASN A 1 360 ? 44.589 12.031  -20.508 1.00 18.96 ? 357 ASN A N     1 
ATOM   2820 C  CA    . ASN A 1 360 ? 45.635 12.854  -21.116 1.00 15.80 ? 357 ASN A CA    1 
ATOM   2821 C  C     . ASN A 1 360 ? 47.031 12.306  -20.823 1.00 25.21 ? 357 ASN A C     1 
ATOM   2822 O  O     . ASN A 1 360 ? 47.919 12.322  -21.682 1.00 21.63 ? 357 ASN A O     1 
ATOM   2823 C  CB    . ASN A 1 360 ? 45.549 14.293  -20.602 1.00 27.29 ? 357 ASN A CB    1 
ATOM   2824 C  CG    . ASN A 1 360 ? 44.391 15.063  -21.208 1.00 24.63 ? 357 ASN A CG    1 
ATOM   2825 O  OD1   . ASN A 1 360 ? 43.977 14.802  -22.335 1.00 25.22 ? 357 ASN A OD1   1 
ATOM   2826 N  ND2   . ASN A 1 360 ? 43.871 16.024  -20.463 1.00 21.55 ? 357 ASN A ND2   1 
ATOM   2827 N  N     . ASP A 1 361 ? 47.224 11.830  -19.597 1.00 16.41 ? 358 ASP A N     1 
ATOM   2828 C  CA    . ASP A 1 361 ? 48.529 11.339  -19.173 1.00 19.81 ? 358 ASP A CA    1 
ATOM   2829 C  C     . ASP A 1 361 ? 48.848 9.951   -19.699 1.00 15.13 ? 358 ASP A C     1 
ATOM   2830 O  O     . ASP A 1 361 ? 50.004 9.650   -19.988 1.00 18.64 ? 358 ASP A O     1 
ATOM   2831 C  CB    . ASP A 1 361 ? 48.614 11.287  -17.642 1.00 25.10 ? 358 ASP A CB    1 
ATOM   2832 C  CG    . ASP A 1 361 ? 48.784 12.653  -17.017 1.00 34.34 ? 358 ASP A CG    1 
ATOM   2833 O  OD1   . ASP A 1 361 ? 49.144 13.611  -17.743 1.00 27.49 ? 358 ASP A OD1   1 
ATOM   2834 O  OD2   . ASP A 1 361 ? 48.560 12.754  -15.791 1.00 28.28 ? 358 ASP A OD2   1 
ATOM   2835 N  N     . ASN A 1 362 ? 47.831 9.099   -19.789 1.00 12.93 ? 359 ASN A N     1 
ATOM   2836 C  CA    . ASN A 1 362 ? 48.068 7.657   -19.877 1.00 20.84 ? 359 ASN A CA    1 
ATOM   2837 C  C     . ASN A 1 362 ? 47.475 6.971   -21.114 1.00 19.85 ? 359 ASN A C     1 
ATOM   2838 O  O     . ASN A 1 362 ? 47.585 5.758   -21.263 1.00 15.27 ? 359 ASN A O     1 
ATOM   2839 C  CB    . ASN A 1 362 ? 47.593 6.965   -18.578 1.00 14.25 ? 359 ASN A CB    1 
ATOM   2840 C  CG    . ASN A 1 362 ? 48.358 7.454   -17.332 1.00 17.38 ? 359 ASN A CG    1 
ATOM   2841 O  OD1   . ASN A 1 362 ? 49.577 7.598   -17.356 1.00 19.06 ? 359 ASN A OD1   1 
ATOM   2842 N  ND2   . ASN A 1 362 ? 47.634 7.699   -16.244 1.00 19.58 ? 359 ASN A ND2   1 
ATOM   2843 N  N     . ASP A 1 363 ? 46.850 7.751   -21.991 1.00 17.14 ? 360 ASP A N     1 
ATOM   2844 C  CA    . ASP A 1 363 ? 46.302 7.242   -23.257 1.00 11.03 ? 360 ASP A CA    1 
ATOM   2845 C  C     . ASP A 1 363 ? 45.352 6.072   -23.105 1.00 24.73 ? 360 ASP A C     1 
ATOM   2846 O  O     . ASP A 1 363 ? 45.499 5.038   -23.765 1.00 20.86 ? 360 ASP A O     1 
ATOM   2847 C  CB    . ASP A 1 363 ? 47.422 6.887   -24.239 1.00 24.84 ? 360 ASP A CB    1 
ATOM   2848 C  CG    . ASP A 1 363 ? 48.277 8.086   -24.598 1.00 30.58 ? 360 ASP A CG    1 
ATOM   2849 O  OD1   . ASP A 1 363 ? 47.713 9.118   -25.033 1.00 22.88 ? 360 ASP A OD1   1 
ATOM   2850 O  OD2   . ASP A 1 363 ? 49.510 8.000   -24.424 1.00 29.19 ? 360 ASP A OD2   1 
ATOM   2851 N  N     . ARG A 1 364 ? 44.361 6.244   -22.242 1.00 22.08 ? 361 ARG A N     1 
ATOM   2852 C  CA    . ARG A 1 364 ? 43.363 5.212   -22.029 1.00 17.54 ? 361 ARG A CA    1 
ATOM   2853 C  C     . ARG A 1 364 ? 42.054 5.855   -21.605 1.00 21.71 ? 361 ARG A C     1 
ATOM   2854 O  O     . ARG A 1 364 ? 42.031 7.008   -21.161 1.00 18.55 ? 361 ARG A O     1 
ATOM   2855 C  CB    . ARG A 1 364 ? 43.835 4.221   -20.961 1.00 25.25 ? 361 ARG A CB    1 
ATOM   2856 C  CG    . ARG A 1 364 ? 44.149 4.873   -19.623 1.00 24.49 ? 361 ARG A CG    1 
ATOM   2857 C  CD    . ARG A 1 364 ? 44.518 3.848   -18.561 1.00 23.86 ? 361 ARG A CD    1 
ATOM   2858 N  NE    . ARG A 1 364 ? 44.712 4.460   -17.248 1.00 18.96 ? 361 ARG A NE    1 
ATOM   2859 C  CZ    . ARG A 1 364 ? 44.915 3.768   -16.130 1.00 25.64 ? 361 ARG A CZ    1 
ATOM   2860 N  NH1   . ARG A 1 364 ? 45.086 4.392   -14.965 1.00 17.15 ? 361 ARG A NH1   1 
ATOM   2861 N  NH2   . ARG A 1 364 ? 44.957 2.449   -16.182 1.00 20.00 ? 361 ARG A NH2   1 
ATOM   2862 N  N     . VAL A 1 365 ? 40.972 5.099   -21.753 1.00 16.36 ? 362 VAL A N     1 
ATOM   2863 C  CA    . VAL A 1 365 ? 39.642 5.539   -21.370 1.00 22.14 ? 362 VAL A CA    1 
ATOM   2864 C  C     . VAL A 1 365 ? 38.924 4.425   -20.626 1.00 26.43 ? 362 VAL A C     1 
ATOM   2865 O  O     . VAL A 1 365 ? 38.893 3.277   -21.082 1.00 23.00 ? 362 VAL A O     1 
ATOM   2866 C  CB    . VAL A 1 365 ? 38.804 5.899   -22.603 1.00 24.57 ? 362 VAL A CB    1 
ATOM   2867 C  CG1   . VAL A 1 365 ? 39.230 7.259   -23.154 1.00 35.25 ? 362 VAL A CG1   1 
ATOM   2868 C  CG2   . VAL A 1 365 ? 38.941 4.813   -23.667 1.00 35.05 ? 362 VAL A CG2   1 
ATOM   2869 N  N     . ALA A 1 366 ? 38.348 4.767   -19.479 1.00 16.63 ? 363 ALA A N     1 
ATOM   2870 C  CA    . ALA A 1 366 ? 37.541 3.824   -18.718 1.00 16.79 ? 363 ALA A CA    1 
ATOM   2871 C  C     . ALA A 1 366 ? 36.224 3.560   -19.464 1.00 28.79 ? 363 ALA A C     1 
ATOM   2872 O  O     . ALA A 1 366 ? 35.689 4.454   -20.130 1.00 26.57 ? 363 ALA A O     1 
ATOM   2873 C  CB    . ALA A 1 366 ? 37.262 4.392   -17.329 1.00 11.25 ? 363 ALA A CB    1 
ATOM   2874 N  N     . THR A 1 367 ? 35.686 2.348   -19.354 1.00 14.59 ? 364 THR A N     1 
ATOM   2875 C  CA    . THR A 1 367 ? 34.464 2.036   -20.087 1.00 16.10 ? 364 THR A CA    1 
ATOM   2876 C  C     . THR A 1 367 ? 33.304 1.571   -19.214 1.00 16.05 ? 364 THR A C     1 
ATOM   2877 O  O     . THR A 1 367 ? 32.180 1.405   -19.695 1.00 18.24 ? 364 THR A O     1 
ATOM   2878 C  CB    . THR A 1 367 ? 34.735 0.990   -21.194 1.00 21.62 ? 364 THR A CB    1 
ATOM   2879 O  OG1   . THR A 1 367 ? 35.119 -0.255  -20.597 1.00 17.04 ? 364 THR A OG1   1 
ATOM   2880 C  CG2   . THR A 1 367 ? 35.862 1.472   -22.095 1.00 21.44 ? 364 THR A CG2   1 
ATOM   2881 N  N     . GLN A 1 368 ? 33.573 1.343   -17.934 1.00 19.54 ? 365 GLN A N     1 
ATOM   2882 C  CA    . GLN A 1 368 ? 32.530 0.891   -17.021 1.00 20.20 ? 365 GLN A CA    1 
ATOM   2883 C  C     . GLN A 1 368 ? 32.535 1.733   -15.749 1.00 22.96 ? 365 GLN A C     1 
ATOM   2884 O  O     . GLN A 1 368 ? 33.599 2.056   -15.209 1.00 17.24 ? 365 GLN A O     1 
ATOM   2885 C  CB    . GLN A 1 368 ? 32.705 -0.591  -16.685 1.00 23.07 ? 365 GLN A CB    1 
ATOM   2886 C  CG    . GLN A 1 368 ? 31.594 -1.170  -15.834 1.00 24.34 ? 365 GLN A CG    1 
ATOM   2887 C  CD    . GLN A 1 368 ? 31.750 -2.667  -15.594 1.00 34.35 ? 365 GLN A CD    1 
ATOM   2888 O  OE1   . GLN A 1 368 ? 32.495 -3.093  -14.710 1.00 36.19 ? 365 GLN A OE1   1 
ATOM   2889 N  NE2   . GLN A 1 368 ? 31.040 -3.471  -16.380 1.00 31.03 ? 365 GLN A NE2   1 
ATOM   2890 N  N     . LEU A 1 369 ? 31.337 2.104   -15.304 1.00 17.94 ? 366 LEU A N     1 
ATOM   2891 C  CA    . LEU A 1 369 ? 31.128 2.831   -14.049 1.00 25.90 ? 366 LEU A CA    1 
ATOM   2892 C  C     . LEU A 1 369 ? 30.499 1.874   -13.048 1.00 17.94 ? 366 LEU A C     1 
ATOM   2893 O  O     . LEU A 1 369 ? 29.429 1.324   -13.298 1.00 26.96 ? 366 LEU A O     1 
ATOM   2894 C  CB    . LEU A 1 369 ? 30.191 4.026   -14.264 1.00 14.30 ? 366 LEU A CB    1 
ATOM   2895 C  CG    . LEU A 1 369 ? 29.851 4.879   -13.037 1.00 21.97 ? 366 LEU A CG    1 
ATOM   2896 C  CD1   . LEU A 1 369 ? 31.116 5.540   -12.497 1.00 25.76 ? 366 LEU A CD1   1 
ATOM   2897 C  CD2   . LEU A 1 369 ? 28.777 5.937   -13.357 1.00 25.43 ? 366 LEU A CD2   1 
ATOM   2898 N  N     . VAL A 1 370 ? 31.170 1.649   -11.930 1.00 17.56 ? 367 VAL A N     1 
ATOM   2899 C  CA    . VAL A 1 370 ? 30.616 0.817   -10.873 1.00 11.86 ? 367 VAL A CA    1 
ATOM   2900 C  C     . VAL A 1 370 ? 30.074 1.699   -9.738  1.00 18.53 ? 367 VAL A C     1 
ATOM   2901 O  O     . VAL A 1 370 ? 30.743 2.625   -9.290  1.00 20.61 ? 367 VAL A O     1 
ATOM   2902 C  CB    . VAL A 1 370 ? 31.679 -0.150  -10.333 1.00 18.68 ? 367 VAL A CB    1 
ATOM   2903 C  CG1   . VAL A 1 370 ? 31.103 -1.000  -9.227  1.00 26.76 ? 367 VAL A CG1   1 
ATOM   2904 C  CG2   . VAL A 1 370 ? 32.213 -1.029  -11.467 1.00 21.48 ? 367 VAL A CG2   1 
ATOM   2905 N  N     . VAL A 1 371 ? 28.856 1.418   -9.286  1.00 17.16 ? 368 VAL A N     1 
ATOM   2906 C  CA    . VAL A 1 371 ? 28.233 2.205   -8.230  1.00 13.73 ? 368 VAL A CA    1 
ATOM   2907 C  C     . VAL A 1 371 ? 27.974 1.319   -7.038  1.00 19.07 ? 368 VAL A C     1 
ATOM   2908 O  O     . VAL A 1 371 ? 27.487 0.200   -7.184  1.00 25.98 ? 368 VAL A O     1 
ATOM   2909 C  CB    . VAL A 1 371 ? 26.902 2.833   -8.703  1.00 22.58 ? 368 VAL A CB    1 
ATOM   2910 C  CG1   . VAL A 1 371 ? 26.322 3.769   -7.632  1.00 19.06 ? 368 VAL A CG1   1 
ATOM   2911 C  CG2   . VAL A 1 371 ? 27.116 3.581   -10.004 1.00 16.82 ? 368 VAL A CG2   1 
ATOM   2912 N  N     . SER A 1 372 ? 28.315 1.805   -5.853  1.00 15.28 ? 369 SER A N     1 
ATOM   2913 C  CA    . SER A 1 372 ? 28.166 0.992   -4.663  1.00 15.01 ? 369 SER A CA    1 
ATOM   2914 C  C     . SER A 1 372 ? 27.691 1.841   -3.510  1.00 15.37 ? 369 SER A C     1 
ATOM   2915 O  O     . SER A 1 372 ? 28.113 2.984   -3.356  1.00 15.10 ? 369 SER A O     1 
ATOM   2916 C  CB    . SER A 1 372 ? 29.495 0.316   -4.308  1.00 20.85 ? 369 SER A CB    1 
ATOM   2917 O  OG    . SER A 1 372 ? 29.376 -0.445  -3.118  1.00 27.42 ? 369 SER A OG    1 
ATOM   2918 N  N     . ILE A 1 373 ? 26.801 1.284   -2.703  1.00 19.03 ? 370 ILE A N     1 
ATOM   2919 C  CA    . ILE A 1 373 ? 26.310 1.993   -1.538  1.00 20.66 ? 370 ILE A CA    1 
ATOM   2920 C  C     . ILE A 1 373 ? 26.255 1.071   -0.335  1.00 25.06 ? 370 ILE A C     1 
ATOM   2921 O  O     . ILE A 1 373 ? 26.319 -0.155  -0.463  1.00 21.60 ? 370 ILE A O     1 
ATOM   2922 C  CB    . ILE A 1 373 ? 24.914 2.613   -1.782  1.00 27.64 ? 370 ILE A CB    1 
ATOM   2923 C  CG1   . ILE A 1 373 ? 23.849 1.521   -1.873  1.00 22.15 ? 370 ILE A CG1   1 
ATOM   2924 C  CG2   . ILE A 1 373 ? 24.919 3.521   -3.026  1.00 14.54 ? 370 ILE A CG2   1 
ATOM   2925 C  CD1   . ILE A 1 373 ? 22.490 2.039   -2.289  1.00 28.85 ? 370 ILE A CD1   1 
ATOM   2926 N  N     . ARG A 1 374 ? 26.172 1.678   0.840   1.00 23.17 ? 371 ARG A N     1 
ATOM   2927 C  CA    . ARG A 1 374 ? 25.883 0.942   2.052   1.00 24.96 ? 371 ARG A CA    1 
ATOM   2928 C  C     . ARG A 1 374 ? 24.622 1.583   2.601   1.00 28.55 ? 371 ARG A C     1 
ATOM   2929 O  O     . ARG A 1 374 ? 24.397 2.781   2.414   1.00 23.25 ? 371 ARG A O     1 
ATOM   2930 C  CB    . ARG A 1 374 ? 27.036 1.040   3.046   1.00 24.07 ? 371 ARG A CB    1 
ATOM   2931 C  CG    . ARG A 1 374 ? 26.925 0.102   4.221   1.00 23.90 ? 371 ARG A CG    1 
ATOM   2932 C  CD    . ARG A 1 374 ? 28.112 0.271   5.148   1.00 38.68 ? 371 ARG A CD    1 
ATOM   2933 N  NE    . ARG A 1 374 ? 28.064 -0.635  6.291   1.00 49.05 ? 371 ARG A NE    1 
ATOM   2934 C  CZ    . ARG A 1 374 ? 28.894 -0.567  7.327   1.00 53.20 ? 371 ARG A CZ    1 
ATOM   2935 N  NH1   . ARG A 1 374 ? 29.829 0.375   7.365   1.00 45.22 ? 371 ARG A NH1   1 
ATOM   2936 N  NH2   . ARG A 1 374 ? 28.785 -1.431  8.327   1.00 60.61 ? 371 ARG A NH2   1 
ATOM   2937 N  N     . VAL A 1 375 ? 23.773 0.772   3.220   1.00 38.26 ? 372 VAL A N     1 
ATOM   2938 C  CA    . VAL A 1 375 ? 22.564 1.275   3.853   1.00 38.14 ? 372 VAL A CA    1 
ATOM   2939 C  C     . VAL A 1 375 ? 22.704 1.105   5.354   1.00 27.14 ? 372 VAL A C     1 
ATOM   2940 O  O     . VAL A 1 375 ? 23.367 0.181   5.821   1.00 24.18 ? 372 VAL A O     1 
ATOM   2941 C  CB    . VAL A 1 375 ? 21.319 0.524   3.373   1.00 43.88 ? 372 VAL A CB    1 
ATOM   2942 C  CG1   . VAL A 1 375 ? 21.113 0.744   1.878   1.00 36.83 ? 372 VAL A CG1   1 
ATOM   2943 C  CG2   . VAL A 1 375 ? 21.447 -0.954  3.700   1.00 41.01 ? 372 VAL A CG2   1 
ATOM   2944 N  N     . GLN A 1 376 ? 22.089 2.008   6.105   1.00 32.56 ? 373 GLN A N     1 
ATOM   2945 C  CA    . GLN A 1 376 ? 22.215 2.003   7.554   1.00 38.21 ? 373 GLN A CA    1 
ATOM   2946 C  C     . GLN A 1 376 ? 21.754 0.691   8.182   1.00 39.74 ? 373 GLN A C     1 
ATOM   2947 O  O     . GLN A 1 376 ? 20.600 0.299   8.041   1.00 46.57 ? 373 GLN A O     1 
ATOM   2948 C  CB    . GLN A 1 376 ? 21.422 3.163   8.142   1.00 42.08 ? 373 GLN A CB    1 
ATOM   2949 C  CG    . GLN A 1 376 ? 21.804 3.506   9.561   1.00 47.63 ? 373 GLN A CG    1 
ATOM   2950 C  CD    . GLN A 1 376 ? 21.312 4.876   9.957   1.00 58.05 ? 373 GLN A CD    1 
ATOM   2951 O  OE1   . GLN A 1 376 ? 20.150 5.220   9.727   1.00 62.23 ? 373 GLN A OE1   1 
ATOM   2952 N  NE2   . GLN A 1 376 ? 22.199 5.680   10.537  1.00 68.26 ? 373 GLN A NE2   1 
ATOM   2953 N  N     . GLY A 1 377 ? 22.661 0.022   8.885   1.00 34.20 ? 374 GLY A N     1 
ATOM   2954 C  CA    . GLY A 1 377 ? 22.327 -1.209  9.579   1.00 57.17 ? 374 GLY A CA    1 
ATOM   2955 C  C     . GLY A 1 377 ? 23.195 -2.379  9.153   1.00 64.62 ? 374 GLY A C     1 
ATOM   2956 O  O     . GLY A 1 377 ? 23.641 -3.176  9.984   1.00 53.16 ? 374 GLY A O     1 
ATOM   2957 N  N     . ASP A 1 378 ? 23.439 -2.475  7.849   1.00 55.40 ? 375 ASP A N     1 
ATOM   2958 C  CA    . ASP A 1 378 ? 24.216 -3.570  7.280   1.00 54.07 ? 375 ASP A CA    1 
ATOM   2959 C  C     . ASP A 1 378 ? 25.633 -3.612  7.843   1.00 57.54 ? 375 ASP A C     1 
ATOM   2960 O  O     . ASP A 1 378 ? 26.346 -2.610  7.816   1.00 61.10 ? 375 ASP A O     1 
ATOM   2961 C  CB    . ASP A 1 378 ? 24.260 -3.435  5.757   1.00 55.35 ? 375 ASP A CB    1 
ATOM   2962 C  CG    . ASP A 1 378 ? 24.754 -4.693  5.073   1.00 55.31 ? 375 ASP A CG    1 
ATOM   2963 O  OD1   . ASP A 1 378 ? 25.611 -5.398  5.648   1.00 50.81 ? 375 ASP A OD1   1 
ATOM   2964 O  OD2   . ASP A 1 378 ? 24.276 -4.975  3.956   1.00 54.35 ? 375 ASP A OD2   1 
ATOM   2965 N  N     . LYS A 1 379 ? 26.044 -4.773  8.347   1.00 60.73 ? 376 LYS A N     1 
ATOM   2966 C  CA    . LYS A 1 379 ? 27.388 -4.917  8.905   1.00 75.46 ? 376 LYS A CA    1 
ATOM   2967 C  C     . LYS A 1 379 ? 28.464 -4.880  7.822   1.00 68.37 ? 376 LYS A C     1 
ATOM   2968 O  O     . LYS A 1 379 ? 29.590 -4.440  8.067   1.00 64.75 ? 376 LYS A O     1 
ATOM   2969 C  CB    . LYS A 1 379 ? 27.516 -6.209  9.719   1.00 76.39 ? 376 LYS A CB    1 
ATOM   2970 C  CG    . LYS A 1 379 ? 28.880 -6.363  10.381  1.00 81.89 ? 376 LYS A CG    1 
ATOM   2971 C  CD    . LYS A 1 379 ? 29.045 -7.713  11.057  1.00 87.35 ? 376 LYS A CD    1 
ATOM   2972 C  CE    . LYS A 1 379 ? 30.437 -7.845  11.662  1.00 75.13 ? 376 LYS A CE    1 
ATOM   2973 N  NZ    . LYS A 1 379 ? 31.506 -7.594  10.651  1.00 76.35 ? 376 LYS A NZ    1 
ATOM   2974 N  N     . ARG A 1 380 ? 28.114 -5.352  6.629   1.00 60.03 ? 377 ARG A N     1 
ATOM   2975 C  CA    . ARG A 1 380 ? 29.045 -5.367  5.504   1.00 68.54 ? 377 ARG A CA    1 
ATOM   2976 C  C     . ARG A 1 380 ? 29.442 -3.952  5.094   1.00 65.24 ? 377 ARG A C     1 
ATOM   2977 O  O     . ARG A 1 380 ? 28.637 -3.022  5.187   1.00 56.24 ? 377 ARG A O     1 
ATOM   2978 C  CB    . ARG A 1 380 ? 28.420 -6.087  4.306   1.00 58.41 ? 377 ARG A CB    1 
ATOM   2979 C  CG    . ARG A 1 380 ? 28.039 -7.535  4.561   1.00 55.72 ? 377 ARG A CG    1 
ATOM   2980 C  CD    . ARG A 1 380 ? 27.277 -8.103  3.377   1.00 44.92 ? 377 ARG A CD    1 
ATOM   2981 N  NE    . ARG A 1 380 ? 26.025 -7.388  3.141   1.00 44.39 ? 377 ARG A NE    1 
ATOM   2982 C  CZ    . ARG A 1 380 ? 25.250 -7.570  2.077   1.00 40.78 ? 377 ARG A CZ    1 
ATOM   2983 N  NH1   . ARG A 1 380 ? 25.598 -8.439  1.143   1.00 39.84 ? 377 ARG A NH1   1 
ATOM   2984 N  NH2   . ARG A 1 380 ? 24.127 -6.880  1.941   1.00 44.78 ? 377 ARG A NH2   1 
ATOM   2985 N  N     . LEU A 1 381 ? 30.682 -3.794  4.638   1.00 58.18 ? 378 LEU A N     1 
ATOM   2986 C  CA    . LEU A 1 381 ? 31.157 -2.503  4.157   1.00 52.90 ? 378 LEU A CA    1 
ATOM   2987 C  C     . LEU A 1 381 ? 30.361 -2.054  2.927   1.00 58.10 ? 378 LEU A C     1 
ATOM   2988 O  O     . LEU A 1 381 ? 29.975 -0.889  2.819   1.00 60.41 ? 378 LEU A O     1 
ATOM   2989 C  CB    . LEU A 1 381 ? 32.659 -2.548  3.864   1.00 62.92 ? 378 LEU A CB    1 
ATOM   2990 C  CG    . LEU A 1 381 ? 33.592 -2.327  5.063   1.00 72.92 ? 378 LEU A CG    1 
ATOM   2991 C  CD1   . LEU A 1 381 ? 33.306 -3.318  6.185   1.00 67.37 ? 378 LEU A CD1   1 
ATOM   2992 C  CD2   . LEU A 1 381 ? 35.060 -2.395  4.643   1.00 69.84 ? 378 LEU A CD2   1 
ATOM   2993 N  N     . SER A 1 382 ? 30.111 -2.981  2.006   1.00 51.07 ? 379 SER A N     1 
ATOM   2994 C  CA    . SER A 1 382 ? 29.261 -2.692  0.854   1.00 47.19 ? 379 SER A CA    1 
ATOM   2995 C  C     . SER A 1 382 ? 27.969 -3.478  0.922   1.00 41.12 ? 379 SER A C     1 
ATOM   2996 O  O     . SER A 1 382 ? 27.981 -4.676  1.201   1.00 43.40 ? 379 SER A O     1 
ATOM   2997 C  CB    . SER A 1 382 ? 29.960 -3.029  -0.460  1.00 38.83 ? 379 SER A CB    1 
ATOM   2998 O  OG    . SER A 1 382 ? 29.004 -3.134  -1.508  1.00 36.10 ? 379 SER A OG    1 
ATOM   2999 N  N     . SER A 1 383 ? 26.858 -2.802  0.640   1.00 45.67 ? 380 SER A N     1 
ATOM   3000 C  CA    . SER A 1 383 ? 25.544 -3.437  0.653   1.00 46.00 ? 380 SER A CA    1 
ATOM   3001 C  C     . SER A 1 383 ? 25.074 -3.806  -0.749  1.00 52.14 ? 380 SER A C     1 
ATOM   3002 O  O     . SER A 1 383 ? 24.216 -4.672  -0.914  1.00 52.72 ? 380 SER A O     1 
ATOM   3003 C  CB    . SER A 1 383 ? 24.503 -2.516  1.304   1.00 41.85 ? 380 SER A CB    1 
ATOM   3004 O  OG    . SER A 1 383 ? 24.787 -2.293  2.677   1.00 37.84 ? 380 SER A OG    1 
ATOM   3005 N  N     . LEU A 1 384 ? 25.629 -3.145  -1.759  1.00 48.17 ? 381 LEU A N     1 
ATOM   3006 C  CA    . LEU A 1 384 ? 25.118 -3.295  -3.116  1.00 32.40 ? 381 LEU A CA    1 
ATOM   3007 C  C     . LEU A 1 384 ? 26.043 -2.659  -4.147  1.00 39.60 ? 381 LEU A C     1 
ATOM   3008 O  O     . LEU A 1 384 ? 26.459 -1.504  -4.005  1.00 26.27 ? 381 LEU A O     1 
ATOM   3009 C  CB    . LEU A 1 384 ? 23.726 -2.671  -3.228  1.00 33.61 ? 381 LEU A CB    1 
ATOM   3010 C  CG    . LEU A 1 384 ? 23.043 -2.788  -4.593  1.00 32.43 ? 381 LEU A CG    1 
ATOM   3011 C  CD1   . LEU A 1 384 ? 21.725 -3.532  -4.466  1.00 39.73 ? 381 LEU A CD1   1 
ATOM   3012 C  CD2   . LEU A 1 384 ? 22.824 -1.426  -5.231  1.00 28.83 ? 381 LEU A CD2   1 
ATOM   3013 N  N     . ARG A 1 385 ? 26.347 -3.420  -5.193  1.00 33.81 ? 382 ARG A N     1 
ATOM   3014 C  CA    . ARG A 1 385 ? 27.218 -2.958  -6.261  1.00 25.76 ? 382 ARG A CA    1 
ATOM   3015 C  C     . ARG A 1 385 ? 26.533 -3.190  -7.596  1.00 31.88 ? 382 ARG A C     1 
ATOM   3016 O  O     . ARG A 1 385 ? 26.063 -4.288  -7.887  1.00 35.77 ? 382 ARG A O     1 
