data_4ECU
# 
_entry.id   4ECU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ECU         
NDB   NA1704       
RCSB  RCSB071456   
WWPDB D_1000071456 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ECU 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ECU 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ECU 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ?                                     ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    3   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
9 water       nat water                                                18.015    302 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ECU       4ECU   2 ? ? ? 
3 PDB 4ECU       4ECU   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ECU A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ECU T 1 ? 12  ? 4ECU   1 ? 12  ? 1 12  
3 3 4ECU P 1 ? 9   ? 4ECU   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ECU GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ECU PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ECU HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ?                               'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ECU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ECU 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.949 
_reflns.number_obs                   33075 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.074 
_reflns.pdbx_netI_over_sigmaI        13.1 
_reflns.B_iso_Wilson_estimate        16.390 
_reflns.pdbx_redundancy              2.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.95 
_reflns_shell.d_res_low                   1.98 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.315 
_reflns_shell.meanI_over_sigI_obs         2.8 
_reflns_shell.pdbx_redundancy             2.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ECU 
_refine.ls_number_reflns_obs                     32989 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.45 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.102 
_refine.ls_d_res_high                            1.949 
_refine.ls_percent_reflns_obs                    98.71 
_refine.ls_R_factor_obs                          0.1755 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1732 
_refine.ls_R_factor_R_free                       0.2168 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_number_reflns_R_free                  1673 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               22.7890 
_refine.aniso_B[1][1]                            -0.1969 
_refine.aniso_B[2][2]                            -0.1969 
_refine.aniso_B[3][3]                            0.3938 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.346 
_refine.solvent_model_param_bsol                 31.943 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.20 
_refine.overall_FOM_work_R_set                   0.8667 
_refine.B_iso_max                                100.260 
_refine.B_iso_min                                4.400 
_refine.pdbx_overall_phase_error                 20.8700 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.000 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             302 
_refine_hist.number_atoms_total               4131 
_refine_hist.d_res_high                       1.949 
_refine_hist.d_res_low                        30.102 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4001 0.011  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5483 1.127  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     609  0.065  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      628  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1552 18.768 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.9489 2.0063  12 96.0000  2507 . 0.1907 0.2493 . 126 . 2633 . 'X-RAY DIFFRACTION' . 
2.0063 2.0710  12 100.0000 2639 . 0.1895 0.2641 . 126 . 2765 . 'X-RAY DIFFRACTION' . 
2.0710 2.1450  12 100.0000 2658 . 0.1794 0.2841 . 134 . 2792 . 'X-RAY DIFFRACTION' . 
2.1450 2.2309  12 100.0000 2615 . 0.1804 0.2383 . 135 . 2750 . 'X-RAY DIFFRACTION' . 
2.2309 2.3323  12 100.0000 2612 . 0.1764 0.2769 . 154 . 2766 . 'X-RAY DIFFRACTION' . 
2.3323 2.4553  12 100.0000 2616 . 0.1809 0.2278 . 156 . 2772 . 'X-RAY DIFFRACTION' . 
2.4553 2.6090  12 100.0000 2650 . 0.1872 0.2600 . 137 . 2787 . 'X-RAY DIFFRACTION' . 
2.6090 2.8103  12 100.0000 2643 . 0.1820 0.2327 . 139 . 2782 . 'X-RAY DIFFRACTION' . 
2.8103 3.0929  12 100.0000 2639 . 0.1892 0.2336 . 134 . 2773 . 'X-RAY DIFFRACTION' . 
3.0929 3.5398  12 99.0000  2601 . 0.1639 0.1932 . 150 . 2751 . 'X-RAY DIFFRACTION' . 
3.5398 4.4575  12 98.0000  2585 . 0.1493 0.1653 . 144 . 2729 . 'X-RAY DIFFRACTION' . 
4.4575 30.1057 12 94.0000  2551 . 0.1532 0.1689 . 138 . 2689 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ECU 
_struct.title                     
'Human DNA polymerase eta - DNA ternary complex: Reaction in the AT crystal at pH 7.0 for 200 sec' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ECU 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 4 ? 
L N N 9 ? 
M N N 9 ? 
N N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ARG A 108 ? LEU A 89  ARG A 105 1 ? 17 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD2   B ? ? 1_555 D MG  . MG  ? ? A ASP 13  A MG  501 1_555 ? ? ? ? ? ? ?            2.074 ? 
metalc2  metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1B A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.095 ? 
metalc3  metalc ? ? J DPO .   O1    B ? ? 1_555 K MG  . MG  B ? P DPO 505 P MG  506 1_555 ? ? ? ? ? ? ?            2.134 ? 
metalc4  metalc ? ? F MG  .   MG    B ? ? 1_555 J DPO . O7  B ? A MG  503 P DPO 505 1_555 ? ? ? ? ? ? ?            2.135 ? 
metalc5  metalc ? ? C DA  9   OP1   B ? ? 1_555 D MG  . MG  ? ? P DA  9   A MG  501 1_555 ? ? ? ? ? ? ?            2.163 ? 
metalc6  metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O2A A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.163 ? 
metalc7  metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O3G A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.166 ? 
metalc8  metalc ? ? D MG  .   MG    ? ? ? 1_555 I DTP . O2A A ? A MG  501 P DTP 504 1_555 ? ? ? ? ? ? ?            2.175 ? 
metalc9  metalc ? ? F MG  .   MG    B ? ? 1_555 J DPO . O2  B ? A MG  503 P DPO 505 1_555 ? ? ? ? ? ? ?            2.200 ? 
metalc10 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D MG  . MG  ? ? A ASP 115 A MG  501 1_555 ? ? ? ? ? ? ?            2.202 ? 
metalc11 metalc ? ? D MG  .   MG    ? ? ? 1_555 L HOH . O   ? ? A MG  501 A HOH 604 1_555 ? ? ? ? ? ? ?            2.218 ? 
metalc12 metalc ? ? A ASP 16  OD1   B ? ? 1_555 F MG  . MG  B ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.220 ? 
metalc13 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MG  . MG  ? ? A GLU 116 A MG  501 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc14 metalc ? ? C DA  9   OP2   B ? ? 1_555 K MG  . MG  B ? P DA  9   P MG  506 1_555 ? ? ? ? ? ? ?            2.229 ? 
metalc15 metalc ? ? A ASP 16  OD1   A ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.233 ? 
metalc16 metalc ? ? C DT  8   "O3'" A ? ? 1_555 D MG  . MG  ? ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc17 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.271 ? 
metalc18 metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.288 ? 
metalc19 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F MG  . MG  B ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.288 ? 
metalc20 metalc ? ? A MET 17  O     ? ? ? 1_555 F MG  . MG  B ? A MET 14  A MG  503 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc21 metalc ? ? C DA  9   OP1   B ? ? 1_555 F MG  . MG  B ? P DA  9   A MG  503 1_555 ? ? ? ? ? ? ?            2.419 ? 
metalc22 metalc ? ? C DT  8   "O3'" B ? ? 1_555 D MG  . MG  ? ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.453 ? 
metalc23 metalc ? ? K MG  .   MG    B ? ? 1_555 L HOH . O   ? ? P MG  506 A HOH 644 1_555 ? ? ? ? ? ? ?            2.511 ? 
metalc24 metalc ? ? K MG  .   MG    B ? ? 1_555 L HOH . O   B ? P MG  506 A HOH 601 1_555 ? ? ? ? ? ? ?            2.620 ? 
metalc25 metalc ? ? K MG  .   MG    B ? ? 1_555 L HOH . O   ? ? P MG  506 A HOH 843 1_555 ? ? ? ? ? ? ?            2.851 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.44  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -2.58 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -8.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N ASP A 16  ? N ASP A 13  O SER A 216 ? O SER A 213 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 502'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 503'  
AC4 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE DTP P 504' 
AC5 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE DPO P 505' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 507' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 508' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG P 506'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 9  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3  AC1 9  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4  AC1 9  CA  E .   ? CA  A 502 . ? 1_555 ? 
5  AC1 9  MG  F .   ? MG  A 503 . ? 1_555 ? 
6  AC1 9  HOH L .   ? HOH A 604 . ? 1_555 ? 
7  AC1 9  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8  AC1 9  DA  C 9   ? DA  P 9   . ? 1_555 ? 
9  AC1 9  DTP I .   ? DTP P 504 . ? 1_555 ? 
10 AC2 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
11 AC2 7  MET A 17  ? MET A 14  . ? 1_555 ? 
12 AC2 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
13 AC2 7  MG  D .   ? MG  A 501 . ? 1_555 ? 
14 AC2 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
15 AC2 7  DTP I .   ? DTP P 504 . ? 1_555 ? 
16 AC2 7  DPO J .   ? DPO P 505 . ? 1_555 ? 
17 AC3 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
18 AC3 7  MET A 17  ? MET A 14  . ? 1_555 ? 
19 AC3 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
20 AC3 7  MG  D .   ? MG  A 501 . ? 1_555 ? 
21 AC3 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
22 AC3 7  DTP I .   ? DTP P 504 . ? 1_555 ? 
23 AC3 7  DPO J .   ? DPO P 505 . ? 1_555 ? 
24 AC4 29 ASP A 16  ? ASP A 13  . ? 1_555 ? 
25 AC4 29 MET A 17  ? MET A 14  . ? 1_555 ? 
26 AC4 29 ASP A 18  ? ASP A 15  . ? 1_555 ? 
27 AC4 29 CYS A 19  ? CYS A 16  . ? 1_555 ? 
28 AC4 29 PHE A 20  ? PHE A 17  . ? 1_555 ? 
29 AC4 29 PHE A 21  ? PHE A 18  . ? 1_555 ? 
30 AC4 29 ILE A 51  ? ILE A 48  . ? 1_555 ? 
31 AC4 29 ALA A 52  ? ALA A 49  . ? 1_555 ? 
32 AC4 29 TYR A 55  ? TYR A 52  . ? 1_555 ? 
33 AC4 29 ARG A 58  ? ARG A 55  . ? 1_555 ? 
34 AC4 29 ARG A 64  ? ARG A 61  . ? 1_555 ? 
35 AC4 29 ASP A 118 ? ASP A 115 . ? 1_555 ? 
36 AC4 29 LYS A 234 ? LYS A 231 . ? 1_555 ? 
37 AC4 29 MG  D .   ? MG  A 501 . ? 1_555 ? 
38 AC4 29 CA  E .   ? CA  A 502 . ? 1_555 ? 
39 AC4 29 MG  F .   ? MG  A 503 . ? 1_555 ? 
40 AC4 29 HOH L .   ? HOH A 601 . ? 1_555 ? 
41 AC4 29 HOH L .   ? HOH A 602 . ? 1_555 ? 
42 AC4 29 HOH L .   ? HOH A 604 . ? 1_555 ? 
43 AC4 29 HOH L .   ? HOH A 617 . ? 1_555 ? 
44 AC4 29 HOH L .   ? HOH A 644 . ? 1_555 ? 
45 AC4 29 HOH L .   ? HOH A 754 . ? 1_555 ? 
46 AC4 29 HOH L .   ? HOH A 843 . ? 1_555 ? 
47 AC4 29 HOH L .   ? HOH A 861 . ? 1_555 ? 
48 AC4 29 DT  C 8   ? DT  P 8   . ? 1_555 ? 
49 AC4 29 HOH N .   ? HOH P 208 . ? 1_555 ? 
50 AC4 29 DT  B 3   ? DT  T 3   . ? 1_555 ? 
51 AC4 29 DT  B 4   ? DT  T 4   . ? 1_555 ? 
52 AC4 29 DA  B 5   ? DA  T 5   . ? 1_555 ? 
53 AC5 18 ASP A 16  ? ASP A 13  . ? 1_555 ? 
54 AC5 18 MET A 17  ? MET A 14  . ? 1_555 ? 
55 AC5 18 ASP A 18  ? ASP A 15  . ? 1_555 ? 
56 AC5 18 CYS A 19  ? CYS A 16  . ? 1_555 ? 
57 AC5 18 PHE A 20  ? PHE A 17  . ? 1_555 ? 
58 AC5 18 TYR A 55  ? TYR A 52  . ? 1_555 ? 
59 AC5 18 ARG A 58  ? ARG A 55  . ? 1_555 ? 
60 AC5 18 ARG A 64  ? ARG A 61  . ? 1_555 ? 
61 AC5 18 ASP A 118 ? ASP A 115 . ? 1_555 ? 
62 AC5 18 LYS A 234 ? LYS A 231 . ? 1_555 ? 
63 AC5 18 CA  E .   ? CA  A 502 . ? 1_555 ? 
64 AC5 18 MG  F .   ? MG  A 503 . ? 1_555 ? 
65 AC5 18 HOH L .   ? HOH A 617 . ? 1_555 ? 
66 AC5 18 HOH L .   ? HOH A 644 . ? 1_555 ? 
67 AC5 18 HOH L .   ? HOH A 843 . ? 1_555 ? 
68 AC5 18 HOH L .   ? HOH A 861 . ? 1_555 ? 
69 AC5 18 DA  C 9   ? DA  P 9   . ? 1_555 ? 
70 AC5 18 MG  K .   ? MG  P 506 . ? 1_555 ? 
71 AC6 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
72 AC6 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
73 AC6 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
74 AC6 10 SER A 251 ? SER A 248 . ? 1_555 ? 
75 AC6 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
76 AC6 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
77 AC6 10 HOH L .   ? HOH A 609 . ? 1_555 ? 
78 AC6 10 HOH L .   ? HOH A 655 . ? 1_555 ? 
79 AC6 10 HOH L .   ? HOH A 658 . ? 6_545 ? 
80 AC6 10 HOH L .   ? HOH A 798 . ? 1_555 ? 
81 AC7 9  ASN A 29  ? ASN A 26  . ? 1_555 ? 
82 AC7 9  PRO A 30  ? PRO A 27  . ? 1_555 ? 
83 AC7 9  HIS A 31  ? HIS A 28  . ? 1_555 ? 
84 AC7 9  GLY A 274 ? GLY A 271 . ? 5_664 ? 
85 AC7 9  GLU A 276 ? GLU A 273 . ? 5_664 ? 
86 AC7 9  TYR A 277 ? TYR A 274 . ? 5_664 ? 
87 AC7 9  GLU A 280 ? GLU A 277 . ? 5_664 ? 
88 AC7 9  HOH L .   ? HOH A 844 . ? 5_664 ? 
89 AC7 9  HOH L .   ? HOH A 855 . ? 5_664 ? 
90 AC8 6  ARG A 64  ? ARG A 61  . ? 1_555 ? 
91 AC8 6  HOH L .   ? HOH A 601 . ? 1_555 ? 
92 AC8 6  HOH L .   ? HOH A 644 . ? 1_555 ? 
93 AC8 6  HOH L .   ? HOH A 843 . ? 1_555 ? 
94 AC8 6  DA  C 9   ? DA  P 9   . ? 1_555 ? 
95 AC8 6  DPO J .   ? DPO P 505 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ECU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ECU 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.960 -34.551 -3.899  1.00 43.69  ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.265 -33.930 -3.758  1.00 53.16  ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.660 -33.053 -4.936  1.00 49.76  ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.529 -31.830 -4.870  1.00 50.20  ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.150 -33.678 -6.023  1.00 47.14  ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.622 -32.980 -7.229  1.00 46.36  ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.496 -32.425 -8.109  1.00 44.74  ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.763 -31.643 -9.026  1.00 47.73  ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.387 -34.074 -7.983  1.00 43.97  ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.710 -35.346 -7.572  1.00 44.49  ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.316 -35.140 -6.129  1.00 45.04  ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.256 -32.820 -7.831  1.00 46.30  ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.117 -32.384 -8.641  1.00 49.60  ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.127 -31.478 -7.894  1.00 52.31  ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.114 -31.066 -8.460  1.00 43.06  ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.391 -33.595 -9.246  1.00 40.93  ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.300 -34.536 -9.977  1.00 36.48  ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.926 -34.200 -11.159 1.00 35.19  ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.694 -35.801 -9.689  1.00 36.59  ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.665 -35.217 -11.570 1.00 38.39  ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.543 -36.199 -10.694 1.00 34.47  ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.419 -31.163 -6.633  1.00 54.24  ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.552 -30.265 -5.865  1.00 65.98  ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.917 -28.792 -6.072  1.00 55.44  ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.920 -28.314 -5.533  1.00 50.17  ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.567 -30.617 -4.370  1.00 66.09  ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.705 -29.692 -3.499  1.00 72.56  ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 60.971 -29.594 -4.020  1.00 100.26 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 60.271 -28.468 -2.799  1.00 59.54  ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 63.097 -28.086 -6.856  1.00 58.15  ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.286 -26.654 -7.104  1.00 51.02  ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.126 -25.877 -5.806  1.00 42.36  ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.232 -26.154 -5.008  1.00 40.39  ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 62.315 -26.141 -8.168  1.00 39.41  ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 64.000 -24.899 -5.607  1.00 33.39  ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.151 -24.268 -4.305  1.00 30.34  ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.666 -22.820 -4.304  1.00 25.97  ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.858 -22.099 -3.322  1.00 28.33  ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.618 -24.319 -3.853  1.00 26.42  ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.446 -23.734 -4.868  1.00 29.03  ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.057 -25.770 -3.620  1.00 24.83  ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.044 -22.403 -5.403  1.00 22.89  ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.479 -21.065 -5.496  1.00 28.38  ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.550 -20.003 -5.334  1.00 22.84  ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.390 -19.052 -4.559  1.00 19.55  ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.655 -20.196 -6.051  1.00 14.29  ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.790 -19.289 -5.999  1.00 12.89  ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.094 -18.699 -7.383  1.00 14.22  ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.169 -18.147 -7.609  1.00 15.90  ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.011 -20.021 -5.439  1.00 13.91  ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.923 -20.257 -3.926  1.00 16.23  ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.126 -21.000 -3.376  1.00 16.67  ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.972 -20.426 -2.687  1.00 19.35  ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.205 -22.282 -3.673  1.00 20.14  ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.120 -18.807 -8.286  1.00 20.21  ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.263 -18.424 -9.695  1.00 22.55  ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.273 -16.909 -9.958  1.00 20.84  ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.833 -16.457 -10.950 1.00 21.09  ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.152 -19.085 -10.541 1.00 21.10  ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.738 -18.873 -9.953  1.00 31.82  ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.518 -19.191 -8.764  1.00 25.31  ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.834 -18.388 -10.681 1.00 35.64  ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.653 -16.137 -9.075  1.00 19.65  ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.490 -14.697 -9.284  1.00 17.92  ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.095 -13.887 -8.154  1.00 14.60  ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.306 -14.392 -7.047  1.00 10.89  ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 63.003 -14.333 -9.342  1.00 13.04  ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.207 -14.954 -10.466 1.00 14.81  ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.725 -14.605 -10.292 1.00 14.63  ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.106 -15.287 -9.154  1.00 11.55  ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 59.010 -14.860 -8.531  1.00 14.79  ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.507 -15.550 -7.513  1.00 10.62  ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.415 -13.737 -8.921  1.00 11.99  ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.359 -12.617 -8.436  1.00 11.07  ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.624 -11.650 -7.387  1.00 5.79   ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.492 -10.636 -7.432  1.00 10.39  ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.244 -10.020 -8.475  1.00 9.87   ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.991 -10.956 -7.559  1.00 11.62  ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.225 -9.955  -6.432  1.00 10.09  ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.094 -11.996 -7.593  1.00 8.14   ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.794 -10.493 -6.304  1.00 9.58   ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.616 -9.636  -6.217  1.00 7.74   ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.778 -8.691  -5.040  1.00 11.32  ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.218 -9.095  -3.962  1.00 11.92  ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.317 -10.452 -6.022  1.00 8.06   ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.147 -9.524  -5.721  1.00 10.99  ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.021 -11.307 -7.250  1.00 10.32  ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.457 -7.421  -5.250  1.00 12.63  ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.478 -6.474  -4.150  1.00 8.16   ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.099 -5.876  -3.927  1.00 10.03  ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.264 -5.843  -4.840  1.00 11.85  ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.527 -5.377  -4.404  1.00 8.34   ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.849 -5.434  -2.699  1.00 5.88   ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.649 -4.658  -2.389  1.00 6.83   ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.098 -3.360  -1.713  1.00 13.31  ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.733 -3.396  -0.657  1.00 9.49   ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.706 -5.448  -1.472  1.00 7.83   ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.340 -4.897  -1.011  1.00 14.17  ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.457 -3.988  0.229   1.00 10.06  ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.600 -4.182  -2.166  1.00 12.77  ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.786 -2.226  -2.342  1.00 8.21   ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.174 -0.919  -1.838  1.00 9.36   ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.938 -0.271  -1.233  1.00 11.25  ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.893 -0.222  -1.873  1.00 9.52   ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.755 -0.036  -2.956  1.00 9.25   ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.104 1.366   -2.427  1.00 7.78   ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.976 -0.699  -3.545  1.00 9.99   ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.056 0.183   0.017   1.00 9.42   ? 13  ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 57.942 0.752   0.771   0.50 10.69  ? 13  ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 57.931 0.824   0.691   0.50 10.68  ? 13  ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.314 2.135   1.361   1.00 9.65   ? 13  ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.217 2.204   2.194   1.00 9.87   ? 13  ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.598 -0.234  1.890   0.50 10.11  ? 13  ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.292 -0.088  1.723   0.50 10.54  ? 13  ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.164 -0.102  2.362   0.50 14.99  ? 13  ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.133 0.586   2.426   0.50 12.91  ? 13  ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 55.778 1.004   2.793   0.50 11.42  ? 13  ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 56.315 1.080   3.550   0.50 13.55  ? 13  ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 55.422 -1.106  2.303   0.50 23.15  ? 13  ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 55.044 0.663   1.829   0.50 16.03  ? 13  ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.620 3.207   0.975   1.00 9.28   ? 14  MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 57.950 4.543   1.488   1.00 9.90   ? 14  MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.707 4.553   2.999   1.00 8.16   ? 14  MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.760 3.958   3.474   1.00 7.83   ? 14  MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.114 5.645   0.814   1.00 7.84   ? 14  MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.194 5.647   -0.730  1.00 10.21  ? 14  MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.891 5.523   -1.338  1.00 15.44  ? 14  MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.539 7.111   -0.865  1.00 13.98  ? 14  MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.576 5.201   3.753   1.00 6.56   ? 15  ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.365 5.286   5.200   1.00 9.63   ? 15  ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.296 6.349   5.486   1.00 14.21  ? 15  ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.299 7.404   4.847   1.00 9.07   ? 15  ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.670 5.661   5.911   1.00 7.54   ? 15  ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.772 4.593   5.745   1.00 11.63  ? 15  ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.459 3.392   5.653   1.00 9.45   ? 15  ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 61.956 4.968   5.732   1.00 13.54  ? 15  ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.416 6.074   6.451   1.00 9.94   ? 16  CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.302 6.966   6.817   1.00 10.95  ? 16  CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.949 7.929   5.687   1.00 8.53   ? 16  CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.146 9.139   5.800   1.00 8.32   ? 16  CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.584 7.726   8.127   1.00 6.55   ? 16  CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.158 8.613   8.229   1.00 13.93  ? 16  CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.423 7.386   4.599   1.00 7.60   ? 17  PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.443 8.103   3.327   1.00 9.54   ? 17  PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.721 9.472   3.318   1.00 6.22   ? 17  PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.317 10.485  2.948   1.00 5.30   ? 17  PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.954 7.202   2.185   1.00 7.51   ? 17  PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 54.037 7.847   0.839   1.00 8.54   ? 17  PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.222 8.442   0.406   1.00 6.91   ? 17  PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.926 7.883   0.008   1.00 11.87  ? 17  PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.294 9.055   -0.856  1.00 11.01  ? 17  PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.991 8.482   -1.242  1.00 9.99   ? 17  PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 54.177 9.071   -1.674  1.00 10.72  ? 17  PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.450 9.516   3.697   1.00 6.65   ? 18  PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.736 10.798  3.669   1.00 7.91   ? 18  PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.415 11.840  4.564   1.00 6.99   ? 18  PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.410 13.020  4.252   1.00 7.25   ? 18  PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.271 10.669  4.074   1.00 6.27   ? 18  PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.429 9.930   3.088   1.00 8.47   ? 18  PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 50.004 9.229   2.038   1.00 7.70   ? 18  PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 48.050 9.929   3.213   1.00 11.17  ? 18  PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.215 8.542   1.135   1.00 12.29  ? 18  PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.253 9.236   2.304   1.00 12.37  ? 18  PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.843 8.546   1.266   1.00 12.92  ? 18  PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.968 11.396  5.690   1.00 7.39   ? 19  VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.705 12.282  6.578   1.00 8.02   ? 19  VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.920 12.906  5.877   1.00 7.93   ? 19  VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.136 14.121  5.956   1.00 4.40   ? 19  VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.148 11.544  7.864   1.00 6.32   ? 19  VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.087 12.404  8.684   1.00 7.14   ? 19  VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.925 11.149  8.700   1.00 11.55  ? 19  VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.715 12.080  5.190   1.00 7.49   ? 20  GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.863 12.618  4.465   1.00 6.35   ? 20  GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.434 13.605  3.381   1.00 6.22   ? 20  GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.141 14.599  3.127   1.00 8.98   ? 20  GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.685 11.515  3.816   1.00 7.83   ? 20  GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.512 10.658  4.743   1.00 10.21  ? 20  GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.601 9.950   3.953   1.00 13.75  ? 20  GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.675 10.498  3.756   1.00 14.05  ? 20  GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.304 8.746   3.452   1.00 13.35  ? 20  GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.305 13.332  2.727   1.00 4.53   ? 21  VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.804 14.258  1.701   1.00 6.45   ? 21  VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.538 15.621  2.351   1.00 8.19   ? 21  VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.960 16.664  1.826   1.00 7.65   ? 21  VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.561 13.701  0.947   1.00 7.33   ? 21  VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.974 14.741  -0.027  1.00 5.59   ? 21  VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.937 12.432  0.193   1.00 6.70   ? 21  VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.894 15.606  3.517   1.00 8.12   ? 22  GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.594 16.846  4.237   1.00 6.90   ? 22  GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.846 17.514  4.820   1.00 6.54   ? 22  GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.918 18.746  4.886   1.00 5.32   ? 22  GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.546 16.608  5.351   1.00 6.23   ? 22  GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.191 16.138  4.825   1.00 5.02   ? 22  GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.504 17.177  3.924   1.00 13.11  ? 22  GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.764 18.399  4.079   1.00 11.41  ? 22  GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.703 16.771  3.056   1.00 14.04  ? 22  GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.804 16.707  5.276   1.00 6.37   ? 23  GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.064 17.233  5.818   1.00 6.38   ? 23  GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.954 17.856  4.743   1.00 8.33   ? 23  GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.666 18.834  4.996   1.00 5.56   ? 23  GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.857 16.144  6.560   1.00 7.58   ? 23  GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.227 15.695  7.879   1.00 7.72   ? 23  GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.972 14.535  8.507   1.00 10.30  ? 23  GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.371 13.604  7.817   1.00 8.56   ? 23  GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.184 14.597  9.814   1.00 11.71  ? 23  GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.937 17.281  3.548   1.00 6.80   ? 24  ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.681 17.894  2.455   1.00 7.84   ? 24  ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.124 19.295  2.198   1.00 10.95  ? 24  ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.884 20.237  2.000   1.00 7.96   ? 24  ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.605 17.065  1.171   1.00 6.56   ? 24  ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.433 17.685  0.031   1.00 11.72  ? 24  ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.489 16.781  -1.204  1.00 9.69   ? 24  ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.208 16.737  -1.904  1.00 6.91   ? 24  ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 58.018 16.122  -3.063  1.00 7.57   ? 24  ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 59.027 15.495  -3.670  1.00 6.87   ? 24  ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.827 16.156  -3.624  1.00 9.23   ? 24  ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.795 19.420  2.221   1.00 6.56   ? 25  GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.129 20.672  1.875   1.00 9.29   ? 25  GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.239 21.722  2.989   1.00 9.43   ? 25  GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.336 22.929  2.725   1.00 8.44   ? 25  GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.654 20.407  1.537   1.00 7.92   ? 25  GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.857 21.650  1.148   1.00 13.49  ? 25  GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.360 21.357  0.997   1.00 17.66  ? 25  GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 51.974 20.399  0.342   1.00 16.64  ? 25  GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.521 22.180  1.623   1.00 17.62  ? 25  GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.211 21.258  4.235   1.00 8.91   ? 26  ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.299 22.151  5.384   1.00 10.70  ? 26  ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.440 21.752  6.304   1.00 9.71   ? 26  ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.292 20.884  7.173   1.00 8.84   ? 26  ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.972 22.159  6.152   1.00 11.52  ? 26  ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.993 23.094  7.378   1.00 14.18  ? 26  ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 56.009 23.720  7.706   1.00 10.19  ? 26  ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.848 23.191  8.049   1.00 10.13  ? 26  ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.594 22.394  6.123   1.00 9.33   ? 27  PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.794 22.051  6.889   1.00 12.61  ? 27  PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.595 22.111  8.414   1.00 11.52  ? 27  PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.328 21.436  9.133   1.00 11.63  ? 27  PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.801 23.111  6.431   1.00 12.08  ? 27  PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.359 23.436  5.013   1.00 11.56  ? 27  PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.862 23.393  5.068   1.00 10.70  ? 27  PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.638 22.907  8.891   1.00 11.27  ? 28  HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.318 22.961  10.327  1.00 16.70  ? 28  HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.915 21.590  10.904  1.00 16.57  ? 28  HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 57.961 21.374  12.118  1.00 14.53  ? 28  HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.184 23.960  10.592  1.00 17.15  ? 28  HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.616 25.394  10.585  1.00 26.57  ? 28  HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 56.842 26.402  10.048  1.00 30.97  ? 28  HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.734 25.992  11.061  1.00 26.07  ? 28  HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.466 27.557  10.189  1.00 29.74  ? 28  HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.618 27.337  10.798  1.00 32.84  ? 28  HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.496 20.671  10.038  1.00 14.23  ? 29  LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 57.040 19.355  10.494  1.00 8.91   ? 29  LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.165 18.323  10.486  1.00 12.39  ? 29  LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 58.010 17.224  11.035  1.00 11.23  ? 29  LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.911 18.833  9.600   1.00 8.38   ? 29  LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.691 19.742  9.490   1.00 13.93  ? 29  LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.664 19.106  8.588   1.00 10.84  ? 29  LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 54.109 20.026  10.882  1.00 12.07  ? 29  LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.283 18.656  9.842   1.00 10.50  ? 30  ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.371 17.685  9.713   1.00 9.35   ? 30  ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 60.949 17.336  11.075  1.00 13.14  ? 30  ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.069 18.198  11.945  1.00 10.01  ? 30  ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.469 18.177  8.760   1.00 12.76  ? 30  ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 60.937 18.514  7.361   1.00 11.73  ? 30  ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 62.010 19.080  6.440   1.00 12.14  ? 30  ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.475 19.439  5.116   1.00 10.54  ? 30  ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.219 19.966  4.148   1.00 13.55  ? 30  ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.510 20.189  4.366   1.00 10.01  ? 30  ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.679 20.278  2.975   1.00 11.31  ? 30  ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.273 16.053  11.247  1.00 15.21  ? 31  ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.922 15.557  12.464  1.00 16.46  ? 31  ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.133 15.835  13.744  1.00 19.22  ? 31  ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.718 16.101  14.800  1.00 20.46  ? 31  ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.350 16.112  12.566  1.00 17.99  ? 31  ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.183 15.802  11.322  1.00 24.21  ? 31  ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.308 14.644  10.908  1.00 28.03  ? 31  ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.724 16.840  10.703  1.00 24.40  ? 31  ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.802 15.777  13.643  1.00 12.50  ? 32  LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.936 16.000  14.788  1.00 10.69  ? 32  LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.924 14.875  14.898  1.00 13.89  ? 32  LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.680 14.173  13.918  1.00 11.38  ? 32  LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.185 17.328  14.643  1.00 15.67  ? 32  LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 59.099 18.555  14.524  1.00 16.02  ? 32  LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 58.961 19.465  15.732  1.00 30.08  ? 32  LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 60.144 20.436  15.842  1.00 31.54  ? 32  LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 60.483 21.050  14.522  1.00 30.34  ? 32  LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.319 14.710  16.091  1.00 12.24  ? 33  PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.167 13.811  16.194  1.00 10.85  ? 33  PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.035 14.459  15.407  1.00 10.44  ? 33  PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.578 15.555  15.749  1.00 9.61   ? 33  PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.852 13.807  17.697  1.00 13.93  ? 33  PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.398 15.099  18.207  1.00 18.93  ? 33  PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.594 15.421  17.355  1.00 18.41  ? 33  PRO A CD    1 
ATOM   294  N  N     . CYS A 1 37  ? 54.593 13.799  14.351  1.00 9.24   ? 34  CYS A N     1 
ATOM   295  C  CA    A CYS A 1 37  ? 53.655 14.382  13.400  0.45 10.59  ? 34  CYS A CA    1 
ATOM   296  C  CA    B CYS A 1 37  ? 53.530 14.372  13.557  0.55 10.55  ? 34  CYS A CA    1 
ATOM   297  C  C     . CYS A 1 37  ? 52.718 13.293  12.874  1.00 9.70   ? 34  CYS A C     1 
ATOM   298  O  O     . CYS A 1 37  ? 53.143 12.146  12.754  1.00 10.19  ? 34  CYS A O     1 
ATOM   299  C  CB    A CYS A 1 37  ? 54.468 15.006  12.253  0.45 10.73  ? 34  CYS A CB    1 
ATOM   300  C  CB    B CYS A 1 37  ? 54.078 15.401  12.563  0.55 11.42  ? 34  CYS A CB    1 
ATOM   301  S  SG    A CYS A 1 37  ? 53.551 15.739  10.874  0.45 12.82  ? 34  CYS A SG    1 
ATOM   302  S  SG    B CYS A 1 37  ? 55.172 14.726  11.323  0.55 9.03   ? 34  CYS A SG    1 
ATOM   303  N  N     . ALA A 1 38  ? 51.483 13.651  12.534  1.00 6.96   ? 35  ALA A N     1 
ATOM   304  C  CA    . ALA A 1 38  ? 50.549 12.715  11.912  1.00 8.06   ? 35  ALA A CA    1 
ATOM   305  C  C     . ALA A 1 38  ? 49.760 13.424  10.843  1.00 8.46   ? 35  ALA A C     1 
ATOM   306  O  O     . ALA A 1 38  ? 49.633 14.654  10.883  1.00 8.89   ? 35  ALA A O     1 
ATOM   307  C  CB    . ALA A 1 38  ? 49.588 12.114  12.935  1.00 9.15   ? 35  ALA A CB    1 
ATOM   308  N  N     . VAL A 1 39  ? 49.211 12.641  9.907   1.00 9.72   ? 36  VAL A N     1 
ATOM   309  C  CA    . VAL A 1 39  ? 48.296 13.163  8.905   1.00 7.53   ? 36  VAL A CA    1 
ATOM   310  C  C     . VAL A 1 39  ? 46.884 12.715  9.261   1.00 14.40  ? 36  VAL A C     1 
ATOM   311  O  O     . VAL A 1 39  ? 46.659 11.542  9.585   1.00 10.33  ? 36  VAL A O     1 
ATOM   312  C  CB    . VAL A 1 39  ? 48.671 12.691  7.473   1.00 8.13   ? 36  VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 39  ? 47.601 13.118  6.457   1.00 6.92   ? 36  VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 39  ? 50.057 13.226  7.072   1.00 6.30   ? 36  VAL A CG2   1 
ATOM   315  N  N     . VAL A 1 40  ? 45.939 13.650  9.220   1.00 9.60   ? 37  VAL A N     1 
ATOM   316  C  CA    . VAL A 1 40  ? 44.567 13.376  9.645   1.00 10.52  ? 37  VAL A CA    1 
ATOM   317  C  C     . VAL A 1 40  ? 43.583 13.775  8.568   1.00 14.34  ? 37  VAL A C     1 
ATOM   318  O  O     . VAL A 1 40  ? 43.849 14.692  7.782   1.00 13.26  ? 37  VAL A O     1 
ATOM   319  C  CB    . VAL A 1 40  ? 44.174 14.181  10.925  1.00 20.33  ? 37  VAL A CB    1 
ATOM   320  C  CG1   . VAL A 1 40  ? 45.008 13.742  12.132  1.00 17.24  ? 37  VAL A CG1   1 
ATOM   321  C  CG2   . VAL A 1 40  ? 44.300 15.687  10.675  1.00 11.37  ? 37  VAL A CG2   1 
ATOM   322  N  N     . GLN A 1 41  ? 42.433 13.110  8.530   1.00 15.03  ? 38  GLN A N     1 
ATOM   323  C  CA    . GLN A 1 41  ? 41.386 13.580  7.638   1.00 11.80  ? 38  GLN A CA    1 
ATOM   324  C  C     . GLN A 1 41  ? 40.160 14.006  8.430   1.00 16.79  ? 38  GLN A C     1 
ATOM   325  O  O     . GLN A 1 41  ? 39.775 13.347  9.407   1.00 14.22  ? 38  GLN A O     1 
ATOM   326  C  CB    . GLN A 1 41  ? 41.069 12.595  6.492   1.00 18.33  ? 38  GLN A CB    1 
ATOM   327  C  CG    . GLN A 1 41  ? 40.839 11.166  6.887   1.00 22.18  ? 38  GLN A CG    1 
ATOM   328  C  CD    . GLN A 1 41  ? 40.832 10.210  5.684   1.00 19.85  ? 38  GLN A CD    1 
ATOM   329  O  OE1   . GLN A 1 41  ? 41.272 10.554  4.577   1.00 20.97  ? 38  GLN A OE1   1 
ATOM   330  N  NE2   . GLN A 1 41  ? 40.331 9.007   5.906   1.00 24.24  ? 38  GLN A NE2   1 
ATOM   331  N  N     . TYR A 1 42  ? 39.586 15.137  8.016   1.00 13.23  ? 39  TYR A N     1 
ATOM   332  C  CA    . TYR A 1 42  ? 38.465 15.756  8.702   1.00 15.30  ? 39  TYR A CA    1 
ATOM   333  C  C     . TYR A 1 42  ? 38.995 16.273  10.042  1.00 21.09  ? 39  TYR A C     1 
ATOM   334  O  O     . TYR A 1 42  ? 40.188 16.151  10.319  1.00 23.21  ? 39  TYR A O     1 
ATOM   335  C  CB    . TYR A 1 42  ? 37.314 14.766  8.809   1.00 12.25  ? 39  TYR A CB    1 
ATOM   336  C  CG    . TYR A 1 42  ? 36.916 14.243  7.435   1.00 17.79  ? 39  TYR A CG    1 
ATOM   337  C  CD1   . TYR A 1 42  ? 36.532 15.125  6.426   1.00 18.20  ? 39  TYR A CD1   1 
ATOM   338  C  CD2   . TYR A 1 42  ? 36.944 12.878  7.139   1.00 19.43  ? 39  TYR A CD2   1 
ATOM   339  C  CE1   . TYR A 1 42  ? 36.168 14.662  5.156   1.00 17.30  ? 39  TYR A CE1   1 
ATOM   340  C  CE2   . TYR A 1 42  ? 36.594 12.406  5.879   1.00 13.73  ? 39  TYR A CE2   1 
ATOM   341  C  CZ    . TYR A 1 42  ? 36.203 13.300  4.891   1.00 16.66  ? 39  TYR A CZ    1 
ATOM   342  O  OH    . TYR A 1 42  ? 35.841 12.818  3.644   1.00 16.22  ? 39  TYR A OH    1 
ATOM   343  N  N     . LYS A 1 43  ? 38.160 16.887  10.857  1.00 24.04  ? 40  LYS A N     1 
ATOM   344  C  CA    . LYS A 1 43  ? 38.711 17.536  12.045  1.00 26.84  ? 40  LYS A CA    1 
ATOM   345  C  C     . LYS A 1 43  ? 37.664 17.737  13.124  1.00 27.68  ? 40  LYS A C     1 
ATOM   346  O  O     . LYS A 1 43  ? 37.991 17.765  14.307  1.00 21.92  ? 40  LYS A O     1 
ATOM   347  C  CB    . LYS A 1 43  ? 39.386 18.869  11.679  1.00 28.30  ? 40  LYS A CB    1 
ATOM   348  C  CG    . LYS A 1 43  ? 40.447 19.371  12.685  1.00 37.20  ? 40  LYS A CG    1 
ATOM   349  C  CD    . LYS A 1 43  ? 41.868 18.857  12.364  1.00 34.82  ? 40  LYS A CD    1 
ATOM   350  C  CE    . LYS A 1 43  ? 42.919 19.434  13.326  1.00 32.95  ? 40  LYS A CE    1 
ATOM   351  N  NZ    . LYS A 1 43  ? 42.699 19.015  14.743  1.00 26.33  ? 40  LYS A NZ    1 
ATOM   352  N  N     . SER A 1 44  ? 36.405 17.850  12.709  1.00 22.01  ? 41  SER A N     1 
ATOM   353  C  CA    . SER A 1 44  ? 35.325 18.141  13.641  1.00 24.45  ? 41  SER A CA    1 
ATOM   354  C  C     . SER A 1 44  ? 35.068 16.993  14.621  1.00 25.23  ? 41  SER A C     1 
ATOM   355  O  O     . SER A 1 44  ? 34.895 17.227  15.815  1.00 29.65  ? 41  SER A O     1 
ATOM   356  C  CB    . SER A 1 44  ? 34.045 18.511  12.885  1.00 31.26  ? 41  SER A CB    1 
ATOM   357  O  OG    . SER A 1 44  ? 33.446 17.368  12.295  1.00 31.30  ? 41  SER A OG    1 
ATOM   358  N  N     . TRP A 1 45  ? 35.051 15.757  14.127  1.00 26.47  ? 42  TRP A N     1 
ATOM   359  C  CA    . TRP A 1 45  ? 34.792 14.602  14.991  1.00 23.55  ? 42  TRP A CA    1 
ATOM   360  C  C     . TRP A 1 45  ? 36.084 14.095  15.653  1.00 23.34  ? 42  TRP A C     1 
ATOM   361  O  O     . TRP A 1 45  ? 36.889 13.414  15.018  1.00 19.42  ? 42  TRP A O     1 
ATOM   362  C  CB    . TRP A 1 45  ? 34.102 13.473  14.204  1.00 26.54  ? 42  TRP A CB    1 
ATOM   363  C  CG    . TRP A 1 45  ? 33.698 12.271  15.033  1.00 28.90  ? 42  TRP A CG    1 
ATOM   364  C  CD1   . TRP A 1 45  ? 34.458 11.166  15.300  1.00 32.72  ? 42  TRP A CD1   1 
ATOM   365  C  CD2   . TRP A 1 45  ? 32.432 12.048  15.675  1.00 33.99  ? 42  TRP A CD2   1 
ATOM   366  N  NE1   . TRP A 1 45  ? 33.751 10.278  16.077  1.00 35.66  ? 42  TRP A NE1   1 
ATOM   367  C  CE2   . TRP A 1 45  ? 32.505 10.794  16.320  1.00 34.79  ? 42  TRP A CE2   1 
ATOM   368  C  CE3   . TRP A 1 45  ? 31.246 12.787  15.769  1.00 37.92  ? 42  TRP A CE3   1 
ATOM   369  C  CZ2   . TRP A 1 45  ? 31.441 10.265  17.050  1.00 34.10  ? 42  TRP A CZ2   1 
ATOM   370  C  CZ3   . TRP A 1 45  ? 30.190 12.261  16.496  1.00 35.20  ? 42  TRP A CZ3   1 
ATOM   371  C  CH2   . TRP A 1 45  ? 30.294 11.011  17.126  1.00 34.41  ? 42  TRP A CH2   1 
ATOM   372  N  N     . LYS A 1 46  ? 36.263 14.451  16.925  1.00 21.72  ? 43  LYS A N     1 
ATOM   373  C  CA    . LYS A 1 46  ? 37.379 13.991  17.757  1.00 15.63  ? 43  LYS A CA    1 
ATOM   374  C  C     . LYS A 1 46  ? 38.745 14.420  17.229  1.00 13.30  ? 43  LYS A C     1 
ATOM   375  O  O     . LYS A 1 46  ? 39.758 13.770  17.488  1.00 16.24  ? 43  LYS A O     1 
ATOM   376  C  CB    . LYS A 1 46  ? 37.310 12.475  17.963  1.00 20.90  ? 43  LYS A CB    1 
ATOM   377  C  CG    . LYS A 1 46  ? 36.083 12.002  18.754  1.00 30.34  ? 43  LYS A CG    1 
ATOM   378  C  CD    . LYS A 1 46  ? 35.968 10.475  18.773  1.00 28.11  ? 43  LYS A CD    1 
ATOM   379  C  CE    . LYS A 1 46  ? 34.891 9.980   19.742  1.00 42.95  ? 43  LYS A CE    1 
ATOM   380  N  NZ    . LYS A 1 46  ? 35.306 10.136  21.176  1.00 49.55  ? 43  LYS A NZ    1 
ATOM   381  N  N     . GLY A 1 47  ? 38.755 15.528  16.497  1.00 17.12  ? 44  GLY A N     1 
ATOM   382  C  CA    . GLY A 1 47  ? 39.974 16.123  15.986  1.00 14.04  ? 44  GLY A CA    1 
ATOM   383  C  C     . GLY A 1 47  ? 40.435 15.540  14.659  1.00 10.86  ? 44  GLY A C     1 
ATOM   384  O  O     . GLY A 1 47  ? 41.446 15.968  14.117  1.00 15.10  ? 44  GLY A O     1 
ATOM   385  N  N     . GLY A 1 48  ? 39.705 14.562  14.137  1.00 16.63  ? 45  GLY A N     1 
ATOM   386  C  CA    . GLY A 1 48  ? 40.067 13.956  12.863  1.00 15.89  ? 45  GLY A CA    1 
ATOM   387  C  C     . GLY A 1 48  ? 40.675 12.575  13.017  1.00 17.92  ? 45  GLY A C     1 
ATOM   388  O  O     . GLY A 1 48  ? 41.274 12.254  14.047  1.00 14.04  ? 45  GLY A O     1 
ATOM   389  N  N     . GLY A 1 49  ? 40.525 11.745  11.990  1.00 14.40  ? 46  GLY A N     1 
ATOM   390  C  CA    . GLY A 1 49  ? 41.048 10.389  12.044  1.00 13.41  ? 46  GLY A CA    1 
ATOM   391  C  C     . GLY A 1 49  ? 42.476 10.347  11.515  1.00 16.79  ? 46  GLY A C     1 
ATOM   392  O  O     . GLY A 1 49  ? 42.754 10.866  10.435  1.00 13.88  ? 46  GLY A O     1 
ATOM   393  N  N     . ILE A 1 50  ? 43.382 9.735   12.267  1.00 10.43  ? 47  ILE A N     1 
ATOM   394  C  CA    . ILE A 1 50  ? 44.797 9.689   11.863  1.00 10.44  ? 47  ILE A CA    1 
ATOM   395  C  C     . ILE A 1 50  ? 44.999 8.609   10.801  1.00 10.15  ? 47  ILE A C     1 
ATOM   396  O  O     . ILE A 1 50  ? 44.539 7.488   10.969  1.00 11.19  ? 47  ILE A O     1 
ATOM   397  C  CB    . ILE A 1 50  ? 45.728 9.446   13.090  1.00 12.55  ? 47  ILE A CB    1 
ATOM   398  C  CG1   . ILE A 1 50  ? 45.748 10.680  13.993  1.00 16.05  ? 47  ILE A CG1   1 
ATOM   399  C  CG2   . ILE A 1 50  ? 47.166 9.075   12.656  1.00 10.51  ? 47  ILE A CG2   1 
ATOM   400  C  CD1   . ILE A 1 50  ? 46.611 10.499  15.232  1.00 15.96  ? 47  ILE A CD1   1 
ATOM   401  N  N     . ILE A 1 51  ? 45.664 8.946   9.698   1.00 8.14   ? 48  ILE A N     1 
ATOM   402  C  CA    . ILE A 1 51  ? 45.944 7.934   8.674   1.00 11.40  ? 48  ILE A CA    1 
ATOM   403  C  C     . ILE A 1 51  ? 47.427 7.629   8.430   1.00 13.10  ? 48  ILE A C     1 
ATOM   404  O  O     . ILE A 1 51  ? 47.757 6.655   7.754   1.00 13.64  ? 48  ILE A O     1 
ATOM   405  C  CB    . ILE A 1 51  ? 45.239 8.232   7.328   1.00 16.33  ? 48  ILE A CB    1 
ATOM   406  C  CG1   . ILE A 1 51  ? 45.710 9.561   6.736   1.00 13.92  ? 48  ILE A CG1   1 
ATOM   407  C  CG2   . ILE A 1 51  ? 43.705 8.190   7.489   1.00 15.21  ? 48  ILE A CG2   1 
ATOM   408  C  CD1   . ILE A 1 51  ? 45.179 9.781   5.346   1.00 15.73  ? 48  ILE A CD1   1 
ATOM   409  N  N     . ALA A 1 52  ? 48.316 8.446   8.984   1.00 11.56  ? 49  ALA A N     1 
ATOM   410  C  CA    . ALA A 1 52  ? 49.750 8.177   8.899   1.00 8.53   ? 49  ALA A CA    1 
ATOM   411  C  C     . ALA A 1 52  ? 50.486 8.856   10.060  1.00 10.77  ? 49  ALA A C     1 
ATOM   412  O  O     . ALA A 1 52  ? 50.066 9.921   10.525  1.00 7.11   ? 49  ALA A O     1 
ATOM   413  C  CB    . ALA A 1 52  ? 50.310 8.643   7.532   1.00 7.82   ? 49  ALA A CB    1 
ATOM   414  N  N     . VAL A 1 53  ? 51.584 8.250   10.521  1.00 7.04   ? 50  VAL A N     1 
ATOM   415  C  CA    . VAL A 1 53  ? 52.235 8.694   11.752  1.00 7.57   ? 50  VAL A CA    1 
ATOM   416  C  C     . VAL A 1 53  ? 53.751 8.657   11.619  1.00 7.44   ? 50  VAL A C     1 
ATOM   417  O  O     . VAL A 1 53  ? 54.302 7.630   11.227  1.00 7.28   ? 50  VAL A O     1 
ATOM   418  C  CB    . VAL A 1 53  ? 51.864 7.734   12.911  1.00 6.61   ? 50  VAL A CB    1 
ATOM   419  C  CG1   . VAL A 1 53  ? 52.404 8.253   14.232  1.00 12.43  ? 50  VAL A CG1   1 
ATOM   420  C  CG2   . VAL A 1 53  ? 50.367 7.554   12.987  1.00 11.76  ? 50  VAL A CG2   1 
ATOM   421  N  N     . SER A 1 54  ? 54.430 9.752   11.967  1.00 8.36   ? 51  SER A N     1 
ATOM   422  C  CA    . SER A 1 54  ? 55.895 9.777   11.917  1.00 9.43   ? 51  SER A CA    1 
ATOM   423  C  C     . SER A 1 54  ? 56.475 8.834   12.963  1.00 11.52  ? 51  SER A C     1 
ATOM   424  O  O     . SER A 1 54  ? 55.830 8.533   13.973  1.00 9.64   ? 51  SER A O     1 
ATOM   425  C  CB    . SER A 1 54  ? 56.450 11.186  12.148  1.00 9.49   ? 51  SER A CB    1 
ATOM   426  O  OG    . SER A 1 54  ? 56.432 11.516  13.530  1.00 11.90  ? 51  SER A OG    1 
ATOM   427  N  N     . TYR A 1 55  ? 57.699 8.372   12.724  1.00 8.75   ? 52  TYR A N     1 
ATOM   428  C  CA    . TYR A 1 55  ? 58.323 7.447   13.651  1.00 11.19  ? 52  TYR A CA    1 
ATOM   429  C  C     . TYR A 1 55  ? 58.512 8.081   15.027  1.00 14.23  ? 52  TYR A C     1 
ATOM   430  O  O     . TYR A 1 55  ? 58.379 7.404   16.030  1.00 12.17  ? 52  TYR A O     1 
ATOM   431  C  CB    . TYR A 1 55  ? 59.611 6.855   13.060  1.00 11.99  ? 52  TYR A CB    1 
ATOM   432  C  CG    . TYR A 1 55  ? 59.258 5.762   12.080  1.00 13.99  ? 52  TYR A CG    1 
ATOM   433  C  CD1   . TYR A 1 55  ? 58.836 6.069   10.789  1.00 11.64  ? 52  TYR A CD1   1 
ATOM   434  C  CD2   . TYR A 1 55  ? 59.265 4.433   12.466  1.00 14.92  ? 52  TYR A CD2   1 
ATOM   435  C  CE1   . TYR A 1 55  ? 58.465 5.080   9.897   1.00 12.08  ? 52  TYR A CE1   1 
ATOM   436  C  CE2   . TYR A 1 55  ? 58.894 3.429   11.585  1.00 14.70  ? 52  TYR A CE2   1 
ATOM   437  C  CZ    . TYR A 1 55  ? 58.498 3.754   10.297  1.00 15.09  ? 52  TYR A CZ    1 
ATOM   438  O  OH    . TYR A 1 55  ? 58.131 2.755   9.418   1.00 13.47  ? 52  TYR A OH    1 
ATOM   439  N  N     . GLU A 1 56  ? 58.754 9.391   15.065  1.00 13.77  ? 53  GLU A N     1 
ATOM   440  C  CA    . GLU A 1 56  ? 58.867 10.111  16.332  1.00 13.97  ? 53  GLU A CA    1 
ATOM   441  C  C     . GLU A 1 56  ? 57.575 10.026  17.134  1.00 13.54  ? 53  GLU A C     1 
ATOM   442  O  O     . GLU A 1 56  ? 57.603 9.835   18.350  1.00 14.39  ? 53  GLU A O     1 
ATOM   443  C  CB    . GLU A 1 56  ? 59.237 11.583  16.099  1.00 12.94  ? 53  GLU A CB    1 
ATOM   444  C  CG    . GLU A 1 56  ? 60.632 11.827  15.522  1.00 18.52  ? 53  GLU A CG    1 
ATOM   445  C  CD    . GLU A 1 56  ? 60.754 11.578  14.010  1.00 29.90  ? 53  GLU A CD    1 
ATOM   446  O  OE1   . GLU A 1 56  ? 59.788 11.104  13.362  1.00 17.50  ? 53  GLU A OE1   1 
ATOM   447  O  OE2   . GLU A 1 56  ? 61.849 11.854  13.473  1.00 28.81  ? 53  GLU A OE2   1 
ATOM   448  N  N     . ALA A 1 57  ? 56.440 10.181  16.455  1.00 10.10  ? 54  ALA A N     1 
ATOM   449  C  CA    . ALA A 1 57  ? 55.140 10.081  17.107  1.00 11.21  ? 54  ALA A CA    1 
ATOM   450  C  C     . ALA A 1 57  ? 54.776 8.652   17.517  1.00 10.91  ? 54  ALA A C     1 
ATOM   451  O  O     . ALA A 1 57  ? 54.127 8.454   18.548  1.00 8.72   ? 54  ALA A O     1 
ATOM   452  C  CB    . ALA A 1 57  ? 54.038 10.675  16.221  1.00 13.71  ? 54  ALA A CB    1 
ATOM   453  N  N     . ARG A 1 58  ? 55.187 7.658   16.726  1.00 12.11  ? 55  ARG A N     1 
ATOM   454  C  CA    . ARG A 1 58  ? 54.899 6.259   17.085  1.00 11.54  ? 55  ARG A CA    1 
ATOM   455  C  C     . ARG A 1 58  ? 55.538 5.892   18.424  1.00 16.13  ? 55  ARG A C     1 
ATOM   456  O  O     . ARG A 1 58  ? 55.008 5.053   19.161  1.00 12.27  ? 55  ARG A O     1 
ATOM   457  C  CB    . ARG A 1 58  ? 55.371 5.287   16.011  1.00 10.41  ? 55  ARG A CB    1 
ATOM   458  C  CG    . ARG A 1 58  ? 54.810 5.575   14.639  1.00 10.27  ? 55  ARG A CG    1 
ATOM   459  C  CD    . ARG A 1 58  ? 55.380 4.610   13.607  1.00 14.81  ? 55  ARG A CD    1 
ATOM   460  N  NE    . ARG A 1 58  ? 54.985 5.029   12.264  1.00 12.69  ? 55  ARG A NE    1 
ATOM   461  C  CZ    . ARG A 1 58  ? 55.051 4.273   11.175  1.00 15.13  ? 55  ARG A CZ    1 
ATOM   462  N  NH1   . ARG A 1 58  ? 55.518 3.030   11.251  1.00 11.83  ? 55  ARG A NH1   1 
ATOM   463  N  NH2   . ARG A 1 58  ? 54.642 4.771   10.008  1.00 13.39  ? 55  ARG A NH2   1 
ATOM   464  N  N     . ALA A 1 59  ? 56.668 6.527   18.733  1.00 11.46  ? 56  ALA A N     1 
ATOM   465  C  CA    . ALA A 1 59  ? 57.356 6.262   19.996  1.00 15.46  ? 56  ALA A CA    1 
ATOM   466  C  C     . ALA A 1 59  ? 56.472 6.611   21.197  1.00 17.02  ? 56  ALA A C     1 
ATOM   467  O  O     . ALA A 1 59  ? 56.618 6.025   22.271  1.00 18.17  ? 56  ALA A O     1 
ATOM   468  C  CB    . ALA A 1 59  ? 58.691 6.997   20.056  1.00 13.37  ? 56  ALA A CB    1 
ATOM   469  N  N     . PHE A 1 60  ? 55.547 7.552   21.017  1.00 10.84  ? 57  PHE A N     1 
ATOM   470  C  CA    . PHE A 1 60  ? 54.587 7.879   22.070  1.00 13.15  ? 57  PHE A CA    1 
ATOM   471  C  C     . PHE A 1 60  ? 53.373 6.942   22.073  1.00 15.54  ? 57  PHE A C     1 
ATOM   472  O  O     . PHE A 1 60  ? 52.517 7.028   22.957  1.00 16.28  ? 57  PHE A O     1 
ATOM   473  C  CB    . PHE A 1 60  ? 54.095 9.327   21.937  1.00 11.98  ? 57  PHE A CB    1 
ATOM   474  C  CG    . PHE A 1 60  ? 55.132 10.369  22.281  1.00 14.65  ? 57  PHE A CG    1 
ATOM   475  C  CD1   . PHE A 1 60  ? 55.166 10.943  23.548  1.00 22.83  ? 57  PHE A CD1   1 
ATOM   476  C  CD2   . PHE A 1 60  ? 56.061 10.783  21.336  1.00 12.83  ? 57  PHE A CD2   1 
ATOM   477  C  CE1   . PHE A 1 60  ? 56.109 11.911  23.872  1.00 23.18  ? 57  PHE A CE1   1 
ATOM   478  C  CE2   . PHE A 1 60  ? 57.012 11.753  21.648  1.00 19.38  ? 57  PHE A CE2   1 
ATOM   479  C  CZ    . PHE A 1 60  ? 57.036 12.317  22.918  1.00 28.20  ? 57  PHE A CZ    1 
ATOM   480  N  N     . GLY A 1 61  ? 53.284 6.067   21.079  1.00 10.79  ? 58  GLY A N     1 
ATOM   481  C  CA    . GLY A 1 61  ? 52.170 5.132   20.984  1.00 13.89  ? 58  GLY A CA    1 
ATOM   482  C  C     . GLY A 1 61  ? 51.056 5.582   20.051  1.00 14.18  ? 58  GLY A C     1 
ATOM   483  O  O     . GLY A 1 61  ? 49.977 4.987   20.017  1.00 13.08  ? 58  GLY A O     1 
ATOM   484  N  N     . VAL A 1 62  ? 51.306 6.651   19.299  1.00 11.37  ? 59  VAL A N     1 
ATOM   485  C  CA    . VAL A 1 62  ? 50.348 7.133   18.312  1.00 11.40  ? 59  VAL A CA    1 
ATOM   486  C  C     . VAL A 1 62  ? 50.246 6.128   17.168  1.00 13.03  ? 59  VAL A C     1 
ATOM   487  O  O     . VAL A 1 62  ? 51.258 5.651   16.672  1.00 11.22  ? 59  VAL A O     1 
ATOM   488  C  CB    . VAL A 1 62  ? 50.752 8.535   17.759  1.00 9.10   ? 59  VAL A CB    1 
ATOM   489  C  CG1   . VAL A 1 62  ? 49.761 8.994   16.695  1.00 12.38  ? 59  VAL A CG1   1 
ATOM   490  C  CG2   . VAL A 1 62  ? 50.785 9.556   18.898  1.00 13.81  ? 59  VAL A CG2   1 
ATOM   491  N  N     . THR A 1 63  ? 49.026 5.802   16.751  1.00 15.46  ? 60  THR A N     1 
ATOM   492  C  CA    . THR A 1 63  ? 48.852 4.857   15.656  1.00 14.43  ? 60  THR A CA    1 
ATOM   493  C  C     . THR A 1 63  ? 47.815 5.329   14.663  1.00 15.54  ? 60  THR A C     1 
ATOM   494  O  O     . THR A 1 63  ? 47.016 6.225   14.935  1.00 14.92  ? 60  THR A O     1 
ATOM   495  C  CB    . THR A 1 63  ? 48.390 3.478   16.156  1.00 17.76  ? 60  THR A CB    1 
ATOM   496  O  OG1   . THR A 1 63  ? 47.100 3.610   16.760  1.00 19.50  ? 60  THR A OG1   1 
ATOM   497  C  CG2   . THR A 1 63  ? 49.381 2.900   17.170  1.00 15.84  ? 60  THR A CG2   1 
ATOM   498  N  N     . ARG A 1 64  ? 47.821 4.685   13.509  1.00 15.75  ? 61  ARG A N     1 
ATOM   499  C  CA    . ARG A 1 64  ? 46.812 4.907   12.489  1.00 17.98  ? 61  ARG A CA    1 
ATOM   500  C  C     . ARG A 1 64  ? 45.454 4.423   12.982  1.00 20.44  ? 61  ARG A C     1 
ATOM   501  O  O     . ARG A 1 64  ? 45.351 3.417   13.683  1.00 20.35  ? 61  ARG A O     1 
ATOM   502  C  CB    . ARG A 1 64  ? 47.191 4.185   11.194  1.00 19.22  ? 61  ARG A CB    1 
ATOM   503  C  CG    A ARG A 1 64  ? 46.054 3.631   10.350  0.50 24.13  ? 61  ARG A CG    1 
ATOM   504  C  CG    B ARG A 1 64  ? 46.023 4.242   10.223  0.50 23.77  ? 61  ARG A CG    1 
ATOM   505  C  CD    A ARG A 1 64  ? 46.566 3.080   9.029   0.50 23.33  ? 61  ARG A CD    1 
ATOM   506  C  CD    B ARG A 1 64  ? 46.310 3.438   8.966   0.50 23.84  ? 61  ARG A CD    1 
ATOM   507  N  NE    A ARG A 1 64  ? 47.636 3.901   8.471   0.50 22.07  ? 61  ARG A NE    1 
ATOM   508  N  NE    B ARG A 1 64  ? 47.001 2.186   9.264   0.50 22.90  ? 61  ARG A NE    1 
ATOM   509  C  CZ    A ARG A 1 64  ? 48.749 3.414   7.933   0.50 20.50  ? 61  ARG A CZ    1 
ATOM   510  C  CZ    B ARG A 1 64  ? 46.388 1.022   9.454   0.50 26.52  ? 61  ARG A CZ    1 
ATOM   511  N  NH1   A ARG A 1 64  ? 49.670 4.236   7.450   0.50 17.64  ? 61  ARG A NH1   1 
ATOM   512  N  NH1   B ARG A 1 64  ? 47.097 -0.067  9.720   0.50 30.37  ? 61  ARG A NH1   1 
ATOM   513  N  NH2   A ARG A 1 64  ? 48.942 2.103   7.877   0.50 22.03  ? 61  ARG A NH2   1 
ATOM   514  N  NH2   B ARG A 1 64  ? 45.067 0.946   9.378   0.50 29.51  ? 61  ARG A NH2   1 
ATOM   515  N  N     . SER A 1 65  ? 44.410 5.174   12.632  1.00 18.64  ? 62  SER A N     1 
ATOM   516  C  CA    . SER A 1 65  ? 43.029 4.875   13.010  1.00 24.24  ? 62  SER A CA    1 
ATOM   517  C  C     . SER A 1 65  ? 42.635 5.507   14.338  1.00 22.28  ? 62  SER A C     1 
ATOM   518  O  O     . SER A 1 65  ? 41.475 5.488   14.730  1.00 32.42  ? 62  SER A O     1 
ATOM   519  C  CB    . SER A 1 65  ? 42.793 3.377   13.103  1.00 26.82  ? 62  SER A CB    1 
ATOM   520  O  OG    . SER A 1 65  ? 42.940 2.957   14.449  1.00 32.09  ? 62  SER A OG    1 
ATOM   521  N  N     . MET A 1 66  ? 43.617 6.039   15.043  1.00 20.10  ? 63  MET A N     1 
ATOM   522  C  CA    . MET A 1 66  ? 43.384 6.733   16.292  1.00 14.00  ? 63  MET A CA    1 
ATOM   523  C  C     . MET A 1 66  ? 42.778 8.098   15.976  1.00 18.79  ? 63  MET A C     1 
ATOM   524  O  O     . MET A 1 66  ? 43.117 8.704   14.950  1.00 13.04  ? 63  MET A O     1 
ATOM   525  C  CB    . MET A 1 66  ? 44.735 6.888   16.977  1.00 16.96  ? 63  MET A CB    1 
ATOM   526  C  CG    . MET A 1 66  ? 44.748 7.340   18.394  1.00 20.41  ? 63  MET A CG    1 
ATOM   527  S  SD    . MET A 1 66  ? 46.425 7.087   19.012  1.00 18.85  ? 63  MET A SD    1 
ATOM   528  C  CE    . MET A 1 66  ? 46.375 5.385   19.556  1.00 18.01  ? 63  MET A CE    1 
ATOM   529  N  N     . TRP A 1 67  ? 41.861 8.567   16.829  1.00 14.26  ? 64  TRP A N     1 
ATOM   530  C  CA    . TRP A 1 67  ? 41.359 9.943   16.733  1.00 15.87  ? 64  TRP A CA    1 
ATOM   531  C  C     . TRP A 1 67  ? 42.444 10.910  17.180  1.00 14.39  ? 64  TRP A C     1 
ATOM   532  O  O     . TRP A 1 67  ? 43.141 10.650  18.162  1.00 15.06  ? 64  TRP A O     1 
ATOM   533  C  CB    . TRP A 1 67  ? 40.098 10.144  17.591  1.00 14.05  ? 64  TRP A CB    1 
ATOM   534  C  CG    . TRP A 1 67  ? 38.961 9.317   17.127  1.00 17.04  ? 64  TRP A CG    1 
ATOM   535  C  CD1   . TRP A 1 67  ? 38.353 8.297   17.806  1.00 17.73  ? 64  TRP A CD1   1 
ATOM   536  C  CD2   . TRP A 1 67  ? 38.310 9.398   15.850  1.00 19.97  ? 64  TRP A CD2   1 
ATOM   537  N  NE1   . TRP A 1 67  ? 37.345 7.754   17.035  1.00 25.74  ? 64  TRP A NE1   1 
ATOM   538  C  CE2   . TRP A 1 67  ? 37.303 8.407   15.830  1.00 28.16  ? 64  TRP A CE2   1 
ATOM   539  C  CE3   . TRP A 1 67  ? 38.478 10.216  14.723  1.00 17.51  ? 64  TRP A CE3   1 
ATOM   540  C  CZ2   . TRP A 1 67  ? 36.468 8.210   14.724  1.00 31.35  ? 64  TRP A CZ2   1 
ATOM   541  C  CZ3   . TRP A 1 67  ? 37.646 10.027  13.630  1.00 19.90  ? 64  TRP A CZ3   1 
ATOM   542  C  CH2   . TRP A 1 67  ? 36.652 9.027   13.638  1.00 21.43  ? 64  TRP A CH2   1 
ATOM   543  N  N     . ALA A 1 68  ? 42.595 12.027  16.469  1.00 15.08  ? 65  ALA A N     1 
ATOM   544  C  CA    . ALA A 1 68  ? 43.615 13.002  16.837  1.00 15.06  ? 65  ALA A CA    1 
ATOM   545  C  C     . ALA A 1 68  ? 43.507 13.458  18.297  1.00 13.58  ? 65  ALA A C     1 
ATOM   546  O  O     . ALA A 1 68  ? 44.530 13.679  18.958  1.00 11.77  ? 65  ALA A O     1 
ATOM   547  C  CB    . ALA A 1 68  ? 43.601 14.204  15.885  1.00 15.76  ? 65  ALA A CB    1 
ATOM   548  N  N     . ASP A 1 69  ? 42.284 13.607  18.804  1.00 16.50  ? 66  ASP A N     1 
ATOM   549  C  CA    . ASP A 1 69  ? 42.114 14.033  20.204  1.00 14.29  ? 66  ASP A CA    1 
ATOM   550  C  C     . ASP A 1 69  ? 42.718 13.016  21.174  1.00 14.00  ? 66  ASP A C     1 
ATOM   551  O  O     . ASP A 1 69  ? 43.251 13.376  22.222  1.00 12.09  ? 66  ASP A O     1 
ATOM   552  C  CB    . ASP A 1 69  ? 40.643 14.260  20.552  1.00 16.99  ? 66  ASP A CB    1 
ATOM   553  C  CG    . ASP A 1 69  ? 40.078 15.536  19.934  1.00 20.85  ? 66  ASP A CG    1 
ATOM   554  O  OD1   . ASP A 1 69  ? 40.856 16.337  19.367  1.00 21.32  ? 66  ASP A OD1   1 
ATOM   555  O  OD2   . ASP A 1 69  ? 38.851 15.739  20.022  1.00 23.83  ? 66  ASP A OD2   1 
ATOM   556  N  N     . ASP A 1 70  ? 42.625 11.743  20.819  1.00 11.86  ? 67  ASP A N     1 
ATOM   557  C  CA    . ASP A 1 70  ? 43.132 10.685  21.669  1.00 14.53  ? 67  ASP A CA    1 
ATOM   558  C  C     . ASP A 1 70  ? 44.648 10.576  21.527  1.00 12.65  ? 67  ASP A C     1 
ATOM   559  O  O     . ASP A 1 70  ? 45.364 10.345  22.505  1.00 9.29   ? 67  ASP A O     1 
ATOM   560  C  CB    . ASP A 1 70  ? 42.440 9.368   21.302  1.00 13.00  ? 67  ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 70  ? 40.942 9.391   21.600  1.00 24.17  ? 67  ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 70  ? 40.527 10.126  22.523  1.00 20.73  ? 67  ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 70  ? 40.179 8.669   20.920  1.00 19.04  ? 67  ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 71  ? 45.141 10.738  20.298  1.00 10.77  ? 68  ALA A N     1 
ATOM   565  C  CA    . ALA A 1 71  ? 46.589 10.824  20.060  1.00 14.25  ? 68  ALA A CA    1 
ATOM   566  C  C     . ALA A 1 71  ? 47.267 11.925  20.889  1.00 11.27  ? 68  ALA A C     1 
ATOM   567  O  O     . ALA A 1 71  ? 48.400 11.766  21.365  1.00 12.12  ? 68  ALA A O     1 
ATOM   568  C  CB    . ALA A 1 71  ? 46.883 11.038  18.562  1.00 13.04  ? 68  ALA A CB    1 
ATOM   569  N  N     . LYS A 1 72  ? 46.589 13.056  21.007  1.00 9.16   ? 69  LYS A N     1 
ATOM   570  C  CA    . LYS A 1 72  ? 47.087 14.200  21.775  1.00 12.48  ? 69  LYS A CA    1 
ATOM   571  C  C     . LYS A 1 72  ? 47.244 13.853  23.264  1.00 12.78  ? 69  LYS A C     1 
ATOM   572  O  O     . LYS A 1 72  ? 48.087 14.417  23.964  1.00 12.78  ? 69  LYS A O     1 
ATOM   573  C  CB    . LYS A 1 72  ? 46.153 15.413  21.587  1.00 13.81  ? 69  LYS A CB    1 
ATOM   574  C  CG    . LYS A 1 72  ? 46.464 16.283  20.345  1.00 19.03  ? 69  LYS A CG    1 
ATOM   575  C  CD    . LYS A 1 72  ? 47.801 17.023  20.508  1.00 19.05  ? 69  LYS A CD    1 
ATOM   576  C  CE    . LYS A 1 72  ? 47.964 18.189  19.518  1.00 21.25  ? 69  LYS A CE    1 
ATOM   577  N  NZ    . LYS A 1 72  ? 49.300 18.883  19.685  1.00 15.94  ? 69  LYS A NZ    1 
ATOM   578  N  N     . LYS A 1 73  ? 46.435 12.908  23.741  1.00 15.56  ? 70  LYS A N     1 
ATOM   579  C  CA    . LYS A 1 73  ? 46.540 12.447  25.126  1.00 16.48  ? 70  LYS A CA    1 
ATOM   580  C  C     . LYS A 1 73  ? 47.843 11.689  25.354  1.00 14.16  ? 70  LYS A C     1 
ATOM   581  O  O     . LYS A 1 73  ? 48.428 11.765  26.424  1.00 16.35  ? 70  LYS A O     1 
ATOM   582  C  CB    . LYS A 1 73  ? 45.333 11.580  25.500  1.00 11.60  ? 70  LYS A CB    1 
ATOM   583  C  CG    . LYS A 1 73  ? 44.009 12.299  25.339  1.00 9.69   ? 70  LYS A CG    1 
ATOM   584  C  CD    . LYS A 1 73  ? 42.830 11.333  25.526  1.00 13.40  ? 70  LYS A CD    1 
ATOM   585  C  CE    . LYS A 1 73  ? 41.502 12.043  25.279  1.00 13.17  ? 70  LYS A CE    1 
ATOM   586  N  NZ    . LYS A 1 73  ? 40.397 11.044  25.092  1.00 18.88  ? 70  LYS A NZ    1 
ATOM   587  N  N     . LEU A 1 74  ? 48.298 10.971  24.333  1.00 11.96  ? 71  LEU A N     1 
ATOM   588  C  CA    . LEU A 1 74  ? 49.557 10.236  24.420  1.00 13.67  ? 71  LEU A CA    1 
ATOM   589  C  C     . LEU A 1 74  ? 50.729 11.140  24.071  1.00 15.33  ? 71  LEU A C     1 
ATOM   590  O  O     . LEU A 1 74  ? 51.836 10.982  24.592  1.00 11.93  ? 71  LEU A O     1 
ATOM   591  C  CB    . LEU A 1 74  ? 49.557 9.070   23.434  1.00 11.61  ? 71  LEU A CB    1 
ATOM   592  C  CG    . LEU A 1 74  ? 48.509 7.973   23.580  1.00 17.29  ? 71  LEU A CG    1 
ATOM   593  C  CD1   . LEU A 1 74  ? 48.711 6.959   22.456  1.00 13.93  ? 71  LEU A CD1   1 
ATOM   594  C  CD2   . LEU A 1 74  ? 48.624 7.300   24.951  1.00 11.34  ? 71  LEU A CD2   1 
ATOM   595  N  N     . CYS A 1 75  ? 50.481 12.081  23.172  1.00 10.85  ? 72  CYS A N     1 
ATOM   596  C  CA    . CYS A 1 75  ? 51.551 12.909  22.629  1.00 11.75  ? 72  CYS A CA    1 
ATOM   597  C  C     . CYS A 1 75  ? 51.071 14.350  22.506  1.00 15.73  ? 72  CYS A C     1 
ATOM   598  O  O     . CYS A 1 75  ? 50.581 14.769  21.447  1.00 14.97  ? 72  CYS A O     1 
ATOM   599  C  CB    . CYS A 1 75  ? 51.978 12.356  21.270  1.00 16.08  ? 72  CYS A CB    1 
ATOM   600  S  SG    . CYS A 1 75  ? 53.374 13.225  20.527  1.00 18.46  ? 72  CYS A SG    1 
ATOM   601  N  N     . PRO A 1 76  ? 51.195 15.117  23.601  1.00 12.86  ? 73  PRO A N     1 
ATOM   602  C  CA    . PRO A 1 76  ? 50.636 16.470  23.696  1.00 14.99  ? 73  PRO A CA    1 
ATOM   603  C  C     . PRO A 1 76  ? 51.190 17.427  22.636  1.00 12.88  ? 73  PRO A C     1 
ATOM   604  O  O     . PRO A 1 76  ? 50.469 18.314  22.162  1.00 16.28  ? 73  PRO A O     1 
ATOM   605  C  CB    . PRO A 1 76  ? 51.060 16.921  25.100  1.00 16.95  ? 73  PRO A CB    1 
ATOM   606  C  CG    . PRO A 1 76  ? 51.207 15.649  25.866  1.00 21.10  ? 73  PRO A CG    1 
ATOM   607  C  CD    . PRO A 1 76  ? 51.769 14.665  24.881  1.00 17.73  ? 73  PRO A CD    1 
ATOM   608  N  N     . ASP A 1 77  ? 52.454 17.253  22.271  1.00 13.89  ? 74  ASP A N     1 
ATOM   609  C  CA    . ASP A 1 77  ? 53.068 18.132  21.285  1.00 17.17  ? 74  ASP A CA    1 
ATOM   610  C  C     . ASP A 1 77  ? 52.923 17.617  19.852  1.00 18.63  ? 74  ASP A C     1 
ATOM   611  O  O     . ASP A 1 77  ? 53.578 18.139  18.942  1.00 16.65  ? 74  ASP A O     1 
ATOM   612  C  CB    . ASP A 1 77  ? 54.548 18.313  21.603  1.00 14.60  ? 74  ASP A CB    1 
ATOM   613  C  CG    . ASP A 1 77  ? 54.774 19.033  22.917  1.00 30.81  ? 74  ASP A CG    1 
ATOM   614  O  OD1   . ASP A 1 77  ? 55.743 18.689  23.623  1.00 40.08  ? 74  ASP A OD1   1 
ATOM   615  O  OD2   . ASP A 1 77  ? 53.983 19.947  23.240  1.00 31.17  ? 74  ASP A OD2   1 
ATOM   616  N  N     . LEU A 1 78  ? 52.092 16.592  19.656  1.00 14.64  ? 75  LEU A N     1 
ATOM   617  C  CA    . LEU A 1 78  ? 51.890 15.999  18.329  1.00 12.93  ? 75  LEU A CA    1 
ATOM   618  C  C     . LEU A 1 78  ? 51.533 17.095  17.328  1.00 12.81  ? 75  LEU A C     1 
ATOM   619  O  O     . LEU A 1 78  ? 50.654 17.897  17.595  1.00 10.94  ? 75  LEU A O     1 
ATOM   620  C  CB    . LEU A 1 78  ? 50.762 14.960  18.371  1.00 9.21   ? 75  LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 78  ? 50.383 14.293  17.039  1.00 7.71   ? 75  LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 78  ? 51.535 13.463  16.522  1.00 8.73   ? 75  LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 78  ? 49.137 13.413  17.213  1.00 10.73  ? 75  LEU A CD2   1 
ATOM   624  N  N     . LEU A 1 79  ? 52.220 17.143  16.190  1.00 9.25   ? 76  LEU A N     1 
ATOM   625  C  CA    . LEU A 1 79  ? 51.860 18.094  15.137  1.00 7.18   ? 76  LEU A CA    1 
ATOM   626  C  C     . LEU A 1 79  ? 50.999 17.393  14.082  1.00 12.09  ? 76  LEU A C     1 
ATOM   627  O  O     . LEU A 1 79  ? 51.151 16.199  13.844  1.00 10.64  ? 76  LEU A O     1 
ATOM   628  C  CB    . LEU A 1 79  ? 53.112 18.708  14.500  1.00 6.03   ? 76  LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 79  ? 54.026 19.473  15.463  1.00 7.79   ? 76  LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 79  ? 55.210 20.109  14.740  1.00 12.69  ? 76  LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 79  ? 53.266 20.503  16.267  1.00 7.94   ? 76  LEU A CD2   1 
ATOM   632  N  N     . LEU A 1 80  ? 50.094 18.140  13.459  1.00 14.14  ? 77  LEU A N     1 
ATOM   633  C  CA    . LEU A 1 80  ? 49.132 17.556  12.529  1.00 11.96  ? 77  LEU A CA    1 
ATOM   634  C  C     . LEU A 1 80  ? 49.126 18.252  11.164  1.00 13.80  ? 77  LEU A C     1 
ATOM   635  O  O     . LEU A 1 80  ? 49.208 19.475  11.079  1.00 12.93  ? 77  LEU A O     1 
ATOM   636  C  CB    . LEU A 1 80  ? 47.721 17.603  13.115  1.00 12.63  ? 77  LEU A CB    1 
ATOM   637  C  CG    . LEU A 1 80  ? 47.487 16.829  14.406  1.00 12.47  ? 77  LEU A CG    1 
ATOM   638  C  CD1   . LEU A 1 80  ? 46.070 17.064  14.906  1.00 15.34  ? 77  LEU A CD1   1 
ATOM   639  C  CD2   . LEU A 1 80  ? 47.761 15.341  14.155  1.00 14.54  ? 77  LEU A CD2   1 
ATOM   640  N  N     . ALA A 1 81  ? 49.043 17.453  10.107  1.00 10.83  ? 78  ALA A N     1 
ATOM   641  C  CA    . ALA A 1 81  ? 48.728 17.961  8.777   1.00 9.68   ? 78  ALA A CA    1 
ATOM   642  C  C     . ALA A 1 81  ? 47.418 17.335  8.305   1.00 8.47   ? 78  ALA A C     1 
ATOM   643  O  O     . ALA A 1 81  ? 47.175 16.135  8.488   1.00 18.23  ? 78  ALA A O     1 
ATOM   644  C  CB    . ALA A 1 81  ? 49.872 17.674  7.804   1.00 14.41  ? 78  ALA A CB    1 
ATOM   645  N  N     . GLN A 1 82  ? 46.554 18.154  7.722   1.00 11.64  ? 79  GLN A N     1 
ATOM   646  C  CA    . GLN A 1 82  ? 45.229 17.710  7.318   1.00 14.33  ? 79  GLN A CA    1 
ATOM   647  C  C     . GLN A 1 82  ? 45.190 17.401  5.847   1.00 12.52  ? 79  GLN A C     1 
ATOM   648  O  O     . GLN A 1 82  ? 45.701 18.172  5.036   1.00 12.86  ? 79  GLN A O     1 
ATOM   649  C  CB    . GLN A 1 82  ? 44.204 18.809  7.558   1.00 19.62  ? 79  GLN A CB    1 
ATOM   650  C  CG    . GLN A 1 82  ? 43.926 19.142  8.987   1.00 30.70  ? 79  GLN A CG    1 
ATOM   651  C  CD    . GLN A 1 82  ? 42.816 20.161  9.081   1.00 35.67  ? 79  GLN A CD    1 
ATOM   652  O  OE1   . GLN A 1 82  ? 43.055 21.325  9.408   1.00 28.93  ? 79  GLN A OE1   1 
ATOM   653  N  NE2   . GLN A 1 82  ? 41.594 19.735  8.754   1.00 26.19  ? 79  GLN A NE2   1 
ATOM   654  N  N     . VAL A 1 83  ? 44.546 16.293  5.498   1.00 11.68  ? 80  VAL A N     1 
ATOM   655  C  CA    . VAL A 1 83  ? 44.294 15.982  4.101   1.00 11.89  ? 80  VAL A CA    1 
ATOM   656  C  C     . VAL A 1 83  ? 43.414 17.075  3.502   1.00 12.62  ? 80  VAL A C     1 
ATOM   657  O  O     . VAL A 1 83  ? 42.498 17.569  4.151   1.00 10.16  ? 80  VAL A O     1 
ATOM   658  C  CB    . VAL A 1 83  ? 43.581 14.631  3.961   1.00 9.12   ? 80  VAL A CB    1 
ATOM   659  C  CG1   . VAL A 1 83  ? 43.135 14.399  2.531   1.00 10.79  ? 80  VAL A CG1   1 
ATOM   660  C  CG2   . VAL A 1 83  ? 44.506 13.510  4.439   1.00 13.24  ? 80  VAL A CG2   1 
ATOM   661  N  N     . ARG A 1 84  ? 43.688 17.431  2.258   1.00 10.71  ? 81  ARG A N     1 
ATOM   662  C  CA    . ARG A 1 84  ? 42.920 18.470  1.571   1.00 16.01  ? 81  ARG A CA    1 
ATOM   663  C  C     . ARG A 1 84  ? 41.449 18.052  1.439   1.00 14.65  ? 81  ARG A C     1 
ATOM   664  O  O     . ARG A 1 84  ? 41.134 16.873  1.261   1.00 13.54  ? 81  ARG A O     1 
ATOM   665  C  CB    . ARG A 1 84  ? 43.535 18.717  0.191   1.00 15.20  ? 81  ARG A CB    1 
ATOM   666  C  CG    . ARG A 1 84  ? 42.741 19.650  -0.731  1.00 19.00  ? 81  ARG A CG    1 
ATOM   667  C  CD    . ARG A 1 84  ? 43.373 19.645  -2.131  1.00 31.62  ? 81  ARG A CD    1 
ATOM   668  N  NE    . ARG A 1 84  ? 42.459 20.091  -3.181  1.00 46.53  ? 81  ARG A NE    1 
ATOM   669  C  CZ    . ARG A 1 84  ? 42.635 19.853  -4.482  1.00 52.77  ? 81  ARG A CZ    1 
ATOM   670  N  NH1   . ARG A 1 84  ? 43.690 19.163  -4.903  1.00 44.40  ? 81  ARG A NH1   1 
ATOM   671  N  NH2   . ARG A 1 84  ? 41.750 20.299  -5.367  1.00 41.07  ? 81  ARG A NH2   1 
ATOM   672  N  N     . GLU A 1 85  ? 40.545 19.016  1.537   1.00 14.95  ? 82  GLU A N     1 
ATOM   673  C  CA    . GLU A 1 85  ? 39.139 18.739  1.295   1.00 16.20  ? 82  GLU A CA    1 
ATOM   674  C  C     . GLU A 1 85  ? 38.656 19.482  0.057   1.00 20.75  ? 82  GLU A C     1 
ATOM   675  O  O     . GLU A 1 85  ? 38.912 20.676  -0.098  1.00 14.43  ? 82  GLU A O     1 
ATOM   676  C  CB    . GLU A 1 85  ? 38.293 19.124  2.508   1.00 19.97  ? 82  GLU A CB    1 
ATOM   677  C  CG    . GLU A 1 85  ? 38.107 17.989  3.495   1.00 26.32  ? 82  GLU A CG    1 
ATOM   678  C  CD    . GLU A 1 85  ? 37.320 18.415  4.729   1.00 39.49  ? 82  GLU A CD    1 
ATOM   679  O  OE1   . GLU A 1 85  ? 36.099 18.699  4.616   1.00 33.65  ? 82  GLU A OE1   1 
ATOM   680  O  OE2   . GLU A 1 85  ? 37.940 18.477  5.812   1.00 43.03  ? 82  GLU A OE2   1 
ATOM   681  N  N     . SER A 1 86  ? 37.969 18.761  -0.824  1.00 15.34  ? 83  SER A N     1 
ATOM   682  C  CA    . SER A 1 86  ? 37.380 19.351  -2.019  1.00 18.15  ? 83  SER A CA    1 
ATOM   683  C  C     . SER A 1 86  ? 36.009 18.745  -2.236  1.00 16.41  ? 83  SER A C     1 
ATOM   684  O  O     . SER A 1 86  ? 35.812 17.552  -2.016  1.00 15.40  ? 83  SER A O     1 
ATOM   685  C  CB    . SER A 1 86  ? 38.249 19.101  -3.254  1.00 18.28  ? 83  SER A CB    1 
ATOM   686  O  OG    . SER A 1 86  ? 39.607 19.383  -2.983  1.00 25.39  ? 83  SER A OG    1 
ATOM   687  N  N     . ARG A 1 87  ? 35.064 19.572  -2.666  1.00 17.59  ? 84  ARG A N     1 
ATOM   688  C  CA    . ARG A 1 87  ? 33.689 19.133  -2.865  1.00 23.17  ? 84  ARG A CA    1 
ATOM   689  C  C     . ARG A 1 87  ? 33.121 18.398  -1.658  1.00 18.71  ? 84  ARG A C     1 
ATOM   690  O  O     . ARG A 1 87  ? 32.325 17.466  -1.799  1.00 23.62  ? 84  ARG A O     1 
ATOM   691  C  CB    . ARG A 1 87  ? 33.590 18.256  -4.105  1.00 22.19  ? 84  ARG A CB    1 
ATOM   692  C  CG    . ARG A 1 87  ? 34.076 18.931  -5.354  1.00 26.04  ? 84  ARG A CG    1 
ATOM   693  C  CD    . ARG A 1 87  ? 33.997 17.983  -6.532  1.00 27.18  ? 84  ARG A CD    1 
ATOM   694  N  NE    . ARG A 1 87  ? 34.755 18.501  -7.664  1.00 28.65  ? 84  ARG A NE    1 
ATOM   695  C  CZ    . ARG A 1 87  ? 36.064 18.325  -7.827  1.00 30.65  ? 84  ARG A CZ    1 
ATOM   696  N  NH1   . ARG A 1 87  ? 36.766 17.636  -6.929  1.00 35.81  ? 84  ARG A NH1   1 
ATOM   697  N  NH2   . ARG A 1 87  ? 36.672 18.840  -8.888  1.00 32.20  ? 84  ARG A NH2   1 
ATOM   698  N  N     . GLY A 1 88  ? 33.529 18.820  -0.470  1.00 16.81  ? 85  GLY A N     1 
ATOM   699  C  CA    . GLY A 1 88  ? 33.013 18.248  0.761   1.00 17.03  ? 85  GLY A CA    1 
ATOM   700  C  C     . GLY A 1 88  ? 33.605 16.917  1.201   1.00 19.23  ? 85  GLY A C     1 
ATOM   701  O  O     . GLY A 1 88  ? 33.113 16.312  2.155   1.00 15.02  ? 85  GLY A O     1 
ATOM   702  N  N     . LYS A 1 89  ? 34.656 16.457  0.525   1.00 11.78  ? 86  LYS A N     1 
ATOM   703  C  CA    . LYS A 1 89  ? 35.274 15.178  0.863   1.00 11.48  ? 86  LYS A CA    1 
ATOM   704  C  C     . LYS A 1 89  ? 36.800 15.235  0.870   1.00 14.97  ? 86  LYS A C     1 
ATOM   705  O  O     . LYS A 1 89  ? 37.398 16.147  0.304   1.00 13.72  ? 86  LYS A O     1 
ATOM   706  C  CB    . LYS A 1 89  ? 34.823 14.094  -0.108  1.00 13.98  ? 86  LYS A CB    1 
ATOM   707  C  CG    . LYS A 1 89  ? 35.415 14.208  -1.506  1.00 15.06  ? 86  LYS A CG    1 
ATOM   708  C  CD    . LYS A 1 89  ? 34.866 13.127  -2.439  1.00 20.68  ? 86  LYS A CD    1 
ATOM   709  C  CE    . LYS A 1 89  ? 35.477 11.760  -2.146  1.00 12.44  ? 86  LYS A CE    1 
ATOM   710  N  NZ    . LYS A 1 89  ? 36.959 11.750  -2.381  1.00 15.16  ? 86  LYS A NZ    1 
ATOM   711  N  N     . ALA A 1 90  ? 37.424 14.244  1.496   1.00 14.94  ? 87  ALA A N     1 
ATOM   712  C  CA    . ALA A 1 90  ? 38.875 14.156  1.486   1.00 13.47  ? 87  ALA A CA    1 
ATOM   713  C  C     . ALA A 1 90  ? 39.337 13.983  0.051   1.00 15.56  ? 87  ALA A C     1 
ATOM   714  O  O     . ALA A 1 90  ? 38.738 13.227  -0.715  1.00 16.24  ? 87  ALA A O     1 
ATOM   715  C  CB    . ALA A 1 90  ? 39.352 12.994  2.341   1.00 15.78  ? 87  ALA A CB    1 
ATOM   716  N  N     . ASN A 1 91  ? 40.390 14.703  -0.312  1.00 12.71  ? 88  ASN A N     1 
ATOM   717  C  CA    . ASN A 1 91  ? 40.967 14.599  -1.650  1.00 15.15  ? 88  ASN A CA    1 
ATOM   718  C  C     . ASN A 1 91  ? 42.431 14.166  -1.566  1.00 12.89  ? 88  ASN A C     1 
ATOM   719  O  O     . ASN A 1 91  ? 43.269 14.869  -0.989  1.00 16.03  ? 88  ASN A O     1 
ATOM   720  C  CB    . ASN A 1 91  ? 40.827 15.932  -2.393  1.00 15.07  ? 88  ASN A CB    1 
ATOM   721  C  CG    . ASN A 1 91  ? 41.204 15.820  -3.858  1.00 24.74  ? 88  ASN A CG    1 
ATOM   722  O  OD1   . ASN A 1 91  ? 42.308 15.404  -4.188  1.00 13.86  ? 88  ASN A OD1   1 
ATOM   723  N  ND2   . ASN A 1 91  ? 40.266 16.152  -4.746  1.00 25.91  ? 88  ASN A ND2   1 
ATOM   724  N  N     . LEU A 1 92  ? 42.748 13.003  -2.128  1.00 10.83  ? 89  LEU A N     1 
ATOM   725  C  CA    . LEU A 1 92  ? 44.092 12.447  -1.963  1.00 14.31  ? 89  LEU A CA    1 
ATOM   726  C  C     . LEU A 1 92  ? 45.074 12.727  -3.102  1.00 15.02  ? 89  LEU A C     1 
ATOM   727  O  O     . LEU A 1 92  ? 46.104 12.063  -3.191  1.00 11.57  ? 89  LEU A O     1 
ATOM   728  C  CB    . LEU A 1 92  ? 44.025 10.934  -1.722  1.00 12.63  ? 89  LEU A CB    1 
ATOM   729  C  CG    . LEU A 1 92  ? 43.101 10.501  -0.580  1.00 10.89  ? 89  LEU A CG    1 
ATOM   730  C  CD1   . LEU A 1 92  ? 42.907 9.007   -0.621  1.00 17.58  ? 89  LEU A CD1   1 
ATOM   731  C  CD2   . LEU A 1 92  ? 43.665 10.935  0.767   1.00 14.97  ? 89  LEU A CD2   1 
ATOM   732  N  N     . THR A 1 93  ? 44.773 13.712  -3.947  1.00 10.85  ? 90  THR A N     1 
ATOM   733  C  CA    . THR A 1 93  ? 45.598 14.000  -5.125  1.00 10.75  ? 90  THR A CA    1 
ATOM   734  C  C     . THR A 1 93  ? 47.084 14.253  -4.847  1.00 15.45  ? 90  THR A C     1 
ATOM   735  O  O     . THR A 1 93  ? 47.956 13.777  -5.589  1.00 10.14  ? 90  THR A O     1 
ATOM   736  C  CB    . THR A 1 93  ? 45.031 15.200  -5.918  1.00 14.46  ? 90  THR A CB    1 
ATOM   737  O  OG1   . THR A 1 93  ? 43.698 14.887  -6.349  1.00 17.31  ? 90  THR A OG1   1 
ATOM   738  C  CG2   . THR A 1 93  ? 45.909 15.496  -7.133  1.00 9.66   ? 90  THR A CG2   1 
ATOM   739  N  N     . LYS A 1 94  ? 47.375 15.021  -3.802  1.00 10.57  ? 91  LYS A N     1 
ATOM   740  C  CA    . LYS A 1 94  ? 48.758 15.319  -3.449  1.00 9.92   ? 91  LYS A CA    1 
ATOM   741  C  C     . LYS A 1 94  ? 49.595 14.043  -3.245  1.00 10.73  ? 91  LYS A C     1 
ATOM   742  O  O     . LYS A 1 94  ? 50.762 13.986  -3.634  1.00 10.92  ? 91  LYS A O     1 
ATOM   743  C  CB    . LYS A 1 94  ? 48.817 16.181  -2.186  1.00 11.62  ? 91  LYS A CB    1 
ATOM   744  C  CG    . LYS A 1 94  ? 50.209 16.765  -1.916  1.00 13.72  ? 91  LYS A CG    1 
ATOM   745  C  CD    . LYS A 1 94  ? 50.355 17.286  -0.470  1.00 11.26  ? 91  LYS A CD    1 
ATOM   746  C  CE    . LYS A 1 94  ? 49.403 18.437  -0.170  1.00 17.18  ? 91  LYS A CE    1 
ATOM   747  N  NZ    . LYS A 1 94  ? 49.600 18.973  1.216   1.00 9.71   ? 91  LYS A NZ    1 
ATOM   748  N  N     . TYR A 1 95  ? 48.988 13.022  -2.651  1.00 9.17   ? 92  TYR A N     1 
ATOM   749  C  CA    . TYR A 1 95  ? 49.695 11.778  -2.339  1.00 10.93  ? 92  TYR A CA    1 
ATOM   750  C  C     . TYR A 1 95  ? 49.798 10.893  -3.569  1.00 11.79  ? 92  TYR A C     1 
ATOM   751  O  O     . TYR A 1 95  ? 50.817 10.243  -3.781  1.00 7.29   ? 92  TYR A O     1 
ATOM   752  C  CB    . TYR A 1 95  ? 49.011 11.045  -1.173  1.00 7.16   ? 92  TYR A CB    1 
ATOM   753  C  CG    . TYR A 1 95  ? 48.719 12.023  -0.065  1.00 9.10   ? 92  TYR A CG    1 
ATOM   754  C  CD1   . TYR A 1 95  ? 47.426 12.460  0.177   1.00 12.52  ? 92  TYR A CD1   1 
ATOM   755  C  CD2   . TYR A 1 95  ? 49.752 12.581  0.676   1.00 10.31  ? 92  TYR A CD2   1 
ATOM   756  C  CE1   . TYR A 1 95  ? 47.161 13.396  1.158   1.00 13.01  ? 92  TYR A CE1   1 
ATOM   757  C  CE2   . TYR A 1 95  ? 49.503 13.510  1.647   1.00 9.19   ? 92  TYR A CE2   1 
ATOM   758  C  CZ    . TYR A 1 95  ? 48.198 13.923  1.885   1.00 12.26  ? 92  TYR A CZ    1 
ATOM   759  O  OH    . TYR A 1 95  ? 47.936 14.872  2.853   1.00 11.82  ? 92  TYR A OH    1 
ATOM   760  N  N     . ARG A 1 96  ? 48.750 10.887  -4.389  1.00 10.67  ? 93  ARG A N     1 
ATOM   761  C  CA    . ARG A 1 96  ? 48.804 10.194  -5.686  1.00 11.83  ? 93  ARG A CA    1 
ATOM   762  C  C     . ARG A 1 96  ? 49.901 10.758  -6.603  1.00 14.86  ? 93  ARG A C     1 
ATOM   763  O  O     . ARG A 1 96  ? 50.612 10.008  -7.279  1.00 11.61  ? 93  ARG A O     1 
ATOM   764  C  CB    . ARG A 1 96  ? 47.453 10.265  -6.387  1.00 10.63  ? 93  ARG A CB    1 
ATOM   765  C  CG    . ARG A 1 96  ? 46.359 9.482   -5.676  1.00 11.60  ? 93  ARG A CG    1 
ATOM   766  C  CD    . ARG A 1 96  ? 45.193 9.136   -6.611  1.00 15.97  ? 93  ARG A CD    1 
ATOM   767  N  NE    . ARG A 1 96  ? 44.129 8.488   -5.858  1.00 16.35  ? 93  ARG A NE    1 
ATOM   768  C  CZ    . ARG A 1 96  ? 43.120 9.139   -5.280  1.00 14.93  ? 93  ARG A CZ    1 
ATOM   769  N  NH1   . ARG A 1 96  ? 42.214 8.462   -4.589  1.00 15.57  ? 93  ARG A NH1   1 
ATOM   770  N  NH2   . ARG A 1 96  ? 43.020 10.465  -5.389  1.00 14.06  ? 93  ARG A NH2   1 
ATOM   771  N  N     . GLU A 1 97  ? 50.033 12.080  -6.637  1.00 9.54   ? 94  GLU A N     1 
ATOM   772  C  CA    . GLU A 1 97  ? 51.078 12.692  -7.455  1.00 11.31  ? 94  GLU A CA    1 
ATOM   773  C  C     . GLU A 1 97  ? 52.481 12.424  -6.908  1.00 12.58  ? 94  GLU A C     1 
ATOM   774  O  O     . GLU A 1 97  ? 53.406 12.130  -7.672  1.00 10.70  ? 94  GLU A O     1 
ATOM   775  C  CB    . GLU A 1 97  ? 50.816 14.183  -7.657  1.00 13.55  ? 94  GLU A CB    1 
ATOM   776  C  CG    . GLU A 1 97  ? 49.614 14.425  -8.571  1.00 17.92  ? 94  GLU A CG    1 
ATOM   777  C  CD    . GLU A 1 97  ? 49.165 15.873  -8.618  1.00 27.87  ? 94  GLU A CD    1 
ATOM   778  O  OE1   . GLU A 1 97  ? 49.796 16.731  -7.967  1.00 34.14  ? 94  GLU A OE1   1 
ATOM   779  O  OE2   . GLU A 1 97  ? 48.164 16.149  -9.312  1.00 34.96  ? 94  GLU A OE2   1 
ATOM   780  N  N     . ALA A 1 98  ? 52.644 12.518  -5.591  1.00 8.50   ? 95  ALA A N     1 
ATOM   781  C  CA    . ALA A 1 98  ? 53.926 12.173  -4.991  1.00 9.44   ? 95  ALA A CA    1 
ATOM   782  C  C     . ALA A 1 98  ? 54.290 10.723  -5.282  1.00 10.36  ? 95  ALA A C     1 
ATOM   783  O  O     . ALA A 1 98  ? 55.451 10.411  -5.524  1.00 10.82  ? 95  ALA A O     1 
ATOM   784  C  CB    . ALA A 1 98  ? 53.918 12.426  -3.482  1.00 6.02   ? 95  ALA A CB    1 
ATOM   785  N  N     . SER A 1 99  ? 53.298 9.837   -5.253  1.00 9.79   ? 96  SER A N     1 
ATOM   786  C  CA    . SER A 1 99  ? 53.519 8.428   -5.585  1.00 10.86  ? 96  SER A CA    1 
ATOM   787  C  C     . SER A 1 99  ? 54.067 8.245   -7.011  1.00 10.89  ? 96  SER A C     1 
ATOM   788  O  O     . SER A 1 99  ? 54.998 7.478   -7.241  1.00 8.84   ? 96  SER A O     1 
ATOM   789  C  CB    . SER A 1 99  ? 52.211 7.644   -5.440  1.00 11.94  ? 96  SER A CB    1 
ATOM   790  O  OG    . SER A 1 99  ? 52.396 6.285   -5.797  1.00 14.02  ? 96  SER A OG    1 
ATOM   791  N  N     . VAL A 1 100 ? 53.476 8.958   -7.962  1.00 9.28   ? 97  VAL A N     1 
ATOM   792  C  CA    . VAL A 1 100 ? 53.948 8.914   -9.347  1.00 9.61   ? 97  VAL A CA    1 
ATOM   793  C  C     . VAL A 1 100 ? 55.419 9.333   -9.449  1.00 11.68  ? 97  VAL A C     1 
ATOM   794  O  O     . VAL A 1 100 ? 56.197 8.731   -10.201 1.00 9.64   ? 97  VAL A O     1 
ATOM   795  C  CB    . VAL A 1 100 ? 53.065 9.786   -10.262 1.00 15.27  ? 97  VAL A CB    1 
ATOM   796  C  CG1   . VAL A 1 100 ? 53.733 9.995   -11.650 1.00 14.07  ? 97  VAL A CG1   1 
ATOM   797  C  CG2   . VAL A 1 100 ? 51.681 9.150   -10.403 1.00 13.27  ? 97  VAL A CG2   1 
ATOM   798  N  N     . GLU A 1 101 ? 55.805 10.344  -8.672  1.00 10.42  ? 98  GLU A N     1 
ATOM   799  C  CA    . GLU A 1 101 ? 57.209 10.768  -8.607  1.00 12.00  ? 98  GLU A CA    1 
ATOM   800  C  C     . GLU A 1 101 ? 58.119 9.584   -8.304  1.00 13.66  ? 98  GLU A C     1 
ATOM   801  O  O     . GLU A 1 101 ? 59.153 9.376   -8.959  1.00 9.65   ? 98  GLU A O     1 
ATOM   802  C  CB    . GLU A 1 101 ? 57.433 11.812  -7.499  1.00 12.39  ? 98  GLU A CB    1 
ATOM   803  C  CG    . GLU A 1 101 ? 57.047 13.253  -7.828  1.00 14.09  ? 98  GLU A CG    1 
ATOM   804  C  CD    . GLU A 1 101 ? 57.451 14.219  -6.711  1.00 16.67  ? 98  GLU A CD    1 
ATOM   805  O  OE1   . GLU A 1 101 ? 58.667 14.469  -6.538  1.00 16.37  ? 98  GLU A OE1   1 
ATOM   806  O  OE2   . GLU A 1 101 ? 56.551 14.706  -5.991  1.00 16.04  ? 98  GLU A OE2   1 
ATOM   807  N  N     . VAL A 1 102 ? 57.747 8.826   -7.279  1.00 8.54   ? 99  VAL A N     1 
ATOM   808  C  CA    . VAL A 1 102 ? 58.585 7.730   -6.822  1.00 10.52  ? 99  VAL A CA    1 
ATOM   809  C  C     . VAL A 1 102 ? 58.566 6.559   -7.794  1.00 11.09  ? 99  VAL A C     1 
ATOM   810  O  O     . VAL A 1 102 ? 59.613 5.980   -8.089  1.00 13.09  ? 99  VAL A O     1 
ATOM   811  C  CB    . VAL A 1 102 ? 58.157 7.248   -5.424  1.00 8.12   ? 99  VAL A CB    1 
ATOM   812  C  CG1   . VAL A 1 102 ? 58.853 5.917   -5.071  1.00 15.05  ? 99  VAL A CG1   1 
ATOM   813  C  CG2   . VAL A 1 102 ? 58.489 8.322   -4.391  1.00 12.06  ? 99  VAL A CG2   1 
ATOM   814  N  N     . MET A 1 103 ? 57.378 6.220   -8.290  1.00 10.73  ? 100 MET A N     1 
ATOM   815  C  CA    . MET A 1 103 ? 57.224 5.102   -9.221  1.00 10.79  ? 100 MET A CA    1 
ATOM   816  C  C     . MET A 1 103 ? 58.013 5.319   -10.520 1.00 13.34  ? 100 MET A C     1 
ATOM   817  O  O     . MET A 1 103 ? 58.564 4.375   -11.086 1.00 9.89   ? 100 MET A O     1 
ATOM   818  C  CB    . MET A 1 103 ? 55.747 4.857   -9.539  1.00 12.98  ? 100 MET A CB    1 
ATOM   819  C  CG    . MET A 1 103 ? 54.858 4.617   -8.321  1.00 21.40  ? 100 MET A CG    1 
ATOM   820  S  SD    . MET A 1 103 ? 55.108 2.987   -7.580  1.00 22.59  ? 100 MET A SD    1 
ATOM   821  C  CE    . MET A 1 103 ? 54.181 3.142   -6.030  1.00 13.21  ? 100 MET A CE    1 
ATOM   822  N  N     . GLU A 1 104 ? 58.060 6.557   -10.998 1.00 11.02  ? 101 GLU A N     1 
ATOM   823  C  CA    . GLU A 1 104 ? 58.759 6.846   -12.250 1.00 13.81  ? 101 GLU A CA    1 
ATOM   824  C  C     . GLU A 1 104 ? 60.267 6.694   -12.074 1.00 13.64  ? 101 GLU A C     1 
ATOM   825  O  O     . GLU A 1 104 ? 60.954 6.192   -12.957 1.00 13.63  ? 101 GLU A O     1 
ATOM   826  C  CB    . GLU A 1 104 ? 58.386 8.235   -12.780 1.00 14.19  ? 101 GLU A CB    1 
ATOM   827  C  CG    . GLU A 1 104 ? 56.914 8.322   -13.223 1.00 15.69  ? 101 GLU A CG    1 
ATOM   828  C  CD    . GLU A 1 104 ? 56.580 9.630   -13.941 1.00 26.69  ? 101 GLU A CD    1 
ATOM   829  O  OE1   . GLU A 1 104 ? 57.359 10.600  -13.811 1.00 31.79  ? 101 GLU A OE1   1 
ATOM   830  O  OE2   . GLU A 1 104 ? 55.540 9.677   -14.636 1.00 31.54  ? 101 GLU A OE2   1 
ATOM   831  N  N     . ILE A 1 105 ? 60.777 7.108   -10.919 1.00 9.54   ? 102 ILE A N     1 
ATOM   832  C  CA    . ILE A 1 105 ? 62.172 6.843   -10.579 1.00 8.74   ? 102 ILE A CA    1 
ATOM   833  C  C     . ILE A 1 105 ? 62.478 5.341   -10.513 1.00 10.24  ? 102 ILE A C     1 
ATOM   834  O  O     . ILE A 1 105 ? 63.420 4.862   -11.148 1.00 11.02  ? 102 ILE A O     1 
ATOM   835  C  CB    . ILE A 1 105 ? 62.575 7.538   -9.266  1.00 9.57   ? 102 ILE A CB    1 
ATOM   836  C  CG1   . ILE A 1 105 ? 62.450 9.059   -9.430  1.00 9.95   ? 102 ILE A CG1   1 
ATOM   837  C  CG2   . ILE A 1 105 ? 63.992 7.149   -8.853  1.00 14.34  ? 102 ILE A CG2   1 
ATOM   838  C  CD1   . ILE A 1 105 ? 62.488 9.823   -8.119  1.00 12.30  ? 102 ILE A CD1   1 
ATOM   839  N  N     . MET A 1 106 ? 61.685 4.590   -9.760  1.00 8.92   ? 103 MET A N     1 
ATOM   840  C  CA    . MET A 1 106 ? 61.898 3.145   -9.687  1.00 13.72  ? 103 MET A CA    1 
ATOM   841  C  C     . MET A 1 106 ? 61.905 2.486   -11.072 1.00 10.18  ? 103 MET A C     1 
ATOM   842  O  O     . MET A 1 106 ? 62.692 1.571   -11.339 1.00 10.28  ? 103 MET A O     1 
ATOM   843  C  CB    . MET A 1 106 ? 60.831 2.498   -8.800  1.00 7.53   ? 103 MET A CB    1 
ATOM   844  C  CG    . MET A 1 106 ? 61.036 2.842   -7.324  1.00 15.22  ? 103 MET A CG    1 
ATOM   845  S  SD    . MET A 1 106 ? 59.846 2.042   -6.241  1.00 19.69  ? 103 MET A SD    1 
ATOM   846  C  CE    . MET A 1 106 ? 60.198 0.312   -6.544  1.00 22.42  ? 103 MET A CE    1 
ATOM   847  N  N     . SER A 1 107 ? 61.025 2.955   -11.949 1.00 10.09  ? 104 SER A N     1 
ATOM   848  C  CA    A SER A 1 107 ? 60.882 2.370   -13.277 0.38 14.74  ? 104 SER A CA    1 
ATOM   849  C  CA    B SER A 1 107 ? 60.887 2.363   -13.272 0.62 14.75  ? 104 SER A CA    1 
ATOM   850  C  C     . SER A 1 107 ? 62.144 2.520   -14.134 1.00 17.06  ? 104 SER A C     1 
ATOM   851  O  O     . SER A 1 107 ? 62.317 1.802   -15.122 1.00 15.28  ? 104 SER A O     1 