ATOM   3017 C  CB    . ARG A 1 385 ? 28.541 -3.718  -6.239  1.00 33.58 ? 382 ARG A CB    1 
ATOM   3018 C  CG    . ARG A 1 385 ? 29.696 -2.943  -6.836  1.00 40.81 ? 382 ARG A CG    1 
ATOM   3019 C  CD    . ARG A 1 385 ? 30.735 -3.862  -7.455  1.00 46.62 ? 382 ARG A CD    1 
ATOM   3020 N  NE    . ARG A 1 385 ? 30.253 -4.465  -8.695  1.00 51.13 ? 382 ARG A NE    1 
ATOM   3021 C  CZ    . ARG A 1 385 ? 31.012 -5.166  -9.532  1.00 45.51 ? 382 ARG A CZ    1 
ATOM   3022 N  NH1   . ARG A 1 385 ? 30.482 -5.676  -10.636 1.00 56.03 ? 382 ARG A NH1   1 
ATOM   3023 N  NH2   . ARG A 1 385 ? 32.300 -5.355  -9.269  1.00 51.50 ? 382 ARG A NH2   1 
ATOM   3024 N  N     . ARG A 1 386 ? 26.470 -2.146  -8.403  1.00 17.51 ? 383 ARG A N     1 
ATOM   3025 C  CA    . ARG A 1 386 ? 25.829 -2.232  -9.702  1.00 27.98 ? 383 ARG A CA    1 
ATOM   3026 C  C     . ARG A 1 386 ? 26.666 -1.481  -10.720 1.00 25.06 ? 383 ARG A C     1 
ATOM   3027 O  O     . ARG A 1 386 ? 27.153 -0.393  -10.437 1.00 24.47 ? 383 ARG A O     1 
ATOM   3028 C  CB    . ARG A 1 386 ? 24.446 -1.604  -9.635  1.00 32.97 ? 383 ARG A CB    1 
ATOM   3029 C  CG    . ARG A 1 386 ? 23.466 -2.354  -8.772  1.00 35.23 ? 383 ARG A CG    1 
ATOM   3030 C  CD    . ARG A 1 386 ? 22.964 -3.584  -9.488  1.00 30.95 ? 383 ARG A CD    1 
ATOM   3031 N  NE    . ARG A 1 386 ? 21.773 -4.117  -8.844  1.00 28.16 ? 383 ARG A NE    1 
ATOM   3032 C  CZ    . ARG A 1 386 ? 21.793 -4.959  -7.820  1.00 37.66 ? 383 ARG A CZ    1 
ATOM   3033 N  NH1   . ARG A 1 386 ? 22.953 -5.368  -7.321  1.00 31.98 ? 383 ARG A NH1   1 
ATOM   3034 N  NH2   . ARG A 1 386 ? 20.651 -5.396  -7.298  1.00 47.93 ? 383 ARG A NH2   1 
ATOM   3035 N  N     . CYS A 1 387 ? 26.823 -2.049  -11.908 1.00 26.75 ? 384 CYS A N     1 
ATOM   3036 C  CA    . CYS A 1 387 ? 27.579 -1.363  -12.949 1.00 23.62 ? 384 CYS A CA    1 
ATOM   3037 C  C     . CYS A 1 387 ? 26.680 -0.805  -14.045 1.00 25.55 ? 384 CYS A C     1 
ATOM   3038 O  O     . CYS A 1 387 ? 25.611 -1.343  -14.311 1.00 30.65 ? 384 CYS A O     1 
ATOM   3039 C  CB    . CYS A 1 387 ? 28.629 -2.304  -13.547 1.00 21.96 ? 384 CYS A CB    1 
ATOM   3040 S  SG    A CYS A 1 387 ? 27.955 -3.735  -14.436 0.61 36.58 ? 384 CYS A SG    1 
ATOM   3041 S  SG    B CYS A 1 387 ? 29.670 -3.084  -12.316 0.39 28.15 ? 384 CYS A SG    1 
ATOM   3042 N  N     . CYS A 1 388 ? 27.121 0.278   -14.672 1.00 25.85 ? 385 CYS A N     1 
ATOM   3043 C  CA    . CYS A 1 388 ? 26.506 0.754   -15.905 1.00 37.50 ? 385 CYS A CA    1 
ATOM   3044 C  C     . CYS A 1 388 ? 27.594 1.112   -16.914 1.00 29.52 ? 385 CYS A C     1 
ATOM   3045 O  O     . CYS A 1 388 ? 28.783 0.984   -16.622 1.00 33.10 ? 385 CYS A O     1 
ATOM   3046 C  CB    . CYS A 1 388 ? 25.576 1.946   -15.652 1.00 30.09 ? 385 CYS A CB    1 
ATOM   3047 S  SG    . CYS A 1 388 ? 26.355 3.413   -14.957 1.00 37.29 ? 385 CYS A SG    1 
ATOM   3048 N  N     . ALA A 1 389 ? 27.191 1.549   -18.103 1.00 26.87 ? 386 ALA A N     1 
ATOM   3049 C  CA    . ALA A 1 389 ? 28.162 1.929   -19.122 1.00 31.45 ? 386 ALA A CA    1 
ATOM   3050 C  C     . ALA A 1 389 ? 28.730 3.303   -18.815 1.00 23.51 ? 386 ALA A C     1 
ATOM   3051 O  O     . ALA A 1 389 ? 28.033 4.168   -18.293 1.00 31.35 ? 386 ALA A O     1 
ATOM   3052 C  CB    . ALA A 1 389 ? 27.529 1.922   -20.495 1.00 29.55 ? 386 ALA A CB    1 
ATOM   3053 N  N     . LEU A 1 390 ? 30.002 3.497   -19.139 1.00 23.65 ? 387 LEU A N     1 
ATOM   3054 C  CA    . LEU A 1 390 ? 30.632 4.804   -19.010 1.00 25.18 ? 387 LEU A CA    1 
ATOM   3055 C  C     . LEU A 1 390 ? 31.052 5.267   -20.396 1.00 29.85 ? 387 LEU A C     1 
ATOM   3056 O  O     . LEU A 1 390 ? 32.112 4.882   -20.889 1.00 34.79 ? 387 LEU A O     1 
ATOM   3057 C  CB    . LEU A 1 390 ? 31.857 4.708   -18.099 1.00 28.47 ? 387 LEU A CB    1 
ATOM   3058 C  CG    . LEU A 1 390 ? 32.189 5.888   -17.182 1.00 28.49 ? 387 LEU A CG    1 
ATOM   3059 C  CD1   . LEU A 1 390 ? 33.388 5.527   -16.319 1.00 20.26 ? 387 LEU A CD1   1 
ATOM   3060 C  CD2   . LEU A 1 390 ? 32.460 7.154   -17.978 1.00 22.74 ? 387 LEU A CD2   1 
ATOM   3061 N  N     . THR A 1 391 ? 30.219 6.087   -21.025 1.00 24.18 ? 388 THR A N     1 
ATOM   3062 C  CA    . THR A 1 391 ? 30.414 6.455   -22.424 1.00 26.72 ? 388 THR A CA    1 
ATOM   3063 C  C     . THR A 1 391 ? 30.981 7.860   -22.599 1.00 33.12 ? 388 THR A C     1 
ATOM   3064 O  O     . THR A 1 391 ? 31.495 8.195   -23.664 1.00 33.34 ? 388 THR A O     1 
ATOM   3065 C  CB    . THR A 1 391 ? 29.095 6.345   -23.218 1.00 38.33 ? 388 THR A CB    1 
ATOM   3066 O  OG1   . THR A 1 391 ? 28.108 7.214   -22.642 1.00 33.26 ? 388 THR A OG1   1 
ATOM   3067 C  CG2   . THR A 1 391 ? 28.583 4.911   -23.192 1.00 35.48 ? 388 THR A CG2   1 
ATOM   3068 N  N     . ARG A 1 392 ? 30.883 8.676   -21.552 1.00 24.66 ? 389 ARG A N     1 
ATOM   3069 C  CA    . ARG A 1 392 ? 31.382 10.045  -21.596 1.00 35.86 ? 389 ARG A CA    1 
ATOM   3070 C  C     . ARG A 1 392 ? 31.900 10.504  -20.234 1.00 21.73 ? 389 ARG A C     1 
ATOM   3071 O  O     . ARG A 1 392 ? 31.280 10.248  -19.203 1.00 25.48 ? 389 ARG A O     1 
ATOM   3072 C  CB    . ARG A 1 392 ? 30.295 11.009  -22.095 1.00 33.96 ? 389 ARG A CB    1 
ATOM   3073 C  CG    . ARG A 1 392 ? 29.930 10.848  -23.565 1.00 35.68 ? 389 ARG A CG    1 
ATOM   3074 C  CD    . ARG A 1 392 ? 28.822 11.811  -23.978 1.00 57.66 ? 389 ARG A CD    1 
ATOM   3075 N  NE    . ARG A 1 392 ? 29.165 13.195  -23.654 1.00 60.83 ? 389 ARG A NE    1 
ATOM   3076 C  CZ    . ARG A 1 392 ? 28.688 13.860  -22.605 1.00 68.56 ? 389 ARG A CZ    1 
ATOM   3077 N  NH1   . ARG A 1 392 ? 29.060 15.116  -22.382 1.00 62.67 ? 389 ARG A NH1   1 
ATOM   3078 N  NH2   . ARG A 1 392 ? 27.832 13.270  -21.780 1.00 62.43 ? 389 ARG A NH2   1 
ATOM   3079 N  N     . TYR A 1 393 ? 33.038 11.186  -20.241 1.00 19.39 ? 390 TYR A N     1 
ATOM   3080 C  CA    . TYR A 1 393 ? 33.575 11.779  -19.026 1.00 22.10 ? 390 TYR A CA    1 
ATOM   3081 C  C     . TYR A 1 393 ? 32.811 13.052  -18.706 1.00 28.79 ? 390 TYR A C     1 
ATOM   3082 O  O     . TYR A 1 393 ? 33.275 14.160  -18.987 1.00 24.35 ? 390 TYR A O     1 
ATOM   3083 C  CB    . TYR A 1 393 ? 35.067 12.080  -19.168 1.00 19.60 ? 390 TYR A CB    1 
ATOM   3084 C  CG    . TYR A 1 393 ? 35.954 10.857  -19.139 1.00 24.29 ? 390 TYR A CG    1 
ATOM   3085 C  CD1   . TYR A 1 393 ? 37.336 10.984  -19.073 1.00 18.71 ? 390 TYR A CD1   1 
ATOM   3086 C  CD2   . TYR A 1 393 ? 35.413 9.578   -19.174 1.00 24.33 ? 390 TYR A CD2   1 
ATOM   3087 C  CE1   . TYR A 1 393 ? 38.153 9.880   -19.045 1.00 19.92 ? 390 TYR A CE1   1 
ATOM   3088 C  CE2   . TYR A 1 393 ? 36.225 8.463   -19.138 1.00 27.07 ? 390 TYR A CE2   1 
ATOM   3089 C  CZ    . TYR A 1 393 ? 37.598 8.618   -19.072 1.00 18.85 ? 390 TYR A CZ    1 
ATOM   3090 O  OH    . TYR A 1 393 ? 38.422 7.506   -19.040 1.00 17.84 ? 390 TYR A OH    1 
ATOM   3091 N  N     . ASP A 1 394 ? 31.625 12.882  -18.136 1.00 25.72 ? 391 ASP A N     1 
ATOM   3092 C  CA    . ASP A 1 394 ? 30.791 14.013  -17.769 1.00 27.02 ? 391 ASP A CA    1 
ATOM   3093 C  C     . ASP A 1 394 ? 30.174 13.729  -16.414 1.00 18.52 ? 391 ASP A C     1 
ATOM   3094 O  O     . ASP A 1 394 ? 29.479 12.723  -16.251 1.00 17.87 ? 391 ASP A O     1 
ATOM   3095 C  CB    . ASP A 1 394 ? 29.693 14.221  -18.808 1.00 33.13 ? 391 ASP A CB    1 
ATOM   3096 C  CG    . ASP A 1 394 ? 28.915 15.500  -18.575 1.00 33.46 ? 391 ASP A CG    1 
ATOM   3097 O  OD1   . ASP A 1 394 ? 27.977 15.482  -17.748 1.00 31.40 ? 391 ASP A OD1   1 
ATOM   3098 O  OD2   . ASP A 1 394 ? 29.251 16.523  -19.209 1.00 49.54 ? 391 ASP A OD2   1 
ATOM   3099 N  N     . ALA A 1 395 ? 30.432 14.606  -15.449 1.00 21.52 ? 392 ALA A N     1 
ATOM   3100 C  CA    . ALA A 1 395 ? 30.018 14.362  -14.065 1.00 23.71 ? 392 ALA A CA    1 
ATOM   3101 C  C     . ALA A 1 395 ? 28.497 14.320  -13.885 1.00 18.82 ? 392 ALA A C     1 
ATOM   3102 O  O     . ALA A 1 395 ? 27.973 13.465  -13.170 1.00 15.65 ? 392 ALA A O     1 
ATOM   3103 C  CB    . ALA A 1 395 ? 30.658 15.386  -13.118 1.00 18.64 ? 392 ALA A CB    1 
ATOM   3104 N  N     . HIS A 1 396 ? 27.782 15.246  -14.522 1.00 17.86 ? 393 HIS A N     1 
ATOM   3105 C  CA    . HIS A 1 396 ? 26.324 15.253  -14.420 1.00 25.20 ? 393 HIS A CA    1 
ATOM   3106 C  C     . HIS A 1 396 ? 25.728 13.955  -14.959 1.00 16.87 ? 393 HIS A C     1 
ATOM   3107 O  O     . HIS A 1 396 ? 24.815 13.378  -14.357 1.00 21.31 ? 393 HIS A O     1 
ATOM   3108 C  CB    . HIS A 1 396 ? 25.724 16.474  -15.125 1.00 28.74 ? 393 HIS A CB    1 
ATOM   3109 C  CG    . HIS A 1 396 ? 26.028 17.771  -14.440 1.00 25.39 ? 393 HIS A CG    1 
ATOM   3110 N  ND1   . HIS A 1 396 ? 27.190 18.477  -14.666 1.00 41.91 ? 393 HIS A ND1   1 
ATOM   3111 C  CD2   . HIS A 1 396 ? 25.329 18.482  -13.523 1.00 32.03 ? 393 HIS A CD2   1 
ATOM   3112 C  CE1   . HIS A 1 396 ? 27.191 19.571  -13.923 1.00 41.11 ? 393 HIS A CE1   1 
ATOM   3113 N  NE2   . HIS A 1 396 ? 26.074 19.596  -13.219 1.00 34.43 ? 393 HIS A NE2   1 
ATOM   3114 N  N     . LYS A 1 397 ? 26.261 13.492  -16.085 1.00 19.89 ? 394 LYS A N     1 
ATOM   3115 C  CA    . LYS A 1 397 ? 25.835 12.220  -16.670 1.00 24.07 ? 394 LYS A CA    1 
ATOM   3116 C  C     . LYS A 1 397 ? 26.112 11.035  -15.760 1.00 18.36 ? 394 LYS A C     1 
ATOM   3117 O  O     . LYS A 1 397 ? 25.251 10.177  -15.558 1.00 26.93 ? 394 LYS A O     1 
ATOM   3118 C  CB    . LYS A 1 397 ? 26.509 11.974  -18.020 1.00 24.06 ? 394 LYS A CB    1 
ATOM   3119 C  CG    . LYS A 1 397 ? 26.267 10.564  -18.555 1.00 30.28 ? 394 LYS A CG    1 
ATOM   3120 C  CD    . LYS A 1 397 ? 26.671 10.439  -20.018 1.00 37.14 ? 394 LYS A CD    1 
ATOM   3121 C  CE    . LYS A 1 397 ? 26.514 9.006   -20.515 1.00 44.23 ? 394 LYS A CE    1 
ATOM   3122 N  NZ    . LYS A 1 397 ? 25.165 8.437   -20.223 1.00 41.78 ? 394 LYS A NZ    1 
ATOM   3123 N  N     . MET A 1 398 ? 27.320 10.983  -15.214 1.00 20.93 ? 395 MET A N     1 
ATOM   3124 C  CA    . MET A 1 398 ? 27.704 9.858   -14.375 1.00 21.78 ? 395 MET A CA    1 
ATOM   3125 C  C     . MET A 1 398 ? 26.867 9.807   -13.103 1.00 17.42 ? 395 MET A C     1 
ATOM   3126 O  O     . MET A 1 398 ? 26.426 8.736   -12.693 1.00 19.05 ? 395 MET A O     1 
ATOM   3127 C  CB    . MET A 1 398 ? 29.203 9.903   -14.056 1.00 19.26 ? 395 MET A CB    1 
ATOM   3128 C  CG    . MET A 1 398 ? 30.083 9.684   -15.272 1.00 16.49 ? 395 MET A CG    1 
ATOM   3129 S  SD    . MET A 1 398 ? 31.803 9.356   -14.835 1.00 27.25 ? 395 MET A SD    1 
ATOM   3130 C  CE    . MET A 1 398 ? 32.353 10.989  -14.338 1.00 20.71 ? 395 MET A CE    1 
ATOM   3131 N  N     . SER A 1 399 ? 26.640 10.961  -12.480 1.00 17.57 ? 396 SER A N     1 
ATOM   3132 C  CA    . SER A 1 399 ? 25.853 10.991  -11.257 1.00 19.68 ? 396 SER A CA    1 
ATOM   3133 C  C     . SER A 1 399 ? 24.406 10.614  -11.557 1.00 20.72 ? 396 SER A C     1 
ATOM   3134 O  O     . SER A 1 399 ? 23.762 9.903   -10.789 1.00 18.12 ? 396 SER A O     1 
ATOM   3135 C  CB    . SER A 1 399 ? 25.942 12.356  -10.567 1.00 21.13 ? 396 SER A CB    1 
ATOM   3136 O  OG    . SER A 1 399 ? 25.607 13.419  -11.443 1.00 20.87 ? 396 SER A OG    1 
ATOM   3137 N  N     . HIS A 1 400 ? 23.899 11.080  -12.687 1.00 19.21 ? 397 HIS A N     1 
ATOM   3138 C  CA    . HIS A 1 400 ? 22.553 10.690  -13.096 1.00 28.01 ? 397 HIS A CA    1 
ATOM   3139 C  C     . HIS A 1 400 ? 22.462 9.171   -13.312 1.00 25.98 ? 397 HIS A C     1 
ATOM   3140 O  O     . HIS A 1 400 ? 21.547 8.513   -12.812 1.00 19.21 ? 397 HIS A O     1 
ATOM   3141 C  CB    . HIS A 1 400 ? 22.131 11.453  -14.352 1.00 23.83 ? 397 HIS A CB    1 
ATOM   3142 C  CG    . HIS A 1 400 ? 20.714 11.196  -14.761 1.00 41.77 ? 397 HIS A CG    1 
ATOM   3143 N  ND1   . HIS A 1 400 ? 20.289 9.978   -15.248 1.00 38.05 ? 397 HIS A ND1   1 
ATOM   3144 C  CD2   . HIS A 1 400 ? 19.622 11.996  -14.748 1.00 43.08 ? 397 HIS A CD2   1 
ATOM   3145 C  CE1   . HIS A 1 400 ? 18.998 10.039  -15.521 1.00 39.28 ? 397 HIS A CE1   1 
ATOM   3146 N  NE2   . HIS A 1 400 ? 18.569 11.253  -15.226 1.00 47.63 ? 397 HIS A NE2   1 
ATOM   3147 N  N     . ASP A 1 401 ? 23.429 8.610   -14.032 1.00 26.09 ? 398 ASP A N     1 
ATOM   3148 C  CA    . ASP A 1 401 ? 23.435 7.173   -14.289 1.00 14.26 ? 398 ASP A CA    1 
ATOM   3149 C  C     . ASP A 1 401 ? 23.530 6.367   -12.999 1.00 24.05 ? 398 ASP A C     1 
ATOM   3150 O  O     . ASP A 1 401 ? 22.952 5.286   -12.888 1.00 27.03 ? 398 ASP A O     1 
ATOM   3151 C  CB    . ASP A 1 401 ? 24.566 6.788   -15.249 1.00 22.34 ? 398 ASP A CB    1 
ATOM   3152 C  CG    . ASP A 1 401 ? 24.364 7.354   -16.643 1.00 33.49 ? 398 ASP A CG    1 
ATOM   3153 O  OD1   . ASP A 1 401 ? 23.232 7.811   -16.935 1.00 31.78 ? 398 ASP A OD1   1 
ATOM   3154 O  OD2   . ASP A 1 401 ? 25.326 7.338   -17.446 1.00 26.52 ? 398 ASP A OD2   1 
ATOM   3155 N  N     . ALA A 1 402 ? 24.247 6.909   -12.019 1.00 22.60 ? 399 ALA A N     1 
ATOM   3156 C  CA    . ALA A 1 402 ? 24.477 6.217   -10.760 1.00 20.30 ? 399 ALA A CA    1 
ATOM   3157 C  C     . ALA A 1 402 ? 23.205 6.183   -9.932  1.00 18.98 ? 399 ALA A C     1 
ATOM   3158 O  O     . ALA A 1 402 ? 22.885 5.178   -9.301  1.00 19.86 ? 399 ALA A O     1 
ATOM   3159 C  CB    . ALA A 1 402 ? 25.603 6.902   -9.977  1.00 27.49 ? 399 ALA A CB    1 
ATOM   3160 N  N     . PHE A 1 403 ? 22.487 7.296   -9.937  1.00 20.81 ? 400 PHE A N     1 
ATOM   3161 C  CA    . PHE A 1 403 ? 21.223 7.390   -9.228  1.00 31.48 ? 400 PHE A CA    1 
ATOM   3162 C  C     . PHE A 1 403 ? 20.235 6.409   -9.836  1.00 26.90 ? 400 PHE A C     1 
ATOM   3163 O  O     . PHE A 1 403 ? 19.519 5.711   -9.120  1.00 27.68 ? 400 PHE A O     1 
ATOM   3164 C  CB    . PHE A 1 403 ? 20.671 8.814   -9.317  1.00 24.40 ? 400 PHE A CB    1 
ATOM   3165 C  CG    . PHE A 1 403 ? 19.420 9.033   -8.510  1.00 38.81 ? 400 PHE A CG    1 
ATOM   3166 C  CD1   . PHE A 1 403 ? 18.172 8.766   -9.053  1.00 46.16 ? 400 PHE A CD1   1 
ATOM   3167 C  CD2   . PHE A 1 403 ? 19.491 9.509   -7.210  1.00 37.70 ? 400 PHE A CD2   1 
ATOM   3168 C  CE1   . PHE A 1 403 ? 17.019 8.966   -8.312  1.00 50.42 ? 400 PHE A CE1   1 
ATOM   3169 C  CE2   . PHE A 1 403 ? 18.344 9.715   -6.464  1.00 45.42 ? 400 PHE A CE2   1 
ATOM   3170 C  CZ    . PHE A 1 403 ? 17.105 9.442   -7.016  1.00 53.36 ? 400 PHE A CZ    1 
ATOM   3171 N  N     . THR A 1 404 ? 20.203 6.364   -11.164 1.00 28.84 ? 401 THR A N     1 
ATOM   3172 C  CA    . THR A 1 404 ? 19.334 5.437   -11.872 1.00 30.54 ? 401 THR A CA    1 
ATOM   3173 C  C     . THR A 1 404 ? 19.544 3.995   -11.404 1.00 29.35 ? 401 THR A C     1 
ATOM   3174 O  O     . THR A 1 404 ? 18.580 3.303   -11.086 1.00 37.05 ? 401 THR A O     1 
ATOM   3175 C  CB    . THR A 1 404 ? 19.508 5.532   -13.408 1.00 26.18 ? 401 THR A CB    1 
ATOM   3176 O  OG1   . THR A 1 404 ? 19.085 6.823   -13.859 1.00 29.16 ? 401 THR A OG1   1 
ATOM   3177 C  CG2   . THR A 1 404 ? 18.674 4.466   -14.109 1.00 32.94 ? 401 THR A CG2   1 
ATOM   3178 N  N     . VAL A 1 405 ? 20.795 3.544   -11.338 1.00 27.72 ? 402 VAL A N     1 
ATOM   3179 C  CA    . VAL A 1 405 ? 21.057 2.151   -10.980 1.00 30.39 ? 402 VAL A CA    1 
ATOM   3180 C  C     . VAL A 1 405 ? 20.792 1.833   -9.508  1.00 27.57 ? 402 VAL A C     1 
ATOM   3181 O  O     . VAL A 1 405 ? 20.606 0.675   -9.158  1.00 29.70 ? 402 VAL A O     1 
ATOM   3182 C  CB    . VAL A 1 405 ? 22.479 1.677   -11.385 1.00 38.72 ? 402 VAL A CB    1 
ATOM   3183 C  CG1   . VAL A 1 405 ? 22.714 1.903   -12.875 1.00 35.17 ? 402 VAL A CG1   1 
ATOM   3184 C  CG2   . VAL A 1 405 ? 23.538 2.374   -10.556 1.00 33.78 ? 402 VAL A CG2   1 
ATOM   3185 N  N     . ILE A 1 406 ? 20.764 2.849   -8.649  1.00 28.53 ? 403 ILE A N     1 
ATOM   3186 C  CA    . ILE A 1 406 ? 20.520 2.612   -7.229  1.00 32.57 ? 403 ILE A CA    1 
ATOM   3187 C  C     . ILE A 1 406 ? 19.148 3.108   -6.747  1.00 29.42 ? 403 ILE A C     1 
ATOM   3188 O  O     . ILE A 1 406 ? 18.732 2.791   -5.633  1.00 38.95 ? 403 ILE A O     1 
ATOM   3189 C  CB    . ILE A 1 406 ? 21.594 3.282   -6.329  1.00 28.44 ? 403 ILE A CB    1 
ATOM   3190 C  CG1   . ILE A 1 406 ? 21.401 4.804   -6.315  1.00 26.56 ? 403 ILE A CG1   1 
ATOM   3191 C  CG2   . ILE A 1 406 ? 22.999 2.877   -6.749  1.00 27.99 ? 403 ILE A CG2   1 
ATOM   3192 C  CD1   . ILE A 1 406 ? 21.986 5.487   -5.088  1.00 24.08 ? 403 ILE A CD1   1 
ATOM   3193 N  N     . LYS A 1 407 ? 18.458 3.891   -7.571  1.00 29.36 ? 404 LYS A N     1 
ATOM   3194 C  CA    . LYS A 1 407 ? 17.242 4.573   -7.129  1.00 34.94 ? 404 LYS A CA    1 
ATOM   3195 C  C     . LYS A 1 407 ? 16.156 3.634   -6.609  1.00 41.95 ? 404 LYS A C     1 
ATOM   3196 O  O     . LYS A 1 407 ? 15.237 4.074   -5.918  1.00 49.22 ? 404 LYS A O     1 
ATOM   3197 C  CB    . LYS A 1 407 ? 16.676 5.460   -8.241  1.00 37.96 ? 404 LYS A CB    1 
ATOM   3198 C  CG    . LYS A 1 407 ? 16.074 4.699   -9.413  1.00 41.20 ? 404 LYS A CG    1 
ATOM   3199 C  CD    . LYS A 1 407 ? 15.525 5.657   -10.465 1.00 39.80 ? 404 LYS A CD    1 
ATOM   3200 C  CE    . LYS A 1 407 ? 14.803 4.918   -11.586 1.00 53.41 ? 404 LYS A CE    1 
ATOM   3201 N  NZ    . LYS A 1 407 ? 15.702 3.991   -12.336 1.00 57.53 ? 404 LYS A NZ    1 
ATOM   3202 N  N     . ASN A 1 408 ? 16.258 2.350   -6.938  1.00 38.97 ? 405 ASN A N     1 
ATOM   3203 C  CA    . ASN A 1 408 ? 15.256 1.382   -6.494  1.00 47.60 ? 405 ASN A CA    1 
ATOM   3204 C  C     . ASN A 1 408 ? 15.656 0.655   -5.217  1.00 45.28 ? 405 ASN A C     1 
ATOM   3205 O  O     . ASN A 1 408 ? 15.055 -0.353  -4.858  1.00 38.76 ? 405 ASN A O     1 
ATOM   3206 C  CB    . ASN A 1 408 ? 14.923 0.370   -7.596  1.00 42.13 ? 405 ASN A CB    1 
ATOM   3207 C  CG    . ASN A 1 408 ? 16.062 -0.593  -7.868  1.00 57.62 ? 405 ASN A CG    1 
ATOM   3208 O  OD1   . ASN A 1 408 ? 17.229 -0.196  -7.922  1.00 55.03 ? 405 ASN A OD1   1 
ATOM   3209 N  ND2   . ASN A 1 408 ? 15.730 -1.870  -8.032  1.00 58.88 ? 405 ASN A ND2   1 
ATOM   3210 N  N     . CYS A 1 409 ? 16.677 1.166   -4.537  1.00 41.94 ? 406 CYS A N     1 
ATOM   3211 C  CA    . CYS A 1 409 ? 17.066 0.616   -3.245  1.00 41.77 ? 406 CYS A CA    1 
ATOM   3212 C  C     . CYS A 1 409 ? 16.340 1.394   -2.167  1.00 34.92 ? 406 CYS A C     1 
ATOM   3213 O  O     . CYS A 1 409 ? 16.470 1.104   -0.980  1.00 51.87 ? 406 CYS A O     1 
ATOM   3214 C  CB    . CYS A 1 409 ? 18.572 0.742   -3.023  1.00 40.83 ? 406 CYS A CB    1 