ATOM   852  C  CB    A SER A 1 107 ? 59.670 2.962   -14.004 0.38 15.24  ? 104 SER A CB    1 
ATOM   853  C  CB    B SER A 1 107 ? 59.657 2.922   -13.996 0.62 15.21  ? 104 SER A CB    1 
ATOM   854  O  OG    A SER A 1 107 ? 59.952 4.265   -14.486 0.38 17.90  ? 104 SER A OG    1 
ATOM   855  O  OG    B SER A 1 107 ? 58.460 2.471   -13.393 0.62 15.97  ? 104 SER A OG    1 
ATOM   856  N  N     . ARG A 1 108 ? 63.027 3.448   -13.766 1.00 13.76  ? 105 ARG A N     1 
ATOM   857  C  CA    . ARG A 1 108 ? 64.286 3.602   -14.505 1.00 16.53  ? 105 ARG A CA    1 
ATOM   858  C  C     . ARG A 1 108 ? 65.203 2.408   -14.278 1.00 19.72  ? 105 ARG A C     1 
ATOM   859  O  O     . ARG A 1 108 ? 66.077 2.120   -15.101 1.00 14.65  ? 105 ARG A O     1 
ATOM   860  C  CB    . ARG A 1 108 ? 65.053 4.861   -14.092 1.00 15.89  ? 105 ARG A CB    1 
ATOM   861  C  CG    . ARG A 1 108 ? 64.309 6.163   -14.289 1.00 18.83  ? 105 ARG A CG    1 
ATOM   862  C  CD    . ARG A 1 108 ? 65.287 7.294   -14.510 1.00 21.97  ? 105 ARG A CD    1 
ATOM   863  N  NE    . ARG A 1 108 ? 66.333 7.361   -13.492 1.00 21.14  ? 105 ARG A NE    1 
ATOM   864  C  CZ    . ARG A 1 108 ? 66.325 8.218   -12.471 1.00 26.81  ? 105 ARG A CZ    1 
ATOM   865  N  NH1   . ARG A 1 108 ? 67.324 8.226   -11.600 1.00 18.93  ? 105 ARG A NH1   1 
ATOM   866  N  NH2   . ARG A 1 108 ? 65.320 9.073   -12.324 1.00 18.55  ? 105 ARG A NH2   1 
ATOM   867  N  N     . PHE A 1 109 ? 65.006 1.718   -13.158 1.00 14.24  ? 106 PHE A N     1 
ATOM   868  C  CA    . PHE A 1 109 ? 65.899 0.626   -12.783 1.00 15.83  ? 106 PHE A CA    1 
ATOM   869  C  C     . PHE A 1 109 ? 65.376 -0.712  -13.266 1.00 20.13  ? 106 PHE A C     1 
ATOM   870  O  O     . PHE A 1 109 ? 66.141 -1.578  -13.690 1.00 28.13  ? 106 PHE A O     1 
ATOM   871  C  CB    . PHE A 1 109 ? 66.115 0.604   -11.271 1.00 10.41  ? 106 PHE A CB    1 
ATOM   872  C  CG    . PHE A 1 109 ? 66.853 1.794   -10.747 1.00 17.87  ? 106 PHE A CG    1 
ATOM   873  C  CD1   . PHE A 1 109 ? 66.206 3.011   -10.574 1.00 12.43  ? 106 PHE A CD1   1 
ATOM   874  C  CD2   . PHE A 1 109 ? 68.198 1.699   -10.416 1.00 14.41  ? 106 PHE A CD2   1 
ATOM   875  C  CE1   . PHE A 1 109 ? 66.889 4.110   -10.082 1.00 10.66  ? 106 PHE A CE1   1 
ATOM   876  C  CE2   . PHE A 1 109 ? 68.885 2.789   -9.925  1.00 18.09  ? 106 PHE A CE2   1 
ATOM   877  C  CZ    . PHE A 1 109 ? 68.230 4.004   -9.755  1.00 14.45  ? 106 PHE A CZ    1 
ATOM   878  N  N     . ALA A 1 110 ? 64.064 -0.882  -13.219 1.00 19.85  ? 107 ALA A N     1 
ATOM   879  C  CA    . ALA A 1 110 ? 63.481 -2.155  -13.600 1.00 17.11  ? 107 ALA A CA    1 
ATOM   880  C  C     . ALA A 1 110 ? 61.987 -2.037  -13.751 1.00 22.17  ? 107 ALA A C     1 
ATOM   881  O  O     . ALA A 1 110 ? 61.390 -1.037  -13.365 1.00 23.44  ? 107 ALA A O     1 
ATOM   882  C  CB    . ALA A 1 110 ? 63.807 -3.211  -12.565 1.00 19.41  ? 107 ALA A CB    1 
ATOM   883  N  N     . VAL A 1 111 ? 61.395 -3.078  -14.317 1.00 22.20  ? 108 VAL A N     1 
ATOM   884  C  CA    . VAL A 1 111 ? 59.955 -3.228  -14.366 1.00 29.55  ? 108 VAL A CA    1 
ATOM   885  C  C     . VAL A 1 111 ? 59.399 -3.285  -12.946 1.00 18.46  ? 108 VAL A C     1 
ATOM   886  O  O     . VAL A 1 111 ? 59.929 -4.014  -12.093 1.00 21.21  ? 108 VAL A O     1 
ATOM   887  C  CB    . VAL A 1 111 ? 59.585 -4.530  -15.078 1.00 31.24  ? 108 VAL A CB    1 
ATOM   888  C  CG1   . VAL A 1 111 ? 58.088 -4.803  -14.941 1.00 28.86  ? 108 VAL A CG1   1 
ATOM   889  C  CG2   . VAL A 1 111 ? 60.013 -4.466  -16.537 1.00 37.40  ? 108 VAL A CG2   1 
ATOM   890  N  N     . ILE A 1 112 ? 58.348 -2.508  -12.689 1.00 19.48  ? 109 ILE A N     1 
ATOM   891  C  CA    . ILE A 1 112 ? 57.731 -2.491  -11.360 1.00 18.64  ? 109 ILE A CA    1 
ATOM   892  C  C     . ILE A 1 112 ? 56.257 -2.860  -11.424 1.00 14.27  ? 109 ILE A C     1 
ATOM   893  O  O     . ILE A 1 112 ? 55.593 -2.653  -12.438 1.00 11.26  ? 109 ILE A O     1 
ATOM   894  C  CB    . ILE A 1 112 ? 57.891 -1.119  -10.663 1.00 15.80  ? 109 ILE A CB    1 
ATOM   895  C  CG1   . ILE A 1 112 ? 56.911 -0.107  -11.257 1.00 22.40  ? 109 ILE A CG1   1 
ATOM   896  C  CG2   . ILE A 1 112 ? 59.340 -0.629  -10.789 1.00 18.95  ? 109 ILE A CG2   1 
ATOM   897  C  CD1   . ILE A 1 112 ? 56.762 1.194   -10.439 1.00 23.26  ? 109 ILE A CD1   1 
ATOM   898  N  N     . GLU A 1 113 ? 55.769 -3.457  -10.344 1.00 10.19  ? 110 GLU A N     1 
ATOM   899  C  CA    . GLU A 1 113 ? 54.350 -3.672  -10.148 1.00 13.78  ? 110 GLU A CA    1 
ATOM   900  C  C     . GLU A 1 113 ? 53.941 -2.744  -9.018  1.00 13.94  ? 110 GLU A C     1 
ATOM   901  O  O     . GLU A 1 113 ? 54.461 -2.855  -7.908  1.00 9.10   ? 110 GLU A O     1 
ATOM   902  C  CB    . GLU A 1 113 ? 54.081 -5.124  -9.739  1.00 12.97  ? 110 GLU A CB    1 
ATOM   903  C  CG    . GLU A 1 113 ? 52.617 -5.429  -9.442  1.00 12.23  ? 110 GLU A CG    1 
ATOM   904  C  CD    . GLU A 1 113 ? 52.392 -6.863  -8.966  1.00 17.80  ? 110 GLU A CD    1 
ATOM   905  O  OE1   . GLU A 1 113 ? 51.340 -7.129  -8.343  1.00 26.29  ? 110 GLU A OE1   1 
ATOM   906  O  OE2   . GLU A 1 113 ? 53.261 -7.726  -9.214  1.00 12.98  ? 110 GLU A OE2   1 
ATOM   907  N  N     . ARG A 1 114 ? 53.030 -1.821  -9.304  1.00 16.10  ? 111 ARG A N     1 
ATOM   908  C  CA    . ARG A 1 114 ? 52.522 -0.908  -8.277  1.00 15.87  ? 111 ARG A CA    1 
ATOM   909  C  C     . ARG A 1 114 ? 51.625 -1.693  -7.346  1.00 18.05  ? 111 ARG A C     1 
ATOM   910  O  O     . ARG A 1 114 ? 50.562 -2.160  -7.763  1.00 20.09  ? 111 ARG A O     1 
ATOM   911  C  CB    . ARG A 1 114 ? 51.724 0.225   -8.933  1.00 17.08  ? 111 ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 114 ? 51.192 1.279   -7.958  1.00 15.38  ? 111 ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 114 ? 50.059 2.062   -8.599  1.00 17.88  ? 111 ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 114 ? 49.708 3.294   -7.889  1.00 18.36  ? 111 ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 114 ? 48.759 3.383   -6.958  1.00 21.67  ? 111 ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 114 ? 48.071 2.307   -6.600  1.00 22.08  ? 111 ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 114 ? 48.497 4.551   -6.376  1.00 16.98  ? 111 ARG A NH2   1 
ATOM   918  N  N     . ALA A 1 115 ? 52.033 -1.857  -6.089  1.00 12.50  ? 112 ALA A N     1 
ATOM   919  C  CA    . ALA A 1 115 ? 51.253 -2.679  -5.179  1.00 15.60  ? 112 ALA A CA    1 
ATOM   920  C  C     . ALA A 1 115 ? 50.266 -1.847  -4.352  1.00 18.85  ? 112 ALA A C     1 
ATOM   921  O  O     . ALA A 1 115 ? 49.250 -2.356  -3.906  1.00 20.35  ? 112 ALA A O     1 
ATOM   922  C  CB    . ALA A 1 115 ? 52.168 -3.518  -4.267  1.00 15.06  ? 112 ALA A CB    1 
ATOM   923  N  N     . SER A 1 116 ? 50.594 -0.573  -4.145  1.00 13.67  ? 113 SER A N     1 
ATOM   924  C  CA    . SER A 1 116 ? 49.753 0.357   -3.410  1.00 12.56  ? 113 SER A CA    1 
ATOM   925  C  C     . SER A 1 116 ? 50.270 1.754   -3.719  1.00 13.48  ? 113 SER A C     1 
ATOM   926  O  O     . SER A 1 116 ? 51.257 1.908   -4.439  1.00 13.26  ? 113 SER A O     1 
ATOM   927  C  CB    . SER A 1 116 ? 49.856 0.117   -1.899  1.00 14.38  ? 113 SER A CB    1 
ATOM   928  O  OG    . SER A 1 116 ? 51.130 0.537   -1.410  1.00 13.21  ? 113 SER A OG    1 
ATOM   929  N  N     . ILE A 1 117 ? 49.630 2.770   -3.150  1.00 10.83  ? 114 ILE A N     1 
ATOM   930  C  CA    . ILE A 1 117 ? 50.067 4.146   -3.362  1.00 9.31   ? 114 ILE A CA    1 
ATOM   931  C  C     . ILE A 1 117 ? 51.538 4.362   -2.977  1.00 10.72  ? 114 ILE A C     1 
ATOM   932  O  O     . ILE A 1 117 ? 52.201 5.226   -3.545  1.00 8.82   ? 114 ILE A O     1 
ATOM   933  C  CB    . ILE A 1 117 ? 49.199 5.145   -2.568  1.00 14.76  ? 114 ILE A CB    1 
ATOM   934  C  CG1   . ILE A 1 117 ? 49.363 6.566   -3.114  1.00 9.22   ? 114 ILE A CG1   1 
ATOM   935  C  CG2   . ILE A 1 117 ? 49.556 5.093   -1.089  1.00 11.18  ? 114 ILE A CG2   1 
ATOM   936  C  CD1   . ILE A 1 117 ? 48.187 7.480   -2.752  1.00 12.99  ? 114 ILE A CD1   1 
ATOM   937  N  N     . ASP A 1 118 ? 52.063 3.581   -2.029  1.00 9.20   ? 115 ASP A N     1 
ATOM   938  C  CA    . ASP A 1 118 ? 53.451 3.820   -1.626  1.00 12.00  ? 115 ASP A CA    1 
ATOM   939  C  C     . ASP A 1 118 ? 54.402 2.611   -1.689  1.00 15.33  ? 115 ASP A C     1 
ATOM   940  O  O     . ASP A 1 118 ? 55.484 2.617   -1.081  1.00 12.03  ? 115 ASP A O     1 
ATOM   941  C  CB    . ASP A 1 118 ? 53.486 4.439   -0.240  1.00 11.18  ? 115 ASP A CB    1 
ATOM   942  C  CG    . ASP A 1 118 ? 53.566 3.406   0.844   1.00 16.77  ? 115 ASP A CG    1 
ATOM   943  O  OD1   . ASP A 1 118 ? 54.349 3.664   1.774   1.00 15.03  ? 115 ASP A OD1   1 
ATOM   944  O  OD2   . ASP A 1 118 ? 52.873 2.347   0.763   1.00 14.35  ? 115 ASP A OD2   1 
ATOM   945  N  N     . GLU A 1 119 ? 54.026 1.584   -2.430  1.00 11.65  ? 116 GLU A N     1 
ATOM   946  C  CA    . GLU A 1 119 ? 54.931 0.455   -2.561  1.00 12.38  ? 116 GLU A CA    1 
ATOM   947  C  C     . GLU A 1 119 ? 54.888 -0.217  -3.916  1.00 13.66  ? 116 GLU A C     1 
ATOM   948  O  O     . GLU A 1 119 ? 53.848 -0.240  -4.589  1.00 9.50   ? 116 GLU A O     1 
ATOM   949  C  CB    . GLU A 1 119 ? 54.726 -0.556  -1.432  1.00 18.69  ? 116 GLU A CB    1 
ATOM   950  C  CG    . GLU A 1 119 ? 53.414 -1.273  -1.444  1.00 23.07  ? 116 GLU A CG    1 
ATOM   951  C  CD    . GLU A 1 119 ? 53.016 -1.739  -0.052  1.00 23.35  ? 116 GLU A CD    1 
ATOM   952  O  OE1   . GLU A 1 119 ? 53.399 -2.865  0.334   1.00 21.81  ? 116 GLU A OE1   1 
ATOM   953  O  OE2   . GLU A 1 119 ? 52.337 -0.970  0.660   1.00 27.23  ? 116 GLU A OE2   1 
ATOM   954  N  N     . ALA A 1 120 ? 56.042 -0.746  -4.310  1.00 10.97  ? 117 ALA A N     1 
ATOM   955  C  CA    . ALA A 1 120 ? 56.176 -1.430  -5.577  1.00 12.93  ? 117 ALA A CA    1 
ATOM   956  C  C     . ALA A 1 120 ? 57.100 -2.636  -5.448  1.00 14.18  ? 117 ALA A C     1 
ATOM   957  O  O     . ALA A 1 120 ? 58.137 -2.584  -4.767  1.00 12.96  ? 117 ALA A O     1 
ATOM   958  C  CB    . ALA A 1 120 ? 56.695 -0.471  -6.645  1.00 12.30  ? 117 ALA A CB    1 
ATOM   959  N  N     . TYR A 1 121 ? 56.715 -3.724  -6.108  1.00 11.50  ? 118 TYR A N     1 
ATOM   960  C  CA    . TYR A 1 121 ? 57.638 -4.822  -6.317  1.00 10.19  ? 118 TYR A CA    1 
ATOM   961  C  C     . TYR A 1 121 ? 58.474 -4.553  -7.546  1.00 12.10  ? 118 TYR A C     1 
ATOM   962  O  O     . TYR A 1 121 ? 58.005 -3.928  -8.502  1.00 9.60   ? 118 TYR A O     1 
ATOM   963  C  CB    . TYR A 1 121 ? 56.881 -6.133  -6.469  1.00 8.13   ? 118 TYR A CB    1 
ATOM   964  C  CG    . TYR A 1 121 ? 56.152 -6.530  -5.219  1.00 9.90   ? 118 TYR A CG    1 
ATOM   965  C  CD1   . TYR A 1 121 ? 54.820 -6.188  -5.038  1.00 10.02  ? 118 TYR A CD1   1 
ATOM   966  C  CD2   . TYR A 1 121 ? 56.796 -7.244  -4.210  1.00 13.09  ? 118 TYR A CD2   1 
ATOM   967  C  CE1   . TYR A 1 121 ? 54.131 -6.549  -3.897  1.00 17.63  ? 118 TYR A CE1   1 
ATOM   968  C  CE2   . TYR A 1 121 ? 56.114 -7.608  -3.047  1.00 12.68  ? 118 TYR A CE2   1 
ATOM   969  C  CZ    . TYR A 1 121 ? 54.777 -7.255  -2.902  1.00 18.18  ? 118 TYR A CZ    1 
ATOM   970  O  OH    . TYR A 1 121 ? 54.072 -7.613  -1.771  1.00 12.12  ? 118 TYR A OH    1 
ATOM   971  N  N     . VAL A 1 122 ? 59.713 -5.036  -7.503  1.00 10.42  ? 119 VAL A N     1 
ATOM   972  C  CA    . VAL A 1 122 ? 60.677 -4.870  -8.572  1.00 13.76  ? 119 VAL A CA    1 
ATOM   973  C  C     . VAL A 1 122 ? 61.238 -6.229  -8.929  1.00 14.42  ? 119 VAL A C     1 
ATOM   974  O  O     . VAL A 1 122 ? 61.715 -6.944  -8.047  1.00 10.02  ? 119 VAL A O     1 
ATOM   975  C  CB    . VAL A 1 122 ? 61.879 -3.999  -8.082  1.00 13.63  ? 119 VAL A CB    1 
ATOM   976  C  CG1   . VAL A 1 122 ? 62.604 -3.410  -9.253  1.00 21.03  ? 119 VAL A CG1   1 
ATOM   977  C  CG2   . VAL A 1 122 ? 61.398 -2.900  -7.139  1.00 16.97  ? 119 VAL A CG2   1 
ATOM   978  N  N     . ASP A 1 123 ? 61.190 -6.600  -10.206 1.00 12.67  ? 120 ASP A N     1 
ATOM   979  C  CA    . ASP A 1 123 ? 61.885 -7.806  -10.663 1.00 14.87  ? 120 ASP A CA    1 
ATOM   980  C  C     . ASP A 1 123 ? 63.315 -7.458  -11.094 1.00 18.78  ? 120 ASP A C     1 
ATOM   981  O  O     . ASP A 1 123 ? 63.530 -6.906  -12.164 1.00 16.83  ? 120 ASP A O     1 
ATOM   982  C  CB    . ASP A 1 123 ? 61.115 -8.467  -11.808 1.00 20.81  ? 120 ASP A CB    1 
ATOM   983  C  CG    . ASP A 1 123 ? 61.555 -9.893  -12.061 1.00 22.77  ? 120 ASP A CG    1 
ATOM   984  O  OD1   . ASP A 1 123 ? 62.777 -10.158 -12.090 1.00 19.53  ? 120 ASP A OD1   1 
ATOM   985  O  OD2   . ASP A 1 123 ? 60.674 -10.762 -12.229 1.00 38.94  ? 120 ASP A OD2   1 
ATOM   986  N  N     . LEU A 1 124 ? 64.289 -7.775  -10.250 1.00 13.92  ? 121 LEU A N     1 
ATOM   987  C  CA    . LEU A 1 124 ? 65.684 -7.409  -10.498 1.00 15.52  ? 121 LEU A CA    1 
ATOM   988  C  C     . LEU A 1 124 ? 66.505 -8.481  -11.202 1.00 10.33  ? 121 LEU A C     1 
ATOM   989  O  O     . LEU A 1 124 ? 67.702 -8.308  -11.391 1.00 8.89   ? 121 LEU A O     1 
ATOM   990  C  CB    . LEU A 1 124 ? 66.375 -7.079  -9.176  1.00 13.00  ? 121 LEU A CB    1 
ATOM   991  C  CG    . LEU A 1 124 ? 65.818 -5.833  -8.498  1.00 20.89  ? 121 LEU A CG    1 
ATOM   992  C  CD1   . LEU A 1 124 ? 66.219 -5.746  -7.027  1.00 16.81  ? 121 LEU A CD1   1 
ATOM   993  C  CD2   . LEU A 1 124 ? 66.273 -4.611  -9.289  1.00 21.93  ? 121 LEU A CD2   1 
ATOM   994  N  N     . THR A 1 125 ? 65.875 -9.597  -11.551 1.00 11.71  ? 122 THR A N     1 
ATOM   995  C  CA    . THR A 1 125 ? 66.631 -10.746 -12.042 1.00 12.71  ? 122 THR A CA    1 
ATOM   996  C  C     . THR A 1 125 ? 67.576 -10.364 -13.190 1.00 13.07  ? 122 THR A C     1 
ATOM   997  O  O     . THR A 1 125 ? 68.767 -10.674 -13.154 1.00 13.38  ? 122 THR A O     1 
ATOM   998  C  CB    . THR A 1 125 ? 65.698 -11.873 -12.465 1.00 15.43  ? 122 THR A CB    1 
ATOM   999  O  OG1   . THR A 1 125 ? 64.830 -12.195 -11.369 1.00 13.32  ? 122 THR A OG1   1 
ATOM   1000 C  CG2   . THR A 1 125 ? 66.512 -13.116 -12.890 1.00 17.54  ? 122 THR A CG2   1 
ATOM   1001 N  N     . SER A 1 126 ? 67.029 -9.678  -14.191 1.00 14.56  ? 123 SER A N     1 
ATOM   1002 C  CA    . SER A 1 126 ? 67.790 -9.199  -15.350 1.00 18.52  ? 123 SER A CA    1 
ATOM   1003 C  C     . SER A 1 126 ? 68.883 -8.196  -14.981 1.00 18.49  ? 123 SER A C     1 
ATOM   1004 O  O     . SER A 1 126 ? 70.034 -8.329  -15.394 1.00 16.85  ? 123 SER A O     1 
ATOM   1005 C  CB    . SER A 1 126 ? 66.845 -8.541  -16.360 1.00 16.09  ? 123 SER A CB    1 
ATOM   1006 O  OG    . SER A 1 126 ? 66.092 -9.517  -17.045 1.00 38.13  ? 123 SER A OG    1 
ATOM   1007 N  N     . ALA A 1 127 ? 68.504 -7.175  -14.221 1.00 15.44  ? 124 ALA A N     1 
ATOM   1008 C  CA    . ALA A 1 127 ? 69.456 -6.169  -13.768 1.00 20.99  ? 124 ALA A CA    1 
ATOM   1009 C  C     . ALA A 1 127 ? 70.620 -6.790  -12.983 1.00 17.90  ? 124 ALA A C     1 
ATOM   1010 O  O     . ALA A 1 127 ? 71.747 -6.331  -13.084 1.00 12.18  ? 124 ALA A O     1 
ATOM   1011 C  CB    . ALA A 1 127 ? 68.745 -5.098  -12.937 1.00 14.05  ? 124 ALA A CB    1 
ATOM   1012 N  N     . VAL A 1 128 ? 70.347 -7.833  -12.201 1.00 12.23  ? 125 VAL A N     1 
ATOM   1013 C  CA    . VAL A 1 128 ? 71.419 -8.511  -11.475 1.00 14.23  ? 125 VAL A CA    1 
ATOM   1014 C  C     . VAL A 1 128 ? 72.418 -9.217  -12.409 1.00 12.81  ? 125 VAL A C     1 
ATOM   1015 O  O     . VAL A 1 128 ? 73.627 -9.090  -12.218 1.00 18.22  ? 125 VAL A O     1 
ATOM   1016 C  CB    . VAL A 1 128 ? 70.863 -9.500  -10.422 1.00 12.66  ? 125 VAL A CB    1 
ATOM   1017 C  CG1   . VAL A 1 128 ? 71.948 -10.471 -9.963  1.00 14.92  ? 125 VAL A CG1   1 
ATOM   1018 C  CG2   . VAL A 1 128 ? 70.293 -8.722  -9.236  1.00 10.90  ? 125 VAL A CG2   1 
ATOM   1019 N  N     . GLN A 1 129 ? 71.918 -9.957  -13.404 1.00 15.78  ? 126 GLN A N     1 
ATOM   1020 C  CA    . GLN A 1 129 ? 72.801 -10.608 -14.376 1.00 23.89  ? 126 GLN A CA    1 
ATOM   1021 C  C     . GLN A 1 129 ? 73.726 -9.567  -14.999 1.00 25.16  ? 126 GLN A C     1 
ATOM   1022 O  O     . GLN A 1 129 ? 74.943 -9.739  -15.033 1.00 22.42  ? 126 GLN A O     1 
ATOM   1023 C  CB    . GLN A 1 129 ? 72.023 -11.325 -15.491 1.00 27.81  ? 126 GLN A CB    1 
ATOM   1024 C  CG    . GLN A 1 129 ? 70.797 -12.121 -15.064 1.00 31.38  ? 126 GLN A CG    1 
ATOM   1025 C  CD    . GLN A 1 129 ? 71.129 -13.414 -14.334 1.00 52.42  ? 126 GLN A CD    1 
ATOM   1026 O  OE1   . GLN A 1 129 ? 72.203 -13.558 -13.742 1.00 51.97  ? 126 GLN A OE1   1 
ATOM   1027 N  NE2   . GLN A 1 129 ? 70.195 -14.366 -14.371 1.00 47.05  ? 126 GLN A NE2   1 
ATOM   1028 N  N     . GLU A 1 130 ? 73.136 -8.477  -15.483 1.00 22.15  ? 127 GLU A N     1 
ATOM   1029 C  CA    . GLU A 1 130 ? 73.909 -7.413  -16.109 1.00 32.27  ? 127 GLU A CA    1 
ATOM   1030 C  C     . GLU A 1 130 ? 74.988 -6.878  -15.179 1.00 30.55  ? 127 GLU A C     1 
ATOM   1031 O  O     . GLU A 1 130 ? 76.163 -6.804  -15.552 1.00 37.15  ? 127 GLU A O     1 
ATOM   1032 C  CB    . GLU A 1 130 ? 72.998 -6.276  -16.566 1.00 30.05  ? 127 GLU A CB    1 
ATOM   1033 C  CG    . GLU A 1 130 ? 72.054 -6.673  -17.685 1.00 42.77  ? 127 GLU A CG    1 
ATOM   1034 C  CD    . GLU A 1 130 ? 71.139 -5.530  -18.111 1.00 70.29  ? 127 GLU A CD    1 
ATOM   1035 O  OE1   . GLU A 1 130 ? 71.290 -4.409  -17.571 1.00 64.81  ? 127 GLU A OE1   1 
ATOM   1036 O  OE2   . GLU A 1 130 ? 70.274 -5.763  -18.985 1.00 72.76  ? 127 GLU A OE2   1 
ATOM   1037 N  N     . ARG A 1 131 ? 74.598 -6.509  -13.966 1.00 23.50  ? 128 ARG A N     1 
ATOM   1038 C  CA    . ARG A 1 131 ? 75.565 -5.972  -13.021 1.00 20.00  ? 128 ARG A CA    1 
ATOM   1039 C  C     . ARG A 1 131 ? 76.655 -6.997  -12.744 1.00 25.86  ? 128 ARG A C     1 
ATOM   1040 O  O     . ARG A 1 131 ? 77.819 -6.638  -12.598 1.00 26.56  ? 128 ARG A O     1 
ATOM   1041 C  CB    . ARG A 1 131 ? 74.898 -5.536  -11.719 1.00 18.91  ? 128 ARG A CB    1 
ATOM   1042 C  CG    . ARG A 1 131 ? 75.891 -4.991  -10.701 1.00 28.51  ? 128 ARG A CG    1 
ATOM   1043 C  CD    . ARG A 1 131 ? 76.546 -3.723  -11.226 1.00 27.02  ? 128 ARG A CD    1 
ATOM   1044 N  NE    . ARG A 1 131 ? 75.515 -2.717  -11.407 1.00 35.97  ? 128 ARG A NE    1 
ATOM   1045 C  CZ    . ARG A 1 131 ? 75.158 -1.858  -10.460 1.00 35.58  ? 128 ARG A CZ    1 
ATOM   1046 N  NH1   . ARG A 1 131 ? 75.793 -1.858  -9.293  1.00 20.82  ? 128 ARG A NH1   1 
ATOM   1047 N  NH2   . ARG A 1 131 ? 74.189 -0.984  -10.692 1.00 39.01  ? 128 ARG A NH2   1 
ATOM   1048 N  N     . LEU A 1 132 ? 76.276 -8.273  -12.681 1.00 22.56  ? 129 LEU A N     1 
ATOM   1049 C  CA    . LEU A 1 132 ? 77.240 -9.350  -12.434 1.00 23.97  ? 129 LEU A CA    1 
ATOM   1050 C  C     . LEU A 1 132 ? 78.317 -9.464  -13.517 1.00 39.94  ? 129 LEU A C     1 
ATOM   1051 O  O     . LEU A 1 132 ? 79.447 -9.875  -13.232 1.00 33.79  ? 129 LEU A O     1 
ATOM   1052 C  CB    . LEU A 1 132 ? 76.534 -10.699 -12.256 1.00 25.22  ? 129 LEU A CB    1 
ATOM   1053 C  CG    . LEU A 1 132 ? 76.198 -11.051 -10.800 1.00 25.53  ? 129 LEU A CG    1 
ATOM   1054 C  CD1   . LEU A 1 132 ? 75.245 -12.233 -10.689 1.00 24.05  ? 129 LEU A CD1   1 
ATOM   1055 C  CD2   . LEU A 1 132 ? 77.484 -11.308 -10.008 1.00 26.55  ? 129 LEU A CD2   1 
ATOM   1056 N  N     . GLN A 1 133 ? 77.963 -9.111  -14.752 1.00 36.84  ? 130 GLN A N     1 
ATOM   1057 C  CA    . GLN A 1 133 ? 78.908 -9.156  -15.868 1.00 38.12  ? 130 GLN A CA    1 
ATOM   1058 C  C     . GLN A 1 133 ? 79.828 -7.937  -15.880 1.00 44.21  ? 130 GLN A C     1 
ATOM   1059 O  O     . GLN A 1 133 ? 80.971 -8.021  -16.323 1.00 50.84  ? 130 GLN A O     1 
ATOM   1060 C  CB    . GLN A 1 133 ? 78.171 -9.276  -17.202 1.00 39.75  ? 130 GLN A CB    1 
ATOM   1061 C  CG    . GLN A 1 133 ? 77.547 -10.645 -17.452 1.00 43.46  ? 130 GLN A CG    1 
ATOM   1062 C  CD    . GLN A 1 133 ? 76.645 -10.652 -18.674 1.00 67.11  ? 130 GLN A CD    1 
ATOM   1063 O  OE1   . GLN A 1 133 ? 76.411 -9.609  -19.290 1.00 72.52  ? 130 GLN A OE1   1 
ATOM   1064 N  NE2   . GLN A 1 133 ? 76.132 -11.826 -19.030 1.00 68.47  ? 130 GLN A NE2   1 
ATOM   1065 N  N     . LYS A 1 134 ? 79.335 -6.804  -15.392 1.00 40.24  ? 131 LYS A N     1 
ATOM   1066 C  CA    . LYS A 1 134 ? 80.175 -5.613  -15.286 1.00 45.17  ? 131 LYS A CA    1 
ATOM   1067 C  C     . LYS A 1 134 ? 81.204 -5.795  -14.174 1.00 50.69  ? 131 LYS A C     1 
ATOM   1068 O  O     . LYS A 1 134 ? 82.358 -5.383  -14.304 1.00 52.15  ? 131 LYS A O     1 
ATOM   1069 C  CB    . LYS A 1 134 ? 79.333 -4.357  -15.030 1.00 47.55  ? 131 LYS A CB    1 
ATOM   1070 C  CG    . LYS A 1 134 ? 78.503 -3.893  -16.224 1.00 55.08  ? 131 LYS A CG    1 
ATOM   1071 C  CD    . LYS A 1 134 ? 77.798 -2.568  -15.934 1.00 55.09  ? 131 LYS A CD    1 
ATOM   1072 C  CE    . LYS A 1 134 ? 76.753 -2.702  -14.824 1.00 61.33  ? 131 LYS A CE    1 
ATOM   1073 N  NZ    . LYS A 1 134 ? 76.203 -1.370  -14.409 1.00 60.98  ? 131 LYS A NZ    1 
ATOM   1074 N  N     . LEU A 1 135 ? 80.777 -6.421  -13.082 1.00 45.89  ? 132 LEU A N     1 
ATOM   1075 C  CA    . LEU A 1 135 ? 81.643 -6.655  -11.934 1.00 48.63  ? 132 LEU A CA    1 
ATOM   1076 C  C     . LEU A 1 135 ? 82.796 -7.587  -12.276 1.00 58.65  ? 132 LEU A C     1 
ATOM   1077 O  O     . LEU A 1 135 ? 83.899 -7.440  -11.748 1.00 65.97  ? 132 LEU A O     1 
ATOM   1078 C  CB    . LEU A 1 135 ? 80.837 -7.241  -10.777 1.00 49.21  ? 132 LEU A CB    1 
ATOM   1079 C  CG    . LEU A 1 135 ? 79.848 -6.269  -10.134 1.00 51.32  ? 132 LEU A CG    1 
ATOM   1080 C  CD1   . LEU A 1 135 ? 78.841 -7.022  -9.276  1.00 40.26  ? 132 LEU A CD1   1 
ATOM   1081 C  CD2   . LEU A 1 135 ? 80.580 -5.196  -9.325  1.00 45.39  ? 132 LEU A CD2   1 
ATOM   1082 N  N     . GLN A 1 136 ? 82.532 -8.541  -13.164 1.00 58.59  ? 133 GLN A N     1 
ATOM   1083 C  CA    . GLN A 1 136 ? 83.507 -9.573  -13.510 1.00 64.17  ? 133 GLN A CA    1 
ATOM   1084 C  C     . GLN A 1 136 ? 84.250 -10.115 -12.291 1.00 57.58  ? 133 GLN A C     1 
ATOM   1085 O  O     . GLN A 1 136 ? 85.400 -9.757  -12.044 1.00 57.49  ? 133 GLN A O     1 
ATOM   1086 C  CB    . GLN A 1 136 ? 84.498 -9.074  -14.569 1.00 62.05  ? 133 GLN A CB    1 
ATOM   1087 C  CG    . GLN A 1 136 ? 83.908 -8.918  -15.975 1.00 72.77  ? 133 GLN A CG    1 
ATOM   1088 C  CD    . GLN A 1 136 ? 83.254 -10.194 -16.510 1.00 81.22  ? 133 GLN A CD    1 
ATOM   1089 O  OE1   . GLN A 1 136 ? 82.760 -11.028 -15.746 1.00 78.50  ? 133 GLN A OE1   1 
ATOM   1090 N  NE2   . GLN A 1 136 ? 83.243 -10.343 -17.835 1.00 68.54  ? 133 GLN A NE2   1 
ATOM   1091 N  N     . GLY A 1 137 ? 83.574 -10.972 -11.532 1.00 54.75  ? 134 GLY A N     1 
ATOM   1092 C  CA    . GLY A 1 137 ? 84.171 -11.655 -10.397 1.00 51.75  ? 134 GLY A CA    1 
ATOM   1093 C  C     . GLY A 1 137 ? 84.741 -10.770 -9.303  1.00 52.54  ? 134 GLY A C     1 
ATOM   1094 O  O     . GLY A 1 137 ? 85.470 -11.249 -8.437  1.00 50.63  ? 134 GLY A O     1 
ATOM   1095 N  N     . GLN A 1 138 ? 84.422 -9.481  -9.334  1.00 52.47  ? 135 GLN A N     1 
ATOM   1096 C  CA    . GLN A 1 138 ? 84.862 -8.581  -8.273  1.00 52.82  ? 135 GLN A CA    1 
ATOM   1097 C  C     . GLN A 1 138 ? 84.050 -8.785  -7.002  1.00 48.15  ? 135 GLN A C     1 
ATOM   1098 O  O     . GLN A 1 138 ? 82.822 -8.852  -7.045  1.00 42.44  ? 135 GLN A O     1 
ATOM   1099 C  CB    . GLN A 1 138 ? 84.765 -7.125  -8.716  1.00 55.15  ? 135 GLN A CB    1 
ATOM   1100 C  CG    . GLN A 1 138 ? 86.023 -6.592  -9.364  1.00 67.31  ? 135 GLN A CG    1 
ATOM   1101 C  CD    . GLN A 1 138 ? 85.822 -5.214  -9.957  1.00 78.01  ? 135 GLN A CD    1 
ATOM   1102 O  OE1   . GLN A 1 138 ? 85.711 -4.223  -9.233  1.00 78.92  ? 135 GLN A OE1   1 
ATOM   1103 N  NE2   . GLN A 1 138 ? 85.759 -5.147  -11.283 1.00 73.01  ? 135 GLN A NE2   1 
ATOM   1104 N  N     . PRO A 1 139 ? 84.738 -8.885  -5.860  1.00 48.76  ? 136 PRO A N     1 
ATOM   1105 C  CA    . PRO A 1 139 ? 84.049 -9.022  -4.575  1.00 41.17  ? 136 PRO A CA    1 
ATOM   1106 C  C     . PRO A 1 139 ? 83.199 -7.788  -4.303  1.00 40.33  ? 136 PRO A C     1 
ATOM   1107 O  O     . PRO A 1 139 ? 83.430 -6.730  -4.889  1.00 37.45  ? 136 PRO A O     1 
ATOM   1108 C  CB    . PRO A 1 139 ? 85.200 -9.117  -3.568  1.00 43.59  ? 136 PRO A CB    1 
ATOM   1109 C  CG    . PRO A 1 139 ? 86.359 -8.485  -4.253  1.00 49.39  ? 136 PRO A CG    1 
ATOM   1110 C  CD    . PRO A 1 139 ? 86.198 -8.816  -5.703  1.00 49.55  ? 136 PRO A CD    1 
ATOM   1111 N  N     . ILE A 1 140 ? 82.212 -7.928  -3.429  1.00 37.29  ? 137 ILE A N     1 
ATOM   1112 C  CA    . ILE A 1 140 ? 81.314 -6.827  -3.127  1.00 26.49  ? 137 ILE A CA    1 
ATOM   1113 C  C     . ILE A 1 140 ? 81.689 -6.196  -1.804  1.00 22.99  ? 137 ILE A C     1 
ATOM   1114 O  O     . ILE A 1 140 ? 81.692 -6.855  -0.768  1.00 22.32  ? 137 ILE A O     1 
ATOM   1115 C  CB    . ILE A 1 140 ? 79.856 -7.295  -3.108  1.00 25.93  ? 137 ILE A CB    1 
ATOM   1116 C  CG1   . ILE A 1 140 ? 79.473 -7.777  -4.509  1.00 35.25  ? 137 ILE A CG1   1 
ATOM   1117 C  CG2   . ILE A 1 140 ? 78.944 -6.171  -2.647  1.00 19.53  ? 137 ILE A CG2   1 
ATOM   1118 C  CD1   . ILE A 1 140 ? 78.122 -8.443  -4.598  1.00 29.57  ? 137 ILE A CD1   1 
ATOM   1119 N  N     . SER A 1 141 ? 82.018 -4.912  -1.855  1.00 26.43  ? 138 SER A N     1 
ATOM   1120 C  CA    . SER A 1 141 ? 82.426 -4.167  -0.670  1.00 22.83  ? 138 SER A CA    1 
ATOM   1121 C  C     . SER A 1 141 ? 81.234 -3.882  0.256   1.00 21.01  ? 138 SER A C     1 
ATOM   1122 O  O     . SER A 1 141 ? 80.138 -3.570  -0.209  1.00 18.69  ? 138 SER A O     1 
ATOM   1123 C  CB    . SER A 1 141 ? 83.088 -2.852  -1.099  1.00 20.63  ? 138 SER A CB    1 
ATOM   1124 O  OG    . SER A 1 141 ? 83.209 -1.960  -0.006  1.00 28.72  ? 138 SER A OG    1 
ATOM   1125 N  N     . ALA A 1 142 ? 81.456 -3.977  1.564   1.00 17.50  ? 139 ALA A N     1 
ATOM   1126 C  CA    . ALA A 1 142 ? 80.425 -3.617  2.525   1.00 23.23  ? 139 ALA A CA    1 
ATOM   1127 C  C     . ALA A 1 142 ? 79.998 -2.166  2.306   1.00 23.42  ? 139 ALA A C     1 
ATOM   1128 O  O     . ALA A 1 142 ? 78.884 -1.784  2.655   1.00 16.19  ? 139 ALA A O     1 
ATOM   1129 C  CB    . ALA A 1 142 ? 80.915 -3.818  3.941   1.00 23.13  ? 139 ALA A CB    1 
ATOM   1130 N  N     . ASP A 1 143 ? 80.894 -1.372  1.724   1.00 21.74  ? 140 ASP A N     1 
ATOM   1131 C  CA    . ASP A 1 143 ? 80.617 0.026   1.426   1.00 25.81  ? 140 ASP A CA    1 
ATOM   1132 C  C     . ASP A 1 143 ? 79.462 0.193   0.443   1.00 19.94  ? 140 ASP A C     1 
ATOM   1133 O  O     . ASP A 1 143 ? 78.759 1.202   0.474   1.00 19.29  ? 140 ASP A O     1 
ATOM   1134 C  CB    . ASP A 1 143 ? 81.865 0.723   0.873   1.00 24.08  ? 140 ASP A CB    1 
ATOM   1135 C  CG    . ASP A 1 143 ? 82.949 0.902   1.923   1.00 40.77  ? 140 ASP A CG    1 
ATOM   1136 O  OD1   . ASP A 1 143 ? 82.617 0.986   3.129   1.00 38.14  ? 140 ASP A OD1   1 
ATOM   1137 O  OD2   . ASP A 1 143 ? 84.136 0.965   1.537   1.00 54.37  ? 140 ASP A OD2   1 
ATOM   1138 N  N     . LEU A 1 144 ? 79.264 -0.789  -0.428  1.00 17.51  ? 141 LEU A N     1 
ATOM   1139 C  CA    . LEU A 1 144 ? 78.149 -0.729  -1.365  1.00 19.09  ? 141 LEU A CA    1 
ATOM   1140 C  C     . LEU A 1 144 ? 76.800 -1.077  -0.722  1.00 15.97  ? 141 LEU A C     1 
ATOM   1141 O  O     . LEU A 1 144 ? 75.768 -1.011  -1.382  1.00 15.28  ? 141 LEU A O     1 
ATOM   1142 C  CB    . LEU A 1 144 ? 78.411 -1.634  -2.568  1.00 14.51  ? 141 LEU A CB    1 
ATOM   1143 C  CG    . LEU A 1 144 ? 79.726 -1.341  -3.295  1.00 24.16  ? 141 LEU A CG    1 
ATOM   1144 C  CD1   . LEU A 1 144 ? 79.961 -2.327  -4.423  1.00 23.82  ? 141 LEU A CD1   1 
ATOM   1145 C  CD2   . LEU A 1 144 ? 79.723 0.088   -3.812  1.00 25.55  ? 141 LEU A CD2   1 
ATOM   1146 N  N     . LEU A 1 145 ? 76.813 -1.438  0.558   1.00 15.86  ? 142 LEU A N     1 
ATOM   1147 C  CA    . LEU A 1 145 ? 75.595 -1.879  1.250   1.00 15.55  ? 142 LEU A CA    1 
ATOM   1148 C  C     . LEU A 1 145 ? 75.413 -1.162  2.587   1.00 14.24  ? 142 LEU A C     1 
ATOM   1149 O  O     . LEU A 1 145 ? 75.266 -1.786  3.636   1.00 12.04  ? 142 LEU A O     1 
ATOM   1150 C  CB    . LEU A 1 145 ? 75.627 -3.405  1.428   1.00 13.89  ? 142 LEU A CB    1 
ATOM   1151 C  CG    . LEU A 1 145 ? 75.523 -4.211  0.131   1.00 12.74  ? 142 LEU A CG    1 
ATOM   1152 C  CD1   . LEU A 1 145 ? 76.014 -5.660  0.293   1.00 16.79  ? 142 LEU A CD1   1 
ATOM   1153 C  CD2   . LEU A 1 145 ? 74.100 -4.204  -0.416  1.00 13.98  ? 142 LEU A CD2   1 
ATOM   1154 N  N     . PRO A 1 146 ? 75.404 0.177   2.556   1.00 19.81  ? 143 PRO A N     1 
ATOM   1155 C  CA    . PRO A 1 146 ? 75.507 0.943   3.804   1.00 19.43  ? 143 PRO A CA    1 
ATOM   1156 C  C     . PRO A 1 146 ? 74.257 0.919   4.663   1.00 17.26  ? 143 PRO A C     1 
ATOM   1157 O  O     . PRO A 1 146 ? 74.348 1.339   5.809   1.00 14.95  ? 143 PRO A O     1 
ATOM   1158 C  CB    . PRO A 1 146 ? 75.762 2.369   3.317   1.00 18.91  ? 143 PRO A CB    1 
ATOM   1159 C  CG    . PRO A 1 146 ? 75.150 2.413   1.947   1.00 19.28  ? 143 PRO A CG    1 
ATOM   1160 C  CD    . PRO A 1 146 ? 75.348 1.046   1.364   1.00 16.28  ? 143 PRO A CD    1 
ATOM   1161 N  N     . SER A 1 147 ? 73.122 0.465   4.128   1.00 15.99  ? 144 SER A N     1 
ATOM   1162 C  CA    . SER A 1 147 ? 71.886 0.458   4.902   1.00 13.29  ? 144 SER A CA    1 
ATOM   1163 C  C     . SER A 1 147 ? 71.210 -0.919  4.908   1.00 14.46  ? 144 SER A C     1 
ATOM   1164 O  O     . SER A 1 147 ? 70.034 -1.035  5.235   1.00 9.22   ? 144 SER A O     1 
ATOM   1165 C  CB    . SER A 1 147 ? 70.915 1.550   4.412   1.00 16.23  ? 144 SER A CB    1 
ATOM   1166 O  OG    . SER A 1 147 ? 70.483 1.317   3.079   1.00 16.33  ? 144 SER A OG    1 
ATOM   1167 N  N     . THR A 1 148 ? 71.982 -1.952  4.582   1.00 10.94  ? 145 THR A N     1 
ATOM   1168 C  CA    . THR A 1 148 ? 71.459 -3.313  4.420   1.00 11.18  ? 145 THR A CA    1 
ATOM   1169 C  C     . THR A 1 148 ? 71.665 -4.179  5.661   1.00 13.19  ? 145 THR A C     1 
ATOM   1170 O  O     . THR A 1 148 ? 72.754 -4.181  6.253   1.00 11.46  ? 145 THR A O     1 
ATOM   1171 C  CB    . THR A 1 148 ? 72.135 -3.998  3.206   1.00 11.78  ? 145 THR A CB    1 
ATOM   1172 O  OG1   . THR A 1 148 ? 71.812 -3.267  2.018   1.00 10.71  ? 145 THR A OG1   1 
ATOM   1173 C  CG2   . THR A 1 148 ? 71.676 -5.460  3.052   1.00 8.16   ? 145 THR A CG2   1 
ATOM   1174 N  N     . TYR A 1 149 ? 70.608 -4.894  6.052   1.00 11.45  ? 146 TYR A N     1 
ATOM   1175 C  CA    . TYR A 1 149 ? 70.651 -5.907  7.109   1.00 15.30  ? 146 TYR A CA    1 
ATOM   1176 C  C     . TYR A 1 149 ? 70.565 -7.276  6.467   1.00 15.58  ? 146 TYR A C     1 
ATOM   1177 O  O     . TYR A 1 149 ? 69.822 -7.455  5.493   1.00 11.88  ? 146 TYR A O     1 
ATOM   1178 C  CB    . TYR A 1 149 ? 69.445 -5.766  8.032   1.00 12.34  ? 146 TYR A CB    1 
ATOM   1179 C  CG    . TYR A 1 149 ? 69.599 -4.695  9.086   1.00 13.67  ? 146 TYR A CG    1 
ATOM   1180 C  CD1   . TYR A 1 149 ? 70.016 -5.029  10.371  1.00 15.66  ? 146 TYR A CD1   1 
ATOM   1181 C  CD2   . TYR A 1 149 ? 69.325 -3.354  8.800   1.00 11.37  ? 146 TYR A CD2   1 
ATOM   1182 C  CE1   . TYR A 1 149 ? 70.161 -4.064  11.346  1.00 18.50  ? 146 TYR A CE1   1 
ATOM   1183 C  CE2   . TYR A 1 149 ? 69.480 -2.371  9.767   1.00 13.42  ? 146 TYR A CE2   1 
ATOM   1184 C  CZ    . TYR A 1 149 ? 69.891 -2.738  11.040  1.00 19.09  ? 146 TYR A CZ    1 
ATOM   1185 O  OH    . TYR A 1 149 ? 70.035 -1.796  12.024  1.00 24.90  ? 146 TYR A OH    1 
ATOM   1186 N  N     . ILE A 1 150 ? 71.287 -8.248  7.015   1.00 7.00   ? 147 ILE A N     1 
ATOM   1187 C  CA    . ILE A 1 150 ? 71.169 -9.621  6.523   1.00 7.74   ? 147 ILE A CA    1 
ATOM   1188 C  C     . ILE A 1 150 ? 70.433 -10.403 7.587   1.00 7.79   ? 147 ILE A C     1 
ATOM   1189 O  O     . ILE A 1 150 ? 70.971 -10.647 8.672   1.00 11.47  ? 147 ILE A O     1 
ATOM   1190 C  CB    . ILE A 1 150 ? 72.532 -10.300 6.284   1.00 8.76   ? 147 ILE A CB    1 
ATOM   1191 C  CG1   . ILE A 1 150 ? 73.433 -9.449  5.398   1.00 8.93   ? 147 ILE A CG1   1 
ATOM   1192 C  CG2   . ILE A 1 150 ? 72.336 -11.680 5.627   1.00 8.51   ? 147 ILE A CG2   1 
ATOM   1193 C  CD1   . ILE A 1 150 ? 72.896 -9.265  3.943   1.00 8.31   ? 147 ILE A CD1   1 
ATOM   1194 N  N     . GLU A 1 151 ? 69.194 -10.775 7.295   1.00 9.20   ? 148 GLU A N     1 
ATOM   1195 C  CA    . GLU A 1 151 ? 68.368 -11.454 8.285   1.00 11.82  ? 148 GLU A CA    1 
ATOM   1196 C  C     . GLU A 1 151 ? 69.027 -12.766 8.747   1.00 14.36  ? 148 GLU A C     1 
ATOM   1197 O  O     . GLU A 1 151 ? 69.478 -13.570 7.925   1.00 11.06  ? 148 GLU A O     1 
ATOM   1198 C  CB    . GLU A 1 151 ? 66.970 -11.721 7.720   1.00 12.38  ? 148 GLU A CB    1 
ATOM   1199 C  CG    . GLU A 1 151 ? 66.039 -12.501 8.678   1.00 11.46  ? 148 GLU A CG    1 
ATOM   1200 C  CD    . GLU A 1 151 ? 65.858 -11.819 10.016  1.00 17.34  ? 148 GLU A CD    1 
ATOM   1201 O  OE1   . GLU A 1 151 ? 65.614 -12.526 11.018  1.00 14.48  ? 148 GLU A OE1   1 
ATOM   1202 O  OE2   . GLU A 1 151 ? 65.948 -10.572 10.059  1.00 17.40  ? 148 GLU A OE2   1 
ATOM   1203 N  N     . GLY A 1 152 ? 69.080 -12.969 10.062  1.00 11.25  ? 149 GLY A N     1 
ATOM   1204 C  CA    . GLY A 1 152 ? 69.678 -14.166 10.621  1.00 11.01  ? 149 GLY A CA    1 
ATOM   1205 C  C     . GLY A 1 152 ? 71.109 -13.966 11.092  1.00 16.34  ? 149 GLY A C     1 
ATOM   1206 O  O     . GLY A 1 152 ? 71.639 -14.791 11.828  1.00 15.63  ? 149 GLY A O     1 
ATOM   1207 N  N     . LEU A 1 153 ? 71.737 -12.875 10.664  1.00 12.90  ? 150 LEU A N     1 
ATOM   1208 C  CA    . LEU A 1 153 ? 73.116 -12.579 11.057  1.00 12.38  ? 150 LEU A CA    1 
ATOM   1209 C  C     . LEU A 1 153 ? 73.210 -11.279 11.872  1.00 14.61  ? 150 LEU A C     1 
ATOM   1210 O  O     . LEU A 1 153 ? 72.365 -10.410 11.747  1.00 13.59  ? 150 LEU A O     1 
ATOM   1211 C  CB    . LEU A 1 153 ? 74.014 -12.509 9.821   1.00 8.50   ? 150 LEU A CB    1 
ATOM   1212 C  CG    . LEU A 1 153 ? 74.120 -13.776 8.965   1.00 11.60  ? 150 LEU A CG    1 
ATOM   1213 C  CD1   . LEU A 1 153 ? 75.050 -13.571 7.759   1.00 8.33   ? 150 LEU A CD1   1 
ATOM   1214 C  CD2   . LEU A 1 153 ? 74.568 -14.966 9.803   1.00 18.81  ? 150 LEU A CD2   1 
ATOM   1215 N  N     . PRO A 1 154 ? 74.240 -11.149 12.727  1.00 21.46  ? 151 PRO A N     1 
ATOM   1216 C  CA    . PRO A 1 154 ? 75.331 -12.108 12.936  1.00 19.57  ? 151 PRO A CA    1 
ATOM   1217 C  C     . PRO A 1 154 ? 74.899 -13.288 13.802  1.00 15.85  ? 151 PRO A C     1 
ATOM   1218 O  O     . PRO A 1 154 ? 73.902 -13.209 14.522  1.00 17.71  ? 151 PRO A O     1 
ATOM   1219 C  CB    . PRO A 1 154 ? 76.375 -11.275 13.683  1.00 22.09  ? 151 PRO A CB    1 
ATOM   1220 C  CG    . PRO A 1 154 ? 75.550 -10.321 14.491  1.00 22.81  ? 151 PRO A CG    1 
ATOM   1221 C  CD    . PRO A 1 154 ? 74.350 -9.988  13.626  1.00 16.56  ? 151 PRO A CD    1 
ATOM   1222 N  N     . GLN A 1 155 ? 75.648 -14.379 13.716  1.00 21.77  ? 152 GLN A N     1 
ATOM   1223 C  CA    . GLN A 1 155 ? 75.392 -15.568 14.515  1.00 31.79  ? 152 GLN A CA    1 
ATOM   1224 C  C     . GLN A 1 155 ? 76.730 -16.055 15.070  1.00 40.15  ? 152 GLN A C     1 
ATOM   1225 O  O     . GLN A 1 155 ? 77.785 -15.714 14.531  1.00 37.90  ? 152 GLN A O     1 
ATOM   1226 C  CB    . GLN A 1 155 ? 74.754 -16.652 13.657  1.00 25.49  ? 152 GLN A CB    1 
ATOM   1227 C  CG    . GLN A 1 155 ? 75.469 -17.986 13.775  1.00 39.58  ? 152 GLN A CG    1 
ATOM   1228 C  CD    . GLN A 1 155 ? 75.112 -18.940 12.667  1.00 31.95  ? 152 GLN A CD    1 
ATOM   1229 O  OE1   . GLN A 1 155 ? 73.937 -19.271 12.469  1.00 38.46  ? 152 GLN A OE1   1 
ATOM   1230 N  NE2   . GLN A 1 155 ? 76.120 -19.383 11.920  1.00 25.54  ? 152 GLN A NE2   1 
ATOM   1231 N  N     . GLY A 1 156 ? 76.691 -16.836 16.148  1.00 47.84  ? 153 GLY A N     1 
ATOM   1232 C  CA    . GLY A 1 156 ? 77.905 -17.348 16.768  1.00 54.51  ? 153 GLY A CA    1 
ATOM   1233 C  C     . GLY A 1 156 ? 78.659 -16.291 17.562  1.00 69.23  ? 153 GLY A C     1 
ATOM   1234 O  O     . GLY A 1 156 ? 78.043 -15.433 18.202  1.00 73.45  ? 153 GLY A O     1 
ATOM   1235 N  N     . PRO A 1 157 ? 80.004 -16.350 17.531  1.00 81.58  ? 154 PRO A N     1 
ATOM   1236 C  CA    . PRO A 1 157 ? 80.856 -15.364 18.212  1.00 80.57  ? 154 PRO A CA    1 
ATOM   1237 C  C     . PRO A 1 157 ? 80.993 -14.067 17.411  1.00 70.22  ? 154 PRO A C     1 
ATOM   1238 O  O     . PRO A 1 157 ? 81.518 -13.078 17.929  1.00 60.51  ? 154 PRO A O     1 
ATOM   1239 C  CB    . PRO A 1 157 ? 82.206 -16.078 18.287  1.00 58.01  ? 154 PRO A CB    1 
ATOM   1240 C  CG    . PRO A 1 157 ? 82.216 -16.946 17.073  1.00 58.70  ? 154 PRO A CG    1 
ATOM   1241 C  CD    . PRO A 1 157 ? 80.798 -17.423 16.903  1.00 65.08  ? 154 PRO A CD    1 
ATOM   1242 N  N     . THR A 1 163 ? 78.991 -4.859  19.222  1.00 67.12  ? 160 THR A N     1 
ATOM   1243 C  CA    . THR A 1 163 ? 77.659 -5.435  19.065  1.00 65.59  ? 160 THR A CA    1 
ATOM   1244 C  C     . THR A 1 163 ? 76.725 -5.036  20.211  1.00 66.46  ? 160 THR A C     1 
ATOM   1245 O  O     . THR A 1 163 ? 75.719 -5.699  20.478  1.00 67.71  ? 160 THR A O     1 
ATOM   1246 C  CB    . THR A 1 163 ? 77.707 -6.976  18.924  1.00 71.90  ? 160 THR A CB    1 
ATOM   1247 O  OG1   . THR A 1 163 ? 78.659 -7.520  19.850  1.00 64.75  ? 160 THR A OG1   1 
ATOM   1248 C  CG2   . THR A 1 163 ? 78.095 -7.373  17.498  1.00 56.02  ? 160 THR A CG2   1 
ATOM   1249 N  N     . VAL A 1 164 ? 77.063 -3.941  20.882  1.00 61.09  ? 161 VAL A N     1 
ATOM   1250 C  CA    . VAL A 1 164 ? 76.191 -3.386  21.905  1.00 57.81  ? 161 VAL A CA    1 
ATOM   1251 C  C     . VAL A 1 164 ? 75.163 -2.442  21.274  1.00 60.48  ? 161 VAL A C     1 
ATOM   1252 O  O     . VAL A 1 164 ? 74.057 -2.275  21.798  1.00 57.82  ? 161 VAL A O     1 
ATOM   1253 C  CB    . VAL A 1 164 ? 77.004 -2.669  23.011  1.00 66.59  ? 161 VAL A CB    1 
ATOM   1254 C  CG1   . VAL A 1 164 ? 76.141 -1.663  23.764  1.00 52.41  ? 161 VAL A CG1   1 
ATOM   1255 C  CG2   . VAL A 1 164 ? 77.612 -3.692  23.969  1.00 54.21  ? 161 VAL A CG2   1 
ATOM   1256 N  N     . GLN A 1 165 ? 75.523 -1.853  20.132  1.00 46.63  ? 162 GLN A N     1 
ATOM   1257 C  CA    . GLN A 1 165 ? 74.669 -0.872  19.459  1.00 43.96  ? 162 GLN A CA    1 
ATOM   1258 C  C     . GLN A 1 165 ? 74.214 -1.340  18.072  1.00 39.67  ? 162 GLN A C     1 
ATOM   1259 O  O     . GLN A 1 165 ? 74.879 -2.170  17.447  1.00 31.59  ? 162 GLN A O     1 
ATOM   1260 C  CB    . GLN A 1 165 ? 75.387 0.471   19.385  1.00 50.60  ? 162 GLN A CB    1 
ATOM   1261 C  CG    . GLN A 1 165 ? 75.775 0.994   20.763  1.00 63.94  ? 162 GLN A CG    1 
ATOM   1262 C  CD    . GLN A 1 165 ? 76.839 2.072   20.718  1.00 72.13  ? 162 GLN A CD    1 
ATOM   1263 O  OE1   . GLN A 1 165 ? 77.829 2.009   21.447  1.00 64.97  ? 162 GLN A OE1   1 
ATOM   1264 N  NE2   . GLN A 1 165 ? 76.635 3.074   19.868  1.00 72.47  ? 162 GLN A NE2   1 
ATOM   1265 N  N     . LYS A 1 166 ? 73.084 -0.816  17.594  1.00 29.80  ? 163 LYS A N     1 
ATOM   1266 C  CA    . LYS A 1 166 ? 72.437 -1.403  16.418  1.00 33.73  ? 163 LYS A CA    1 
ATOM   1267 C  C     . LYS A 1 166 ? 73.260 -1.366  15.129  1.00 24.09  ? 163 LYS A C     1 
ATOM   1268 O  O     . LYS A 1 166 ? 73.279 -2.344  14.382  1.00 24.31  ? 163 LYS A O     1 
ATOM   1269 C  CB    . LYS A 1 166 ? 71.019 -0.859  16.163  1.00 32.55  ? 163 LYS A CB    1 
ATOM   1270 C  CG    . LYS A 1 166 ? 70.169 -1.895  15.418  1.00 41.73  ? 163 LYS A CG    1 
ATOM   1271 C  CD    . LYS A 1 166 ? 68.839 -1.384  14.865  1.00 44.99  ? 163 LYS A CD    1 
ATOM   1272 C  CE    . LYS A 1 166 ? 68.055 -2.556  14.253  1.00 35.11  ? 163 LYS A CE    1 
ATOM   1273 N  NZ    . LYS A 1 166 ? 66.938 -2.152  13.323  1.00 39.79  ? 163 LYS A NZ    1 
ATOM   1274 N  N     . GLU A 1 167 ? 73.914 -0.244  14.848  1.00 24.12  ? 164 GLU A N     1 
ATOM   1275 C  CA    . GLU A 1 167 ? 74.722 -0.162  13.639  1.00 24.80  ? 164 GLU A CA    1 
ATOM   1276 C  C     . GLU A 1 167 ? 75.856 -1.182  13.692  1.00 22.84  ? 164 GLU A C     1 
ATOM   1277 O  O     . GLU A 1 167 ? 76.273 -1.716  12.669  1.00 24.69  ? 164 GLU A O     1 
ATOM   1278 C  CB    . GLU A 1 167 ? 75.270 1.256   13.429  1.00 29.86  ? 164 GLU A CB    1 
ATOM   1279 C  CG    . GLU A 1 167 ? 76.197 1.420   12.204  1.00 24.69  ? 164 GLU A CG    1 
ATOM   1280 C  CD    . GLU A 1 167 ? 75.519 1.135   10.854  1.00 31.73  ? 164 GLU A CD    1 
ATOM   1281 O  OE1   . GLU A 1 167 ? 76.238 1.117   9.825   1.00 34.10  ? 164 GLU A OE1   1 
ATOM   1282 O  OE2   . GLU A 1 167 ? 74.283 0.941   10.812  1.00 29.00  ? 164 GLU A OE2   1 
ATOM   1283 N  N     . GLY A 1 168 ? 76.361 -1.440  14.891  1.00 25.77  ? 165 GLY A N     1 
ATOM   1284 C  CA    . GLY A 1 168 ? 77.454 -2.375  15.055  1.00 26.95  ? 165 GLY A CA    1 
ATOM   1285 C  C     . GLY A 1 168 ? 77.020 -3.788  14.736  1.00 21.83  ? 165 GLY A C     1 
ATOM   1286 O  O     . GLY A 1 168 ? 77.721 -4.516  14.041  1.00 21.98  ? 165 GLY A O     1 
ATOM   1287 N  N     . MET A 1 169 ? 75.864 -4.176  15.268  1.00 23.29  ? 166 MET A N     1 
ATOM   1288 C  CA    . MET A 1 169 ? 75.243 -5.449  14.926  1.00 22.63  ? 166 MET A CA    1 
ATOM   1289 C  C     . MET A 1 169 ? 75.028 -5.542  13.414  1.00 17.26  ? 166 MET A C     1 
ATOM   1290 O  O     . MET A 1 169 ? 75.443 -6.513  12.779  1.00 19.29  ? 166 MET A O     1 
ATOM   1291 C  CB    . MET A 1 169 ? 73.906 -5.607  15.660  1.00 27.61  ? 166 MET A CB    1 
ATOM   1292 C  CG    . MET A 1 169 ? 74.030 -5.923  17.148  1.00 51.56  ? 166 MET A CG    1 
ATOM   1293 S  SD    . MET A 1 169 ? 74.384 -7.666  17.487  1.00 64.88  ? 166 MET A SD    1 
ATOM   1294 C  CE    . MET A 1 169 ? 72.969 -8.459  16.711  1.00 40.61  ? 166 MET A CE    1 
ATOM   1295 N  N     . ARG A 1 170 ? 74.401 -4.523  12.831  1.00 17.91  ? 167 ARG A N     1 
ATOM   1296 C  CA    . ARG A 1 170 ? 74.169 -4.536  11.384  1.00 18.56  ? 167 ARG A CA    1 
ATOM   1297 C  C     . ARG A 1 170 ? 75.446 -4.885  10.627  1.00 18.55  ? 167 ARG A C     1 
ATOM   1298 O  O     . ARG A 1 170 ? 75.447 -5.764  9.765   1.00 16.30  ? 167 ARG A O     1 
ATOM   1299 C  CB    . ARG A 1 170 ? 73.630 -3.190  10.885  1.00 16.64  ? 167 ARG A CB    1 
ATOM   1300 C  CG    . ARG A 1 170 ? 73.183 -3.208  9.413   1.00 14.30  ? 167 ARG A CG    1 
ATOM   1301 C  CD    . ARG A 1 170 ? 73.040 -1.795  8.830   1.00 17.43  ? 167 ARG A CD    1 
ATOM   1302 N  NE    . ARG A 1 170 ? 74.336 -1.154  8.613   1.00 18.57  ? 167 ARG A NE    1 
ATOM   1303 C  CZ    . ARG A 1 170 ? 75.127 -1.385  7.568   1.00 19.38  ? 167 ARG A CZ    1 
ATOM   1304 N  NH1   . ARG A 1 170 ? 74.779 -2.263  6.637   1.00 13.93  ? 167 ARG A NH1   1 
ATOM   1305 N  NH2   . ARG A 1 170 ? 76.277 -0.737  7.451   1.00 20.13  ? 167 ARG A NH2   1 
ATOM   1306 N  N     . LYS A 1 171 ? 76.534 -4.187  10.947  1.00 16.20  ? 168 LYS A N     1 
ATOM   1307 C  CA    . LYS A 1 171 ? 77.796 -4.387  10.244  1.00 16.23  ? 168 LYS A CA    1 
ATOM   1308 C  C     . LYS A 1 171 ? 78.439 -5.760  10.477  1.00 14.54  ? 168 LYS A C     1 
ATOM   1309 O  O     . LYS A 1 171 ? 79.004 -6.353  9.550   1.00 14.10  ? 168 LYS A O     1 
ATOM   1310 C  CB    . LYS A 1 171 ? 78.793 -3.277  10.586  1.00 28.69  ? 168 LYS A CB    1 
ATOM   1311 C  CG    . LYS A 1 171 ? 78.584 -1.999  9.782   1.00 28.95  ? 168 LYS A CG    1 
ATOM   1312 C  CD    . LYS A 1 171 ? 79.698 -0.996  10.076  1.00 39.17  ? 168 LYS A CD    1 
ATOM   1313 C  CE    . LYS A 1 171 ? 79.920 -0.051  8.905   1.00 45.86  ? 168 LYS A CE    1 
ATOM   1314 N  NZ    . LYS A 1 171 ? 80.972 0.960   9.201   1.00 60.38  ? 168 LYS A NZ    1 
ATOM   1315 N  N     . GLN A 1 172 ? 78.363 -6.254  11.707  1.00 19.93  ? 169 GLN A N     1 
ATOM   1316 C  CA    . GLN A 1 172 ? 78.895 -7.577  12.019  1.00 20.36  ? 169 GLN A CA    1 
ATOM   1317 C  C     . GLN A 1 172 ? 78.164 -8.600  11.161  1.00 21.42  ? 169 GLN A C     1 
ATOM   1318 O  O     . GLN A 1 172 ? 78.780 -9.496  10.569  1.00 15.01  ? 169 GLN A O     1 
ATOM   1319 C  CB    . GLN A 1 172 ? 78.713 -7.910  13.502  1.00 19.95  ? 169 GLN A CB    1 
ATOM   1320 C  CG    . GLN A 1 172 ? 79.625 -7.146  14.444  1.00 36.19  ? 169 GLN A CG    1 
ATOM   1321 C  CD    . GLN A 1 172 ? 81.071 -7.614  14.374  1.00 62.70  ? 169 GLN A CD    1 
ATOM   1322 O  OE1   . GLN A 1 172 ? 81.388 -8.595  13.698  1.00 67.98  ? 169 GLN A OE1   1 
ATOM   1323 N  NE2   . GLN A 1 172 ? 81.957 -6.909  15.075  1.00 66.17  ? 169 GLN A NE2   1 
ATOM   1324 N  N     . GLY A 1 173 ? 76.840 -8.460  11.090  1.00 16.60  ? 170 GLY A N     1 
ATOM   1325 C  CA    . GLY A 1 173 ? 76.035 -9.366  10.287  1.00 12.95  ? 170 GLY A CA    1 
ATOM   1326 C  C     . GLY A 1 173 ? 76.409 -9.313  8.820   1.00 10.49  ? 170 GLY A C     1 
ATOM   1327 O  O     . GLY A 1 173 ? 76.577 -10.346 8.169   1.00 11.45  ? 170 GLY A O     1 
ATOM   1328 N  N     . LEU A 1 174 ? 76.526 -8.096  8.291   1.00 13.79  ? 171 LEU A N     1 
ATOM   1329 C  CA    . LEU A 1 174 ? 76.897 -7.888  6.892   1.00 12.47  ? 171 LEU A CA    1 
ATOM   1330 C  C     . LEU A 1 174 ? 78.288 -8.464  6.578   1.00 16.00  ? 171 LEU A C     1 
ATOM   1331 O  O     . LEU A 1 174 ? 78.489 -9.085  5.537   1.00 13.93  ? 171 LEU A O     1 
ATOM   1332 C  CB    . LEU A 1 174 ? 76.846 -6.395  6.548   1.00 9.64   ? 171 LEU A CB    1 
ATOM   1333 C  CG    . LEU A 1 174 ? 77.287 -5.985  5.146   1.00 11.32  ? 171 LEU A CG    1 
ATOM   1334 C  CD1   . LEU A 1 174 ? 76.382 -6.648  4.098   1.00 11.39  ? 171 LEU A CD1   1 
ATOM   1335 C  CD2   . LEU A 1 174 ? 77.294 -4.434  5.000   1.00 9.84   ? 171 LEU A CD2   1 
ATOM   1336 N  N     . PHE A 1 175 ? 79.248 -8.251  7.476   1.00 17.41  ? 172 PHE A N     1 
ATOM   1337 C  CA    . PHE A 1 175 ? 80.596 -8.780  7.269   1.00 18.74  ? 172 PHE A CA    1 
ATOM   1338 C  C     . PHE A 1 175 ? 80.605 -10.310 7.217   1.00 15.30  ? 172 PHE A C     1 
ATOM   1339 O  O     . PHE A 1 175 ? 81.240 -10.897 6.344   1.00 20.63  ? 172 PHE A O     1 
ATOM   1340 C  CB    . PHE A 1 175 ? 81.550 -8.279  8.347   1.00 18.51  ? 172 PHE A CB    1 
ATOM   1341 C  CG    . PHE A 1 175 ? 81.947 -6.839  8.177   1.00 35.46  ? 172 PHE A CG    1 
ATOM   1342 C  CD1   . PHE A 1 175 ? 82.104 -6.010  9.280   1.00 37.66  ? 172 PHE A CD1   1 
ATOM   1343 C  CD2   . PHE A 1 175 ? 82.165 -6.312  6.910   1.00 33.48  ? 172 PHE A CD2   1 
ATOM   1344 C  CE1   . PHE A 1 175 ? 82.474 -4.680  9.121   1.00 44.68  ? 172 PHE A CE1   1 
ATOM   1345 C  CE2   . PHE A 1 175 ? 82.533 -4.992  6.747   1.00 35.29  ? 172 PHE A CE2   1 
ATOM   1346 C  CZ    . PHE A 1 175 ? 82.685 -4.171  7.851   1.00 39.35  ? 172 PHE A CZ    1 
ATOM   1347 N  N     . GLN A 1 176 ? 79.914 -10.954 8.155   1.00 15.97  ? 173 GLN A N     1 
ATOM   1348 C  CA    . GLN A 1 176 ? 79.802 -12.414 8.123   1.00 20.66  ? 173 GLN A CA    1 
ATOM   1349 C  C     . GLN A 1 176 ? 79.260 -12.882 6.779   1.00 16.83  ? 173 GLN A C     1 
ATOM   1350 O  O     . GLN A 1 176 ? 79.777 -13.830 6.191   1.00 16.49  ? 173 GLN A O     1 
ATOM   1351 C  CB    . GLN A 1 176 ? 78.927 -12.946 9.267   1.00 18.62  ? 173 GLN A CB    1 
ATOM   1352 C  CG    . GLN A 1 176 ? 79.553 -12.803 10.648  1.00 20.10  ? 173 GLN A CG    1 
ATOM   1353 C  CD    . GLN A 1 176 ? 78.740 -13.481 11.729  1.00 25.71  ? 173 GLN A CD    1 
ATOM   1354 O  OE1   . GLN A 1 176 ? 77.606 -13.897 11.499  1.00 25.60  ? 173 GLN A OE1   1 
ATOM   1355 N  NE2   . GLN A 1 176 ? 79.317 -13.595 12.924  1.00 28.83  ? 173 GLN A NE2   1 
ATOM   1356 N  N     . TRP A 1 177 ? 78.226 -12.203 6.290   1.00 12.78  ? 174 TRP A N     1 
ATOM   1357 C  CA    . TRP A 1 177 ? 77.588 -12.563 5.025   1.00 14.11  ? 174 TRP A CA    1 
ATOM   1358 C  C     . TRP A 1 177 ? 78.566 -12.427 3.861   1.00 15.24  ? 174 TRP A C     1 
ATOM   1359 O  O     . TRP A 1 177 ? 78.760 -13.365 3.077   1.00 16.30  ? 174 TRP A O     1 
ATOM   1360 C  CB    . TRP A 1 177 ? 76.342 -11.690 4.795   1.00 9.56   ? 174 TRP A CB    1 
ATOM   1361 C  CG    . TRP A 1 177 ? 75.682 -11.853 3.443   1.00 12.76  ? 174 TRP A CG    1 
ATOM   1362 C  CD1   . TRP A 1 177 ? 75.792 -11.011 2.376   1.00 12.46  ? 174 TRP A CD1   1 
ATOM   1363 C  CD2   . TRP A 1 177 ? 74.791 -12.901 3.033   1.00 13.24  ? 174 TRP A CD2   1 
ATOM   1364 N  NE1   . TRP A 1 177 ? 75.041 -11.469 1.330   1.00 13.21  ? 174 TRP A NE1   1 
ATOM   1365 C  CE2   . TRP A 1 177 ? 74.415 -12.630 1.702   1.00 15.71  ? 174 TRP A CE2   1 
ATOM   1366 C  CE3   . TRP A 1 177 ? 74.290 -14.050 3.657   1.00 13.05  ? 174 TRP A CE3   1 
ATOM   1367 C  CZ2   . TRP A 1 177 ? 73.559 -13.456 0.980   1.00 10.78  ? 174 TRP A CZ2   1 
ATOM   1368 C  CZ3   . TRP A 1 177 ? 73.431 -14.873 2.945   1.00 13.88  ? 174 TRP A CZ3   1 
ATOM   1369 C  CH2   . TRP A 1 177 ? 73.069 -14.571 1.616   1.00 11.15  ? 174 TRP A CH2   1 
ATOM   1370 N  N     . LEU A 1 178 ? 79.201 -11.267 3.764   1.00 11.72  ? 175 LEU A N     1 
ATOM   1371 C  CA    . LEU A 1 178 ? 80.107 -10.998 2.646   1.00 14.33  ? 175 LEU A CA    1 
ATOM   1372 C  C     . LEU A 1 178 ? 81.356 -11.879 2.683   1.00 26.34  ? 175 LEU A C     1 
ATOM   1373 O  O     . LEU A 1 178 ? 81.891 -12.252 1.638   1.00 23.07  ? 175 LEU A O     1 
ATOM   1374 C  CB    . LEU A 1 178 ? 80.522 -9.526  2.625   1.00 16.91  ? 175 LEU A CB    1 
ATOM   1375 C  CG    . LEU A 1 178 ? 79.380 -8.555  2.322   1.00 17.61  ? 175 LEU A CG    1 
ATOM   1376 C  CD1   . LEU A 1 178 ? 79.877 -7.113  2.372   1.00 20.21  ? 175 LEU A CD1   1 
ATOM   1377 C  CD2   . LEU A 1 178 ? 78.762 -8.874  0.957   1.00 14.90  ? 175 LEU A CD2   1 
ATOM   1378 N  N     . ASP A 1 179 ? 81.828 -12.184 3.886   1.00 18.05  ? 176 ASP A N     1 
ATOM   1379 C  CA    . ASP A 1 179 ? 83.031 -13.006 4.044   1.00 31.00  ? 176 ASP A CA    1 
ATOM   1380 C  C     . ASP A 1 179 ? 82.752 -14.443 3.615   1.00 31.77  ? 176 ASP A C     1 
ATOM   1381 O  O     . ASP A 1 179 ? 83.663 -15.183 3.236   1.00 33.49  ? 176 ASP A O     1 
ATOM   1382 C  CB    . ASP A 1 179 ? 83.554 -12.957 5.488   1.00 27.25  ? 176 ASP A CB    1 
ATOM   1383 C  CG    . ASP A 1 179 ? 84.284 -11.657 5.799   1.00 41.30  ? 176 ASP A CG    1 
ATOM   1384 O  OD1   . ASP A 1 179 ? 84.904 -11.087 4.875   1.00 48.57  ? 176 ASP A OD1   1 
ATOM   1385 O  OD2   . ASP A 1 179 ? 84.237 -11.199 6.963   1.00 47.07  ? 176 ASP A OD2   1 
ATOM   1386 N  N     . SER A 1 180 ? 81.481 -14.824 3.667   1.00 21.71  ? 177 SER A N     1 
ATOM   1387 C  CA    . SER A 1 180 ? 81.065 -16.160 3.264   1.00 27.76  ? 177 SER A CA    1 
ATOM   1388 C  C     . SER A 1 180 ? 80.724 -16.268 1.782   1.00 29.92  ? 177 SER A C     1 
ATOM   1389 O  O     . SER A 1 180 ? 80.563 -17.377 1.265   1.00 34.84  ? 177 SER A O     1 
ATOM   1390 C  CB    . SER A 1 180 ? 79.858 -16.614 4.092   1.00 21.31  ? 177 SER A CB    1 
ATOM   1391 O  OG    . SER A 1 180 ? 80.209 -16.731 5.462   1.00 33.87  ? 177 SER A OG    1 
ATOM   1392 N  N     . LEU A 1 181 ? 80.588 -15.132 1.104   1.00 20.57  ? 178 LEU A N     1 
ATOM   1393 C  CA    . LEU A 1 181 ? 80.096 -15.135 -0.276  1.00 27.42  ? 178 LEU A CA    1 
ATOM   1394 C  C     . LEU A 1 181 ? 81.049 -15.781 -1.278  1.00 35.97  ? 178 LEU A C     1 
ATOM   1395 O  O     . LEU A 1 181 ? 82.265 -15.618 -1.182  1.00 37.99  ? 178 LEU A O     1 
ATOM   1396 C  CB    . LEU A 1 181 ? 79.786 -13.713 -0.748  1.00 36.02  ? 178 LEU A CB    1 
ATOM   1397 C  CG    . LEU A 1 181 ? 78.373 -13.146 -0.641  1.00 29.10  ? 178 LEU A CG    1 
ATOM   1398 C  CD1   . LEU A 1 181 ? 78.290 -11.874 -1.484  1.00 16.69  ? 178 LEU A CD1   1 
ATOM   1399 C  CD2   . LEU A 1 181 ? 77.311 -14.151 -1.089  1.00 21.04  ? 178 LEU A CD2   1 
ATOM   1400 N  N     . GLN A 1 182 ? 80.481 -16.497 -2.249  1.00 43.39  ? 179 GLN A N     1 
ATOM   1401 C  CA    . GLN A 1 182 ? 81.253 -17.054 -3.359  1.00 53.81  ? 179 GLN A CA    1 
ATOM   1402 C  C     . GLN A 1 182 ? 80.991 -16.288 -4.656  1.00 54.02  ? 179 GLN A C     1 
ATOM   1403 O  O     . GLN A 1 182 ? 80.109 -16.658 -5.436  1.00 59.95  ? 179 GLN A O     1 
ATOM   1404 C  CB    . GLN A 1 182 ? 80.932 -18.539 -3.557  1.00 57.17  ? 179 GLN A CB    1 
ATOM   1405 C  CG    . GLN A 1 182 ? 81.800 -19.237 -4.605  1.00 61.53  ? 179 GLN A CG    1 
ATOM   1406 C  CD    . GLN A 1 182 ? 83.279 -19.237 -4.243  1.00 68.69  ? 179 GLN A CD    1 
ATOM   1407 O  OE1   . GLN A 1 182 ? 84.058 -18.427 -4.755  1.00 59.66  ? 179 GLN A OE1   1 
ATOM   1408 N  NE2   . GLN A 1 182 ? 83.674 -20.152 -3.356  1.00 60.70  ? 179 GLN A NE2   1 
ATOM   1409 N  N     . ILE A 1 183 ? 81.772 -15.231 -4.882  1.00 53.37  ? 180 ILE A N     1 
ATOM   1410 C  CA    . ILE A 1 183 ? 81.601 -14.354 -6.044  1.00 58.33  ? 180 ILE A CA    1 
ATOM   1411 C  C     . ILE A 1 183 ? 82.120 -14.971 -7.350  1.00 58.74  ? 180 ILE A C     1 
ATOM   1412 O  O     . ILE A 1 183 ? 81.905 -14.426 -8.436  1.00 55.04  ? 180 ILE A O     1 
ATOM   1413 C  CB    . ILE A 1 183 ? 82.253 -12.964 -5.811  1.00 51.92  ? 180 ILE A CB    1 
ATOM   1414 C  CG1   . ILE A 1 183 ? 83.728 -13.108 -5.421  1.00 56.05  ? 180 ILE A CG1   1 
ATOM   1415 C  CG2   . ILE A 1 183 ? 81.506 -12.198 -4.726  1.00 49.45  ? 180 ILE A CG2   1 
ATOM   1416 C  CD1   . ILE A 1 183 ? 84.662 -13.360 -6.585  1.00 59.27  ? 180 ILE A CD1   1 
ATOM   1417 N  N     . ASP A 1 184 ? 82.800 -16.108 -7.232  1.00 68.77  ? 181 ASP A N     1 
ATOM   1418 C  CA    . ASP A 1 184 ? 83.337 -16.826 -8.384  1.00 66.82  ? 181 ASP A CA    1 
ATOM   1419 C  C     . ASP A 1 184 ? 82.211 -17.492 -9.174  1.00 65.98  ? 181 ASP A C     1 
ATOM   1420 O  O     . ASP A 1 184 ? 82.411 -17.963 -10.293 1.00 65.51  ? 181 ASP A O     1 
ATOM   1421 C  CB    . ASP A 1 184 ? 84.337 -17.885 -7.909  1.00 73.36  ? 181 ASP A CB    1 
ATOM   1422 C  CG    . ASP A 1 184 ? 85.317 -18.304 -8.994  1.00 95.05  ? 181 ASP A CG    1 
ATOM   1423 O  OD1   . ASP A 1 184 ? 85.011 -18.113 -10.192 1.00 99.56  ? 181 ASP A OD1   1 
ATOM   1424 O  OD2   . ASP A 1 184 ? 86.397 -18.831 -8.645  1.00 92.55  ? 181 ASP A OD2   1 
ATOM   1425 N  N     . ASN A 1 185 ? 81.020 -17.514 -8.586  1.00 61.24  ? 182 ASN A N     1 
ATOM   1426 C  CA    . ASN A 1 185 ? 79.887 -18.223 -9.169  1.00 60.58  ? 182 ASN A CA    1 
ATOM   1427 C  C     . ASN A 1 185 ? 78.726 -17.301 -9.566  1.00 55.21  ? 182 ASN A C     1 
ATOM   1428 O  O     . ASN A 1 185 ? 77.952 -16.859 -8.713  1.00 49.26  ? 182 ASN A O     1 
ATOM   1429 C  CB    . ASN A 1 185 ? 79.408 -19.300 -8.194  1.00 58.14  ? 182 ASN A CB    1 
ATOM   1430 C  CG    . ASN A 1 185 ? 78.366 -20.215 -8.799  1.00 54.10  ? 182 ASN A CG    1 
ATOM   1431 O  OD1   . ASN A 1 185 ? 78.091 -20.161 -10.001 1.00 55.57  ? 182 ASN A OD1   1 
ATOM   1432 N  ND2   . ASN A 1 185 ? 77.780 -21.069 -7.967  1.00 54.99  ? 182 ASN A ND2   1 
ATOM   1433 N  N     . LEU A 1 186 ? 78.603 -17.034 -10.866 1.00 51.82  ? 183 LEU A N     1 
ATOM   1434 C  CA    . LEU A 1 186 ? 77.565 -16.139 -11.390 1.00 47.18  ? 183 LEU A CA    1 
ATOM   1435 C  C     . LEU A 1 186 ? 76.126 -16.622 -11.154 1.00 43.58  ? 183 LEU A C     1 
ATOM   1436 O  O     . LEU A 1 186 ? 75.174 -15.863 -11.347 1.00 42.68  ? 183 LEU A O     1 
ATOM   1437 C  CB    . LEU A 1 186 ? 77.776 -15.874 -12.887 1.00 44.32  ? 183 LEU A CB    1 
ATOM   1438 C  CG    . LEU A 1 186 ? 78.868 -14.883 -13.305 1.00 58.88  ? 183 LEU A CG    1 
ATOM   1439 C  CD1   . LEU A 1 186 ? 80.190 -15.598 -13.539 1.00 65.85  ? 183 LEU A CD1   1 
ATOM   1440 C  CD2   . LEU A 1 186 ? 78.450 -14.117 -14.554 1.00 51.46  ? 183 LEU A CD2   1 
ATOM   1441 N  N     . THR A 1 187 ? 75.964 -17.879 -10.750 1.00 46.39  ? 184 THR A N     1 
ATOM   1442 C  CA    . THR A 1 187 ? 74.625 -18.430 -10.530 1.00 39.06  ? 184 THR A CA    1 
ATOM   1443 C  C     . THR A 1 187 ? 74.314 -18.778 -9.067  1.00 31.62  ? 184 THR A C     1 
ATOM   1444 O  O     . THR A 1 187 ? 73.303 -19.423 -8.792  1.00 33.99  ? 184 THR A O     1 
ATOM   1445 C  CB    . THR A 1 187 ? 74.353 -19.682 -11.415 1.00 48.67  ? 184 THR A CB    1 
ATOM   1446 O  OG1   . THR A 1 187 ? 75.211 -20.761 -11.015 1.00 42.21  ? 184 THR A OG1   1 
ATOM   1447 C  CG2   . THR A 1 187 ? 74.578 -19.367 -12.894 1.00 50.24  ? 184 THR A CG2   1 
ATOM   1448 N  N     . SER A 1 188 ? 75.173 -18.373 -8.134  1.00 31.47  ? 185 SER A N     1 
ATOM   1449 C  CA    . SER A 1 188 ? 74.828 -18.501 -6.715  1.00 24.56  ? 185 SER A CA    1 
ATOM   1450 C  C     . SER A 1 188 ? 73.668 -17.572 -6.407  1.00 14.91  ? 185 SER A C     1 
ATOM   1451 O  O     . SER A 1 188 ? 73.766 -16.354 -6.599  1.00 15.61  ? 185 SER A O     1 
ATOM   1452 C  CB    . SER A 1 188 ? 76.005 -18.154 -5.800  1.00 30.10  ? 185 SER A CB    1 
ATOM   1453 O  OG    . SER A 1 188 ? 75.606 -18.167 -4.428  1.00 26.47  ? 185 SER A OG    1 
ATOM   1454 N  N     . PRO A 1 189 ? 72.561 -18.140 -5.930  1.00 17.36  ? 186 PRO A N     1 
ATOM   1455 C  CA    . PRO A 1 189 ? 71.408 -17.308 -5.560  1.00 13.92  ? 186 PRO A CA    1 
ATOM   1456 C  C     . PRO A 1 189 ? 71.780 -16.316 -4.460  1.00 12.49  ? 186 PRO A C     1 
ATOM   1457 O  O     . PRO A 1 189 ? 71.273 -15.202 -4.482  1.00 8.50   ? 186 PRO A O     1 
ATOM   1458 C  CB    . PRO A 1 189 ? 70.381 -18.330 -5.060  1.00 14.19  ? 186 PRO A CB    1 
ATOM   1459 C  CG    . PRO A 1 189 ? 70.781 -19.629 -5.739  1.00 18.15  ? 186 PRO A CG    1 
ATOM   1460 C  CD    . PRO A 1 189 ? 72.283 -19.580 -5.813  1.00 17.89  ? 186 PRO A CD    1 
ATOM   1461 N  N     . ASP A 1 190 ? 72.654 -16.688 -3.524  1.00 9.34   ? 187 ASP A N     1 
ATOM   1462 C  CA    . ASP A 1 190 ? 73.024 -15.740 -2.472  1.00 8.40   ? 187 ASP A CA    1 
ATOM   1463 C  C     . ASP A 1 190 ? 73.749 -14.530 -3.049  1.00 8.83   ? 187 ASP A C     1 
ATOM   1464 O  O     . ASP A 1 190 ? 73.551 -13.397 -2.600  1.00 8.88   ? 187 ASP A O     1 
ATOM   1465 C  CB    . ASP A 1 190 ? 73.889 -16.395 -1.389  1.00 8.58   ? 187 ASP A CB    1 
ATOM   1466 C  CG    . ASP A 1 190 ? 73.107 -17.388 -0.544  1.00 16.36  ? 187 ASP A CG    1 
ATOM   1467 O  OD1   . ASP A 1 190 ? 71.858 -17.350 -0.576  1.00 12.77  ? 187 ASP A OD1   1 
ATOM   1468 O  OD2   . ASP A 1 190 ? 73.748 -18.205 0.147   1.00 19.17  ? 187 ASP A OD2   1 
ATOM   1469 N  N     . LEU A 1 191 ? 74.614 -14.780 -4.022  1.00 9.74   ? 188 LEU A N     1 
ATOM   1470 C  CA    . LEU A 1 191 ? 75.329 -13.703 -4.689  1.00 12.25  ? 188 LEU A CA    1 
ATOM   1471 C  C     . LEU A 1 191 ? 74.353 -12.812 -5.447  1.00 8.31   ? 188 LEU A C     1 
ATOM   1472 O  O     . LEU A 1 191 ? 74.447 -11.593 -5.391  1.00 10.34  ? 188 LEU A O     1 
ATOM   1473 C  CB    . LEU A 1 191 ? 76.378 -14.268 -5.651  1.00 13.29  ? 188 LEU A CB    1 
ATOM   1474 C  CG    . LEU A 1 191 ? 77.170 -13.255 -6.495  1.00 15.85  ? 188 LEU A CG    1 
ATOM   1475 C  CD1   . LEU A 1 191 ? 77.773 -12.146 -5.641  1.00 15.43  ? 188 LEU A CD1   1 
ATOM   1476 C  CD2   . LEU A 1 191 ? 78.257 -13.973 -7.282  1.00 20.01  ? 188 LEU A CD2   1 
ATOM   1477 N  N     . GLN A 1 192 ? 73.428 -13.431 -6.167  1.00 9.03   ? 189 GLN A N     1 
ATOM   1478 C  CA    . GLN A 1 192 ? 72.421 -12.689 -6.915  1.00 11.53  ? 189 GLN A CA    1 
ATOM   1479 C  C     . GLN A 1 192 ? 71.608 -11.787 -5.990  1.00 12.19  ? 189 GLN A C     1 
ATOM   1480 O  O     . GLN A 1 192 ? 71.407 -10.610 -6.291  1.00 11.51  ? 189 GLN A O     1 
ATOM   1481 C  CB    . GLN A 1 192 ? 71.515 -13.649 -7.679  1.00 11.43  ? 189 GLN A CB    1 
ATOM   1482 C  CG    . GLN A 1 192 ? 72.258 -14.399 -8.775  1.00 17.24  ? 189 GLN A CG    1 
ATOM   1483 C  CD    . GLN A 1 192 ? 71.381 -15.387 -9.516  1.00 29.98  ? 189 GLN A CD    1 
ATOM   1484 O  OE1   . GLN A 1 192 ? 70.591 -16.111 -8.912  1.00 29.42  ? 189 GLN A OE1   1 
ATOM   1485 N  NE2   . GLN A 1 192 ? 71.524 -15.426 -10.836 1.00 45.25  ? 189 GLN A NE2   1 
ATOM   1486 N  N     . LEU A 1 193 ? 71.148 -12.332 -4.860  1.00 12.84  ? 190 LEU A N     1 
ATOM   1487 C  CA    . LEU A 1 193 ? 70.454 -11.524 -3.856  1.00 5.60   ? 190 LEU A CA    1 
ATOM   1488 C  C     . LEU A 1 193 ? 71.326 -10.342 -3.418  1.00 9.34   ? 190 LEU A C     1 
ATOM   1489 O  O     . LEU A 1 193 ? 70.843 -9.228  -3.281  1.00 8.88   ? 190 LEU A O     1 
ATOM   1490 C  CB    . LEU A 1 193 ? 70.070 -12.353 -2.624  1.00 10.77  ? 190 LEU A CB    1 
ATOM   1491 C  CG    . LEU A 1 193 ? 68.951 -13.394 -2.735  1.00 9.69   ? 190 LEU A CG    1 
ATOM   1492 C  CD1   . LEU A 1 193 ? 68.625 -13.968 -1.352  1.00 9.40   ? 190 LEU A CD1   1 
ATOM   1493 C  CD2   . LEU A 1 193 ? 67.710 -12.776 -3.368  1.00 7.93   ? 190 LEU A CD2   1 
ATOM   1494 N  N     . THR A 1 194 ? 72.607 -10.598 -3.179  1.00 9.04   ? 191 THR A N     1 
ATOM   1495 C  CA    . THR A 1 194 ? 73.523 -9.558  -2.716  1.00 6.43   ? 191 THR A CA    1 
ATOM   1496 C  C     . THR A 1 194 ? 73.645 -8.433  -3.741  1.00 9.33   ? 191 THR A C     1 
ATOM   1497 O  O     . THR A 1 194 ? 73.616 -7.248  -3.386  1.00 11.92  ? 191 THR A O     1 
ATOM   1498 C  CB    . THR A 1 194 ? 74.920 -10.150 -2.429  1.00 9.67   ? 191 THR A CB    1 
ATOM   1499 O  OG1   . THR A 1 194 ? 74.790 -11.190 -1.451  1.00 13.15  ? 191 THR A OG1   1 
ATOM   1500 C  CG2   . THR A 1 194 ? 75.866 -9.072  -1.907  1.00 11.17  ? 191 THR A CG2   1 
ATOM   1501 N  N     . VAL A 1 195 ? 73.769 -8.809  -5.011  1.00 8.40   ? 192 VAL A N     1 
ATOM   1502 C  CA    . VAL A 1 195 ? 73.865 -7.817  -6.075  1.00 16.30  ? 192 VAL A CA    1 
ATOM   1503 C  C     . VAL A 1 195 ? 72.539 -7.070  -6.181  1.00 11.53  ? 192 VAL A C     1 
ATOM   1504 O  O     . VAL A 1 195 ? 72.514 -5.857  -6.401  1.00 10.64  ? 192 VAL A O     1 
ATOM   1505 C  CB    . VAL A 1 195 ? 74.261 -8.462  -7.423  1.00 12.93  ? 192 VAL A CB    1 
ATOM   1506 C  CG1   . VAL A 1 195 ? 74.097 -7.466  -8.578  1.00 13.15  ? 192 VAL A CG1   1 
ATOM   1507 C  CG2   . VAL A 1 195 ? 75.687 -8.976  -7.353  1.00 13.31  ? 192 VAL A CG2   1 
ATOM   1508 N  N     . GLY A 1 196 ? 71.441 -7.802  -6.010  1.00 13.09  ? 193 GLY A N     1 
ATOM   1509 C  CA    . GLY A 1 196 ? 70.123 -7.187  -5.902  1.00 10.21  ? 193 GLY A CA    1 
ATOM   1510 C  C     . GLY A 1 196 ? 70.098 -6.067  -4.870  1.00 10.63  ? 193 GLY A C     1 
ATOM   1511 O  O     . GLY A 1 196 ? 69.607 -4.965  -5.139  1.00 12.73  ? 193 GLY A O     1 
ATOM   1512 N  N     . ALA A 1 197 ? 70.618 -6.345  -3.678  1.00 7.81   ? 194 ALA A N     1 
ATOM   1513 C  CA    . ALA A 1 197 ? 70.650 -5.347  -2.619  1.00 6.91   ? 194 ALA A CA    1 
ATOM   1514 C  C     . ALA A 1 197 ? 71.508 -4.139  -2.987  1.00 11.33  ? 194 ALA A C     1 
ATOM   1515 O  O     . ALA A 1 197 ? 71.181 -3.012  -2.607  1.00 7.85   ? 194 ALA A O     1 
ATOM   1516 C  CB    . ALA A 1 197 ? 71.106 -5.963  -1.287  1.00 12.10  ? 194 ALA A CB    1 
ATOM   1517 N  N     . VAL A 1 198 ? 72.593 -4.361  -3.724  1.00 10.06  ? 195 VAL A N     1 
ATOM   1518 C  CA    . VAL A 1 198 ? 73.418 -3.230  -4.150  1.00 10.86  ? 195 VAL A CA    1 
ATOM   1519 C  C     . VAL A 1 198 ? 72.585 -2.327  -5.053  1.00 12.64  ? 195 VAL A C     1 
ATOM   1520 O  O     . VAL A 1 198 ? 72.563 -1.103  -4.883  1.00 13.38  ? 195 VAL A O     1 
ATOM   1521 C  CB    . VAL A 1 198 ? 74.698 -3.694  -4.870  1.00 14.75  ? 195 VAL A CB    1 
ATOM   1522 C  CG1   . VAL A 1 198 ? 75.427 -2.504  -5.518  1.00 17.15  ? 195 VAL A CG1   1 
ATOM   1523 C  CG2   . VAL A 1 198 ? 75.607 -4.419  -3.879  1.00 11.47  ? 195 VAL A CG2   1 
ATOM   1524 N  N     . ILE A 1 199 ? 71.867 -2.936  -5.989  1.00 7.67   ? 196 ILE A N     1 
ATOM   1525 C  CA    . ILE A 1 199 ? 70.992 -2.161  -6.863  1.00 13.37  ? 196 ILE A CA    1 
ATOM   1526 C  C     . ILE A 1 199 ? 69.918 -1.393  -6.065  1.00 11.17  ? 196 ILE A C     1 
ATOM   1527 O  O     . ILE A 1 199 ? 69.671 -0.211  -6.328  1.00 10.03  ? 196 ILE A O     1 
ATOM   1528 C  CB    . ILE A 1 199 ? 70.389 -3.035  -7.972  1.00 11.39  ? 196 ILE A CB    1 
ATOM   1529 C  CG1   . ILE A 1 199 ? 71.518 -3.574  -8.862  1.00 11.26  ? 196 ILE A CG1   1 
ATOM   1530 C  CG2   . ILE A 1 199 ? 69.396 -2.247  -8.807  1.00 10.54  ? 196 ILE A CG2   1 
ATOM   1531 C  CD1   . ILE A 1 199 ? 71.103 -4.688  -9.810  1.00 13.77  ? 196 ILE A CD1   1 
ATOM   1532 N  N     . VAL A 1 200 ? 69.311 -2.047  -5.079  1.00 10.80  ? 197 VAL A N     1 
ATOM   1533 C  CA    . VAL A 1 200 ? 68.267 -1.413  -4.285  1.00 6.81   ? 197 VAL A CA    1 
ATOM   1534 C  C     . VAL A 1 200 ? 68.812 -0.258  -3.455  1.00 12.04  ? 197 VAL A C     1 
ATOM   1535 O  O     . VAL A 1 200 ? 68.137 0.766   -3.297  1.00 9.75   ? 197 VAL A O     1 
ATOM   1536 C  CB    . VAL A 1 200 ? 67.490 -2.426  -3.416  1.00 8.82   ? 197 VAL A CB    1 
ATOM   1537 C  CG1   . VAL A 1 200 ? 66.394 -1.698  -2.600  1.00 8.02   ? 197 VAL A CG1   1 
ATOM   1538 C  CG2   . VAL A 1 200 ? 66.863 -3.504  -4.315  1.00 10.86  ? 197 VAL A CG2   1 
ATOM   1539 N  N     . GLU A 1 201 ? 70.036 -0.385  -2.948  1.00 10.01  ? 198 GLU A N     1 
ATOM   1540 C  CA    . GLU A 1 201 ? 70.655 0.755   -2.278  1.00 12.12  ? 198 GLU A CA    1 
ATOM   1541 C  C     . GLU A 1 201 ? 70.690 1.942   -3.252  1.00 11.07  ? 198 GLU A C     1 
ATOM   1542 O  O     . GLU A 1 201 ? 70.389 3.077   -2.878  1.00 13.63  ? 198 GLU A O     1 
ATOM   1543 C  CB    . GLU A 1 201 ? 72.081 0.423   -1.792  1.00 14.46  ? 198 GLU A CB    1 
ATOM   1544 C  CG    . GLU A 1 201 ? 72.182 -0.626  -0.667  1.00 12.31  ? 198 GLU A CG    1 
ATOM   1545 C  CD    . GLU A 1 201 ? 72.111 -0.031  0.732   1.00 15.28  ? 198 GLU A CD    1 
ATOM   1546 O  OE1   . GLU A 1 201 ? 71.785 1.170   0.854   1.00 14.61  ? 198 GLU A OE1   1 
ATOM   1547 O  OE2   . GLU A 1 201 ? 72.375 -0.766  1.716   1.00 16.05  ? 198 GLU A OE2   1 
ATOM   1548 N  N     . GLU A 1 202 ? 71.055 1.664   -4.500  1.00 11.30  ? 199 GLU A N     1 
ATOM   1549 C  CA    . GLU A 1 202 ? 71.145 2.699   -5.539  1.00 14.00  ? 199 GLU A CA    1 
ATOM   1550 C  C     . GLU A 1 202 ? 69.774 3.316   -5.849  1.00 13.65  ? 199 GLU A C     1 
ATOM   1551 O  O     . GLU A 1 202 ? 69.624 4.541   -5.914  1.00 11.65  ? 199 GLU A O     1 
ATOM   1552 C  CB    . GLU A 1 202 ? 71.762 2.115   -6.817  1.00 15.46  ? 199 GLU A CB    1 
ATOM   1553 C  CG    . GLU A 1 202 ? 73.253 1.825   -6.707  1.00 18.34  ? 199 GLU A CG    1 
ATOM   1554 C  CD    . GLU A 1 202 ? 73.764 0.904   -7.806  1.00 22.03  ? 199 GLU A CD    1 
ATOM   1555 O  OE1   . GLU A 1 202 ? 74.958 0.544   -7.761  1.00 23.32  ? 199 GLU A OE1   1 
ATOM   1556 O  OE2   . GLU A 1 202 ? 72.986 0.550   -8.718  1.00 28.54  ? 199 GLU A OE2   1 
ATOM   1557 N  N     . MET A 1 203 ? 68.776 2.463   -6.042  1.00 11.93  ? 200 MET A N     1 
ATOM   1558 C  CA    . MET A 1 203 ? 67.415 2.927   -6.261  1.00 8.68   ? 200 MET A CA    1 
ATOM   1559 C  C     . MET A 1 203 ? 66.953 3.806   -5.111  1.00 11.31  ? 200 MET A C     1 
ATOM   1560 O  O     . MET A 1 203 ? 66.363 4.883   -5.333  1.00 9.01   ? 200 MET A O     1 
ATOM   1561 C  CB    . MET A 1 203 ? 66.458 1.741   -6.390  1.00 7.10   ? 200 MET A CB    1 
ATOM   1562 C  CG    A MET A 1 203 ? 66.785 0.754   -7.499  0.52 7.91   ? 200 MET A CG    1 
ATOM   1563 C  CG    B MET A 1 203 ? 65.049 2.153   -6.789  0.48 9.52   ? 200 MET A CG    1 
ATOM   1564 S  SD    A MET A 1 203 ? 65.639 -0.655  -7.476  0.52 16.51  ? 200 MET A SD    1 
ATOM   1565 S  SD    B MET A 1 203 ? 63.966 0.734   -7.032  0.48 18.77  ? 200 MET A SD    1 
ATOM   1566 C  CE    A MET A 1 203 ? 64.109 0.161   -7.939  0.52 10.43  ? 200 MET A CE    1 
ATOM   1567 C  CE    B MET A 1 203 ? 64.974 -0.305  -8.078  0.48 14.50  ? 200 MET A CE    1 
ATOM   1568 N  N     . ARG A 1 204 ? 67.187 3.341   -3.882  1.00 8.73   ? 201 ARG A N     1 
ATOM   1569 C  CA    . ARG A 1 204 ? 66.744 4.079   -2.701  1.00 11.32  ? 201 ARG A CA    1 
ATOM   1570 C  C     . ARG A 1 204 ? 67.481 5.417   -2.585  1.00 12.62  ? 201 ARG A C     1 
ATOM   1571 O  O     . ARG A 1 204 ? 66.898 6.415   -2.174  1.00 8.67   ? 201 ARG A O     1 
ATOM   1572 C  CB    . ARG A 1 204 ? 66.861 3.237   -1.421  1.00 13.20  ? 201 ARG A CB    1 
ATOM   1573 C  CG    . ARG A 1 204 ? 65.898 2.018   -1.424  1.00 7.06   ? 201 ARG A CG    1 
ATOM   1574 C  CD    . ARG A 1 204 ? 65.979 1.199   -0.137  1.00 12.51  ? 201 ARG A CD    1 
ATOM   1575 N  NE    . ARG A 1 204 ? 66.016 2.056   1.038   1.00 9.05   ? 201 ARG A NE    1 
ATOM   1576 C  CZ    . ARG A 1 204 ? 67.062 2.148   1.852   1.00 11.99  ? 201 ARG A CZ    1 
ATOM   1577 N  NH1   . ARG A 1 204 ? 67.035 2.980   2.889   1.00 7.47   ? 201 ARG A NH1   1 
ATOM   1578 N  NH2   . ARG A 1 204 ? 68.137 1.404   1.628   1.00 12.20  ? 201 ARG A NH2   1 
ATOM   1579 N  N     . ALA A 1 205 ? 68.748 5.441   -2.983  1.00 11.74  ? 202 ALA A N     1 
ATOM   1580 C  CA    . ALA A 1 205 ? 69.513 6.691   -2.956  1.00 13.12  ? 202 ALA A CA    1 
ATOM   1581 C  C     . ALA A 1 205 ? 68.926 7.680   -3.975  1.00 9.92   ? 202 ALA A C     1 
ATOM   1582 O  O     . ALA A 1 205 ? 68.750 8.878   -3.682  1.00 8.90   ? 202 ALA A O     1 
ATOM   1583 C  CB    . ALA A 1 205 ? 70.994 6.431   -3.236  1.00 12.56  ? 202 ALA A CB    1 
ATOM   1584 N  N     . ALA A 1 206 ? 68.611 7.171   -5.160  1.00 9.07   ? 203 ALA A N     1 
ATOM   1585 C  CA    . ALA A 1 206 ? 68.019 7.990   -6.215  1.00 12.74  ? 203 ALA A CA    1 
ATOM   1586 C  C     . ALA A 1 206 ? 66.654 8.558   -5.813  1.00 10.40  ? 203 ALA A C     1 
ATOM   1587 O  O     . ALA A 1 206 ? 66.346 9.736   -6.078  1.00 9.74   ? 203 ALA A O     1 
ATOM   1588 C  CB    . ALA A 1 206 ? 67.910 7.196   -7.512  1.00 10.92  ? 203 ALA A CB    1 
ATOM   1589 N  N     . ILE A 1 207 ? 65.826 7.731   -5.181  1.00 8.55   ? 204 ILE A N     1 
ATOM   1590 C  CA    . ILE A 1 207 ? 64.526 8.209   -4.718  1.00 10.17  ? 204 ILE A CA    1 
ATOM   1591 C  C     . ILE A 1 207 ? 64.714 9.354   -3.735  1.00 9.93   ? 204 ILE A C     1 
ATOM   1592 O  O     . ILE A 1 207 ? 64.062 10.395  -3.844  1.00 6.08   ? 204 ILE A O     1 
ATOM   1593 C  CB    . ILE A 1 207 ? 63.694 7.082   -4.061  1.00 5.74   ? 204 ILE A CB    1 
ATOM   1594 C  CG1   . ILE A 1 207 ? 63.283 6.062   -5.121  1.00 7.54   ? 204 ILE A CG1   1 
ATOM   1595 C  CG2   . ILE A 1 207 ? 62.452 7.661   -3.371  1.00 9.22   ? 204 ILE A CG2   1 
ATOM   1596 C  CD1   . ILE A 1 207 ? 62.665 4.758   -4.548  1.00 10.97  ? 204 ILE A CD1   1 
ATOM   1597 N  N     . GLU A 1 208 ? 65.611 9.167   -2.771  1.00 8.68   ? 205 GLU A N     1 
ATOM   1598 C  CA    . GLU A 1 208 ? 65.790 10.190  -1.745  1.00 11.04  ? 205 GLU A CA    1 
ATOM   1599 C  C     . GLU A 1 208 ? 66.403 11.461  -2.318  1.00 12.05  ? 205 GLU A C     1 
ATOM   1600 O  O     . GLU A 1 208 ? 65.967 12.562  -1.982  1.00 10.57  ? 205 GLU A O     1 
ATOM   1601 C  CB    . GLU A 1 208 ? 66.644 9.698   -0.578  1.00 12.46  ? 205 GLU A CB    1 
ATOM   1602 C  CG    . GLU A 1 208 ? 66.704 10.737  0.559   1.00 15.34  ? 205 GLU A CG    1 
ATOM   1603 C  CD    . GLU A 1 208 ? 67.428 10.240  1.798   1.00 16.88  ? 205 GLU A CD    1 
ATOM   1604 O  OE1   . GLU A 1 208 ? 67.344 10.914  2.844   1.00 20.47  ? 205 GLU A OE1   1 
ATOM   1605 O  OE2   . GLU A 1 208 ? 68.076 9.177   1.726   1.00 16.61  ? 205 GLU A OE2   1 
ATOM   1606 N  N     . ARG A 1 209 ? 67.404 11.310  -3.180  1.00 8.42   ? 206 ARG A N     1 
ATOM   1607 C  CA    . ARG A 1 209 ? 68.018 12.469  -3.843  1.00 9.01   ? 206 ARG A CA    1 
ATOM   1608 C  C     . ARG A 1 209 ? 67.012 13.314  -4.637  1.00 8.88   ? 206 ARG A C     1 
ATOM   1609 O  O     . ARG A 1 209 ? 67.020 14.536  -4.573  1.00 9.68   ? 206 ARG A O     1 
ATOM   1610 C  CB    . ARG A 1 209 ? 69.149 12.040  -4.798  1.00 10.94  ? 206 ARG A CB    1 
ATOM   1611 C  CG    . ARG A 1 209 ? 69.854 13.272  -5.445  1.00 17.71  ? 206 ARG A CG    1 
ATOM   1612 C  CD    . ARG A 1 209 ? 70.937 12.946  -6.491  1.00 20.73  ? 206 ARG A CD    1 
ATOM   1613 N  NE    . ARG A 1 209 ? 70.428 12.596  -7.829  1.00 26.29  ? 206 ARG A NE    1 
ATOM   1614 C  CZ    . ARG A 1 209 ? 70.052 13.470  -8.768  1.00 26.88  ? 206 ARG A CZ    1 
ATOM   1615 N  NH1   . ARG A 1 209 ? 69.624 13.036  -9.959  1.00 18.06  ? 206 ARG A NH1   1 
ATOM   1616 N  NH2   . ARG A 1 209 ? 70.086 14.775  -8.524  1.00 13.93  ? 206 ARG A NH2   1 
ATOM   1617 N  N     . GLU A 1 210 ? 66.173 12.635  -5.404  1.00 9.72   ? 207 GLU A N     1 
ATOM   1618 C  CA    . GLU A 1 210 ? 65.328 13.268  -6.402  1.00 9.41   ? 207 GLU A CA    1 
ATOM   1619 C  C     . GLU A 1 210 ? 63.939 13.641  -5.869  1.00 9.55   ? 207 GLU A C     1 
ATOM   1620 O  O     . GLU A 1 210 ? 63.219 14.402  -6.506  1.00 8.76   ? 207 GLU A O     1 
ATOM   1621 C  CB    . GLU A 1 210 ? 65.218 12.352  -7.615  1.00 10.44  ? 207 GLU A CB    1 
ATOM   1622 C  CG    . GLU A 1 210 ? 66.572 12.013  -8.232  1.00 12.00  ? 207 GLU A CG    1 
ATOM   1623 C  CD    . GLU A 1 210 ? 66.470 11.132  -9.476  1.00 18.97  ? 207 GLU A CD    1 
ATOM   1624 O  OE1   . GLU A 1 210 ? 65.434 11.163  -10.169 1.00 16.62  ? 207 GLU A OE1   1 
ATOM   1625 O  OE2   . GLU A 1 210 ? 67.441 10.403  -9.766  1.00 19.02  ? 207 GLU A OE2   1 
ATOM   1626 N  N     . THR A 1 211 ? 63.561 13.116  -4.701  1.00 8.89   ? 208 THR A N     1 
ATOM   1627 C  CA    . THR A 1 211 ? 62.243 13.438  -4.157  1.00 8.18   ? 208 THR A CA    1 
ATOM   1628 C  C     . THR A 1 211 ? 62.307 13.954  -2.732  1.00 9.16   ? 208 THR A C     1 
ATOM   1629 O  O     . THR A 1 211 ? 61.409 14.655  -2.298  1.00 8.55   ? 208 THR A O     1 
ATOM   1630 C  CB    . THR A 1 211 ? 61.271 12.226  -4.184  1.00 7.44   ? 208 THR A CB    1 
ATOM   1631 O  OG1   . THR A 1 211 ? 61.709 11.231  -3.251  1.00 9.76   ? 208 THR A OG1   1 
ATOM   1632 C  CG2   . THR A 1 211 ? 61.163 11.629  -5.598  1.00 6.43   ? 208 THR A CG2   1 
ATOM   1633 N  N     . GLY A 1 212 ? 63.355 13.574  -2.007  1.00 8.43   ? 209 GLY A N     1 
ATOM   1634 C  CA    . GLY A 1 212 ? 63.466 13.893  -0.593  1.00 10.89  ? 209 GLY A CA    1 
ATOM   1635 C  C     . GLY A 1 212 ? 62.851 12.819  0.302   1.00 15.12  ? 209 GLY A C     1 
ATOM   1636 O  O     . GLY A 1 212 ? 62.938 12.909  1.521   1.00 14.11  ? 209 GLY A O     1 
ATOM   1637 N  N     . PHE A 1 213 ? 62.237 11.800  -0.298  1.00 12.33  ? 210 PHE A N     1 
ATOM   1638 C  CA    . PHE A 1 213 ? 61.528 10.776  0.471   1.00 9.63   ? 210 PHE A CA    1 
ATOM   1639 C  C     . PHE A 1 213 ? 62.444 9.606   0.788   1.00 10.11  ? 210 PHE A C     1 
ATOM   1640 O  O     . PHE A 1 213 ? 63.210 9.177   -0.066  1.00 11.85  ? 210 PHE A O     1 
ATOM   1641 C  CB    . PHE A 1 213 ? 60.296 10.253  -0.285  1.00 6.83   ? 210 PHE A CB    1 
ATOM   1642 C  CG    . PHE A 1 213 ? 59.304 11.321  -0.668  1.00 8.19   ? 210 PHE A CG    1 
ATOM   1643 C  CD1   . PHE A 1 213 ? 58.650 11.267  -1.896  1.00 8.59   ? 210 PHE A CD1   1 
ATOM   1644 C  CD2   . PHE A 1 213 ? 59.002 12.366  0.207   1.00 11.48  ? 210 PHE A CD2   1 
ATOM   1645 C  CE1   . PHE A 1 213 ? 57.723 12.254  -2.258  1.00 11.40  ? 210 PHE A CE1   1 
ATOM   1646 C  CE2   . PHE A 1 213 ? 58.084 13.353  -0.156  1.00 8.40   ? 210 PHE A CE2   1 
ATOM   1647 C  CZ    . PHE A 1 213 ? 57.441 13.288  -1.391  1.00 6.94   ? 210 PHE A CZ    1 
ATOM   1648 N  N     . GLN A 1 214 ? 62.350 9.100   2.016   1.00 6.13   ? 211 GLN A N     1 
ATOM   1649 C  CA    . GLN A 1 214 ? 63.069 7.898   2.418   1.00 10.10  ? 211 GLN A CA    1 
ATOM   1650 C  C     . GLN A 1 214 ? 62.145 6.679   2.382   1.00 9.03   ? 211 GLN A C     1 
ATOM   1651 O  O     . GLN A 1 214 ? 60.917 6.799   2.504   1.00 9.90   ? 211 GLN A O     1 
ATOM   1652 C  CB    . GLN A 1 214 ? 63.658 8.067   3.825   1.00 11.33  ? 211 GLN A CB    1 
ATOM   1653 C  CG    . GLN A 1 214 ? 64.838 9.037   3.900   1.00 13.75  ? 211 GLN A CG    1 
ATOM   1654 C  CD    . GLN A 1 214 ? 65.359 9.216   5.320   1.00 17.59  ? 211 GLN A CD    1 
ATOM   1655 O  OE1   . GLN A 1 214 ? 64.783 8.698   6.275   1.00 13.11  ? 211 GLN A OE1   1 
ATOM   1656 N  NE2   . GLN A 1 214 ? 66.469 9.932   5.456   1.00 13.17  ? 211 GLN A NE2   1 
ATOM   1657 N  N     . CYS A 1 215 ? 62.726 5.506   2.205   1.00 9.98   ? 212 CYS A N     1 
ATOM   1658 C  CA    . CYS A 1 215 ? 61.931 4.285   2.132   1.00 10.21  ? 212 CYS A CA    1 
ATOM   1659 C  C     . CYS A 1 215 ? 62.699 3.115   2.727   1.00 10.34  ? 212 CYS A C     1 
ATOM   1660 O  O     . CYS A 1 215 ? 63.918 3.186   2.958   1.00 10.37  ? 212 CYS A O     1 
ATOM   1661 C  CB    . CYS A 1 215 ? 61.575 3.964   0.671   1.00 10.66  ? 212 CYS A CB    1 
ATOM   1662 S  SG    . CYS A 1 215 ? 63.045 3.744   -0.386  1.00 15.17  ? 212 CYS A SG    1 
ATOM   1663 N  N     . SER A 1 216 ? 61.984 2.029   2.971   1.00 7.16   ? 213 SER A N     1 
ATOM   1664 C  CA    . SER A 1 216 ? 62.648 0.774   3.302   1.00 11.70  ? 213 SER A CA    1 
ATOM   1665 C  C     . SER A 1 216 ? 62.445 -0.215  2.150   1.00 10.78  ? 213 SER A C     1 
ATOM   1666 O  O     . SER A 1 216 ? 61.682 0.052   1.226   1.00 8.36   ? 213 SER A O     1 
ATOM   1667 C  CB    . SER A 1 216 ? 62.101 0.216   4.608   1.00 10.68  ? 213 SER A CB    1 
ATOM   1668 O  OG    . SER A 1 216 ? 62.220 1.192   5.631   1.00 11.14  ? 213 SER A OG    1 
ATOM   1669 N  N     . ALA A 1 217 ? 63.137 -1.346  2.195   1.00 7.30   ? 214 ALA A N     1 
ATOM   1670 C  CA    . ALA A 1 217 ? 62.987 -2.336  1.139   1.00 6.03   ? 214 ALA A CA    1 
ATOM   1671 C  C     . ALA A 1 217 ? 63.338 -3.725  1.636   1.00 8.97   ? 214 ALA A C     1 
ATOM   1672 O  O     . ALA A 1 217 ? 64.124 -3.873  2.573   1.00 8.13   ? 214 ALA A O     1 
ATOM   1673 C  CB    . ALA A 1 217 ? 63.859 -1.977  -0.049  1.00 7.31   ? 214 ALA A CB    1 
ATOM   1674 N  N     . GLY A 1 218 ? 62.735 -4.738  1.017   1.00 7.52   ? 215 GLY A N     1 
ATOM   1675 C  CA    . GLY A 1 218 ? 63.115 -6.118  1.268   1.00 6.24   ? 215 GLY A CA    1 
ATOM   1676 C  C     . GLY A 1 218 ? 63.654 -6.670  -0.035  1.00 9.67   ? 215 GLY A C     1 
ATOM   1677 O  O     . GLY A 1 218 ? 63.151 -6.313  -1.104  1.00 7.37   ? 215 GLY A O     1 
ATOM   1678 N  N     . ILE A 1 219 ? 64.704 -7.488  0.040   1.00 5.55   ? 216 ILE A N     1 
ATOM   1679 C  CA    . ILE A 1 219 ? 65.231 -8.168  -1.141  1.00 6.53   ? 216 ILE A CA    1 
ATOM   1680 C  C     . ILE A 1 219 ? 65.263 -9.657  -0.859  1.00 7.29   ? 216 ILE A C     1 
ATOM   1681 O  O     . ILE A 1 219 ? 65.880 -10.091 0.127   1.00 7.32   ? 216 ILE A O     1 
ATOM   1682 C  CB    . ILE A 1 219 ? 66.661 -7.685  -1.497  1.00 8.25   ? 216 ILE A CB    1 
ATOM   1683 C  CG1   . ILE A 1 219 ? 66.703 -6.154  -1.657  1.00 6.78   ? 216 ILE A CG1   1 
ATOM   1684 C  CG2   . ILE A 1 219 ? 67.185 -8.399  -2.754  1.00 7.60   ? 216 ILE A CG2   1 
ATOM   1685 C  CD1   . ILE A 1 219 ? 67.133 -5.414  -0.391  1.00 11.66  ? 216 ILE A CD1   1 
ATOM   1686 N  N     . SER A 1 220 ? 64.577 -10.435 -1.692  1.00 5.74   ? 217 SER A N     1 
ATOM   1687 C  CA    . SER A 1 220 ? 64.555 -11.887 -1.540  1.00 7.10   ? 217 SER A CA    1 
ATOM   1688 C  C     . SER A 1 220 ? 64.305 -12.549 -2.884  1.00 12.24  ? 217 SER A C     1 
ATOM   1689 O  O     . SER A 1 220 ? 64.551 -11.930 -3.916  1.00 7.74   ? 217 SER A O     1 
ATOM   1690 C  CB    . SER A 1 220 ? 63.491 -12.314 -0.525  1.00 10.82  ? 217 SER A CB    1 
ATOM   1691 O  OG    . SER A 1 220 ? 63.690 -13.664 -0.136  1.00 9.66   ? 217 SER A OG    1 
ATOM   1692 N  N     . HIS A 1 221 ? 63.830 -13.801 -2.884  1.00 7.60   ? 218 HIS A N     1 
ATOM   1693 C  CA    . HIS A 1 221 ? 63.620 -14.521 -4.150  1.00 9.18   ? 218 HIS A CA    1 
ATOM   1694 C  C     . HIS A 1 221 ? 62.181 -14.468 -4.674  1.00 11.43  ? 218 HIS A C     1 
ATOM   1695 O  O     . HIS A 1 221 ? 61.899 -14.964 -5.760  1.00 10.22  ? 218 HIS A O     1 
ATOM   1696 C  CB    . HIS A 1 221 ? 64.058 -15.991 -4.031  1.00 10.24  ? 218 HIS A CB    1 
ATOM   1697 C  CG    . HIS A 1 221 ? 65.539 -16.175 -3.920  1.00 10.47  ? 218 HIS A CG    1 
ATOM   1698 N  ND1   . HIS A 1 221 ? 66.408 -15.830 -4.931  1.00 8.97   ? 218 HIS A ND1   1 
ATOM   1699 C  CD2   . HIS A 1 221 ? 66.303 -16.676 -2.916  1.00 9.33   ? 218 HIS A CD2   1 
ATOM   1700 C  CE1   . HIS A 1 221 ? 67.646 -16.116 -4.560  1.00 12.71  ? 218 HIS A CE1   1 
ATOM   1701 N  NE2   . HIS A 1 221 ? 67.611 -16.619 -3.337  1.00 11.31  ? 218 HIS A NE2   1 
ATOM   1702 N  N     . ASN A 1 222 ? 61.271 -13.893 -3.896  1.00 5.88   ? 219 ASN A N     1 
ATOM   1703 C  CA    . ASN A 1 222 ? 59.871 -13.774 -4.317  1.00 7.90   ? 219 ASN A CA    1 
ATOM   1704 C  C     . ASN A 1 222 ? 59.194 -12.626 -3.579  1.00 9.65   ? 219 ASN A C     1 
ATOM   1705 O  O     . ASN A 1 222 ? 59.777 -12.040 -2.654  1.00 9.05   ? 219 ASN A O     1 
ATOM   1706 C  CB    . ASN A 1 222 ? 59.102 -15.090 -4.100  1.00 6.35   ? 219 ASN A CB    1 
ATOM   1707 C  CG    . ASN A 1 222 ? 59.195 -15.595 -2.656  1.00 11.05  ? 219 ASN A CG    1 
ATOM   1708 O  OD1   . ASN A 1 222 ? 58.697 -14.950 -1.725  1.00 8.23   ? 219 ASN A OD1   1 
ATOM   1709 N  ND2   . ASN A 1 222 ? 59.816 -16.759 -2.470  1.00 8.00   ? 219 ASN A ND2   1 
ATOM   1710 N  N     . LYS A 1 223 ? 57.974 -12.298 -3.992  1.00 8.26   ? 220 LYS A N     1 
ATOM   1711 C  CA    . LYS A 1 223 ? 57.269 -11.139 -3.447  1.00 12.42  ? 220 LYS A CA    1 
ATOM   1712 C  C     . LYS A 1 223 ? 56.917 -11.277 -1.964  1.00 9.36   ? 220 LYS A C     1 
ATOM   1713 O  O     . LYS A 1 223 ? 57.059 -10.312 -1.199  1.00 8.42   ? 220 LYS A O     1 
ATOM   1714 C  CB    . LYS A 1 223 ? 56.000 -10.851 -4.259  1.00 10.88  ? 220 LYS A CB    1 
ATOM   1715 C  CG    . LYS A 1 223 ? 56.279 -10.606 -5.733  1.00 11.58  ? 220 LYS A CG    1 
ATOM   1716 C  CD    . LYS A 1 223 ? 55.193 -9.754  -6.407  1.00 22.76  ? 220 LYS A CD    1 
ATOM   1717 C  CE    . LYS A 1 223 ? 53.865 -10.428 -6.406  1.00 20.23  ? 220 LYS A CE    1 
ATOM   1718 N  NZ    . LYS A 1 223 ? 52.840 -9.700  -7.231  1.00 17.32  ? 220 LYS A NZ    1 
ATOM   1719 N  N     . VAL A 1 224 ? 56.421 -12.447 -1.558  1.00 7.58   ? 221 VAL A N     1 
ATOM   1720 C  CA    . VAL A 1 224 ? 56.068 -12.644 -0.139  1.00 6.62   ? 221 VAL A CA    1 
ATOM   1721 C  C     . VAL A 1 224 ? 57.262 -12.437 0.802   1.00 7.59   ? 221 VAL A C     1 
ATOM   1722 O  O     . VAL A 1 224 ? 57.151 -11.721 1.809   1.00 8.63   ? 221 VAL A O     1 
ATOM   1723 C  CB    . VAL A 1 224 ? 55.385 -14.003 0.128   1.00 7.03   ? 221 VAL A CB    1 
ATOM   1724 C  CG1   . VAL A 1 224 ? 55.257 -14.253 1.610   1.00 11.81  ? 221 VAL A CG1   1 
ATOM   1725 C  CG2   . VAL A 1 224 ? 53.988 -14.013 -0.493  1.00 11.71  ? 221 VAL A CG2   1 
ATOM   1726 N  N     . LEU A 1 225 ? 58.403 -13.044 0.466   1.00 8.73   ? 222 LEU A N     1 
ATOM   1727 C  CA    . LEU A 1 225 ? 59.621 -12.876 1.272   1.00 8.24   ? 222 LEU A CA    1 
ATOM   1728 C  C     . LEU A 1 225 ? 60.155 -11.441 1.217   1.00 9.61   ? 222 LEU A C     1 
ATOM   1729 O  O     . LEU A 1 225 ? 60.645 -10.912 2.214   1.00 8.05   ? 222 LEU A O     1 
ATOM   1730 C  CB    . LEU A 1 225 ? 60.728 -13.869 0.868   1.00 6.23   ? 222 LEU A CB    1 
ATOM   1731 C  CG    . LEU A 1 225 ? 60.450 -15.346 1.203   1.00 8.18   ? 222 LEU A CG    1 
ATOM   1732 C  CD1   . LEU A 1 225 ? 61.706 -16.220 0.968   1.00 10.30  ? 222 LEU A CD1   1 
ATOM   1733 C  CD2   . LEU A 1 225 ? 59.968 -15.490 2.636   1.00 10.73  ? 222 LEU A CD2   1 
ATOM   1734 N  N     . ALA A 1 226 ? 60.057 -10.818 0.048   1.00 8.21   ? 223 ALA A N     1 
ATOM   1735 C  CA    . ALA A 1 226 ? 60.497 -9.443  -0.111  1.00 8.35   ? 223 ALA A CA    1 
ATOM   1736 C  C     . ALA A 1 226 ? 59.671 -8.517  0.770   1.00 9.04   ? 223 ALA A C     1 
ATOM   1737 O  O     . ALA A 1 226 ? 60.215 -7.662  1.460   1.00 10.68  ? 223 ALA A O     1 
ATOM   1738 C  CB    . ALA A 1 226 ? 60.406 -9.013  -1.577  1.00 8.72   ? 223 ALA A CB    1 
ATOM   1739 N  N     . LYS A 1 227 ? 58.352 -8.685  0.727   1.00 8.06   ? 224 LYS A N     1 
ATOM   1740 C  CA    . LYS A 1 227 ? 57.435 -7.894  1.555   1.00 9.34   ? 224 LYS A CA    1 
ATOM   1741 C  C     . LYS A 1 227 ? 57.731 -8.103  3.055   1.00 12.01  ? 224 LYS A C     1 
ATOM   1742 O  O     . LYS A 1 227 ? 57.812 -7.143  3.827   1.00 6.34   ? 224 LYS A O     1 
ATOM   1743 C  CB    . LYS A 1 227 ? 55.985 -8.266  1.218   1.00 7.55   ? 224 LYS A CB    1 
ATOM   1744 C  CG    A LYS A 1 227 ? 54.939 -7.671  2.150   0.25 14.02  ? 224 LYS A CG    1 
ATOM   1745 C  CG    B LYS A 1 227 ? 54.914 -7.572  2.065   0.75 14.10  ? 224 LYS A CG    1 
ATOM   1746 C  CD    A LYS A 1 227 ? 54.733 -6.187  1.888   0.25 16.25  ? 224 LYS A CD    1 
ATOM   1747 C  CD    B LYS A 1 227 ? 55.038 -6.049  1.983   0.75 16.12  ? 224 LYS A CD    1 
ATOM   1748 C  CE    A LYS A 1 227 ? 53.790 -5.580  2.917   0.25 19.86  ? 224 LYS A CE    1 
ATOM   1749 C  CE    B LYS A 1 227 ? 53.877 -5.342  2.697   0.75 20.91  ? 224 LYS A CE    1 
ATOM   1750 N  NZ    A LYS A 1 227 ? 52.545 -6.372  3.057   0.25 14.62  ? 224 LYS A NZ    1 
ATOM   1751 N  NZ    B LYS A 1 227 ? 54.167 -3.881  2.885   0.75 17.98  ? 224 LYS A NZ    1 
ATOM   1752 N  N     . LEU A 1 228 ? 57.906 -9.356  3.460   1.00 6.23   ? 225 LEU A N     1 
ATOM   1753 C  CA    . LEU A 1 228 ? 58.228 -9.668  4.855   1.00 9.41   ? 225 LEU A CA    1 
ATOM   1754 C  C     . LEU A 1 228 ? 59.565 -9.041  5.279   1.00 10.36  ? 225 LEU A C     1 
ATOM   1755 O  O     . LEU A 1 228 ? 59.666 -8.378  6.321   1.00 9.10   ? 225 LEU A O     1 
ATOM   1756 C  CB    . LEU A 1 228 ? 58.265 -11.186 5.061   1.00 8.31   ? 225 LEU A CB    1 
ATOM   1757 C  CG    . LEU A 1 228 ? 58.420 -11.662 6.513   1.00 13.31  ? 225 LEU A CG    1 
ATOM   1758 C  CD1   . LEU A 1 228 ? 57.215 -11.207 7.331   1.00 10.83  ? 225 LEU A CD1   1 
ATOM   1759 C  CD2   . LEU A 1 228 ? 58.564 -13.172 6.563   1.00 10.32  ? 225 LEU A CD2   1 
ATOM   1760 N  N     . ALA A 1 229 ? 60.588 -9.273  4.463   1.00 9.31   ? 226 ALA A N     1 
ATOM   1761 C  CA    . ALA A 1 229 ? 61.914 -8.698  4.675   1.00 11.30  ? 226 ALA A CA    1 
ATOM   1762 C  C     . ALA A 1 229 ? 61.828 -7.196  4.904   1.00 12.29  ? 226 ALA A C     1 
ATOM   1763 O  O     . ALA A 1 229 ? 62.399 -6.677  5.860   1.00 10.55  ? 226 ALA A O     1 
ATOM   1764 C  CB    . ALA A 1 229 ? 62.828 -8.994  3.467   1.00 7.78   ? 226 ALA A CB    1 
ATOM   1765 N  N     . CYS A 1 230 ? 61.101 -6.507  4.021   1.00 8.04   ? 227 CYS A N     1 
ATOM   1766 C  CA    . CYS A 1 230 ? 61.034 -5.049  4.056   1.00 5.91   ? 227 CYS A CA    1 
ATOM   1767 C  C     . CYS A 1 230 ? 60.636 -4.510  5.440   1.00 6.93   ? 227 CYS A C     1 
ATOM   1768 O  O     . CYS A 1 230 ? 61.183 -3.513  5.903   1.00 11.28  ? 227 CYS A O     1 
ATOM   1769 C  CB    . CYS A 1 230 ? 60.068 -4.530  2.978   1.00 7.15   ? 227 CYS A CB    1 
ATOM   1770 S  SG    . CYS A 1 230 ? 59.912 -2.723  2.941   1.00 11.43  ? 227 CYS A SG    1 
ATOM   1771 N  N     . GLY A 1 231 ? 59.702 -5.189  6.094   1.00 9.51   ? 228 GLY A N     1 
ATOM   1772 C  CA    . GLY A 1 231 ? 59.215 -4.765  7.396   1.00 11.28  ? 228 GLY A CA    1 
ATOM   1773 C  C     . GLY A 1 231 ? 60.133 -5.105  8.567   1.00 13.85  ? 228 GLY A C     1 
ATOM   1774 O  O     . GLY A 1 231 ? 59.873 -4.701  9.699   1.00 12.04  ? 228 GLY A O     1 
ATOM   1775 N  N     . LEU A 1 232 ? 61.215 -5.833  8.311   1.00 11.98  ? 229 LEU A N     1 
ATOM   1776 C  CA    . LEU A 1 232 ? 62.054 -6.317  9.416   1.00 12.01  ? 229 LEU A CA    1 
ATOM   1777 C  C     . LEU A 1 232 ? 62.905 -5.202  10.028  1.00 17.91  ? 229 LEU A C     1 
ATOM   1778 O  O     . LEU A 1 232 ? 63.186 -5.190  11.232  1.00 12.32  ? 229 LEU A O     1 
ATOM   1779 C  CB    . LEU A 1 232 ? 62.922 -7.488  8.963   1.00 15.22  ? 229 LEU A CB    1 
ATOM   1780 C  CG    . LEU A 1 232 ? 62.100 -8.749  8.680   1.00 13.02  ? 229 LEU A CG    1 
ATOM   1781 C  CD1   . LEU A 1 232 ? 62.992 -9.912  8.252   1.00 11.52  ? 229 LEU A CD1   1 
ATOM   1782 C  CD2   . LEU A 1 232 ? 61.256 -9.111  9.915   1.00 11.66  ? 229 LEU A CD2   1 
ATOM   1783 N  N     . ASN A 1 233 ? 63.311 -4.259  9.191   1.00 10.97  ? 230 ASN A N     1 
ATOM   1784 C  CA    . ASN A 1 233 ? 64.110 -3.143  9.656   1.00 14.37  ? 230 ASN A CA    1 
ATOM   1785 C  C     . ASN A 1 233 ? 63.599 -1.872  8.981   1.00 16.26  ? 230 ASN A C     1 
ATOM   1786 O  O     . ASN A 1 233 ? 63.856 -1.630  7.806   1.00 22.26  ? 230 ASN A O     1 
ATOM   1787 C  CB    . ASN A 1 233 ? 65.595 -3.383  9.354   1.00 11.34  ? 230 ASN A CB    1 
ATOM   1788 C  CG    . ASN A 1 233 ? 66.163 -4.577  10.108  1.00 15.59  ? 230 ASN A CG    1 
ATOM   1789 O  OD1   . ASN A 1 233 ? 66.494 -4.475  11.288  1.00 14.74  ? 230 ASN A OD1   1 
ATOM   1790 N  ND2   . ASN A 1 233 ? 66.300 -5.704  9.422   1.00 8.44   ? 230 ASN A ND2   1 
ATOM   1791 N  N     . LYS A 1 234 ? 62.817 -1.107  9.725   1.00 18.48  ? 231 LYS A N     1 
ATOM   1792 C  CA    . LYS A 1 234 ? 62.236 0.146   9.261   1.00 19.57  ? 231 LYS A CA    1 
ATOM   1793 C  C     . LYS A 1 234 ? 62.520 1.134   10.381  1.00 18.07  ? 231 LYS A C     1 
ATOM   1794 O  O     . LYS A 1 234 ? 62.678 0.729   11.534  1.00 17.14  ? 231 LYS A O     1 
ATOM   1795 C  CB    . LYS A 1 234 ? 60.713 0.008   9.024   1.00 20.35  ? 231 LYS A CB    1 
ATOM   1796 C  CG    . LYS A 1 234 ? 60.280 -0.372  7.590   1.00 20.52  ? 231 LYS A CG    1 
ATOM   1797 C  CD    . LYS A 1 234 ? 58.776 -0.036  7.313   1.00 23.76  ? 231 LYS A CD    1 
ATOM   1798 C  CE    . LYS A 1 234 ? 58.414 0.085   5.802   1.00 27.34  ? 231 LYS A CE    1 
ATOM   1799 N  NZ    . LYS A 1 234 ? 58.302 1.521   5.257   1.00 11.34  ? 231 LYS A NZ    1 
ATOM   1800 N  N     . PRO A 1 235 ? 62.622 2.430   10.057  1.00 11.45  ? 232 PRO A N     1 
ATOM   1801 C  CA    . PRO A 1 235 ? 62.543 3.028   8.718   1.00 11.83  ? 232 PRO A CA    1 
ATOM   1802 C  C     . PRO A 1 235 ? 63.921 3.192   8.088   1.00 11.70  ? 232 PRO A C     1 
ATOM   1803 O  O     . PRO A 1 235 ? 64.931 2.952   8.743   1.00 10.93  ? 232 PRO A O     1 
ATOM   1804 C  CB    . PRO A 1 235 ? 61.972 4.416   9.012   1.00 14.69  ? 232 PRO A CB    1 
ATOM   1805 C  CG    . PRO A 1 235 ? 62.620 4.762   10.350  1.00 15.25  ? 232 PRO A CG    1 
ATOM   1806 C  CD    . PRO A 1 235 ? 62.679 3.457   11.116  1.00 18.17  ? 232 PRO A CD    1 
ATOM   1807 N  N     . ASN A 1 236 ? 63.945 3.584   6.818   1.00 11.16  ? 233 ASN A N     1 
ATOM   1808 C  CA    . ASN A 1 236 ? 65.184 3.979   6.145   1.00 10.01  ? 233 ASN A CA    1 
ATOM   1809 C  C     . ASN A 1 236 ? 66.276 2.905   6.112   1.00 7.42   ? 233 ASN A C     1 
ATOM   1810 O  O     . ASN A 1 236 ? 67.457 3.228   6.189   1.00 9.51   ? 233 ASN A O     1 
ATOM   1811 C  CB    . ASN A 1 236 ? 65.740 5.277   6.753   1.00 12.04  ? 233 ASN A CB    1 
ATOM   1812 C  CG    . ASN A 1 236 ? 66.743 5.973   5.835   1.00 14.52  ? 233 ASN A CG    1 
ATOM   1813 O  OD1   . ASN A 1 236 ? 66.601 5.951   4.615   1.00 15.68  ? 233 ASN A OD1   1 
ATOM   1814 N  ND2   . ASN A 1 236 ? 67.757 6.590   6.425   1.00 17.33  ? 233 ASN A ND2   1 
ATOM   1815 N  N     . ARG A 1 237 ? 65.880 1.635   6.006   1.00 8.07   ? 234 ARG A N     1 
ATOM   1816 C  CA    . ARG A 1 237 ? 66.822 0.507   5.952   1.00 10.51  ? 234 ARG A CA    1 
ATOM   1817 C  C     . ARG A 1 237 ? 66.276 -0.574  5.023   1.00 10.54  ? 234 ARG A C     1 
ATOM   1818 O  O     . ARG A 1 237 ? 65.103 -0.567  4.675   1.00 11.45  ? 234 ARG A O     1 
ATOM   1819 C  CB    . ARG A 1 237 ? 67.051 -0.115  7.341   1.00 12.29  ? 234 ARG A CB    1 
ATOM   1820 C  CG    . ARG A 1 237 ? 67.681 0.814   8.377   1.00 11.62  ? 234 ARG A CG    1 
ATOM   1821 C  CD    . ARG A 1 237 ? 69.150 1.080   8.049   1.00 20.32  ? 234 ARG A CD    1 
ATOM   1822 N  NE    . ARG A 1 237 ? 69.824 1.859   9.090   1.00 23.20  ? 234 ARG A NE    1 
ATOM   1823 C  CZ    . ARG A 1 237 ? 69.903 3.187   9.098   1.00 29.07  ? 234 ARG A CZ    1 
ATOM   1824 N  NH1   . ARG A 1 237 ? 69.351 3.890   8.117   1.00 17.08  ? 234 ARG A NH1   1 
ATOM   1825 N  NH2   . ARG A 1 237 ? 70.537 3.813   10.084  1.00 27.47  ? 234 ARG A NH2   1 
ATOM   1826 N  N     . GLN A 1 238 ? 67.128 -1.509  4.628   1.00 9.32   ? 235 GLN A N     1 
ATOM   1827 C  CA    . GLN A 1 238 ? 66.691 -2.588  3.764   1.00 8.66   ? 235 GLN A CA    1 
ATOM   1828 C  C     . GLN A 1 238 ? 67.262 -3.917  4.260   1.00 9.49   ? 235 GLN A C     1 
ATOM   1829 O  O     . GLN A 1 238 ? 68.333 -3.958  4.851   1.00 10.81  ? 235 GLN A O     1 
ATOM   1830 C  CB    . GLN A 1 238 ? 67.088 -2.332  2.307   1.00 7.99   ? 235 GLN A CB    1 
ATOM   1831 C  CG    . GLN A 1 238 ? 68.594 -2.200  2.088   1.00 11.58  ? 235 GLN A CG    1 
ATOM   1832 C  CD    . GLN A 1 238 ? 68.957 -1.919  0.628   1.00 14.17  ? 235 GLN A CD    1 
ATOM   1833 O  OE1   . GLN A 1 238 ? 68.582 -0.885  0.057   1.00 11.61  ? 235 GLN A OE1   1 
ATOM   1834 N  NE2   . GLN A 1 238 ? 69.694 -2.837  0.026   1.00 8.95   ? 235 GLN A NE2   1 
ATOM   1835 N  N     . THR A 1 239 ? 66.533 -4.990  3.995   1.00 6.73   ? 236 THR A N     1 
ATOM   1836 C  CA    . THR A 1 239 ? 66.793 -6.290  4.587   1.00 7.97   ? 236 THR A CA    1 
ATOM   1837 C  C     . THR A 1 239 ? 66.822 -7.350  3.489   1.00 9.65   ? 236 THR A C     1 
ATOM   1838 O  O     . THR A 1 239 ? 65.902 -7.441  2.665   1.00 7.88   ? 236 THR A O     1 
ATOM   1839 C  CB    . THR A 1 239 ? 65.713 -6.626  5.613   1.00 10.32  ? 236 THR A CB    1 
ATOM   1840 O  OG1   . THR A 1 239 ? 65.591 -5.551  6.554   1.00 10.00  ? 236 THR A OG1   1 