ATOM   3215 S  SG    . CYS A 1 409 ? 19.572 0.125   -4.374  1.00 59.88 ? 406 CYS A SG    1 
ATOM   3216 N  N     . ASN A 1 410 ? 15.586 2.399   -2.593  1.00 42.39 ? 407 ASN A N     1 
ATOM   3217 C  CA    . ASN A 1 410 ? 14.839 3.235   -1.670  1.00 41.86 ? 407 ASN A CA    1 
ATOM   3218 C  C     . ASN A 1 410 ? 13.512 2.592   -1.252  1.00 51.75 ? 407 ASN A C     1 
ATOM   3219 O  O     . ASN A 1 410 ? 12.562 2.530   -2.034  1.00 43.42 ? 407 ASN A O     1 
ATOM   3220 C  CB    . ASN A 1 410 ? 14.600 4.606   -2.292  1.00 39.32 ? 407 ASN A CB    1 
ATOM   3221 C  CG    . ASN A 1 410 ? 13.989 5.579   -1.322  1.00 41.11 ? 407 ASN A CG    1 
ATOM   3222 O  OD1   . ASN A 1 410 ? 13.717 5.236   -0.171  1.00 42.51 ? 407 ASN A OD1   1 
ATOM   3223 N  ND2   . ASN A 1 410 ? 13.779 6.812   -1.775  1.00 41.07 ? 407 ASN A ND2   1 
ATOM   3224 N  N     . THR A 1 411 ? 13.462 2.117   -0.010  1.00 50.48 ? 408 THR A N     1 
ATOM   3225 C  CA    . THR A 1 411 ? 12.273 1.472   0.539   1.00 47.69 ? 408 THR A CA    1 
ATOM   3226 C  C     . THR A 1 411 ? 11.132 2.466   0.728   1.00 58.60 ? 408 THR A C     1 
ATOM   3227 O  O     . THR A 1 411 ? 9.960  2.111   0.598   1.00 66.26 ? 408 THR A O     1 
ATOM   3228 C  CB    . THR A 1 411 ? 12.578 0.807   1.898   1.00 42.91 ? 408 THR A CB    1 
ATOM   3229 O  OG1   . THR A 1 411 ? 13.561 -0.221  1.724   1.00 56.73 ? 408 THR A OG1   1 
ATOM   3230 C  CG2   . THR A 1 411 ? 11.317 0.199   2.493   1.00 71.21 ? 408 THR A CG2   1 
ATOM   3231 N  N     . SER A 1 412 ? 11.485 3.711   1.037   1.00 54.11 ? 409 SER A N     1 
ATOM   3232 C  CA    . SER A 1 412 ? 10.503 4.763   1.293   1.00 58.51 ? 409 SER A CA    1 
ATOM   3233 C  C     . SER A 1 412 ? 9.357  4.775   0.290   1.00 58.17 ? 409 SER A C     1 
ATOM   3234 O  O     . SER A 1 412 ? 9.572  4.664   -0.916  1.00 59.51 ? 409 SER A O     1 
ATOM   3235 C  CB    . SER A 1 412 ? 11.185 6.132   1.307   1.00 54.33 ? 409 SER A CB    1 
ATOM   3236 O  OG    . SER A 1 412 ? 10.230 7.180   1.323   1.00 60.10 ? 409 SER A OG    1 
ATOM   3237 N  N     . GLY A 1 413 ? 8.138  4.912   0.803   1.00 60.85 ? 410 GLY A N     1 
ATOM   3238 C  CA    . GLY A 1 413 ? 6.969  5.053   -0.043  1.00 68.96 ? 410 GLY A CA    1 
ATOM   3239 C  C     . GLY A 1 413 ? 6.896  6.463   -0.595  1.00 72.05 ? 410 GLY A C     1 
ATOM   3240 O  O     . GLY A 1 413 ? 6.273  6.712   -1.628  1.00 73.27 ? 410 GLY A O     1 
ATOM   3241 N  N     . ILE A 1 414 ? 7.538  7.392   0.105   1.00 65.10 ? 411 ILE A N     1 
ATOM   3242 C  CA    . ILE A 1 414 ? 7.635  8.769   -0.351  1.00 60.28 ? 411 ILE A CA    1 
ATOM   3243 C  C     . ILE A 1 414 ? 8.800  8.895   -1.331  1.00 68.77 ? 411 ILE A C     1 
ATOM   3244 O  O     . ILE A 1 414 ? 9.866  8.312   -1.124  1.00 64.20 ? 411 ILE A O     1 
ATOM   3245 C  CB    . ILE A 1 414 ? 7.858  9.728   0.831   1.00 60.86 ? 411 ILE A CB    1 
ATOM   3246 C  CG1   . ILE A 1 414 ? 7.081  9.243   2.057   1.00 50.90 ? 411 ILE A CG1   1 
ATOM   3247 C  CG2   . ILE A 1 414 ? 7.477  11.157  0.447   1.00 58.13 ? 411 ILE A CG2   1 
ATOM   3248 C  CD1   . ILE A 1 414 ? 7.371  10.034  3.313   1.00 55.43 ? 411 ILE A CD1   1 
ATOM   3249 N  N     . GLN A 1 415 ? 8.588  9.658   -2.398  1.00 80.90 ? 412 GLN A N     1 
ATOM   3250 C  CA    . GLN A 1 415 ? 9.593  9.847   -3.440  1.00 72.21 ? 412 GLN A CA    1 
ATOM   3251 C  C     . GLN A 1 415 ? 10.783 10.656  -2.930  1.00 71.52 ? 412 GLN A C     1 
ATOM   3252 O  O     . GLN A 1 415 ? 11.929 10.402  -3.308  1.00 76.14 ? 412 GLN A O     1 
ATOM   3253 C  CB    . GLN A 1 415 ? 8.962  10.579  -4.627  1.00 74.64 ? 412 GLN A CB    1 
ATOM   3254 C  CG    . GLN A 1 415 ? 9.805  10.595  -5.892  1.00 76.67 ? 412 GLN A CG    1 
ATOM   3255 C  CD    . GLN A 1 415 ? 9.751  9.279   -6.641  1.00 79.68 ? 412 GLN A CD    1 
ATOM   3256 O  OE1   . GLN A 1 415 ? 10.061 8.222   -6.088  1.00 80.29 ? 412 GLN A OE1   1 
ATOM   3257 N  NE2   . GLN A 1 415 ? 9.345  9.335   -7.906  1.00 71.66 ? 412 GLN A NE2   1 
ATOM   3258 N  N     . THR A 1 416 ? 10.500 11.629  -2.069  1.00 65.55 ? 413 THR A N     1 
ATOM   3259 C  CA    . THR A 1 416 ? 11.500 12.601  -1.632  1.00 63.57 ? 413 THR A CA    1 
ATOM   3260 C  C     . THR A 1 416 ? 12.339 12.119  -0.450  1.00 57.92 ? 413 THR A C     1 
ATOM   3261 O  O     . THR A 1 416 ? 13.400 12.672  -0.165  1.00 53.53 ? 413 THR A O     1 
ATOM   3262 C  CB    . THR A 1 416 ? 10.832 13.936  -1.264  1.00 56.76 ? 413 THR A CB    1 
ATOM   3263 O  OG1   . THR A 1 416 ? 9.933  14.317  -2.311  1.00 64.68 ? 413 THR A OG1   1 
ATOM   3264 C  CG2   . THR A 1 416 ? 11.875 15.027  -1.067  1.00 60.10 ? 413 THR A CG2   1 
ATOM   3265 N  N     . GLU A 1 417 ? 11.861 11.090  0.239   1.00 57.84 ? 414 GLU A N     1 
ATOM   3266 C  CA    . GLU A 1 417 ? 12.594 10.538  1.370   1.00 53.46 ? 414 GLU A CA    1 
ATOM   3267 C  C     . GLU A 1 417 ? 13.400 9.317   0.957   1.00 55.11 ? 414 GLU A C     1 
ATOM   3268 O  O     . GLU A 1 417 ? 13.007 8.578   0.052   1.00 56.14 ? 414 GLU A O     1 
ATOM   3269 C  CB    . GLU A 1 417 ? 11.641 10.179  2.513   1.00 49.17 ? 414 GLU A CB    1 
ATOM   3270 C  CG    . GLU A 1 417 ? 10.783 11.339  2.972   1.00 55.90 ? 414 GLU A CG    1 
ATOM   3271 C  CD    . GLU A 1 417 ? 11.592 12.599  3.197   1.00 56.53 ? 414 GLU A CD    1 
ATOM   3272 O  OE1   . GLU A 1 417 ? 12.547 12.560  4.003   1.00 54.74 ? 414 GLU A OE1   1 
ATOM   3273 O  OE2   . GLU A 1 417 ? 11.276 13.626  2.559   1.00 59.87 ? 414 GLU A OE2   1 
ATOM   3274 N  N     . TRP A 1 418 ? 14.533 9.110   1.618   1.00 41.62 ? 415 TRP A N     1 
ATOM   3275 C  CA    . TRP A 1 418 ? 15.353 7.943   1.344   1.00 40.91 ? 415 TRP A CA    1 
ATOM   3276 C  C     . TRP A 1 418 ? 15.508 7.070   2.582   1.00 37.67 ? 415 TRP A C     1 
ATOM   3277 O  O     . TRP A 1 418 ? 16.132 7.470   3.564   1.00 41.97 ? 415 TRP A O     1 
ATOM   3278 C  CB    . TRP A 1 418 ? 16.730 8.345   0.812   1.00 37.64 ? 415 TRP A CB    1 
ATOM   3279 C  CG    . TRP A 1 418 ? 17.400 7.212   0.128   1.00 27.62 ? 415 TRP A CG    1 
ATOM   3280 C  CD1   . TRP A 1 418 ? 17.919 6.100   0.711   1.00 27.44 ? 415 TRP A CD1   1 
ATOM   3281 C  CD2   . TRP A 1 418 ? 17.604 7.064   -1.281  1.00 28.27 ? 415 TRP A CD2   1 
ATOM   3282 N  NE1   . TRP A 1 418 ? 18.438 5.261   -0.248  1.00 37.32 ? 415 TRP A NE1   1 
ATOM   3283 C  CE2   . TRP A 1 418 ? 18.256 5.832   -1.480  1.00 31.72 ? 415 TRP A CE2   1 
ATOM   3284 C  CE3   . TRP A 1 418 ? 17.296 7.856   -2.394  1.00 39.29 ? 415 TRP A CE3   1 
ATOM   3285 C  CZ2   . TRP A 1 418 ? 18.615 5.372   -2.747  1.00 35.10 ? 415 TRP A CZ2   1 
ATOM   3286 C  CZ3   . TRP A 1 418 ? 17.653 7.398   -3.654  1.00 35.72 ? 415 TRP A CZ3   1 
ATOM   3287 C  CH2   . TRP A 1 418 ? 18.305 6.169   -3.819  1.00 34.89 ? 415 TRP A CH2   1 
ATOM   3288 N  N     . SER A 1 419 ? 14.932 5.875   2.533   1.00 42.73 ? 416 SER A N     1 
ATOM   3289 C  CA    . SER A 1 419 ? 15.112 4.903   3.602   1.00 38.56 ? 416 SER A CA    1 
ATOM   3290 C  C     . SER A 1 419 ? 15.432 3.544   3.004   1.00 41.74 ? 416 SER A C     1 
ATOM   3291 O  O     . SER A 1 419 ? 14.961 3.222   1.915   1.00 48.76 ? 416 SER A O     1 
ATOM   3292 C  CB    . SER A 1 419 ? 13.864 4.818   4.484   1.00 43.01 ? 416 SER A CB    1 
ATOM   3293 O  OG    . SER A 1 419 ? 12.727 4.452   3.722   1.00 62.56 ? 416 SER A OG    1 
ATOM   3294 N  N     . PRO A 1 420 ? 16.272 2.761   3.697   1.00 44.41 ? 417 PRO A N     1 
ATOM   3295 C  CA    . PRO A 1 420 ? 16.976 3.267   4.878   1.00 46.88 ? 417 PRO A CA    1 
ATOM   3296 C  C     . PRO A 1 420 ? 18.062 4.241   4.441   1.00 40.16 ? 417 PRO A C     1 
ATOM   3297 O  O     . PRO A 1 420 ? 18.539 4.124   3.313   1.00 37.41 ? 417 PRO A O     1 
ATOM   3298 C  CB    . PRO A 1 420 ? 17.599 2.006   5.480   1.00 44.62 ? 417 PRO A CB    1 
ATOM   3299 C  CG    . PRO A 1 420 ? 17.756 1.081   4.323   1.00 50.12 ? 417 PRO A CG    1 
ATOM   3300 C  CD    . PRO A 1 420 ? 16.585 1.348   3.425   1.00 35.07 ? 417 PRO A CD    1 
ATOM   3301 N  N     . PRO A 1 421 ? 18.440 5.193   5.312   1.00 34.76 ? 418 PRO A N     1 
ATOM   3302 C  CA    . PRO A 1 421 ? 19.460 6.186   4.952   1.00 39.24 ? 418 PRO A CA    1 
ATOM   3303 C  C     . PRO A 1 421 ? 20.736 5.528   4.422   1.00 29.59 ? 418 PRO A C     1 
ATOM   3304 O  O     . PRO A 1 421 ? 20.999 4.364   4.733   1.00 28.97 ? 418 PRO A O     1 
ATOM   3305 C  CB    . PRO A 1 421 ? 19.735 6.905   6.277   1.00 37.07 ? 418 PRO A CB    1 
ATOM   3306 C  CG    . PRO A 1 421 ? 18.486 6.711   7.082   1.00 47.09 ? 418 PRO A CG    1 
ATOM   3307 C  CD    . PRO A 1 421 ? 17.965 5.356   6.699   1.00 43.37 ? 418 PRO A CD    1 
ATOM   3308 N  N     . LEU A 1 422 ? 21.507 6.267   3.626   1.00 29.76 ? 419 LEU A N     1 
ATOM   3309 C  CA    . LEU A 1 422 ? 22.723 5.739   3.006   1.00 29.22 ? 419 LEU A CA    1 
ATOM   3310 C  C     . LEU A 1 422 ? 23.967 6.178   3.778   1.00 23.66 ? 419 LEU A C     1 
ATOM   3311 O  O     . LEU A 1 422 ? 24.158 7.369   4.032   1.00 28.93 ? 419 LEU A O     1 
ATOM   3312 C  CB    . LEU A 1 422 ? 22.829 6.215   1.550   1.00 23.14 ? 419 LEU A CB    1 
ATOM   3313 C  CG    . LEU A 1 422 ? 21.767 5.742   0.555   1.00 28.17 ? 419 LEU A CG    1 
ATOM   3314 C  CD1   . LEU A 1 422 ? 22.188 6.065   -0.878  1.00 22.49 ? 419 LEU A CD1   1 
ATOM   3315 C  CD2   . LEU A 1 422 ? 21.498 4.254   0.709   1.00 28.87 ? 419 LEU A CD2   1 
ATOM   3316 N  N     . THR A 1 423 ? 24.815 5.224   4.145   1.00 23.77 ? 420 THR A N     1 
ATOM   3317 C  CA    . THR A 1 423 ? 25.993 5.545   4.948   1.00 25.05 ? 420 THR A CA    1 
ATOM   3318 C  C     . THR A 1 423 ? 27.304 5.441   4.163   1.00 22.05 ? 420 THR A C     1 
ATOM   3319 O  O     . THR A 1 423 ? 28.384 5.623   4.720   1.00 15.02 ? 420 THR A O     1 
ATOM   3320 C  CB    . THR A 1 423 ? 26.083 4.650   6.187   1.00 20.42 ? 420 THR A CB    1 
ATOM   3321 O  OG1   . THR A 1 423 ? 26.106 3.275   5.781   1.00 26.77 ? 420 THR A OG1   1 
ATOM   3322 C  CG2   . THR A 1 423 ? 24.883 4.891   7.099   1.00 31.19 ? 420 THR A CG2   1 
ATOM   3323 N  N     . MET A 1 424 ? 27.201 5.139   2.875   1.00 15.65 ? 421 MET A N     1 
ATOM   3324 C  CA    . MET A 1 424 ? 28.370 5.140   1.996   1.00 14.25 ? 421 MET A CA    1 
ATOM   3325 C  C     . MET A 1 424 ? 27.951 5.228   0.540   1.00 16.62 ? 421 MET A C     1 
ATOM   3326 O  O     . MET A 1 424 ? 26.963 4.618   0.147   1.00 17.92 ? 421 MET A O     1 
ATOM   3327 C  CB    . MET A 1 424 ? 29.222 3.894   2.224   1.00 14.08 ? 421 MET A CB    1 
ATOM   3328 C  CG    . MET A 1 424 ? 30.515 3.833   1.400   1.00 18.88 ? 421 MET A CG    1 
ATOM   3329 S  SD    . MET A 1 424 ? 30.238 3.178   -0.257  1.00 24.51 ? 421 MET A SD    1 
ATOM   3330 C  CE    . MET A 1 424 ? 29.613 1.554   0.145   1.00 20.49 ? 421 MET A CE    1 
ATOM   3331 N  N     . LEU A 1 425 ? 28.693 6.014   -0.240  1.00 11.57 ? 422 LEU A N     1 
ATOM   3332 C  CA    . LEU A 1 425 ? 28.522 6.103   -1.685  1.00 13.23 ? 422 LEU A CA    1 
ATOM   3333 C  C     . LEU A 1 425 ? 29.897 5.924   -2.329  1.00 16.29 ? 422 LEU A C     1 
ATOM   3334 O  O     . LEU A 1 425 ? 30.915 6.376   -1.784  1.00 17.86 ? 422 LEU A O     1 
ATOM   3335 C  CB    . LEU A 1 425 ? 27.960 7.462   -2.097  1.00 8.37  ? 422 LEU A CB    1 
ATOM   3336 C  CG    . LEU A 1 425 ? 26.562 7.910   -1.662  1.00 14.32 ? 422 LEU A CG    1 
ATOM   3337 C  CD1   . LEU A 1 425 ? 26.324 9.345   -2.151  1.00 15.92 ? 422 LEU A CD1   1 
ATOM   3338 C  CD2   . LEU A 1 425 ? 25.450 6.961   -2.161  1.00 9.96  ? 422 LEU A CD2   1 
ATOM   3339 N  N     . PHE A 1 426 ? 29.923 5.283   -3.490  1.00 14.05 ? 423 PHE A N     1 
ATOM   3340 C  CA    . PHE A 1 426 ? 31.174 4.894   -4.133  1.00 12.57 ? 423 PHE A CA    1 
ATOM   3341 C  C     . PHE A 1 426 ? 30.979 4.896   -5.643  1.00 16.58 ? 423 PHE A C     1 
ATOM   3342 O  O     . PHE A 1 426 ? 30.076 4.233   -6.157  1.00 23.05 ? 423 PHE A O     1 
ATOM   3343 C  CB    . PHE A 1 426 ? 31.557 3.489   -3.661  1.00 19.21 ? 423 PHE A CB    1 
ATOM   3344 C  CG    . PHE A 1 426 ? 32.894 3.010   -4.154  1.00 20.41 ? 423 PHE A CG    1 
ATOM   3345 C  CD1   . PHE A 1 426 ? 33.115 1.659   -4.357  1.00 37.19 ? 423 PHE A CD1   1 
ATOM   3346 C  CD2   . PHE A 1 426 ? 33.935 3.896   -4.384  1.00 19.26 ? 423 PHE A CD2   1 
ATOM   3347 C  CE1   . PHE A 1 426 ? 34.341 1.199   -4.799  1.00 27.92 ? 423 PHE A CE1   1 
ATOM   3348 C  CE2   . PHE A 1 426 ? 35.169 3.443   -4.822  1.00 22.17 ? 423 PHE A CE2   1 
ATOM   3349 C  CZ    . PHE A 1 426 ? 35.373 2.091   -5.023  1.00 22.48 ? 423 PHE A CZ    1 
ATOM   3350 N  N     . LEU A 1 427 ? 31.797 5.662   -6.355  1.00 10.92 ? 424 LEU A N     1 
ATOM   3351 C  CA    . LEU A 1 427 ? 31.826 5.584   -7.812  1.00 10.33 ? 424 LEU A CA    1 
ATOM   3352 C  C     . LEU A 1 427 ? 33.198 5.132   -8.255  1.00 14.93 ? 424 LEU A C     1 
ATOM   3353 O  O     . LEU A 1 427 ? 34.195 5.710   -7.842  1.00 15.86 ? 424 LEU A O     1 
ATOM   3354 C  CB    . LEU A 1 427 ? 31.505 6.924   -8.471  1.00 13.16 ? 424 LEU A CB    1 
ATOM   3355 C  CG    . LEU A 1 427 ? 30.168 7.574   -8.142  1.00 16.93 ? 424 LEU A CG    1 
ATOM   3356 C  CD1   . LEU A 1 427 ? 30.063 8.920   -8.864  1.00 16.46 ? 424 LEU A CD1   1 
ATOM   3357 C  CD2   . LEU A 1 427 ? 28.993 6.651   -8.511  1.00 13.96 ? 424 LEU A CD2   1 
ATOM   3358 N  N     . CYS A 1 428 ? 33.254 4.104   -9.102  1.00 14.11 ? 425 CYS A N     1 
ATOM   3359 C  CA    . CYS A 1 428 ? 34.545 3.615   -9.591  1.00 13.86 ? 425 CYS A CA    1 
ATOM   3360 C  C     . CYS A 1 428 ? 34.540 3.402   -11.104 1.00 15.56 ? 425 CYS A C     1 
ATOM   3361 O  O     . CYS A 1 428 ? 33.667 2.713   -11.632 1.00 16.01 ? 425 CYS A O     1 
ATOM   3362 C  CB    . CYS A 1 428 ? 34.943 2.316   -8.884  1.00 20.20 ? 425 CYS A CB    1 
ATOM   3363 S  SG    . CYS A 1 428 ? 36.618 1.739   -9.295  1.00 24.92 ? 425 CYS A SG    1 
ATOM   3364 N  N     . ALA A 1 429 ? 35.522 3.988   -11.787 1.00 14.64 ? 426 ALA A N     1 
ATOM   3365 C  CA    . ALA A 1 429 ? 35.681 3.793   -13.219 1.00 15.03 ? 426 ALA A CA    1 
ATOM   3366 C  C     . ALA A 1 429 ? 36.639 2.629   -13.461 1.00 18.41 ? 426 ALA A C     1 
ATOM   3367 O  O     . ALA A 1 429 ? 37.689 2.538   -12.820 1.00 16.16 ? 426 ALA A O     1 
ATOM   3368 C  CB    . ALA A 1 429 ? 36.205 5.058   -13.874 1.00 13.59 ? 426 ALA A CB    1 
ATOM   3369 N  N     . THR A 1 430 ? 36.271 1.732   -14.375 1.00 18.61 ? 427 THR A N     1 
ATOM   3370 C  CA    . THR A 1 430 ? 37.018 0.497   -14.566 1.00 22.89 ? 427 THR A CA    1 
ATOM   3371 C  C     . THR A 1 430 ? 37.026 0.078   -16.034 1.00 22.09 ? 427 THR A C     1 
ATOM   3372 O  O     . THR A 1 430 ? 36.403 0.727   -16.878 1.00 19.38 ? 427 THR A O     1 
ATOM   3373 C  CB    . THR A 1 430 ? 36.404 -0.659  -13.736 1.00 19.98 ? 427 THR A CB    1 
ATOM   3374 O  OG1   . THR A 1 430 ? 35.173 -1.080  -14.336 1.00 22.77 ? 427 THR A OG1   1 
ATOM   3375 C  CG2   . THR A 1 430 ? 36.127 -0.222  -12.293 1.00 21.83 ? 427 THR A CG2   1 
ATOM   3376 N  N     . LYS A 1 431 ? 37.728 -1.014  -16.326 1.00 25.11 ? 428 LYS A N     1 
ATOM   3377 C  CA    . LYS A 1 431 ? 37.734 -1.597  -17.671 1.00 23.28 ? 428 LYS A CA    1 
ATOM   3378 C  C     . LYS A 1 431 ? 38.299 -0.635  -18.716 1.00 12.52 ? 428 LYS A C     1 
ATOM   3379 O  O     . LYS A 1 431 ? 37.601 -0.222  -19.653 1.00 17.25 ? 428 LYS A O     1 
ATOM   3380 C  CB    . LYS A 1 431 ? 36.321 -2.041  -18.061 1.00 15.51 ? 428 LYS A CB    1 
ATOM   3381 C  CG    . LYS A 1 431 ? 35.747 -3.133  -17.174 1.00 31.69 ? 428 LYS A CG    1 
ATOM   3382 C  CD    . LYS A 1 431 ? 34.508 -3.757  -17.815 1.00 31.83 ? 428 LYS A CD    1 
ATOM   3383 C  CE    . LYS A 1 431 ? 33.921 -4.873  -16.955 1.00 39.99 ? 428 LYS A CE    1 
ATOM   3384 N  NZ    . LYS A 1 431 ? 34.936 -5.898  -16.589 1.00 42.80 ? 428 LYS A NZ    1 
ATOM   3385 N  N     . PHE A 1 432 ? 39.569 -0.281  -18.560 1.00 18.04 ? 429 PHE A N     1 
ATOM   3386 C  CA    . PHE A 1 432 ? 40.188 0.712   -19.420 1.00 18.35 ? 429 PHE A CA    1 
ATOM   3387 C  C     . PHE A 1 432 ? 40.512 0.106   -20.782 1.00 28.52 ? 429 PHE A C     1 
ATOM   3388 O  O     . PHE A 1 432 ? 40.855 -1.082  -20.883 1.00 21.93 ? 429 PHE A O     1 
ATOM   3389 C  CB    . PHE A 1 432 ? 41.461 1.288   -18.764 1.00 18.69 ? 429 PHE A CB    1 
ATOM   3390 C  CG    . PHE A 1 432 ? 41.183 2.257   -17.640 1.00 19.10 ? 429 PHE A CG    1 
ATOM   3391 C  CD1   . PHE A 1 432 ? 41.025 3.606   -17.898 1.00 13.27 ? 429 PHE A CD1   1 
ATOM   3392 C  CD2   . PHE A 1 432 ? 41.078 1.817   -16.327 1.00 28.39 ? 429 PHE A CD2   1 
ATOM   3393 C  CE1   . PHE A 1 432 ? 40.761 4.503   -16.873 1.00 11.35 ? 429 PHE A CE1   1 
ATOM   3394 C  CE2   . PHE A 1 432 ? 40.818 2.707   -15.293 1.00 22.90 ? 429 PHE A CE2   1 
ATOM   3395 C  CZ    . PHE A 1 432 ? 40.657 4.057   -15.568 1.00 20.28 ? 429 PHE A CZ    1 
ATOM   3396 N  N     . SER A 1 433 ? 40.367 0.926   -21.820 1.00 23.21 ? 430 SER A N     1 
ATOM   3397 C  CA    . SER A 1 433 ? 40.803 0.595   -23.176 1.00 29.86 ? 430 SER A CA    1 
ATOM   3398 C  C     . SER A 1 433 ? 41.807 1.646   -23.626 1.00 29.14 ? 430 SER A C     1 
ATOM   3399 O  O     . SER A 1 433 ? 41.784 2.777   -23.137 1.00 18.95 ? 430 SER A O     1 
ATOM   3400 C  CB    . SER A 1 433 ? 39.619 0.586   -24.154 1.00 20.68 ? 430 SER A CB    1 
ATOM   3401 O  OG    . SER A 1 433 ? 38.650 -0.385  -23.803 1.00 37.42 ? 430 SER A OG    1 
ATOM   3402 N  N     . ALA A 1 434 ? 42.679 1.281   -24.561 1.00 18.71 ? 431 ALA A N     1 
ATOM   3403 C  CA    . ALA A 1 434 ? 43.679 2.216   -25.058 1.00 20.35 ? 431 ALA A CA    1 
ATOM   3404 C  C     . ALA A 1 434 ? 42.991 3.295   -25.875 1.00 26.81 ? 431 ALA A C     1 
ATOM   3405 O  O     . ALA A 1 434 ? 41.987 3.038   -26.548 1.00 28.80 ? 431 ALA A O     1 
ATOM   3406 C  CB    . ALA A 1 434 ? 44.732 1.495   -25.895 1.00 32.16 ? 431 ALA A CB    1 
ATOM   3407 N  N     . SER A 1 435 ? 43.522 4.509   -25.794 1.00 23.78 ? 432 SER A N     1 
ATOM   3408 C  CA    . SER A 1 435 ? 42.997 5.628   -26.566 1.00 28.38 ? 432 SER A CA    1 
ATOM   3409 C  C     . SER A 1 435 ? 44.146 6.556   -26.945 1.00 37.35 ? 432 SER A C     1 
ATOM   3410 O  O     . SER A 1 435 ? 43.945 7.627   -27.506 1.00 35.22 ? 432 SER A O     1 
ATOM   3411 C  CB    . SER A 1 435 ? 41.952 6.394   -25.759 1.00 28.62 ? 432 SER A CB    1 
ATOM   3412 O  OG    . SER A 1 435 ? 42.561 7.106   -24.696 1.00 43.28 ? 432 SER A OG    1 