ATOM   1841 C  CG2   . THR A 1 239 ? 66.035 -7.929  6.367   1.00 9.17   ? 236 THR A CG2   1 
ATOM   1842 N  N     . LEU A 1 240 ? 67.900 -8.124  3.472   1.00 6.50   ? 237 LEU A N     1 
ATOM   1843 C  CA    . LEU A 1 240 ? 68.066 -9.241  2.555   1.00 5.57   ? 237 LEU A CA    1 
ATOM   1844 C  C     . LEU A 1 240 ? 67.689 -10.532 3.295   1.00 10.33  ? 237 LEU A C     1 
ATOM   1845 O  O     . LEU A 1 240 ? 68.253 -10.842 4.348   1.00 7.04   ? 237 LEU A O     1 
ATOM   1846 C  CB    . LEU A 1 240 ? 69.509 -9.275  2.039   1.00 6.98   ? 237 LEU A CB    1 
ATOM   1847 C  CG    . LEU A 1 240 ? 69.931 -10.329 1.008   1.00 12.42  ? 237 LEU A CG    1 
ATOM   1848 C  CD1   . LEU A 1 240 ? 71.258 -9.937  0.351   1.00 8.91   ? 237 LEU A CD1   1 
ATOM   1849 C  CD2   . LEU A 1 240 ? 70.015 -11.745 1.619   1.00 8.63   ? 237 LEU A CD2   1 
ATOM   1850 N  N     . VAL A 1 241 ? 66.691 -11.243 2.768   1.00 10.53  ? 238 VAL A N     1 
ATOM   1851 C  CA    . VAL A 1 241 ? 66.255 -12.507 3.358   1.00 8.48   ? 238 VAL A CA    1 
ATOM   1852 C  C     . VAL A 1 241 ? 66.603 -13.600 2.367   1.00 9.10   ? 238 VAL A C     1 
ATOM   1853 O  O     . VAL A 1 241 ? 66.001 -13.707 1.299   1.00 7.34   ? 238 VAL A O     1 
ATOM   1854 C  CB    . VAL A 1 241 ? 64.754 -12.510 3.656   1.00 8.73   ? 238 VAL A CB    1 
ATOM   1855 C  CG1   . VAL A 1 241 ? 64.217 -13.954 3.823   1.00 6.94   ? 238 VAL A CG1   1 
ATOM   1856 C  CG2   . VAL A 1 241 ? 64.452 -11.647 4.897   1.00 6.71   ? 238 VAL A CG2   1 
ATOM   1857 N  N     . SER A 1 242 ? 67.617 -14.385 2.702   1.00 9.15   ? 239 SER A N     1 
ATOM   1858 C  CA    . SER A 1 242 ? 68.083 -15.425 1.792   1.00 10.87  ? 239 SER A CA    1 
ATOM   1859 C  C     . SER A 1 242 ? 67.241 -16.690 1.950   1.00 7.26   ? 239 SER A C     1 
ATOM   1860 O  O     . SER A 1 242 ? 66.510 -16.853 2.935   1.00 5.45   ? 239 SER A O     1 
ATOM   1861 C  CB    . SER A 1 242 ? 69.553 -15.750 2.073   1.00 7.51   ? 239 SER A CB    1 
ATOM   1862 O  OG    . SER A 1 242 ? 69.659 -16.246 3.397   1.00 11.53  ? 239 SER A OG    1 
ATOM   1863 N  N     . HIS A 1 243 ? 67.352 -17.594 0.984   1.00 9.37   ? 240 HIS A N     1 
ATOM   1864 C  CA    . HIS A 1 243 ? 66.628 -18.854 1.064   1.00 9.60   ? 240 HIS A CA    1 
ATOM   1865 C  C     . HIS A 1 243 ? 67.001 -19.577 2.362   1.00 11.48  ? 240 HIS A C     1 
ATOM   1866 O  O     . HIS A 1 243 ? 66.144 -20.136 3.061   1.00 9.29   ? 240 HIS A O     1 
ATOM   1867 C  CB    . HIS A 1 243 ? 66.938 -19.750 -0.148  1.00 12.89  ? 240 HIS A CB    1 
ATOM   1868 C  CG    . HIS A 1 243 ? 66.173 -21.041 -0.147  1.00 14.56  ? 240 HIS A CG    1 
ATOM   1869 N  ND1   . HIS A 1 243 ? 64.818 -21.102 -0.401  1.00 11.85  ? 240 HIS A ND1   1 
ATOM   1870 C  CD2   . HIS A 1 243 ? 66.568 -22.315 0.099   1.00 15.36  ? 240 HIS A CD2   1 
ATOM   1871 C  CE1   . HIS A 1 243 ? 64.414 -22.359 -0.319  1.00 14.42  ? 240 HIS A CE1   1 
ATOM   1872 N  NE2   . HIS A 1 243 ? 65.453 -23.115 -0.013  1.00 12.95  ? 240 HIS A NE2   1 
ATOM   1873 N  N     . GLY A 1 244 ? 68.286 -19.528 2.689   1.00 11.24  ? 241 GLY A N     1 
ATOM   1874 C  CA    . GLY A 1 244 ? 68.810 -20.205 3.856   1.00 9.58   ? 241 GLY A CA    1 
ATOM   1875 C  C     . GLY A 1 244 ? 68.285 -19.690 5.174   1.00 8.98   ? 241 GLY A C     1 
ATOM   1876 O  O     . GLY A 1 244 ? 68.206 -20.454 6.138   1.00 9.34   ? 241 GLY A O     1 
ATOM   1877 N  N     . SER A 1 245 ? 67.926 -18.406 5.232   1.00 8.08   ? 242 SER A N     1 
ATOM   1878 C  CA    . SER A 1 245 ? 67.437 -17.828 6.483   1.00 10.11  ? 242 SER A CA    1 
ATOM   1879 C  C     . SER A 1 245 ? 66.014 -18.271 6.814   1.00 7.50   ? 242 SER A C     1 
ATOM   1880 O  O     . SER A 1 245 ? 65.545 -18.078 7.938   1.00 8.33   ? 242 SER A O     1 
ATOM   1881 C  CB    . SER A 1 245 ? 67.480 -16.298 6.444   1.00 10.66  ? 242 SER A CB    1 
ATOM   1882 O  OG    . SER A 1 245 ? 66.504 -15.782 5.542   1.00 11.26  ? 242 SER A OG    1 
ATOM   1883 N  N     . VAL A 1 246 ? 65.328 -18.847 5.837   1.00 6.45   ? 243 VAL A N     1 
ATOM   1884 C  CA    . VAL A 1 246 ? 63.903 -19.141 5.996   1.00 8.35   ? 243 VAL A CA    1 
ATOM   1885 C  C     . VAL A 1 246 ? 63.544 -20.069 7.194   1.00 7.30   ? 243 VAL A C     1 
ATOM   1886 O  O     . VAL A 1 246 ? 62.663 -19.753 7.996   1.00 6.73   ? 243 VAL A O     1 
ATOM   1887 C  CB    . VAL A 1 246 ? 63.295 -19.641 4.653   1.00 5.82   ? 243 VAL A CB    1 
ATOM   1888 C  CG1   . VAL A 1 246 ? 61.840 -20.175 4.850   1.00 7.56   ? 243 VAL A CG1   1 
ATOM   1889 C  CG2   . VAL A 1 246 ? 63.331 -18.518 3.631   1.00 9.87   ? 243 VAL A CG2   1 
ATOM   1890 N  N     . PRO A 1 247 ? 64.230 -21.217 7.332   1.00 8.48   ? 244 PRO A N     1 
ATOM   1891 C  CA    . PRO A 1 247 ? 63.806 -22.089 8.438   1.00 7.73   ? 244 PRO A CA    1 
ATOM   1892 C  C     . PRO A 1 247 ? 63.855 -21.399 9.821   1.00 8.28   ? 244 PRO A C     1 
ATOM   1893 O  O     . PRO A 1 247 ? 62.875 -21.465 10.563  1.00 9.41   ? 244 PRO A O     1 
ATOM   1894 C  CB    . PRO A 1 247 ? 64.794 -23.267 8.371   1.00 9.04   ? 244 PRO A CB    1 
ATOM   1895 C  CG    . PRO A 1 247 ? 65.255 -23.283 6.910   1.00 14.03  ? 244 PRO A CG    1 
ATOM   1896 C  CD    . PRO A 1 247 ? 65.271 -21.831 6.478   1.00 8.74   ? 244 PRO A CD    1 
ATOM   1897 N  N     . GLN A 1 248 ? 64.946 -20.728 10.159  1.00 9.00   ? 245 GLN A N     1 
ATOM   1898 C  CA    . GLN A 1 248 ? 64.977 -20.055 11.461  1.00 8.76   ? 245 GLN A CA    1 
ATOM   1899 C  C     . GLN A 1 248 ? 63.956 -18.917 11.524  1.00 10.05  ? 245 GLN A C     1 
ATOM   1900 O  O     . GLN A 1 248 ? 63.284 -18.739 12.546  1.00 7.64   ? 245 GLN A O     1 
ATOM   1901 C  CB    . GLN A 1 248 ? 66.369 -19.531 11.792  1.00 11.11  ? 245 GLN A CB    1 
ATOM   1902 C  CG    . GLN A 1 248 ? 67.416 -20.648 12.005  1.00 19.69  ? 245 GLN A CG    1 
ATOM   1903 C  CD    . GLN A 1 248 ? 68.442 -20.294 13.077  1.00 28.93  ? 245 GLN A CD    1 
ATOM   1904 O  OE1   . GLN A 1 248 ? 68.097 -20.181 14.257  1.00 31.07  ? 245 GLN A OE1   1 
ATOM   1905 N  NE2   . GLN A 1 248 ? 69.711 -20.128 12.673  1.00 19.47  ? 245 GLN A NE2   1 
ATOM   1906 N  N     . LEU A 1 249 ? 63.864 -18.134 10.448  1.00 9.27   ? 246 LEU A N     1 
ATOM   1907 C  CA    . LEU A 1 249 ? 62.948 -16.987 10.418  1.00 8.15   ? 246 LEU A CA    1 
ATOM   1908 C  C     . LEU A 1 249 ? 61.498 -17.437 10.602  1.00 7.49   ? 246 LEU A C     1 
ATOM   1909 O  O     . LEU A 1 249 ? 60.735 -16.852 11.379  1.00 8.12   ? 246 LEU A O     1 
ATOM   1910 C  CB    . LEU A 1 249 ? 63.104 -16.189 9.102   1.00 4.74   ? 246 LEU A CB    1 
ATOM   1911 C  CG    . LEU A 1 249 ? 62.154 -15.009 8.868   1.00 12.45  ? 246 LEU A CG    1 
ATOM   1912 C  CD1   . LEU A 1 249 ? 62.375 -13.939 9.937   1.00 12.04  ? 246 LEU A CD1   1 
ATOM   1913 C  CD2   . LEU A 1 249 ? 62.300 -14.417 7.446   1.00 11.55  ? 246 LEU A CD2   1 
ATOM   1914 N  N     . PHE A 1 250 ? 61.118 -18.491 9.894   1.00 8.20   ? 247 PHE A N     1 
ATOM   1915 C  CA    . PHE A 1 250 ? 59.748 -18.992 9.982   1.00 9.38   ? 247 PHE A CA    1 
ATOM   1916 C  C     . PHE A 1 250 ? 59.433 -19.765 11.272  1.00 8.56   ? 247 PHE A C     1 
ATOM   1917 O  O     . PHE A 1 250 ? 58.264 -19.947 11.608  1.00 7.78   ? 247 PHE A O     1 
ATOM   1918 C  CB    . PHE A 1 250 ? 59.412 -19.859 8.764   1.00 7.53   ? 247 PHE A CB    1 
ATOM   1919 C  CG    . PHE A 1 250 ? 59.035 -19.066 7.533   1.00 6.70   ? 247 PHE A CG    1 
ATOM   1920 C  CD1   . PHE A 1 250 ? 58.522 -19.710 6.412   1.00 8.05   ? 247 PHE A CD1   1 
ATOM   1921 C  CD2   . PHE A 1 250 ? 59.204 -17.683 7.496   1.00 10.85  ? 247 PHE A CD2   1 
ATOM   1922 C  CE1   . PHE A 1 250 ? 58.169 -18.983 5.273   1.00 11.27  ? 247 PHE A CE1   1 
ATOM   1923 C  CE2   . PHE A 1 250 ? 58.857 -16.943 6.366   1.00 9.29   ? 247 PHE A CE2   1 
ATOM   1924 C  CZ    . PHE A 1 250 ? 58.341 -17.588 5.256   1.00 9.25   ? 247 PHE A CZ    1 
ATOM   1925 N  N     . SER A 1 251 ? 60.460 -20.214 11.990  1.00 8.41   ? 248 SER A N     1 
ATOM   1926 C  CA    . SER A 1 251 ? 60.231 -21.084 13.142  1.00 7.37   ? 248 SER A CA    1 
ATOM   1927 C  C     . SER A 1 251 ? 59.484 -20.348 14.265  1.00 10.10  ? 248 SER A C     1 
ATOM   1928 O  O     . SER A 1 251 ? 58.833 -20.981 15.104  1.00 7.68   ? 248 SER A O     1 
ATOM   1929 C  CB    . SER A 1 251 ? 61.556 -21.669 13.677  1.00 7.88   ? 248 SER A CB    1 
ATOM   1930 O  OG    . SER A 1 251 ? 62.314 -20.687 14.374  1.00 7.23   ? 248 SER A OG    1 
ATOM   1931 N  N     . GLN A 1 252 ? 59.584 -19.018 14.288  1.00 7.37   ? 249 GLN A N     1 
ATOM   1932 C  CA    . GLN A 1 252 ? 58.871 -18.240 15.297  1.00 8.55   ? 249 GLN A CA    1 
ATOM   1933 C  C     . GLN A 1 252 ? 58.024 -17.133 14.684  1.00 13.96  ? 249 GLN A C     1 
ATOM   1934 O  O     . GLN A 1 252 ? 57.700 -16.152 15.357  1.00 11.77  ? 249 GLN A O     1 
ATOM   1935 C  CB    . GLN A 1 252 ? 59.842 -17.596 16.284  1.00 11.33  ? 249 GLN A CB    1 
ATOM   1936 C  CG    . GLN A 1 252 ? 60.648 -18.563 17.098  1.00 11.42  ? 249 GLN A CG    1 
ATOM   1937 C  CD    . GLN A 1 252 ? 61.495 -17.833 18.107  1.00 23.11  ? 249 GLN A CD    1 
ATOM   1938 O  OE1   . GLN A 1 252 ? 61.102 -17.672 19.263  1.00 19.19  ? 249 GLN A OE1   1 
ATOM   1939 N  NE2   . GLN A 1 252 ? 62.654 -17.350 17.666  1.00 17.24  ? 249 GLN A NE2   1 
ATOM   1940 N  N     . MET A 1 253 ? 57.693 -17.285 13.408  1.00 9.36   ? 250 MET A N     1 
ATOM   1941 C  CA    . MET A 1 253 ? 56.998 -16.244 12.673  1.00 9.75   ? 250 MET A CA    1 
ATOM   1942 C  C     . MET A 1 253 ? 55.516 -16.549 12.734  1.00 9.58   ? 250 MET A C     1 
ATOM   1943 O  O     . MET A 1 253 ? 55.067 -17.520 12.144  1.00 8.40   ? 250 MET A O     1 
ATOM   1944 C  CB    . MET A 1 253 ? 57.464 -16.215 11.206  1.00 7.72   ? 250 MET A CB    1 
ATOM   1945 C  CG    . MET A 1 253 ? 56.786 -15.120 10.347  1.00 12.70  ? 250 MET A CG    1 
ATOM   1946 S  SD    . MET A 1 253 ? 57.160 -13.435 10.884  1.00 16.98  ? 250 MET A SD    1 
ATOM   1947 C  CE    . MET A 1 253 ? 58.941 -13.355 10.597  1.00 12.45  ? 250 MET A CE    1 
ATOM   1948 N  N     . PRO A 1 254 ? 54.746 -15.711 13.441  1.00 11.52  ? 251 PRO A N     1 
ATOM   1949 C  CA    . PRO A 1 254 ? 53.295 -15.945 13.481  1.00 10.92  ? 251 PRO A CA    1 
ATOM   1950 C  C     . PRO A 1 254 ? 52.721 -15.978 12.063  1.00 10.53  ? 251 PRO A C     1 
ATOM   1951 O  O     . PRO A 1 254 ? 53.101 -15.173 11.224  1.00 9.03   ? 251 PRO A O     1 
ATOM   1952 C  CB    . PRO A 1 254 ? 52.756 -14.733 14.251  1.00 12.36  ? 251 PRO A CB    1 
ATOM   1953 C  CG    . PRO A 1 254 ? 53.951 -14.188 15.012  1.00 18.38  ? 251 PRO A CG    1 
ATOM   1954 C  CD    . PRO A 1 254 ? 55.131 -14.451 14.100  1.00 13.21  ? 251 PRO A CD    1 
ATOM   1955 N  N     . ILE A 1 255 ? 51.832 -16.928 11.809  1.00 11.06  ? 252 ILE A N     1 
ATOM   1956 C  CA    . ILE A 1 255 ? 51.239 -17.100 10.492  1.00 8.87   ? 252 ILE A CA    1 
ATOM   1957 C  C     . ILE A 1 255 ? 50.653 -15.808 9.899   1.00 14.50  ? 252 ILE A C     1 
ATOM   1958 O  O     . ILE A 1 255 ? 50.798 -15.556 8.696   1.00 9.17   ? 252 ILE A O     1 
ATOM   1959 C  CB    . ILE A 1 255 ? 50.225 -18.271 10.520  1.00 14.87  ? 252 ILE A CB    1 
ATOM   1960 C  CG1   . ILE A 1 255 ? 51.004 -19.597 10.604  1.00 17.88  ? 252 ILE A CG1   1 
ATOM   1961 C  CG2   . ILE A 1 255 ? 49.307 -18.253 9.292   1.00 13.59  ? 252 ILE A CG2   1 
ATOM   1962 C  CD1   . ILE A 1 255 ? 50.201 -20.766 11.113  1.00 13.24  ? 252 ILE A CD1   1 
ATOM   1963 N  N     . ARG A 1 256 ? 50.047 -14.973 10.748  1.00 7.86   ? 253 ARG A N     1 
ATOM   1964 C  CA    . ARG A 1 256 ? 49.343 -13.783 10.285  1.00 11.47  ? 253 ARG A CA    1 
ATOM   1965 C  C     . ARG A 1 256 ? 50.266 -12.729 9.677   1.00 14.15  ? 253 ARG A C     1 
ATOM   1966 O  O     . ARG A 1 256 ? 49.793 -11.794 9.032   1.00 11.98  ? 253 ARG A O     1 
ATOM   1967 C  CB    . ARG A 1 256 ? 48.554 -13.150 11.432  1.00 9.22   ? 253 ARG A CB    1 
ATOM   1968 C  CG    . ARG A 1 256 ? 49.446 -12.588 12.521  1.00 11.72  ? 253 ARG A CG    1 
ATOM   1969 C  CD    . ARG A 1 256 ? 48.639 -11.943 13.659  1.00 18.37  ? 253 ARG A CD    1 
ATOM   1970 N  NE    . ARG A 1 256 ? 49.511 -11.493 14.748  1.00 18.56  ? 253 ARG A NE    1 
ATOM   1971 C  CZ    . ARG A 1 256 ? 49.890 -12.245 15.785  1.00 23.17  ? 253 ARG A CZ    1 
ATOM   1972 N  NH1   . ARG A 1 256 ? 49.468 -13.502 15.902  1.00 17.41  ? 253 ARG A NH1   1 
ATOM   1973 N  NH2   . ARG A 1 256 ? 50.697 -11.734 16.712  1.00 21.12  ? 253 ARG A NH2   1 
ATOM   1974 N  N     . LYS A 1 257 ? 51.575 -12.867 9.895   1.00 11.95  ? 254 LYS A N     1 
ATOM   1975 C  CA    . LYS A 1 257 ? 52.543 -11.898 9.377   1.00 12.69  ? 254 LYS A CA    1 
ATOM   1976 C  C     . LYS A 1 257 ? 52.818 -12.056 7.884   1.00 14.93  ? 254 LYS A C     1 
ATOM   1977 O  O     . LYS A 1 257 ? 53.348 -11.142 7.245   1.00 9.37   ? 254 LYS A O     1 
ATOM   1978 C  CB    . LYS A 1 257 ? 53.868 -12.008 10.139  1.00 12.80  ? 254 LYS A CB    1 
ATOM   1979 C  CG    . LYS A 1 257 ? 53.726 -11.881 11.640  1.00 19.13  ? 254 LYS A CG    1 
ATOM   1980 C  CD    . LYS A 1 257 ? 53.209 -10.515 12.055  1.00 18.90  ? 254 LYS A CD    1 
ATOM   1981 C  CE    . LYS A 1 257 ? 53.123 -10.436 13.595  1.00 30.50  ? 254 LYS A CE    1 
ATOM   1982 N  NZ    . LYS A 1 257 ? 52.609 -9.135  14.126  1.00 25.12  ? 254 LYS A NZ    1 
ATOM   1983 N  N     . ILE A 1 258 ? 52.488 -13.224 7.334   1.00 9.33   ? 255 ILE A N     1 
ATOM   1984 C  CA    . ILE A 1 258 ? 52.728 -13.490 5.911   1.00 9.07   ? 255 ILE A CA    1 
ATOM   1985 C  C     . ILE A 1 258 ? 51.580 -12.942 5.048   1.00 13.27  ? 255 ILE A C     1 
ATOM   1986 O  O     . ILE A 1 258 ? 50.409 -13.150 5.342   1.00 12.49  ? 255 ILE A O     1 
ATOM   1987 C  CB    . ILE A 1 258 ? 52.928 -14.992 5.645   1.00 11.60  ? 255 ILE A CB    1 
ATOM   1988 C  CG1   . ILE A 1 258 ? 54.377 -15.407 5.946   1.00 19.78  ? 255 ILE A CG1   1 
ATOM   1989 C  CG2   . ILE A 1 258 ? 52.622 -15.340 4.198   1.00 10.72  ? 255 ILE A CG2   1 
ATOM   1990 C  CD1   . ILE A 1 258 ? 54.807 -15.182 7.359   1.00 14.71  ? 255 ILE A CD1   1 
ATOM   1991 N  N     . ARG A 1 259 ? 51.923 -12.253 3.972   1.00 11.88  ? 256 ARG A N     1 
ATOM   1992 C  CA    . ARG A 1 259 ? 50.916 -11.583 3.160   1.00 11.60  ? 256 ARG A CA    1 
ATOM   1993 C  C     . ARG A 1 259 ? 49.853 -12.548 2.620   1.00 12.86  ? 256 ARG A C     1 
ATOM   1994 O  O     . ARG A 1 259 ? 50.180 -13.572 2.013   1.00 13.52  ? 256 ARG A O     1 
ATOM   1995 C  CB    . ARG A 1 259 ? 51.588 -10.828 2.013   1.00 17.81  ? 256 ARG A CB    1 
ATOM   1996 C  CG    . ARG A 1 259 ? 50.638 -9.915  1.263   1.00 21.88  ? 256 ARG A CG    1 
ATOM   1997 C  CD    . ARG A 1 259 ? 50.392 -10.445 -0.122  1.00 35.23  ? 256 ARG A CD    1 
ATOM   1998 N  NE    . ARG A 1 259 ? 51.419 -9.987  -1.048  1.00 44.31  ? 256 ARG A NE    1 
ATOM   1999 C  CZ    . ARG A 1 259 ? 51.650 -10.541 -2.233  1.00 47.18  ? 256 ARG A CZ    1 
ATOM   2000 N  NH1   . ARG A 1 259 ? 50.927 -11.588 -2.628  1.00 51.15  ? 256 ARG A NH1   1 
ATOM   2001 N  NH2   . ARG A 1 259 ? 52.603 -10.051 -3.020  1.00 32.53  ? 256 ARG A NH2   1 
ATOM   2002 N  N     . SER A 1 260 ? 48.594 -12.209 2.892   1.00 13.20  ? 257 SER A N     1 
ATOM   2003 C  CA    . SER A 1 260 ? 47.398 -12.974 2.502   1.00 14.16  ? 257 SER A CA    1 
ATOM   2004 C  C     . SER A 1 260 ? 46.895 -13.885 3.627   1.00 18.30  ? 257 SER A C     1 
ATOM   2005 O  O     . SER A 1 260 ? 45.792 -14.435 3.554   1.00 13.19  ? 257 SER A O     1 
ATOM   2006 C  CB    . SER A 1 260 ? 47.594 -13.752 1.191   1.00 17.11  ? 257 SER A CB    1 
ATOM   2007 O  OG    . SER A 1 260 ? 48.146 -15.042 1.409   1.00 15.53  ? 257 SER A OG    1 
ATOM   2008 N  N     . LEU A 1 261 ? 47.702 -14.025 4.672   1.00 10.07  ? 258 LEU A N     1 
ATOM   2009 C  CA    . LEU A 1 261 ? 47.325 -14.849 5.817   1.00 9.36   ? 258 LEU A CA    1 
ATOM   2010 C  C     . LEU A 1 261 ? 46.930 -14.017 7.042   1.00 10.91  ? 258 LEU A C     1 
ATOM   2011 O  O     . LEU A 1 261 ? 46.762 -14.558 8.142   1.00 11.92  ? 258 LEU A O     1 
ATOM   2012 C  CB    . LEU A 1 261 ? 48.468 -15.812 6.171   1.00 10.84  ? 258 LEU A CB    1 
ATOM   2013 C  CG    . LEU A 1 261 ? 48.851 -16.837 5.089   1.00 13.40  ? 258 LEU A CG    1 
ATOM   2014 C  CD1   . LEU A 1 261 ? 49.915 -17.804 5.602   1.00 9.99   ? 258 LEU A CD1   1 
ATOM   2015 C  CD2   . LEU A 1 261 ? 47.624 -17.619 4.589   1.00 13.78  ? 258 LEU A CD2   1 
ATOM   2016 N  N     . GLY A 1 262 ? 46.786 -12.705 6.863   1.00 12.69  ? 259 GLY A N     1 
ATOM   2017 C  CA    . GLY A 1 262 ? 46.461 -11.828 7.981   1.00 13.39  ? 259 GLY A CA    1 
ATOM   2018 C  C     . GLY A 1 262 ? 44.997 -11.807 8.402   1.00 17.50  ? 259 GLY A C     1 
ATOM   2019 O  O     . GLY A 1 262 ? 44.642 -11.184 9.407   1.00 14.23  ? 259 GLY A O     1 
ATOM   2020 N  N     . GLY A 1 263 ? 44.146 -12.487 7.637   1.00 12.38  ? 260 GLY A N     1 
ATOM   2021 C  CA    . GLY A 1 263 ? 42.710 -12.446 7.861   1.00 13.77  ? 260 GLY A CA    1 
ATOM   2022 C  C     . GLY A 1 263 ? 42.112 -13.801 8.196   1.00 17.53  ? 260 GLY A C     1 
ATOM   2023 O  O     . GLY A 1 263 ? 42.668 -14.550 9.008   1.00 11.61  ? 260 GLY A O     1 
ATOM   2024 N  N     . LYS A 1 264 ? 40.982 -14.122 7.571   1.00 15.63  ? 261 LYS A N     1 
ATOM   2025 C  CA    . LYS A 1 264 ? 40.223 -15.321 7.930   1.00 17.37  ? 261 LYS A CA    1 
ATOM   2026 C  C     . LYS A 1 264 ? 40.938 -16.636 7.577   1.00 15.02  ? 261 LYS A C     1 
ATOM   2027 O  O     . LYS A 1 264 ? 40.888 -17.600 8.356   1.00 14.57  ? 261 LYS A O     1 
ATOM   2028 C  CB    . LYS A 1 264 ? 38.817 -15.291 7.302   1.00 20.40  ? 261 LYS A CB    1 
ATOM   2029 C  CG    . LYS A 1 264 ? 37.882 -14.224 7.893   1.00 23.24  ? 261 LYS A CG    1 
ATOM   2030 C  CD    . LYS A 1 264 ? 36.473 -14.298 7.252   1.00 22.92  ? 261 LYS A CD    1 
ATOM   2031 C  CE    . LYS A 1 264 ? 35.588 -13.129 7.682   1.00 36.48  ? 261 LYS A CE    1 
ATOM   2032 N  NZ    . LYS A 1 264 ? 34.176 -13.272 7.210   1.00 30.90  ? 261 LYS A NZ    1 
ATOM   2033 N  N     . LEU A 1 265 ? 41.591 -16.683 6.416   1.00 9.62   ? 262 LEU A N     1 
ATOM   2034 C  CA    . LEU A 1 265 ? 42.309 -17.900 6.009   1.00 15.01  ? 262 LEU A CA    1 
ATOM   2035 C  C     . LEU A 1 265 ? 43.406 -18.230 7.018   1.00 12.60  ? 262 LEU A C     1 
ATOM   2036 O  O     . LEU A 1 265 ? 43.550 -19.384 7.436   1.00 13.58  ? 262 LEU A O     1 
ATOM   2037 C  CB    . LEU A 1 265 ? 42.920 -17.755 4.613   1.00 11.48  ? 262 LEU A CB    1 
ATOM   2038 C  CG    . LEU A 1 265 ? 43.803 -18.886 4.046   1.00 10.93  ? 262 LEU A CG    1 
ATOM   2039 C  CD1   . LEU A 1 265 ? 43.021 -20.203 3.938   1.00 15.68  ? 262 LEU A CD1   1 
ATOM   2040 C  CD2   . LEU A 1 265 ? 44.391 -18.500 2.678   1.00 8.80   ? 262 LEU A CD2   1 
ATOM   2041 N  N     . GLY A 1 266 ? 44.181 -17.217 7.398   1.00 11.76  ? 263 GLY A N     1 
ATOM   2042 C  CA    . GLY A 1 266 ? 45.247 -17.397 8.365   1.00 15.27  ? 263 GLY A CA    1 
ATOM   2043 C  C     . GLY A 1 266 ? 44.693 -17.867 9.691   1.00 15.22  ? 263 GLY A C     1 
ATOM   2044 O  O     . GLY A 1 266 ? 45.281 -18.727 10.360  1.00 14.24  ? 263 GLY A O     1 
ATOM   2045 N  N     . ALA A 1 267 ? 43.547 -17.304 10.070  1.00 11.78  ? 264 ALA A N     1 
ATOM   2046 C  CA    . ALA A 1 267 ? 42.869 -17.708 11.297  1.00 15.87  ? 264 ALA A CA    1 
ATOM   2047 C  C     . ALA A 1 267 ? 42.494 -19.176 11.233  1.00 11.28  ? 264 ALA A C     1 
ATOM   2048 O  O     . ALA A 1 267 ? 42.631 -19.893 12.223  1.00 14.92  ? 264 ALA A O     1 
ATOM   2049 C  CB    . ALA A 1 267 ? 41.625 -16.847 11.553  1.00 15.85  ? 264 ALA A CB    1 
ATOM   2050 N  N     . SER A 1 268 ? 42.022 -19.642 10.079  1.00 14.30  ? 265 SER A N     1 
ATOM   2051 C  CA    . SER A 1 268 ? 41.618 -21.050 9.988   1.00 13.23  ? 265 SER A CA    1 
ATOM   2052 C  C     . SER A 1 268 ? 42.827 -21.977 9.949   1.00 12.48  ? 265 SER A C     1 
ATOM   2053 O  O     . SER A 1 268 ? 42.758 -23.092 10.452  1.00 10.67  ? 265 SER A O     1 
ATOM   2054 C  CB    . SER A 1 268 ? 40.714 -21.339 8.784   1.00 12.88  ? 265 SER A CB    1 
ATOM   2055 O  OG    A SER A 1 268 ? 40.121 -20.166 8.266   0.50 17.35  ? 265 SER A OG    1 
ATOM   2056 O  OG    B SER A 1 268 ? 41.372 -21.045 7.569   0.50 11.05  ? 265 SER A OG    1 
ATOM   2057 N  N     . VAL A 1 269 ? 43.918 -21.534 9.331   1.00 10.80  ? 266 VAL A N     1 
ATOM   2058 C  CA    . VAL A 1 269 ? 45.138 -22.349 9.323   1.00 6.90   ? 266 VAL A CA    1 
ATOM   2059 C  C     . VAL A 1 269 ? 45.537 -22.644 10.778  1.00 13.83  ? 266 VAL A C     1 
ATOM   2060 O  O     . VAL A 1 269 ? 45.762 -23.793 11.167  1.00 12.70  ? 266 VAL A O     1 
ATOM   2061 C  CB    . VAL A 1 269 ? 46.296 -21.660 8.564   1.00 11.86  ? 266 VAL A CB    1 
ATOM   2062 C  CG1   . VAL A 1 269 ? 47.603 -22.430 8.779   1.00 9.37   ? 266 VAL A CG1   1 
ATOM   2063 C  CG2   . VAL A 1 269 ? 45.972 -21.563 7.066   1.00 9.80   ? 266 VAL A CG2   1 
ATOM   2064 N  N     . ILE A 1 270 ? 45.577 -21.597 11.591  1.00 13.53  ? 267 ILE A N     1 
ATOM   2065 C  CA    . ILE A 1 270 ? 45.928 -21.736 13.000  1.00 12.79  ? 267 ILE A CA    1 
ATOM   2066 C  C     . ILE A 1 270 ? 44.944 -22.636 13.748  1.00 14.36  ? 267 ILE A C     1 
ATOM   2067 O  O     . ILE A 1 270 ? 45.351 -23.537 14.506  1.00 18.02  ? 267 ILE A O     1 
ATOM   2068 C  CB    . ILE A 1 270 ? 45.995 -20.353 13.667  1.00 12.49  ? 267 ILE A CB    1 
ATOM   2069 C  CG1   . ILE A 1 270 ? 47.220 -19.582 13.151  1.00 11.58  ? 267 ILE A CG1   1 
ATOM   2070 C  CG2   . ILE A 1 270 ? 46.041 -20.485 15.181  1.00 21.33  ? 267 ILE A CG2   1 
ATOM   2071 C  CD1   . ILE A 1 270 ? 47.082 -18.083 13.260  1.00 18.71  ? 267 ILE A CD1   1 
ATOM   2072 N  N     . GLU A 1 271 ? 43.651 -22.395 13.537  1.00 12.09  ? 268 GLU A N     1 
ATOM   2073 C  CA    . GLU A 1 271 ? 42.607 -23.131 14.254  1.00 13.05  ? 268 GLU A CA    1 
ATOM   2074 C  C     . GLU A 1 271 ? 42.534 -24.597 13.838  1.00 16.15  ? 268 GLU A C     1 
ATOM   2075 O  O     . GLU A 1 271 ? 42.561 -25.498 14.677  1.00 15.25  ? 268 GLU A O     1 
ATOM   2076 C  CB    . GLU A 1 271 ? 41.241 -22.470 14.044  1.00 20.20  ? 268 GLU A CB    1 
ATOM   2077 C  CG    . GLU A 1 271 ? 40.084 -23.296 14.605  0.88 27.88  ? 268 GLU A CG    1 
ATOM   2078 C  CD    . GLU A 1 271 ? 38.737 -22.629 14.407  0.35 25.99  ? 268 GLU A CD    1 
ATOM   2079 O  OE1   . GLU A 1 271 ? 38.405 -22.286 13.253  0.00 24.42  ? 268 GLU A OE1   1 
ATOM   2080 O  OE2   . GLU A 1 271 ? 38.014 -22.444 15.406  0.89 31.90  ? 268 GLU A OE2   1 
ATOM   2081 N  N     . ILE A 1 272 ? 42.457 -24.836 12.534  1.00 13.38  ? 269 ILE A N     1 
ATOM   2082 C  CA    . ILE A 1 272 ? 42.315 -26.192 12.023  1.00 10.75  ? 269 ILE A CA    1 
ATOM   2083 C  C     . ILE A 1 272 ? 43.541 -27.054 12.307  1.00 16.42  ? 269 ILE A C     1 
ATOM   2084 O  O     . ILE A 1 272 ? 43.420 -28.229 12.674  1.00 12.57  ? 269 ILE A O     1 
ATOM   2085 C  CB    . ILE A 1 272 ? 42.012 -26.190 10.496  1.00 11.81  ? 269 ILE A CB    1 
ATOM   2086 C  CG1   . ILE A 1 272 ? 40.624 -25.605 10.231  1.00 15.73  ? 269 ILE A CG1   1 
ATOM   2087 C  CG2   . ILE A 1 272 ? 42.097 -27.593 9.921   1.00 12.81  ? 269 ILE A CG2   1 
ATOM   2088 C  CD1   . ILE A 1 272 ? 40.295 -25.451 8.742   1.00 21.81  ? 269 ILE A CD1   1 
ATOM   2089 N  N     . LEU A 1 273 ? 44.729 -26.488 12.126  1.00 12.64  ? 270 LEU A N     1 
ATOM   2090 C  CA    . LEU A 1 273 ? 45.940 -27.291 12.255  1.00 14.11  ? 270 LEU A CA    1 
ATOM   2091 C  C     . LEU A 1 273 ? 46.504 -27.282 13.673  1.00 12.89  ? 270 LEU A C     1 
ATOM   2092 O  O     . LEU A 1 273 ? 47.357 -28.109 14.014  1.00 12.77  ? 270 LEU A O     1 
ATOM   2093 C  CB    . LEU A 1 273 ? 47.007 -26.816 11.271  1.00 15.32  ? 270 LEU A CB    1 
ATOM   2094 C  CG    . LEU A 1 273 ? 46.624 -26.883 9.797   1.00 14.38  ? 270 LEU A CG    1 
ATOM   2095 C  CD1   . LEU A 1 273 ? 47.797 -26.407 8.953   1.00 14.42  ? 270 LEU A CD1   1 
ATOM   2096 C  CD2   . LEU A 1 273 ? 46.228 -28.307 9.416   1.00 13.14  ? 270 LEU A CD2   1 
ATOM   2097 N  N     . GLY A 1 274 ? 46.029 -26.348 14.488  1.00 11.81  ? 271 GLY A N     1 
ATOM   2098 C  CA    . GLY A 1 274 ? 46.495 -26.214 15.861  1.00 12.49  ? 271 GLY A CA    1 
ATOM   2099 C  C     . GLY A 1 274 ? 47.945 -25.778 15.946  1.00 16.85  ? 271 GLY A C     1 
ATOM   2100 O  O     . GLY A 1 274 ? 48.686 -26.244 16.812  1.00 20.08  ? 271 GLY A O     1 
ATOM   2101 N  N     . ILE A 1 275 ? 48.352 -24.880 15.051  1.00 13.16  ? 272 ILE A N     1 
ATOM   2102 C  CA    . ILE A 1 275 ? 49.729 -24.383 15.028  1.00 11.20  ? 272 ILE A CA    1 
ATOM   2103 C  C     . ILE A 1 275 ? 49.750 -22.860 15.209  1.00 10.96  ? 272 ILE A C     1 
ATOM   2104 O  O     . ILE A 1 275 ? 48.706 -22.219 15.162  1.00 12.83  ? 272 ILE A O     1 
ATOM   2105 C  CB    . ILE A 1 275 ? 50.446 -24.749 13.696  1.00 11.47  ? 272 ILE A CB    1 
ATOM   2106 C  CG1   . ILE A 1 275 ? 49.748 -24.082 12.493  1.00 9.88   ? 272 ILE A CG1   1 
ATOM   2107 C  CG2   . ILE A 1 275 ? 50.547 -26.270 13.541  1.00 11.79  ? 272 ILE A CG2   1 
ATOM   2108 C  CD1   . ILE A 1 275 ? 50.461 -24.350 11.149  1.00 12.86  ? 272 ILE A CD1   1 
ATOM   2109 N  N     . GLU A 1 276 ? 50.937 -22.286 15.406  1.00 7.82   ? 273 GLU A N     1 
ATOM   2110 C  CA    . GLU A 1 276 ? 51.069 -20.834 15.543  1.00 11.42  ? 273 GLU A CA    1 
ATOM   2111 C  C     . GLU A 1 276 ? 52.010 -20.205 14.512  1.00 12.91  ? 273 GLU A C     1 
ATOM   2112 O  O     . GLU A 1 276 ? 51.819 -19.058 14.120  1.00 13.12  ? 273 GLU A O     1 
ATOM   2113 C  CB    . GLU A 1 276 ? 51.572 -20.456 16.948  1.00 14.41  ? 273 GLU A CB    1 
ATOM   2114 C  CG    . GLU A 1 276 ? 50.624 -20.798 18.087  1.00 20.72  ? 273 GLU A CG    1 
ATOM   2115 C  CD    . GLU A 1 276 ? 51.275 -20.622 19.460  1.00 44.01  ? 273 GLU A CD    1 
ATOM   2116 O  OE1   . GLU A 1 276 ? 51.041 -21.471 20.352  1.00 50.59  ? 273 GLU A OE1   1 
ATOM   2117 O  OE2   . GLU A 1 276 ? 52.018 -19.631 19.649  1.00 38.70  ? 273 GLU A OE2   1 
ATOM   2118 N  N     . TYR A 1 277 ? 53.036 -20.944 14.096  1.00 11.58  ? 274 TYR A N     1 
ATOM   2119 C  CA    . TYR A 1 277 ? 54.124 -20.353 13.316  1.00 10.42  ? 274 TYR A CA    1 
ATOM   2120 C  C     . TYR A 1 277 ? 54.187 -20.909 11.909  1.00 6.60   ? 274 TYR A C     1 
ATOM   2121 O  O     . TYR A 1 277 ? 53.848 -22.073 11.675  1.00 8.88   ? 274 TYR A O     1 
ATOM   2122 C  CB    . TYR A 1 277 ? 55.473 -20.583 14.013  1.00 7.14   ? 274 TYR A CB    1 
ATOM   2123 C  CG    . TYR A 1 277 ? 55.482 -20.074 15.436  1.00 9.42   ? 274 TYR A CG    1 
ATOM   2124 C  CD1   . TYR A 1 277 ? 55.729 -20.932 16.506  1.00 13.92  ? 274 TYR A CD1   1 
ATOM   2125 C  CD2   . TYR A 1 277 ? 55.201 -18.742 15.710  1.00 10.36  ? 274 TYR A CD2   1 
ATOM   2126 C  CE1   . TYR A 1 277 ? 55.719 -20.465 17.822  1.00 15.49  ? 274 TYR A CE1   1 
ATOM   2127 C  CE2   . TYR A 1 277 ? 55.180 -18.262 17.014  1.00 14.05  ? 274 TYR A CE2   1 
ATOM   2128 C  CZ    . TYR A 1 277 ? 55.442 -19.132 18.070  1.00 20.34  ? 274 TYR A CZ    1 
ATOM   2129 O  OH    . TYR A 1 277 ? 55.421 -18.668 19.375  1.00 19.93  ? 274 TYR A OH    1 
ATOM   2130 N  N     . MET A 1 278 ? 54.684 -20.086 10.992  1.00 6.25   ? 275 MET A N     1 
ATOM   2131 C  CA    . MET A 1 278 ? 54.763 -20.444 9.581   1.00 8.92   ? 275 MET A CA    1 
ATOM   2132 C  C     . MET A 1 278 ? 55.564 -21.737 9.352   1.00 9.17   ? 275 MET A C     1 
ATOM   2133 O  O     . MET A 1 278 ? 55.218 -22.552 8.493   1.00 7.50   ? 275 MET A O     1 
ATOM   2134 C  CB    . MET A 1 278 ? 55.386 -19.285 8.793   1.00 9.91   ? 275 MET A CB    1 
ATOM   2135 C  CG    . MET A 1 278 ? 55.089 -19.311 7.310   1.00 19.29  ? 275 MET A CG    1 
ATOM   2136 S  SD    . MET A 1 278 ? 53.346 -19.076 6.897   1.00 16.32  ? 275 MET A SD    1 
ATOM   2137 C  CE    . MET A 1 278 ? 53.439 -19.435 5.143   1.00 21.66  ? 275 MET A CE    1 
ATOM   2138 N  N     . GLY A 1 279 ? 56.624 -21.930 10.132  1.00 7.96   ? 276 GLY A N     1 
ATOM   2139 C  CA    . GLY A 1 279 ? 57.482 -23.088 9.969   1.00 8.67   ? 276 GLY A CA    1 
ATOM   2140 C  C     . GLY A 1 279 ? 56.769 -24.399 10.270  1.00 13.29  ? 276 GLY A C     1 
ATOM   2141 O  O     . GLY A 1 279 ? 57.095 -25.441 9.693   1.00 11.62  ? 276 GLY A O     1 
ATOM   2142 N  N     . GLU A 1 280 ? 55.788 -24.353 11.167  1.00 8.84   ? 277 GLU A N     1 
ATOM   2143 C  CA    . GLU A 1 280 ? 55.083 -25.566 11.567  1.00 9.08   ? 277 GLU A CA    1 
ATOM   2144 C  C     . GLU A 1 280 ? 54.274 -26.160 10.405  1.00 6.85   ? 277 GLU A C     1 
ATOM   2145 O  O     . GLU A 1 280 ? 53.868 -27.325 10.455  1.00 9.79   ? 277 GLU A O     1 
ATOM   2146 C  CB    . GLU A 1 280 ? 54.168 -25.318 12.783  1.00 9.77   ? 277 GLU A CB    1 
ATOM   2147 C  CG    . GLU A 1 280 ? 54.866 -24.781 14.034  1.00 9.12   ? 277 GLU A CG    1 
ATOM   2148 C  CD    . GLU A 1 280 ? 53.890 -24.558 15.192  1.00 14.09  ? 277 GLU A CD    1 
ATOM   2149 O  OE1   . GLU A 1 280 ? 53.577 -23.392 15.518  1.00 12.67  ? 277 GLU A OE1   1 
ATOM   2150 O  OE2   . GLU A 1 280 ? 53.426 -25.551 15.775  1.00 12.30  ? 277 GLU A OE2   1 
ATOM   2151 N  N     . LEU A 1 281 ? 54.034 -25.369 9.365   1.00 4.88   ? 278 LEU A N     1 
ATOM   2152 C  CA    . LEU A 1 281 ? 53.351 -25.881 8.167   1.00 7.95   ? 278 LEU A CA    1 
ATOM   2153 C  C     . LEU A 1 281 ? 54.075 -27.002 7.407   1.00 9.52   ? 278 LEU A C     1 
ATOM   2154 O  O     . LEU A 1 281 ? 53.440 -27.746 6.652   1.00 9.60   ? 278 LEU A O     1 
ATOM   2155 C  CB    . LEU A 1 281 ? 53.034 -24.737 7.193   1.00 7.07   ? 278 LEU A CB    1 
ATOM   2156 C  CG    . LEU A 1 281 ? 51.819 -23.886 7.554   1.00 13.20  ? 278 LEU A CG    1 
ATOM   2157 C  CD1   . LEU A 1 281 ? 51.795 -22.610 6.701   1.00 12.18  ? 278 LEU A CD1   1 
ATOM   2158 C  CD2   . LEU A 1 281 ? 50.524 -24.703 7.366   1.00 7.07   ? 278 LEU A CD2   1 
ATOM   2159 N  N     . THR A 1 282 ? 55.391 -27.100 7.569   1.00 10.54  ? 279 THR A N     1 
ATOM   2160 C  CA    . THR A 1 282 ? 56.183 -28.021 6.755   1.00 12.46  ? 279 THR A CA    1 
ATOM   2161 C  C     . THR A 1 282 ? 55.849 -29.466 7.096   1.00 10.95  ? 279 THR A C     1 
ATOM   2162 O  O     . THR A 1 282 ? 56.162 -30.365 6.341   1.00 12.23  ? 279 THR A O     1 
ATOM   2163 C  CB    . THR A 1 282 ? 57.709 -27.833 6.952   1.00 10.88  ? 279 THR A CB    1 
ATOM   2164 O  OG1   . THR A 1 282 ? 58.051 -28.070 8.329   1.00 11.97  ? 279 THR A OG1   1 
ATOM   2165 C  CG2   . THR A 1 282 ? 58.178 -26.434 6.516   1.00 9.82   ? 279 THR A CG2   1 
ATOM   2166 N  N     . GLN A 1 283 ? 55.210 -29.682 8.240   1.00 9.42   ? 280 GLN A N     1 
ATOM   2167 C  CA    . GLN A 1 283 ? 54.939 -31.031 8.694   1.00 14.68  ? 280 GLN A CA    1 
ATOM   2168 C  C     . GLN A 1 283 ? 53.664 -31.618 8.089   1.00 15.55  ? 280 GLN A C     1 
ATOM   2169 O  O     . GLN A 1 283 ? 53.274 -32.724 8.427   1.00 21.72  ? 280 GLN A O     1 
ATOM   2170 C  CB    . GLN A 1 283 ? 54.879 -31.064 10.223  1.00 13.90  ? 280 GLN A CB    1 
ATOM   2171 C  CG    A GLN A 1 283 ? 53.724 -30.326 10.808  0.50 14.02  ? 280 GLN A CG    1 
ATOM   2172 C  CG    B GLN A 1 283 ? 56.214 -30.782 10.849  0.50 13.62  ? 280 GLN A CG    1 
ATOM   2173 C  CD    A GLN A 1 283 ? 53.888 -30.102 12.291  0.50 17.24  ? 280 GLN A CD    1 
ATOM   2174 C  CD    B GLN A 1 283 ? 57.284 -31.655 10.239  0.50 14.30  ? 280 GLN A CD    1 
ATOM   2175 O  OE1   A GLN A 1 283 ? 54.377 -30.977 13.016  0.50 23.85  ? 280 GLN A OE1   1 
ATOM   2176 O  OE1   B GLN A 1 283 ? 57.237 -32.882 10.360  0.50 11.70  ? 280 GLN A OE1   1 
ATOM   2177 N  NE2   A GLN A 1 283 ? 53.483 -28.930 12.755  0.50 9.21   ? 280 GLN A NE2   1 
ATOM   2178 N  NE2   B GLN A 1 283 ? 58.240 -31.035 9.553   0.50 13.64  ? 280 GLN A NE2   1 
ATOM   2179 N  N     . PHE A 1 284 ? 53.024 -30.878 7.189   1.00 9.28   ? 281 PHE A N     1 
ATOM   2180 C  CA    . PHE A 1 284 ? 51.844 -31.383 6.515   1.00 12.16  ? 281 PHE A CA    1 
ATOM   2181 C  C     . PHE A 1 284 ? 52.117 -31.674 5.037   1.00 14.38  ? 281 PHE A C     1 
ATOM   2182 O  O     . PHE A 1 284 ? 52.911 -30.987 4.401   1.00 13.85  ? 281 PHE A O     1 
ATOM   2183 C  CB    . PHE A 1 284 ? 50.704 -30.392 6.674   1.00 8.96   ? 281 PHE A CB    1 
ATOM   2184 C  CG    . PHE A 1 284 ? 50.395 -30.080 8.100   1.00 10.53  ? 281 PHE A CG    1 
ATOM   2185 C  CD1   . PHE A 1 284 ? 49.469 -30.841 8.806   1.00 14.99  ? 281 PHE A CD1   1 
ATOM   2186 C  CD2   . PHE A 1 284 ? 51.050 -29.049 8.751   1.00 10.23  ? 281 PHE A CD2   1 
ATOM   2187 C  CE1   . PHE A 1 284 ? 49.184 -30.557 10.139  1.00 20.97  ? 281 PHE A CE1   1 
ATOM   2188 C  CE2   . PHE A 1 284 ? 50.771 -28.766 10.086  1.00 12.25  ? 281 PHE A CE2   1 
ATOM   2189 C  CZ    . PHE A 1 284 ? 49.842 -29.516 10.776  1.00 18.15  ? 281 PHE A CZ    1 
ATOM   2190 N  N     . THR A 1 285 ? 51.470 -32.698 4.492   1.00 11.30  ? 282 THR A N     1 
ATOM   2191 C  CA    . THR A 1 285 ? 51.645 -32.964 3.068   1.00 16.31  ? 282 THR A CA    1 
ATOM   2192 C  C     . THR A 1 285 ? 50.874 -31.935 2.260   1.00 8.93   ? 282 THR A C     1 
ATOM   2193 O  O     . THR A 1 285 ? 49.977 -31.277 2.775   1.00 12.88  ? 282 THR A O     1 
ATOM   2194 C  CB    . THR A 1 285 ? 51.156 -34.357 2.672   1.00 12.01  ? 282 THR A CB    1 
ATOM   2195 O  OG1   . THR A 1 285 ? 49.743 -34.416 2.856   1.00 9.44   ? 282 THR A OG1   1 
ATOM   2196 C  CG2   . THR A 1 285 ? 51.830 -35.420 3.524   1.00 14.48  ? 282 THR A CG2   1 
ATOM   2197 N  N     . GLU A 1 286 ? 51.228 -31.788 0.988   1.00 12.16  ? 283 GLU A N     1 
ATOM   2198 C  CA    . GLU A 1 286 ? 50.482 -30.891 0.116   1.00 14.48  ? 283 GLU A CA    1 
ATOM   2199 C  C     . GLU A 1 286 ? 49.009 -31.316 0.070   1.00 13.65  ? 283 GLU A C     1 
ATOM   2200 O  O     . GLU A 1 286 ? 48.116 -30.471 0.138   1.00 10.73  ? 283 GLU A O     1 
ATOM   2201 C  CB    . GLU A 1 286 ? 51.103 -30.849 -1.287  1.00 11.72  ? 283 GLU A CB    1 
ATOM   2202 C  CG    . GLU A 1 286 ? 50.542 -29.741 -2.174  1.00 13.06  ? 283 GLU A CG    1 
ATOM   2203 C  CD    . GLU A 1 286 ? 51.240 -29.685 -3.531  1.00 21.74  ? 283 GLU A CD    1 
ATOM   2204 O  OE1   . GLU A 1 286 ? 52.133 -30.519 -3.769  1.00 18.80  ? 283 GLU A OE1   1 
ATOM   2205 O  OE2   . GLU A 1 286 ? 50.900 -28.806 -4.352  1.00 17.44  ? 283 GLU A OE2   1 
ATOM   2206 N  N     . SER A 1 287 ? 48.753 -32.627 -0.003  1.00 11.87  ? 284 SER A N     1 
ATOM   2207 C  CA    . SER A 1 287 ? 47.368 -33.119 -0.022  1.00 14.98  ? 284 SER A CA    1 
ATOM   2208 C  C     . SER A 1 287 ? 46.594 -32.695 1.230   1.00 11.48  ? 284 SER A C     1 
ATOM   2209 O  O     . SER A 1 287 ? 45.456 -32.242 1.141   1.00 13.33  ? 284 SER A O     1 
ATOM   2210 C  CB    . SER A 1 287 ? 47.315 -34.651 -0.196  1.00 13.99  ? 284 SER A CB    1 
ATOM   2211 O  OG    . SER A 1 287 ? 47.836 -35.034 -1.463  1.00 20.83  ? 284 SER A OG    1 
ATOM   2212 N  N     . GLN A 1 288 ? 47.217 -32.841 2.399   1.00 12.22  ? 285 GLN A N     1 
ATOM   2213 C  CA    . GLN A 1 288 ? 46.574 -32.424 3.641   1.00 11.18  ? 285 GLN A CA    1 
ATOM   2214 C  C     . GLN A 1 288 ? 46.185 -30.949 3.602   1.00 11.43  ? 285 GLN A C     1 
ATOM   2215 O  O     . GLN A 1 288 ? 45.060 -30.584 3.933   1.00 11.93  ? 285 GLN A O     1 
ATOM   2216 C  CB    . GLN A 1 288 ? 47.482 -32.681 4.840   1.00 9.97   ? 285 GLN A CB    1 
ATOM   2217 C  CG    . GLN A 1 288 ? 47.589 -34.137 5.216   1.00 17.80  ? 285 GLN A CG    1 
ATOM   2218 C  CD    . GLN A 1 288 ? 48.535 -34.357 6.380   1.00 23.90  ? 285 GLN A CD    1 
ATOM   2219 O  OE1   . GLN A 1 288 ? 49.676 -33.894 6.367   1.00 15.40  ? 285 GLN A OE1   1 
ATOM   2220 N  NE2   . GLN A 1 288 ? 48.054 -35.052 7.409   1.00 28.51  ? 285 GLN A NE2   1 
ATOM   2221 N  N     . LEU A 1 289 ? 47.112 -30.101 3.176   1.00 10.63  ? 286 LEU A N     1 
ATOM   2222 C  CA    . LEU A 1 289 ? 46.825 -28.667 3.125   1.00 9.53   ? 286 LEU A CA    1 
ATOM   2223 C  C     . LEU A 1 289 ? 45.721 -28.359 2.110   1.00 11.49  ? 286 LEU A C     1 
ATOM   2224 O  O     . LEU A 1 289 ? 44.843 -27.519 2.351   1.00 13.37  ? 286 LEU A O     1 
ATOM   2225 C  CB    . LEU A 1 289 ? 48.097 -27.878 2.813   1.00 11.20  ? 286 LEU A CB    1 
ATOM   2226 C  CG    . LEU A 1 289 ? 49.216 -28.017 3.860   1.00 9.19   ? 286 LEU A CG    1 
ATOM   2227 C  CD1   . LEU A 1 289 ? 50.487 -27.305 3.403   1.00 10.71  ? 286 LEU A CD1   1 
ATOM   2228 C  CD2   . LEU A 1 289 ? 48.750 -27.495 5.227   1.00 9.24   ? 286 LEU A CD2   1 
ATOM   2229 N  N     . GLN A 1 290 ? 45.767 -29.036 0.971   1.00 13.82  ? 287 GLN A N     1 
ATOM   2230 C  CA    . GLN A 1 290 ? 44.718 -28.862 -0.025  1.00 14.16  ? 287 GLN A CA    1 
ATOM   2231 C  C     . GLN A 1 290 ? 43.347 -29.304 0.496   1.00 10.67  ? 287 GLN A C     1 
ATOM   2232 O  O     . GLN A 1 290 ? 42.330 -28.693 0.174   1.00 12.76  ? 287 GLN A O     1 
ATOM   2233 C  CB    . GLN A 1 290 ? 45.068 -29.614 -1.307  1.00 14.80  ? 287 GLN A CB    1 
ATOM   2234 C  CG    . GLN A 1 290 ? 46.203 -28.993 -2.103  1.00 13.72  ? 287 GLN A CG    1 
ATOM   2235 C  CD    . GLN A 1 290 ? 46.602 -29.856 -3.278  1.00 17.08  ? 287 GLN A CD    1 
ATOM   2236 O  OE1   . GLN A 1 290 ? 46.608 -31.087 -3.181  1.00 15.65  ? 287 GLN A OE1   1 
ATOM   2237 N  NE2   . GLN A 1 290 ? 46.943 -29.220 -4.398  1.00 16.12  ? 287 GLN A NE2   1 
ATOM   2238 N  N     . SER A 1 291 ? 43.312 -30.361 1.296   1.00 11.79  ? 288 SER A N     1 
ATOM   2239 C  CA    . SER A 1 291 ? 42.033 -30.854 1.815   1.00 13.14  ? 288 SER A CA    1 
ATOM   2240 C  C     . SER A 1 291 ? 41.344 -29.837 2.726   1.00 20.22  ? 288 SER A C     1 
ATOM   2241 O  O     . SER A 1 291 ? 40.118 -29.740 2.735   1.00 26.45  ? 288 SER A O     1 
ATOM   2242 C  CB    . SER A 1 291 ? 42.185 -32.202 2.535   1.00 12.65  ? 288 SER A CB    1 
ATOM   2243 O  OG    . SER A 1 291 ? 42.860 -32.041 3.772   1.00 23.44  ? 288 SER A OG    1 
ATOM   2244 N  N     . HIS A 1 292 ? 42.126 -29.075 3.486   1.00 16.33  ? 289 HIS A N     1 
ATOM   2245 C  CA    . HIS A 1 292 ? 41.551 -28.086 4.397   1.00 13.46  ? 289 HIS A CA    1 
ATOM   2246 C  C     . HIS A 1 292 ? 41.283 -26.736 3.719   1.00 17.01  ? 289 HIS A C     1 
ATOM   2247 O  O     . HIS A 1 292 ? 40.282 -26.082 3.994   1.00 22.53  ? 289 HIS A O     1 
ATOM   2248 C  CB    . HIS A 1 292 ? 42.472 -27.855 5.589   1.00 20.49  ? 289 HIS A CB    1 
ATOM   2249 C  CG    . HIS A 1 292 ? 42.647 -29.051 6.473   1.00 17.11  ? 289 HIS A CG    1 
ATOM   2250 N  ND1   . HIS A 1 292 ? 41.606 -29.620 7.175   1.00 21.60  ? 289 HIS A ND1   1 
ATOM   2251 C  CD2   . HIS A 1 292 ? 43.755 -29.757 6.804   1.00 19.63  ? 289 HIS A CD2   1 
ATOM   2252 C  CE1   . HIS A 1 292 ? 42.061 -30.638 7.884   1.00 16.52  ? 289 HIS A CE1   1 
ATOM   2253 N  NE2   . HIS A 1 292 ? 43.363 -30.740 7.680   1.00 22.91  ? 289 HIS A NE2   1 
ATOM   2254 N  N     . PHE A 1 293 ? 42.187 -26.314 2.842   1.00 15.58  ? 290 PHE A N     1 
ATOM   2255 C  CA    . PHE A 1 293 ? 42.194 -24.922 2.393   1.00 14.22  ? 290 PHE A CA    1 
ATOM   2256 C  C     . PHE A 1 293 ? 41.963 -24.746 0.890   1.00 16.82  ? 290 PHE A C     1 
ATOM   2257 O  O     . PHE A 1 293 ? 41.980 -23.624 0.380   1.00 18.71  ? 290 PHE A O     1 
ATOM   2258 C  CB    . PHE A 1 293 ? 43.502 -24.261 2.849   1.00 13.59  ? 290 PHE A CB    1 
ATOM   2259 C  CG    . PHE A 1 293 ? 43.811 -24.518 4.298   1.00 11.78  ? 290 PHE A CG    1 
ATOM   2260 C  CD1   . PHE A 1 293 ? 42.989 -23.994 5.298   1.00 12.99  ? 290 PHE A CD1   1 
ATOM   2261 C  CD2   . PHE A 1 293 ? 44.884 -25.316 4.669   1.00 11.67  ? 290 PHE A CD2   1 
ATOM   2262 C  CE1   . PHE A 1 293 ? 43.242 -24.245 6.628   1.00 7.62   ? 290 PHE A CE1   1 
ATOM   2263 C  CE2   . PHE A 1 293 ? 45.148 -25.571 6.018   1.00 9.23   ? 290 PHE A CE2   1 
ATOM   2264 C  CZ    . PHE A 1 293 ? 44.326 -25.037 6.989   1.00 10.07  ? 290 PHE A CZ    1 
ATOM   2265 N  N     . GLY A 1 294 ? 41.725 -25.853 0.190   1.00 17.75  ? 291 GLY A N     1 
ATOM   2266 C  CA    . GLY A 1 294 ? 41.450 -25.806 -1.239  1.00 16.97  ? 291 GLY A CA    1 
ATOM   2267 C  C     . GLY A 1 294 ? 42.702 -26.071 -2.046  1.00 19.43  ? 291 GLY A C     1 
ATOM   2268 O  O     . GLY A 1 294 ? 43.808 -25.882 -1.548  1.00 14.17  ? 291 GLY A O     1 
ATOM   2269 N  N     . GLU A 1 295 ? 42.531 -26.503 -3.294  1.00 16.44  ? 292 GLU A N     1 
ATOM   2270 C  CA    . GLU A 1 295 ? 43.653 -26.899 -4.139  1.00 16.97  ? 292 GLU A CA    1 
ATOM   2271 C  C     . GLU A 1 295 ? 44.701 -25.789 -4.261  1.00 16.03  ? 292 GLU A C     1 
ATOM   2272 O  O     . GLU A 1 295 ? 45.881 -26.025 -4.054  1.00 12.61  ? 292 GLU A O     1 
ATOM   2273 C  CB    . GLU A 1 295 ? 43.138 -27.291 -5.525  1.00 23.10  ? 292 GLU A CB    1 
ATOM   2274 C  CG    . GLU A 1 295 ? 44.154 -27.947 -6.427  1.00 24.75  ? 292 GLU A CG    1 
ATOM   2275 C  CD    . GLU A 1 295 ? 43.620 -28.144 -7.847  1.00 44.59  ? 292 GLU A CD    1 
ATOM   2276 O  OE1   . GLU A 1 295 ? 44.381 -27.894 -8.809  1.00 47.95  ? 292 GLU A OE1   1 
ATOM   2277 O  OE2   . GLU A 1 295 ? 42.440 -28.540 -8.007  1.00 37.18  ? 292 GLU A OE2   1 
ATOM   2278 N  N     . LYS A 1 296 ? 44.264 -24.581 -4.600  1.00 14.34  ? 293 LYS A N     1 
ATOM   2279 C  CA    . LYS A 1 296 ? 45.181 -23.457 -4.808  1.00 15.29  ? 293 LYS A CA    1 
ATOM   2280 C  C     . LYS A 1 296 ? 45.895 -23.035 -3.510  1.00 13.30  ? 293 LYS A C     1 
ATOM   2281 O  O     . LYS A 1 296 ? 47.129 -22.989 -3.451  1.00 11.60  ? 293 LYS A O     1 
ATOM   2282 C  CB    . LYS A 1 296 ? 44.432 -22.270 -5.437  1.00 16.16  ? 293 LYS A CB    1 
ATOM   2283 C  CG    . LYS A 1 296 ? 45.307 -21.074 -5.809  1.00 30.82  ? 293 LYS A CG    1 
ATOM   2284 C  CD    . LYS A 1 296 ? 44.553 -20.090 -6.718  1.00 38.49  ? 293 LYS A CD    1 
ATOM   2285 C  CE    . LYS A 1 296 ? 44.863 -18.622 -6.377  1.00 41.17  ? 293 LYS A CE    1 
ATOM   2286 N  NZ    . LYS A 1 296 ? 44.239 -18.175 -5.082  1.00 37.61  ? 293 LYS A NZ    1 
ATOM   2287 N  N     . ASN A 1 297 ? 45.125 -22.734 -2.473  1.00 13.53  ? 294 ASN A N     1 
ATOM   2288 C  CA    . ASN A 1 297 ? 45.710 -22.360 -1.189  1.00 15.07  ? 294 ASN A CA    1 
ATOM   2289 C  C     . ASN A 1 297 ? 46.620 -23.440 -0.622  1.00 16.36  ? 294 ASN A C     1 
ATOM   2290 O  O     . ASN A 1 297 ? 47.649 -23.125 -0.033  1.00 12.25  ? 294 ASN A O     1 
ATOM   2291 C  CB    . ASN A 1 297 ? 44.634 -22.064 -0.146  1.00 19.47  ? 294 ASN A CB    1 
ATOM   2292 C  CG    . ASN A 1 297 ? 43.900 -20.775 -0.413  1.00 19.03  ? 294 ASN A CG    1 
ATOM   2293 O  OD1   . ASN A 1 297 ? 44.432 -19.867 -1.053  1.00 24.10  ? 294 ASN A OD1   1 
ATOM   2294 N  ND2   . ASN A 1 297 ? 42.663 -20.684 0.085   1.00 20.94  ? 294 ASN A ND2   1 
ATOM   2295 N  N     . GLY A 1 298 ? 46.216 -24.701 -0.765  1.00 13.51  ? 295 GLY A N     1 
ATOM   2296 C  CA    . GLY A 1 298 ? 46.988 -25.820 -0.245  1.00 13.45  ? 295 GLY A CA    1 
ATOM   2297 C  C     . GLY A 1 298 ? 48.366 -25.898 -0.881  1.00 13.64  ? 295 GLY A C     1 
ATOM   2298 O  O     . GLY A 1 298 ? 49.385 -26.045 -0.188  1.00 12.36  ? 295 GLY A O     1 
ATOM   2299 N  N     . SER A 1 299 ? 48.395 -25.809 -2.209  1.00 9.15   ? 296 SER A N     1 
ATOM   2300 C  CA    . SER A 1 299 ? 49.650 -25.783 -2.950  1.00 12.74  ? 296 SER A CA    1 
ATOM   2301 C  C     . SER A 1 299 ? 50.480 -24.568 -2.565  1.00 12.13  ? 296 SER A C     1 
ATOM   2302 O  O     . SER A 1 299 ? 51.685 -24.672 -2.353  1.00 10.10  ? 296 SER A O     1 
ATOM   2303 C  CB    . SER A 1 299 ? 49.387 -25.747 -4.462  1.00 17.35  ? 296 SER A CB    1 
ATOM   2304 O  OG    . SER A 1 299 ? 48.890 -26.989 -4.906  1.00 18.33  ? 296 SER A OG    1 
ATOM   2305 N  N     . TRP A 1 300 ? 49.831 -23.412 -2.489  1.00 9.34   ? 297 TRP A N     1 
ATOM   2306 C  CA    . TRP A 1 300 ? 50.537 -22.189 -2.143  1.00 12.28  ? 297 TRP A CA    1 
ATOM   2307 C  C     . TRP A 1 300 ? 51.203 -22.314 -0.763  1.00 11.49  ? 297 TRP A C     1 
ATOM   2308 O  O     . TRP A 1 300 ? 52.391 -22.000 -0.605  1.00 11.78  ? 297 TRP A O     1 
ATOM   2309 C  CB    . TRP A 1 300 ? 49.579 -20.994 -2.190  1.00 11.36  ? 297 TRP A CB    1 
ATOM   2310 C  CG    . TRP A 1 300 ? 50.259 -19.687 -1.951  1.00 13.01  ? 297 TRP A CG    1 
ATOM   2311 C  CD1   . TRP A 1 300 ? 50.909 -18.916 -2.873  1.00 18.11  ? 297 TRP A CD1   1 
ATOM   2312 C  CD2   . TRP A 1 300 ? 50.361 -18.988 -0.698  1.00 12.02  ? 297 TRP A CD2   1 
ATOM   2313 N  NE1   . TRP A 1 300 ? 51.407 -17.773 -2.268  1.00 13.50  ? 297 TRP A NE1   1 
ATOM   2314 C  CE2   . TRP A 1 300 ? 51.086 -17.800 -0.936  1.00 13.20  ? 297 TRP A CE2   1 
ATOM   2315 C  CE3   . TRP A 1 300 ? 49.912 -19.251 0.596   1.00 15.54  ? 297 TRP A CE3   1 
ATOM   2316 C  CZ2   . TRP A 1 300 ? 51.362 -16.884 0.070   1.00 11.13  ? 297 TRP A CZ2   1 
ATOM   2317 C  CZ3   . TRP A 1 300 ? 50.183 -18.338 1.592   1.00 19.63  ? 297 TRP A CZ3   1 
ATOM   2318 C  CH2   . TRP A 1 300 ? 50.912 -17.172 1.326   1.00 11.39  ? 297 TRP A CH2   1 
ATOM   2319 N  N     . LEU A 1 301 ? 50.443 -22.801 0.220   1.00 10.81  ? 298 LEU A N     1 
ATOM   2320 C  CA    . LEU A 1 301 ? 50.951 -22.950 1.588   1.00 11.17  ? 298 LEU A CA    1 
ATOM   2321 C  C     . LEU A 1 301 ? 52.117 -23.936 1.696   1.00 10.44  ? 298 LEU A C     1 
ATOM   2322 O  O     . LEU A 1 301 ? 53.102 -23.686 2.401   1.00 8.36   ? 298 LEU A O     1 
ATOM   2323 C  CB    . LEU A 1 301 ? 49.820 -23.358 2.546   1.00 9.35   ? 298 LEU A CB    1 
ATOM   2324 C  CG    . LEU A 1 301 ? 48.798 -22.258 2.891   1.00 11.98  ? 298 LEU A CG    1 
ATOM   2325 C  CD1   . LEU A 1 301 ? 47.524 -22.859 3.468   1.00 9.99   ? 298 LEU A CD1   1 
ATOM   2326 C  CD2   . LEU A 1 301 ? 49.385 -21.190 3.842   1.00 8.60   ? 298 LEU A CD2   1 
ATOM   2327 N  N     . TYR A 1 302 ? 52.009 -25.051 0.989   1.00 9.47   ? 299 TYR A N     1 
ATOM   2328 C  CA    . TYR A 1 302 ? 53.047 -26.070 1.013   1.00 9.32   ? 299 TYR A CA    1 
ATOM   2329 C  C     . TYR A 1 302 ? 54.385 -25.511 0.533   1.00 10.90  ? 299 TYR A C     1 
ATOM   2330 O  O     . TYR A 1 302 ? 55.431 -25.715 1.169   1.00 7.95   ? 299 TYR A O     1 
ATOM   2331 C  CB    . TYR A 1 302 ? 52.628 -27.273 0.150   1.00 12.69  ? 299 TYR A CB    1 
ATOM   2332 C  CG    . TYR A 1 302 ? 53.630 -28.399 0.188   1.00 14.22  ? 299 TYR A CG    1 
ATOM   2333 C  CD1   . TYR A 1 302 ? 53.618 -29.339 1.224   1.00 13.06  ? 299 TYR A CD1   1 
ATOM   2334 C  CD2   . TYR A 1 302 ? 54.612 -28.507 -0.794  1.00 17.70  ? 299 TYR A CD2   1 
ATOM   2335 C  CE1   . TYR A 1 302 ? 54.552 -30.372 1.272   1.00 13.65  ? 299 TYR A CE1   1 