ATOM   3413 O  OXT   . SER A 1 435 ? 45.312 6.258   -26.685 1.00 40.05 ? 432 SER A OXT   1 
ATOM   3414 O  "O3'" . DC  B 2 1   ? 27.982 4.893   11.752  1.00 49.17 ? 1   DC  T "O3'" 1 
ATOM   3415 P  P     . DA  B 2 2   ? 28.419 4.306   13.185  1.00 91.14 ? 2   DA  T P     1 
ATOM   3416 O  OP1   . DA  B 2 2   ? 28.600 2.840   13.044  1.00 69.26 ? 2   DA  T OP1   1 
ATOM   3417 O  OP2   . DA  B 2 2   ? 27.490 4.847   14.202  1.00 71.46 ? 2   DA  T OP2   1 
ATOM   3418 O  "O5'" . DA  B 2 2   ? 29.845 4.984   13.451  1.00 57.06 ? 2   DA  T "O5'" 1 
ATOM   3419 C  "C5'" . DA  B 2 2   ? 30.960 4.685   12.616  1.00 58.69 ? 2   DA  T "C5'" 1 
ATOM   3420 C  "C4'" . DA  B 2 2   ? 32.189 5.423   13.109  1.00 48.70 ? 2   DA  T "C4'" 1 
ATOM   3421 O  "O4'" . DA  B 2 2   ? 32.054 6.833   12.805  1.00 51.64 ? 2   DA  T "O4'" 1 
ATOM   3422 C  "C3'" . DA  B 2 2   ? 32.400 5.348   14.616  1.00 55.05 ? 2   DA  T "C3'" 1 
ATOM   3423 O  "O3'" . DA  B 2 2   ? 33.780 5.392   14.921  1.00 46.69 ? 2   DA  T "O3'" 1 
ATOM   3424 C  "C2'" . DA  B 2 2   ? 31.691 6.594   15.131  1.00 48.77 ? 2   DA  T "C2'" 1 
ATOM   3425 C  "C1'" . DA  B 2 2   ? 32.002 7.574   14.009  1.00 42.59 ? 2   DA  T "C1'" 1 
ATOM   3426 N  N9    . DA  B 2 2   ? 30.981 8.605   13.891  1.00 38.21 ? 2   DA  T N9    1 
ATOM   3427 C  C8    . DA  B 2 2   ? 29.700 8.572   14.374  1.00 42.36 ? 2   DA  T C8    1 
ATOM   3428 N  N7    . DA  B 2 2   ? 29.012 9.661   14.120  1.00 37.59 ? 2   DA  T N7    1 
ATOM   3429 C  C5    . DA  B 2 2   ? 29.913 10.456  13.424  1.00 31.51 ? 2   DA  T C5    1 
ATOM   3430 C  C6    . DA  B 2 2   ? 29.807 11.744  12.870  1.00 34.73 ? 2   DA  T C6    1 
ATOM   3431 N  N6    . DA  B 2 2   ? 28.688 12.476  12.935  1.00 42.06 ? 2   DA  T N6    1 
ATOM   3432 N  N1    . DA  B 2 2   ? 30.894 12.244  12.245  1.00 30.51 ? 2   DA  T N1    1 
ATOM   3433 C  C2    . DA  B 2 2   ? 32.010 11.505  12.174  1.00 22.16 ? 2   DA  T C2    1 
ATOM   3434 N  N3    . DA  B 2 2   ? 32.232 10.285  12.663  1.00 31.37 ? 2   DA  T N3    1 
ATOM   3435 C  C4    . DA  B 2 2   ? 31.131 9.822   13.279  1.00 31.51 ? 2   DA  T C4    1 
ATOM   3436 P  P     . DT  B 2 3   ? 34.589 4.030   15.178  1.00 46.36 ? 3   DT  T P     1 
ATOM   3437 O  OP1   . DT  B 2 3   ? 33.725 3.129   15.971  1.00 53.07 ? 3   DT  T OP1   1 
ATOM   3438 O  OP2   . DT  B 2 3   ? 35.945 4.388   15.657  1.00 56.83 ? 3   DT  T OP2   1 
ATOM   3439 O  "O5'" . DT  B 2 3   ? 34.734 3.398   13.718  1.00 48.74 ? 3   DT  T "O5'" 1 
ATOM   3440 C  "C5'" . DT  B 2 3   ? 36.024 3.300   13.111  1.00 55.02 ? 3   DT  T "C5'" 1 
ATOM   3441 C  "C4'" . DT  B 2 3   ? 36.354 4.567   12.342  1.00 54.69 ? 3   DT  T "C4'" 1 
ATOM   3442 O  "O4'" . DT  B 2 3   ? 37.789 4.728   12.202  1.00 53.59 ? 3   DT  T "O4'" 1 
ATOM   3443 C  "C3'" . DT  B 2 3   ? 35.768 4.641   10.935  1.00 47.80 ? 3   DT  T "C3'" 1 
ATOM   3444 O  "O3'" . DT  B 2 3   ? 35.118 5.881   10.821  1.00 32.67 ? 3   DT  T "O3'" 1 
ATOM   3445 C  "C2'" . DT  B 2 3   ? 36.978 4.550   10.007  1.00 43.18 ? 3   DT  T "C2'" 1 
ATOM   3446 C  "C1'" . DT  B 2 3   ? 38.103 5.109   10.875  1.00 50.43 ? 3   DT  T "C1'" 1 
ATOM   3447 N  N1    . DT  B 2 3   ? 39.454 4.535   10.566  1.00 51.31 ? 3   DT  T N1    1 
ATOM   3448 C  C2    . DT  B 2 3   ? 40.507 5.339   10.144  1.00 47.86 ? 3   DT  T C2    1 
ATOM   3449 O  O2    . DT  B 2 3   ? 40.427 6.551   9.989   1.00 51.96 ? 3   DT  T O2    1 
ATOM   3450 N  N3    . DT  B 2 3   ? 41.685 4.662   9.908   1.00 33.36 ? 3   DT  T N3    1 
ATOM   3451 C  C4    . DT  B 2 3   ? 41.897 3.297   10.051  1.00 42.17 ? 3   DT  T C4    1 
ATOM   3452 O  O4    . DT  B 2 3   ? 42.986 2.779   9.818   1.00 45.39 ? 3   DT  T O4    1 
ATOM   3453 C  C5    . DT  B 2 3   ? 40.757 2.524   10.497  1.00 40.33 ? 3   DT  T C5    1 
ATOM   3454 C  C7    . DT  B 2 3   ? 40.854 1.037   10.692  1.00 47.74 ? 3   DT  T C7    1 
ATOM   3455 C  C6    . DT  B 2 3   ? 39.610 3.173   10.730  1.00 43.43 ? 3   DT  T C6    1 
ATOM   3456 P  P     . DT  B 2 4   ? 34.246 6.215   9.523   1.00 42.70 ? 4   DT  T P     1 
ATOM   3457 O  OP1   . DT  B 2 4   ? 33.354 7.352   9.852   1.00 42.13 ? 4   DT  T OP1   1 
ATOM   3458 O  OP2   . DT  B 2 4   ? 33.678 4.944   9.021   1.00 46.11 ? 4   DT  T OP2   1 
ATOM   3459 O  "O5'" . DT  B 2 4   ? 35.335 6.702   8.458   1.00 31.22 ? 4   DT  T "O5'" 1 
ATOM   3460 C  "C5'" . DT  B 2 4   ? 36.053 7.916   8.635   1.00 25.55 ? 4   DT  T "C5'" 1 
ATOM   3461 C  "C4'" . DT  B 2 4   ? 36.833 8.190   7.365   1.00 20.63 ? 4   DT  T "C4'" 1 
ATOM   3462 O  "O4'" . DT  B 2 4   ? 38.028 7.374   7.308   1.00 23.79 ? 4   DT  T "O4'" 1 
ATOM   3463 C  "C3'" . DT  B 2 4   ? 36.066 7.880   6.088   1.00 16.91 ? 4   DT  T "C3'" 1 
ATOM   3464 O  "O3'" . DT  B 2 4   ? 36.353 8.926   5.189   1.00 20.72 ? 4   DT  T "O3'" 1 
ATOM   3465 C  "C2'" . DT  B 2 4   ? 36.620 6.527   5.644   1.00 16.27 ? 4   DT  T "C2'" 1 
ATOM   3466 C  "C1'" . DT  B 2 4   ? 38.070 6.688   6.074   1.00 23.62 ? 4   DT  T "C1'" 1 
ATOM   3467 N  N1    . DT  B 2 4   ? 38.824 5.437   6.328   1.00 19.59 ? 4   DT  T N1    1 
ATOM   3468 C  C2    . DT  B 2 4   ? 40.145 5.405   5.949   1.00 16.33 ? 4   DT  T C2    1 
ATOM   3469 O  O2    . DT  B 2 4   ? 40.716 6.339   5.413   1.00 13.32 ? 4   DT  T O2    1 
ATOM   3470 N  N3    . DT  B 2 4   ? 40.779 4.233   6.227   1.00 20.27 ? 4   DT  T N3    1 
ATOM   3471 C  C4    . DT  B 2 4   ? 40.247 3.113   6.829   1.00 17.85 ? 4   DT  T C4    1 
ATOM   3472 O  O4    . DT  B 2 4   ? 40.934 2.119   7.022   1.00 15.97 ? 4   DT  T O4    1 
ATOM   3473 C  C5    . DT  B 2 4   ? 38.855 3.212   7.206   1.00 26.16 ? 4   DT  T C5    1 
ATOM   3474 C  C7    . DT  B 2 4   ? 38.160 2.058   7.872   1.00 24.27 ? 4   DT  T C7    1 
ATOM   3475 C  C6    . DT  B 2 4   ? 38.215 4.362   6.945   1.00 21.33 ? 4   DT  T C6    1 
ATOM   3476 P  P     . DA  B 2 5   ? 35.718 8.925   3.725   1.00 15.89 ? 5   DA  T P     1 
ATOM   3477 O  OP1   . DA  B 2 5   ? 35.419 10.318  3.365   1.00 13.69 ? 5   DA  T OP1   1 
ATOM   3478 O  OP2   . DA  B 2 5   ? 34.666 7.880   3.682   1.00 17.64 ? 5   DA  T OP2   1 
ATOM   3479 O  "O5'" . DA  B 2 5   ? 36.927 8.417   2.800   1.00 14.73 ? 5   DA  T "O5'" 1 
ATOM   3480 C  "C5'" . DA  B 2 5   ? 38.038 9.276   2.563   1.00 9.19  ? 5   DA  T "C5'" 1 
ATOM   3481 C  "C4'" . DA  B 2 5   ? 39.021 8.629   1.602   1.00 13.94 ? 5   DA  T "C4'" 1 
ATOM   3482 O  "O4'" . DA  B 2 5   ? 39.581 7.424   2.189   1.00 11.49 ? 5   DA  T "O4'" 1 
ATOM   3483 C  "C3'" . DA  B 2 5   ? 38.405 8.203   0.271   1.00 12.70 ? 5   DA  T "C3'" 1 
ATOM   3484 O  "O3'" . DA  B 2 5   ? 39.321 8.475   -0.777  1.00 13.12 ? 5   DA  T "O3'" 1 
ATOM   3485 C  "C2'" . DA  B 2 5   ? 38.252 6.698   0.430   1.00 15.85 ? 5   DA  T "C2'" 1 
ATOM   3486 C  "C1'" . DA  B 2 5   ? 39.519 6.390   1.233   1.00 17.58 ? 5   DA  T "C1'" 1 
ATOM   3487 N  N9    . DA  B 2 5   ? 39.457 5.147   1.985   1.00 16.30 ? 5   DA  T N9    1 
ATOM   3488 C  C8    . DA  B 2 5   ? 38.371 4.655   2.640   1.00 12.05 ? 5   DA  T C8    1 
ATOM   3489 N  N7    . DA  B 2 5   ? 38.597 3.516   3.255   1.00 14.49 ? 5   DA  T N7    1 
ATOM   3490 C  C5    . DA  B 2 5   ? 39.927 3.249   2.987   1.00 17.31 ? 5   DA  T C5    1 
ATOM   3491 C  C6    . DA  B 2 5   ? 40.763 2.179   3.348   1.00 16.96 ? 5   DA  T C6    1 
ATOM   3492 N  N6    . DA  B 2 5   ? 40.357 1.148   4.099   1.00 12.77 ? 5   DA  T N6    1 
ATOM   3493 N  N1    . DA  B 2 5   ? 42.038 2.219   2.911   1.00 19.88 ? 5   DA  T N1    1 
ATOM   3494 C  C2    . DA  B 2 5   ? 42.441 3.253   2.164   1.00 14.39 ? 5   DA  T C2    1 
ATOM   3495 N  N3    . DA  B 2 5   ? 41.739 4.302   1.755   1.00 12.00 ? 5   DA  T N3    1 
ATOM   3496 C  C4    . DA  B 2 5   ? 40.478 4.241   2.205   1.00 16.40 ? 5   DA  T C4    1 
ATOM   3497 P  P     . DT  B 2 6   ? 38.832 8.451   -2.308  1.00 14.29 ? 6   DT  T P     1 
ATOM   3498 O  OP1   . DT  B 2 6   ? 39.967 8.870   -3.147  1.00 14.89 ? 6   DT  T OP1   1 
ATOM   3499 O  OP2   . DT  B 2 6   ? 37.532 9.144   -2.387  1.00 16.62 ? 6   DT  T OP2   1 
ATOM   3500 O  "O5'" . DT  B 2 6   ? 38.491 6.919   -2.572  1.00 18.03 ? 6   DT  T "O5'" 1 
ATOM   3501 C  "C5'" . DT  B 2 6   ? 39.218 6.135   -3.501  1.00 17.30 ? 6   DT  T "C5'" 1 
ATOM   3502 C  "C4'" . DT  B 2 6   ? 40.452 5.529   -2.868  1.00 18.13 ? 6   DT  T "C4'" 1 
ATOM   3503 O  "O4'" . DT  B 2 6   ? 40.097 4.825   -1.663  1.00 16.60 ? 6   DT  T "O4'" 1 
ATOM   3504 C  "C3'" . DT  B 2 6   ? 41.063 4.456   -3.755  1.00 20.90 ? 6   DT  T "C3'" 1 
ATOM   3505 O  "O3'" . DT  B 2 6   ? 42.043 5.067   -4.553  1.00 13.55 ? 6   DT  T "O3'" 1 
ATOM   3506 C  "C2'" . DT  B 2 6   ? 41.682 3.454   -2.783  1.00 20.29 ? 6   DT  T "C2'" 1 
ATOM   3507 C  "C1'" . DT  B 2 6   ? 41.071 3.833   -1.437  1.00 18.97 ? 6   DT  T "C1'" 1 
ATOM   3508 N  N1    . DT  B 2 6   ? 40.389 2.717   -0.747  1.00 23.58 ? 6   DT  T N1    1 
ATOM   3509 C  C2    . DT  B 2 6   ? 41.116 1.614   -0.367  1.00 14.83 ? 6   DT  T C2    1 
ATOM   3510 O  O2    . DT  B 2 6   ? 42.305 1.489   -0.581  1.00 17.04 ? 6   DT  T O2    1 
ATOM   3511 N  N3    . DT  B 2 6   ? 40.387 0.655   0.284   1.00 12.98 ? 6   DT  T N3    1 
ATOM   3512 C  C4    . DT  B 2 6   ? 39.045 0.700   0.590   1.00 16.07 ? 6   DT  T C4    1 
ATOM   3513 O  O4    . DT  B 2 6   ? 38.467 -0.204  1.176   1.00 15.53 ? 6   DT  T O4    1 
ATOM   3514 C  C5    . DT  B 2 6   ? 38.348 1.885   0.170   1.00 16.48 ? 6   DT  T C5    1 
ATOM   3515 C  C7    . DT  B 2 6   ? 36.881 2.008   0.455   1.00 20.07 ? 6   DT  T C7    1 
ATOM   3516 C  C6    . DT  B 2 6   ? 39.043 2.828   -0.470  1.00 16.52 ? 6   DT  T C6    1 
ATOM   3517 P  P     . DG  B 2 7   ? 42.163 4.705   -6.114  1.00 12.30 ? 7   DG  T P     1 
ATOM   3518 O  OP1   . DG  B 2 7   ? 43.285 5.484   -6.667  1.00 14.42 ? 7   DG  T OP1   1 
ATOM   3519 O  OP2   . DG  B 2 7   ? 40.817 4.768   -6.716  1.00 15.12 ? 7   DG  T OP2   1 
ATOM   3520 O  "O5'" . DG  B 2 7   ? 42.525 3.137   -6.120  1.00 19.75 ? 7   DG  T "O5'" 1 
ATOM   3521 C  "C5'" . DG  B 2 7   ? 43.809 2.651   -5.760  1.00 22.80 ? 7   DG  T "C5'" 1 
ATOM   3522 C  "C4'" . DG  B 2 7   ? 43.826 1.127   -5.694  1.00 9.52  ? 7   DG  T "C4'" 1 
ATOM   3523 O  "O4'" . DG  B 2 7   ? 43.150 0.671   -4.497  1.00 16.26 ? 7   DG  T "O4'" 1 
ATOM   3524 C  "C3'" . DG  B 2 7   ? 43.182 0.382   -6.869  1.00 25.96 ? 7   DG  T "C3'" 1 
ATOM   3525 O  "O3'" . DG  B 2 7   ? 44.219 -0.319  -7.578  1.00 22.25 ? 7   DG  T "O3'" 1 
ATOM   3526 C  "C2'" . DG  B 2 7   ? 42.169 -0.563  -6.214  1.00 18.26 ? 7   DG  T "C2'" 1 
ATOM   3527 C  "C1'" . DG  B 2 7   ? 42.661 -0.617  -4.773  1.00 23.43 ? 7   DG  T "C1'" 1 
ATOM   3528 N  N9    . DG  B 2 7   ? 41.609 -0.942  -3.815  1.00 20.67 ? 7   DG  T N9    1 
ATOM   3529 C  C8    . DG  B 2 7   ? 40.424 -0.287  -3.588  1.00 15.48 ? 7   DG  T C8    1 
ATOM   3530 N  N7    . DG  B 2 7   ? 39.701 -0.848  -2.657  1.00 19.49 ? 7   DG  T N7    1 
ATOM   3531 C  C5    . DG  B 2 7   ? 40.452 -1.945  -2.254  1.00 20.82 ? 7   DG  T C5    1 
ATOM   3532 C  C6    . DG  B 2 7   ? 40.195 -2.931  -1.274  1.00 15.80 ? 7   DG  T C6    1 
ATOM   3533 O  O6    . DG  B 2 7   ? 39.202 -3.039  -0.547  1.00 11.46 ? 7   DG  T O6    1 
ATOM   3534 N  N1    . DG  B 2 7   ? 41.231 -3.863  -1.188  1.00 14.49 ? 7   DG  T N1    1 
ATOM   3535 C  C2    . DG  B 2 7   ? 42.375 -3.837  -1.950  1.00 18.92 ? 7   DG  T C2    1 
ATOM   3536 N  N2    . DG  B 2 7   ? 43.267 -4.817  -1.738  1.00 16.70 ? 7   DG  T N2    1 
ATOM   3537 N  N3    . DG  B 2 7   ? 42.625 -2.917  -2.868  1.00 19.86 ? 7   DG  T N3    1 
ATOM   3538 C  C4    . DG  B 2 7   ? 41.629 -2.009  -2.956  1.00 19.85 ? 7   DG  T C4    1 
ATOM   3539 P  P     . DA  B 2 8   ? 43.862 -1.274  -8.823  1.00 20.21 ? 8   DA  T P     1 
ATOM   3540 O  OP1   . DA  B 2 8   ? 44.900 -1.095  -9.843  1.00 15.85 ? 8   DA  T OP1   1 
ATOM   3541 O  OP2   . DA  B 2 8   ? 42.424 -1.123  -9.136  1.00 26.20 ? 8   DA  T OP2   1 
ATOM   3542 O  "O5'" . DA  B 2 8   ? 44.087 -2.752  -8.244  1.00 25.41 ? 8   DA  T "O5'" 1 
ATOM   3543 C  "C5'" . DA  B 2 8   ? 45.312 -3.026  -7.559  1.00 13.74 ? 8   DA  T "C5'" 1 
ATOM   3544 C  "C4'" . DA  B 2 8   ? 45.445 -4.507  -7.244  1.00 21.64 ? 8   DA  T "C4'" 1 
ATOM   3545 O  "O4'" . DA  B 2 8   ? 44.663 -4.828  -6.060  1.00 22.85 ? 8   DA  T "O4'" 1 
ATOM   3546 C  "C3'" . DA  B 2 8   ? 44.970 -5.445  -8.348  1.00 20.47 ? 8   DA  T "C3'" 1 
ATOM   3547 O  "O3'" . DA  B 2 8   ? 45.767 -6.618  -8.363  1.00 17.68 ? 8   DA  T "O3'" 1 
ATOM   3548 C  "C2'" . DA  B 2 8   ? 43.554 -5.777  -7.920  1.00 24.94 ? 8   DA  T "C2'" 1 
ATOM   3549 C  "C1'" . DA  B 2 8   ? 43.685 -5.785  -6.401  1.00 24.10 ? 8   DA  T "C1'" 1 
ATOM   3550 N  N9    . DA  B 2 8   ? 42.412 -5.422  -5.795  1.00 22.53 ? 8   DA  T N9    1 
ATOM   3551 C  C8    . DA  B 2 8   ? 41.606 -4.376  -6.155  1.00 26.11 ? 8   DA  T C8    1 
ATOM   3552 N  N7    . DA  B 2 8   ? 40.510 -4.290  -5.446  1.00 16.40 ? 8   DA  T N7    1 
ATOM   3553 C  C5    . DA  B 2 8   ? 40.600 -5.360  -4.572  1.00 15.99 ? 8   DA  T C5    1 
ATOM   3554 C  C6    . DA  B 2 8   ? 39.737 -5.821  -3.561  1.00 14.55 ? 8   DA  T C6    1 
ATOM   3555 N  N6    . DA  B 2 8   ? 38.560 -5.226  -3.251  1.00 10.91 ? 8   DA  T N6    1 
ATOM   3556 N  N1    . DA  B 2 8   ? 40.137 -6.920  -2.884  1.00 17.37 ? 8   DA  T N1    1 
ATOM   3557 C  C2    . DA  B 2 8   ? 41.302 -7.502  -3.188  1.00 13.56 ? 8   DA  T C2    1 
ATOM   3558 N  N3    . DA  B 2 8   ? 42.197 -7.159  -4.115  1.00 15.20 ? 8   DA  T N3    1 
ATOM   3559 C  C4    . DA  B 2 8   ? 41.771 -6.072  -4.778  1.00 17.77 ? 8   DA  T C4    1 
ATOM   3560 P  P     . DC  B 2 9   ? 45.646 -7.664  -9.577  1.00 28.91 ? 9   DC  T P     1 
ATOM   3561 O  OP1   . DC  B 2 9   ? 47.011 -8.020  -9.998  1.00 22.86 ? 9   DC  T OP1   1 
ATOM   3562 O  OP2   . DC  B 2 9   ? 44.690 -7.121  -10.569 1.00 21.15 ? 9   DC  T OP2   1 
ATOM   3563 O  "O5'" . DC  B 2 9   ? 44.917 -8.921  -8.914  1.00 20.22 ? 9   DC  T "O5'" 1 
ATOM   3564 C  "C5'" . DC  B 2 9   ? 45.455 -9.524  -7.753  1.00 22.22 ? 9   DC  T "C5'" 1 
ATOM   3565 C  "C4'" . DC  B 2 9   ? 44.410 -10.440 -7.162  1.00 21.08 ? 9   DC  T "C4'" 1 
ATOM   3566 O  "O4'" . DC  B 2 9   ? 43.321 -9.673  -6.577  1.00 26.18 ? 9   DC  T "O4'" 1 
ATOM   3567 C  "C3'" . DC  B 2 9   ? 43.764 -11.386 -8.170  1.00 23.88 ? 9   DC  T "C3'" 1 
ATOM   3568 O  "O3'" . DC  B 2 9   ? 43.619 -12.627 -7.519  1.00 29.08 ? 9   DC  T "O3'" 1 
ATOM   3569 C  "C2'" . DC  B 2 9   ? 42.403 -10.743 -8.414  1.00 16.87 ? 9   DC  T "C2'" 1 
ATOM   3570 C  "C1'" . DC  B 2 9   ? 42.110 -10.266 -6.998  1.00 24.22 ? 9   DC  T "C1'" 1 
ATOM   3571 N  N1    . DC  B 2 9   ? 40.995 -9.292  -6.898  1.00 21.67 ? 9   DC  T N1    1 
ATOM   3572 C  C2    . DC  B 2 9   ? 40.095 -9.441  -5.855  1.00 20.23 ? 9   DC  T C2    1 
ATOM   3573 O  O2    . DC  B 2 9   ? 40.276 -10.367 -5.050  1.00 23.31 ? 9   DC  T O2    1 
ATOM   3574 N  N3    . DC  B 2 9   ? 39.068 -8.565  -5.755  1.00 17.97 ? 9   DC  T N3    1 
ATOM   3575 C  C4    . DC  B 2 9   ? 38.922 -7.582  -6.653  1.00 17.14 ? 9   DC  T C4    1 
ATOM   3576 N  N4    . DC  B 2 9   ? 37.888 -6.752  -6.507  1.00 19.20 ? 9   DC  T N4    1 
ATOM   3577 C  C5    . DC  B 2 9   ? 39.827 -7.420  -7.737  1.00 22.48 ? 9   DC  T C5    1 
ATOM   3578 C  C6    . DC  B 2 9   ? 40.843 -8.293  -7.816  1.00 24.78 ? 9   DC  T C6    1 
ATOM   3579 P  P     . DG  B 2 10  ? 43.452 -13.985 -8.368  1.00 22.72 ? 10  DG  T P     1 
ATOM   3580 O  OP1   . DG  B 2 10  ? 44.777 -14.628 -8.455  1.00 37.05 ? 10  DG  T OP1   1 
ATOM   3581 O  OP2   . DG  B 2 10  ? 42.673 -13.673 -9.592  1.00 27.37 ? 10  DG  T OP2   1 
ATOM   3582 O  "O5'" . DG  B 2 10  ? 42.517 -14.881 -7.437  1.00 25.07 ? 10  DG  T "O5'" 1 
ATOM   3583 C  "C5'" . DG  B 2 10  ? 42.628 -14.770 -6.017  1.00 21.04 ? 10  DG  T "C5'" 1 
ATOM   3584 C  "C4'" . DG  B 2 10  ? 41.437 -15.414 -5.336  1.00 22.19 ? 10  DG  T "C4'" 1 
ATOM   3585 O  "O4'" . DG  B 2 10  ? 40.398 -14.425 -5.135  1.00 31.15 ? 10  DG  T "O4'" 1 
ATOM   3586 C  "C3'" . DG  B 2 10  ? 40.780 -16.552 -6.111  1.00 31.05 ? 10  DG  T "C3'" 1 
ATOM   3587 O  "O3'" . DG  B 2 10  ? 40.225 -17.456 -5.162  1.00 31.81 ? 10  DG  T "O3'" 1 
ATOM   3588 C  "C2'" . DG  B 2 10  ? 39.713 -15.819 -6.917  1.00 21.80 ? 10  DG  T "C2'" 1 
ATOM   3589 C  "C1'" . DG  B 2 10  ? 39.265 -14.763 -5.911  1.00 26.03 ? 10  DG  T "C1'" 1 
ATOM   3590 N  N9    . DG  B 2 10  ? 38.732 -13.542 -6.514  1.00 24.94 ? 10  DG  T N9    1 
ATOM   3591 C  C8    . DG  B 2 10  ? 39.322 -12.722 -7.452  1.00 21.20 ? 10  DG  T C8    1 
ATOM   3592 N  N7    . DG  B 2 10  ? 38.590 -11.694 -7.775  1.00 17.76 ? 10  DG  T N7    1 
ATOM   3593 C  C5    . DG  B 2 10  ? 37.437 -11.848 -7.012  1.00 18.94 ? 10  DG  T C5    1 
ATOM   3594 C  C6    . DG  B 2 10  ? 36.274 -11.057 -6.941  1.00 19.14 ? 10  DG  T C6    1 
ATOM   3595 O  O6    . DG  B 2 10  ? 36.009 -10.017 -7.557  1.00 21.91 ? 10  DG  T O6    1 
ATOM   3596 N  N1    . DG  B 2 10  ? 35.355 -11.581 -6.033  1.00 20.20 ? 10  DG  T N1    1 
ATOM   3597 C  C2    . DG  B 2 10  ? 35.527 -12.728 -5.294  1.00 20.36 ? 10  DG  T C2    1 
ATOM   3598 N  N2    . DG  B 2 10  ? 34.527 -13.072 -4.471  1.00 21.40 ? 10  DG  T N2    1 
ATOM   3599 N  N3    . DG  B 2 10  ? 36.611 -13.484 -5.351  1.00 23.50 ? 10  DG  T N3    1 
ATOM   3600 C  C4    . DG  B 2 10  ? 37.516 -12.980 -6.228  1.00 18.65 ? 10  DG  T C4    1 
ATOM   3601 P  P     . DC  B 2 11  ? 39.566 -18.843 -5.640  1.00 33.16 ? 11  DC  T P     1 
ATOM   3602 O  OP1   . DC  B 2 11  ? 39.879 -19.866 -4.621  1.00 45.46 ? 11  DC  T OP1   1 
ATOM   3603 O  OP2   . DC  B 2 11  ? 39.954 -19.085 -7.041  1.00 24.46 ? 11  DC  T OP2   1 
ATOM   3604 O  "O5'" . DC  B 2 11  ? 38.004 -18.545 -5.590  1.00 27.23 ? 11  DC  T "O5'" 1 
ATOM   3605 C  "C5'" . DC  B 2 11  ? 37.442 -18.220 -4.333  1.00 26.60 ? 11  DC  T "C5'" 1 
ATOM   3606 C  "C4'" . DC  B 2 11  ? 35.927 -18.251 -4.409  1.00 22.77 ? 11  DC  T "C4'" 1 
ATOM   3607 O  "O4'" . DC  B 2 11  ? 35.420 -17.007 -4.952  1.00 26.43 ? 11  DC  T "O4'" 1 
ATOM   3608 C  "C3'" . DC  B 2 11  ? 35.333 -19.383 -5.249  1.00 23.49 ? 11  DC  T "C3'" 1 
ATOM   3609 O  "O3'" . DC  B 2 11  ? 34.300 -19.958 -4.450  1.00 16.76 ? 11  DC  T "O3'" 1 
ATOM   3610 C  "C2'" . DC  B 2 11  ? 34.832 -18.682 -6.515  1.00 19.69 ? 11  DC  T "C2'" 1 