ATOM   2336 C  CE2   . TYR A 1 302 ? 55.549 -29.523 -0.755  1.00 16.43  ? 299 TYR A CE2   1 
ATOM   2337 C  CZ    . TYR A 1 302 ? 55.512 -30.456 0.275   1.00 19.14  ? 299 TYR A CZ    1 
ATOM   2338 O  OH    . TYR A 1 302 ? 56.452 -31.457 0.302   1.00 20.38  ? 299 TYR A OH    1 
ATOM   2339 N  N     . ALA A 1 303 ? 54.349 -24.801 -0.593  1.00 8.61   ? 300 ALA A N     1 
ATOM   2340 C  CA    . ALA A 1 303 ? 55.534 -24.123 -1.113  1.00 8.21   ? 300 ALA A CA    1 
ATOM   2341 C  C     . ALA A 1 303 ? 55.960 -22.923 -0.243  1.00 8.23   ? 300 ALA A C     1 
ATOM   2342 O  O     . ALA A 1 303 ? 57.147 -22.740 0.053   1.00 10.53  ? 300 ALA A O     1 
ATOM   2343 C  CB    . ALA A 1 303 ? 55.295 -23.666 -2.578  1.00 13.08  ? 300 ALA A CB    1 
ATOM   2344 N  N     . MET A 1 304 ? 54.999 -22.116 0.182   1.00 8.96   ? 301 MET A N     1 
ATOM   2345 C  CA    . MET A 1 304 ? 55.344 -20.873 0.895   1.00 9.92   ? 301 MET A CA    1 
ATOM   2346 C  C     . MET A 1 304 ? 56.061 -21.121 2.216   1.00 9.23   ? 301 MET A C     1 
ATOM   2347 O  O     . MET A 1 304 ? 56.971 -20.364 2.586   1.00 7.63   ? 301 MET A O     1 
ATOM   2348 C  CB    . MET A 1 304 ? 54.113 -20.019 1.167   1.00 10.09  ? 301 MET A CB    1 
ATOM   2349 C  CG    . MET A 1 304 ? 54.467 -18.611 1.676   1.00 11.71  ? 301 MET A CG    1 
ATOM   2350 S  SD    . MET A 1 304 ? 55.232 -17.671 0.337   1.00 12.96  ? 301 MET A SD    1 
ATOM   2351 C  CE    . MET A 1 304 ? 56.953 -17.544 0.859   1.00 10.33  ? 301 MET A CE    1 
ATOM   2352 N  N     . CYS A 1 305 ? 55.639 -22.150 2.945   1.00 7.82   ? 302 CYS A N     1 
ATOM   2353 C  CA    . CYS A 1 305 ? 56.247 -22.410 4.259   1.00 13.88  ? 302 CYS A CA    1 
ATOM   2354 C  C     . CYS A 1 305 ? 57.687 -22.910 4.106   1.00 9.10   ? 302 CYS A C     1 
ATOM   2355 O  O     . CYS A 1 305 ? 58.446 -22.954 5.078   1.00 7.28   ? 302 CYS A O     1 
ATOM   2356 C  CB    . CYS A 1 305 ? 55.411 -23.386 5.105   1.00 11.39  ? 302 CYS A CB    1 
ATOM   2357 S  SG    . CYS A 1 305 ? 55.459 -25.093 4.508   1.00 8.55   ? 302 CYS A SG    1 
ATOM   2358 N  N     . ARG A 1 306 ? 58.056 -23.247 2.870   1.00 7.71   ? 303 ARG A N     1 
ATOM   2359 C  CA    . ARG A 1 306 ? 59.422 -23.625 2.520   1.00 10.74  ? 303 ARG A CA    1 
ATOM   2360 C  C     . ARG A 1 306 ? 60.197 -22.457 1.888   1.00 11.08  ? 303 ARG A C     1 
ATOM   2361 O  O     . ARG A 1 306 ? 61.348 -22.606 1.488   1.00 10.10  ? 303 ARG A O     1 
ATOM   2362 C  CB    . ARG A 1 306 ? 59.416 -24.853 1.592   1.00 12.12  ? 303 ARG A CB    1 
ATOM   2363 C  CG    . ARG A 1 306 ? 58.829 -26.095 2.278   1.00 11.64  ? 303 ARG A CG    1 
ATOM   2364 C  CD    . ARG A 1 306 ? 58.697 -27.338 1.374   1.00 14.22  ? 303 ARG A CD    1 
ATOM   2365 N  NE    . ARG A 1 306 ? 58.504 -28.530 2.208   1.00 18.76  ? 303 ARG A NE    1 
ATOM   2366 C  CZ    . ARG A 1 306 ? 57.395 -28.793 2.903   1.00 14.42  ? 303 ARG A CZ    1 
ATOM   2367 N  NH1   . ARG A 1 306 ? 57.317 -29.895 3.650   1.00 10.67  ? 303 ARG A NH1   1 
ATOM   2368 N  NH2   . ARG A 1 306 ? 56.356 -27.971 2.837   1.00 9.46   ? 303 ARG A NH2   1 
ATOM   2369 N  N     . GLY A 1 307 ? 59.559 -21.293 1.828   1.00 7.54   ? 304 GLY A N     1 
ATOM   2370 C  CA    . GLY A 1 307 ? 60.197 -20.098 1.335   1.00 8.18   ? 304 GLY A CA    1 
ATOM   2371 C  C     . GLY A 1 307 ? 60.035 -19.929 -0.163  1.00 8.15   ? 304 GLY A C     1 
ATOM   2372 O  O     . GLY A 1 307 ? 60.723 -19.108 -0.768  1.00 10.48  ? 304 GLY A O     1 
ATOM   2373 N  N     . ILE A 1 308 ? 59.120 -20.697 -0.752  1.00 8.66   ? 305 ILE A N     1 
ATOM   2374 C  CA    . ILE A 1 308 ? 58.963 -20.756 -2.208  1.00 12.72  ? 305 ILE A CA    1 
ATOM   2375 C  C     . ILE A 1 308 ? 57.603 -20.200 -2.648  1.00 9.75   ? 305 ILE A C     1 
ATOM   2376 O  O     . ILE A 1 308 ? 56.578 -20.524 -2.059  1.00 8.66   ? 305 ILE A O     1 
ATOM   2377 C  CB    . ILE A 1 308 ? 59.108 -22.205 -2.732  1.00 13.63  ? 305 ILE A CB    1 
ATOM   2378 C  CG1   . ILE A 1 308 ? 60.440 -22.812 -2.287  1.00 13.49  ? 305 ILE A CG1   1 
ATOM   2379 C  CG2   . ILE A 1 308 ? 58.994 -22.244 -4.250  1.00 14.24  ? 305 ILE A CG2   1 
ATOM   2380 C  CD1   . ILE A 1 308 ? 60.583 -24.286 -2.647  1.00 22.65  ? 305 ILE A CD1   1 
ATOM   2381 N  N     . GLU A 1 309 ? 57.607 -19.358 -3.681  1.00 9.66   ? 306 GLU A N     1 
ATOM   2382 C  CA    . GLU A 1 309 ? 56.377 -18.740 -4.185  1.00 14.08  ? 306 GLU A CA    1 
ATOM   2383 C  C     . GLU A 1 309 ? 56.620 -18.264 -5.619  1.00 17.99  ? 306 GLU A C     1 
ATOM   2384 O  O     . GLU A 1 309 ? 57.712 -17.805 -5.935  1.00 14.83  ? 306 GLU A O     1 
ATOM   2385 C  CB    . GLU A 1 309 ? 55.994 -17.545 -3.316  1.00 14.45  ? 306 GLU A CB    1 
ATOM   2386 C  CG    . GLU A 1 309 ? 54.536 -17.215 -3.408  1.00 22.34  ? 306 GLU A CG    1 
ATOM   2387 C  CD    . GLU A 1 309 ? 54.267 -15.746 -3.617  1.00 22.23  ? 306 GLU A CD    1 
ATOM   2388 O  OE1   . GLU A 1 309 ? 55.228 -14.956 -3.806  1.00 19.89  ? 306 GLU A OE1   1 
ATOM   2389 O  OE2   . GLU A 1 309 ? 53.074 -15.387 -3.589  1.00 27.76  ? 306 GLU A OE2   1 
ATOM   2390 N  N     . HIS A 1 310 ? 55.622 -18.357 -6.492  1.00 16.21  ? 307 HIS A N     1 
ATOM   2391 C  CA    . HIS A 1 310 ? 55.899 -18.099 -7.917  1.00 18.15  ? 307 HIS A CA    1 
ATOM   2392 C  C     . HIS A 1 310 ? 55.181 -16.907 -8.532  1.00 16.87  ? 307 HIS A C     1 
ATOM   2393 O  O     . HIS A 1 310 ? 55.372 -16.605 -9.718  1.00 18.43  ? 307 HIS A O     1 
ATOM   2394 C  CB    . HIS A 1 310 ? 55.678 -19.355 -8.763  1.00 23.78  ? 307 HIS A CB    1 
ATOM   2395 C  CG    . HIS A 1 310 ? 56.613 -20.472 -8.421  1.00 34.31  ? 307 HIS A CG    1 
ATOM   2396 N  ND1   . HIS A 1 310 ? 57.986 -20.326 -8.448  1.00 30.71  ? 307 HIS A ND1   1 
ATOM   2397 C  CD2   . HIS A 1 310 ? 56.377 -21.743 -8.015  1.00 31.31  ? 307 HIS A CD2   1 
ATOM   2398 C  CE1   . HIS A 1 310 ? 58.553 -21.465 -8.091  1.00 37.55  ? 307 HIS A CE1   1 
ATOM   2399 N  NE2   . HIS A 1 310 ? 57.598 -22.339 -7.820  1.00 37.29  ? 307 HIS A NE2   1 
ATOM   2400 N  N     . ASP A 1 311 ? 54.379 -16.220 -7.728  1.00 16.82  ? 308 ASP A N     1 
ATOM   2401 C  CA    . ASP A 1 311 ? 53.624 -15.071 -8.215  1.00 14.13  ? 308 ASP A CA    1 
ATOM   2402 C  C     . ASP A 1 311 ? 54.554 -14.080 -8.930  1.00 15.86  ? 308 ASP A C     1 
ATOM   2403 O  O     . ASP A 1 311 ? 55.531 -13.612 -8.340  1.00 11.28  ? 308 ASP A O     1 
ATOM   2404 C  CB    . ASP A 1 311 ? 52.888 -14.401 -7.057  1.00 14.61  ? 308 ASP A CB    1 
ATOM   2405 C  CG    . ASP A 1 311 ? 51.955 -13.300 -7.520  1.00 19.12  ? 308 ASP A CG    1 
ATOM   2406 O  OD1   . ASP A 1 311 ? 51.779 -12.306 -6.790  1.00 29.49  ? 308 ASP A OD1   1 
ATOM   2407 O  OD2   . ASP A 1 311 ? 51.388 -13.432 -8.620  1.00 26.64  ? 308 ASP A OD2   1 
ATOM   2408 N  N     . PRO A 1 312 ? 54.267 -13.764 -10.212 1.00 12.04  ? 309 PRO A N     1 
ATOM   2409 C  CA    . PRO A 1 312 ? 55.186 -12.858 -10.906 1.00 13.06  ? 309 PRO A CA    1 
ATOM   2410 C  C     . PRO A 1 312 ? 55.025 -11.383 -10.520 1.00 12.70  ? 309 PRO A C     1 
ATOM   2411 O  O     . PRO A 1 312 ? 53.953 -10.925 -10.117 1.00 13.47  ? 309 PRO A O     1 
ATOM   2412 C  CB    . PRO A 1 312 ? 54.844 -13.071 -12.394 1.00 17.79  ? 309 PRO A CB    1 
ATOM   2413 C  CG    . PRO A 1 312 ? 53.404 -13.491 -12.389 1.00 14.37  ? 309 PRO A CG    1 
ATOM   2414 C  CD    . PRO A 1 312 ? 53.220 -14.295 -11.112 1.00 14.38  ? 309 PRO A CD    1 
ATOM   2415 N  N     . VAL A 1 313 ? 56.121 -10.640 -10.620 1.00 15.08  ? 310 VAL A N     1 
ATOM   2416 C  CA    . VAL A 1 313 ? 56.030 -9.184  -10.581 1.00 12.97  ? 310 VAL A CA    1 
ATOM   2417 C  C     . VAL A 1 313 ? 55.333 -8.764  -11.873 1.00 13.67  ? 310 VAL A C     1 
ATOM   2418 O  O     . VAL A 1 313 ? 55.901 -8.920  -12.954 1.00 11.86  ? 310 VAL A O     1 
ATOM   2419 C  CB    . VAL A 1 313 ? 57.424 -8.539  -10.503 1.00 13.24  ? 310 VAL A CB    1 
ATOM   2420 C  CG1   . VAL A 1 313 ? 57.323 -7.002  -10.564 1.00 9.96   ? 310 VAL A CG1   1 
ATOM   2421 C  CG2   . VAL A 1 313 ? 58.124 -8.978  -9.227  1.00 7.59   ? 310 VAL A CG2   1 
ATOM   2422 N  N     . LYS A 1 314 ? 54.094 -8.286  -11.771 1.00 14.19  ? 311 LYS A N     1 
ATOM   2423 C  CA    . LYS A 1 314 ? 53.356 -7.875  -12.967 1.00 12.58  ? 311 LYS A CA    1 
ATOM   2424 C  C     . LYS A 1 314 ? 53.855 -6.544  -13.465 1.00 12.27  ? 311 LYS A C     1 
ATOM   2425 O  O     . LYS A 1 314 ? 54.065 -5.621  -12.672 1.00 13.54  ? 311 LYS A O     1 
ATOM   2426 C  CB    . LYS A 1 314 ? 51.851 -7.761  -12.703 1.00 15.68  ? 311 LYS A CB    1 
ATOM   2427 C  CG    . LYS A 1 314 ? 51.097 -9.062  -12.716 1.00 20.73  ? 311 LYS A CG    1 
ATOM   2428 C  CD    . LYS A 1 314 ? 51.297 -9.764  -11.420 1.00 28.25  ? 311 LYS A CD    1 
ATOM   2429 C  CE    . LYS A 1 314 ? 50.423 -10.990 -11.277 1.00 29.33  ? 311 LYS A CE    1 
ATOM   2430 N  NZ    . LYS A 1 314 ? 50.817 -11.663 -10.007 1.00 24.20  ? 311 LYS A NZ    1 
ATOM   2431 N  N     . PRO A 1 315 ? 54.050 -6.439  -14.784 1.00 14.06  ? 312 PRO A N     1 
ATOM   2432 C  CA    . PRO A 1 315 ? 54.426 -5.185  -15.430 1.00 11.30  ? 312 PRO A CA    1 
ATOM   2433 C  C     . PRO A 1 315 ? 53.243 -4.237  -15.408 1.00 17.37  ? 312 PRO A C     1 
ATOM   2434 O  O     . PRO A 1 315 ? 52.482 -4.178  -16.379 1.00 16.61  ? 312 PRO A O     1 
ATOM   2435 C  CB    . PRO A 1 315 ? 54.726 -5.618  -16.871 1.00 13.82  ? 312 PRO A CB    1 
ATOM   2436 C  CG    . PRO A 1 315 ? 53.860 -6.825  -17.080 1.00 18.48  ? 312 PRO A CG    1 
ATOM   2437 C  CD    . PRO A 1 315 ? 53.901 -7.540  -15.757 1.00 18.38  ? 312 PRO A CD    1 
ATOM   2438 N  N     . ARG A 1 316 ? 53.070 -3.512  -14.309 1.00 14.79  ? 313 ARG A N     1 
ATOM   2439 C  CA    . ARG A 1 316 ? 51.939 -2.590  -14.188 1.00 16.01  ? 313 ARG A CA    1 
ATOM   2440 C  C     . ARG A 1 316 ? 52.269 -1.473  -13.205 1.00 20.57  ? 313 ARG A C     1 
ATOM   2441 O  O     . ARG A 1 316 ? 52.394 -1.707  -12.010 1.00 14.85  ? 313 ARG A O     1 
ATOM   2442 C  CB    . ARG A 1 316 ? 50.663 -3.325  -13.757 1.00 20.26  ? 313 ARG A CB    1 
ATOM   2443 C  CG    . ARG A 1 316 ? 49.425 -2.426  -13.665 1.00 24.49  ? 313 ARG A CG    1 
ATOM   2444 C  CD    . ARG A 1 316 ? 48.194 -3.165  -13.122 1.00 23.40  ? 313 ARG A CD    1 
ATOM   2445 N  NE    . ARG A 1 316 ? 48.441 -3.753  -11.806 1.00 25.40  ? 313 ARG A NE    1 
ATOM   2446 C  CZ    . ARG A 1 316 ? 48.584 -3.053  -10.685 1.00 33.43  ? 313 ARG A CZ    1 
ATOM   2447 N  NH1   . ARG A 1 316 ? 48.495 -1.722  -10.713 1.00 28.86  ? 313 ARG A NH1   1 
ATOM   2448 N  NH2   . ARG A 1 316 ? 48.819 -3.681  -9.533  1.00 20.23  ? 313 ARG A NH2   1 
ATOM   2449 N  N     . GLN A 1 317 ? 52.405 -0.260  -13.728 1.00 13.06  ? 314 GLN A N     1 
ATOM   2450 C  CA    . GLN A 1 317 ? 52.792 0.906   -12.942 1.00 23.87  ? 314 GLN A CA    1 
ATOM   2451 C  C     . GLN A 1 317 ? 51.590 1.800   -12.604 1.00 23.68  ? 314 GLN A C     1 
ATOM   2452 O  O     . GLN A 1 317 ? 51.647 2.617   -11.680 1.00 25.48  ? 314 GLN A O     1 
ATOM   2453 C  CB    . GLN A 1 317 ? 53.827 1.712   -13.730 1.00 28.22  ? 314 GLN A CB    1 
ATOM   2454 C  CG    . GLN A 1 317 ? 54.511 2.801   -12.944 1.00 31.90  ? 314 GLN A CG    1 
ATOM   2455 C  CD    . GLN A 1 317 ? 55.489 3.584   -13.791 1.00 26.88  ? 314 GLN A CD    1 
ATOM   2456 O  OE1   . GLN A 1 317 ? 55.770 3.212   -14.938 1.00 33.23  ? 314 GLN A OE1   1 
ATOM   2457 N  NE2   . GLN A 1 317 ? 56.008 4.681   -13.239 1.00 24.69  ? 314 GLN A NE2   1 
ATOM   2458 N  N     . LEU A 1 318 ? 50.507 1.640   -13.356 1.00 17.10  ? 315 LEU A N     1 
ATOM   2459 C  CA    . LEU A 1 318 ? 49.309 2.463   -13.197 1.00 17.79  ? 315 LEU A CA    1 
ATOM   2460 C  C     . LEU A 1 318 ? 48.175 1.680   -12.526 1.00 17.01  ? 315 LEU A C     1 
ATOM   2461 O  O     . LEU A 1 318 ? 47.964 0.505   -12.829 1.00 17.63  ? 315 LEU A O     1 
ATOM   2462 C  CB    . LEU A 1 318 ? 48.817 2.945   -14.574 1.00 19.22  ? 315 LEU A CB    1 
ATOM   2463 C  CG    . LEU A 1 318 ? 49.775 3.718   -15.490 1.00 22.90  ? 315 LEU A CG    1 
ATOM   2464 C  CD1   . LEU A 1 318 ? 49.136 3.955   -16.866 1.00 24.02  ? 315 LEU A CD1   1 
ATOM   2465 C  CD2   . LEU A 1 318 ? 50.220 5.042   -14.855 1.00 22.50  ? 315 LEU A CD2   1 
ATOM   2466 N  N     . PRO A 1 319 ? 47.419 2.336   -11.630 1.00 17.21  ? 316 PRO A N     1 
ATOM   2467 C  CA    . PRO A 1 319 ? 46.238 1.662   -11.067 1.00 15.36  ? 316 PRO A CA    1 
ATOM   2468 C  C     . PRO A 1 319 ? 45.305 1.158   -12.182 1.00 17.54  ? 316 PRO A C     1 
ATOM   2469 O  O     . PRO A 1 319 ? 45.330 1.731   -13.270 1.00 19.42  ? 316 PRO A O     1 
ATOM   2470 C  CB    . PRO A 1 319 ? 45.564 2.758   -10.213 1.00 18.86  ? 316 PRO A CB    1 
ATOM   2471 C  CG    . PRO A 1 319 ? 46.279 4.044   -10.547 1.00 27.79  ? 316 PRO A CG    1 
ATOM   2472 C  CD    . PRO A 1 319 ? 47.620 3.692   -11.089 1.00 18.46  ? 316 PRO A CD    1 
ATOM   2473 N  N     . LYS A 1 320 ? 44.536 0.098   -11.915 1.00 20.04  ? 317 LYS A N     1 
ATOM   2474 C  CA    . LYS A 1 320 ? 43.581 -0.488  -12.867 1.00 20.52  ? 317 LYS A CA    1 
ATOM   2475 C  C     . LYS A 1 320 ? 42.186 0.118   -12.744 1.00 21.11  ? 317 LYS A C     1 
ATOM   2476 O  O     . LYS A 1 320 ? 41.319 -0.120  -13.587 1.00 19.91  ? 317 LYS A O     1 
ATOM   2477 C  CB    . LYS A 1 320 ? 43.411 -1.984  -12.589 1.00 26.32  ? 317 LYS A CB    1 
ATOM   2478 C  CG    . LYS A 1 320 ? 44.575 -2.872  -12.938 1.00 29.11  ? 317 LYS A CG    1 
ATOM   2479 C  CD    . LYS A 1 320 ? 44.160 -4.329  -12.750 1.00 32.51  ? 317 LYS A CD    1 
ATOM   2480 C  CE    . LYS A 1 320 ? 45.159 -5.277  -13.382 1.00 45.26  ? 317 LYS A CE    1 
ATOM   2481 N  NZ    . LYS A 1 320 ? 44.642 -6.670  -13.414 1.00 46.79  ? 317 LYS A NZ    1 
ATOM   2482 N  N     . THR A 1 321 ? 41.952 0.845   -11.659 1.00 18.01  ? 318 THR A N     1 
ATOM   2483 C  CA    . THR A 1 321 ? 40.657 1.468   -11.425 1.00 16.91  ? 318 THR A CA    1 
ATOM   2484 C  C     . THR A 1 321 ? 40.875 2.867   -10.870 1.00 15.40  ? 318 THR A C     1 
ATOM   2485 O  O     . THR A 1 321 ? 41.918 3.161   -10.275 1.00 21.03  ? 318 THR A O     1 
ATOM   2486 C  CB    . THR A 1 321 ? 39.768 0.653   -10.436 1.00 22.58  ? 318 THR A CB    1 
ATOM   2487 O  OG1   . THR A 1 321 ? 40.468 0.454   -9.199  1.00 18.98  ? 318 THR A OG1   1 
ATOM   2488 C  CG2   . THR A 1 321 ? 39.379 -0.689  -11.017 1.00 17.02  ? 318 THR A CG2   1 
ATOM   2489 N  N     . ILE A 1 322 ? 39.905 3.743   -11.094 1.00 13.73  ? 319 ILE A N     1 
ATOM   2490 C  CA    . ILE A 1 322 ? 39.942 5.077   -10.504 1.00 15.53  ? 319 ILE A CA    1 
ATOM   2491 C  C     . ILE A 1 322 ? 38.609 5.286   -9.782  1.00 17.71  ? 319 ILE A C     1 
ATOM   2492 O  O     . ILE A 1 322 ? 37.548 5.261   -10.413 1.00 13.73  ? 319 ILE A O     1 
ATOM   2493 C  CB    . ILE A 1 322 ? 40.157 6.160   -11.565 1.00 14.53  ? 319 ILE A CB    1 
ATOM   2494 C  CG1   . ILE A 1 322 ? 41.506 5.941   -12.265 1.00 24.95  ? 319 ILE A CG1   1 
ATOM   2495 C  CG2   . ILE A 1 322 ? 40.095 7.563   -10.939 1.00 14.09  ? 319 ILE A CG2   1 
ATOM   2496 C  CD1   . ILE A 1 322 ? 41.880 7.038   -13.253 1.00 18.73  ? 319 ILE A CD1   1 
ATOM   2497 N  N     . GLY A 1 323 ? 38.675 5.467   -8.466  1.00 13.91  ? 320 GLY A N     1 
ATOM   2498 C  CA    . GLY A 1 323 ? 37.483 5.495   -7.638  1.00 17.68  ? 320 GLY A CA    1 
ATOM   2499 C  C     . GLY A 1 323 ? 37.422 6.664   -6.679  1.00 13.78  ? 320 GLY A C     1 
ATOM   2500 O  O     . GLY A 1 323 ? 38.454 7.234   -6.317  1.00 15.06  ? 320 GLY A O     1 
ATOM   2501 N  N     . CYS A 1 324 ? 36.195 6.998   -6.274  1.00 16.97  ? 321 CYS A N     1 
ATOM   2502 C  CA    . CYS A 1 324 ? 35.878 8.087   -5.346  1.00 17.78  ? 321 CYS A CA    1 
ATOM   2503 C  C     . CYS A 1 324 ? 34.834 7.554   -4.370  1.00 14.49  ? 321 CYS A C     1 
ATOM   2504 O  O     . CYS A 1 324 ? 33.807 7.008   -4.786  1.00 17.52  ? 321 CYS A O     1 
ATOM   2505 C  CB    . CYS A 1 324 ? 35.265 9.281   -6.093  1.00 22.18  ? 321 CYS A CB    1 
ATOM   2506 S  SG    . CYS A 1 324 ? 36.336 10.081  -7.277  1.00 31.90  ? 321 CYS A SG    1 
ATOM   2507 N  N     . SER A 1 325 ? 35.088 7.726   -3.079  1.00 14.31  ? 322 SER A N     1 
ATOM   2508 C  CA    . SER A 1 325 ? 34.293 7.077   -2.045  1.00 18.85  ? 322 SER A CA    1 
ATOM   2509 C  C     . SER A 1 325 ? 34.090 8.004   -0.847  1.00 16.08  ? 322 SER A C     1 
ATOM   2510 O  O     . SER A 1 325 ? 35.013 8.719   -0.453  1.00 17.05  ? 322 SER A O     1 
ATOM   2511 C  CB    . SER A 1 325 ? 35.038 5.816   -1.587  1.00 20.13  ? 322 SER A CB    1 
ATOM   2512 O  OG    . SER A 1 325 ? 34.382 5.182   -0.519  1.00 27.81  ? 322 SER A OG    1 
ATOM   2513 N  N     . LYS A 1 326 ? 32.898 7.969   -0.248  1.00 15.66  ? 323 LYS A N     1 
ATOM   2514 C  CA    . LYS A 1 326 ? 32.664 8.693   1.000   1.00 20.74  ? 323 LYS A CA    1 
ATOM   2515 C  C     . LYS A 1 326 ? 31.677 7.987   1.925   1.00 22.03  ? 323 LYS A C     1 
ATOM   2516 O  O     . LYS A 1 326 ? 30.606 7.549   1.493   1.00 13.99  ? 323 LYS A O     1 
ATOM   2517 C  CB    . LYS A 1 326 ? 32.181 10.131  0.737   1.00 18.71  ? 323 LYS A CB    1 
ATOM   2518 C  CG    . LYS A 1 326 ? 31.908 10.913  2.033   1.00 20.70  ? 323 LYS A CG    1 
ATOM   2519 C  CD    . LYS A 1 326 ? 31.683 12.400  1.784   1.00 17.78  ? 323 LYS A CD    1 
ATOM   2520 C  CE    . LYS A 1 326 ? 31.461 13.156  3.088   1.00 21.24  ? 323 LYS A CE    1 
ATOM   2521 N  NZ    . LYS A 1 326 ? 32.580 12.938  4.014   1.00 22.26  ? 323 LYS A NZ    1 
ATOM   2522 N  N     . ASN A 1 327 ? 32.060 7.884   3.195   1.00 18.32  ? 324 ASN A N     1 
ATOM   2523 C  CA    . ASN A 1 327 ? 31.178 7.407   4.245   1.00 20.85  ? 324 ASN A CA    1 
ATOM   2524 C  C     . ASN A 1 327 ? 30.318 8.533   4.808   1.00 20.40  ? 324 ASN A C     1 
ATOM   2525 O  O     . ASN A 1 327 ? 30.722 9.698   4.824   1.00 14.74  ? 324 ASN A O     1 
ATOM   2526 C  CB    . ASN A 1 327 ? 31.980 6.784   5.387   1.00 18.73  ? 324 ASN A CB    1 
ATOM   2527 C  CG    . ASN A 1 327 ? 32.650 5.485   4.995   1.00 24.32  ? 324 ASN A CG    1 
ATOM   2528 O  OD1   . ASN A 1 327 ? 32.388 4.919   3.929   1.00 23.03  ? 324 ASN A OD1   1 
ATOM   2529 N  ND2   . ASN A 1 327 ? 33.516 4.992   5.872   1.00 26.43  ? 324 ASN A ND2   1 
ATOM   2530 N  N     . PHE A 1 328 ? 29.131 8.165   5.275   1.00 20.85  ? 325 PHE A N     1 
ATOM   2531 C  CA    . PHE A 1 328 ? 28.227 9.095   5.930   1.00 21.73  ? 325 PHE A CA    1 
ATOM   2532 C  C     . PHE A 1 328 ? 27.784 8.429   7.222   1.00 25.67  ? 325 PHE A C     1 
ATOM   2533 O  O     . PHE A 1 328 ? 26.711 7.828   7.296   1.00 21.56  ? 325 PHE A O     1 
ATOM   2534 C  CB    . PHE A 1 328 ? 27.046 9.421   5.020   1.00 23.73  ? 325 PHE A CB    1 
ATOM   2535 C  CG    . PHE A 1 328 ? 27.460 9.967   3.692   1.00 19.61  ? 325 PHE A CG    1 
ATOM   2536 C  CD1   . PHE A 1 328 ? 27.649 9.117   2.609   1.00 19.76  ? 325 PHE A CD1   1 
ATOM   2537 C  CD2   . PHE A 1 328 ? 27.701 11.325  3.528   1.00 17.54  ? 325 PHE A CD2   1 
ATOM   2538 C  CE1   . PHE A 1 328 ? 28.048 9.618   1.382   1.00 14.59  ? 325 PHE A CE1   1 
ATOM   2539 C  CE2   . PHE A 1 328 ? 28.096 11.833  2.303   1.00 20.14  ? 325 PHE A CE2   1 
ATOM   2540 C  CZ    . PHE A 1 328 ? 28.274 10.975  1.225   1.00 17.78  ? 325 PHE A CZ    1 
ATOM   2541 N  N     . PRO A 1 329 ? 28.648 8.510   8.239   1.00 28.61  ? 326 PRO A N     1 
ATOM   2542 C  CA    . PRO A 1 329 ? 28.519 7.727   9.470   1.00 36.41  ? 326 PRO A CA    1 
ATOM   2543 C  C     . PRO A 1 329 ? 27.483 8.273   10.440  1.00 38.79  ? 326 PRO A C     1 
ATOM   2544 O  O     . PRO A 1 329 ? 27.132 9.459   10.404  1.00 28.57  ? 326 PRO A O     1 
ATOM   2545 C  CB    . PRO A 1 329 ? 29.920 7.813   10.082  1.00 38.55  ? 326 PRO A CB    1 
ATOM   2546 C  CG    . PRO A 1 329 ? 30.458 9.111   9.585   1.00 37.56  ? 326 PRO A CG    1 
ATOM   2547 C  CD    . PRO A 1 329 ? 29.908 9.273   8.194   1.00 29.81  ? 326 PRO A CD    1 
ATOM   2548 N  N     . GLY A 1 330 ? 27.005 7.382   11.303  1.00 49.51  ? 327 GLY A N     1 
ATOM   2549 C  CA    . GLY A 1 330 ? 26.044 7.726   12.332  1.00 48.09  ? 327 GLY A CA    1 
ATOM   2550 C  C     . GLY A 1 330 ? 24.947 8.642   11.836  1.00 40.03  ? 327 GLY A C     1 
ATOM   2551 O  O     . GLY A 1 330 ? 24.200 8.306   10.912  1.00 31.26  ? 327 GLY A O     1 
ATOM   2552 N  N     . LYS A 1 331 ? 24.882 9.821   12.443  1.00 32.70  ? 328 LYS A N     1 
ATOM   2553 C  CA    . LYS A 1 331 ? 23.781 10.740  12.233  1.00 38.40  ? 328 LYS A CA    1 
ATOM   2554 C  C     . LYS A 1 331 ? 23.809 11.425  10.867  1.00 35.30  ? 328 LYS A C     1 
ATOM   2555 O  O     . LYS A 1 331 ? 22.820 12.029  10.465  1.00 35.76  ? 328 LYS A O     1 
ATOM   2556 C  CB    . LYS A 1 331 ? 23.753 11.778  13.363  1.00 44.75  ? 328 LYS A CB    1 
ATOM   2557 C  CG    . LYS A 1 331 ? 22.421 12.494  13.526  1.00 65.51  ? 328 LYS A CG    1 
ATOM   2558 C  CD    . LYS A 1 331 ? 22.366 13.293  14.826  1.00 68.06  ? 328 LYS A CD    1 
ATOM   2559 C  CE    . LYS A 1 331 ? 21.158 14.226  14.857  1.00 68.75  ? 328 LYS A CE    1 
ATOM   2560 N  NZ    . LYS A 1 331 ? 21.199 15.235  13.754  1.00 52.27  ? 328 LYS A NZ    1 
ATOM   2561 N  N     . THR A 1 332 ? 24.930 11.337  10.154  1.00 34.54  ? 329 THR A N     1 
ATOM   2562 C  CA    . THR A 1 332 ? 25.048 12.016  8.855   1.00 38.30  ? 329 THR A CA    1 
ATOM   2563 C  C     . THR A 1 332 ? 24.540 11.188  7.669   1.00 29.95  ? 329 THR A C     1 
ATOM   2564 O  O     . THR A 1 332 ? 24.585 11.653  6.530   1.00 28.06  ? 329 THR A O     1 
ATOM   2565 C  CB    . THR A 1 332 ? 26.503 12.474  8.545   1.00 34.82  ? 329 THR A CB    1 
ATOM   2566 O  OG1   . THR A 1 332 ? 27.367 11.331  8.462   1.00 24.78  ? 329 THR A OG1   1 
ATOM   2567 C  CG2   . THR A 1 332 ? 27.013 13.446  9.613   1.00 27.62  ? 329 THR A CG2   1 
ATOM   2568 N  N     . ALA A 1 333 ? 24.074 9.970   7.931   1.00 26.66  ? 330 ALA A N     1 
ATOM   2569 C  CA    . ALA A 1 333 ? 23.547 9.118   6.865   1.00 27.26  ? 330 ALA A CA    1 
ATOM   2570 C  C     . ALA A 1 333 ? 22.546 9.866   5.985   1.00 33.49  ? 330 ALA A C     1 
ATOM   2571 O  O     . ALA A 1 333 ? 21.719 10.632  6.479   1.00 35.26  ? 330 ALA A O     1 
ATOM   2572 C  CB    . ALA A 1 333 ? 22.919 7.854   7.448   1.00 31.80  ? 330 ALA A CB    1 
ATOM   2573 N  N     . LEU A 1 334 ? 22.623 9.646   4.677   1.00 31.02  ? 331 LEU A N     1 
ATOM   2574 C  CA    . LEU A 1 334 ? 21.780 10.375  3.736   1.00 36.80  ? 331 LEU A CA    1 
ATOM   2575 C  C     . LEU A 1 334 ? 20.346 9.829   3.751   1.00 31.81  ? 331 LEU A C     1 
ATOM   2576 O  O     . LEU A 1 334 ? 20.123 8.638   3.548   1.00 36.49  ? 331 LEU A O     1 
ATOM   2577 C  CB    . LEU A 1 334 ? 22.371 10.317  2.322   1.00 32.16  ? 331 LEU A CB    1 
ATOM   2578 C  CG    . LEU A 1 334 ? 23.870 10.607  2.180   1.00 27.64  ? 331 LEU A CG    1 
ATOM   2579 C  CD1   . LEU A 1 334 ? 24.284 10.574  0.704   1.00 22.75  ? 331 LEU A CD1   1 
ATOM   2580 C  CD2   . LEU A 1 334 ? 24.246 11.940  2.833   1.00 22.91  ? 331 LEU A CD2   1 
ATOM   2581 N  N     . ALA A 1 335 ? 19.380 10.710  3.984   1.00 41.28  ? 332 ALA A N     1 
ATOM   2582 C  CA    . ALA A 1 335 ? 18.006 10.278  4.232   1.00 39.58  ? 332 ALA A CA    1 
ATOM   2583 C  C     . ALA A 1 335 ? 16.980 10.944  3.312   1.00 43.31  ? 332 ALA A C     1 
ATOM   2584 O  O     . ALA A 1 335 ? 15.773 10.760  3.478   1.00 44.47  ? 332 ALA A O     1 
ATOM   2585 C  CB    . ALA A 1 335 ? 17.647 10.507  5.693   1.00 35.20  ? 332 ALA A CB    1 
ATOM   2586 N  N     . THR A 1 336 ? 17.464 11.715  2.345   1.00 34.31  ? 333 THR A N     1 
ATOM   2587 C  CA    . THR A 1 336 ? 16.594 12.330  1.353   1.00 40.27  ? 333 THR A CA    1 
ATOM   2588 C  C     . THR A 1 336 ? 17.163 12.132  -0.044  1.00 47.19  ? 333 THR A C     1 
ATOM   2589 O  O     . THR A 1 336 ? 18.366 11.919  -0.211  1.00 36.18  ? 333 THR A O     1 
ATOM   2590 C  CB    . THR A 1 336 ? 16.441 13.837  1.581   1.00 36.70  ? 333 THR A CB    1 
ATOM   2591 O  OG1   . THR A 1 336 ? 17.663 14.498  1.231   1.00 34.80  ? 333 THR A OG1   1 
ATOM   2592 C  CG2   . THR A 1 336 ? 16.083 14.140  3.034   1.00 37.80  ? 333 THR A CG2   1 
ATOM   2593 N  N     . ARG A 1 337 ? 16.297 12.226  -1.047  1.00 47.53  ? 334 ARG A N     1 
ATOM   2594 C  CA    . ARG A 1 337 ? 16.713 12.073  -2.431  1.00 42.16  ? 334 ARG A CA    1 
ATOM   2595 C  C     . ARG A 1 337 ? 17.648 13.204  -2.850  1.00 39.04  ? 334 ARG A C     1 
ATOM   2596 O  O     . ARG A 1 337 ? 18.626 12.977  -3.558  1.00 37.67  ? 334 ARG A O     1 
ATOM   2597 C  CB    . ARG A 1 337 ? 15.490 12.009  -3.348  1.00 46.48  ? 334 ARG A CB    1 
ATOM   2598 C  CG    . ARG A 1 337 ? 15.813 11.683  -4.798  1.00 52.34  ? 334 ARG A CG    1 
ATOM   2599 C  CD    . ARG A 1 337 ? 14.549 11.534  -5.646  1.00 56.50  ? 334 ARG A CD    1 
ATOM   2600 N  NE    . ARG A 1 337 ? 13.548 12.559  -5.354  1.00 74.70  ? 334 ARG A NE    1 
ATOM   2601 C  CZ    . ARG A 1 337 ? 13.698 13.859  -5.603  1.00 75.97  ? 334 ARG A CZ    1 
ATOM   2602 N  NH1   . ARG A 1 337 ? 14.821 14.316  -6.145  1.00 66.58  ? 334 ARG A NH1   1 
ATOM   2603 N  NH2   . ARG A 1 337 ? 12.724 14.706  -5.299  1.00 70.59  ? 334 ARG A NH2   1 
ATOM   2604 N  N     . GLU A 1 338 ? 17.348 14.421  -2.409  1.00 39.25  ? 335 GLU A N     1 
ATOM   2605 C  CA    . GLU A 1 338 ? 18.187 15.576  -2.725  1.00 40.66  ? 335 GLU A CA    1 
ATOM   2606 C  C     . GLU A 1 338 ? 19.632 15.365  -2.278  1.00 38.21  ? 335 GLU A C     1 
ATOM   2607 O  O     . GLU A 1 338 ? 20.575 15.686  -3.002  1.00 34.15  ? 335 GLU A O     1 
ATOM   2608 C  CB    . GLU A 1 338 ? 17.633 16.841  -2.066  1.00 38.40  ? 335 GLU A CB    1 
ATOM   2609 C  CG    . GLU A 1 338 ? 16.489 17.487  -2.819  1.00 53.50  ? 335 GLU A CG    1 
ATOM   2610 C  CD    . GLU A 1 338 ? 16.927 18.060  -4.150  1.00 66.10  ? 335 GLU A CD    1 
ATOM   2611 O  OE1   . GLU A 1 338 ? 17.564 19.136  -4.152  1.00 65.27  ? 335 GLU A OE1   1 
ATOM   2612 O  OE2   . GLU A 1 338 ? 16.641 17.432  -5.192  1.00 73.52  ? 335 GLU A OE2   1 
ATOM   2613 N  N     . GLN A 1 339 ? 19.792 14.833  -1.073  1.00 37.57  ? 336 GLN A N     1 
ATOM   2614 C  CA    . GLN A 1 339 ? 21.109 14.604  -0.502  1.00 34.48  ? 336 GLN A CA    1 
ATOM   2615 C  C     . GLN A 1 339 ? 21.907 13.619  -1.338  1.00 31.24  ? 336 GLN A C     1 
ATOM   2616 O  O     . GLN A 1 339 ? 23.040 13.898  -1.734  1.00 26.78  ? 336 GLN A O     1 
ATOM   2617 C  CB    . GLN A 1 339 ? 20.979 14.037  0.902   1.00 37.02  ? 336 GLN A CB    1 
ATOM   2618 C  CG    . GLN A 1 339 ? 20.764 15.047  1.994   1.00 31.37  ? 336 GLN A CG    1 
ATOM   2619 C  CD    . GLN A 1 339 ? 20.952 14.406  3.340   1.00 34.94  ? 336 GLN A CD    1 
ATOM   2620 O  OE1   . GLN A 1 339 ? 20.174 13.533  3.738   1.00 28.55  ? 336 GLN A OE1   1 
ATOM   2621 N  NE2   . GLN A 1 339 ? 22.012 14.798  4.039   1.00 25.88  ? 336 GLN A NE2   1 
ATOM   2622 N  N     . VAL A 1 340 ? 21.306 12.458  -1.578  1.00 28.22  ? 337 VAL A N     1 
ATOM   2623 C  CA    . VAL A 1 340 ? 21.928 11.399  -2.359  1.00 31.65  ? 337 VAL A CA    1 
ATOM   2624 C  C     . VAL A 1 340 ? 22.392 11.902  -3.723  1.00 25.36  ? 337 VAL A C     1 
ATOM   2625 O  O     . VAL A 1 340 ? 23.484 11.567  -4.176  1.00 27.81  ? 337 VAL A O     1 
ATOM   2626 C  CB    . VAL A 1 340 ? 20.971 10.205  -2.536  1.00 33.25  ? 337 VAL A CB    1 
ATOM   2627 C  CG1   . VAL A 1 340 ? 21.539 9.197   -3.539  1.00 21.38  ? 337 VAL A CG1   1 
ATOM   2628 C  CG2   . VAL A 1 340 ? 20.700 9.544   -1.190  1.00 32.52  ? 337 VAL A CG2   1 
ATOM   2629 N  N     . GLN A 1 341 ? 21.569 12.718  -4.371  1.00 26.43  ? 338 GLN A N     1 
ATOM   2630 C  CA    . GLN A 1 341 ? 21.901 13.221  -5.696  1.00 30.38  ? 338 GLN A CA    1 
ATOM   2631 C  C     . GLN A 1 341 ? 23.016 14.246  -5.639  1.00 26.96  ? 338 GLN A C     1 
ATOM   2632 O  O     . GLN A 1 341 ? 23.847 14.308  -6.536  1.00 26.79  ? 338 GLN A O     1 
ATOM   2633 C  CB    . GLN A 1 341 ? 20.668 13.804  -6.392  1.00 32.73  ? 338 GLN A CB    1 
ATOM   2634 C  CG    . GLN A 1 341 ? 19.664 12.741  -6.806  1.00 29.84  ? 338 GLN A CG    1 
ATOM   2635 C  CD    . GLN A 1 341 ? 18.381 13.329  -7.362  1.00 51.10  ? 338 GLN A CD    1 
ATOM   2636 O  OE1   . GLN A 1 341 ? 18.107 14.523  -7.206  1.00 51.08  ? 338 GLN A OE1   1 
ATOM   2637 N  NE2   . GLN A 1 341 ? 17.585 12.490  -8.017  1.00 48.06  ? 338 GLN A NE2   1 
ATOM   2638 N  N     . TRP A 1 342 ? 23.035 15.050  -4.583  1.00 24.77  ? 339 TRP A N     1 
ATOM   2639 C  CA    . TRP A 1 342 ? 24.072 16.062  -4.429  1.00 27.04  ? 339 TRP A CA    1 
ATOM   2640 C  C     . TRP A 1 342 ? 25.454 15.437  -4.199  1.00 18.45  ? 339 TRP A C     1 
ATOM   2641 O  O     . TRP A 1 342 ? 26.453 15.888  -4.759  1.00 21.88  ? 339 TRP A O     1 
ATOM   2642 C  CB    . TRP A 1 342 ? 23.730 17.030  -3.291  1.00 25.53  ? 339 TRP A CB    1 
ATOM   2643 C  CG    . TRP A 1 342 ? 24.660 18.212  -3.227  1.00 23.34  ? 339 TRP A CG    1 
ATOM   2644 C  CD1   . TRP A 1 342 ? 24.598 19.345  -3.983  1.00 26.96  ? 339 TRP A CD1   1 
ATOM   2645 C  CD2   . TRP A 1 342 ? 25.797 18.360  -2.374  1.00 25.24  ? 339 TRP A CD2   1 
ATOM   2646 N  NE1   . TRP A 1 342 ? 25.620 20.193  -3.647  1.00 27.42  ? 339 TRP A NE1   1 
ATOM   2647 C  CE2   . TRP A 1 342 ? 26.370 19.614  -2.658  1.00 22.49  ? 339 TRP A CE2   1 
ATOM   2648 C  CE3   . TRP A 1 342 ? 26.385 17.556  -1.392  1.00 21.81  ? 339 TRP A CE3   1 
ATOM   2649 C  CZ2   . TRP A 1 342 ? 27.503 20.084  -2.002  1.00 29.25  ? 339 TRP A CZ2   1 
ATOM   2650 C  CZ3   . TRP A 1 342 ? 27.507 18.025  -0.739  1.00 28.23  ? 339 TRP A CZ3   1 
ATOM   2651 C  CH2   . TRP A 1 342 ? 28.056 19.278  -1.046  1.00 27.26  ? 339 TRP A CH2   1 
ATOM   2652 N  N     . TRP A 1 343 ? 25.504 14.399  -3.380  1.00 18.01  ? 340 TRP A N     1 
ATOM   2653 C  CA    . TRP A 1 343 ? 26.773 13.752  -3.089  1.00 22.94  ? 340 TRP A CA    1 
ATOM   2654 C  C     . TRP A 1 343 ? 27.238 12.886  -4.263  1.00 20.13  ? 340 TRP A C     1 
ATOM   2655 O  O     . TRP A 1 343 ? 28.434 12.791  -4.528  1.00 19.72  ? 340 TRP A O     1 
ATOM   2656 C  CB    . TRP A 1 343 ? 26.697 12.946  -1.787  1.00 18.67  ? 340 TRP A CB    1 
ATOM   2657 C  CG    . TRP A 1 343 ? 26.814 13.803  -0.541  1.00 24.14  ? 340 TRP A CG    1 
ATOM   2658 C  CD1   . TRP A 1 343 ? 25.819 14.110  0.340   1.00 26.70  ? 340 TRP A CD1   1 
ATOM   2659 C  CD2   . TRP A 1 343 ? 27.996 14.462  -0.054  1.00 19.69  ? 340 TRP A CD2   1 
ATOM   2660 N  NE1   . TRP A 1 343 ? 26.306 14.917  1.348   1.00 26.26  ? 340 TRP A NE1   1 
ATOM   2661 C  CE2   . TRP A 1 343 ? 27.639 15.145  1.129   1.00 27.42  ? 340 TRP A CE2   1 
ATOM   2662 C  CE3   . TRP A 1 343 ? 29.317 14.539  -0.502  1.00 17.10  ? 340 TRP A CE3   1 
ATOM   2663 C  CZ2   . TRP A 1 343 ? 28.558 15.894  1.873   1.00 23.12  ? 340 TRP A CZ2   1 
ATOM   2664 C  CZ3   . TRP A 1 343 ? 30.229 15.279  0.239   1.00 21.32  ? 340 TRP A CZ3   1 
ATOM   2665 C  CH2   . TRP A 1 343 ? 29.843 15.948  1.414   1.00 25.61  ? 340 TRP A CH2   1 
ATOM   2666 N  N     . LEU A 1 344 ? 26.300 12.261  -4.972  1.00 16.94  ? 341 LEU A N     1 
ATOM   2667 C  CA    . LEU A 1 344 ? 26.672 11.487  -6.157  1.00 22.38  ? 341 LEU A CA    1 
ATOM   2668 C  C     . LEU A 1 344 ? 27.312 12.448  -7.143  1.00 20.23  ? 341 LEU A C     1 
ATOM   2669 O  O     . LEU A 1 344 ? 28.256 12.104  -7.854  1.00 17.89  ? 341 LEU A O     1 
ATOM   2670 C  CB    . LEU A 1 344 ? 25.461 10.797  -6.804  1.00 17.56  ? 341 LEU A CB    1 
ATOM   2671 C  CG    . LEU A 1 344 ? 24.906 9.515   -6.178  1.00 23.61  ? 341 LEU A CG    1 
ATOM   2672 C  CD1   . LEU A 1 344 ? 23.617 9.083   -6.876  1.00 23.69  ? 341 LEU A CD1   1 
ATOM   2673 C  CD2   . LEU A 1 344 ? 25.929 8.380   -6.194  1.00 21.13  ? 341 LEU A CD2   1 
ATOM   2674 N  N     . LEU A 1 345 ? 26.805 13.673  -7.173  1.00 15.11  ? 342 LEU A N     1 
ATOM   2675 C  CA    . LEU A 1 345 ? 27.382 14.681  -8.046  1.00 18.12  ? 342 LEU A CA    1 
ATOM   2676 C  C     . LEU A 1 345 ? 28.794 15.095  -7.609  1.00 17.69  ? 342 LEU A C     1 
ATOM   2677 O  O     . LEU A 1 345 ? 29.685 15.258  -8.445  1.00 17.69  ? 342 LEU A O     1 
ATOM   2678 C  CB    . LEU A 1 345 ? 26.470 15.905  -8.145  1.00 27.37  ? 342 LEU A CB    1 
ATOM   2679 C  CG    . LEU A 1 345 ? 26.950 17.025  -9.069  1.00 20.40  ? 342 LEU A CG    1 
ATOM   2680 C  CD1   . LEU A 1 345 ? 27.340 16.477  -10.452 1.00 25.37  ? 342 LEU A CD1   1 
ATOM   2681 C  CD2   . LEU A 1 345 ? 25.869 18.104  -9.202  1.00 27.23  ? 342 LEU A CD2   1 
ATOM   2682 N  N     . GLN A 1 346 ? 28.999 15.264  -6.305  1.00 18.36  ? 343 GLN A N     1 
ATOM   2683 C  CA    . GLN A 1 346 ? 30.313 15.676  -5.806  1.00 22.93  ? 343 GLN A CA    1 
ATOM   2684 C  C     . GLN A 1 346 ? 31.345 14.603  -6.136  1.00 16.82  ? 343 GLN A C     1 
ATOM   2685 O  O     . GLN A 1 346 ? 32.446 14.908  -6.581  1.00 14.43  ? 343 GLN A O     1 
ATOM   2686 C  CB    . GLN A 1 346 ? 30.296 15.933  -4.290  1.00 22.01  ? 343 GLN A CB    1 
ATOM   2687 C  CG    . GLN A 1 346 ? 29.286 16.981  -3.824  1.00 18.74  ? 343 GLN A CG    1 
ATOM   2688 C  CD    . GLN A 1 346 ? 29.295 18.222  -4.681  1.00 20.89  ? 343 GLN A CD    1 
ATOM   2689 O  OE1   . GLN A 1 346 ? 30.287 18.957  -4.735  1.00 23.64  ? 343 GLN A OE1   1 
ATOM   2690 N  NE2   . GLN A 1 346 ? 28.189 18.459  -5.374  1.00 26.49  ? 343 GLN A NE2   1 
ATOM   2691 N  N     . LEU A 1 347 ? 30.978 13.348  -5.897  1.00 19.51  ? 344 LEU A N     1 
ATOM   2692 C  CA    . LEU A 1 347 ? 31.844 12.223  -6.232  1.00 21.58  ? 344 LEU A CA    1 
ATOM   2693 C  C     . LEU A 1 347 ? 32.121 12.171  -7.733  1.00 18.97  ? 344 LEU A C     1 
ATOM   2694 O  O     . LEU A 1 347 ? 33.263 11.973  -8.153  1.00 17.77  ? 344 LEU A O     1 
ATOM   2695 C  CB    . LEU A 1 347 ? 31.233 10.907  -5.761  1.00 14.64  ? 344 LEU A CB    1 
ATOM   2696 C  CG    . LEU A 1 347 ? 31.349 10.630  -4.259  1.00 20.09  ? 344 LEU A CG    1 
ATOM   2697 C  CD1   . LEU A 1 347 ? 30.571 9.362   -3.885  1.00 24.52  ? 344 LEU A CD1   1 
ATOM   2698 C  CD2   . LEU A 1 347 ? 32.800 10.496  -3.859  1.00 23.72  ? 344 LEU A CD2   1 
ATOM   2699 N  N     . ALA A 1 348 ? 31.073 12.355  -8.528  1.00 15.99  ? 345 ALA A N     1 
ATOM   2700 C  CA    . ALA A 1 348 ? 31.179 12.309  -9.983  1.00 17.51  ? 345 ALA A CA    1 
ATOM   2701 C  C     . ALA A 1 348 ? 32.057 13.424  -10.522 1.00 16.21  ? 345 ALA A C     1 
ATOM   2702 O  O     . ALA A 1 348 ? 32.729 13.259  -11.544 1.00 13.77  ? 345 ALA A O     1 
ATOM   2703 C  CB    . ALA A 1 348 ? 29.795 12.376  -10.621 1.00 15.46  ? 345 ALA A CB    1 
ATOM   2704 N  N     . GLN A 1 349 ? 32.036 14.570  -9.851  1.00 17.35  ? 346 GLN A N     1 
ATOM   2705 C  CA    . GLN A 1 349 ? 32.883 15.679  -10.257 1.00 15.29  ? 346 GLN A CA    1 
ATOM   2706 C  C     . GLN A 1 349 ? 34.361 15.417  -9.982  1.00 15.93  ? 346 GLN A C     1 
ATOM   2707 O  O     . GLN A 1 349 ? 35.226 15.791  -10.777 1.00 12.74  ? 346 GLN A O     1 
ATOM   2708 C  CB    . GLN A 1 349 ? 32.430 16.984  -9.599  1.00 13.57  ? 346 GLN A CB    1 
ATOM   2709 C  CG    . GLN A 1 349 ? 31.129 17.507  -10.205 1.00 18.30  ? 346 GLN A CG    1 
ATOM   2710 C  CD    . GLN A 1 349 ? 30.644 18.801  -9.566  1.00 29.55  ? 346 GLN A CD    1 
ATOM   2711 O  OE1   . GLN A 1 349 ? 31.088 19.186  -8.484  1.00 29.19  ? 346 GLN A OE1   1 
ATOM   2712 N  NE2   . GLN A 1 349 ? 29.720 19.475  -10.240 1.00 33.03  ? 346 GLN A NE2   1 
ATOM   2713 N  N     . GLU A 1 350 ? 34.661 14.785  -8.856  1.00 12.40  ? 347 GLU A N     1 
ATOM   2714 C  CA    . GLU A 1 350 ? 36.062 14.490  -8.586  1.00 15.35  ? 347 GLU A CA    1 
ATOM   2715 C  C     . GLU A 1 350 ? 36.516 13.434  -9.582  1.00 12.95  ? 347 GLU A C     1 
ATOM   2716 O  O     . GLU A 1 350 ? 37.609 13.527  -10.137 1.00 13.21  ? 347 GLU A O     1 
ATOM   2717 C  CB    . GLU A 1 350 ? 36.299 14.022  -7.149  1.00 15.32  ? 347 GLU A CB    1 
ATOM   2718 C  CG    . GLU A 1 350 ? 37.785 13.725  -6.874  1.00 17.78  ? 347 GLU A CG    1 
ATOM   2719 C  CD    . GLU A 1 350 ? 38.039 13.054  -5.523  1.00 22.15  ? 347 GLU A CD    1 
ATOM   2720 O  OE1   . GLU A 1 350 ? 37.409 13.445  -4.516  1.00 20.96  ? 347 GLU A OE1   1 
ATOM   2721 O  OE2   . GLU A 1 350 ? 38.875 12.131  -5.474  1.00 21.81  ? 347 GLU A OE2   1 
ATOM   2722 N  N     . LEU A 1 351 ? 35.651 12.455  -9.816  1.00 13.71  ? 348 LEU A N     1 
ATOM   2723 C  CA    . LEU A 1 351 ? 35.968 11.324  -10.688 1.00 12.07  ? 348 LEU A CA    1 
ATOM   2724 C  C     . LEU A 1 351 ? 36.227 11.774  -12.125 1.00 18.10  ? 348 LEU A C     1 
ATOM   2725 O  O     . LEU A 1 351 ? 37.170 11.310  -12.776 1.00 13.44  ? 348 LEU A O     1 
ATOM   2726 C  CB    . LEU A 1 351 ? 34.839 10.298  -10.654 1.00 14.05  ? 348 LEU A CB    1 
ATOM   2727 C  CG    . LEU A 1 351 ? 35.131 8.988   -11.403 1.00 18.32  ? 348 LEU A CG    1 
ATOM   2728 C  CD1   . LEU A 1 351 ? 36.335 8.266   -10.778 1.00 16.09  ? 348 LEU A CD1   1 
ATOM   2729 C  CD2   . LEU A 1 351 ? 33.921 8.073   -11.435 1.00 23.41  ? 348 LEU A CD2   1 
ATOM   2730 N  N     . GLU A 1 352 ? 35.390 12.685  -12.617 1.00 14.35  ? 349 GLU A N     1 
ATOM   2731 C  CA    . GLU A 1 352 ? 35.594 13.249  -13.951 1.00 13.08  ? 349 GLU A CA    1 
ATOM   2732 C  C     . GLU A 1 352 ? 36.943 13.947  -14.073 1.00 16.14  ? 349 GLU A C     1 
ATOM   2733 O  O     . GLU A 1 352 ? 37.657 13.789  -15.073 1.00 15.24  ? 349 GLU A O     1 
ATOM   2734 C  CB    . GLU A 1 352 ? 34.471 14.232  -14.315 1.00 19.79  ? 349 GLU A CB    1 
ATOM   2735 C  CG    . GLU A 1 352 ? 34.812 15.028  -15.567 1.00 24.75  ? 349 GLU A CG    1 
ATOM   2736 C  CD    . GLU A 1 352 ? 33.693 15.936  -16.025 1.00 40.79  ? 349 GLU A CD    1 
ATOM   2737 O  OE1   . GLU A 1 352 ? 33.908 16.671  -17.014 1.00 39.64  ? 349 GLU A OE1   1 
ATOM   2738 O  OE2   . GLU A 1 352 ? 32.602 15.911  -15.407 1.00 40.15  ? 349 GLU A OE2   1 
ATOM   2739 N  N     . GLU A 1 353 ? 37.294 14.723  -13.050 1.00 15.67  ? 350 GLU A N     1 
ATOM   2740 C  CA    . GLU A 1 353 ? 38.556 15.453  -13.042 1.00 14.94  ? 350 GLU A CA    1 
ATOM   2741 C  C     . GLU A 1 353 ? 39.739 14.483  -13.107 1.00 16.80  ? 350 GLU A C     1 
ATOM   2742 O  O     . GLU A 1 353 ? 40.644 14.618  -13.937 1.00 15.55  ? 350 GLU A O     1 
ATOM   2743 C  CB    . GLU A 1 353 ? 38.640 16.299  -11.775 1.00 21.15  ? 350 GLU A CB    1 
ATOM   2744 C  CG    . GLU A 1 353 ? 39.690 17.391  -11.800 1.00 26.95  ? 350 GLU A CG    1 
ATOM   2745 C  CD    . GLU A 1 353 ? 39.450 18.415  -10.695 1.00 40.57  ? 350 GLU A CD    1 
ATOM   2746 O  OE1   . GLU A 1 353 ? 39.650 18.061  -9.515  1.00 41.27  ? 350 GLU A OE1   1 
ATOM   2747 O  OE2   . GLU A 1 353 ? 39.031 19.556  -11.002 1.00 39.94  ? 350 GLU A OE2   1 
ATOM   2748 N  N     . ARG A 1 354 ? 39.715 13.488  -12.231 1.00 12.48  ? 351 ARG A N     1 
ATOM   2749 C  CA    . ARG A 1 354 ? 40.744 12.444  -12.248 1.00 20.38  ? 351 ARG A CA    1 
ATOM   2750 C  C     . ARG A 1 354 ? 40.768 11.611  -13.546 1.00 16.90  ? 351 ARG A C     1 
ATOM   2751 O  O     . ARG A 1 354 ? 41.844 11.286  -14.055 1.00 14.85  ? 351 ARG A O     1 
ATOM   2752 C  CB    . ARG A 1 354 ? 40.622 11.554  -11.010 1.00 16.46  ? 351 ARG A CB    1 
ATOM   2753 C  CG    . ARG A 1 354 ? 41.077 12.256  -9.730  1.00 14.08  ? 351 ARG A CG    1 
ATOM   2754 C  CD    . ARG A 1 354 ? 40.608 11.526  -8.496  1.00 19.65  ? 351 ARG A CD    1 
ATOM   2755 N  NE    . ARG A 1 354 ? 41.136 10.171  -8.420  1.00 15.67  ? 351 ARG A NE    1 
ATOM   2756 C  CZ    . ARG A 1 354 ? 40.738 9.280   -7.517  1.00 24.10  ? 351 ARG A CZ    1 
ATOM   2757 N  NH1   . ARG A 1 354 ? 39.801 9.616   -6.623  1.00 23.92  ? 351 ARG A NH1   1 
ATOM   2758 N  NH2   . ARG A 1 354 ? 41.264 8.057   -7.511  1.00 15.60  ? 351 ARG A NH2   1 
ATOM   2759 N  N     . LEU A 1 355 ? 39.593 11.292  -14.091 1.00 14.47  ? 352 LEU A N     1 
ATOM   2760 C  CA    . LEU A 1 355 ? 39.513 10.539  -15.344 1.00 15.10  ? 352 LEU A CA    1 
ATOM   2761 C  C     . LEU A 1 355 ? 40.060 11.305  -16.542 1.00 19.34  ? 352 LEU A C     1 
ATOM   2762 O  O     . LEU A 1 355 ? 40.727 10.735  -17.411 1.00 16.33  ? 352 LEU A O     1 
ATOM   2763 C  CB    . LEU A 1 355 ? 38.079 10.109  -15.647 1.00 13.38  ? 352 LEU A CB    1 
ATOM   2764 C  CG    . LEU A 1 355 ? 37.557 8.901   -14.890 1.00 15.15  ? 352 LEU A CG    1 
ATOM   2765 C  CD1   . LEU A 1 355 ? 36.092 8.673   -15.232 1.00 14.12  ? 352 LEU A CD1   1 
ATOM   2766 C  CD2   . LEU A 1 355 ? 38.396 7.676   -15.227 1.00 14.32  ? 352 LEU A CD2   1 
ATOM   2767 N  N     . THR A 1 356 ? 39.748 12.593  -16.610 1.00 20.06  ? 353 THR A N     1 
ATOM   2768 C  CA    . THR A 1 356 ? 40.216 13.407  -17.711 1.00 16.42  ? 353 THR A CA    1 
ATOM   2769 C  C     . THR A 1 356 ? 41.735 13.523  -17.676 1.00 18.11  ? 353 THR A C     1 
ATOM   2770 O  O     . THR A 1 356 ? 42.403 13.397  -18.706 1.00 19.81  ? 353 THR A O     1 
ATOM   2771 C  CB    . THR A 1 356 ? 39.559 14.799  -17.693 1.00 20.75  ? 353 THR A CB    1 
ATOM   2772 O  OG1   . THR A 1 356 ? 38.146 14.644  -17.857 1.00 16.61  ? 353 THR A OG1   1 
ATOM   2773 C  CG2   . THR A 1 356 ? 40.085 15.654  -18.827 1.00 16.05  ? 353 THR A CG2   1 
ATOM   2774 N  N     . LYS A 1 357 ? 42.289 13.758  -16.492 1.00 16.86  ? 354 LYS A N     1 
ATOM   2775 C  CA    . LYS A 1 357 ? 43.737 13.817  -16.366 1.00 18.96  ? 354 LYS A CA    1 
ATOM   2776 C  C     . LYS A 1 357 ? 44.343 12.465  -16.729 1.00 19.76  ? 354 LYS A C     1 
ATOM   2777 O  O     . LYS A 1 357 ? 45.363 12.392  -17.423 1.00 17.52  ? 354 LYS A O     1 
ATOM   2778 C  CB    . LYS A 1 357 ? 44.167 14.231  -14.962 1.00 20.47  ? 354 LYS A CB    1 
ATOM   2779 C  CG    . LYS A 1 357 ? 45.670 14.446  -14.854 1.00 33.41  ? 354 LYS A CG    1 
ATOM   2780 C  CD    . LYS A 1 357 ? 46.030 15.332  -13.672 1.00 47.77  ? 354 LYS A CD    1 
ATOM   2781 C  CE    . LYS A 1 357 ? 47.416 15.933  -13.851 1.00 47.82  ? 354 LYS A CE    1 
ATOM   2782 N  NZ    . LYS A 1 357 ? 48.411 14.877  -14.186 1.00 36.08  ? 354 LYS A NZ    1 
ATOM   2783 N  N     . ASP A 1 358 ? 43.704 11.394  -16.274 1.00 17.65  ? 355 ASP A N     1 
ATOM   2784 C  CA    . ASP A 1 358 ? 44.182 10.050  -16.595 1.00 21.58  ? 355 ASP A CA    1 
ATOM   2785 C  C     . ASP A 1 358 ? 44.282 9.831   -18.100 1.00 19.57  ? 355 ASP A C     1 
ATOM   2786 O  O     . ASP A 1 358 ? 45.289 9.317   -18.589 1.00 24.80  ? 355 ASP A O     1 
ATOM   2787 C  CB    . ASP A 1 358 ? 43.292 8.964   -15.982 1.00 17.30  ? 355 ASP A CB    1 
ATOM   2788 C  CG    . ASP A 1 358 ? 43.862 7.560   -16.199 1.00 22.24  ? 355 ASP A CG    1 
ATOM   2789 O  OD1   . ASP A 1 358 ? 44.842 7.209   -15.506 1.00 21.76  ? 355 ASP A OD1   1 
ATOM   2790 O  OD2   . ASP A 1 358 ? 43.351 6.819   -17.068 1.00 18.78  ? 355 ASP A OD2   1 
ATOM   2791 N  N     . ARG A 1 359 ? 43.231 10.204  -18.822 1.00 18.18  ? 356 ARG A N     1 
ATOM   2792 C  CA    . ARG A 1 359 ? 43.186 10.032  -20.268 1.00 17.21  ? 356 ARG A CA    1 
ATOM   2793 C  C     . ARG A 1 359 ? 44.292 10.817  -20.978 1.00 15.93  ? 356 ARG A C     1 
ATOM   2794 O  O     . ARG A 1 359 ? 44.877 10.329  -21.931 1.00 15.32  ? 356 ARG A O     1 
ATOM   2795 C  CB    . ARG A 1 359 ? 41.811 10.438  -20.818 1.00 24.36  ? 356 ARG A CB    1 
ATOM   2796 C  CG    . ARG A 1 359 ? 41.563 10.036  -22.272 1.00 24.56  ? 356 ARG A CG    1 
ATOM   2797 C  CD    . ARG A 1 359 ? 40.170 10.486  -22.737 1.00 25.95  ? 356 ARG A CD    1 
ATOM   2798 N  NE    . ARG A 1 359 ? 39.995 11.927  -22.554 1.00 26.50  ? 356 ARG A NE    1 
ATOM   2799 C  CZ    . ARG A 1 359 ? 38.820 12.532  -22.382 1.00 35.74  ? 356 ARG A CZ    1 
ATOM   2800 N  NH1   . ARG A 1 359 ? 37.696 11.821  -22.370 1.00 33.33  ? 356 ARG A NH1   1 
ATOM   2801 N  NH2   . ARG A 1 359 ? 38.770 13.850  -22.226 1.00 31.54  ? 356 ARG A NH2   1 
ATOM   2802 N  N     . ASN A 1 360 ? 44.575 12.030  -20.509 1.00 18.17  ? 357 ASN A N     1 
ATOM   2803 C  CA    . ASN A 1 360 ? 45.650 12.838  -21.085 1.00 17.57  ? 357 ASN A CA    1 
ATOM   2804 C  C     . ASN A 1 360 ? 47.053 12.279  -20.835 1.00 22.78  ? 357 ASN A C     1 
ATOM   2805 O  O     . ASN A 1 360 ? 47.906 12.295  -21.728 1.00 21.38  ? 357 ASN A O     1 
ATOM   2806 C  CB    . ASN A 1 360 ? 45.581 14.271  -20.563 1.00 26.02  ? 357 ASN A CB    1 
ATOM   2807 C  CG    . ASN A 1 360 ? 44.549 15.101  -21.281 1.00 26.99  ? 357 ASN A CG    1 
ATOM   2808 O  OD1   . ASN A 1 360 ? 44.161 14.795  -22.413 1.00 24.85  ? 357 ASN A OD1   1 
ATOM   2809 N  ND2   . ASN A 1 360 ? 44.110 16.176  -20.635 1.00 23.80  ? 357 ASN A ND2   1 
ATOM   2810 N  N     . ASP A 1 361 ? 47.291 11.808  -19.610 1.00 19.92  ? 358 ASP A N     1 
ATOM   2811 C  CA    . ASP A 1 361 ? 48.613 11.317  -19.215 1.00 27.64  ? 358 ASP A CA    1 
ATOM   2812 C  C     . ASP A 1 361 ? 48.920 9.915   -19.739 1.00 17.36  ? 358 ASP A C     1 
ATOM   2813 O  O     . ASP A 1 361 ? 50.065 9.608   -20.074 1.00 21.92  ? 358 ASP A O     1 
ATOM   2814 C  CB    . ASP A 1 361 ? 48.760 11.296  -17.682 1.00 21.40  ? 358 ASP A CB    1 
ATOM   2815 C  CG    . ASP A 1 361 ? 48.701 12.680  -17.055 1.00 35.72  ? 358 ASP A CG    1 
ATOM   2816 O  OD1   . ASP A 1 361 ? 48.859 13.691  -17.782 1.00 28.00  ? 358 ASP A OD1   1 
ATOM   2817 O  OD2   . ASP A 1 361 ? 48.503 12.748  -15.820 1.00 31.80  ? 358 ASP A OD2   1 
ATOM   2818 N  N     . ASN A 1 362 ? 47.902 9.066   -19.794 1.00 16.63  ? 359 ASN A N     1 
ATOM   2819 C  CA    . ASN A 1 362 ? 48.128 7.625   -19.892 1.00 24.21  ? 359 ASN A CA    1 
ATOM   2820 C  C     . ASN A 1 362 ? 47.492 6.970   -21.113 1.00 23.68  ? 359 ASN A C     1 
ATOM   2821 O  O     . ASN A 1 362 ? 47.604 5.763   -21.287 1.00 20.88  ? 359 ASN A O     1 
ATOM   2822 C  CB    . ASN A 1 362 ? 47.674 6.919   -18.597 1.00 17.95  ? 359 ASN A CB    1 
ATOM   2823 C  CG    . ASN A 1 362 ? 48.454 7.394   -17.369 1.00 24.65  ? 359 ASN A CG    1 
ATOM   2824 O  OD1   . ASN A 1 362 ? 49.664 7.615   -17.436 1.00 17.22  ? 359 ASN A OD1   1 
ATOM   2825 N  ND2   . ASN A 1 362 ? 47.758 7.562   -16.248 1.00 20.09  ? 359 ASN A ND2   1 
ATOM   2826 N  N     . ASP A 1 363 ? 46.830 7.767   -21.949 1.00 21.10  ? 360 ASP A N     1 
ATOM   2827 C  CA    . ASP A 1 363 ? 46.306 7.281   -23.232 1.00 16.54  ? 360 ASP A CA    1 
ATOM   2828 C  C     . ASP A 1 363 ? 45.400 6.088   -23.092 1.00 26.23  ? 360 ASP A C     1 
ATOM   2829 O  O     . ASP A 1 363 ? 45.611 5.062   -23.736 1.00 24.09  ? 360 ASP A O     1 
ATOM   2830 C  CB    . ASP A 1 363 ? 47.448 6.927   -24.181 1.00 26.14  ? 360 ASP A CB    1 