ATOM   3611 C  "C1'" . DC  B 2 11  ? 34.541 -17.265 -6.031  1.00 22.83 ? 11  DC  T "C1'" 1 
ATOM   3612 N  N1    . DC  B 2 11  ? 34.772 -16.178 -7.031  1.00 15.08 ? 11  DC  T N1    1 
ATOM   3613 C  C2    . DC  B 2 11  ? 33.764 -15.227 -7.235  1.00 22.19 ? 11  DC  T C2    1 
ATOM   3614 O  O2    . DC  B 2 11  ? 32.702 -15.323 -6.604  1.00 17.40 ? 11  DC  T O2    1 
ATOM   3615 N  N3    . DC  B 2 11  ? 33.971 -14.224 -8.129  1.00 15.19 ? 11  DC  T N3    1 
ATOM   3616 C  C4    . DC  B 2 11  ? 35.121 -14.154 -8.799  1.00 18.94 ? 11  DC  T C4    1 
ATOM   3617 N  N4    . DC  B 2 11  ? 35.247 -13.136 -9.663  1.00 14.56 ? 11  DC  T N4    1 
ATOM   3618 C  C5    . DC  B 2 11  ? 36.172 -15.110 -8.602  1.00 19.44 ? 11  DC  T C5    1 
ATOM   3619 C  C6    . DC  B 2 11  ? 35.953 -16.097 -7.713  1.00 14.93 ? 11  DC  T C6    1 
ATOM   3620 P  P     . DT  B 2 12  ? 33.565 -21.310 -4.907  1.00 19.06 ? 12  DT  T P     1 
ATOM   3621 O  OP1   . DT  B 2 12  ? 33.052 -21.981 -3.694  1.00 20.65 ? 12  DT  T OP1   1 
ATOM   3622 O  OP2   . DT  B 2 12  ? 34.465 -22.046 -5.810  1.00 16.04 ? 12  DT  T OP2   1 
ATOM   3623 O  "O5'" . DT  B 2 12  ? 32.321 -20.780 -5.752  1.00 18.85 ? 12  DT  T "O5'" 1 
ATOM   3624 C  "C5'" . DT  B 2 12  ? 31.168 -20.316 -5.074  1.00 19.88 ? 12  DT  T "C5'" 1 
ATOM   3625 C  "C4'" . DT  B 2 12  ? 30.200 -19.764 -6.093  1.00 19.68 ? 12  DT  T "C4'" 1 
ATOM   3626 O  "O4'" . DT  B 2 12  ? 30.877 -18.685 -6.782  1.00 21.62 ? 12  DT  T "O4'" 1 
ATOM   3627 C  "C3'" . DT  B 2 12  ? 29.802 -20.778 -7.171  1.00 20.44 ? 12  DT  T "C3'" 1 
ATOM   3628 O  "O3'" . DT  B 2 12  ? 28.392 -20.719 -7.413  1.00 17.04 ? 12  DT  T "O3'" 1 
ATOM   3629 C  "C2'" . DT  B 2 12  ? 30.615 -20.332 -8.381  1.00 14.36 ? 12  DT  T "C2'" 1 
ATOM   3630 C  "C1'" . DT  B 2 12  ? 30.569 -18.823 -8.153  1.00 23.99 ? 12  DT  T "C1'" 1 
ATOM   3631 N  N1    . DT  B 2 12  ? 31.505 -18.010 -8.977  1.00 26.47 ? 12  DT  T N1    1 
ATOM   3632 C  C2    . DT  B 2 12  ? 31.125 -16.735 -9.329  1.00 20.69 ? 12  DT  T C2    1 
ATOM   3633 O  O2    . DT  B 2 12  ? 30.072 -16.226 -9.001  1.00 27.28 ? 12  DT  T O2    1 
ATOM   3634 N  N3    . DT  B 2 12  ? 32.031 -16.057 -10.091 1.00 20.64 ? 12  DT  T N3    1 
ATOM   3635 C  C4    . DT  B 2 12  ? 33.250 -16.504 -10.537 1.00 16.65 ? 12  DT  T C4    1 
ATOM   3636 O  O4    . DT  B 2 12  ? 33.968 -15.790 -11.231 1.00 21.63 ? 12  DT  T O4    1 
ATOM   3637 C  C5    . DT  B 2 12  ? 33.595 -17.845 -10.141 1.00 19.67 ? 12  DT  T C5    1 
ATOM   3638 C  C7    . DT  B 2 12  ? 34.899 -18.443 -10.566 1.00 20.29 ? 12  DT  T C7    1 
ATOM   3639 C  C6    . DT  B 2 12  ? 32.719 -18.531 -9.389  1.00 21.53 ? 12  DT  T C6    1 
ATOM   3640 O  "O5'" . DA  C 3 1   ? 29.261 -7.090  -14.853 1.00 41.77 ? 1   DA  P "O5'" 1 
ATOM   3641 C  "C5'" . DA  C 3 1   ? 28.532 -8.161  -15.465 1.00 23.99 ? 1   DA  P "C5'" 1 
ATOM   3642 C  "C4'" . DA  C 3 1   ? 27.359 -8.558  -14.590 1.00 24.86 ? 1   DA  P "C4'" 1 
ATOM   3643 O  "O4'" . DA  C 3 1   ? 27.457 -9.962  -14.240 1.00 32.70 ? 1   DA  P "O4'" 1 
ATOM   3644 C  "C3'" . DA  C 3 1   ? 27.302 -7.821  -13.256 1.00 21.02 ? 1   DA  P "C3'" 1 
ATOM   3645 O  "O3'" . DA  C 3 1   ? 25.975 -7.693  -12.801 1.00 28.62 ? 1   DA  P "O3'" 1 
ATOM   3646 C  "C2'" . DA  C 3 1   ? 28.091 -8.710  -12.302 1.00 26.04 ? 1   DA  P "C2'" 1 
ATOM   3647 C  "C1'" . DA  C 3 1   ? 28.080 -10.083 -12.973 1.00 30.48 ? 1   DA  P "C1'" 1 
ATOM   3648 N  N9    . DA  C 3 1   ? 29.430 -10.637 -13.116 1.00 22.83 ? 1   DA  P N9    1 
ATOM   3649 C  C8    . DA  C 3 1   ? 30.439 -10.228 -13.946 1.00 27.57 ? 1   DA  P C8    1 
ATOM   3650 N  N7    . DA  C 3 1   ? 31.546 -10.930 -13.826 1.00 28.01 ? 1   DA  P N7    1 
ATOM   3651 C  C5    . DA  C 3 1   ? 31.232 -11.860 -12.847 1.00 17.19 ? 1   DA  P C5    1 
ATOM   3652 C  C6    . DA  C 3 1   ? 31.969 -12.903 -12.257 1.00 18.19 ? 1   DA  P C6    1 
ATOM   3653 N  N6    . DA  C 3 1   ? 33.229 -13.191 -12.586 1.00 18.39 ? 1   DA  P N6    1 
ATOM   3654 N  N1    . DA  C 3 1   ? 31.364 -13.638 -11.306 1.00 24.60 ? 1   DA  P N1    1 
ATOM   3655 C  C2    . DA  C 3 1   ? 30.100 -13.358 -10.972 1.00 22.35 ? 1   DA  P C2    1 
ATOM   3656 N  N3    . DA  C 3 1   ? 29.306 -12.407 -11.453 1.00 22.90 ? 1   DA  P N3    1 
ATOM   3657 C  C4    . DA  C 3 1   ? 29.941 -11.689 -12.395 1.00 22.06 ? 1   DA  P C4    1 
ATOM   3658 P  P     . DG  C 3 2   ? 25.605 -6.570  -11.710 1.00 36.69 ? 2   DG  P P     1 
ATOM   3659 O  OP1   . DG  C 3 2   ? 24.141 -6.375  -11.739 1.00 32.97 ? 2   DG  P OP1   1 
ATOM   3660 O  OP2   . DG  C 3 2   ? 26.562 -5.452  -11.866 1.00 29.51 ? 2   DG  P OP2   1 
ATOM   3661 O  "O5'" . DG  C 3 2   ? 25.979 -7.253  -10.318 1.00 33.33 ? 2   DG  P "O5'" 1 
ATOM   3662 C  "C5'" . DG  C 3 2   ? 24.979 -7.949  -9.603  1.00 28.26 ? 2   DG  P "C5'" 1 
ATOM   3663 C  "C4'" . DG  C 3 2   ? 25.625 -8.609  -8.408  1.00 24.78 ? 2   DG  P "C4'" 1 
ATOM   3664 O  "O4'" . DG  C 3 2   ? 26.814 -9.298  -8.853  1.00 18.97 ? 2   DG  P "O4'" 1 
ATOM   3665 C  "C3'" . DG  C 3 2   ? 26.056 -7.676  -7.272  1.00 27.30 ? 2   DG  P "C3'" 1 
ATOM   3666 O  "O3'" . DG  C 3 2   ? 25.424 -8.197  -6.116  1.00 36.12 ? 2   DG  P "O3'" 1 
ATOM   3667 C  "C2'" . DG  C 3 2   ? 27.579 -7.801  -7.228  1.00 22.90 ? 2   DG  P "C2'" 1 
ATOM   3668 C  "C1'" . DG  C 3 2   ? 27.816 -9.165  -7.866  1.00 19.22 ? 2   DG  P "C1'" 1 
ATOM   3669 N  N9    . DG  C 3 2   ? 29.133 -9.329  -8.478  1.00 21.27 ? 2   DG  P N9    1 
ATOM   3670 C  C8    . DG  C 3 2   ? 29.773 -8.455  -9.326  1.00 22.55 ? 2   DG  P C8    1 
ATOM   3671 N  N7    . DG  C 3 2   ? 30.945 -8.865  -9.709  1.00 15.68 ? 2   DG  P N7    1 
ATOM   3672 C  C5    . DG  C 3 2   ? 31.101 -10.105 -9.090  1.00 20.45 ? 2   DG  P C5    1 
ATOM   3673 C  C6    . DG  C 3 2   ? 32.172 -11.035 -9.119  1.00 14.23 ? 2   DG  P C6    1 
ATOM   3674 O  O6    . DG  C 3 2   ? 33.243 -10.958 -9.733  1.00 15.85 ? 2   DG  P O6    1 
ATOM   3675 N  N1    . DG  C 3 2   ? 31.916 -12.172 -8.340  1.00 16.17 ? 2   DG  P N1    1 
ATOM   3676 C  C2    . DG  C 3 2   ? 30.770 -12.372 -7.615  1.00 18.02 ? 2   DG  P C2    1 
ATOM   3677 N  N2    . DG  C 3 2   ? 30.687 -13.517 -6.919  1.00 23.77 ? 2   DG  P N2    1 
ATOM   3678 N  N3    . DG  C 3 2   ? 29.765 -11.507 -7.578  1.00 23.30 ? 2   DG  P N3    1 
ATOM   3679 C  C4    . DG  C 3 2   ? 29.994 -10.400 -8.326  1.00 23.10 ? 2   DG  P C4    1 
ATOM   3680 P  P     . DC  C 3 3   ? 25.586 -7.479  -4.686  1.00 30.62 ? 3   DC  P P     1 
ATOM   3681 O  OP1   . DC  C 3 3   ? 24.265 -7.494  -4.022  1.00 47.07 ? 3   DC  P OP1   1 
ATOM   3682 O  OP2   . DC  C 3 3   ? 26.336 -6.213  -4.878  1.00 26.34 ? 3   DC  P OP2   1 
ATOM   3683 O  "O5'" . DC  C 3 3   ? 26.575 -8.459  -3.888  1.00 35.48 ? 3   DC  P "O5'" 1 
ATOM   3684 C  "C5'" . DC  C 3 3   ? 26.361 -9.866  -3.848  1.00 41.45 ? 3   DC  P "C5'" 1 
ATOM   3685 C  "C4'" . DC  C 3 3   ? 27.620 -10.571 -3.369  1.00 39.02 ? 3   DC  P "C4'" 1 
ATOM   3686 O  "O4'" . DC  C 3 3   ? 28.599 -10.575 -4.441  1.00 30.70 ? 3   DC  P "O4'" 1 
ATOM   3687 C  "C3'" . DC  C 3 3   ? 28.294 -9.927  -2.152  1.00 35.51 ? 3   DC  P "C3'" 1 
ATOM   3688 O  "O3'" . DC  C 3 3   ? 28.106 -10.724 -0.980  1.00 38.86 ? 3   DC  P "O3'" 1 
ATOM   3689 C  "C2'" . DC  C 3 3   ? 29.774 -9.841  -2.515  1.00 31.88 ? 3   DC  P "C2'" 1 
ATOM   3690 C  "C1'" . DC  C 3 3   ? 29.883 -10.567 -3.852  1.00 32.87 ? 3   DC  P "C1'" 1 
ATOM   3691 N  N1    . DC  C 3 3   ? 30.852 -9.874  -4.746  1.00 28.69 ? 3   DC  P N1    1 
ATOM   3692 C  C2    . DC  C 3 3   ? 32.034 -10.529 -5.085  1.00 19.00 ? 3   DC  P C2    1 
ATOM   3693 O  O2    . DC  C 3 3   ? 32.218 -11.668 -4.646  1.00 27.40 ? 3   DC  P O2    1 
ATOM   3694 N  N3    . DC  C 3 3   ? 32.929 -9.900  -5.890  1.00 26.38 ? 3   DC  P N3    1 
ATOM   3695 C  C4    . DC  C 3 3   ? 32.677 -8.665  -6.330  1.00 20.20 ? 3   DC  P C4    1 
ATOM   3696 N  N4    . DC  C 3 3   ? 33.586 -8.075  -7.119  1.00 21.52 ? 3   DC  P N4    1 
ATOM   3697 C  C5    . DC  C 3 3   ? 31.470 -7.982  -5.983  1.00 24.87 ? 3   DC  P C5    1 
ATOM   3698 C  C6    . DC  C 3 3   ? 30.597 -8.614  -5.191  1.00 21.55 ? 3   DC  P C6    1 
ATOM   3699 P  P     . DG  C 3 4   ? 28.703 -10.244 0.434   1.00 37.60 ? 4   DG  P P     1 
ATOM   3700 O  OP1   . DG  C 3 4   ? 27.926 -10.908 1.504   1.00 42.32 ? 4   DG  P OP1   1 
ATOM   3701 O  OP2   . DG  C 3 4   ? 28.817 -8.768  0.408   1.00 39.52 ? 4   DG  P OP2   1 
ATOM   3702 O  "O5'" . DG  C 3 4   ? 30.192 -10.836 0.436   1.00 36.45 ? 4   DG  P "O5'" 1 
ATOM   3703 C  "C5'" . DG  C 3 4   ? 30.387 -12.248 0.446   1.00 28.23 ? 4   DG  P "C5'" 1 
ATOM   3704 C  "C4'" . DG  C 3 4   ? 31.866 -12.590 0.436   1.00 41.89 ? 4   DG  P "C4'" 1 
ATOM   3705 O  "O4'" . DG  C 3 4   ? 32.463 -12.033 -0.766  1.00 28.09 ? 4   DG  P "O4'" 1 
ATOM   3706 C  "C3'" . DG  C 3 4   ? 32.659 -12.054 1.633   1.00 17.67 ? 4   DG  P "C3'" 1 
ATOM   3707 O  "O3'" . DG  C 3 4   ? 33.426 -13.111 2.244   1.00 35.64 ? 4   DG  P "O3'" 1 
ATOM   3708 C  "C2'" . DG  C 3 4   ? 33.533 -10.959 1.016   1.00 21.69 ? 4   DG  P "C2'" 1 
ATOM   3709 C  "C1'" . DG  C 3 4   ? 33.692 -11.429 -0.426  1.00 25.48 ? 4   DG  P "C1'" 1 
ATOM   3710 N  N9    . DG  C 3 4   ? 33.926 -10.315 -1.334  1.00 21.93 ? 4   DG  P N9    1 
ATOM   3711 C  C8    . DG  C 3 4   ? 33.113 -9.227  -1.540  1.00 23.93 ? 4   DG  P C8    1 
ATOM   3712 N  N7    . DG  C 3 4   ? 33.586 -8.377  -2.408  1.00 21.91 ? 4   DG  P N7    1 
ATOM   3713 C  C5    . DG  C 3 4   ? 34.800 -8.935  -2.797  1.00 21.06 ? 4   DG  P C5    1 
ATOM   3714 C  C6    . DG  C 3 4   ? 35.768 -8.471  -3.714  1.00 21.16 ? 4   DG  P C6    1 
ATOM   3715 O  O6    . DG  C 3 4   ? 35.753 -7.435  -4.394  1.00 27.04 ? 4   DG  P O6    1 
ATOM   3716 N  N1    . DG  C 3 4   ? 36.847 -9.347  -3.801  1.00 17.85 ? 4   DG  P N1    1 
ATOM   3717 C  C2    . DG  C 3 4   ? 36.974 -10.522 -3.096  1.00 15.49 ? 4   DG  P C2    1 
ATOM   3718 N  N2    . DG  C 3 4   ? 38.082 -11.254 -3.308  1.00 19.97 ? 4   DG  P N2    1 
ATOM   3719 N  N3    . DG  C 3 4   ? 36.075 -10.967 -2.241  1.00 24.38 ? 4   DG  P N3    1 
ATOM   3720 C  C4    . DG  C 3 4   ? 35.021 -10.123 -2.141  1.00 19.70 ? 4   DG  P C4    1 
ATOM   3721 P  P     . DT  C 3 5   ? 34.128 -12.884 3.677   1.00 41.46 ? 5   DT  P P     1 
ATOM   3722 O  OP1   . DT  C 3 5   ? 33.949 -14.117 4.472   1.00 38.47 ? 5   DT  P OP1   1 
ATOM   3723 O  OP2   . DT  C 3 5   ? 33.683 -11.575 4.204   1.00 24.91 ? 5   DT  P OP2   1 
ATOM   3724 O  "O5'" . DT  C 3 5   ? 35.677 -12.732 3.313   1.00 35.93 ? 5   DT  P "O5'" 1 
ATOM   3725 C  "C5'" . DT  C 3 5   ? 36.131 -13.323 2.120   1.00 25.80 ? 5   DT  P "C5'" 1 
ATOM   3726 C  "C4'" . DT  C 3 5   ? 37.602 -13.041 1.875   1.00 25.38 ? 5   DT  P "C4'" 1 
ATOM   3727 O  "O4'" . DT  C 3 5   ? 37.741 -12.082 0.806   1.00 19.70 ? 5   DT  P "O4'" 1 
ATOM   3728 C  "C3'" . DT  C 3 5   ? 38.409 -12.516 3.061   1.00 19.77 ? 5   DT  P "C3'" 1 
ATOM   3729 O  "O3'" . DT  C 3 5   ? 39.559 -13.314 3.093   1.00 23.21 ? 5   DT  P "O3'" 1 
ATOM   3730 C  "C2'" . DT  C 3 5   ? 38.747 -11.074 2.697   1.00 12.18 ? 5   DT  P "C2'" 1 
ATOM   3731 C  "C1'" . DT  C 3 5   ? 38.696 -11.104 1.174   1.00 17.89 ? 5   DT  P "C1'" 1 
ATOM   3732 N  N1    . DT  C 3 5   ? 38.229 -9.843  0.548   1.00 16.16 ? 5   DT  P N1    1 
ATOM   3733 C  C2    . DT  C 3 5   ? 39.023 -9.249  -0.400  1.00 17.33 ? 5   DT  P C2    1 
ATOM   3734 O  O2    . DT  C 3 5   ? 40.095 -9.695  -0.737  1.00 17.83 ? 5   DT  P O2    1 
ATOM   3735 N  N3    . DT  C 3 5   ? 38.521 -8.099  -0.937  1.00 19.97 ? 5   DT  P N3    1 
ATOM   3736 C  C4    . DT  C 3 5   ? 37.321 -7.500  -0.625  1.00 15.15 ? 5   DT  P C4    1 
ATOM   3737 O  O4    . DT  C 3 5   ? 36.976 -6.453  -1.168  1.00 17.82 ? 5   DT  P O4    1 
ATOM   3738 C  C5    . DT  C 3 5   ? 36.534 -8.166  0.388   1.00 18.70 ? 5   DT  P C5    1 
ATOM   3739 C  C7    . DT  C 3 5   ? 35.218 -7.590  0.808   1.00 13.07 ? 5   DT  P C7    1 
ATOM   3740 C  C6    . DT  C 3 5   ? 37.013 -9.299  0.923   1.00 21.52 ? 5   DT  P C6    1 
ATOM   3741 P  P     . DC  C 3 6   ? 40.588 -13.226 4.320   1.00 14.78 ? 6   DC  P P     1 
ATOM   3742 O  OP1   . DC  C 3 6   ? 41.293 -14.528 4.404   1.00 14.65 ? 6   DC  P OP1   1 
ATOM   3743 O  OP2   . DC  C 3 6   ? 39.895 -12.653 5.474   1.00 12.27 ? 6   DC  P OP2   1 
ATOM   3744 O  "O5'" . DC  C 3 6   ? 41.642 -12.124 3.842   1.00 14.76 ? 6   DC  P "O5'" 1 
ATOM   3745 C  "C5'" . DC  C 3 6   ? 42.598 -12.410 2.836   1.00 9.02  ? 6   DC  P "C5'" 1 
ATOM   3746 C  "C4'" . DC  C 3 6   ? 43.301 -11.116 2.484   1.00 19.87 ? 6   DC  P "C4'" 1 
ATOM   3747 O  "O4'" . DC  C 3 6   ? 42.340 -10.246 1.834   1.00 16.80 ? 6   DC  P "O4'" 1 
ATOM   3748 C  "C3'" . DC  C 3 6   ? 43.880 -10.333 3.667   1.00 14.37 ? 6   DC  P "C3'" 1 
ATOM   3749 O  "O3'" . DC  C 3 6   ? 45.317 -10.456 3.621   1.00 11.43 ? 6   DC  P "O3'" 1 
ATOM   3750 C  "C2'" . DC  C 3 6   ? 43.370 -8.903  3.439   1.00 9.70  ? 6   DC  P "C2'" 1 
ATOM   3751 C  "C1'" . DC  C 3 6   ? 42.781 -8.929  2.028   1.00 12.77 ? 6   DC  P "C1'" 1 
ATOM   3752 N  N1    . DC  C 3 6   ? 41.666 -7.932  1.831   1.00 17.00 ? 6   DC  P N1    1 
ATOM   3753 C  C2    . DC  C 3 6   ? 41.777 -6.969  0.812   1.00 13.54 ? 6   DC  P C2    1 
ATOM   3754 O  O2    . DC  C 3 6   ? 42.780 -6.982  0.081   1.00 9.80  ? 6   DC  P O2    1 
ATOM   3755 N  N3    . DC  C 3 6   ? 40.779 -6.054  0.655   1.00 12.08 ? 6   DC  P N3    1 
ATOM   3756 C  C4    . DC  C 3 6   ? 39.712 -6.076  1.470   1.00 14.30 ? 6   DC  P C4    1 
ATOM   3757 N  N4    . DC  C 3 6   ? 38.758 -5.157  1.289   1.00 15.26 ? 6   DC  P N4    1 
ATOM   3758 C  C5    . DC  C 3 6   ? 39.579 -7.040  2.509   1.00 16.09 ? 6   DC  P C5    1 
ATOM   3759 C  C6    . DC  C 3 6   ? 40.568 -7.942  2.652   1.00 16.65 ? 6   DC  P C6    1 
ATOM   3760 P  P     . DA  C 3 7   ? 46.247 -9.754  4.735   1.00 12.24 ? 7   DA  P P     1 
ATOM   3761 O  OP1   . DA  C 3 7   ? 47.464 -10.586 4.897   1.00 11.12 ? 7   DA  P OP1   1 
ATOM   3762 O  OP2   . DA  C 3 7   ? 45.414 -9.477  5.926   1.00 11.91 ? 7   DA  P OP2   1 
ATOM   3763 O  "O5'" . DA  C 3 7   ? 46.570 -8.317  4.113   1.00 14.93 ? 7   DA  P "O5'" 1 
ATOM   3764 C  "C5'" . DA  C 3 7   ? 47.229 -8.171  2.865   1.00 19.35 ? 7   DA  P "C5'" 1 
ATOM   3765 C  "C4'" . DA  C 3 7   ? 47.055 -6.750  2.334   1.00 23.19 ? 7   DA  P "C4'" 1 
ATOM   3766 O  "O4'" . DA  C 3 7   ? 45.659 -6.522  2.011   1.00 19.49 ? 7   DA  P "O4'" 1 
ATOM   3767 C  "C3'" . DA  C 3 7   ? 47.375 -5.581  3.271   1.00 23.08 ? 7   DA  P "C3'" 1 
ATOM   3768 O  "O3'" . DA  C 3 7   ? 48.766 -5.259  3.288   1.00 28.84 ? 7   DA  P "O3'" 1 
ATOM   3769 C  "C2'" . DA  C 3 7   ? 46.617 -4.432  2.624   1.00 17.03 ? 7   DA  P "C2'" 1 
ATOM   3770 C  "C1'" . DA  C 3 7   ? 45.520 -5.129  1.832   1.00 22.16 ? 7   DA  P "C1'" 1 
ATOM   3771 N  N9    . DA  C 3 7   ? 44.205 -4.695  2.269   1.00 13.87 ? 7   DA  P N9    1 
ATOM   3772 C  C8    . DA  C 3 7   ? 43.381 -5.263  3.202   1.00 17.22 ? 7   DA  P C8    1 
ATOM   3773 N  N7    . DA  C 3 7   ? 42.252 -4.615  3.363   1.00 19.01 ? 7   DA  P N7    1 
ATOM   3774 C  C5    . DA  C 3 7   ? 42.358 -3.551  2.478   1.00 15.56 ? 7   DA  P C5    1 
ATOM   3775 C  C6    . DA  C 3 7   ? 41.491 -2.495  2.170   1.00 15.09 ? 7   DA  P C6    1 
ATOM   3776 N  N6    . DA  C 3 7   ? 40.305 -2.365  2.757   1.00 12.75 ? 7   DA  P N6    1 
ATOM   3777 N  N1    . DA  C 3 7   ? 41.890 -1.594  1.242   1.00 17.02 ? 7   DA  P N1    1 
ATOM   3778 C  C2    . DA  C 3 7   ? 43.092 -1.753  0.673   1.00 17.50 ? 7   DA  P C2    1 
ATOM   3779 N  N3    . DA  C 3 7   ? 44.000 -2.714  0.878   1.00 15.66 ? 7   DA  P N3    1 
ATOM   3780 C  C4    . DA  C 3 7   ? 43.557 -3.582  1.803   1.00 17.47 ? 7   DA  P C4    1 
ATOM   3781 P  P     A DT  C 3 8   ? 49.321 -4.158  4.303   0.85 29.46 ? 8   DT  P P     1 
ATOM   3782 P  P     B DT  C 3 8   ? 49.311 -3.966  4.110   0.15 27.76 ? 8   DT  P P     1 
ATOM   3783 O  OP1   A DT  C 3 8   ? 50.760 -4.439  4.536   0.85 23.01 ? 8   DT  P OP1   1 
ATOM   3784 O  OP1   B DT  C 3 8   ? 50.794 -4.060  4.142   0.15 23.32 ? 8   DT  P OP1   1 
ATOM   3785 O  OP2   A DT  C 3 8   ? 48.364 -4.056  5.437   0.85 27.49 ? 8   DT  P OP2   1 
ATOM   3786 O  OP2   B DT  C 3 8   ? 48.544 -3.858  5.373   0.15 26.94 ? 8   DT  P OP2   1 
ATOM   3787 O  "O5'" A DT  C 3 8   ? 49.188 -2.803  3.474   0.85 31.21 ? 8   DT  P "O5'" 1 
ATOM   3788 O  "O5'" B DT  C 3 8   ? 48.922 -2.714  3.183   0.15 26.36 ? 8   DT  P "O5'" 1 
ATOM   3789 C  "C5'" A DT  C 3 8   ? 49.633 -2.742  2.123   0.85 21.68 ? 8   DT  P "C5'" 1 
ATOM   3790 C  "C5'" B DT  C 3 8   ? 49.842 -2.190  2.223   0.15 22.07 ? 8   DT  P "C5'" 1 
ATOM   3791 C  "C4'" A DT  C 3 8   ? 49.367 -1.319  1.689   0.85 20.37 ? 8   DT  P "C4'" 1 
ATOM   3792 C  "C4'" B DT  C 3 8   ? 49.339 -0.900  1.588   0.15 19.87 ? 8   DT  P "C4'" 1 
ATOM   3793 O  "O4'" A DT  C 3 8   ? 47.932 -1.141  1.626   0.85 19.12 ? 8   DT  P "O4'" 1 
ATOM   3794 O  "O4'" B DT  C 3 8   ? 47.942 -1.038  1.218   0.15 19.27 ? 8   DT  P "O4'" 1 
ATOM   3795 C  "C3'" A DT  C 3 8   ? 49.908 -0.294  2.680   0.85 21.37 ? 8   DT  P "C3'" 1 
ATOM   3796 C  "C3'" B DT  C 3 8   ? 49.351 0.340   2.479   0.15 18.78 ? 8   DT  P "C3'" 1 
ATOM   3797 O  "O3'" A DT  C 3 8   ? 50.729 0.651   1.993   0.85 15.27 ? 8   DT  P "O3'" 1 
ATOM   3798 O  "O3'" B DT  C 3 8   ? 50.632 0.966   2.508   0.15 16.14 ? 8   DT  P "O3'" 1 
ATOM   3799 C  "C2'" A DT  C 3 8   ? 48.670 0.354   3.314   0.85 18.92 ? 8   DT  P "C2'" 1 
ATOM   3800 C  "C2'" B DT  C 3 8   ? 48.320 1.230   1.794   0.15 17.37 ? 8   DT  P "C2'" 1 
ATOM   3801 C  "C1'" A DT  C 3 8   ? 47.542 0.019   2.338   0.85 21.87 ? 8   DT  P "C1'" 1 
ATOM   3802 C  "C1'" B DT  C 3 8   ? 47.276 0.209   1.351   0.15 18.11 ? 8   DT  P "C1'" 1 
ATOM   3803 N  N1    A DT  C 3 8   ? 46.222 -0.207  3.017   0.85 17.83 ? 8   DT  P N1    1 
ATOM   3804 N  N1    B DT  C 3 8   ? 46.117 0.048   2.292   0.15 18.71 ? 8   DT  P N1    1 
ATOM   3805 C  C2    A DT  C 3 8   ? 45.177 0.656   2.735   0.85 18.85 ? 8   DT  P C2    1 
ATOM   3806 C  C2    B DT  C 3 8   ? 45.019 0.870   2.155   0.15 17.79 ? 8   DT  P C2    1 
ATOM   3807 O  O2    A DT  C 3 8   ? 45.258 1.584   1.949   0.85 17.38 ? 8   DT  P O2    1 
ATOM   3808 O  O2    B DT  C 3 8   ? 44.936 1.744   1.309   0.15 15.92 ? 8   DT  P O2    1 