ATOM   2831 C  CG    . ASP A 1 363 ? 48.304 8.125   -24.515 1.00 34.09  ? 360 ASP A CG    1 
ATOM   2832 O  OD1   . ASP A 1 363 ? 47.737 9.158   -24.936 1.00 28.98  ? 360 ASP A OD1   1 
ATOM   2833 O  OD2   . ASP A 1 363 ? 49.533 8.043   -24.326 1.00 31.39  ? 360 ASP A OD2   1 
ATOM   2834 N  N     . ARG A 1 364 ? 44.388 6.228   -22.245 1.00 24.50  ? 361 ARG A N     1 
ATOM   2835 C  CA    . ARG A 1 364 ? 43.386 5.191   -22.067 1.00 23.92  ? 361 ARG A CA    1 
ATOM   2836 C  C     . ARG A 1 364 ? 42.085 5.844   -21.638 1.00 21.91  ? 361 ARG A C     1 
ATOM   2837 O  O     . ARG A 1 364 ? 42.074 6.996   -21.186 1.00 21.37  ? 361 ARG A O     1 
ATOM   2838 C  CB    . ARG A 1 364 ? 43.840 4.188   -21.005 1.00 23.27  ? 361 ARG A CB    1 
ATOM   2839 C  CG    . ARG A 1 364 ? 44.156 4.840   -19.664 1.00 22.54  ? 361 ARG A CG    1 
ATOM   2840 C  CD    . ARG A 1 364 ? 44.626 3.828   -18.626 1.00 21.26  ? 361 ARG A CD    1 
ATOM   2841 N  NE    . ARG A 1 364 ? 44.761 4.436   -17.300 1.00 21.71  ? 361 ARG A NE    1 
ATOM   2842 C  CZ    . ARG A 1 364 ? 44.993 3.746   -16.186 1.00 26.81  ? 361 ARG A CZ    1 
ATOM   2843 N  NH1   . ARG A 1 364 ? 45.101 4.365   -15.007 1.00 22.72  ? 361 ARG A NH1   1 
ATOM   2844 N  NH2   . ARG A 1 364 ? 45.125 2.434   -16.254 1.00 18.87  ? 361 ARG A NH2   1 
ATOM   2845 N  N     . VAL A 1 365 ? 40.996 5.106   -21.796 1.00 23.71  ? 362 VAL A N     1 
ATOM   2846 C  CA    . VAL A 1 365 ? 39.686 5.531   -21.326 1.00 27.67  ? 362 VAL A CA    1 
ATOM   2847 C  C     . VAL A 1 365 ? 39.000 4.390   -20.584 1.00 27.96  ? 362 VAL A C     1 
ATOM   2848 O  O     . VAL A 1 365 ? 39.035 3.236   -21.027 1.00 21.87  ? 362 VAL A O     1 
ATOM   2849 C  CB    . VAL A 1 365 ? 38.774 5.959   -22.493 1.00 30.62  ? 362 VAL A CB    1 
ATOM   2850 C  CG1   . VAL A 1 365 ? 39.234 7.298   -23.064 1.00 30.08  ? 362 VAL A CG1   1 
ATOM   2851 C  CG2   . VAL A 1 365 ? 38.749 4.878   -23.572 1.00 37.08  ? 362 VAL A CG2   1 
ATOM   2852 N  N     . ALA A 1 366 ? 38.379 4.719   -19.454 1.00 18.62  ? 363 ALA A N     1 
ATOM   2853 C  CA    . ALA A 1 366 ? 37.565 3.758   -18.723 1.00 22.42  ? 363 ALA A CA    1 
ATOM   2854 C  C     . ALA A 1 366 ? 36.254 3.538   -19.471 1.00 27.21  ? 363 ALA A C     1 
ATOM   2855 O  O     . ALA A 1 366 ? 35.742 4.443   -20.143 1.00 27.37  ? 363 ALA A O     1 
ATOM   2856 C  CB    . ALA A 1 366 ? 37.294 4.265   -17.314 1.00 16.02  ? 363 ALA A CB    1 
ATOM   2857 N  N     . THR A 1 367 ? 35.695 2.343   -19.355 1.00 18.55  ? 364 THR A N     1 
ATOM   2858 C  CA    . THR A 1 367 ? 34.494 2.046   -20.113 1.00 23.35  ? 364 THR A CA    1 
ATOM   2859 C  C     . THR A 1 367 ? 33.336 1.553   -19.254 1.00 21.07  ? 364 THR A C     1 
ATOM   2860 O  O     . THR A 1 367 ? 32.219 1.408   -19.741 1.00 20.90  ? 364 THR A O     1 
ATOM   2861 C  CB    . THR A 1 367 ? 34.801 1.017   -21.221 1.00 25.15  ? 364 THR A CB    1 
ATOM   2862 O  OG1   . THR A 1 367 ? 35.170 -0.236  -20.623 1.00 22.97  ? 364 THR A OG1   1 
ATOM   2863 C  CG2   . THR A 1 367 ? 35.960 1.519   -22.074 1.00 19.07  ? 364 THR A CG2   1 
ATOM   2864 N  N     . GLN A 1 368 ? 33.606 1.273   -17.983 1.00 24.26  ? 365 GLN A N     1 
ATOM   2865 C  CA    . GLN A 1 368 ? 32.563 0.805   -17.081 1.00 23.05  ? 365 GLN A CA    1 
ATOM   2866 C  C     . GLN A 1 368 ? 32.538 1.644   -15.803 1.00 25.67  ? 365 GLN A C     1 
ATOM   2867 O  O     . GLN A 1 368 ? 33.584 1.955   -15.229 1.00 21.21  ? 365 GLN A O     1 
ATOM   2868 C  CB    . GLN A 1 368 ? 32.775 -0.662  -16.735 1.00 24.62  ? 365 GLN A CB    1 
ATOM   2869 C  CG    . GLN A 1 368 ? 31.588 -1.306  -16.051 1.00 28.87  ? 365 GLN A CG    1 
ATOM   2870 C  CD    . GLN A 1 368 ? 31.809 -2.781  -15.768 1.00 38.44  ? 365 GLN A CD    1 
ATOM   2871 O  OE1   . GLN A 1 368 ? 32.695 -3.151  -14.996 1.00 48.86  ? 365 GLN A OE1   1 
ATOM   2872 N  NE2   . GLN A 1 368 ? 31.006 -3.633  -16.397 1.00 30.87  ? 365 GLN A NE2   1 
ATOM   2873 N  N     . LEU A 1 369 ? 31.338 2.021   -15.377 1.00 23.87  ? 366 LEU A N     1 
ATOM   2874 C  CA    . LEU A 1 369 ? 31.153 2.722   -14.108 1.00 28.54  ? 366 LEU A CA    1 
ATOM   2875 C  C     . LEU A 1 369 ? 30.522 1.764   -13.108 1.00 22.08  ? 366 LEU A C     1 
ATOM   2876 O  O     . LEU A 1 369 ? 29.460 1.193   -13.363 1.00 26.91  ? 366 LEU A O     1 
ATOM   2877 C  CB    . LEU A 1 369 ? 30.271 3.963   -14.287 1.00 19.63  ? 366 LEU A CB    1 
ATOM   2878 C  CG    . LEU A 1 369 ? 29.979 4.819   -13.045 1.00 24.42  ? 366 LEU A CG    1 
ATOM   2879 C  CD1   . LEU A 1 369 ? 31.236 5.530   -12.551 1.00 23.52  ? 366 LEU A CD1   1 
ATOM   2880 C  CD2   . LEU A 1 369 ? 28.873 5.838   -13.337 1.00 27.92  ? 366 LEU A CD2   1 
ATOM   2881 N  N     . VAL A 1 370 ? 31.196 1.565   -11.986 1.00 20.15  ? 367 VAL A N     1 
ATOM   2882 C  CA    . VAL A 1 370 ? 30.671 0.741   -10.910 1.00 18.24  ? 367 VAL A CA    1 
ATOM   2883 C  C     . VAL A 1 370 ? 30.123 1.625   -9.785  1.00 25.44  ? 367 VAL A C     1 
ATOM   2884 O  O     . VAL A 1 370 ? 30.801 2.543   -9.330  1.00 22.65  ? 367 VAL A O     1 
ATOM   2885 C  CB    . VAL A 1 370 ? 31.766 -0.179  -10.346 1.00 23.30  ? 367 VAL A CB    1 
ATOM   2886 C  CG1   . VAL A 1 370 ? 31.275 -0.884  -9.089  1.00 21.46  ? 367 VAL A CG1   1 
ATOM   2887 C  CG2   . VAL A 1 370 ? 32.212 -1.185  -11.407 1.00 22.04  ? 367 VAL A CG2   1 
ATOM   2888 N  N     . VAL A 1 371 ? 28.899 1.347   -9.344  1.00 20.26  ? 368 VAL A N     1 
ATOM   2889 C  CA    . VAL A 1 371 ? 28.275 2.126   -8.279  1.00 20.97  ? 368 VAL A CA    1 
ATOM   2890 C  C     . VAL A 1 371 ? 28.031 1.237   -7.083  1.00 26.00  ? 368 VAL A C     1 
ATOM   2891 O  O     . VAL A 1 371 ? 27.480 0.140   -7.213  1.00 25.72  ? 368 VAL A O     1 
ATOM   2892 C  CB    . VAL A 1 371 ? 26.932 2.739   -8.713  1.00 25.63  ? 368 VAL A CB    1 
ATOM   2893 C  CG1   . VAL A 1 371 ? 26.422 3.729   -7.647  1.00 20.07  ? 368 VAL A CG1   1 
ATOM   2894 C  CG2   . VAL A 1 371 ? 27.074 3.429   -10.057 1.00 23.09  ? 368 VAL A CG2   1 
ATOM   2895 N  N     . SER A 1 372 ? 28.454 1.703   -5.914  1.00 19.66  ? 369 SER A N     1 
ATOM   2896 C  CA    . SER A 1 372 ? 28.299 0.921   -4.702  1.00 17.79  ? 369 SER A CA    1 
ATOM   2897 C  C     . SER A 1 372 ? 27.803 1.784   -3.540  1.00 21.97  ? 369 SER A C     1 
ATOM   2898 O  O     . SER A 1 372 ? 28.164 2.955   -3.413  1.00 17.18  ? 369 SER A O     1 
ATOM   2899 C  CB    . SER A 1 372 ? 29.615 0.230   -4.344  1.00 26.14  ? 369 SER A CB    1 
ATOM   2900 O  OG    . SER A 1 372 ? 29.485 -0.501  -3.141  1.00 32.67  ? 369 SER A OG    1 
ATOM   2901 N  N     . ILE A 1 373 ? 26.954 1.201   -2.707  1.00 20.45  ? 370 ILE A N     1 
ATOM   2902 C  CA    . ILE A 1 373 ? 26.418 1.916   -1.556  1.00 23.39  ? 370 ILE A CA    1 
ATOM   2903 C  C     . ILE A 1 373 ? 26.379 1.027   -0.317  1.00 26.25  ? 370 ILE A C     1 
ATOM   2904 O  O     . ILE A 1 373 ? 26.490 -0.200  -0.411  1.00 27.26  ? 370 ILE A O     1 
ATOM   2905 C  CB    . ILE A 1 373 ? 25.001 2.457   -1.830  1.00 22.93  ? 370 ILE A CB    1 
ATOM   2906 C  CG1   . ILE A 1 373 ? 23.995 1.307   -1.915  1.00 26.67  ? 370 ILE A CG1   1 
ATOM   2907 C  CG2   . ILE A 1 373 ? 24.977 3.337   -3.085  1.00 18.36  ? 370 ILE A CG2   1 
ATOM   2908 C  CD1   . ILE A 1 373 ? 22.580 1.769   -2.131  1.00 32.89  ? 370 ILE A CD1   1 
ATOM   2909 N  N     . ARG A 1 374 ? 26.243 1.659   0.845   1.00 23.99  ? 371 ARG A N     1 
ATOM   2910 C  CA    . ARG A 1 374 ? 25.995 0.940   2.082   1.00 28.53  ? 371 ARG A CA    1 
ATOM   2911 C  C     . ARG A 1 374 ? 24.740 1.547   2.692   1.00 36.55  ? 371 ARG A C     1 
ATOM   2912 O  O     . ARG A 1 374 ? 24.517 2.760   2.597   1.00 26.16  ? 371 ARG A O     1 
ATOM   2913 C  CB    . ARG A 1 374 ? 27.186 1.039   3.040   1.00 32.35  ? 371 ARG A CB    1 
ATOM   2914 C  CG    . ARG A 1 374 ? 27.203 -0.019  4.148   1.00 31.76  ? 371 ARG A CG    1 
ATOM   2915 C  CD    . ARG A 1 374 ? 28.448 0.119   5.029   1.00 48.06  ? 371 ARG A CD    1 
ATOM   2916 N  NE    . ARG A 1 374 ? 28.542 1.444   5.649   1.00 56.25  ? 371 ARG A NE    1 
ATOM   2917 C  CZ    . ARG A 1 374 ? 29.677 2.123   5.814   1.00 50.83  ? 371 ARG A CZ    1 
ATOM   2918 N  NH1   . ARG A 1 374 ? 30.825 1.599   5.401   1.00 54.81  ? 371 ARG A NH1   1 
ATOM   2919 N  NH2   . ARG A 1 374 ? 29.665 3.329   6.390   1.00 41.19  ? 371 ARG A NH2   1 
ATOM   2920 N  N     . VAL A 1 375 ? 23.900 0.689   3.267   1.00 38.09  ? 372 VAL A N     1 
ATOM   2921 C  CA    . VAL A 1 375 ? 22.673 1.130   3.916   1.00 41.60  ? 372 VAL A CA    1 
ATOM   2922 C  C     . VAL A 1 375 ? 22.805 0.939   5.420   1.00 32.96  ? 372 VAL A C     1 
ATOM   2923 O  O     . VAL A 1 375 ? 23.497 0.031   5.887   1.00 35.20  ? 372 VAL A O     1 
ATOM   2924 C  CB    . VAL A 1 375 ? 21.442 0.370   3.400   1.00 39.06  ? 372 VAL A CB    1 
ATOM   2925 C  CG1   . VAL A 1 375 ? 21.213 0.671   1.928   1.00 41.80  ? 372 VAL A CG1   1 
ATOM   2926 C  CG2   . VAL A 1 375 ? 21.611 -1.116  3.630   1.00 43.43  ? 372 VAL A CG2   1 
ATOM   2927 N  N     . GLN A 1 376 ? 22.157 1.812   6.177   1.00 34.99  ? 373 GLN A N     1 
ATOM   2928 C  CA    . GLN A 1 376 ? 22.282 1.781   7.624   1.00 37.49  ? 373 GLN A CA    1 
ATOM   2929 C  C     . GLN A 1 376 ? 21.901 0.418   8.198   1.00 41.30  ? 373 GLN A C     1 
ATOM   2930 O  O     . GLN A 1 376 ? 20.796 -0.068  7.979   1.00 41.46  ? 373 GLN A O     1 
ATOM   2931 C  CB    . GLN A 1 376 ? 21.422 2.877   8.239   1.00 38.02  ? 373 GLN A CB    1 
ATOM   2932 C  CG    . GLN A 1 376 ? 21.966 3.404   9.553   1.00 53.85  ? 373 GLN A CG    1 
ATOM   2933 C  CD    . GLN A 1 376 ? 21.487 4.809   9.841   1.00 48.30  ? 373 GLN A CD    1 
ATOM   2934 O  OE1   . GLN A 1 376 ? 20.348 5.164   9.527   1.00 54.90  ? 373 GLN A OE1   1 
ATOM   2935 N  NE2   . GLN A 1 376 ? 22.363 5.629   10.416  1.00 54.98  ? 373 GLN A NE2   1 
ATOM   2936 N  N     . GLY A 1 377 ? 22.825 -0.200  8.927   1.00 45.25  ? 374 GLY A N     1 
ATOM   2937 C  CA    . GLY A 1 377 ? 22.561 -1.488  9.547   1.00 61.18  ? 374 GLY A CA    1 
ATOM   2938 C  C     . GLY A 1 377 ? 23.540 -2.581  9.154   1.00 61.47  ? 374 GLY A C     1 
ATOM   2939 O  O     . GLY A 1 377 ? 24.082 -3.287  10.007  1.00 56.23  ? 374 GLY A O     1 
ATOM   2940 N  N     . ASP A 1 378 ? 23.764 -2.718  7.852   1.00 51.79  ? 375 ASP A N     1 
ATOM   2941 C  CA    . ASP A 1 378 ? 24.650 -3.739  7.313   1.00 51.18  ? 375 ASP A CA    1 
ATOM   2942 C  C     . ASP A 1 378 ? 26.103 -3.484  7.725   1.00 65.69  ? 375 ASP A C     1 
ATOM   2943 O  O     . ASP A 1 378 ? 26.614 -2.375  7.559   1.00 76.29  ? 375 ASP A O     1 
ATOM   2944 C  CB    . ASP A 1 378 ? 24.530 -3.739  5.791   1.00 52.71  ? 375 ASP A CB    1 
ATOM   2945 C  CG    . ASP A 1 378 ? 25.152 -4.955  5.156   1.00 53.12  ? 375 ASP A CG    1 
ATOM   2946 O  OD1   . ASP A 1 378 ? 25.962 -5.639  5.821   1.00 49.49  ? 375 ASP A OD1   1 
ATOM   2947 O  OD2   . ASP A 1 378 ? 24.828 -5.218  3.982   1.00 43.90  ? 375 ASP A OD2   1 
ATOM   2948 N  N     . LYS A 1 379 ? 26.774 -4.505  8.253   1.00 62.12  ? 376 LYS A N     1 
ATOM   2949 C  CA    . LYS A 1 379 ? 28.153 -4.335  8.720   1.00 72.16  ? 376 LYS A CA    1 
ATOM   2950 C  C     . LYS A 1 379 ? 29.185 -4.684  7.645   1.00 76.57  ? 376 LYS A C     1 
ATOM   2951 O  O     . LYS A 1 379 ? 30.367 -4.882  7.942   1.00 74.81  ? 376 LYS A O     1 
ATOM   2952 C  CB    . LYS A 1 379 ? 28.415 -5.164  9.984   1.00 79.44  ? 376 LYS A CB    1 
ATOM   2953 C  CG    . LYS A 1 379 ? 29.622 -4.698  10.798  1.00 77.79  ? 376 LYS A CG    1 
ATOM   2954 C  CD    . LYS A 1 379 ? 30.325 -5.868  11.468  1.00 81.49  ? 376 LYS A CD    1 
ATOM   2955 C  CE    . LYS A 1 379 ? 30.898 -6.824  10.430  1.00 70.20  ? 376 LYS A CE    1 
ATOM   2956 N  NZ    . LYS A 1 379 ? 31.513 -8.026  11.051  1.00 62.00  ? 376 LYS A NZ    1 
ATOM   2957 N  N     . ARG A 1 380 ? 28.736 -4.756  6.396   1.00 71.94  ? 377 ARG A N     1 
ATOM   2958 C  CA    . ARG A 1 380 ? 29.632 -5.041  5.281   1.00 65.24  ? 377 ARG A CA    1 
ATOM   2959 C  C     . ARG A 1 380 ? 30.147 -3.748  4.655   1.00 65.39  ? 377 ARG A C     1 
ATOM   2960 O  O     . ARG A 1 380 ? 29.448 -2.733  4.658   1.00 67.78  ? 377 ARG A O     1 
ATOM   2961 C  CB    . ARG A 1 380 ? 28.912 -5.882  4.225   1.00 59.73  ? 377 ARG A CB    1 
ATOM   2962 C  CG    . ARG A 1 380 ? 28.392 -7.212  4.745   1.00 60.14  ? 377 ARG A CG    1 
ATOM   2963 C  CD    . ARG A 1 380 ? 27.625 -7.960  3.669   1.00 49.16  ? 377 ARG A CD    1 
ATOM   2964 N  NE    . ARG A 1 380 ? 26.383 -7.285  3.300   1.00 46.83  ? 377 ARG A NE    1 
ATOM   2965 C  CZ    . ARG A 1 380 ? 25.608 -7.660  2.288   1.00 44.33  ? 377 ARG A CZ    1 
ATOM   2966 N  NH1   . ARG A 1 380 ? 25.953 -8.703  1.548   1.00 39.58  ? 377 ARG A NH1   1 
ATOM   2967 N  NH2   . ARG A 1 380 ? 24.491 -7.000  2.013   1.00 40.32  ? 377 ARG A NH2   1 
ATOM   2968 N  N     . LEU A 1 381 ? 31.373 -3.786  4.138   1.00 54.79  ? 378 LEU A N     1 
ATOM   2969 C  CA    . LEU A 1 381 ? 31.924 -2.663  3.391   1.00 58.06  ? 378 LEU A CA    1 
ATOM   2970 C  C     . LEU A 1 381 ? 30.850 -2.153  2.439   1.00 60.37  ? 378 LEU A C     1 
ATOM   2971 O  O     . LEU A 1 381 ? 30.439 -0.991  2.508   1.00 60.20  ? 378 LEU A O     1 
ATOM   2972 C  CB    . LEU A 1 381 ? 33.171 -3.098  2.605   1.00 72.30  ? 378 LEU A CB    1 
ATOM   2973 C  CG    . LEU A 1 381 ? 34.096 -2.056  1.948   1.00 72.37  ? 378 LEU A CG    1 
ATOM   2974 C  CD1   . LEU A 1 381 ? 35.445 -2.679  1.582   1.00 53.16  ? 378 LEU A CD1   1 
ATOM   2975 C  CD2   . LEU A 1 381 ? 33.461 -1.395  0.723   1.00 59.19  ? 378 LEU A CD2   1 
ATOM   2976 N  N     . SER A 1 382 ? 30.388 -3.039  1.562   1.00 58.66  ? 379 SER A N     1 
ATOM   2977 C  CA    . SER A 1 382 ? 29.359 -2.697  0.588   1.00 52.54  ? 379 SER A CA    1 
ATOM   2978 C  C     . SER A 1 382 ? 28.089 -3.493  0.796   1.00 48.41  ? 379 SER A C     1 
ATOM   2979 O  O     . SER A 1 382 ? 28.129 -4.705  1.029   1.00 49.57  ? 379 SER A O     1 
ATOM   2980 C  CB    . SER A 1 382 ? 29.843 -2.940  -0.840  1.00 49.89  ? 379 SER A CB    1 
ATOM   2981 O  OG    . SER A 1 382 ? 28.734 -2.992  -1.728  1.00 38.80  ? 379 SER A OG    1 
ATOM   2982 N  N     . SER A 1 383 ? 26.960 -2.804  0.683   1.00 43.05  ? 380 SER A N     1 
ATOM   2983 C  CA    . SER A 1 383 ? 25.661 -3.452  0.722   1.00 46.33  ? 380 SER A CA    1 
ATOM   2984 C  C     . SER A 1 383 ? 25.286 -3.946  -0.664  1.00 51.34  ? 380 SER A C     1 
ATOM   2985 O  O     . SER A 1 383 ? 24.647 -4.989  -0.808  1.00 48.85  ? 380 SER A O     1 
ATOM   2986 C  CB    . SER A 1 383 ? 24.585 -2.485  1.234   1.00 43.91  ? 380 SER A CB    1 
ATOM   2987 O  OG    . SER A 1 383 ? 24.769 -2.186  2.611   1.00 42.44  ? 380 SER A OG    1 
ATOM   2988 N  N     . LEU A 1 384 ? 25.691 -3.197  -1.687  1.00 45.63  ? 381 LEU A N     1 
ATOM   2989 C  CA    . LEU A 1 384 ? 25.230 -3.473  -3.043  1.00 40.02  ? 381 LEU A CA    1 
ATOM   2990 C  C     . LEU A 1 384 ? 26.082 -2.820  -4.133  1.00 41.10  ? 381 LEU A C     1 
ATOM   2991 O  O     . LEU A 1 384 ? 26.485 -1.659  -4.020  1.00 28.72  ? 381 LEU A O     1 
ATOM   2992 C  CB    . LEU A 1 384 ? 23.773 -3.039  -3.187  1.00 34.83  ? 381 LEU A CB    1 
ATOM   2993 C  CG    . LEU A 1 384 ? 23.156 -3.160  -4.578  1.00 40.34  ? 381 LEU A CG    1 
ATOM   2994 C  CD1   . LEU A 1 384 ? 21.754 -3.732  -4.471  1.00 43.94  ? 381 LEU A CD1   1 
ATOM   2995 C  CD2   . LEU A 1 384 ? 23.140 -1.821  -5.284  1.00 33.60  ? 381 LEU A CD2   1 
ATOM   2996 N  N     . ARG A 1 385 ? 26.328 -3.577  -5.198  1.00 35.01  ? 382 ARG A N     1 
ATOM   2997 C  CA    . ARG A 1 385 ? 27.168 -3.132  -6.304  1.00 32.04  ? 382 ARG A CA    1 
ATOM   2998 C  C     . ARG A 1 385 ? 26.414 -3.322  -7.616  1.00 29.33  ? 382 ARG A C     1 
ATOM   2999 O  O     . ARG A 1 385 ? 25.798 -4.364  -7.848  1.00 34.52  ? 382 ARG A O     1 
ATOM   3000 C  CB    . ARG A 1 385 ? 28.465 -3.942  -6.331  1.00 37.16  ? 382 ARG A CB    1 
ATOM   3001 C  CG    . ARG A 1 385 ? 29.732 -3.120  -6.269  1.00 40.62  ? 382 ARG A CG    1 
ATOM   3002 C  CD    . ARG A 1 385 ? 30.936 -3.997  -5.916  1.00 49.60  ? 382 ARG A CD    1 
ATOM   3003 N  NE    . ARG A 1 385 ? 30.723 -4.753  -4.678  1.00 58.36  ? 382 ARG A NE    1 
ATOM   3004 C  CZ    . ARG A 1 385 ? 31.624 -5.563  -4.118  1.00 58.44  ? 382 ARG A CZ    1 
ATOM   3005 N  NH1   . ARG A 1 385 ? 32.819 -5.733  -4.680  1.00 48.97  ? 382 ARG A NH1   1 
ATOM   3006 N  NH2   . ARG A 1 385 ? 31.333 -6.208  -2.993  1.00 39.21  ? 382 ARG A NH2   1 
ATOM   3007 N  N     . ARG A 1 386 ? 26.453 -2.299  -8.458  1.00 19.70  ? 383 ARG A N     1 
ATOM   3008 C  CA    . ARG A 1 386 ? 25.782 -2.309  -9.750  1.00 28.95  ? 383 ARG A CA    1 
ATOM   3009 C  C     . ARG A 1 386 ? 26.618 -1.516  -10.741 1.00 29.00  ? 383 ARG A C     1 
ATOM   3010 O  O     . ARG A 1 386 ? 27.111 -0.440  -10.417 1.00 24.86  ? 383 ARG A O     1 
ATOM   3011 C  CB    . ARG A 1 386 ? 24.406 -1.662  -9.639  1.00 26.82  ? 383 ARG A CB    1 
ATOM   3012 C  CG    . ARG A 1 386 ? 23.417 -2.431  -8.801  1.00 34.12  ? 383 ARG A CG    1 
ATOM   3013 C  CD    . ARG A 1 386 ? 22.899 -3.632  -9.560  1.00 29.87  ? 383 ARG A CD    1 
ATOM   3014 N  NE    . ARG A 1 386 ? 21.730 -4.202  -8.908  1.00 24.85  ? 383 ARG A NE    1 
ATOM   3015 C  CZ    . ARG A 1 386 ? 21.787 -5.080  -7.915  1.00 37.17  ? 383 ARG A CZ    1 
ATOM   3016 N  NH1   . ARG A 1 386 ? 22.964 -5.487  -7.457  1.00 36.41  ? 383 ARG A NH1   1 
ATOM   3017 N  NH2   . ARG A 1 386 ? 20.664 -5.556  -7.384  1.00 48.97  ? 383 ARG A NH2   1 
ATOM   3018 N  N     . CYS A 1 387 ? 26.767 -2.036  -11.953 1.00 31.30  ? 384 CYS A N     1 
ATOM   3019 C  CA    . CYS A 1 387 ? 27.568 -1.351  -12.961 1.00 25.28  ? 384 CYS A CA    1 
ATOM   3020 C  C     . CYS A 1 387 ? 26.718 -0.828  -14.120 1.00 26.61  ? 384 CYS A C     1 
ATOM   3021 O  O     . CYS A 1 387 ? 25.668 -1.382  -14.429 1.00 30.88  ? 384 CYS A O     1 
ATOM   3022 C  CB    . CYS A 1 387 ? 28.681 -2.282  -13.474 1.00 30.88  ? 384 CYS A CB    1 
ATOM   3023 S  SG    . CYS A 1 387 ? 28.079 -3.820  -14.232 1.00 55.79  ? 384 CYS A SG    1 
ATOM   3024 N  N     . CYS A 1 388 ? 27.174 0.243   -14.758 1.00 30.13  ? 385 CYS A N     1 
ATOM   3025 C  CA    . CYS A 1 388 ? 26.554 0.714   -15.993 1.00 35.35  ? 385 CYS A CA    1 
ATOM   3026 C  C     . CYS A 1 388 ? 27.636 1.143   -16.973 1.00 31.80  ? 385 CYS A C     1 
ATOM   3027 O  O     . CYS A 1 388 ? 28.817 1.175   -16.624 1.00 32.14  ? 385 CYS A O     1 
ATOM   3028 C  CB    . CYS A 1 388 ? 25.584 1.866   -15.719 1.00 30.91  ? 385 CYS A CB    1 
ATOM   3029 S  SG    . CYS A 1 388 ? 26.342 3.374   -15.072 1.00 36.36  ? 385 CYS A SG    1 
ATOM   3030 N  N     . ALA A 1 389 ? 27.245 1.469   -18.201 1.00 32.26  ? 386 ALA A N     1 
ATOM   3031 C  CA    . ALA A 1 389 ? 28.225 1.906   -19.191 1.00 28.29  ? 386 ALA A CA    1 
ATOM   3032 C  C     . ALA A 1 389 ? 28.740 3.293   -18.858 1.00 24.57  ? 386 ALA A C     1 
ATOM   3033 O  O     . ALA A 1 389 ? 28.009 4.131   -18.335 1.00 29.95  ? 386 ALA A O     1 
ATOM   3034 C  CB    . ALA A 1 389 ? 27.637 1.878   -20.592 1.00 31.31  ? 386 ALA A CB    1 
ATOM   3035 N  N     . LEU A 1 390 ? 30.011 3.520   -19.158 1.00 24.85  ? 387 LEU A N     1 
ATOM   3036 C  CA    . LEU A 1 390 ? 30.636 4.817   -18.966 1.00 27.46  ? 387 LEU A CA    1 
ATOM   3037 C  C     . LEU A 1 390 ? 31.120 5.298   -20.331 1.00 28.98  ? 387 LEU A C     1 
ATOM   3038 O  O     . LEU A 1 390 ? 32.206 4.929   -20.776 1.00 31.76  ? 387 LEU A O     1 
ATOM   3039 C  CB    . LEU A 1 390 ? 31.815 4.683   -18.000 1.00 26.62  ? 387 LEU A CB    1 
ATOM   3040 C  CG    . LEU A 1 390 ? 32.290 5.908   -17.214 1.00 27.58  ? 387 LEU A CG    1 
ATOM   3041 C  CD1   . LEU A 1 390 ? 33.425 5.500   -16.291 1.00 22.69  ? 387 LEU A CD1   1 
ATOM   3042 C  CD2   . LEU A 1 390 ? 32.740 7.026   -18.134 1.00 24.88  ? 387 LEU A CD2   1 
ATOM   3043 N  N     . THR A 1 391 ? 30.310 6.120   -20.992 1.00 26.50  ? 388 THR A N     1 
ATOM   3044 C  CA    . THR A 1 391 ? 30.537 6.466   -22.393 1.00 31.40  ? 388 THR A CA    1 
ATOM   3045 C  C     . THR A 1 391 ? 31.128 7.855   -22.596 1.00 34.17  ? 388 THR A C     1 
ATOM   3046 O  O     . THR A 1 391 ? 31.752 8.124   -23.622 1.00 29.71  ? 388 THR A O     1 
ATOM   3047 C  CB    . THR A 1 391 ? 29.229 6.371   -23.208 1.00 40.39  ? 388 THR A CB    1 
ATOM   3048 O  OG1   . THR A 1 391 ? 28.233 7.223   -22.622 1.00 36.59  ? 388 THR A OG1   1 
ATOM   3049 C  CG2   . THR A 1 391 ? 28.718 4.937   -23.231 1.00 31.36  ? 388 THR A CG2   1 
ATOM   3050 N  N     . ARG A 1 392 ? 30.912 8.740   -21.630 1.00 27.03  ? 389 ARG A N     1 
ATOM   3051 C  CA    . ARG A 1 392 ? 31.475 10.083  -21.685 1.00 31.68  ? 389 ARG A CA    1 
ATOM   3052 C  C     . ARG A 1 392 ? 31.963 10.528  -20.311 1.00 21.55  ? 389 ARG A C     1 
ATOM   3053 O  O     . ARG A 1 392 ? 31.329 10.252  -19.299 1.00 30.63  ? 389 ARG A O     1 
ATOM   3054 C  CB    . ARG A 1 392 ? 30.461 11.090  -22.248 1.00 34.69  ? 389 ARG A CB    1 
ATOM   3055 C  CG    . ARG A 1 392 ? 30.252 10.968  -23.762 1.00 38.96  ? 389 ARG A CG    1 
ATOM   3056 C  CD    . ARG A 1 392 ? 29.558 12.190  -24.344 1.00 50.18  ? 389 ARG A CD    1 
ATOM   3057 N  NE    . ARG A 1 392 ? 28.148 12.238  -23.972 1.00 62.65  ? 389 ARG A NE    1 
ATOM   3058 C  CZ    . ARG A 1 392 ? 27.136 12.104  -24.826 1.00 58.91  ? 389 ARG A CZ    1 
ATOM   3059 N  NH1   . ARG A 1 392 ? 27.361 11.924  -26.130 1.00 37.35  ? 389 ARG A NH1   1 
ATOM   3060 N  NH2   . ARG A 1 392 ? 25.888 12.160  -24.370 1.00 52.16  ? 389 ARG A NH2   1 
ATOM   3061 N  N     . TYR A 1 393 ? 33.101 11.204  -20.292 1.00 21.66  ? 390 TYR A N     1 
ATOM   3062 C  CA    . TYR A 1 393 ? 33.628 11.783  -19.068 1.00 23.12  ? 390 TYR A CA    1 
ATOM   3063 C  C     . TYR A 1 393 ? 32.827 13.042  -18.743 1.00 29.47  ? 390 TYR A C     1 
ATOM   3064 O  O     . TYR A 1 393 ? 33.270 14.163  -19.003 1.00 31.43  ? 390 TYR A O     1 
ATOM   3065 C  CB    . TYR A 1 393 ? 35.121 12.097  -19.219 1.00 24.79  ? 390 TYR A CB    1 
ATOM   3066 C  CG    . TYR A 1 393 ? 36.021 10.868  -19.176 1.00 22.29  ? 390 TYR A CG    1 
ATOM   3067 C  CD1   . TYR A 1 393 ? 37.407 10.986  -19.254 1.00 17.46  ? 390 TYR A CD1   1 
ATOM   3068 C  CD2   . TYR A 1 393 ? 35.480 9.595   -19.044 1.00 25.08  ? 390 TYR A CD2   1 
ATOM   3069 C  CE1   . TYR A 1 393 ? 38.228 9.860   -19.200 1.00 17.83  ? 390 TYR A CE1   1 
ATOM   3070 C  CE2   . TYR A 1 393 ? 36.282 8.474   -18.990 1.00 22.19  ? 390 TYR A CE2   1 
ATOM   3071 C  CZ    . TYR A 1 393 ? 37.655 8.604   -19.068 1.00 23.23  ? 390 TYR A CZ    1 
ATOM   3072 O  OH    . TYR A 1 393 ? 38.440 7.464   -19.009 1.00 20.31  ? 390 TYR A OH    1 
ATOM   3073 N  N     . ASP A 1 394 ? 31.631 12.844  -18.200 1.00 22.76  ? 391 ASP A N     1 
ATOM   3074 C  CA    . ASP A 1 394 ? 30.766 13.949  -17.827 1.00 28.17  ? 391 ASP A CA    1 
ATOM   3075 C  C     . ASP A 1 394 ? 30.151 13.646  -16.473 1.00 20.78  ? 391 ASP A C     1 
ATOM   3076 O  O     . ASP A 1 394 ? 29.450 12.643  -16.321 1.00 19.49  ? 391 ASP A O     1 
ATOM   3077 C  CB    . ASP A 1 394 ? 29.668 14.144  -18.871 1.00 29.08  ? 391 ASP A CB    1 
ATOM   3078 C  CG    . ASP A 1 394 ? 28.846 15.396  -18.618 1.00 35.53  ? 391 ASP A CG    1 
ATOM   3079 O  OD1   . ASP A 1 394 ? 28.059 15.407  -17.645 1.00 27.68  ? 391 ASP A OD1   1 
ATOM   3080 O  OD2   . ASP A 1 394 ? 28.997 16.368  -19.389 1.00 53.43  ? 391 ASP A OD2   1 
ATOM   3081 N  N     . ALA A 1 395 ? 30.421 14.510  -15.495 1.00 20.56  ? 392 ALA A N     1 
ATOM   3082 C  CA    . ALA A 1 395 ? 30.023 14.258  -14.109 1.00 22.61  ? 392 ALA A CA    1 
ATOM   3083 C  C     . ALA A 1 395 ? 28.507 14.245  -13.911 1.00 21.40  ? 392 ALA A C     1 
ATOM   3084 O  O     . ALA A 1 395 ? 27.978 13.456  -13.125 1.00 18.95  ? 392 ALA A O     1 
ATOM   3085 C  CB    . ALA A 1 395 ? 30.687 15.274  -13.163 1.00 20.02  ? 392 ALA A CB    1 
ATOM   3086 N  N     . HIS A 1 396 ? 27.805 15.119  -14.624 1.00 24.95  ? 393 HIS A N     1 
ATOM   3087 C  CA    . HIS A 1 396 ? 26.350 15.156  -14.519 1.00 30.91  ? 393 HIS A CA    1 
ATOM   3088 C  C     . HIS A 1 396 ? 25.741 13.860  -15.030 1.00 24.92  ? 393 HIS A C     1 
ATOM   3089 O  O     . HIS A 1 396 ? 24.852 13.287  -14.393 1.00 20.85  ? 393 HIS A O     1 
ATOM   3090 C  CB    . HIS A 1 396 ? 25.774 16.373  -15.250 1.00 34.92  ? 393 HIS A CB    1 
ATOM   3091 C  CG    . HIS A 1 396 ? 26.054 17.673  -14.555 1.00 36.01  ? 393 HIS A CG    1 
ATOM   3092 N  ND1   . HIS A 1 396 ? 27.096 18.501  -14.915 1.00 52.88  ? 393 HIS A ND1   1 
ATOM   3093 C  CD2   . HIS A 1 396 ? 25.443 18.272  -13.505 1.00 38.08  ? 393 HIS A CD2   1 
ATOM   3094 C  CE1   . HIS A 1 396 ? 27.106 19.561  -14.127 1.00 51.97  ? 393 HIS A CE1   1 
ATOM   3095 N  NE2   . HIS A 1 396 ? 26.116 19.446  -13.261 1.00 41.65  ? 393 HIS A NE2   1 
ATOM   3096 N  N     . LYS A 1 397 ? 26.229 13.385  -16.173 1.00 25.61  ? 394 LYS A N     1 
ATOM   3097 C  CA    . LYS A 1 397 ? 25.759 12.107  -16.697 1.00 26.21  ? 394 LYS A CA    1 
ATOM   3098 C  C     . LYS A 1 397 ? 26.118 10.951  -15.781 1.00 21.83  ? 394 LYS A C     1 
ATOM   3099 O  O     . LYS A 1 397 ? 25.299 10.063  -15.523 1.00 24.74  ? 394 LYS A O     1 
ATOM   3100 C  CB    . LYS A 1 397 ? 26.305 11.825  -18.097 1.00 22.91  ? 394 LYS A CB    1 
ATOM   3101 C  CG    . LYS A 1 397 ? 25.914 10.427  -18.594 1.00 30.55  ? 394 LYS A CG    1 
ATOM   3102 C  CD    . LYS A 1 397 ? 26.249 10.211  -20.066 1.00 38.30  ? 394 LYS A CD    1 
ATOM   3103 C  CE    . LYS A 1 397 ? 26.028 8.756   -20.474 1.00 40.25  ? 394 LYS A CE    1 
ATOM   3104 N  NZ    . LYS A 1 397 ? 24.648 8.262   -20.168 1.00 38.23  ? 394 LYS A NZ    1 
ATOM   3105 N  N     . MET A 1 398 ? 27.350 10.945  -15.295 1.00 18.54  ? 395 MET A N     1 
ATOM   3106 C  CA    . MET A 1 398 ? 27.766 9.850   -14.443 1.00 25.16  ? 395 MET A CA    1 
ATOM   3107 C  C     . MET A 1 398 ? 26.912 9.792   -13.183 1.00 20.29  ? 395 MET A C     1 
ATOM   3108 O  O     . MET A 1 398 ? 26.439 8.718   -12.804 1.00 22.71  ? 395 MET A O     1 
ATOM   3109 C  CB    . MET A 1 398 ? 29.257 9.932   -14.118 1.00 20.66  ? 395 MET A CB    1 
ATOM   3110 C  CG    . MET A 1 398 ? 30.127 9.479   -15.279 1.00 19.57  ? 395 MET A CG    1 
ATOM   3111 S  SD    . MET A 1 398 ? 31.862 9.362   -14.825 1.00 27.18  ? 395 MET A SD    1 
ATOM   3112 C  CE    . MET A 1 398 ? 32.350 11.088  -14.850 1.00 21.89  ? 395 MET A CE    1 
ATOM   3113 N  N     . SER A 1 399 ? 26.699 10.942  -12.544 1.00 23.32  ? 396 SER A N     1 
ATOM   3114 C  CA    . SER A 1 399 ? 25.905 10.958  -11.319 1.00 25.13  ? 396 SER A CA    1 
ATOM   3115 C  C     . SER A 1 399 ? 24.471 10.532  -11.620 1.00 23.38  ? 396 SER A C     1 
ATOM   3116 O  O     . SER A 1 399 ? 23.850 9.815   -10.839 1.00 19.32  ? 396 SER A O     1 
ATOM   3117 C  CB    . SER A 1 399 ? 25.955 12.325  -10.617 1.00 24.55  ? 396 SER A CB    1 
ATOM   3118 O  OG    . SER A 1 399 ? 25.655 13.400  -11.496 1.00 27.85  ? 396 SER A OG    1 
ATOM   3119 N  N     . HIS A 1 400 ? 23.956 10.960  -12.766 1.00 26.36  ? 397 HIS A N     1 
ATOM   3120 C  CA    . HIS A 1 400 ? 22.589 10.604  -13.139 1.00 32.84  ? 397 HIS A CA    1 
ATOM   3121 C  C     . HIS A 1 400 ? 22.449 9.089   -13.354 1.00 27.14  ? 397 HIS A C     1 
ATOM   3122 O  O     . HIS A 1 400 ? 21.495 8.469   -12.871 1.00 27.14  ? 397 HIS A O     1 
ATOM   3123 C  CB    . HIS A 1 400 ? 22.138 11.385  -14.375 1.00 34.91  ? 397 HIS A CB    1 
ATOM   3124 C  CG    . HIS A 1 400 ? 20.680 11.238  -14.673 1.00 50.80  ? 397 HIS A CG    1 
ATOM   3125 N  ND1   . HIS A 1 400 ? 20.146 10.095  -15.231 1.00 47.16  ? 397 HIS A ND1   1 
ATOM   3126 C  CD2   . HIS A 1 400 ? 19.639 12.081  -14.474 1.00 54.68  ? 397 HIS A CD2   1 
ATOM   3127 C  CE1   . HIS A 1 400 ? 18.840 10.245  -15.371 1.00 43.90  ? 397 HIS A CE1   1 
ATOM   3128 N  NE2   . HIS A 1 400 ? 18.508 11.441  -14.920 1.00 56.03  ? 397 HIS A NE2   1 
ATOM   3129 N  N     . ASP A 1 401 ? 23.420 8.501   -14.055 1.00 26.88  ? 398 ASP A N     1 
ATOM   3130 C  CA    . ASP A 1 401 ? 23.451 7.058   -14.293 1.00 22.82  ? 398 ASP A CA    1 
ATOM   3131 C  C     . ASP A 1 401 ? 23.584 6.272   -12.991 1.00 25.82  ? 398 ASP A C     1 
ATOM   3132 O  O     . ASP A 1 401 ? 22.965 5.219   -12.824 1.00 27.25  ? 398 ASP A O     1 
ATOM   3133 C  CB    . ASP A 1 401 ? 24.607 6.691   -15.231 1.00 24.83  ? 398 ASP A CB    1 
ATOM   3134 C  CG    . ASP A 1 401 ? 24.432 7.268   -16.629 1.00 34.87  ? 398 ASP A CG    1 
ATOM   3135 O  OD1   . ASP A 1 401 ? 23.305 7.697   -16.961 1.00 35.90  ? 398 ASP A OD1   1 
ATOM   3136 O  OD2   . ASP A 1 401 ? 25.417 7.290   -17.397 1.00 33.20  ? 398 ASP A OD2   1 
ATOM   3137 N  N     . ALA A 1 402 ? 24.394 6.792   -12.072 1.00 26.79  ? 399 ALA A N     1 
ATOM   3138 C  CA    . ALA A 1 402 ? 24.629 6.136   -10.791 1.00 22.21  ? 399 ALA A CA    1 
ATOM   3139 C  C     . ALA A 1 402 ? 23.335 6.121   -10.002 1.00 19.98  ? 399 ALA A C     1 
ATOM   3140 O  O     . ALA A 1 402 ? 22.991 5.135   -9.352  1.00 22.71  ? 399 ALA A O     1 
ATOM   3141 C  CB    . ALA A 1 402 ? 25.709 6.875   -10.015 1.00 23.51  ? 399 ALA A CB    1 
ATOM   3142 N  N     . PHE A 1 403 ? 22.613 7.229   -10.076 1.00 22.64  ? 400 PHE A N     1 
ATOM   3143 C  CA    . PHE A 1 403 ? 21.348 7.342   -9.381  1.00 29.41  ? 400 PHE A CA    1 
ATOM   3144 C  C     . PHE A 1 403 ? 20.369 6.326   -9.948  1.00 33.55  ? 400 PHE A C     1 
ATOM   3145 O  O     . PHE A 1 403 ? 19.670 5.632   -9.207  1.00 35.17  ? 400 PHE A O     1 
ATOM   3146 C  CB    . PHE A 1 403 ? 20.786 8.750   -9.529  1.00 23.51  ? 400 PHE A CB    1 
ATOM   3147 C  CG    . PHE A 1 403 ? 19.489 8.947   -8.820  1.00 41.80  ? 400 PHE A CG    1 
ATOM   3148 C  CD1   . PHE A 1 403 ? 18.309 9.076   -9.533  1.00 45.47  ? 400 PHE A CD1   1 
ATOM   3149 C  CD2   . PHE A 1 403 ? 19.444 8.976   -7.436  1.00 37.96  ? 400 PHE A CD2   1 
ATOM   3150 C  CE1   . PHE A 1 403 ? 17.109 9.249   -8.876  1.00 51.38  ? 400 PHE A CE1   1 
ATOM   3151 C  CE2   . PHE A 1 403 ? 18.250 9.152   -6.773  1.00 48.65  ? 400 PHE A CE2   1 
ATOM   3152 C  CZ    . PHE A 1 403 ? 17.079 9.288   -7.493  1.00 55.74  ? 400 PHE A CZ    1 
ATOM   3153 N  N     . THR A 1 404 ? 20.340 6.232   -11.270 1.00 31.10  ? 401 THR A N     1 
ATOM   3154 C  CA    . THR A 1 404 ? 19.448 5.295   -11.938 1.00 34.58  ? 401 THR A CA    1 
ATOM   3155 C  C     . THR A 1 404 ? 19.677 3.846   -11.492 1.00 30.71  ? 401 THR A C     1 
ATOM   3156 O  O     . THR A 1 404 ? 18.724 3.113   -11.225 1.00 33.03  ? 401 THR A O     1 
ATOM   3157 C  CB    . THR A 1 404 ? 19.548 5.419   -13.473 1.00 29.49  ? 401 THR A CB    1 
ATOM   3158 O  OG1   . THR A 1 404 ? 19.136 6.733   -13.870 1.00 30.40  ? 401 THR A OG1   1 
ATOM   3159 C  CG2   . THR A 1 404 ? 18.663 4.389   -14.155 1.00 37.45  ? 401 THR A CG2   1 
ATOM   3160 N  N     . VAL A 1 405 ? 20.933 3.429   -11.381 1.00 30.48  ? 402 VAL A N     1 
ATOM   3161 C  CA    . VAL A 1 405 ? 21.187 2.036   -11.034 1.00 28.84  ? 402 VAL A CA    1 
ATOM   3162 C  C     . VAL A 1 405 ? 20.875 1.700   -9.572  1.00 28.04  ? 402 VAL A C     1 
ATOM   3163 O  O     . VAL A 1 405 ? 20.604 0.545   -9.253  1.00 35.47  ? 402 VAL A O     1 
ATOM   3164 C  CB    . VAL A 1 405 ? 22.617 1.567   -11.428 1.00 35.09  ? 402 VAL A CB    1 
ATOM   3165 C  CG1   . VAL A 1 405 ? 22.825 1.714   -12.925 1.00 34.44  ? 402 VAL A CG1   1 
ATOM   3166 C  CG2   . VAL A 1 405 ? 23.669 2.340   -10.673 1.00 34.88  ? 402 VAL A CG2   1 
ATOM   3167 N  N     . ILE A 1 406 ? 20.889 2.700   -8.691  1.00 25.41  ? 403 ILE A N     1 
ATOM   3168 C  CA    . ILE A 1 406 ? 20.654 2.457   -7.265  1.00 36.14  ? 403 ILE A CA    1 
ATOM   3169 C  C     . ILE A 1 406 ? 19.274 2.883   -6.747  1.00 35.54  ? 403 ILE A C     1 
ATOM   3170 O  O     . ILE A 1 406 ? 18.859 2.449   -5.673  1.00 35.97  ? 403 ILE A O     1 
ATOM   3171 C  CB    . ILE A 1 406 ? 21.696 3.176   -6.374  1.00 32.78  ? 403 ILE A CB    1 
ATOM   3172 C  CG1   . ILE A 1 406 ? 21.363 4.665   -6.273  1.00 32.28  ? 403 ILE A CG1   1 
ATOM   3173 C  CG2   . ILE A 1 406 ? 23.106 2.932   -6.876  1.00 35.64  ? 403 ILE A CG2   1 
ATOM   3174 C  CD1   . ILE A 1 406 ? 22.102 5.368   -5.150  1.00 36.92  ? 403 ILE A CD1   1 
ATOM   3175 N  N     . LYS A 1 407 ? 18.583 3.741   -7.492  1.00 32.58  ? 404 LYS A N     1 
ATOM   3176 C  CA    . LYS A 1 407 ? 17.332 4.333   -7.021  1.00 40.10  ? 404 LYS A CA    1 
ATOM   3177 C  C     . LYS A 1 407 ? 16.297 3.309   -6.528  1.00 51.37  ? 404 LYS A C     1 
ATOM   3178 O  O     . LYS A 1 407 ? 15.492 3.605   -5.639  1.00 52.51  ? 404 LYS A O     1 
ATOM   3179 C  CB    . LYS A 1 407 ? 16.722 5.229   -8.100  1.00 37.17  ? 404 LYS A CB    1 
ATOM   3180 C  CG    . LYS A 1 407 ? 16.440 4.518   -9.403  1.00 41.59  ? 404 LYS A CG    1 
ATOM   3181 C  CD    . LYS A 1 407 ? 15.812 5.466   -10.402 1.00 44.46  ? 404 LYS A CD    1 
ATOM   3182 C  CE    . LYS A 1 407 ? 15.525 4.767   -11.715 1.00 48.30  ? 404 LYS A CE    1 
ATOM   3183 N  NZ    . LYS A 1 407 ? 14.727 5.638   -12.616 1.00 55.95  ? 404 LYS A NZ    1 
ATOM   3184 N  N     . ASN A 1 408 ? 16.323 2.109   -7.096  1.00 49.22  ? 405 ASN A N     1 
ATOM   3185 C  CA    . ASN A 1 408 ? 15.381 1.065   -6.702  1.00 51.68  ? 405 ASN A CA    1 
ATOM   3186 C  C     . ASN A 1 408 ? 15.666 0.516   -5.311  1.00 52.54  ? 405 ASN A C     1 
ATOM   3187 O  O     . ASN A 1 408 ? 14.956 -0.361  -4.821  1.00 47.79  ? 405 ASN A O     1 
ATOM   3188 C  CB    . ASN A 1 408 ? 15.376 -0.068  -7.729  1.00 54.55  ? 405 ASN A CB    1 
ATOM   3189 C  CG    . ASN A 1 408 ? 14.939 0.400   -9.106  1.00 74.22  ? 405 ASN A CG    1 
ATOM   3190 O  OD1   . ASN A 1 408 ? 15.688 0.293   -10.080 1.00 75.23  ? 405 ASN A OD1   1 
ATOM   3191 N  ND2   . ASN A 1 408 ? 13.722 0.931   -9.191  1.00 72.61  ? 405 ASN A ND2   1 
ATOM   3192 N  N     . CYS A 1 409 ? 16.711 1.034   -4.676  1.00 50.32  ? 406 CYS A N     1 
ATOM   3193 C  CA    . CYS A 1 409 ? 17.079 0.593   -3.337  1.00 52.75  ? 406 CYS A CA    1 
ATOM   3194 C  C     . CYS A 1 409 ? 16.262 1.321   -2.292  1.00 52.63  ? 406 CYS A C     1 
ATOM   3195 O  O     . CYS A 1 409 ? 16.193 0.901   -1.138  1.00 62.61  ? 406 CYS A O     1 
ATOM   3196 C  CB    . CYS A 1 409 ? 18.561 0.842   -3.076  1.00 50.94  ? 406 CYS A CB    1 
ATOM   3197 S  SG    . CYS A 1 409 ? 19.620 -0.440  -3.724  1.00 56.50  ? 406 CYS A SG    1 
ATOM   3198 N  N     . ASN A 1 410 ? 15.653 2.425   -2.704  1.00 51.22  ? 407 ASN A N     1 
ATOM   3199 C  CA    . ASN A 1 410 ? 14.869 3.243   -1.798  1.00 49.27  ? 407 ASN A CA    1 
ATOM   3200 C  C     . ASN A 1 410 ? 13.578 2.553   -1.348  1.00 58.34  ? 407 ASN A C     1 
ATOM   3201 O  O     . ASN A 1 410 ? 12.650 2.369   -2.139  1.00 53.41  ? 407 ASN A O     1 
ATOM   3202 C  CB    . ASN A 1 410 ? 14.561 4.591   -2.444  1.00 44.97  ? 407 ASN A CB    1 
ATOM   3203 C  CG    . ASN A 1 410 ? 14.027 5.586   -1.456  1.00 45.05  ? 407 ASN A CG    1 
ATOM   3204 O  OD1   . ASN A 1 410 ? 13.942 5.295   -0.263  1.00 50.78  ? 407 ASN A OD1   1 
ATOM   3205 N  ND2   . ASN A 1 410 ? 13.671 6.774   -1.935  1.00 51.97  ? 407 ASN A ND2   1 
ATOM   3206 N  N     . THR A 1 411 ? 13.540 2.170   -0.073  1.00 53.67  ? 408 THR A N     1 
ATOM   3207 C  CA    . THR A 1 411 ? 12.367 1.553   0.538   1.00 53.63  ? 408 THR A CA    1 
ATOM   3208 C  C     . THR A 1 411 ? 11.228 2.553   0.707   1.00 59.56  ? 408 THR A C     1 
ATOM   3209 O  O     . THR A 1 411 ? 10.061 2.208   0.529   1.00 65.96  ? 408 THR A O     1 
ATOM   3210 C  CB    . THR A 1 411 ? 12.706 0.956   1.920   1.00 48.55  ? 408 THR A CB    1 
ATOM   3211 O  OG1   . THR A 1 411 ? 13.355 -0.310  1.750   1.00 59.48  ? 408 THR A OG1   1 
ATOM   3212 C  CG2   . THR A 1 411 ? 11.447 0.762   2.752   1.00 63.67  ? 408 THR A CG2   1 
ATOM   3213 N  N     . SER A 1 412 ? 11.575 3.791   1.052   1.00 54.48  ? 409 SER A N     1 
ATOM   3214 C  CA    . SER A 1 412 ? 10.583 4.839   1.298   1.00 62.53  ? 409 SER A CA    1 
ATOM   3215 C  C     . SER A 1 412 ? 9.477  4.861   0.247   1.00 67.16  ? 409 SER A C     1 
ATOM   3216 O  O     . SER A 1 412 ? 9.749  4.878   -0.954  1.00 63.45  ? 409 SER A O     1 
ATOM   3217 C  CB    . SER A 1 412 ? 11.259 6.212   1.362   1.00 59.11  ? 409 SER A CB    1 
ATOM   3218 O  OG    . SER A 1 412 ? 10.302 7.259   1.407   1.00 59.81  ? 409 SER A OG    1 
ATOM   3219 N  N     . GLY A 1 413 ? 8.229  4.864   0.710   1.00 68.73  ? 410 GLY A N     1 
ATOM   3220 C  CA    . GLY A 1 413 ? 7.087  4.976   -0.181  1.00 73.25  ? 410 GLY A CA    1 
ATOM   3221 C  C     . GLY A 1 413 ? 6.978  6.384   -0.735  1.00 71.44  ? 410 GLY A C     1 
ATOM   3222 O  O     . GLY A 1 413 ? 6.403  6.609   -1.801  1.00 65.10  ? 410 GLY A O     1 
ATOM   3223 N  N     . ILE A 1 414 ? 7.542  7.333   0.006   1.00 73.80  ? 411 ILE A N     1 
ATOM   3224 C  CA    . ILE A 1 414 ? 7.598  8.723   -0.419  1.00 70.89  ? 411 ILE A CA    1 
ATOM   3225 C  C     . ILE A 1 414 ? 8.726  8.909   -1.432  1.00 75.28  ? 411 ILE A C     1 
ATOM   3226 O  O     . ILE A 1 414 ? 9.784  8.284   -1.322  1.00 70.09  ? 411 ILE A O     1 
ATOM   3227 C  CB    . ILE A 1 414 ? 7.843  9.653   0.783   1.00 69.55  ? 411 ILE A CB    1 
ATOM   3228 C  CG1   . ILE A 1 414 ? 7.054  9.160   1.999   1.00 58.31  ? 411 ILE A CG1   1 
ATOM   3229 C  CG2   . ILE A 1 414 ? 7.495  11.096  0.430   1.00 64.24  ? 411 ILE A CG2   1 
ATOM   3230 C  CD1   . ILE A 1 414 ? 7.403  9.871   3.275   1.00 63.90  ? 411 ILE A CD1   1 
ATOM   3231 N  N     . GLN A 1 415 ? 8.495  9.771   -2.416  1.00 81.50  ? 412 GLN A N     1 
ATOM   3232 C  CA    . GLN A 1 415 ? 9.472  10.019  -3.470  1.00 78.03  ? 412 GLN A CA    1 
ATOM   3233 C  C     . GLN A 1 415 ? 10.676 10.799  -2.939  1.00 75.39  ? 412 GLN A C     1 
ATOM   3234 O  O     . GLN A 1 415 ? 11.820 10.535  -3.316  1.00 76.40  ? 412 GLN A O     1 
ATOM   3235 C  CB    . GLN A 1 415 ? 8.812  10.787  -4.622  1.00 77.62  ? 412 GLN A CB    1 
ATOM   3236 C  CG    . GLN A 1 415 ? 9.610  10.812  -5.923  1.00 86.61  ? 412 GLN A CG    1 
ATOM   3237 C  CD    . GLN A 1 415 ? 9.542  9.498   -6.693  1.00 91.63  ? 412 GLN A CD    1 
ATOM   3238 O  OE1   . GLN A 1 415 ? 9.527  8.415   -6.104  1.00 86.78  ? 412 GLN A OE1   1 
ATOM   3239 N  NE2   . GLN A 1 415 ? 9.498  9.593   -8.020  1.00 84.70  ? 412 GLN A NE2   1 
ATOM   3240 N  N     . THR A 1 416 ? 10.405 11.750  -2.049  1.00 72.32  ? 413 THR A N     1 
ATOM   3241 C  CA    . THR A 1 416 ? 11.415 12.691  -1.574  1.00 68.04  ? 413 THR A CA    1 
ATOM   3242 C  C     . THR A 1 416 ? 12.279 12.146  -0.436  1.00 61.38  ? 413 THR A C     1 
ATOM   3243 O  O     . THR A 1 416 ? 13.356 12.671  -0.164  1.00 60.28  ? 413 THR A O     1 
ATOM   3244 C  CB    . THR A 1 416 ? 10.755 14.006  -1.118  1.00 66.22  ? 413 THR A CB    1 
ATOM   3245 O  OG1   . THR A 1 416 ? 9.914  14.501  -2.168  1.00 77.33  ? 413 THR A OG1   1 
ATOM   3246 C  CG2   . THR A 1 416 ? 11.805 15.055  -0.773  1.00 67.63  ? 413 THR A CG2   1 
ATOM   3247 N  N     . GLU A 1 417 ? 11.809 11.098  0.230   1.00 61.14  ? 414 GLU A N     1 
ATOM   3248 C  CA    . GLU A 1 417 ? 12.560 10.524  1.341   1.00 55.55  ? 414 GLU A CA    1 
ATOM   3249 C  C     . GLU A 1 417 ? 13.377 9.315   0.902   1.00 59.77  ? 414 GLU A C     1 
ATOM   3250 O  O     . GLU A 1 417 ? 13.029 8.637   -0.068  1.00 57.17  ? 414 GLU A O     1 
ATOM   3251 C  CB    . GLU A 1 417 ? 11.626 10.144  2.493   1.00 56.57  ? 414 GLU A CB    1 
ATOM   3252 C  CG    . GLU A 1 417 ? 10.751 11.288  2.975   1.00 63.16  ? 414 GLU A CG    1 
ATOM   3253 C  CD    . GLU A 1 417 ? 11.528 12.578  3.142   1.00 62.29  ? 414 GLU A CD    1 
ATOM   3254 O  OE1   . GLU A 1 417 ? 12.301 12.684  4.121   1.00 59.18  ? 414 GLU A OE1   1 
ATOM   3255 O  OE2   . GLU A 1 417 ? 11.370 13.479  2.287   1.00 60.96  ? 414 GLU A OE2   1 
ATOM   3256 N  N     . TRP A 1 418 ? 14.467 9.048   1.615   1.00 44.59  ? 415 TRP A N     1 
ATOM   3257 C  CA    . TRP A 1 418 ? 15.300 7.896   1.299   1.00 42.12  ? 415 TRP A CA    1 
ATOM   3258 C  C     . TRP A 1 418 ? 15.513 6.978   2.500   1.00 43.10  ? 415 TRP A C     1 
ATOM   3259 O  O     . TRP A 1 418 ? 16.048 7.388   3.528   1.00 42.48  ? 415 TRP A O     1 
ATOM   3260 C  CB    . TRP A 1 418 ? 16.659 8.332   0.740   1.00 39.06  ? 415 TRP A CB    1 
ATOM   3261 C  CG    . TRP A 1 418 ? 17.364 7.198   0.083   1.00 36.18  ? 415 TRP A CG    1 
ATOM   3262 C  CD1   . TRP A 1 418 ? 17.934 6.119   0.692   1.00 34.61  ? 415 TRP A CD1   1 
ATOM   3263 C  CD2   . TRP A 1 418 ? 17.551 7.015   -1.322  1.00 36.12  ? 415 TRP A CD2   1 
ATOM   3264 N  NE1   . TRP A 1 418 ? 18.468 5.272   -0.252  1.00 39.80  ? 415 TRP A NE1   1 
ATOM   3265 C  CE2   . TRP A 1 418 ? 18.246 5.802   -1.497  1.00 41.90  ? 415 TRP A CE2   1 
ATOM   3266 C  CE3   . TRP A 1 418 ? 17.200 7.763   -2.450  1.00 42.96  ? 415 TRP A CE3   1 
ATOM   3267 C  CZ2   . TRP A 1 418 ? 18.601 5.322   -2.756  1.00 43.97  ? 415 TRP A CZ2   1 
ATOM   3268 C  CZ3   . TRP A 1 418 ? 17.552 7.286   -3.700  1.00 41.40  ? 415 TRP A CZ3   1 
ATOM   3269 C  CH2   . TRP A 1 418 ? 18.245 6.079   -3.843  1.00 38.83  ? 415 TRP A CH2   1 
ATOM   3270 N  N     . SER A 1 419 ? 15.100 5.726   2.365   1.00 46.89  ? 416 SER A N     1 
ATOM   3271 C  CA    . SER A 1 419 ? 15.313 4.765   3.434   1.00 43.97  ? 416 SER A CA    1 
ATOM   3272 C  C     . SER A 1 419 ? 15.609 3.387   2.870   1.00 46.10  ? 416 SER A C     1 
ATOM   3273 O  O     . SER A 1 419 ? 15.199 3.071   1.756   1.00 45.12  ? 416 SER A O     1 
ATOM   3274 C  CB    . SER A 1 419 ? 14.104 4.710   4.370   1.00 53.36  ? 416 SER A CB    1 
ATOM   3275 O  OG    . SER A 1 419 ? 12.967 4.187   3.706   1.00 62.22  ? 416 SER A OG    1 
ATOM   3276 N  N     . PRO A 1 420 ? 16.375 2.583   3.622   1.00 42.24  ? 417 PRO A N     1 
ATOM   3277 C  CA    . PRO A 1 420 ? 17.031 3.092   4.831   1.00 47.28  ? 417 PRO A CA    1 
ATOM   3278 C  C     . PRO A 1 420 ? 18.159 4.036   4.433   1.00 44.53  ? 417 PRO A C     1 
ATOM   3279 O  O     . PRO A 1 420 ? 18.675 3.916   3.320   1.00 45.17  ? 417 PRO A O     1 
ATOM   3280 C  CB    . PRO A 1 420 ? 17.593 1.827   5.481   1.00 47.30  ? 417 PRO A CB    1 
ATOM   3281 C  CG    . PRO A 1 420 ? 17.771 0.869   4.343   1.00 51.03  ? 417 PRO A CG    1 
ATOM   3282 C  CD    . PRO A 1 420 ? 16.643 1.153   3.399   1.00 41.63  ? 417 PRO A CD    1 
ATOM   3283 N  N     . PRO A 1 421 ? 18.532 4.968   5.325   1.00 48.87  ? 418 PRO A N     1 
ATOM   3284 C  CA    . PRO A 1 421 ? 19.556 5.966   4.986   1.00 42.84  ? 418 PRO A CA    1 
ATOM   3285 C  C     . PRO A 1 421 ? 20.864 5.330   4.508   1.00 24.95  ? 418 PRO A C     1 
ATOM   3286 O  O     . PRO A 1 421 ? 21.209 4.224   4.930   1.00 30.33  ? 418 PRO A O     1 
ATOM   3287 C  CB    . PRO A 1 421 ? 19.774 6.713   6.310   1.00 38.40  ? 418 PRO A CB    1 
ATOM   3288 C  CG    . PRO A 1 421 ? 18.532 6.463   7.104   1.00 45.15  ? 418 PRO A CG    1 
ATOM   3289 C  CD    . PRO A 1 421 ? 18.076 5.090   6.720   1.00 41.72  ? 418 PRO A CD    1 
ATOM   3290 N  N     . LEU A 1 422 ? 21.576 6.041   3.635   1.00 31.45  ? 419 LEU A N     1 
ATOM   3291 C  CA    . LEU A 1 422 ? 22.820 5.550   3.041   1.00 29.01  ? 419 LEU A CA    1 
ATOM   3292 C  C     . LEU A 1 422 ? 24.032 6.004   3.854   1.00 28.29  ? 419 LEU A C     1 
ATOM   3293 O  O     . LEU A 1 422 ? 24.184 7.189   4.144   1.00 26.04  ? 419 LEU A O     1 
ATOM   3294 C  CB    . LEU A 1 422 ? 22.951 6.044   1.589   1.00 26.44  ? 419 LEU A CB    1 
ATOM   3295 C  CG    . LEU A 1 422 ? 21.807 5.686   0.633   1.00 30.19  ? 419 LEU A CG    1 
ATOM   3296 C  CD1   . LEU A 1 422 ? 22.111 6.140   -0.805  1.00 27.09  ? 419 LEU A CD1   1 
ATOM   3297 C  CD2   . LEU A 1 422 ? 21.521 4.194   0.678   1.00 29.09  ? 419 LEU A CD2   1 
ATOM   3298 N  N     . THR A 1 423 ? 24.894 5.061   4.221   1.00 26.31  ? 420 THR A N     1 
ATOM   3299 C  CA    . THR A 1 423 ? 26.069 5.401   5.011   1.00 28.67  ? 420 THR A CA    1 
ATOM   3300 C  C     . THR A 1 423 ? 27.363 5.349   4.194   1.00 24.83  ? 420 THR A C     1 
ATOM   3301 O  O     . THR A 1 423 ? 28.444 5.554   4.733   1.00 20.42  ? 420 THR A O     1 
ATOM   3302 C  CB    . THR A 1 423 ? 26.196 4.494   6.236   1.00 28.84  ? 420 THR A CB    1 
ATOM   3303 O  OG1   . THR A 1 423 ? 26.175 3.126   5.813   1.00 30.17  ? 420 THR A OG1   1 
ATOM   3304 C  CG2   . THR A 1 423 ? 25.034 4.744   7.202   1.00 31.20  ? 420 THR A CG2   1 
ATOM   3305 N  N     . MET A 1 424 ? 27.244 5.077   2.898   1.00 20.04  ? 421 MET A N     1 
ATOM   3306 C  CA    . MET A 1 424 ? 28.409 5.056   2.007   1.00 20.26  ? 421 MET A CA    1 
ATOM   3307 C  C     . MET A 1 424 ? 27.975 5.150   0.548   1.00 18.39  ? 421 MET A C     1 
ATOM   3308 O  O     . MET A 1 424 ? 26.980 4.535   0.152   1.00 19.85  ? 421 MET A O     1 
ATOM   3309 C  CB    . MET A 1 424 ? 29.232 3.786   2.233   1.00 20.76  ? 421 MET A CB    1 
ATOM   3310 C  CG    . MET A 1 424 ? 30.542 3.709   1.438   1.00 18.29  ? 421 MET A CG    1 
ATOM   3311 S  SD    . MET A 1 424 ? 30.307 3.079   -0.238  1.00 27.20  ? 421 MET A SD    1 
ATOM   3312 C  CE    . MET A 1 424 ? 29.859 1.379   0.115   1.00 28.17  ? 421 MET A CE    1 
ATOM   3313 N  N     . LEU A 1 425 ? 28.701 5.953   -0.226  1.00 11.14  ? 422 LEU A N     1 
ATOM   3314 C  CA    . LEU A 1 425 ? 28.548 6.040   -1.676  1.00 14.26  ? 422 LEU A CA    1 
ATOM   3315 C  C     . LEU A 1 425 ? 29.925 5.829   -2.314  1.00 18.02  ? 422 LEU A C     1 
ATOM   3316 O  O     . LEU A 1 425 ? 30.945 6.298   -1.786  1.00 14.92  ? 422 LEU A O     1 
ATOM   3317 C  CB    . LEU A 1 425 ? 28.013 7.407   -2.102  1.00 10.69  ? 422 LEU A CB    1 
ATOM   3318 C  CG    . LEU A 1 425 ? 26.614 7.856   -1.685  1.00 17.11  ? 422 LEU A CG    1 
ATOM   3319 C  CD1   . LEU A 1 425 ? 26.398 9.310   -2.116  1.00 21.34  ? 422 LEU A CD1   1 
ATOM   3320 C  CD2   . LEU A 1 425 ? 25.524 6.946   -2.267  1.00 17.68  ? 422 LEU A CD2   1 
ATOM   3321 N  N     . PHE A 1 426 ? 29.954 5.137   -3.449  1.00 16.68  ? 423 PHE A N     1 
ATOM   3322 C  CA    . PHE A 1 426 ? 31.212 4.768   -4.095  1.00 16.48  ? 423 PHE A CA    1 
ATOM   3323 C  C     . PHE A 1 426 ? 31.017 4.749   -5.609  1.00 17.07  ? 423 PHE A C     1 
ATOM   3324 O  O     . PHE A 1 426 ? 30.157 4.024   -6.121  1.00 22.95  ? 423 PHE A O     1 
ATOM   3325 C  CB    . PHE A 1 426 ? 31.650 3.386   -3.598  1.00 21.90  ? 423 PHE A CB    1 