ATOM   3809 N  N3    A DT  C 3 8   ? 44.008 0.386   3.396   0.85 15.74 ? 8   DT  P N3    1 
ATOM   3810 N  N3    B DT  C 3 8   ? 44.008 0.639   3.054   0.15 16.91 ? 8   DT  P N3    1 
ATOM   3811 C  C4    A DT  C 3 8   ? 43.772 -0.626  4.296   0.85 16.49 ? 8   DT  P C4    1 
ATOM   3812 C  C4    B DT  C 3 8   ? 43.978 -0.310  4.052   0.15 16.97 ? 8   DT  P C4    1 
ATOM   3813 O  O4    A DT  C 3 8   ? 42.674 -0.758  4.830   0.85 17.91 ? 8   DT  P O4    1 
ATOM   3814 O  O4    B DT  C 3 8   ? 43.019 -0.439  4.809   0.15 17.60 ? 8   DT  P O4    1 
ATOM   3815 C  C5    A DT  C 3 8   ? 44.900 -1.488  4.559   0.85 18.01 ? 8   DT  P C5    1 
ATOM   3816 C  C5    B DT  C 3 8   ? 45.152 -1.139  4.140   0.15 18.75 ? 8   DT  P C5    1 
ATOM   3817 C  C7    A DT  C 3 8   ? 44.767 -2.628  5.525   0.85 19.50 ? 8   DT  P C7    1 
ATOM   3818 C  C7    B DT  C 3 8   ? 45.224 -2.205  5.191   0.15 18.98 ? 8   DT  P C7    1 
ATOM   3819 C  C6    A DT  C 3 8   ? 46.057 -1.240  3.917   0.85 20.26 ? 8   DT  P C6    1 
ATOM   3820 C  C6    B DT  C 3 8   ? 46.150 -0.928  3.270   0.15 18.66 ? 8   DT  P C6    1 
ATOM   3821 P  P     B DA  C 3 9   ? 51.153 1.667   3.858   0.15 13.88 ? 9   DA  P P     1 
ATOM   3822 O  OP1   B DA  C 3 9   ? 52.618 1.833   3.763   0.15 12.88 ? 9   DA  P OP1   1 
ATOM   3823 O  OP2   B DA  C 3 9   ? 50.566 0.931   5.008   0.15 15.93 ? 9   DA  P OP2   1 
ATOM   3824 O  "O5'" B DA  C 3 9   ? 50.498 3.115   3.799   0.15 12.24 ? 9   DA  P "O5'" 1 
ATOM   3825 C  "C5'" B DA  C 3 9   ? 50.915 4.047   2.812   0.15 11.45 ? 9   DA  P "C5'" 1 
ATOM   3826 C  "C4'" B DA  C 3 9   ? 50.080 5.303   2.952   0.15 10.63 ? 9   DA  P "C4'" 1 
ATOM   3827 O  "O4'" B DA  C 3 9   ? 48.714 4.966   2.612   0.15 11.61 ? 9   DA  P "O4'" 1 
ATOM   3828 C  "C3'" B DA  C 3 9   ? 50.012 5.863   4.366   0.15 10.23 ? 9   DA  P "C3'" 1 
ATOM   3829 O  "O3'" B DA  C 3 9   ? 51.081 6.794   4.581   0.15 8.86  ? 9   DA  P "O3'" 1 
ATOM   3830 C  "C2'" B DA  C 3 9   ? 48.638 6.531   4.385   0.15 9.99  ? 9   DA  P "C2'" 1 
ATOM   3831 C  "C1'" B DA  C 3 9   ? 47.809 5.610   3.485   0.15 11.79 ? 9   DA  P "C1'" 1 
ATOM   3832 N  N9    B DA  C 3 9   ? 47.068 4.584   4.214   0.15 12.99 ? 9   DA  P N9    1 
ATOM   3833 C  C8    B DA  C 3 9   ? 47.547 3.399   4.703   0.15 15.20 ? 9   DA  P C8    1 
ATOM   3834 N  N7    B DA  C 3 9   ? 46.638 2.683   5.330   0.15 15.21 ? 9   DA  P N7    1 
ATOM   3835 C  C5    B DA  C 3 9   ? 45.486 3.450   5.236   0.15 16.24 ? 9   DA  P C5    1 
ATOM   3836 C  C6    B DA  C 3 9   ? 44.162 3.256   5.694   0.15 18.34 ? 9   DA  P C6    1 
ATOM   3837 N  N6    B DA  C 3 9   ? 43.762 2.174   6.368   0.15 18.30 ? 9   DA  P N6    1 
ATOM   3838 N  N1    B DA  C 3 9   ? 43.258 4.226   5.435   0.15 16.66 ? 9   DA  P N1    1 
ATOM   3839 C  C2    B DA  C 3 9   ? 43.653 5.311   4.761   0.15 14.94 ? 9   DA  P C2    1 
ATOM   3840 N  N3    B DA  C 3 9   ? 44.860 5.603   4.276   0.15 14.79 ? 9   DA  P N3    1 
ATOM   3841 C  C4    B DA  C 3 9   ? 45.735 4.623   4.553   0.15 13.67 ? 9   DA  P C4    1 
HETATM 3842 MG MG    . MG  D 4 .   ? 52.891 0.464   2.072   0.85 15.76 ? 503 MG  A MG    1 
HETATM 3843 CA CA    A CA  E 5 .   ? 54.819 2.672   3.791   0.30 8.78  ? 504 CA  A CA    1 
HETATM 3844 MG MG    B MG  F 4 .   ? 54.819 2.672   3.791   0.70 7.99  ? 505 MG  A MG    1 
HETATM 3845 C  C1    . GOL G 6 .   ? 60.669 -24.981 12.096  1.00 21.68 ? 506 GOL A C1    1 
HETATM 3846 O  O1    . GOL G 6 .   ? 59.279 -24.803 12.256  1.00 14.75 ? 506 GOL A O1    1 
HETATM 3847 C  C2    . GOL G 6 .   ? 61.169 -24.344 10.790  1.00 16.49 ? 506 GOL A C2    1 
HETATM 3848 O  O2    . GOL G 6 .   ? 60.546 -23.099 10.589  1.00 13.51 ? 506 GOL A O2    1 
HETATM 3849 C  C3    . GOL G 6 .   ? 60.893 -25.257 9.595   1.00 26.73 ? 506 GOL A C3    1 
HETATM 3850 O  O3    . GOL G 6 .   ? 61.636 -24.848 8.465   1.00 18.54 ? 506 GOL A O3    1 
HETATM 3851 C  C1    . GOL H 6 .   ? 54.041 16.597  -6.926  1.00 33.88 ? 507 GOL A C1    1 
HETATM 3852 O  O1    . GOL H 6 .   ? 54.109 15.185  -6.947  1.00 17.31 ? 507 GOL A O1    1 
HETATM 3853 C  C2    . GOL H 6 .   ? 54.119 17.142  -8.349  1.00 38.68 ? 507 GOL A C2    1 
HETATM 3854 O  O2    . GOL H 6 .   ? 54.103 16.072  -9.276  1.00 26.33 ? 507 GOL A O2    1 
HETATM 3855 C  C3    . GOL H 6 .   ? 55.370 18.006  -8.512  1.00 31.22 ? 507 GOL A C3    1 
HETATM 3856 O  O3    . GOL H 6 .   ? 55.676 18.171  -9.879  1.00 36.66 ? 507 GOL A O3    1 
HETATM 3857 P  PG    A DTP I 7 .   ? 55.359 2.728   7.223   0.85 11.44 ? 501 DTP P PG    1 
HETATM 3858 O  O1G   A DTP I 7 .   ? 55.037 1.795   8.364   0.85 11.12 ? 501 DTP P O1G   1 
HETATM 3859 O  O2G   A DTP I 7 .   ? 56.653 3.481   7.474   0.85 10.41 ? 501 DTP P O2G   1 
HETATM 3860 O  O3G   A DTP I 7 .   ? 55.231 2.084   5.860   0.85 8.13  ? 501 DTP P O3G   1 
HETATM 3861 P  PB    A DTP I 7 .   ? 53.154 4.212   6.087   0.85 9.59  ? 501 DTP P PB    1 
HETATM 3862 O  O1B   A DTP I 7 .   ? 53.912 4.368   4.789   0.85 9.91  ? 501 DTP P O1B   1 
HETATM 3863 O  O2B   A DTP I 7 .   ? 52.369 5.394   6.606   0.85 11.51 ? 501 DTP P O2B   1 
HETATM 3864 O  O3B   A DTP I 7 .   ? 54.162 3.817   7.298   0.85 13.50 ? 501 DTP P O3B   1 
HETATM 3865 P  PA    A DTP I 7 .   ? 51.654 2.095   4.813   0.85 14.95 ? 501 DTP P PA    1 
HETATM 3866 O  O1A   A DTP I 7 .   ? 50.758 1.001   5.360   0.85 16.50 ? 501 DTP P O1A   1 
HETATM 3867 O  O2A   A DTP I 7 .   ? 52.846 1.720   3.948   0.85 12.59 ? 501 DTP P O2A   1 
HETATM 3868 O  O3A   A DTP I 7 .   ? 52.213 2.902   6.100   0.85 12.12 ? 501 DTP P O3A   1 
HETATM 3869 O  "O5'" A DTP I 7 .   ? 50.690 3.117   4.026   0.85 11.34 ? 501 DTP P "O5'" 1 
HETATM 3870 C  "C5'" A DTP I 7 .   ? 51.174 4.093   3.100   0.85 10.92 ? 501 DTP P "C5'" 1 
HETATM 3871 C  "C4'" A DTP I 7 .   ? 50.239 5.301   3.075   0.85 10.41 ? 501 DTP P "C4'" 1 
HETATM 3872 O  "O4'" A DTP I 7 .   ? 48.908 4.945   2.685   0.85 11.33 ? 501 DTP P "O4'" 1 
HETATM 3873 C  "C3'" A DTP I 7 .   ? 50.113 5.917   4.458   0.85 10.10 ? 501 DTP P "C3'" 1 
HETATM 3874 O  "O3'" A DTP I 7 .   ? 51.129 6.916   4.648   0.85 8.64  ? 501 DTP P "O3'" 1 
HETATM 3875 C  "C2'" A DTP I 7 .   ? 48.696 6.478   4.471   0.85 9.82  ? 501 DTP P "C2'" 1 
HETATM 3876 C  "C1'" A DTP I 7 .   ? 47.922 5.576   3.511   0.85 11.73 ? 501 DTP P "C1'" 1 
HETATM 3877 N  N9    A DTP I 7 .   ? 47.146 4.550   4.268   0.85 12.87 ? 501 DTP P N9    1 
HETATM 3878 C  C8    A DTP I 7 .   ? 47.608 3.392   4.767   0.85 15.23 ? 501 DTP P C8    1 
HETATM 3879 N  N7    A DTP I 7 .   ? 46.592 2.734   5.380   0.85 15.11 ? 501 DTP P N7    1 
HETATM 3880 C  C5    A DTP I 7 .   ? 45.482 3.491   5.255   0.85 16.26 ? 501 DTP P C5    1 
HETATM 3881 C  C6    A DTP I 7 .   ? 44.160 3.348   5.677   0.85 18.51 ? 501 DTP P C6    1 
HETATM 3882 N  N6    A DTP I 7 .   ? 43.766 2.252   6.370   0.85 18.31 ? 501 DTP P N6    1 
HETATM 3883 N  N1    A DTP I 7 .   ? 43.264 4.316   5.386   0.85 16.63 ? 501 DTP P N1    1 
HETATM 3884 C  C2    A DTP I 7 .   ? 43.645 5.406   4.709   0.85 14.87 ? 501 DTP P C2    1 
HETATM 3885 N  N3    A DTP I 7 .   ? 44.913 5.570   4.287   0.85 14.79 ? 501 DTP P N3    1 
HETATM 3886 C  C4    A DTP I 7 .   ? 45.843 4.626   4.549   0.85 13.49 ? 501 DTP P C4    1 
HETATM 3887 P  P1    B DPO J 8 .   ? 53.283 4.271   6.111   0.15 9.98  ? 502 DPO P P1    1 
HETATM 3888 O  O1    B DPO J 8 .   ? 52.376 3.067   6.130   0.15 11.89 ? 502 DPO P O1    1 
HETATM 3889 O  O2    B DPO J 8 .   ? 54.146 4.396   4.877   0.15 9.92  ? 502 DPO P O2    1 
HETATM 3890 O  O3    B DPO J 8 .   ? 52.612 5.554   6.540   0.15 11.00 ? 502 DPO P O3    1 
HETATM 3891 O  O4    B DPO J 8 .   ? 54.326 3.963   7.301   0.15 12.71 ? 502 DPO P O4    1 
HETATM 3892 P  P2    B DPO J 8 .   ? 55.412 2.780   7.175   0.15 11.54 ? 502 DPO P P2    1 
HETATM 3893 O  O5    B DPO J 8 .   ? 56.748 3.483   7.245   0.15 10.56 ? 502 DPO P O5    1 
HETATM 3894 O  O6    B DPO J 8 .   ? 55.127 1.902   8.369   0.15 11.19 ? 502 DPO P O6    1 
HETATM 3895 O  O7    B DPO J 8 .   ? 55.100 2.132   5.846   0.15 8.61  ? 502 DPO P O7    1 
HETATM 3896 O  O     B HOH K 9 .   ? 49.784 1.944   7.697   0.15 16.67 ? 601 HOH A O     1 
HETATM 3897 O  O     B HOH K 9 .   ? 49.815 4.551   7.611   0.15 14.10 ? 602 HOH A O     1 
HETATM 3898 O  O     . HOH K 9 .   ? 53.077 -1.035  3.814   1.00 17.93 ? 603 HOH A O     1 
HETATM 3899 O  O     . HOH K 9 .   ? 67.491 -20.732 8.622   1.00 5.96  ? 604 HOH A O     1 
HETATM 3900 O  O     . HOH K 9 .   ? 56.416 -13.901 -5.878  1.00 7.36  ? 605 HOH A O     1 
HETATM 3901 O  O     . HOH K 9 .   ? 43.977 -14.482 5.610   1.00 7.62  ? 606 HOH A O     1 
HETATM 3902 O  O     . HOH K 9 .   ? 64.153 -3.406  6.064   1.00 6.62  ? 607 HOH A O     1 
HETATM 3903 O  O     . HOH K 9 .   ? 57.945 -23.489 14.252  1.00 6.61  ? 608 HOH A O     1 
HETATM 3904 O  O     . HOH K 9 .   ? 43.698 12.191  -7.331  1.00 11.98 ? 609 HOH A O     1 
HETATM 3905 O  O     . HOH K 9 .   ? 69.202 -17.507 -1.317  1.00 8.07  ? 610 HOH A O     1 
HETATM 3906 O  O     . HOH K 9 .   ? 51.955 5.827   9.132   1.00 10.06 ? 611 HOH A O     1 
HETATM 3907 O  O     . HOH K 9 .   ? 59.614 9.531   10.638  1.00 12.50 ? 612 HOH A O     1 
HETATM 3908 O  O     . HOH K 9 .   ? 54.768 -11.474 3.451   1.00 9.04  ? 613 HOH A O     1 
HETATM 3909 O  O     . HOH K 9 .   ? 55.531 17.355  -0.636  1.00 8.18  ? 614 HOH A O     1 
HETATM 3910 O  O     . HOH K 9 .   ? 68.930 16.307  -4.087  1.00 11.86 ? 615 HOH A O     1 
HETATM 3911 O  O     . HOH K 9 .   ? 60.505 -18.616 -4.688  1.00 10.06 ? 616 HOH A O     1 
HETATM 3912 O  O     . HOH K 9 .   ? 67.158 -16.629 9.579   1.00 9.04  ? 617 HOH A O     1 
HETATM 3913 O  O     . HOH K 9 .   ? 53.933 -28.585 4.076   1.00 12.79 ? 618 HOH A O     1 
HETATM 3914 O  O     . HOH K 9 .   ? 59.957 11.528  -10.320 1.00 10.11 ? 619 HOH A O     1 
HETATM 3915 O  O     . HOH K 9 .   ? 53.442 -28.383 15.278  1.00 15.80 ? 620 HOH A O     1 
HETATM 3916 O  O     . HOH K 9 .   ? 62.624 14.871  -9.229  1.00 8.46  ? 621 HOH A O     1 
HETATM 3917 O  O     . HOH K 9 .   ? 54.373 -9.582  5.473   1.00 12.78 ? 622 HOH A O     1 
HETATM 3918 O  O     . HOH K 9 .   ? 62.655 7.432   7.165   1.00 13.68 ? 623 HOH A O     1 
HETATM 3919 O  O     . HOH K 9 .   ? 73.198 -7.271  8.858   1.00 10.19 ? 624 HOH A O     1 
HETATM 3920 O  O     . HOH K 9 .   ? 65.790 -22.963 3.332   1.00 12.40 ? 625 HOH A O     1 
HETATM 3921 O  O     . HOH K 9 .   ? 43.521 -33.267 -0.433  1.00 12.28 ? 626 HOH A O     1 
HETATM 3922 O  O     . HOH K 9 .   ? 53.960 17.281  -3.006  1.00 19.41 ? 627 HOH A O     1 
HETATM 3923 O  O     . HOH K 9 .   ? 45.567 16.022  -1.638  1.00 10.49 ? 628 HOH A O     1 
HETATM 3924 O  O     . HOH K 9 .   ? 50.199 -17.188 15.543  1.00 8.88  ? 629 HOH A O     1 
HETATM 3925 O  O     . HOH K 9 .   ? 45.097 7.505   -10.418 1.00 15.44 ? 630 HOH A O     1 
HETATM 3926 O  O     . HOH K 9 .   ? 53.711 13.515  -9.951  1.00 12.49 ? 631 HOH A O     1 
HETATM 3927 O  O     . HOH K 9 .   ? 42.249 -22.704 -2.397  1.00 13.90 ? 632 HOH A O     1 
HETATM 3928 O  O     . HOH K 9 .   ? 69.285 -13.447 5.047   1.00 9.57  ? 633 HOH A O     1 
HETATM 3929 O  O     . HOH K 9 .   ? 59.435 11.153  8.508   1.00 8.88  ? 634 HOH A O     1 
HETATM 3930 O  O     . HOH K 9 .   ? 58.586 -12.087 -11.522 1.00 13.67 ? 635 HOH A O     1 
HETATM 3931 O  O     . HOH K 9 .   ? 71.118 3.512   -0.527  1.00 12.88 ? 636 HOH A O     1 
HETATM 3932 O  O     . HOH K 9 .   ? 70.870 16.240  -6.094  1.00 10.51 ? 637 HOH A O     1 
HETATM 3933 O  O     . HOH K 9 .   ? 53.788 -20.437 -2.454  1.00 12.88 ? 638 HOH A O     1 
HETATM 3934 O  O     . HOH K 9 .   ? 44.124 -15.180 1.473   1.00 15.28 ? 639 HOH A O     1 
HETATM 3935 O  O     . HOH K 9 .   ? 40.726 11.486  -3.466  1.00 17.81 ? 640 HOH A O     1 
HETATM 3936 O  O     . HOH K 9 .   ? 49.181 6.690   -11.949 1.00 16.07 ? 641 HOH A O     1 
HETATM 3937 O  O     . HOH K 9 .   ? 33.266 10.797  5.320   1.00 17.88 ? 642 HOH A O     1 
HETATM 3938 O  O     . HOH K 9 .   ? 49.141 -15.661 13.482  1.00 14.15 ? 643 HOH A O     1 
HETATM 3939 O  O     . HOH K 9 .   ? 60.890 -23.438 6.268   1.00 14.65 ? 644 HOH A O     1 
HETATM 3940 O  O     . HOH K 9 .   ? 51.458 5.583   -8.356  1.00 13.04 ? 645 HOH A O     1 
HETATM 3941 O  O     . HOH K 9 .   ? 45.109 -14.343 10.330  1.00 13.62 ? 646 HOH A O     1 
HETATM 3942 O  O     . HOH K 9 .   ? 68.282 -15.880 -7.689  1.00 20.95 ? 647 HOH A O     1 
HETATM 3943 O  O     . HOH K 9 .   ? 52.798 1.373   9.384   1.00 17.07 ? 648 HOH A O     1 
HETATM 3944 O  O     . HOH K 9 .   ? 59.243 4.987   16.708  1.00 20.46 ? 649 HOH A O     1 
HETATM 3945 O  O     . HOH K 9 .   ? 40.637 16.725  5.951   1.00 15.74 ? 650 HOH A O     1 
HETATM 3946 O  O     . HOH K 9 .   ? 57.933 -7.676  8.224   1.00 16.38 ? 651 HOH A O     1 
HETATM 3947 O  O     . HOH K 9 .   ? 52.451 15.913  -4.618  1.00 15.78 ? 652 HOH A O     1 
HETATM 3948 O  O     . HOH K 9 .   ? 41.172 6.860   19.128  1.00 14.78 ? 653 HOH A O     1 
HETATM 3949 O  O     . HOH K 9 .   ? 47.191 2.621   -1.318  1.00 14.93 ? 654 HOH A O     1 
HETATM 3950 O  O     . HOH K 9 .   ? 58.021 17.527  -6.814  1.00 17.20 ? 655 HOH A O     1 
HETATM 3951 O  O     . HOH K 9 .   ? 64.087 -9.373  -14.431 1.00 16.11 ? 656 HOH A O     1 
HETATM 3952 O  O     . HOH K 9 .   ? 52.535 20.261  4.878   1.00 15.00 ? 657 HOH A O     1 
HETATM 3953 O  O     . HOH K 9 .   ? 65.702 -6.544  -13.689 1.00 16.95 ? 658 HOH A O     1 
HETATM 3954 O  O     . HOH K 9 .   ? 50.667 -34.786 -0.871  1.00 15.48 ? 659 HOH A O     1 
HETATM 3955 O  O     . HOH K 9 .   ? 43.951 11.132  -12.414 1.00 14.41 ? 660 HOH A O     1 
HETATM 3956 O  O     . HOH K 9 .   ? 48.654 -36.951 2.425   1.00 14.54 ? 661 HOH A O     1 
HETATM 3957 O  O     . HOH K 9 .   ? 37.044 16.096  -4.363  1.00 16.95 ? 662 HOH A O     1 
HETATM 3958 O  O     . HOH K 9 .   ? 60.477 -17.759 -7.513  1.00 22.88 ? 663 HOH A O     1 
HETATM 3959 O  O     . HOH K 9 .   ? 43.685 9.765   -10.081 1.00 16.13 ? 664 HOH A O     1 
HETATM 3960 O  O     . HOH K 9 .   ? 41.499 17.068  -14.829 1.00 13.98 ? 665 HOH A O     1 
HETATM 3961 O  O     . HOH K 9 .   ? 46.294 16.789  1.162   1.00 8.41  ? 666 HOH A O     1 
HETATM 3962 O  O     . HOH K 9 .   ? 51.691 -8.635  4.796   1.00 23.43 ? 667 HOH A O     1 
HETATM 3963 O  O     . HOH K 9 .   ? 35.198 5.581   2.037   1.00 16.31 ? 668 HOH A O     1 
HETATM 3964 O  O     . HOH K 9 .   ? 65.856 -15.377 11.697  1.00 16.46 ? 669 HOH A O     1 
HETATM 3965 O  O     . HOH K 9 .   ? 63.437 12.845  -10.878 1.00 16.23 ? 670 HOH A O     1 
HETATM 3966 O  O     . HOH K 9 .   ? 71.653 5.984   -7.216  1.00 15.02 ? 671 HOH A O     1 
HETATM 3967 O  O     . HOH K 9 .   ? 41.438 -23.904 -5.068  1.00 16.55 ? 672 HOH A O     1 
HETATM 3968 O  O     . HOH K 9 .   ? 51.315 3.451   10.522  1.00 16.73 ? 673 HOH A O     1 
HETATM 3969 O  O     . HOH K 9 .   ? 59.766 10.432  19.743  1.00 15.69 ? 674 HOH A O     1 
HETATM 3970 O  O     . HOH K 9 .   ? 58.503 -8.849  -14.315 1.00 20.93 ? 675 HOH A O     1 
HETATM 3971 O  O     . HOH K 9 .   ? 49.173 7.250   -7.681  1.00 18.83 ? 676 HOH A O     1 
HETATM 3972 O  O     . HOH K 9 .   ? 58.443 -18.019 19.637  1.00 21.30 ? 677 HOH A O     1 
HETATM 3973 O  O     . HOH K 9 .   ? 72.205 -3.810  -13.828 1.00 17.34 ? 678 HOH A O     1 
HETATM 3974 O  O     . HOH K 9 .   ? 55.642 -7.136  6.374   1.00 23.40 ? 679 HOH A O     1 
HETATM 3975 O  O     . HOH K 9 .   ? 23.316 14.347  -9.084  1.00 26.63 ? 680 HOH A O     1 
HETATM 3976 O  O     . HOH K 9 .   ? 41.630 -30.425 -6.487  1.00 17.59 ? 681 HOH A O     1 
HETATM 3977 O  O     . HOH K 9 .   ? 48.774 -22.205 -5.885  1.00 17.13 ? 682 HOH A O     1 
HETATM 3978 O  O     . HOH K 9 .   ? 53.253 -33.445 -0.112  1.00 14.74 ? 683 HOH A O     1 
HETATM 3979 O  O     . HOH K 9 .   ? 60.172 14.253  -8.638  1.00 14.44 ? 684 HOH A O     1 
HETATM 3980 O  O     . HOH K 9 .   ? 64.519 6.784   -0.525  1.00 16.59 ? 685 HOH A O     1 
HETATM 3981 O  O     . HOH K 9 .   ? 69.666 -12.881 -11.410 1.00 22.17 ? 686 HOH A O     1 
HETATM 3982 O  O     . HOH K 9 .   ? 35.374 5.868   18.385  1.00 32.76 ? 687 HOH A O     1 
HETATM 3983 O  O     . HOH K 9 .   ? 35.979 11.008  0.683   1.00 15.99 ? 688 HOH A O     1 
HETATM 3984 O  O     . HOH K 9 .   ? 34.808 15.182  11.449  1.00 20.21 ? 689 HOH A O     1 
HETATM 3985 O  O     . HOH K 9 .   ? 49.954 -3.106  -17.340 1.00 18.39 ? 690 HOH A O     1 
HETATM 3986 O  O     . HOH K 9 .   ? 55.271 2.598   21.060  1.00 24.41 ? 691 HOH A O     1 
HETATM 3987 O  O     . HOH K 9 .   ? 47.923 -26.987 -7.233  1.00 21.26 ? 692 HOH A O     1 
HETATM 3988 O  O     . HOH K 9 .   ? 46.886 -0.357  -15.115 1.00 15.51 ? 693 HOH A O     1 
HETATM 3989 O  O     . HOH K 9 .   ? 48.807 13.665  28.340  1.00 24.04 ? 694 HOH A O     1 
HETATM 3990 O  O     . HOH K 9 .   ? 42.783 15.606  23.789  1.00 18.82 ? 695 HOH A O     1 
HETATM 3991 O  O     . HOH K 9 .   ? 53.536 7.173   -14.670 1.00 29.80 ? 696 HOH A O     1 
HETATM 3992 O  O     . HOH K 9 .   ? 56.093 18.696  18.173  1.00 20.30 ? 697 HOH A O     1 
HETATM 3993 O  O     . HOH K 9 .   ? 69.392 4.605   3.832   1.00 19.38 ? 698 HOH A O     1 
HETATM 3994 O  O     . HOH K 9 .   ? 51.449 5.279   -10.993 1.00 20.45 ? 699 HOH A O     1 
HETATM 3995 O  O     . HOH K 9 .   ? 65.889 5.904   2.280   1.00 22.44 ? 700 HOH A O     1 
HETATM 3996 O  O     . HOH K 9 .   ? 58.115 -14.226 -13.250 1.00 21.51 ? 701 HOH A O     1 
HETATM 3997 O  O     . HOH K 9 .   ? 47.989 10.536  -9.696  1.00 24.14 ? 702 HOH A O     1 
HETATM 3998 O  O     . HOH K 9 .   ? 47.686 15.805  -17.693 1.00 32.07 ? 703 HOH A O     1 
HETATM 3999 O  O     . HOH K 9 .   ? 43.016 -1.438  -25.008 1.00 24.77 ? 704 HOH A O     1 
HETATM 4000 O  O     . HOH K 9 .   ? 62.154 -25.299 4.985   1.00 25.16 ? 705 HOH A O     1 
HETATM 4001 O  O     . HOH K 9 .   ? 42.310 -18.993 14.942  1.00 19.18 ? 706 HOH A O     1 
HETATM 4002 O  O     . HOH K 9 .   ? 53.193 19.431  -1.616  1.00 24.37 ? 707 HOH A O     1 
HETATM 4003 O  O     . HOH K 9 .   ? 59.906 13.120  11.361  1.00 17.60 ? 708 HOH A O     1 
HETATM 4004 O  O     . HOH K 9 .   ? 46.881 -14.701 14.754  1.00 22.21 ? 709 HOH A O     1 
HETATM 4005 O  O     . HOH K 9 .   ? 62.077 16.430  2.672   1.00 21.48 ? 710 HOH A O     1 
HETATM 4006 O  O     . HOH K 9 .   ? 46.262 -9.574  10.930  1.00 22.10 ? 711 HOH A O     1 
HETATM 4007 O  O     . HOH K 9 .   ? 51.144 21.709  7.621   1.00 21.84 ? 712 HOH A O     1 
HETATM 4008 O  O     . HOH K 9 .   ? 65.618 -22.195 -7.609  1.00 25.15 ? 713 HOH A O     1 
HETATM 4009 O  O     . HOH K 9 .   ? 54.335 -0.582  6.480   1.00 21.30 ? 714 HOH A O     1 
HETATM 4010 O  O     . HOH K 9 .   ? 51.045 0.521   -16.116 1.00 25.12 ? 715 HOH A O     1 
HETATM 4011 O  O     . HOH K 9 .   ? 61.665 -31.551 -10.550 1.00 26.49 ? 716 HOH A O     1 
HETATM 4012 O  O     . HOH K 9 .   ? 70.752 -19.081 1.173   1.00 13.46 ? 717 HOH A O     1 
HETATM 4013 O  O     . HOH K 9 .   ? 41.262 7.703   -18.647 1.00 18.52 ? 718 HOH A O     1 
HETATM 4014 O  O     . HOH K 9 .   ? 49.020 2.831   21.280  1.00 16.44 ? 719 HOH A O     1 
HETATM 4015 O  O     . HOH K 9 .   ? 64.460 -24.656 -7.831  1.00 24.20 ? 720 HOH A O     1 
HETATM 4016 O  O     . HOH K 9 .   ? 21.951 11.793  -9.350  1.00 25.44 ? 721 HOH A O     1 
HETATM 4017 O  O     . HOH K 9 .   ? 73.578 4.629   -1.007  1.00 38.24 ? 722 HOH A O     1 
HETATM 4018 O  O     . HOH K 9 .   ? 35.590 10.404  23.158  1.00 35.34 ? 723 HOH A O     1 
HETATM 4019 O  O     . HOH K 9 .   ? 47.180 16.374  25.671  1.00 20.12 ? 724 HOH A O     1 
HETATM 4020 O  O     . HOH K 9 .   ? 41.505 20.360  4.873   1.00 20.50 ? 725 HOH A O     1 
HETATM 4021 O  O     . HOH K 9 .   ? 51.534 8.881   -15.505 1.00 27.54 ? 726 HOH A O     1 
HETATM 4022 O  O     . HOH K 9 .   ? 69.738 10.071  -8.554  1.00 23.17 ? 727 HOH A O     1 
HETATM 4023 O  O     . HOH K 9 .   ? 48.553 20.161  4.744   1.00 21.06 ? 728 HOH A O     1 
HETATM 4024 O  O     . HOH K 9 .   ? 47.507 -16.479 -0.727  1.00 25.63 ? 729 HOH A O     1 
HETATM 4025 O  O     . HOH K 9 .   ? 55.786 -32.759 4.847   1.00 23.06 ? 730 HOH A O     1 
HETATM 4026 O  O     . HOH K 9 .   ? 61.648 14.742  8.526   1.00 18.70 ? 731 HOH A O     1 
HETATM 4027 O  O     . HOH K 9 .   ? 53.961 -8.584  8.733   1.00 21.85 ? 732 HOH A O     1 
HETATM 4028 O  O     . HOH K 9 .   ? 41.212 21.669  2.281   1.00 23.38 ? 733 HOH A O     1 
HETATM 4029 O  O     . HOH K 9 .   ? 36.730 13.010  12.132  1.00 21.10 ? 734 HOH A O     1 
HETATM 4030 O  O     . HOH K 9 .   ? 45.641 18.065  -3.631  1.00 21.92 ? 735 HOH A O     1 
HETATM 4031 O  O     . HOH K 9 .   ? 38.952 -19.654 12.618  1.00 24.95 ? 736 HOH A O     1 
HETATM 4032 O  O     . HOH K 9 .   ? 60.673 -28.232 8.350   1.00 23.93 ? 737 HOH A O     1 
HETATM 4033 O  O     . HOH K 9 .   ? 68.142 1.946   12.426  1.00 30.64 ? 738 HOH A O     1 
HETATM 4034 O  O     . HOH K 9 .   ? 78.097 -0.928  5.350   1.00 14.20 ? 739 HOH A O     1 
HETATM 4035 O  O     . HOH K 9 .   ? 56.559 21.618  18.410  1.00 24.69 ? 740 HOH A O     1 
HETATM 4036 O  O     . HOH K 9 .   ? 40.933 -29.697 -2.542  1.00 26.71 ? 741 HOH A O     1 
HETATM 4037 O  O     . HOH K 9 .   ? 76.641 2.710   7.021   1.00 29.14 ? 742 HOH A O     1 
HETATM 4038 O  O     . HOH K 9 .   ? 63.178 -23.587 3.249   1.00 22.45 ? 743 HOH A O     1 
HETATM 4039 O  O     . HOH K 9 .   ? 82.548 -4.240  -5.731  1.00 36.64 ? 744 HOH A O     1 
HETATM 4040 O  O     . HOH K 9 .   ? 58.824 15.366  -10.449 1.00 20.53 ? 745 HOH A O     1 
HETATM 4041 O  O     . HOH K 9 .   ? 70.935 -6.802  13.951  1.00 29.93 ? 746 HOH A O     1 
HETATM 4042 O  O     . HOH K 9 .   ? 48.986 -9.497  10.415  1.00 24.06 ? 747 HOH A O     1 
HETATM 4043 O  O     . HOH K 9 .   ? 42.290 8.168   3.298   1.00 21.83 ? 748 HOH A O     1 
HETATM 4044 O  O     . HOH K 9 .   ? 53.537 6.107   -12.151 1.00 24.97 ? 749 HOH A O     1 
HETATM 4045 O  O     . HOH K 9 .   ? 59.512 -31.575 4.294   1.00 27.61 ? 750 HOH A O     1 
HETATM 4046 O  O     . HOH K 9 .   ? 47.865 7.955   -9.768  1.00 25.72 ? 751 HOH A O     1 
HETATM 4047 O  O     . HOH K 9 .   ? 33.455 10.965  8.915   1.00 29.23 ? 752 HOH A O     1 
HETATM 4048 O  O     . HOH K 9 .   ? 62.963 9.533   -13.841 1.00 33.40 ? 753 HOH A O     1 
HETATM 4049 O  O     . HOH K 9 .   ? 66.491 3.785   10.685  1.00 24.62 ? 754 HOH A O     1 
HETATM 4050 O  O     . HOH K 9 .   ? 45.024 17.011  -18.105 1.00 30.68 ? 755 HOH A O     1 
HETATM 4051 O  O     . HOH K 9 .   ? 52.811 3.653   17.868  1.00 20.77 ? 756 HOH A O     1 
HETATM 4052 O  O     . HOH K 9 .   ? 38.628 -18.035 10.081  1.00 21.85 ? 757 HOH A O     1 
HETATM 4053 O  O     . HOH K 9 .   ? 34.159 15.595  18.573  1.00 25.47 ? 758 HOH A O     1 
HETATM 4054 O  O     . HOH K 9 .   ? 49.538 8.517   -13.746 1.00 25.92 ? 759 HOH A O     1 
HETATM 4055 O  O     . HOH K 9 .   ? 68.448 10.018  7.396   1.00 29.77 ? 760 HOH A O     1 
HETATM 4056 O  O     . HOH K 9 .   ? 33.359 2.774   -0.465  1.00 25.51 ? 761 HOH A O     1 
HETATM 4057 O  O     . HOH K 9 .   ? 49.751 -9.367  -8.494  1.00 19.57 ? 762 HOH A O     1 
HETATM 4058 O  O     . HOH K 9 .   ? 55.781 13.422  -11.796 1.00 28.65 ? 763 HOH A O     1 
HETATM 4059 O  O     . HOH K 9 .   ? 73.131 2.049   8.442   1.00 30.57 ? 764 HOH A O     1 
HETATM 4060 O  O     . HOH K 9 .   ? 47.406 -20.103 18.462  1.00 30.86 ? 765 HOH A O     1 
HETATM 4061 O  O     . HOH K 9 .   ? 75.234 0.712   -3.524  1.00 23.77 ? 766 HOH A O     1 
HETATM 4062 O  O     . HOH K 9 .   ? 41.467 15.768  -23.104 1.00 18.95 ? 767 HOH A O     1 
HETATM 4063 O  O     . HOH K 9 .   ? 62.573 12.014  5.672   1.00 29.97 ? 768 HOH A O     1 
HETATM 4064 O  O     . HOH K 9 .   ? 81.799 -20.221 0.133   1.00 35.87 ? 769 HOH A O     1 
HETATM 4065 O  O     . HOH K 9 .   ? 60.533 13.777  6.230   1.00 25.91 ? 770 HOH A O     1 
HETATM 4066 O  O     . HOH K 9 .   ? 46.775 0.303   6.814   1.00 25.01 ? 771 HOH A O     1 
HETATM 4067 O  O     . HOH K 9 .   ? 51.432 -29.279 16.592  1.00 23.15 ? 772 HOH A O     1 
HETATM 4068 O  O     . HOH K 9 .   ? 80.844 -15.804 7.585   1.00 22.20 ? 773 HOH A O     1 
HETATM 4069 O  O     . HOH K 9 .   ? 50.046 3.040   12.773  1.00 22.94 ? 774 HOH A O     1 
HETATM 4070 O  O     . HOH K 9 .   ? 50.872 17.672  -5.829  1.00 25.50 ? 775 HOH A O     1 
HETATM 4071 O  O     . HOH K 9 .   ? 71.987 -19.051 14.065  1.00 25.98 ? 776 HOH A O     1 
HETATM 4072 O  O     . HOH K 9 .   ? 62.203 -13.055 -13.351 1.00 24.73 ? 777 HOH A O     1 
HETATM 4073 O  O     . HOH K 9 .   ? 24.453 16.317  3.225   1.00 24.71 ? 778 HOH A O     1 
HETATM 4074 O  O     . HOH K 9 .   ? 60.056 14.447  3.224   1.00 19.96 ? 779 HOH A O     1 
HETATM 4075 O  O     . HOH K 9 .   ? 29.090 8.249   -18.921 1.00 26.99 ? 780 HOH A O     1 
HETATM 4076 O  O     . HOH K 9 .   ? 68.916 -10.806 12.038  1.00 22.97 ? 781 HOH A O     1 
HETATM 4077 O  O     . HOH K 9 .   ? 64.148 -7.853  -18.234 1.00 33.98 ? 782 HOH A O     1 
HETATM 4078 O  O     . HOH K 9 .   ? 57.888 11.976  -12.329 1.00 24.76 ? 783 HOH A O     1 
HETATM 4079 O  O     . HOH K 9 .   ? 51.735 -35.236 7.905   1.00 23.96 ? 784 HOH A O     1 
HETATM 4080 O  O     . HOH K 9 .   ? 35.435 22.532  -3.312  1.00 29.65 ? 785 HOH A O     1 
HETATM 4081 O  O     . HOH K 9 .   ? 67.687 6.403   9.919   1.00 27.97 ? 786 HOH A O     1 
HETATM 4082 O  O     . HOH K 9 .   ? 68.397 -14.620 -9.825  1.00 20.34 ? 787 HOH A O     1 
HETATM 4083 O  O     . HOH K 9 .   ? 45.868 7.577   -12.970 1.00 28.98 ? 788 HOH A O     1 
HETATM 4084 O  O     . HOH K 9 .   ? 46.774 -19.118 -2.832  1.00 27.51 ? 789 HOH A O     1 
HETATM 4085 O  O     . HOH K 9 .   ? 70.621 -21.624 0.566   1.00 24.71 ? 790 HOH A O     1 
HETATM 4086 O  O     . HOH K 9 .   ? 53.209 -20.160 -5.116  1.00 27.85 ? 791 HOH A O     1 
HETATM 4087 O  O     . HOH K 9 .   ? 54.205 -32.137 -2.875  1.00 23.71 ? 792 HOH A O     1 
HETATM 4088 O  O     . HOH K 9 .   ? 51.771 -25.804 17.694  1.00 30.73 ? 793 HOH A O     1 
HETATM 4089 O  O     . HOH K 9 .   ? 35.956 11.116  10.316  1.00 23.21 ? 794 HOH A O     1 
HETATM 4090 O  O     . HOH K 9 .   ? 42.664 13.271  -23.696 1.00 26.35 ? 795 HOH A O     1 
HETATM 4091 O  O     . HOH K 9 .   ? 58.118 -0.142  -14.475 1.00 25.99 ? 796 HOH A O     1 
HETATM 4092 O  O     . HOH K 9 .   ? 39.783 7.025   13.700  1.00 26.07 ? 797 HOH A O     1 
HETATM 4093 O  O     . HOH K 9 .   ? 38.836 21.238  5.787   1.00 25.83 ? 798 HOH A O     1 
HETATM 4094 O  O     . HOH K 9 .   ? 61.223 9.898   7.209   1.00 29.03 ? 799 HOH A O     1 
HETATM 4095 O  O     . HOH K 9 .   ? 35.492 20.706  0.469   1.00 21.35 ? 800 HOH A O     1 
HETATM 4096 O  O     . HOH K 9 .   ? 49.149 -34.544 10.562  1.00 30.70 ? 801 HOH A O     1 
HETATM 4097 O  O     . HOH K 9 .   ? 63.462 -18.990 -1.585  1.00 23.12 ? 802 HOH A O     1 
HETATM 4098 O  O     . HOH K 9 .   ? 56.202 -2.898  3.752   1.00 31.44 ? 803 HOH A O     1 
HETATM 4099 O  O     . HOH K 9 .   ? 48.270 -17.686 17.213  1.00 26.73 ? 804 HOH A O     1 
HETATM 4100 O  O     . HOH K 9 .   ? 61.668 8.158   9.909   1.00 26.07 ? 805 HOH A O     1 
HETATM 4101 O  O     . HOH K 9 .   ? 61.189 21.060  11.858  1.00 22.39 ? 806 HOH A O     1 
HETATM 4102 O  O     . HOH K 9 .   ? 51.535 -16.163 17.629  1.00 27.43 ? 807 HOH A O     1 
HETATM 4103 O  O     . HOH K 9 .   ? 80.628 -4.095  14.423  1.00 29.97 ? 808 HOH A O     1 
HETATM 4104 O  O     . HOH K 9 .   ? 27.700 6.848   -16.891 1.00 24.14 ? 809 HOH A O     1 
HETATM 4105 O  O     . HOH K 9 .   ? 83.814 -5.171  2.594   1.00 25.74 ? 810 HOH A O     1 
HETATM 4106 O  O     . HOH K 9 .   ? 62.022 8.062   15.638  1.00 28.96 ? 811 HOH A O     1 
HETATM 4107 O  O     . HOH K 9 .   ? 41.137 -29.609 13.163  1.00 24.54 ? 812 HOH A O     1 
HETATM 4108 O  O     . HOH K 9 .   ? 60.048 9.485   22.461  1.00 26.25 ? 813 HOH A O     1 
HETATM 4109 O  O     . HOH K 9 .   ? 56.643 1.334   13.453  1.00 28.87 ? 814 HOH A O     1 
HETATM 4110 O  O     . HOH K 9 .   ? 67.416 -6.339  13.026  1.00 24.79 ? 815 HOH A O     1 
HETATM 4111 O  O     . HOH K 9 .   ? 82.285 -10.775 -0.777  1.00 32.49 ? 816 HOH A O     1 
HETATM 4112 O  O     . HOH K 9 .   ? 67.510 -8.257  9.941   1.00 24.68 ? 817 HOH A O     1 
HETATM 4113 O  O     . HOH K 9 .   ? 61.983 9.287   18.916  1.00 23.87 ? 818 HOH A O     1 
HETATM 4114 O  O     . HOH K 9 .   ? 73.737 -20.495 1.224   1.00 23.57 ? 819 HOH A O     1 
HETATM 4115 O  O     . HOH K 9 .   ? 39.566 18.660  18.144  1.00 25.11 ? 820 HOH A O     1 
HETATM 4116 O  O     . HOH K 9 .   ? 25.334 21.361  -10.818 1.00 30.87 ? 821 HOH A O     1 
HETATM 4117 O  O     . HOH K 9 .   ? 73.414 -19.621 -2.962  1.00 19.51 ? 822 HOH A O     1 
HETATM 4118 O  O     . HOH K 9 .   ? 58.147 18.219  19.584  1.00 25.85 ? 823 HOH A O     1 
HETATM 4119 O  O     . HOH K 9 .   ? 44.935 -17.166 -0.527  1.00 24.20 ? 824 HOH A O     1 
HETATM 4120 O  O     . HOH K 9 .   ? 34.683 17.589  -12.932 1.00 27.42 ? 825 HOH A O     1 
HETATM 4121 O  O     . HOH K 9 .   ? 49.693 -24.078 18.786  1.00 31.80 ? 826 HOH A O     1 
HETATM 4122 O  O     . HOH K 9 .   ? 63.247 -4.829  -15.598 1.00 33.83 ? 827 HOH A O     1 
HETATM 4123 O  O     . HOH K 9 .   ? 47.395 -3.482  -5.287  1.00 27.67 ? 828 HOH A O     1 
HETATM 4124 O  O     . HOH K 9 .   ? 58.930 4.671   23.133  1.00 27.38 ? 829 HOH A O     1 
HETATM 4125 O  O     . HOH K 9 .   ? 34.238 5.997   -21.896 1.00 25.98 ? 830 HOH A O     1 
HETATM 4126 O  O     . HOH K 9 .   ? 57.546 0.071   11.029  1.00 28.58 ? 831 HOH A O     1 
HETATM 4127 O  O     . HOH K 9 .   ? 69.783 5.556   1.328   1.00 28.40 ? 832 HOH A O     1 
HETATM 4128 O  O     . HOH K 9 .   ? 46.797 19.623  1.244   1.00 20.35 ? 833 HOH A O     1 
HETATM 4129 O  O     . HOH K 9 .   ? 38.235 -22.661 10.264  1.00 35.56 ? 834 HOH A O     1 
HETATM 4130 O  O     . HOH K 9 .   ? 72.383 -7.789  11.668  1.00 17.45 ? 835 HOH A O     1 
HETATM 4131 O  O     . HOH K 9 .   ? 57.303 -16.428 -11.497 1.00 26.78 ? 836 HOH A O     1 
HETATM 4132 O  O     . HOH K 9 .   ? 47.994 18.573  -5.462  1.00 33.63 ? 837 HOH A O     1 
HETATM 4133 O  O     . HOH K 9 .   ? 44.925 0.620   -18.468 1.00 22.23 ? 838 HOH A O     1 
HETATM 4134 O  O     . HOH K 9 .   ? 44.365 10.348  -24.638 1.00 32.04 ? 839 HOH A O     1 
HETATM 4135 O  O     . HOH K 9 .   ? 52.123 -5.921  -0.869  1.00 29.63 ? 840 HOH A O     1 
HETATM 4136 O  O     . HOH K 9 .   ? 39.529 -1.943  -14.187 1.00 31.76 ? 841 HOH A O     1 
HETATM 4137 O  O     . HOH K 9 .   ? 44.981 20.694  3.931   1.00 23.40 ? 842 HOH A O     1 
HETATM 4138 O  O     . HOH K 9 .   ? 76.649 1.277   -5.688  1.00 30.39 ? 843 HOH A O     1 
HETATM 4139 O  O     . HOH K 9 .   ? 58.376 -27.432 11.125  1.00 21.46 ? 844 HOH A O     1 
HETATM 4140 O  O     . HOH K 9 .   ? 43.929 -28.768 15.464  1.00 27.60 ? 845 HOH A O     1 
HETATM 4141 O  O     . HOH K 9 .   ? 43.031 17.435  -16.955 1.00 25.09 ? 846 HOH A O     1 
HETATM 4142 O  O     . HOH K 9 .   ? 65.152 19.560  1.944   1.00 21.18 ? 847 HOH A O     1 
HETATM 4143 O  O     . HOH K 9 .   ? 65.923 -26.005 0.659   1.00 28.03 ? 848 HOH A O     1 
HETATM 4144 O  O     . HOH K 9 .   ? 25.667 14.713  5.267   1.00 24.01 ? 849 HOH A O     1 
HETATM 4145 O  O     . HOH K 9 .   ? 43.174 17.122  -11.986 1.00 31.26 ? 850 HOH A O     1 
HETATM 4146 O  O     . HOH K 9 .   ? 49.125 12.263  -11.435 1.00 27.71 ? 851 HOH A O     1 
HETATM 4147 O  O     . HOH K 9 .   ? 83.043 -2.947  -3.928  1.00 33.45 ? 852 HOH A O     1 
HETATM 4148 O  O     . HOH K 9 .   ? 67.530 6.642   0.800   1.00 22.98 ? 853 HOH A O     1 
HETATM 4149 O  O     . HOH K 9 .   ? 39.476 4.844   18.087  1.00 32.11 ? 854 HOH A O     1 
HETATM 4150 O  O     . HOH K 9 .   ? 52.690 2.346   -17.859 1.00 32.38 ? 855 HOH A O     1 
HETATM 4151 O  O     . HOH K 9 .   ? 40.868 -1.599  -16.435 1.00 24.48 ? 856 HOH A O     1 
HETATM 4152 O  O     . HOH K 9 .   ? 44.809 -33.197 -3.258  1.00 29.64 ? 857 HOH A O     1 
HETATM 4153 O  O     . HOH K 9 .   ? 59.196 -30.929 -0.631  1.00 34.49 ? 858 HOH A O     1 
HETATM 4154 O  O     . HOH K 9 .   ? 50.019 -8.911  13.069  1.00 24.57 ? 859 HOH A O     1 
HETATM 4155 O  O     . HOH K 9 .   ? 66.003 -4.017  -15.289 1.00 23.61 ? 860 HOH A O     1 
HETATM 4156 O  O     . HOH K 9 .   ? 52.662 8.435   25.618  1.00 25.75 ? 861 HOH A O     1 
HETATM 4157 O  O     . HOH K 9 .   ? 37.387 15.284  -20.454 1.00 26.54 ? 862 HOH A O     1 
HETATM 4158 O  O     . HOH K 9 .   ? 52.816 -19.998 22.361  1.00 27.95 ? 863 HOH A O     1 
HETATM 4159 O  O     . HOH K 9 .   ? 60.578 6.237   -15.747 1.00 23.62 ? 864 HOH A O     1 
HETATM 4160 O  O     . HOH K 9 .   ? 51.479 6.162   -19.241 1.00 30.45 ? 865 HOH A O     1 
HETATM 4161 O  O     . HOH K 9 .   ? 52.226 1.313   19.134  1.00 29.14 ? 866 HOH A O     1 
HETATM 4162 O  O     . HOH K 9 .   ? 57.515 -19.012 22.221  1.00 28.09 ? 867 HOH A O     1 
HETATM 4163 O  O     . HOH K 9 .   ? 60.659 -15.444 13.406  1.00 29.19 ? 868 HOH A O     1 
HETATM 4164 O  O     . HOH K 9 .   ? 57.084 26.121  6.647   1.00 24.33 ? 869 HOH A O     1 
HETATM 4165 O  O     . HOH K 9 .   ? 44.476 15.769  26.311  1.00 25.07 ? 870 HOH A O     1 
HETATM 4166 O  O     . HOH K 9 .   ? 70.644 -17.383 12.486  1.00 24.10 ? 871 HOH A O     1 
HETATM 4167 O  O     . HOH K 9 .   ? 40.014 -22.456 3.070   1.00 24.67 ? 872 HOH A O     1 
HETATM 4168 O  O     . HOH K 9 .   ? 29.523 4.016   6.707   1.00 30.22 ? 873 HOH A O     1 
HETATM 4169 O  O     . HOH K 9 .   ? 50.572 -13.288 -1.002  1.00 23.18 ? 874 HOH A O     1 
HETATM 4170 O  O     . HOH K 9 .   ? 52.877 -12.578 -4.062  1.00 21.71 ? 875 HOH A O     1 
HETATM 4171 O  O     . HOH L 9 .   ? 40.991 -3.458  -9.362  1.00 26.32 ? 101 HOH T O     1 
HETATM 4172 O  O     . HOH L 9 .   ? 42.178 -7.254  -10.469 1.00 22.92 ? 102 HOH T O     1 
HETATM 4173 O  O     . HOH L 9 .   ? 42.220 -20.095 -3.858  1.00 31.49 ? 103 HOH T O     1 
HETATM 4174 O  O     . HOH L 9 .   ? 47.167 -0.468  -8.571  1.00 21.43 ? 104 HOH T O     1 
HETATM 4175 O  O     . HOH L 9 .   ? 40.236 -0.819  7.853   1.00 31.86 ? 105 HOH T O     1 
HETATM 4176 O  O     . HOH L 9 .   ? 44.343 -8.614  -3.590  1.00 23.88 ? 106 HOH T O     1 
HETATM 4177 O  O     . HOH L 9 .   ? 36.888 -23.258 -5.051  1.00 30.02 ? 107 HOH T O     1 
HETATM 4178 O  O     . HOH L 9 .   ? 43.429 5.577   -8.991  1.00 15.73 ? 108 HOH T O     1 
HETATM 4179 O  O     . HOH L 9 .   ? 31.344 -16.387 -4.454  1.00 27.41 ? 109 HOH T O     1 
HETATM 4180 O  O     . HOH L 9 .   ? 38.955 2.370   -6.988  1.00 30.01 ? 110 HOH T O     1 
HETATM 4181 O  O     . HOH L 9 .   ? 45.485 -4.948  -3.359  1.00 30.71 ? 111 HOH T O     1 
HETATM 4182 O  O     . HOH L 9 .   ? 39.039 -10.337 -9.897  1.00 26.94 ? 112 HOH T O     1 
HETATM 4183 O  O     . HOH L 9 .   ? 28.549 -16.803 -6.186  1.00 36.78 ? 113 HOH T O     1 
HETATM 4184 O  O     . HOH L 9 .   ? 40.288 -18.402 -1.564  1.00 28.58 ? 114 HOH T O     1 
HETATM 4185 O  O     . HOH L 9 .   ? 45.700 5.321   -4.975  1.00 29.22 ? 115 HOH T O     1 
HETATM 4186 O  O     A HOH M 9 .   ? 49.210 2.349   0.944   0.85 22.15 ? 101 HOH P O     1 
HETATM 4187 O  O     . HOH M 9 .   ? 49.550 -10.212 6.532   1.00 13.34 ? 102 HOH P O     1 
HETATM 4188 O  O     . HOH M 9 .   ? 44.464 7.370   2.173   1.00 11.98 ? 103 HOH P O     1 
HETATM 4189 O  O     . HOH M 9 .   ? 42.985 -8.984  7.022   1.00 15.27 ? 104 HOH P O     1 
HETATM 4190 O  O     . HOH M 9 .   ? 41.934 -11.474 -1.151  1.00 19.23 ? 105 HOH P O     1 
HETATM 4191 O  O     . HOH M 9 .   ? 44.236 -13.011 -0.511  1.00 20.85 ? 106 HOH P O     1 
HETATM 4192 O  O     . HOH M 9 .   ? 44.921 -8.324  -1.012  1.00 26.90 ? 107 HOH P O     1 
HETATM 4193 O  O     . HOH M 9 .   ? 41.673 -15.701 1.729   1.00 17.16 ? 108 HOH P O     1 
HETATM 4194 O  O     . HOH M 9 .   ? 40.381 -5.255  5.651   1.00 24.18 ? 109 HOH P O     1 
HETATM 4195 O  O     . HOH M 9 .   ? 46.310 -2.327  -0.587  1.00 21.07 ? 110 HOH P O     1 
HETATM 4196 O  O     . HOH M 9 .   ? 46.238 3.830   0.803   1.00 23.08 ? 111 HOH P O     1 
HETATM 4197 O  O     . HOH M 9 .   ? 40.440 -9.335  5.820   1.00 22.44 ? 112 HOH P O     1 
HETATM 4198 O  O     . HOH M 9 .   ? 31.214 -13.754 -3.039  1.00 32.31 ? 113 HOH P O     1 
HETATM 4199 O  O     . HOH M 9 .   ? 38.313 -10.722 6.281   1.00 31.34 ? 114 HOH P O     1 
HETATM 4200 O  O     . HOH M 9 .   ? 46.766 -7.917  7.908   1.00 26.34 ? 115 HOH P O     1 
HETATM 4201 O  O     . HOH M 9 .   ? 40.432 -13.720 0.137   1.00 31.80 ? 116 HOH P O     1 
HETATM 4202 O  O     . HOH M 9 .   ? 34.686 -9.295  -11.307 1.00 33.73 ? 117 HOH P O     1 
HETATM 4203 O  O     . HOH M 9 .   ? 46.120 -10.728 -0.004  1.00 24.38 ? 118 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   503 501 MG  MG  A . 
E 5 CA  1   504 502 CA  CA  A . 
F 4 MG  1   505 502 MG  MG  A . 
G 6 GOL 1   506 436 GOL GOL A . 
H 6 GOL 1   507 437 GOL GOL A . 
I 7 DTP 1   501 9   DTP DTP P . 
J 8 DPO 1   502 9   DPO DPO P . 
K 9 HOH 1   601 61  HOH HOH A . 
K 9 HOH 2   602 61  HOH HOH A . 
K 9 HOH 3   603 1   HOH HOH A . 
K 9 HOH 4   604 2   HOH HOH A . 
K 9 HOH 5   605 3   HOH HOH A . 
K 9 HOH 6   606 4   HOH HOH A . 
K 9 HOH 7   607 5   HOH HOH A . 
K 9 HOH 8   608 6   HOH HOH A . 
K 9 HOH 9   609 7   HOH HOH A . 
K 9 HOH 10  610 8   HOH HOH A . 
K 9 HOH 11  611 9   HOH HOH A . 
K 9 HOH 12  612 10  HOH HOH A . 
K 9 HOH 13  613 11  HOH HOH A . 
K 9 HOH 14  614 12  HOH HOH A . 
K 9 HOH 15  615 13  HOH HOH A . 
K 9 HOH 16  616 14  HOH HOH A . 
K 9 HOH 17  617 15  HOH HOH A . 
K 9 HOH 18  618 16  HOH HOH A . 
K 9 HOH 19  619 17  HOH HOH A . 
K 9 HOH 20  620 18  HOH HOH A . 
K 9 HOH 21  621 19  HOH HOH A . 
K 9 HOH 22  622 20  HOH HOH A . 
K 9 HOH 23  623 22  HOH HOH A . 
K 9 HOH 24  624 24  HOH HOH A . 
K 9 HOH 25  625 25  HOH HOH A . 
K 9 HOH 26  626 26  HOH HOH A . 
K 9 HOH 27  627 27  HOH HOH A . 
K 9 HOH 28  628 28  HOH HOH A . 
K 9 HOH 29  629 29  HOH HOH A . 
K 9 HOH 30  630 30  HOH HOH A . 
K 9 HOH 31  631 31  HOH HOH A . 
K 9 HOH 32  632 32  HOH HOH A . 
K 9 HOH 33  633 33  HOH HOH A . 
K 9 HOH 34  634 35  HOH HOH A . 
K 9 HOH 35  635 36  HOH HOH A . 
K 9 HOH 36  636 37  HOH HOH A . 
K 9 HOH 37  637 38  HOH HOH A . 
K 9 HOH 38  638 39  HOH HOH A . 
K 9 HOH 39  639 40  HOH HOH A . 
K 9 HOH 40  640 41  HOH HOH A . 
K 9 HOH 41  641 42  HOH HOH A . 
K 9 HOH 42  642 43  HOH HOH A . 
K 9 HOH 43  643 44  HOH HOH A . 
K 9 HOH 44  644 45  HOH HOH A . 
K 9 HOH 45  645 46  HOH HOH A . 
K 9 HOH 46  646 47  HOH HOH A . 
K 9 HOH 47  647 48  HOH HOH A . 
K 9 HOH 48  648 49  HOH HOH A . 
K 9 HOH 49  649 50  HOH HOH A . 
K 9 HOH 50  650 51  HOH HOH A . 
K 9 HOH 51  651 52  HOH HOH A . 
K 9 HOH 52  652 53  HOH HOH A . 
K 9 HOH 53  653 54  HOH HOH A . 
K 9 HOH 54  654 55  HOH HOH A . 
K 9 HOH 55  655 56  HOH HOH A . 
K 9 HOH 56  656 57  HOH HOH A . 
K 9 HOH 57  657 58  HOH HOH A . 
K 9 HOH 58  658 59  HOH HOH A . 
K 9 HOH 59  659 61  HOH HOH A . 
K 9 HOH 60  660 63  HOH HOH A . 
K 9 HOH 61  661 64  HOH HOH A . 
K 9 HOH 62  662 65  HOH HOH A . 
K 9 HOH 63  663 66  HOH HOH A . 
K 9 HOH 64  664 67  HOH HOH A . 
K 9 HOH 65  665 68  HOH HOH A . 
K 9 HOH 66  666 69  HOH HOH A . 
K 9 HOH 67  667 70  HOH HOH A . 
K 9 HOH 68  668 72  HOH HOH A . 
K 9 HOH 69  669 73  HOH HOH A . 
K 9 HOH 70  670 74  HOH HOH A . 
K 9 HOH 71  671 75  HOH HOH A . 
K 9 HOH 72  672 76  HOH HOH A . 
K 9 HOH 73  673 77  HOH HOH A . 
K 9 HOH 74  674 78  HOH HOH A . 
K 9 HOH 75  675 80  HOH HOH A . 
K 9 HOH 76  676 82  HOH HOH A . 
K 9 HOH 77  677 83  HOH HOH A . 
K 9 HOH 78  678 84  HOH HOH A . 
K 9 HOH 79  679 85  HOH HOH A . 
K 9 HOH 80  680 86  HOH HOH A . 
K 9 HOH 81  681 87  HOH HOH A . 
K 9 HOH 82  682 88  HOH HOH A . 
K 9 HOH 83  683 90  HOH HOH A . 
K 9 HOH 84  684 91  HOH HOH A . 
K 9 HOH 85  685 92  HOH HOH A . 
K 9 HOH 86  686 93  HOH HOH A . 
K 9 HOH 87  687 95  HOH HOH A . 
K 9 HOH 88  688 96  HOH HOH A . 
K 9 HOH 89  689 97  HOH HOH A . 
K 9 HOH 90  690 98  HOH HOH A . 
K 9 HOH 91  691 99  HOH HOH A . 
K 9 HOH 92  692 100 HOH HOH A . 
K 9 HOH 93  693 101 HOH HOH A . 
K 9 HOH 94  694 102 HOH HOH A . 
K 9 HOH 95  695 103 HOH HOH A . 
K 9 HOH 96  696 104 HOH HOH A . 
K 9 HOH 97  697 105 HOH HOH A . 
K 9 HOH 98  698 106 HOH HOH A . 
K 9 HOH 99  699 108 HOH HOH A . 
K 9 HOH 100 700 109 HOH HOH A . 
K 9 HOH 101 701 110 HOH HOH A . 
K 9 HOH 102 702 111 HOH HOH A . 
K 9 HOH 103 703 113 HOH HOH A . 
K 9 HOH 104 704 114 HOH HOH A . 
K 9 HOH 105 705 115 HOH HOH A . 
K 9 HOH 106 706 116 HOH HOH A . 
K 9 HOH 107 707 117 HOH HOH A . 
K 9 HOH 108 708 118 HOH HOH A . 
K 9 HOH 109 709 120 HOH HOH A . 
K 9 HOH 110 710 122 HOH HOH A . 
K 9 HOH 111 711 123 HOH HOH A . 
K 9 HOH 112 712 124 HOH HOH A . 
K 9 HOH 113 713 125 HOH HOH A . 
K 9 HOH 114 714 126 HOH HOH A . 
K 9 HOH 115 715 127 HOH HOH A . 
K 9 HOH 116 716 128 HOH HOH A . 
K 9 HOH 117 717 130 HOH HOH A . 
K 9 HOH 118 718 131 HOH HOH A . 
K 9 HOH 119 719 132 HOH HOH A . 
K 9 HOH 120 720 135 HOH HOH A . 
K 9 HOH 121 721 136 HOH HOH A . 
K 9 HOH 122 722 137 HOH HOH A . 
K 9 HOH 123 723 138 HOH HOH A . 
K 9 HOH 124 724 139 HOH HOH A . 
K 9 HOH 125 725 140 HOH HOH A . 
K 9 HOH 126 726 142 HOH HOH A . 
K 9 HOH 127 727 143 HOH HOH A . 
K 9 HOH 128 728 144 HOH HOH A . 
K 9 HOH 129 729 145 HOH HOH A . 
K 9 HOH 130 730 146 HOH HOH A . 
K 9 HOH 131 731 148 HOH HOH A . 
K 9 HOH 132 732 149 HOH HOH A . 
K 9 HOH 133 733 150 HOH HOH A . 
K 9 HOH 134 734 151 HOH HOH A . 
K 9 HOH 135 735 152 HOH HOH A . 
K 9 HOH 136 736 153 HOH HOH A . 
K 9 HOH 137 737 154 HOH HOH A . 
K 9 HOH 138 738 155 HOH HOH A . 
K 9 HOH 139 739 156 HOH HOH A . 
K 9 HOH 140 740 157 HOH HOH A . 
K 9 HOH 141 741 158 HOH HOH A . 
K 9 HOH 142 742 159 HOH HOH A . 
K 9 HOH 143 743 160 HOH HOH A . 
K 9 HOH 144 744 162 HOH HOH A . 
K 9 HOH 145 745 163 HOH HOH A . 
K 9 HOH 146 746 164 HOH HOH A . 
K 9 HOH 147 747 165 HOH HOH A . 
K 9 HOH 148 748 166 HOH HOH A . 
K 9 HOH 149 749 167 HOH HOH A . 
K 9 HOH 150 750 168 HOH HOH A . 
K 9 HOH 151 751 169 HOH HOH A . 
K 9 HOH 152 752 171 HOH HOH A . 
K 9 HOH 153 753 172 HOH HOH A . 
K 9 HOH 154 754 174 HOH HOH A . 
K 9 HOH 155 755 175 HOH HOH A . 
K 9 HOH 156 756 176 HOH HOH A . 
K 9 HOH 157 757 177 HOH HOH A . 
K 9 HOH 158 758 178 HOH HOH A . 
K 9 HOH 159 759 179 HOH HOH A . 
K 9 HOH 160 760 182 HOH HOH A . 
K 9 HOH 161 761 183 HOH HOH A . 
K 9 HOH 162 762 185 HOH HOH A . 
K 9 HOH 163 763 187 HOH HOH A . 
K 9 HOH 164 764 188 HOH HOH A . 
K 9 HOH 165 765 189 HOH HOH A . 
K 9 HOH 166 766 190 HOH HOH A . 
K 9 HOH 167 767 191 HOH HOH A . 
K 9 HOH 168 768 192 HOH HOH A . 
K 9 HOH 169 769 193 HOH HOH A . 
K 9 HOH 170 770 194 HOH HOH A . 
K 9 HOH 171 771 195 HOH HOH A . 
K 9 HOH 172 772 196 HOH HOH A . 
K 9 HOH 173 773 197 HOH HOH A . 
K 9 HOH 174 774 198 HOH HOH A . 
K 9 HOH 175 775 199 HOH HOH A . 
K 9 HOH 176 776 200 HOH HOH A . 
K 9 HOH 177 777 202 HOH HOH A . 
K 9 HOH 178 778 204 HOH HOH A . 
K 9 HOH 179 779 205 HOH HOH A . 
K 9 HOH 180 780 207 HOH HOH A . 
K 9 HOH 181 781 208 HOH HOH A . 
K 9 HOH 182 782 210 HOH HOH A . 
K 9 HOH 183 783 211 HOH HOH A . 
K 9 HOH 184 784 212 HOH HOH A . 
K 9 HOH 185 785 213 HOH HOH A . 
K 9 HOH 186 786 214 HOH HOH A . 
K 9 HOH 187 787 215 HOH HOH A . 
K 9 HOH 188 788 216 HOH HOH A . 
K 9 HOH 189 789 217 HOH HOH A . 
K 9 HOH 190 790 218 HOH HOH A . 
K 9 HOH 191 791 219 HOH HOH A . 
K 9 HOH 192 792 220 HOH HOH A . 
K 9 HOH 193 793 221 HOH HOH A . 
K 9 HOH 194 794 222 HOH HOH A . 
K 9 HOH 195 795 223 HOH HOH A . 
K 9 HOH 196 796 224 HOH HOH A . 
K 9 HOH 197 797 225 HOH HOH A . 
K 9 HOH 198 798 227 HOH HOH A . 
K 9 HOH 199 799 228 HOH HOH A . 
K 9 HOH 200 800 229 HOH HOH A . 
K 9 HOH 201 801 230 HOH HOH A . 
K 9 HOH 202 802 231 HOH HOH A . 
K 9 HOH 203 803 232 HOH HOH A . 
K 9 HOH 204 804 233 HOH HOH A . 
K 9 HOH 205 805 234 HOH HOH A . 
K 9 HOH 206 806 235 HOH HOH A . 
K 9 HOH 207 807 236 HOH HOH A . 
K 9 HOH 208 808 238 HOH HOH A . 
K 9 HOH 209 809 239 HOH HOH A . 
K 9 HOH 210 810 242 HOH HOH A . 
K 9 HOH 211 811 243 HOH HOH A . 
K 9 HOH 212 812 245 HOH HOH A . 
K 9 HOH 213 813 247 HOH HOH A . 
K 9 HOH 214 814 250 HOH HOH A . 
K 9 HOH 215 815 251 HOH HOH A . 
K 9 HOH 216 816 252 HOH HOH A . 
K 9 HOH 217 817 253 HOH HOH A . 
K 9 HOH 218 818 254 HOH HOH A . 
K 9 HOH 219 819 255 HOH HOH A . 
K 9 HOH 220 820 256 HOH HOH A . 
K 9 HOH 221 821 259 HOH HOH A . 
K 9 HOH 222 822 260 HOH HOH A . 
K 9 HOH 223 823 261 HOH HOH A . 
K 9 HOH 224 824 262 HOH HOH A . 
K 9 HOH 225 825 263 HOH HOH A . 
K 9 HOH 226 826 264 HOH HOH A . 
K 9 HOH 227 827 265 HOH HOH A . 
K 9 HOH 228 828 266 HOH HOH A . 
K 9 HOH 229 829 267 HOH HOH A . 
K 9 HOH 230 830 268 HOH HOH A . 
K 9 HOH 231 831 269 HOH HOH A . 
K 9 HOH 232 832 272 HOH HOH A . 
K 9 HOH 233 833 273 HOH HOH A . 
K 9 HOH 234 834 274 HOH HOH A . 
K 9 HOH 235 835 278 HOH HOH A . 
K 9 HOH 236 836 279 HOH HOH A . 
K 9 HOH 237 837 280 HOH HOH A . 
K 9 HOH 238 838 281 HOH HOH A . 
K 9 HOH 239 839 282 HOH HOH A . 
K 9 HOH 240 840 283 HOH HOH A . 
K 9 HOH 241 841 284 HOH HOH A . 
K 9 HOH 242 842 285 HOH HOH A . 
K 9 HOH 243 843 286 HOH HOH A . 
K 9 HOH 244 844 288 HOH HOH A . 
K 9 HOH 245 845 291 HOH HOH A . 
K 9 HOH 246 846 292 HOH HOH A . 
K 9 HOH 247 847 293 HOH HOH A . 
K 9 HOH 248 848 294 HOH HOH A . 
K 9 HOH 249 849 297 HOH HOH A . 
K 9 HOH 250 850 298 HOH HOH A . 
K 9 HOH 251 851 299 HOH HOH A . 
K 9 HOH 252 852 303 HOH HOH A . 
K 9 HOH 253 853 304 HOH HOH A . 
K 9 HOH 254 854 306 HOH HOH A . 
K 9 HOH 255 855 307 HOH HOH A . 
K 9 HOH 256 856 308 HOH HOH A . 
K 9 HOH 257 857 310 HOH HOH A . 
K 9 HOH 258 858 311 HOH HOH A . 
K 9 HOH 259 859 312 HOH HOH A . 
K 9 HOH 260 860 313 HOH HOH A . 
K 9 HOH 261 861 317 HOH HOH A . 
K 9 HOH 262 862 318 HOH HOH A . 
K 9 HOH 263 863 319 HOH HOH A . 
K 9 HOH 264 864 320 HOH HOH A . 
K 9 HOH 265 865 321 HOH HOH A . 
K 9 HOH 266 866 322 HOH HOH A . 
K 9 HOH 267 867 323 HOH HOH A . 
K 9 HOH 268 868 324 HOH HOH A . 
K 9 HOH 269 869 326 HOH HOH A . 
K 9 HOH 270 870 327 HOH HOH A . 
K 9 HOH 271 871 328 HOH HOH A . 
K 9 HOH 272 872 329 HOH HOH A . 
K 9 HOH 273 873 330 HOH HOH A . 
K 9 HOH 274 874 331 HOH HOH A . 
K 9 HOH 275 875 332 HOH HOH A . 
L 9 HOH 1   101 79  HOH HOH T . 
L 9 HOH 2   102 107 HOH HOH T . 
L 9 HOH 3   103 129 HOH HOH T . 
L 9 HOH 4   104 141 HOH HOH T . 
L 9 HOH 5   105 161 HOH HOH T . 
L 9 HOH 6   106 170 HOH HOH T . 
L 9 HOH 7   107 173 HOH HOH T . 
L 9 HOH 8   108 180 HOH HOH T . 
L 9 HOH 9   109 181 HOH HOH T . 
L 9 HOH 10  110 246 HOH HOH T . 
L 9 HOH 11  111 271 HOH HOH T . 
L 9 HOH 12  112 275 HOH HOH T . 
L 9 HOH 13  113 290 HOH HOH T . 
L 9 HOH 14  114 296 HOH HOH T . 
L 9 HOH 15  115 309 HOH HOH T . 
M 9 HOH 1   101 8   HOH HOH P . 
M 9 HOH 2   102 34  HOH HOH P . 
M 9 HOH 3   103 60  HOH HOH P . 
M 9 HOH 4   104 62  HOH HOH P . 
M 9 HOH 5   105 71  HOH HOH P . 
M 9 HOH 6   106 89  HOH HOH P . 
M 9 HOH 7   107 94  HOH HOH P . 
M 9 HOH 8   108 121 HOH HOH P . 
M 9 HOH 9   109 186 HOH HOH P . 
M 9 HOH 10  110 201 HOH HOH P . 
M 9 HOH 11  111 209 HOH HOH P . 
M 9 HOH 12  112 241 HOH HOH P . 
M 9 HOH 13  113 249 HOH HOH P . 
M 9 HOH 14  114 270 HOH HOH P . 
M 9 HOH 15  115 277 HOH HOH P . 
M 9 HOH 16  116 287 HOH HOH P . 
M 9 HOH 17  117 295 HOH HOH P . 
M 9 HOH 18  118 302 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6200  ? 
1 MORE         -64   ? 
1 'SSA (A^2)'  21930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O7    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 O2    B J DPO .   ? P DPO 502 ? 1_555 76.0  ? 
2  O7    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 85.2  ? 
3  O2    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 147.9 ? 
4  O7    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 164.2 ? 
5  O2    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 88.2  ? 
6  OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 109.4 ? 
7  O7    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 92.5  ? 
8  O2    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 89.9  ? 
9  OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 117.0 ? 
10 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 86.3  ? 
11 O7    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 100.1 ? 
12 O2    B J DPO .   ? P DPO 502 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 83.2  ? 
13 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 505 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 74.7  ? 
14 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 505 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 78.7  ? 
15 OP1   B C DA  9   ? P DA  9   ? 1_555 MG B F MG . ? A MG 505 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 163.7 ? 
16 O1B   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 O3G   A I DTP .   ? P DTP 501 ? 1_555 81.6  ? 
17 O1B   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 O2A   A I DTP .   ? P DTP 501 ? 1_555 86.0  ? 
18 O3G   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 O2A   A I DTP .   ? P DTP 501 ? 1_555 89.1  ? 
19 O1B   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 175.4 ? 
20 O3G   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 102.2 ? 
21 O2A   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 96.5  ? 
22 O1B   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 85.1  ? 
23 O3G   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 166.4 ? 
24 O2A   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 92.9  ? 
25 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 504 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 90.9  ? 
26 O1B   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 88.4  ? 
27 O3G   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 97.8  ? 
28 O2A   A I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 170.3 ? 
29 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 504 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 88.6  ? 
30 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 504 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 78.7  ? 
31 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 173.1 ? 
32 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 100.2 ? 
33 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 81.4  ? 
34 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 98.7  ? 
35 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 81.1  ? 
36 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 158.4 ? 
37 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O2A   A I DTP .   ? P DTP 501 ? 1_555 94.3  ? 
38 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O2A   A I DTP .   ? P DTP 501 ? 1_555 87.8  ? 
39 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O2A   A I DTP .   ? P DTP 501 ? 1_555 7.9   ? 
40 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O2A   A I DTP .   ? P DTP 501 ? 1_555 159.6 ? 
41 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 87.9  ? 
42 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 85.6  ? 
43 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 84.7  ? 
44 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 106.3 ? 
45 O2A   A I DTP .   ? P DTP 501 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 89.8  ? 
46 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O     ? K HOH .   ? A HOH 603 ? 1_555 87.4  ? 
47 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O     ? K HOH .   ? A HOH 603 ? 1_555 99.4  ? 
48 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O     ? K HOH .   ? A HOH 603 ? 1_555 80.4  ? 
49 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O     ? K HOH .   ? A HOH 603 ? 1_555 90.2  ? 
50 O2A   A I DTP .   ? P DTP 501 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O     ? K HOH .   ? A HOH 603 ? 1_555 74.7  ? 
51 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 O     ? K HOH .   ? A HOH 603 ? 1_555 163.3 ? 
52 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 166.2 ? 
53 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 14.8  ? 
54 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 66.7  ? 
55 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 95.0  ? 
56 O2A   A I DTP .   ? P DTP 501 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 73.1  ? 
57 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 86.5  ? 
58 O     ? K HOH .   ? A HOH 603 ? 1_555 MG ? D MG . ? A MG 503 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 94.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ECS 
_pdbx_entry_details.nonpolymer_details   'CA A 504 AND MG A 505 ARE IN ALTERNATE CONFORMATIONS OF EACH OTHER.' 
_pdbx_entry_details.sequence_details     
;ARG A 61 HAS THE FOLLOWING ALTERNATE CONFIGURATION. 
ALTERNATE A HAS ARG 61 (OCCUPANCY 0.85),  
ALTERNATE B HAS ARG 61 (OCCUPANCY 0.15) + HOH A 601 + HOH A 602. 
CHAIN P HAS THE FOLLOWING ALTERNATE CONFIGURATION. 
ALTERNATE A HAS DT 8 + DTP 501 + HOH P 101,  
ALTERNATE B HAS DT 8 + DA 9 + DPO 502.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DC 9  ? ? "C1'" T DC 9  ? ? N1 T DC 9  ? ? 110.40 108.30 2.10 0.30 N 
2 1 "O4'" T DT 12 ? ? "C1'" T DT 12 ? ? N1 T DT 12 ? ? 110.30 108.30 2.00 0.30 N 
3 1 "O4'" P DA 1  ? ? "C1'" P DA 1  ? ? N9 P DA 1  ? ? 110.48 108.30 2.18 0.30 N 
4 1 "O4'" P DC 3  ? ? "C1'" P DC 3  ? ? N1 P DC 3  ? ? 110.10 108.30 1.80 0.30 N 
5 1 "O4'" P DC 6  ? ? "C1'" P DC 6  ? ? N1 P DC 6  ? ? 111.72 108.30 3.42 0.30 N 
6 1 "O4'" P DA 7  ? ? "C1'" P DA 7  ? ? N9 P DA 7  ? ? 110.24 108.30 1.94 0.30 N 
7 1 "O4'" P DT 8  ? A "C1'" P DT 8  ? A N1 P DT 8  ? A 110.26 108.30 1.96 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 19.08   66.74   
2 1 TYR A 39  ? ? 63.16   -175.81 
3 1 LYS A 40  ? ? -160.56 -29.86  
4 1 SER A 62  ? ? 83.88   -10.93  
5 1 SER A 217 ? ? -152.17 -155.75 
6 1 SER A 257 ? ? 98.28   -17.71  
7 1 LYS A 428 ? ? 61.71   63.02   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ECS 'double helix'        
4ECS 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.007  -0.169 -0.070 -3.359 -6.640  6.186  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.087 -0.066 0.327  -3.407 -15.959 2.124  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.144 -0.152 -0.332 -4.404 -1.483  -2.039 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 -0.003 -0.183 0.004  3.767  -1.520  0.060  4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.260  0.024  -0.395 11.214 -6.833  1.180  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.630 -0.124 -0.128 -3.954 -9.188  4.667  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.133  -0.063 0.204  -7.031 -3.622  1.787  7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.381 -0.094 -0.278 18.456 -1.349  3.813  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.736  -1.112 3.368 -3.844 -0.045 26.369 -2.401 -2.618 3.232 -0.098 8.370 
26.643 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.393 -1.231 3.262 6.565  10.714 28.955 -4.109 1.852  2.514 20.265 
-12.418 31.510 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.628 -0.518 3.205 -2.266 0.828  33.515 -1.030 0.721  3.226 1.433  3.923 
33.599 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.347  -0.702 3.276 3.177  1.775  30.911 -1.649 -0.038 3.250 3.316  -5.934 
31.120 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.392 -0.526 3.747 -6.427 7.226  33.511 -2.134 -0.461 3.573 12.220 10.869 
34.840 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.656 -0.582 3.489 -3.120 -1.500 37.889 -0.687 0.579  3.550 -2.305 4.793 
38.041 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.369  0.205  2.877 0.297  1.449  25.785 0.104  -0.753 2.888 3.242  -0.666 
25.827 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 DIPHOSPHATE                         DPO 
9 water                               HOH 
#