ATOM   3326 C  CG    . PHE A 1 426 ? 33.055 2.995   -3.988  1.00 25.46  ? 423 PHE A CG    1 
ATOM   3327 C  CD1   . PHE A 1 426 ? 33.529 1.727   -3.698  1.00 36.82  ? 423 PHE A CD1   1 
ATOM   3328 C  CD2   . PHE A 1 426 ? 33.902 3.890   -4.629  1.00 29.48  ? 423 PHE A CD2   1 
ATOM   3329 C  CE1   . PHE A 1 426 ? 34.819 1.348   -4.049  1.00 43.21  ? 423 PHE A CE1   1 
ATOM   3330 C  CE2   . PHE A 1 426 ? 35.204 3.521   -4.981  1.00 28.38  ? 423 PHE A CE2   1 
ATOM   3331 C  CZ    . PHE A 1 426 ? 35.659 2.247   -4.691  1.00 29.28  ? 423 PHE A CZ    1 
ATOM   3332 N  N     . LEU A 1 427 ? 31.785 5.564   -6.327  1.00 14.40  ? 424 LEU A N     1 
ATOM   3333 C  CA    . LEU A 1 427 ? 31.829 5.475   -7.788  1.00 15.23  ? 424 LEU A CA    1 
ATOM   3334 C  C     . LEU A 1 427 ? 33.207 5.023   -8.239  1.00 20.28  ? 424 LEU A C     1 
ATOM   3335 O  O     . LEU A 1 427 ? 34.209 5.624   -7.858  1.00 18.43  ? 424 LEU A O     1 
ATOM   3336 C  CB    . LEU A 1 427 ? 31.517 6.819   -8.452  1.00 16.59  ? 424 LEU A CB    1 
ATOM   3337 C  CG    . LEU A 1 427 ? 30.176 7.498   -8.204  1.00 15.27  ? 424 LEU A CG    1 
ATOM   3338 C  CD1   . LEU A 1 427 ? 30.134 8.859   -8.892  1.00 15.29  ? 424 LEU A CD1   1 
ATOM   3339 C  CD2   . LEU A 1 427 ? 29.022 6.619   -8.665  1.00 17.01  ? 424 LEU A CD2   1 
ATOM   3340 N  N     . CYS A 1 428 ? 33.261 3.984   -9.073  1.00 20.01  ? 425 CYS A N     1 
ATOM   3341 C  CA    . CYS A 1 428 ? 34.547 3.489   -9.568  1.00 18.17  ? 425 CYS A CA    1 
ATOM   3342 C  C     . CYS A 1 428 ? 34.578 3.334   -11.088 1.00 17.95  ? 425 CYS A C     1 
ATOM   3343 O  O     . CYS A 1 428 ? 33.708 2.677   -11.662 1.00 19.75  ? 425 CYS A O     1 
ATOM   3344 C  CB    . CYS A 1 428 ? 34.892 2.147   -8.919  1.00 20.30  ? 425 CYS A CB    1 
ATOM   3345 S  SG    . CYS A 1 428 ? 36.599 1.630   -9.221  1.00 26.69  ? 425 CYS A SG    1 
ATOM   3346 N  N     . ALA A 1 429 ? 35.587 3.925   -11.725 1.00 17.16  ? 426 ALA A N     1 
ATOM   3347 C  CA    . ALA A 1 429 ? 35.772 3.774   -13.166 1.00 16.24  ? 426 ALA A CA    1 
ATOM   3348 C  C     . ALA A 1 429 ? 36.725 2.609   -13.418 1.00 20.23  ? 426 ALA A C     1 
ATOM   3349 O  O     . ALA A 1 429 ? 37.782 2.524   -12.797 1.00 12.96  ? 426 ALA A O     1 
ATOM   3350 C  CB    . ALA A 1 429 ? 36.326 5.039   -13.770 1.00 15.29  ? 426 ALA A CB    1 
ATOM   3351 N  N     . THR A 1 430 ? 36.350 1.724   -14.336 1.00 20.16  ? 427 THR A N     1 
ATOM   3352 C  CA    . THR A 1 430 ? 37.084 0.482   -14.540 1.00 24.30  ? 427 THR A CA    1 
ATOM   3353 C  C     . THR A 1 430 ? 37.054 0.079   -16.009 1.00 21.11  ? 427 THR A C     1 
ATOM   3354 O  O     . THR A 1 430 ? 36.402 0.731   -16.837 1.00 20.06  ? 427 THR A O     1 
ATOM   3355 C  CB    . THR A 1 430 ? 36.451 -0.684  -13.724 1.00 21.72  ? 427 THR A CB    1 
ATOM   3356 O  OG1   . THR A 1 430 ? 35.188 -1.039  -14.297 1.00 27.54  ? 427 THR A OG1   1 
ATOM   3357 C  CG2   . THR A 1 430 ? 36.229 -0.293  -12.262 1.00 24.25  ? 427 THR A CG2   1 
ATOM   3358 N  N     . LYS A 1 431 ? 37.743 -1.016  -16.317 1.00 27.23  ? 428 LYS A N     1 
ATOM   3359 C  CA    . LYS A 1 431 ? 37.750 -1.579  -17.667 1.00 24.95  ? 428 LYS A CA    1 
ATOM   3360 C  C     . LYS A 1 431 ? 38.294 -0.584  -18.693 1.00 18.25  ? 428 LYS A C     1 
ATOM   3361 O  O     . LYS A 1 431 ? 37.587 -0.141  -19.603 1.00 18.35  ? 428 LYS A O     1 
ATOM   3362 C  CB    . LYS A 1 431 ? 36.350 -2.056  -18.052 1.00 22.78  ? 428 LYS A CB    1 
ATOM   3363 C  CG    . LYS A 1 431 ? 35.828 -3.197  -17.176 1.00 31.18  ? 428 LYS A CG    1 
ATOM   3364 C  CD    . LYS A 1 431 ? 34.781 -4.034  -17.920 1.00 43.85  ? 428 LYS A CD    1 
ATOM   3365 C  CE    . LYS A 1 431 ? 34.148 -5.106  -17.031 1.00 40.68  ? 428 LYS A CE    1 
ATOM   3366 N  NZ    . LYS A 1 431 ? 35.162 -5.945  -16.331 1.00 41.36  ? 428 LYS A NZ    1 
ATOM   3367 N  N     . PHE A 1 432 ? 39.563 -0.234  -18.533 1.00 20.49  ? 429 PHE A N     1 
ATOM   3368 C  CA    . PHE A 1 432 ? 40.210 0.720   -19.418 1.00 18.57  ? 429 PHE A CA    1 
ATOM   3369 C  C     . PHE A 1 432 ? 40.582 0.088   -20.752 1.00 32.71  ? 429 PHE A C     1 
ATOM   3370 O  O     . PHE A 1 432 ? 40.901 -1.104  -20.824 1.00 25.08  ? 429 PHE A O     1 
ATOM   3371 C  CB    . PHE A 1 432 ? 41.470 1.271   -18.757 1.00 21.66  ? 429 PHE A CB    1 
ATOM   3372 C  CG    . PHE A 1 432 ? 41.193 2.232   -17.646 1.00 24.12  ? 429 PHE A CG    1 
ATOM   3373 C  CD1   . PHE A 1 432 ? 41.109 3.587   -17.897 1.00 18.07  ? 429 PHE A CD1   1 
ATOM   3374 C  CD2   . PHE A 1 432 ? 41.008 1.782   -16.348 1.00 30.54  ? 429 PHE A CD2   1 
ATOM   3375 C  CE1   . PHE A 1 432 ? 40.850 4.479   -16.881 1.00 18.22  ? 429 PHE A CE1   1 
ATOM   3376 C  CE2   . PHE A 1 432 ? 40.754 2.668   -15.324 1.00 25.85  ? 429 PHE A CE2   1 
ATOM   3377 C  CZ    . PHE A 1 432 ? 40.671 4.022   -15.591 1.00 19.51  ? 429 PHE A CZ    1 
ATOM   3378 N  N     . SER A 1 433 ? 40.543 0.897   -21.806 1.00 28.95  ? 430 SER A N     1 
ATOM   3379 C  CA    . SER A 1 433 ? 41.010 0.474   -23.120 1.00 28.71  ? 430 SER A CA    1 
ATOM   3380 C  C     . SER A 1 433 ? 41.896 1.580   -23.703 1.00 29.56  ? 430 SER A C     1 
ATOM   3381 O  O     . SER A 1 433 ? 41.775 2.751   -23.323 1.00 23.61  ? 430 SER A O     1 
ATOM   3382 C  CB    . SER A 1 433 ? 39.822 0.163   -24.042 1.00 29.50  ? 430 SER A CB    1 
ATOM   3383 O  OG    . SER A 1 433 ? 39.436 1.312   -24.779 1.00 47.37  ? 430 SER A OG    1 
ATOM   3384 N  N     . ALA A 1 434 ? 42.803 1.215   -24.604 1.00 25.92  ? 431 ALA A N     1 
ATOM   3385 C  CA    . ALA A 1 434 ? 43.761 2.188   -25.124 1.00 24.81  ? 431 ALA A CA    1 
ATOM   3386 C  C     . ALA A 1 434 ? 43.072 3.250   -25.974 1.00 32.60  ? 431 ALA A C     1 
ATOM   3387 O  O     . ALA A 1 434 ? 42.057 2.977   -26.626 1.00 34.41  ? 431 ALA A O     1 
ATOM   3388 C  CB    . ALA A 1 434 ? 44.872 1.495   -25.913 1.00 36.54  ? 431 ALA A CB    1 
ATOM   3389 N  N     . SER A 1 435 ? 43.615 4.467   -25.949 1.00 27.39  ? 432 SER A N     1 
ATOM   3390 C  CA    . SER A 1 435 ? 43.096 5.548   -26.794 1.00 38.95  ? 432 SER A CA    1 
ATOM   3391 C  C     . SER A 1 435 ? 44.192 6.524   -27.235 1.00 39.91  ? 432 SER A C     1 
ATOM   3392 O  O     . SER A 1 435 ? 43.925 7.691   -27.503 1.00 40.96  ? 432 SER A O     1 
ATOM   3393 C  CB    . SER A 1 435 ? 41.958 6.297   -26.091 1.00 33.09  ? 432 SER A CB    1 
ATOM   3394 O  OG    . SER A 1 435 ? 42.425 6.985   -24.944 1.00 40.21  ? 432 SER A OG    1 
ATOM   3395 O  OXT   . SER A 1 435 ? 45.371 6.181   -27.340 1.00 40.89  ? 432 SER A OXT   1 
ATOM   3396 O  "O3'" . DC  B 2 1   ? 28.093 4.612   11.512  1.00 64.13  ? 1   DC  T "O3'" 1 
ATOM   3397 P  P     . DA  B 2 2   ? 28.646 4.422   13.012  1.00 87.20  ? 2   DA  T P     1 
ATOM   3398 O  OP1   . DA  B 2 2   ? 28.947 2.982   13.213  1.00 69.46  ? 2   DA  T OP1   1 
ATOM   3399 O  OP2   . DA  B 2 2   ? 27.721 5.123   13.934  1.00 70.01  ? 2   DA  T OP2   1 
ATOM   3400 O  "O5'" . DA  B 2 2   ? 30.011 5.253   13.015  1.00 63.60  ? 2   DA  T "O5'" 1 
ATOM   3401 C  "C5'" . DA  B 2 2   ? 31.144 4.832   12.267  1.00 57.24  ? 2   DA  T "C5'" 1 
ATOM   3402 C  "C4'" . DA  B 2 2   ? 32.387 5.453   12.873  1.00 49.50  ? 2   DA  T "C4'" 1 
ATOM   3403 O  "O4'" . DA  B 2 2   ? 32.341 6.890   12.703  1.00 50.26  ? 2   DA  T "O4'" 1 
ATOM   3404 C  "C3'" . DA  B 2 2   ? 32.524 5.251   14.378  1.00 57.31  ? 2   DA  T "C3'" 1 
ATOM   3405 O  "O3'" A DA  B 2 2   ? 33.891 5.320   14.753  0.70 52.48  ? 2   DA  T "O3'" 1 
ATOM   3406 O  "O3'" B DA  B 2 2   ? 33.891 5.320   14.751  0.30 52.44  ? 2   DA  T "O3'" 1 
ATOM   3407 C  "C2'" . DA  B 2 2   ? 31.739 6.425   14.952  1.00 50.27  ? 2   DA  T "C2'" 1 
ATOM   3408 C  "C1'" . DA  B 2 2   ? 32.147 7.511   13.963  1.00 44.31  ? 2   DA  T "C1'" 1 
ATOM   3409 N  N9    . DA  B 2 2   ? 31.170 8.587   13.824  1.00 39.57  ? 2   DA  T N9    1 
ATOM   3410 C  C8    . DA  B 2 2   ? 29.897 8.655   14.319  1.00 36.39  ? 2   DA  T C8    1 
ATOM   3411 N  N7    . DA  B 2 2   ? 29.272 9.773   14.019  1.00 39.89  ? 2   DA  T N7    1 
ATOM   3412 C  C5    . DA  B 2 2   ? 30.208 10.482  13.283  1.00 39.89  ? 2   DA  T C5    1 
ATOM   3413 C  C6    . DA  B 2 2   ? 30.176 11.748  12.669  1.00 40.62  ? 2   DA  T C6    1 
ATOM   3414 N  N6    . DA  B 2 2   ? 29.109 12.557  12.709  1.00 42.35  ? 2   DA  T N6    1 
ATOM   3415 N  N1    . DA  B 2 2   ? 31.288 12.146  12.012  1.00 46.03  ? 2   DA  T N1    1 
ATOM   3416 C  C2    . DA  B 2 2   ? 32.354 11.336  11.970  1.00 34.99  ? 2   DA  T C2    1 
ATOM   3417 N  N3    . DA  B 2 2   ? 32.505 10.126  12.510  1.00 36.42  ? 2   DA  T N3    1 
ATOM   3418 C  C4    . DA  B 2 2   ? 31.383 9.764   13.156  1.00 36.94  ? 2   DA  T C4    1 
ATOM   3419 P  P     . DT  B 2 3   ? 34.688 3.982   15.141  1.00 59.01  ? 3   DT  T P     1 
ATOM   3420 O  OP1   . DT  B 2 3   ? 33.697 2.965   15.559  1.00 57.69  ? 3   DT  T OP1   1 
ATOM   3421 O  OP2   . DT  B 2 3   ? 35.809 4.362   16.032  1.00 61.43  ? 3   DT  T OP2   1 
ATOM   3422 O  "O5'" . DT  B 2 3   ? 35.309 3.494   13.749  1.00 55.12  ? 3   DT  T "O5'" 1 
ATOM   3423 C  "C5'" . DT  B 2 3   ? 36.698 3.643   13.509  1.00 54.37  ? 3   DT  T "C5'" 1 
ATOM   3424 C  "C4'" . DT  B 2 3   ? 36.943 4.797   12.562  1.00 52.91  ? 3   DT  T "C4'" 1 
ATOM   3425 O  "O4'" . DT  B 2 3   ? 38.371 4.928   12.350  1.00 52.99  ? 3   DT  T "O4'" 1 
ATOM   3426 C  "C3'" . DT  B 2 3   ? 36.303 4.615   11.187  1.00 55.53  ? 3   DT  T "C3'" 1 
ATOM   3427 O  "O3'" . DT  B 2 3   ? 35.352 5.641   10.899  1.00 45.89  ? 3   DT  T "O3'" 1 
ATOM   3428 C  "C2'" . DT  B 2 3   ? 37.469 4.674   10.203  1.00 45.37  ? 3   DT  T "C2'" 1 
ATOM   3429 C  "C1'" . DT  B 2 3   ? 38.594 5.319   11.008  1.00 56.34  ? 3   DT  T "C1'" 1 
ATOM   3430 N  N1    . DT  B 2 3   ? 39.918 4.797   10.566  1.00 56.05  ? 3   DT  T N1    1 
ATOM   3431 C  C2    . DT  B 2 3   ? 40.914 5.634   10.067  1.00 48.20  ? 3   DT  T C2    1 
ATOM   3432 O  O2    . DT  B 2 3   ? 40.808 6.853   9.963   1.00 47.54  ? 3   DT  T O2    1 
ATOM   3433 N  N3    . DT  B 2 3   ? 42.068 4.969   9.699   1.00 34.74  ? 3   DT  T N3    1 
ATOM   3434 C  C4    . DT  B 2 3   ? 42.304 3.603   9.780   1.00 40.76  ? 3   DT  T C4    1 
ATOM   3435 O  O4    . DT  B 2 3   ? 43.365 3.103   9.424   1.00 43.28  ? 3   DT  T O4    1 
ATOM   3436 C  C5    . DT  B 2 3   ? 41.218 2.801   10.303  1.00 44.66  ? 3   DT  T C5    1 
ATOM   3437 C  C7    . DT  B 2 3   ? 41.343 1.312   10.439  1.00 42.18  ? 3   DT  T C7    1 
ATOM   3438 C  C6    . DT  B 2 3   ? 40.094 3.428   10.662  1.00 48.13  ? 3   DT  T C6    1 
ATOM   3439 P  P     . DT  B 2 4   ? 34.640 5.689   9.460   1.00 58.91  ? 4   DT  T P     1 
ATOM   3440 O  OP1   . DT  B 2 4   ? 33.483 6.612   9.547   1.00 45.13  ? 4   DT  T OP1   1 
ATOM   3441 O  OP2   . DT  B 2 4   ? 34.488 4.293   8.984   1.00 43.65  ? 4   DT  T OP2   1 
ATOM   3442 O  "O5'" . DT  B 2 4   ? 35.737 6.374   8.518   1.00 40.51  ? 4   DT  T "O5'" 1 
ATOM   3443 C  "C5'" . DT  B 2 4   ? 36.052 7.753   8.616   1.00 31.29  ? 4   DT  T "C5'" 1 
ATOM   3444 C  "C4'" . DT  B 2 4   ? 36.818 8.139   7.368   1.00 27.37  ? 4   DT  T "C4'" 1 
ATOM   3445 O  "O4'" . DT  B 2 4   ? 38.056 7.385   7.303   1.00 22.81  ? 4   DT  T "O4'" 1 
ATOM   3446 C  "C3'" . DT  B 2 4   ? 36.083 7.824   6.069   1.00 21.94  ? 4   DT  T "C3'" 1 
ATOM   3447 O  "O3'" . DT  B 2 4   ? 36.429 8.827   5.156   1.00 20.91  ? 4   DT  T "O3'" 1 
ATOM   3448 C  "C2'" . DT  B 2 4   ? 36.652 6.469   5.668   1.00 21.27  ? 4   DT  T "C2'" 1 
ATOM   3449 C  "C1'" . DT  B 2 4   ? 38.102 6.670   6.086   1.00 28.07  ? 4   DT  T "C1'" 1 
ATOM   3450 N  N1    . DT  B 2 4   ? 38.857 5.421   6.351   1.00 23.97  ? 4   DT  T N1    1 
ATOM   3451 C  C2    . DT  B 2 4   ? 40.167 5.365   5.945   1.00 22.59  ? 4   DT  T C2    1 
ATOM   3452 O  O2    . DT  B 2 4   ? 40.722 6.283   5.373   1.00 17.83  ? 4   DT  T O2    1 
ATOM   3453 N  N3    . DT  B 2 4   ? 40.802 4.186   6.233   1.00 22.83  ? 4   DT  T N3    1 
ATOM   3454 C  C4    . DT  B 2 4   ? 40.276 3.086   6.874   1.00 22.97  ? 4   DT  T C4    1 
ATOM   3455 O  O4    . DT  B 2 4   ? 40.956 2.090   7.076   1.00 21.05  ? 4   DT  T O4    1 
ATOM   3456 C  C5    . DT  B 2 4   ? 38.896 3.208   7.286   1.00 32.33  ? 4   DT  T C5    1 
ATOM   3457 C  C7    . DT  B 2 4   ? 38.206 2.073   7.996   1.00 30.89  ? 4   DT  T C7    1 
ATOM   3458 C  C6    . DT  B 2 4   ? 38.260 4.361   7.012   1.00 28.18  ? 4   DT  T C6    1 
ATOM   3459 P  P     . DA  B 2 5   ? 35.734 8.889   3.713   1.00 17.53  ? 5   DA  T P     1 
ATOM   3460 O  OP1   . DA  B 2 5   ? 35.368 10.290  3.456   1.00 17.06  ? 5   DA  T OP1   1 
ATOM   3461 O  OP2   . DA  B 2 5   ? 34.678 7.848   3.658   1.00 15.77  ? 5   DA  T OP2   1 
ATOM   3462 O  "O5'" . DA  B 2 5   ? 36.907 8.444   2.724   1.00 17.15  ? 5   DA  T "O5'" 1 
ATOM   3463 C  "C5'" . DA  B 2 5   ? 38.027 9.304   2.524   1.00 13.74  ? 5   DA  T "C5'" 1 
ATOM   3464 C  "C4'" . DA  B 2 5   ? 39.006 8.657   1.571   1.00 16.87  ? 5   DA  T "C4'" 1 
ATOM   3465 O  "O4'" . DA  B 2 5   ? 39.558 7.451   2.169   1.00 16.03  ? 5   DA  T "O4'" 1 
ATOM   3466 C  "C3'" . DA  B 2 5   ? 38.384 8.223   0.246   1.00 17.21  ? 5   DA  T "C3'" 1 
ATOM   3467 O  "O3'" . DA  B 2 5   ? 39.289 8.529   -0.799  1.00 18.10  ? 5   DA  T "O3'" 1 
ATOM   3468 C  "C2'" . DA  B 2 5   ? 38.214 6.714   0.410   1.00 19.89  ? 5   DA  T "C2'" 1 
ATOM   3469 C  "C1'" . DA  B 2 5   ? 39.464 6.393   1.234   1.00 19.28  ? 5   DA  T "C1'" 1 
ATOM   3470 N  N9    . DA  B 2 5   ? 39.415 5.146   1.988   1.00 18.75  ? 5   DA  T N9    1 
ATOM   3471 C  C8    . DA  B 2 5   ? 38.342 4.633   2.657   1.00 16.14  ? 5   DA  T C8    1 
ATOM   3472 N  N7    . DA  B 2 5   ? 38.598 3.497   3.271   1.00 20.34  ? 5   DA  T N7    1 
ATOM   3473 C  C5    . DA  B 2 5   ? 39.928 3.252   2.986   1.00 18.69  ? 5   DA  T C5    1 
ATOM   3474 C  C6    . DA  B 2 5   ? 40.789 2.197   3.337   1.00 23.51  ? 5   DA  T C6    1 
ATOM   3475 N  N6    . DA  B 2 5   ? 40.398 1.162   4.089   1.00 19.21  ? 5   DA  T N6    1 
ATOM   3476 N  N1    . DA  B 2 5   ? 42.067 2.256   2.893   1.00 19.82  ? 5   DA  T N1    1 
ATOM   3477 C  C2    . DA  B 2 5   ? 42.442 3.296   2.142   1.00 18.26  ? 5   DA  T C2    1 
ATOM   3478 N  N3    . DA  B 2 5   ? 41.715 4.339   1.741   1.00 17.36  ? 5   DA  T N3    1 
ATOM   3479 C  C4    . DA  B 2 5   ? 40.454 4.257   2.199   1.00 20.17  ? 5   DA  T C4    1 
ATOM   3480 P  P     . DT  B 2 6   ? 38.809 8.472   -2.335  1.00 16.82  ? 6   DT  T P     1 
ATOM   3481 O  OP1   . DT  B 2 6   ? 39.945 8.880   -3.176  1.00 17.77  ? 6   DT  T OP1   1 
ATOM   3482 O  OP2   . DT  B 2 6   ? 37.518 9.168   -2.444  1.00 18.78  ? 6   DT  T OP2   1 
ATOM   3483 O  "O5'" . DT  B 2 6   ? 38.487 6.933   -2.560  1.00 22.22  ? 6   DT  T "O5'" 1 
ATOM   3484 C  "C5'" . DT  B 2 6   ? 39.233 6.155   -3.485  1.00 22.09  ? 6   DT  T "C5'" 1 
ATOM   3485 C  "C4'" . DT  B 2 6   ? 40.459 5.525   -2.865  1.00 19.41  ? 6   DT  T "C4'" 1 
ATOM   3486 O  "O4'" . DT  B 2 6   ? 40.123 4.835   -1.638  1.00 22.79  ? 6   DT  T "O4'" 1 
ATOM   3487 C  "C3'" . DT  B 2 6   ? 41.050 4.460   -3.777  1.00 21.28  ? 6   DT  T "C3'" 1 
ATOM   3488 O  "O3'" . DT  B 2 6   ? 42.084 5.047   -4.535  1.00 18.35  ? 6   DT  T "O3'" 1 
ATOM   3489 C  "C2'" . DT  B 2 6   ? 41.565 3.352   -2.861  1.00 26.34  ? 6   DT  T "C2'" 1 
ATOM   3490 C  "C1'" . DT  B 2 6   ? 40.996 3.732   -1.497  1.00 23.88  ? 6   DT  T "C1'" 1 
ATOM   3491 N  N1    . DT  B 2 6   ? 40.277 2.646   -0.795  1.00 21.47  ? 6   DT  T N1    1 
ATOM   3492 C  C2    . DT  B 2 6   ? 41.017 1.571   -0.368  1.00 19.31  ? 6   DT  T C2    1 
ATOM   3493 O  O2    . DT  B 2 6   ? 42.209 1.459   -0.569  1.00 23.37  ? 6   DT  T O2    1 
ATOM   3494 N  N3    . DT  B 2 6   ? 40.300 0.618   0.303   1.00 18.53  ? 6   DT  T N3    1 
ATOM   3495 C  C4    . DT  B 2 6   ? 38.957 0.638   0.601   1.00 21.67  ? 6   DT  T C4    1 
ATOM   3496 O  O4    . DT  B 2 6   ? 38.423 -0.275  1.222   1.00 19.93  ? 6   DT  T O4    1 
ATOM   3497 C  C5    . DT  B 2 6   ? 38.235 1.801   0.136   1.00 23.43  ? 6   DT  T C5    1 
ATOM   3498 C  C7    . DT  B 2 6   ? 36.760 1.910   0.407   1.00 27.05  ? 6   DT  T C7    1 
ATOM   3499 C  C6    . DT  B 2 6   ? 38.921 2.741   -0.532  1.00 21.30  ? 6   DT  T C6    1 
ATOM   3500 P  P     . DG  B 2 7   ? 42.237 4.689   -6.090  1.00 19.46  ? 7   DG  T P     1 
ATOM   3501 O  OP1   . DG  B 2 7   ? 43.388 5.452   -6.614  1.00 24.03  ? 7   DG  T OP1   1 
ATOM   3502 O  OP2   . DG  B 2 7   ? 40.908 4.769   -6.720  1.00 16.20  ? 7   DG  T OP2   1 
ATOM   3503 O  "O5'" . DG  B 2 7   ? 42.569 3.111   -6.093  1.00 23.12  ? 7   DG  T "O5'" 1 
ATOM   3504 C  "C5'" . DG  B 2 7   ? 43.888 2.645   -5.907  1.00 26.10  ? 7   DG  T "C5'" 1 
ATOM   3505 C  "C4'" . DG  B 2 7   ? 43.909 1.137   -5.720  1.00 18.58  ? 7   DG  T "C4'" 1 
ATOM   3506 O  "O4'" . DG  B 2 7   ? 43.212 0.780   -4.509  1.00 21.62  ? 7   DG  T "O4'" 1 
ATOM   3507 C  "C3'" . DG  B 2 7   ? 43.250 0.321   -6.833  1.00 26.72  ? 7   DG  T "C3'" 1 
ATOM   3508 O  "O3'" . DG  B 2 7   ? 44.294 -0.326  -7.543  1.00 26.04  ? 7   DG  T "O3'" 1 
ATOM   3509 C  "C2'" . DG  B 2 7   ? 42.378 -0.691  -6.099  1.00 24.45  ? 7   DG  T "C2'" 1 
ATOM   3510 C  "C1'" . DG  B 2 7   ? 42.836 -0.562  -4.649  1.00 23.61  ? 7   DG  T "C1'" 1 
ATOM   3511 N  N9    . DG  B 2 7   ? 41.765 -0.923  -3.722  1.00 28.15  ? 7   DG  T N9    1 
ATOM   3512 C  C8    . DG  B 2 7   ? 40.556 -0.299  -3.517  1.00 20.39  ? 7   DG  T C8    1 
ATOM   3513 N  N7    . DG  B 2 7   ? 39.808 -0.908  -2.631  1.00 19.25  ? 7   DG  T N7    1 
ATOM   3514 C  C5    . DG  B 2 7   ? 40.573 -2.008  -2.243  1.00 25.60  ? 7   DG  T C5    1 
ATOM   3515 C  C6    . DG  B 2 7   ? 40.300 -3.040  -1.318  1.00 17.98  ? 7   DG  T C6    1 
ATOM   3516 O  O6    . DG  B 2 7   ? 39.283 -3.181  -0.628  1.00 20.09  ? 7   DG  T O6    1 
ATOM   3517 N  N1    . DG  B 2 7   ? 41.348 -3.965  -1.236  1.00 18.86  ? 7   DG  T N1    1 
ATOM   3518 C  C2    . DG  B 2 7   ? 42.525 -3.893  -1.956  1.00 21.10  ? 7   DG  T C2    1 
ATOM   3519 N  N2    . DG  B 2 7   ? 43.439 -4.858  -1.760  1.00 17.95  ? 7   DG  T N2    1 
ATOM   3520 N  N3    . DG  B 2 7   ? 42.792 -2.928  -2.824  1.00 21.00  ? 7   DG  T N3    1 
ATOM   3521 C  C4    . DG  B 2 7   ? 41.775 -2.032  -2.911  1.00 21.86  ? 7   DG  T C4    1 
ATOM   3522 P  P     . DA  B 2 8   ? 43.966 -1.313  -8.770  1.00 24.80  ? 8   DA  T P     1 
ATOM   3523 O  OP1   . DA  B 2 8   ? 44.999 -1.112  -9.802  1.00 23.74  ? 8   DA  T OP1   1 
ATOM   3524 O  OP2   . DA  B 2 8   ? 42.527 -1.202  -9.097  1.00 26.18  ? 8   DA  T OP2   1 
ATOM   3525 O  "O5'" . DA  B 2 8   ? 44.201 -2.768  -8.143  1.00 29.26  ? 8   DA  T "O5'" 1 
ATOM   3526 C  "C5'" . DA  B 2 8   ? 45.459 -3.053  -7.552  1.00 19.68  ? 8   DA  T "C5'" 1 
ATOM   3527 C  "C4'" . DA  B 2 8   ? 45.540 -4.533  -7.239  1.00 25.38  ? 8   DA  T "C4'" 1 
ATOM   3528 O  "O4'" . DA  B 2 8   ? 44.684 -4.781  -6.093  1.00 24.46  ? 8   DA  T "O4'" 1 
ATOM   3529 C  "C3'" . DA  B 2 8   ? 45.065 -5.448  -8.370  1.00 22.14  ? 8   DA  T "C3'" 1 
ATOM   3530 O  "O3'" . DA  B 2 8   ? 45.863 -6.625  -8.390  1.00 17.26  ? 8   DA  T "O3'" 1 
ATOM   3531 C  "C2'" . DA  B 2 8   ? 43.624 -5.743  -7.972  1.00 26.79  ? 8   DA  T "C2'" 1 
ATOM   3532 C  "C1'" . DA  B 2 8   ? 43.695 -5.719  -6.446  1.00 28.45  ? 8   DA  T "C1'" 1 
ATOM   3533 N  N9    . DA  B 2 8   ? 42.415 -5.344  -5.858  1.00 26.82  ? 8   DA  T N9    1 
ATOM   3534 C  C8    . DA  B 2 8   ? 41.615 -4.300  -6.239  1.00 24.86  ? 8   DA  T C8    1 
ATOM   3535 N  N7    . DA  B 2 8   ? 40.508 -4.201  -5.546  1.00 18.35  ? 8   DA  T N7    1 
ATOM   3536 C  C5    . DA  B 2 8   ? 40.584 -5.261  -4.659  1.00 21.20  ? 8   DA  T C5    1 
ATOM   3537 C  C6    . DA  B 2 8   ? 39.711 -5.709  -3.653  1.00 19.51  ? 8   DA  T C6    1 
ATOM   3538 N  N6    . DA  B 2 8   ? 38.543 -5.107  -3.373  1.00 16.62  ? 8   DA  T N6    1 
ATOM   3539 N  N1    . DA  B 2 8   ? 40.088 -6.801  -2.947  1.00 18.01  ? 8   DA  T N1    1 
ATOM   3540 C  C2    . DA  B 2 8   ? 41.255 -7.394  -3.226  1.00 15.98  ? 8   DA  T C2    1 
ATOM   3541 N  N3    . DA  B 2 8   ? 42.158 -7.063  -4.146  1.00 20.23  ? 8   DA  T N3    1 
ATOM   3542 C  C4    . DA  B 2 8   ? 41.755 -5.981  -4.839  1.00 22.95  ? 8   DA  T C4    1 
ATOM   3543 P  P     . DC  B 2 9   ? 45.718 -7.705  -9.578  1.00 30.78  ? 9   DC  T P     1 
ATOM   3544 O  OP1   . DC  B 2 9   ? 47.074 -8.168  -9.929  1.00 33.34  ? 9   DC  T OP1   1 
ATOM   3545 O  OP2   . DC  B 2 9   ? 44.839 -7.142  -10.628 1.00 24.71  ? 9   DC  T OP2   1 
ATOM   3546 O  "O5'" . DC  B 2 9   ? 44.899 -8.895  -8.899  1.00 23.97  ? 9   DC  T "O5'" 1 
ATOM   3547 C  "C5'" . DC  B 2 9   ? 45.394 -9.471  -7.713  1.00 25.47  ? 9   DC  T "C5'" 1 
ATOM   3548 C  "C4'" . DC  B 2 9   ? 44.289 -10.313 -7.123  1.00 25.57  ? 9   DC  T "C4'" 1 
ATOM   3549 O  "O4'" . DC  B 2 9   ? 43.230 -9.429  -6.677  1.00 29.35  ? 9   DC  T "O4'" 1 
ATOM   3550 C  "C3'" . DC  B 2 9   ? 43.649 -11.290 -8.112  1.00 32.34  ? 9   DC  T "C3'" 1 
ATOM   3551 O  "O3'" . DC  B 2 9   ? 43.624 -12.565 -7.504  1.00 35.89  ? 9   DC  T "O3'" 1 
ATOM   3552 C  "C2'" . DC  B 2 9   ? 42.237 -10.738 -8.298  1.00 26.68  ? 9   DC  T "C2'" 1 
ATOM   3553 C  "C1'" . DC  B 2 9   ? 42.017 -10.089 -6.936  1.00 26.47  ? 9   DC  T "C1'" 1 
ATOM   3554 N  N1    . DC  B 2 9   ? 40.877 -9.138  -6.868  1.00 25.66  ? 9   DC  T N1    1 
ATOM   3555 C  C2    . DC  B 2 9   ? 39.987 -9.290  -5.811  1.00 21.17  ? 9   DC  T C2    1 
ATOM   3556 O  O2    . DC  B 2 9   ? 40.202 -10.184 -4.980  1.00 24.84  ? 9   DC  T O2    1 
ATOM   3557 N  N3    . DC  B 2 9   ? 38.934 -8.451  -5.720  1.00 21.42  ? 9   DC  T N3    1 
ATOM   3558 C  C4    . DC  B 2 9   ? 38.753 -7.497  -6.636  1.00 25.71  ? 9   DC  T C4    1 
ATOM   3559 N  N4    . DC  B 2 9   ? 37.684 -6.705  -6.494  1.00 22.51  ? 9   DC  T N4    1 
ATOM   3560 C  C5    . DC  B 2 9   ? 39.647 -7.331  -7.738  1.00 26.73  ? 9   DC  T C5    1 
ATOM   3561 C  C6    . DC  B 2 9   ? 40.690 -8.169  -7.813  1.00 28.97  ? 9   DC  T C6    1 
ATOM   3562 P  P     . DG  B 2 10  ? 43.433 -13.896 -8.388  1.00 33.46  ? 10  DG  T P     1 
ATOM   3563 O  OP1   . DG  B 2 10  ? 44.742 -14.565 -8.489  1.00 38.59  ? 10  DG  T OP1   1 
ATOM   3564 O  OP2   . DG  B 2 10  ? 42.683 -13.541 -9.614  1.00 29.12  ? 10  DG  T OP2   1 
ATOM   3565 O  "O5'" . DG  B 2 10  ? 42.451 -14.787 -7.494  1.00 31.85  ? 10  DG  T "O5'" 1 
ATOM   3566 C  "C5'" . DG  B 2 10  ? 42.587 -14.758 -6.078  1.00 29.29  ? 10  DG  T "C5'" 1 
ATOM   3567 C  "C4'" . DG  B 2 10  ? 41.377 -15.384 -5.414  1.00 27.43  ? 10  DG  T "C4'" 1 
ATOM   3568 O  "O4'" . DG  B 2 10  ? 40.365 -14.372 -5.195  1.00 30.57  ? 10  DG  T "O4'" 1 
ATOM   3569 C  "C3'" . DG  B 2 10  ? 40.725 -16.508 -6.214  1.00 31.85  ? 10  DG  T "C3'" 1 
ATOM   3570 O  "O3'" . DG  B 2 10  ? 40.330 -17.535 -5.297  1.00 40.87  ? 10  DG  T "O3'" 1 
ATOM   3571 C  "C2'" . DG  B 2 10  ? 39.558 -15.801 -6.899  1.00 28.36  ? 10  DG  T "C2'" 1 
ATOM   3572 C  "C1'" . DG  B 2 10  ? 39.187 -14.719 -5.890  1.00 29.83  ? 10  DG  T "C1'" 1 
ATOM   3573 N  N9    . DG  B 2 10  ? 38.631 -13.514 -6.505  1.00 24.41  ? 10  DG  T N9    1 
ATOM   3574 C  C8    . DG  B 2 10  ? 39.212 -12.714 -7.465  1.00 24.42  ? 10  DG  T C8    1 
ATOM   3575 N  N7    . DG  B 2 10  ? 38.465 -11.702 -7.815  1.00 22.16  ? 10  DG  T N7    1 
ATOM   3576 C  C5    . DG  B 2 10  ? 37.322 -11.845 -7.036  1.00 20.76  ? 10  DG  T C5    1 
ATOM   3577 C  C6    . DG  B 2 10  ? 36.163 -11.051 -6.981  1.00 20.93  ? 10  DG  T C6    1 
ATOM   3578 O  O6    . DG  B 2 10  ? 35.921 -10.034 -7.634  1.00 19.71  ? 10  DG  T O6    1 
ATOM   3579 N  N1    . DG  B 2 10  ? 35.236 -11.538 -6.056  1.00 23.59  ? 10  DG  T N1    1 
ATOM   3580 C  C2    . DG  B 2 10  ? 35.408 -12.667 -5.282  1.00 24.04  ? 10  DG  T C2    1 
ATOM   3581 N  N2    . DG  B 2 10  ? 34.402 -12.982 -4.448  1.00 22.24  ? 10  DG  T N2    1 
ATOM   3582 N  N3    . DG  B 2 10  ? 36.497 -13.428 -5.323  1.00 22.00  ? 10  DG  T N3    1 
ATOM   3583 C  C4    . DG  B 2 10  ? 37.406 -12.954 -6.222  1.00 18.72  ? 10  DG  T C4    1 
ATOM   3584 P  P     . DC  B 2 11  ? 39.558 -18.850 -5.818  1.00 33.70  ? 11  DC  T P     1 
ATOM   3585 O  OP1   . DC  B 2 11  ? 39.926 -19.971 -4.929  1.00 42.49  ? 11  DC  T OP1   1 
ATOM   3586 O  OP2   . DC  B 2 11  ? 39.781 -18.979 -7.271  1.00 25.97  ? 11  DC  T OP2   1 
ATOM   3587 O  "O5'" . DC  B 2 11  ? 38.023 -18.484 -5.607  1.00 25.49  ? 11  DC  T "O5'" 1 
ATOM   3588 C  "C5'" . DC  B 2 11  ? 37.502 -18.296 -4.314  1.00 25.27  ? 11  DC  T "C5'" 1 
ATOM   3589 C  "C4'" . DC  B 2 11  ? 35.991 -18.262 -4.424  1.00 27.51  ? 11  DC  T "C4'" 1 
ATOM   3590 O  "O4'" . DC  B 2 11  ? 35.554 -17.018 -5.027  1.00 23.27  ? 11  DC  T "O4'" 1 
ATOM   3591 C  "C3'" . DC  B 2 11  ? 35.386 -19.386 -5.268  1.00 19.16  ? 11  DC  T "C3'" 1 
ATOM   3592 O  "O3'" . DC  B 2 11  ? 34.285 -19.899 -4.514  1.00 19.96  ? 11  DC  T "O3'" 1 
ATOM   3593 C  "C2'" . DC  B 2 11  ? 34.977 -18.697 -6.575  1.00 20.74  ? 11  DC  T "C2'" 1 
ATOM   3594 C  "C1'" . DC  B 2 11  ? 34.660 -17.276 -6.094  1.00 28.56  ? 11  DC  T "C1'" 1 
ATOM   3595 N  N1    . DC  B 2 11  ? 34.848 -16.165 -7.099  1.00 18.75  ? 11  DC  T N1    1 
ATOM   3596 C  C2    . DC  B 2 11  ? 33.827 -15.221 -7.275  1.00 24.80  ? 11  DC  T C2    1 
ATOM   3597 O  O2    . DC  B 2 11  ? 32.783 -15.334 -6.621  1.00 21.45  ? 11  DC  T O2    1 
ATOM   3598 N  N3    . DC  B 2 11  ? 34.002 -14.214 -8.175  1.00 20.95  ? 11  DC  T N3    1 
ATOM   3599 C  C4    . DC  B 2 11  ? 35.141 -14.133 -8.869  1.00 21.94  ? 11  DC  T C4    1 
ATOM   3600 N  N4    . DC  B 2 11  ? 35.260 -13.121 -9.738  1.00 20.72  ? 11  DC  T N4    1 
ATOM   3601 C  C5    . DC  B 2 11  ? 36.202 -15.076 -8.696  1.00 21.34  ? 11  DC  T C5    1 
ATOM   3602 C  C6    . DC  B 2 11  ? 36.014 -16.065 -7.807  1.00 21.57  ? 11  DC  T C6    1 
ATOM   3603 P  P     . DT  B 2 12  ? 33.560 -21.255 -4.964  1.00 22.38  ? 12  DT  T P     1 
ATOM   3604 O  OP1   . DT  B 2 12  ? 33.041 -21.917 -3.750  1.00 19.84  ? 12  DT  T OP1   1 
ATOM   3605 O  OP2   . DT  B 2 12  ? 34.466 -21.971 -5.886  1.00 22.07  ? 12  DT  T OP2   1 
ATOM   3606 O  "O5'" . DT  B 2 12  ? 32.319 -20.734 -5.822  1.00 21.29  ? 12  DT  T "O5'" 1 
ATOM   3607 C  "C5'" . DT  B 2 12  ? 31.183 -20.240 -5.141  1.00 20.10  ? 12  DT  T "C5'" 1 
ATOM   3608 C  "C4'" . DT  B 2 12  ? 30.246 -19.686 -6.184  1.00 21.19  ? 12  DT  T "C4'" 1 
ATOM   3609 O  "O4'" . DT  B 2 12  ? 30.950 -18.598 -6.832  1.00 21.13  ? 12  DT  T "O4'" 1 
ATOM   3610 C  "C3'" . DT  B 2 12  ? 29.892 -20.690 -7.285  1.00 22.89  ? 12  DT  T "C3'" 1 
ATOM   3611 O  "O3'" . DT  B 2 12  ? 28.483 -20.724 -7.523  1.00 24.09  ? 12  DT  T "O3'" 1 
ATOM   3612 C  "C2'" . DT  B 2 12  ? 30.652 -20.159 -8.503  1.00 23.41  ? 12  DT  T "C2'" 1 
ATOM   3613 C  "C1'" . DT  B 2 12  ? 30.621 -18.663 -8.200  1.00 29.10  ? 12  DT  T "C1'" 1 
ATOM   3614 N  N1    . DT  B 2 12  ? 31.553 -17.845 -9.031  1.00 29.04  ? 12  DT  T N1    1 
ATOM   3615 C  C2    . DT  B 2 12  ? 31.152 -16.594 -9.439  1.00 24.29  ? 12  DT  T C2    1 
ATOM   3616 O  O2    . DT  B 2 12  ? 30.078 -16.100 -9.149  1.00 35.43  ? 12  DT  T O2    1 
ATOM   3617 N  N3    . DT  B 2 12  ? 32.060 -15.926 -10.210 1.00 25.77  ? 12  DT  T N3    1 
ATOM   3618 C  C4    . DT  B 2 12  ? 33.299 -16.369 -10.620 1.00 23.43  ? 12  DT  T C4    1 
ATOM   3619 O  O4    . DT  B 2 12  ? 34.025 -15.667 -11.324 1.00 24.88  ? 12  DT  T O4    1 
ATOM   3620 C  C5    . DT  B 2 12  ? 33.662 -17.689 -10.154 1.00 25.53  ? 12  DT  T C5    1 
ATOM   3621 C  C7    . DT  B 2 12  ? 34.985 -18.300 -10.512 1.00 23.70  ? 12  DT  T C7    1 
ATOM   3622 C  C6    . DT  B 2 12  ? 32.780 -18.360 -9.399  1.00 26.26  ? 12  DT  T C6    1 
ATOM   3623 O  "O5'" . DA  C 3 1   ? 29.148 -8.062  -15.534 1.00 41.39  ? 1   DA  P "O5'" 1 
ATOM   3624 C  "C5'" . DA  C 3 1   ? 27.757 -8.137  -15.823 1.00 33.64  ? 1   DA  P "C5'" 1 
ATOM   3625 C  "C4'" . DA  C 3 1   ? 26.958 -8.659  -14.640 1.00 35.31  ? 1   DA  P "C4'" 1 
ATOM   3626 O  "O4'" . DA  C 3 1   ? 27.365 -10.025 -14.372 1.00 39.66  ? 1   DA  P "O4'" 1 
ATOM   3627 C  "C3'" . DA  C 3 1   ? 27.071 -7.893  -13.317 1.00 29.79  ? 1   DA  P "C3'" 1 
ATOM   3628 O  "O3'" . DA  C 3 1   ? 25.784 -7.814  -12.722 1.00 32.57  ? 1   DA  P "O3'" 1 
ATOM   3629 C  "C2'" . DA  C 3 1   ? 27.987 -8.743  -12.439 1.00 27.68  ? 1   DA  P "C2'" 1 
ATOM   3630 C  "C1'" . DA  C 3 1   ? 27.976 -10.126 -13.099 1.00 36.98  ? 1   DA  P "C1'" 1 
ATOM   3631 N  N9    . DA  C 3 1   ? 29.325 -10.673 -13.247 1.00 28.96  ? 1   DA  P N9    1 
ATOM   3632 C  C8    . DA  C 3 1   ? 30.317 -10.279 -14.104 1.00 28.48  ? 1   DA  P C8    1 
ATOM   3633 N  N7    . DA  C 3 1   ? 31.433 -10.966 -13.979 1.00 32.27  ? 1   DA  P N7    1 
ATOM   3634 C  C5    . DA  C 3 1   ? 31.141 -11.867 -12.963 1.00 25.03  ? 1   DA  P C5    1 
ATOM   3635 C  C6    . DA  C 3 1   ? 31.894 -12.884 -12.346 1.00 25.99  ? 1   DA  P C6    1 
ATOM   3636 N  N6    . DA  C 3 1   ? 33.157 -13.173 -12.677 1.00 25.46  ? 1   DA  P N6    1 
ATOM   3637 N  N1    . DA  C 3 1   ? 31.295 -13.591 -11.364 1.00 28.57  ? 1   DA  P N1    1 
ATOM   3638 C  C2    . DA  C 3 1   ? 30.031 -13.311 -11.025 1.00 23.89  ? 1   DA  P C2    1 
ATOM   3639 N  N3    . DA  C 3 1   ? 29.227 -12.384 -11.533 1.00 27.19  ? 1   DA  P N3    1 
ATOM   3640 C  C4    . DA  C 3 1   ? 29.852 -11.696 -12.502 1.00 26.11  ? 1   DA  P C4    1 
ATOM   3641 P  P     . DG  C 3 2   ? 25.440 -6.638  -11.675 1.00 37.37  ? 2   DG  P P     1 
ATOM   3642 O  OP1   . DG  C 3 2   ? 23.985 -6.405  -11.725 1.00 28.09  ? 2   DG  P OP1   1 
ATOM   3643 O  OP2   . DG  C 3 2   ? 26.420 -5.547  -11.873 1.00 28.47  ? 2   DG  P OP2   1 
ATOM   3644 O  "O5'" . DG  C 3 2   ? 25.785 -7.281  -10.248 1.00 30.90  ? 2   DG  P "O5'" 1 
ATOM   3645 C  "C5'" . DG  C 3 2   ? 24.855 -8.135  -9.613  1.00 29.38  ? 2   DG  P "C5'" 1 
ATOM   3646 C  "C4'" . DG  C 3 2   ? 25.556 -8.763  -8.429  1.00 31.55  ? 2   DG  P "C4'" 1 
ATOM   3647 O  "O4'" . DG  C 3 2   ? 26.758 -9.419  -8.890  1.00 21.76  ? 2   DG  P "O4'" 1 
ATOM   3648 C  "C3'" . DG  C 3 2   ? 25.989 -7.790  -7.333  1.00 26.39  ? 2   DG  P "C3'" 1 
ATOM   3649 O  "O3'" . DG  C 3 2   ? 25.436 -8.305  -6.139  1.00 32.51  ? 2   DG  P "O3'" 1 
ATOM   3650 C  "C2'" . DG  C 3 2   ? 27.518 -7.837  -7.347  1.00 20.87  ? 2   DG  P "C2'" 1 
ATOM   3651 C  "C1'" . DG  C 3 2   ? 27.785 -9.216  -7.940  1.00 22.10  ? 2   DG  P "C1'" 1 
ATOM   3652 N  N9    . DG  C 3 2   ? 29.097 -9.363  -8.576  1.00 21.85  ? 2   DG  P N9    1 
ATOM   3653 C  C8    . DG  C 3 2   ? 29.735 -8.497  -9.435  1.00 23.54  ? 2   DG  P C8    1 
ATOM   3654 N  N7    . DG  C 3 2   ? 30.915 -8.913  -9.820  1.00 23.05  ? 2   DG  P N7    1 
ATOM   3655 C  C5    . DG  C 3 2   ? 31.070 -10.146 -9.183  1.00 24.59  ? 2   DG  P C5    1 
ATOM   3656 C  C6    . DG  C 3 2   ? 32.139 -11.080 -9.204  1.00 21.52  ? 2   DG  P C6    1 
ATOM   3657 O  O6    . DG  C 3 2   ? 33.212 -11.021 -9.828  1.00 22.77  ? 2   DG  P O6    1 
ATOM   3658 N  N1    . DG  C 3 2   ? 31.875 -12.195 -8.404  1.00 22.49  ? 2   DG  P N1    1 
ATOM   3659 C  C2    . DG  C 3 2   ? 30.726 -12.382 -7.674  1.00 20.69  ? 2   DG  P C2    1 
ATOM   3660 N  N2    . DG  C 3 2   ? 30.632 -13.515 -6.964  1.00 25.72  ? 2   DG  P N2    1 
ATOM   3661 N  N3    . DG  C 3 2   ? 29.724 -11.519 -7.648  1.00 22.98  ? 2   DG  P N3    1 
ATOM   3662 C  C4    . DG  C 3 2   ? 29.962 -10.427 -8.414  1.00 26.86  ? 2   DG  P C4    1 
ATOM   3663 P  P     . DC  C 3 3   ? 25.623 -7.532  -4.744  1.00 30.29  ? 3   DC  P P     1 
ATOM   3664 O  OP1   . DC  C 3 3   ? 24.301 -7.451  -4.093  1.00 43.49  ? 3   DC  P OP1   1 
ATOM   3665 O  OP2   . DC  C 3 3   ? 26.418 -6.305  -4.992  1.00 28.60  ? 3   DC  P OP2   1 
ATOM   3666 O  "O5'" . DC  C 3 3   ? 26.579 -8.505  -3.907  1.00 40.47  ? 3   DC  P "O5'" 1 
ATOM   3667 C  "C5'" . DC  C 3 3   ? 26.296 -9.893  -3.801  1.00 45.03  ? 3   DC  P "C5'" 1 
ATOM   3668 C  "C4'" . DC  C 3 3   ? 27.535 -10.613 -3.306  1.00 38.31  ? 3   DC  P "C4'" 1 
ATOM   3669 O  "O4'" . DC  C 3 3   ? 28.517 -10.613 -4.372  1.00 35.79  ? 3   DC  P "O4'" 1 
ATOM   3670 C  "C3'" . DC  C 3 3   ? 28.195 -9.952  -2.092  1.00 34.16  ? 3   DC  P "C3'" 1 
ATOM   3671 O  "O3'" . DC  C 3 3   ? 28.124 -10.791 -0.947  1.00 33.40  ? 3   DC  P "O3'" 1 
ATOM   3672 C  "C2'" . DC  C 3 3   ? 29.646 -9.702  -2.504  1.00 33.52  ? 3   DC  P "C2'" 1 
ATOM   3673 C  "C1'" . DC  C 3 3   ? 29.796 -10.512 -3.789  1.00 32.55  ? 3   DC  P "C1'" 1 
ATOM   3674 N  N1    . DC  C 3 3   ? 30.715 -9.846  -4.745  1.00 33.14  ? 3   DC  P N1    1 
ATOM   3675 C  C2    . DC  C 3 3   ? 31.905 -10.501 -5.053  1.00 24.56  ? 3   DC  P C2    1 
ATOM   3676 O  O2    . DC  C 3 3   ? 32.126 -11.603 -4.529  1.00 28.90  ? 3   DC  P O2    1 
ATOM   3677 N  N3    . DC  C 3 3   ? 32.773 -9.911  -5.907  1.00 24.55  ? 3   DC  P N3    1 
ATOM   3678 C  C4    . DC  C 3 3   ? 32.489 -8.723  -6.437  1.00 27.31  ? 3   DC  P C4    1 
ATOM   3679 N  N4    . DC  C 3 3   ? 33.392 -8.195  -7.279  1.00 29.32  ? 3   DC  P N4    1 
ATOM   3680 C  C5    . DC  C 3 3   ? 31.272 -8.037  -6.126  1.00 29.79  ? 3   DC  P C5    1 
ATOM   3681 C  C6    . DC  C 3 3   ? 30.418 -8.624  -5.274  1.00 29.02  ? 3   DC  P C6    1 
ATOM   3682 P  P     . DG  C 3 4   ? 28.686 -10.271 0.469   1.00 36.01  ? 4   DG  P P     1 
ATOM   3683 O  OP1   . DG  C 3 4   ? 27.903 -10.933 1.538   1.00 41.43  ? 4   DG  P OP1   1 
ATOM   3684 O  OP2   . DG  C 3 4   ? 28.768 -8.787  0.416   1.00 37.31  ? 4   DG  P OP2   1 
ATOM   3685 O  "O5'" . DG  C 3 4   ? 30.192 -10.817 0.493   1.00 30.69  ? 4   DG  P "O5'" 1 
ATOM   3686 C  "C5'" . DG  C 3 4   ? 30.396 -12.219 0.361   1.00 29.80  ? 4   DG  P "C5'" 1 
ATOM   3687 C  "C4'" . DG  C 3 4   ? 31.876 -12.553 0.337   1.00 43.39  ? 4   DG  P "C4'" 1 
ATOM   3688 O  "O4'" . DG  C 3 4   ? 32.494 -11.989 -0.850  1.00 34.06  ? 4   DG  P "O4'" 1 
ATOM   3689 C  "C3'" . DG  C 3 4   ? 32.646 -12.017 1.542   1.00 32.34  ? 4   DG  P "C3'" 1 
ATOM   3690 O  "O3'" . DG  C 3 4   ? 33.402 -13.080 2.124   1.00 43.34  ? 4   DG  P "O3'" 1 
ATOM   3691 C  "C2'" . DG  C 3 4   ? 33.511 -10.906 0.953   1.00 28.08  ? 4   DG  P "C2'" 1 
ATOM   3692 C  "C1'" . DG  C 3 4   ? 33.705 -11.369 -0.486  1.00 26.33  ? 4   DG  P "C1'" 1 
ATOM   3693 N  N9    . DG  C 3 4   ? 33.952 -10.269 -1.411  1.00 26.03  ? 4   DG  P N9    1 
ATOM   3694 C  C8    . DG  C 3 4   ? 33.143 -9.179  -1.658  1.00 30.89  ? 4   DG  P C8    1 
ATOM   3695 N  N7    . DG  C 3 4   ? 33.630 -8.353  -2.545  1.00 24.84  ? 4   DG  P N7    1 
ATOM   3696 C  C5    . DG  C 3 4   ? 34.841 -8.929  -2.903  1.00 21.42  ? 4   DG  P C5    1 
ATOM   3697 C  C6    . DG  C 3 4   ? 35.816 -8.491  -3.821  1.00 25.20  ? 4   DG  P C6    1 
ATOM   3698 O  O6    . DG  C 3 4   ? 35.804 -7.460  -4.512  1.00 26.26  ? 4   DG  P O6    1 
ATOM   3699 N  N1    . DG  C 3 4   ? 36.895 -9.373  -3.879  1.00 21.49  ? 4   DG  P N1    1 
ATOM   3700 C  C2    . DG  C 3 4   ? 37.016 -10.533 -3.147  1.00 18.23  ? 4   DG  P C2    1 
ATOM   3701 N  N2    . DG  C 3 4   ? 38.124 -11.273 -3.328  1.00 19.90  ? 4   DG  P N2    1 
ATOM   3702 N  N3    . DG  C 3 4   ? 36.108 -10.950 -2.283  1.00 23.12  ? 4   DG  P N3    1 
ATOM   3703 C  C4    . DG  C 3 4   ? 35.053 -10.102 -2.215  1.00 25.06  ? 4   DG  P C4    1 
ATOM   3704 P  P     . DT  C 3 5   ? 34.181 -12.855 3.514   1.00 36.69  ? 5   DT  P P     1 
ATOM   3705 O  OP1   . DT  C 3 5   ? 34.162 -14.136 4.256   1.00 37.28  ? 5   DT  P OP1   1 
ATOM   3706 O  OP2   . DT  C 3 5   ? 33.674 -11.607 4.124   1.00 31.14  ? 5   DT  P OP2   1 
ATOM   3707 O  "O5'" . DT  C 3 5   ? 35.685 -12.567 3.048   1.00 29.91  ? 5   DT  P "O5'" 1 
ATOM   3708 C  "C5'" . DT  C 3 5   ? 36.285 -13.504 2.178   1.00 25.31  ? 5   DT  P "C5'" 1 
ATOM   3709 C  "C4'" . DT  C 3 5   ? 37.702 -13.094 1.837   1.00 26.47  ? 5   DT  P "C4'" 1 
ATOM   3710 O  "O4'" . DT  C 3 5   ? 37.686 -12.069 0.819   1.00 19.47  ? 5   DT  P "O4'" 1 
ATOM   3711 C  "C3'" . DT  C 3 5   ? 38.516 -12.552 3.012   1.00 19.38  ? 5   DT  P "C3'" 1 
ATOM   3712 O  "O3'" . DT  C 3 5   ? 39.692 -13.328 3.049   1.00 25.09  ? 5   DT  P "O3'" 1 
ATOM   3713 C  "C2'" . DT  C 3 5   ? 38.800 -11.098 2.655   1.00 16.72  ? 5   DT  P "C2'" 1 
ATOM   3714 C  "C1'" . DT  C 3 5   ? 38.681 -11.107 1.135   1.00 20.61  ? 5   DT  P "C1'" 1 
ATOM   3715 N  N1    . DT  C 3 5   ? 38.225 -9.832  0.494   1.00 21.75  ? 5   DT  P N1    1 
ATOM   3716 C  C2    . DT  C 3 5   ? 39.020 -9.243  -0.461  1.00 20.57  ? 5   DT  P C2    1 
ATOM   3717 O  O2    . DT  C 3 5   ? 40.105 -9.677  -0.799  1.00 19.19  ? 5   DT  P O2    1 
ATOM   3718 N  N3    . DT  C 3 5   ? 38.506 -8.100  -1.002  1.00 16.79  ? 5   DT  P N3    1 
ATOM   3719 C  C4    . DT  C 3 5   ? 37.306 -7.508  -0.706  1.00 16.71  ? 5   DT  P C4    1 
ATOM   3720 O  O4    . DT  C 3 5   ? 36.955 -6.471  -1.264  1.00 16.53  ? 5   DT  P O4    1 
ATOM   3721 C  C5    . DT  C 3 5   ? 36.515 -8.176  0.304   1.00 25.29  ? 5   DT  P C5    1 
ATOM   3722 C  C7    . DT  C 3 5   ? 35.187 -7.617  0.716   1.00 22.61  ? 5   DT  P C7    1 
ATOM   3723 C  C6    . DT  C 3 5   ? 37.003 -9.295  0.849   1.00 20.27  ? 5   DT  P C6    1 
ATOM   3724 P  P     . DC  C 3 6   ? 40.708 -13.221 4.290   1.00 15.22  ? 6   DC  P P     1 
ATOM   3725 O  OP1   . DC  C 3 6   ? 41.450 -14.513 4.379   1.00 16.23  ? 6   DC  P OP1   1 
ATOM   3726 O  OP2   . DC  C 3 6   ? 39.992 -12.655 5.433   1.00 12.76  ? 6   DC  P OP2   1 
ATOM   3727 O  "O5'" . DC  C 3 6   ? 41.741 -12.097 3.821   1.00 17.10  ? 6   DC  P "O5'" 1 
ATOM   3728 C  "C5'" . DC  C 3 6   ? 42.640 -12.363 2.771   1.00 12.47  ? 6   DC  P "C5'" 1 
ATOM   3729 C  "C4'" . DC  C 3 6   ? 43.346 -11.061 2.451   1.00 22.42  ? 6   DC  P "C4'" 1 
ATOM   3730 O  "O4'" . DC  C 3 6   ? 42.391 -10.186 1.812   1.00 19.29  ? 6   DC  P "O4'" 1 
ATOM   3731 C  "C3'" . DC  C 3 6   ? 43.910 -10.295 3.654   1.00 20.56  ? 6   DC  P "C3'" 1 
ATOM   3732 O  "O3'" . DC  C 3 6   ? 45.331 -10.460 3.605   1.00 17.14  ? 6   DC  P "O3'" 1 
ATOM   3733 C  "C2'" . DC  C 3 6   ? 43.456 -8.843  3.426   1.00 13.94  ? 6   DC  P "C2'" 1 
ATOM   3734 C  "C1'" . DC  C 3 6   ? 42.851 -8.872  2.016   1.00 17.77  ? 6   DC  P "C1'" 1 
ATOM   3735 N  N1    . DC  C 3 6   ? 41.723 -7.893  1.812   1.00 16.58  ? 6   DC  P N1    1 
ATOM   3736 C  C2    . DC  C 3 6   ? 41.801 -6.982  0.749   1.00 19.78  ? 6   DC  P C2    1 
ATOM   3737 O  O2    . DC  C 3 6   ? 42.781 -7.036  0.001   1.00 16.48  ? 6   DC  P O2    1 
ATOM   3738 N  N3    . DC  C 3 6   ? 40.799 -6.083  0.564   1.00 14.94  ? 6   DC  P N3    1 
ATOM   3739 C  C4    . DC  C 3 6   ? 39.762 -6.073  1.398   1.00 17.89  ? 6   DC  P C4    1 
ATOM   3740 N  N4    . DC  C 3 6   ? 38.803 -5.171  1.179   1.00 15.81  ? 6   DC  P N4    1 
ATOM   3741 C  C5    . DC  C 3 6   ? 39.655 -6.984  2.492   1.00 18.90  ? 6   DC  P C5    1 
ATOM   3742 C  C6    . DC  C 3 6   ? 40.649 -7.869  2.663   1.00 22.41  ? 6   DC  P C6    1 
ATOM   3743 P  P     . DA  C 3 7   ? 46.284 -9.782  4.715   1.00 15.57  ? 7   DA  P P     1 
ATOM   3744 O  OP1   . DA  C 3 7   ? 47.487 -10.632 4.854   1.00 13.91  ? 7   DA  P OP1   1 
ATOM   3745 O  OP2   . DA  C 3 7   ? 45.470 -9.502  5.915   1.00 12.93  ? 7   DA  P OP2   1 
ATOM   3746 O  "O5'" . DA  C 3 7   ? 46.618 -8.332  4.105   1.00 20.69  ? 7   DA  P "O5'" 1 
ATOM   3747 C  "C5'" . DA  C 3 7   ? 47.290 -8.151  2.867   1.00 23.15  ? 7   DA  P "C5'" 1 
ATOM   3748 C  "C4'" . DA  C 3 7   ? 47.087 -6.740  2.305   1.00 26.57  ? 7   DA  P "C4'" 1 
ATOM   3749 O  "O4'" . DA  C 3 7   ? 45.700 -6.504  1.972   1.00 20.49  ? 7   DA  P "O4'" 1 
ATOM   3750 C  "C3'" . DA  C 3 7   ? 47.394 -5.549  3.205   1.00 27.07  ? 7   DA  P "C3'" 1 
ATOM   3751 O  "O3'" . DA  C 3 7   ? 48.789 -5.267  3.254   1.00 30.19  ? 7   DA  P "O3'" 1 
ATOM   3752 C  "C2'" . DA  C 3 7   ? 46.668 -4.407  2.499   1.00 21.34  ? 7   DA  P "C2'" 1 
ATOM   3753 C  "C1'" . DA  C 3 7   ? 45.538 -5.119  1.762   1.00 22.54  ? 7   DA  P "C1'" 1 
ATOM   3754 N  N9    . DA  C 3 7   ? 44.215 -4.697  2.216   1.00 18.92  ? 7   DA  P N9    1 
ATOM   3755 C  C8    . DA  C 3 7   ? 43.401 -5.283  3.151   1.00 17.07  ? 7   DA  P C8    1 
ATOM   3756 N  N7    . DA  C 3 7   ? 42.262 -4.637  3.326   1.00 17.25  ? 7   DA  P N7    1 
ATOM   3757 C  C5    . DA  C 3 7   ? 42.351 -3.560  2.451   1.00 17.89  ? 7   DA  P C5    1 
ATOM   3758 C  C6    . DA  C 3 7   ? 41.475 -2.496  2.144   1.00 16.92  ? 7   DA  P C6    1 
ATOM   3759 N  N6    . DA  C 3 7   ? 40.284 -2.346  2.725   1.00 17.12  ? 7   DA  P N6    1 
ATOM   3760 N  N1    . DA  C 3 7   ? 41.872 -1.586  1.223   1.00 16.85  ? 7   DA  P N1    1 
ATOM   3761 C  C2    . DA  C 3 7   ? 43.071 -1.739  0.643   1.00 20.69  ? 7   DA  P C2    1 
ATOM   3762 N  N3    . DA  C 3 7   ? 43.977 -2.696  0.847   1.00 17.08  ? 7   DA  P N3    1 
ATOM   3763 C  C4    . DA  C 3 7   ? 43.549 -3.582  1.764   1.00 18.52  ? 7   DA  P C4    1 
ATOM   3764 P  P     A DT  C 3 8   ? 49.360 -4.229  4.337   0.50 27.57  ? 8   DT  P P     1 
ATOM   3765 P  P     B DT  C 3 8   ? 49.336 -4.034  4.135   0.50 26.80  ? 8   DT  P P     1 
ATOM   3766 O  OP1   A DT  C 3 8   ? 50.802 -4.517  4.530   0.50 26.11  ? 8   DT  P OP1   1 
ATOM   3767 O  OP1   B DT  C 3 8   ? 50.815 -4.137  4.191   0.50 25.68  ? 8   DT  P OP1   1 
ATOM   3768 O  OP2   A DT  C 3 8   ? 48.439 -4.228  5.499   0.50 28.08  ? 8   DT  P OP2   1 
ATOM   3769 O  OP2   B DT  C 3 8   ? 48.547 -3.985  5.389   0.50 27.87  ? 8   DT  P OP2   1 
ATOM   3770 O  "O5'" A DT  C 3 8   ? 49.208 -2.818  3.608   0.50 24.08  ? 8   DT  P "O5'" 1 
ATOM   3771 O  "O5'" B DT  C 3 8   ? 48.937 -2.733  3.276   0.50 24.26  ? 8   DT  P "O5'" 1 
ATOM   3772 C  "C5'" A DT  C 3 8   ? 49.555 -2.717  2.225   0.50 21.34  ? 8   DT  P "C5'" 1 
ATOM   3773 C  "C5'" B DT  C 3 8   ? 49.744 -2.279  2.177   0.50 21.14  ? 8   DT  P "C5'" 1 
ATOM   3774 C  "C4'" A DT  C 3 8   ? 49.284 -1.296  1.798   0.50 19.96  ? 8   DT  P "C4'" 1 
ATOM   3775 C  "C4'" B DT  C 3 8   ? 49.281 -0.934  1.625   0.50 19.92  ? 8   DT  P "C4'" 1 
ATOM   3776 O  "O4'" A DT  C 3 8   ? 47.849 -1.076  1.793   0.50 18.84  ? 8   DT  P "O4'" 1 
ATOM   3777 O  "O4'" B DT  C 3 8   ? 47.887 -1.019  1.226   0.50 17.64  ? 8   DT  P "O4'" 1 
ATOM   3778 C  "C3'" A DT  C 3 8   ? 49.899 -0.303  2.778   0.50 20.90  ? 8   DT  P "C3'" 1 
ATOM   3779 C  "C3'" B DT  C 3 8   ? 49.329 0.253   2.589   0.50 21.15  ? 8   DT  P "C3'" 1 
ATOM   3780 O  "O3'" A DT  C 3 8   ? 50.728 0.645   2.078   0.50 16.91  ? 8   DT  P "O3'" 1 
ATOM   3781 O  "O3'" B DT  C 3 8   ? 50.604 0.901   2.583   0.50 17.59  ? 8   DT  P "O3'" 1 
ATOM   3782 C  "C2'" A DT  C 3 8   ? 48.694 0.305   3.508   0.50 18.11  ? 8   DT  P "C2'" 1 
ATOM   3783 C  "C2'" B DT  C 3 8   ? 48.262 1.188   2.028   0.50 18.00  ? 8   DT  P "C2'" 1 
ATOM   3784 C  "C1'" A DT  C 3 8   ? 47.534 0.084   2.541   0.50 20.00  ? 8   DT  P "C1'" 1 
ATOM   3785 C  "C1'" B DT  C 3 8   ? 47.230 0.218   1.461   0.50 18.41  ? 8   DT  P "C1'" 1 
ATOM   3786 N  N1    A DT  C 3 8   ? 46.200 -0.111  3.202   0.50 20.61  ? 8   DT  P N1    1 
ATOM   3787 N  N1    B DT  C 3 8   ? 46.026 -0.010  2.339   0.50 20.16  ? 8   DT  P N1    1 
ATOM   3788 C  C2    A DT  C 3 8   ? 45.193 0.810   2.977   0.50 20.01  ? 8   DT  P C2    1 
ATOM   3789 C  C2    B DT  C 3 8   ? 44.911 0.794   2.180   0.50 19.95  ? 8   DT  P C2    1 
ATOM   3790 O  O2    A DT  C 3 8   ? 45.320 1.787   2.260   0.50 18.28  ? 8   DT  P O2    1 
ATOM   3791 O  O2    B DT  C 3 8   ? 44.835 1.697   1.369   0.50 18.69  ? 8   DT  P O2    1 
ATOM   3792 N  N3    A DT  C 3 8   ? 44.013 0.540   3.623   0.50 18.89  ? 8   DT  P N3    1 
ATOM   3793 N  N3    B DT  C 3 8   ? 43.867 0.500   3.018   0.50 19.76  ? 8   DT  P N3    1 
ATOM   3794 C  C4    A DT  C 3 8   ? 43.741 -0.530  4.450   0.50 20.20  ? 8   DT  P C4    1 
ATOM   3795 C  C4    B DT  C 3 8   ? 43.817 -0.486  3.977   0.50 19.13  ? 8   DT  P C4    1 
ATOM   3796 O  O4    A DT  C 3 8   ? 42.648 -0.677  4.986   0.50 21.46  ? 8   DT  P O4    1 
ATOM   3797 O  O4    B DT  C 3 8   ? 42.828 -0.660  4.677   0.50 21.04  ? 8   DT  P O4    1 
ATOM   3798 C  C5    A DT  C 3 8   ? 44.834 -1.449  4.650   0.50 19.82  ? 8   DT  P C5    1 
ATOM   3799 C  C5    B DT  C 3 8   ? 45.006 -1.289  4.098   0.50 19.96  ? 8   DT  P C5    1 
ATOM   3800 C  C7    A DT  C 3 8   ? 44.652 -2.643  5.539   0.50 18.87  ? 8   DT  P C7    1 
ATOM   3801 C  C7    B DT  C 3 8   ? 45.053 -2.387  5.119   0.50 19.37  ? 8   DT  P C7    1 
ATOM   3802 C  C6    A DT  C 3 8   ? 45.995 -1.200  4.025   0.50 19.74  ? 8   DT  P C6    1 
ATOM   3803 C  C6    B DT  C 3 8   ? 46.042 -1.018  3.286   0.50 19.29  ? 8   DT  P C6    1 
ATOM   3804 P  P     B DA  C 3 9   ? 51.107 1.703   3.885   0.50 19.29  ? 9   DA  P P     1 
ATOM   3805 O  OP1   B DA  C 3 9   ? 52.576 1.863   3.798   0.50 16.71  ? 9   DA  P OP1   1 
ATOM   3806 O  OP2   B DA  C 3 9   ? 50.515 1.054   5.077   0.50 18.25  ? 9   DA  P OP2   1 
ATOM   3807 O  "O5'" B DA  C 3 9   ? 50.449 3.140   3.717   0.50 15.85  ? 9   DA  P "O5'" 1 
ATOM   3808 C  "C5'" B DA  C 3 9   ? 50.904 4.057   2.741   0.50 14.52  ? 9   DA  P "C5'" 1 
ATOM   3809 C  "C4'" B DA  C 3 9   ? 50.088 5.321   2.920   0.50 13.65  ? 9   DA  P "C4'" 1 
ATOM   3810 O  "O4'" B DA  C 3 9   ? 48.721 5.028   2.550   0.50 14.05  ? 9   DA  P "O4'" 1 
ATOM   3811 C  "C3'" B DA  C 3 9   ? 49.996 5.809   4.362   0.50 13.97  ? 9   DA  P "C3'" 1 
ATOM   3812 O  "O3'" B DA  C 3 9   ? 51.115 6.641   4.683   0.50 11.28  ? 9   DA  P "O3'" 1 
ATOM   3813 C  "C2'" B DA  C 3 9   ? 48.669 6.572   4.346   0.50 13.35  ? 9   DA  P "C2'" 1 
ATOM   3814 C  "C1'" B DA  C 3 9   ? 47.825 5.689   3.421   0.50 16.28  ? 9   DA  P "C1'" 1 
ATOM   3815 N  N9    B DA  C 3 9   ? 47.055 4.675   4.140   0.50 17.08  ? 9   DA  P N9    1 
ATOM   3816 C  C8    B DA  C 3 9   ? 47.507 3.474   4.616   0.50 18.19  ? 9   DA  P C8    1 
ATOM   3817 N  N7    B DA  C 3 9   ? 46.585 2.768   5.235   0.50 17.50  ? 9   DA  P N7    1 
ATOM   3818 C  C5    B DA  C 3 9   ? 45.451 3.560   5.157   0.50 19.12  ? 9   DA  P C5    1 
ATOM   3819 C  C6    B DA  C 3 9   ? 44.129 3.384   5.622   0.50 21.81  ? 9   DA  P C6    1 
ATOM   3820 N  N6    B DA  C 3 9   ? 43.717 2.297   6.285   0.50 21.24  ? 9   DA  P N6    1 
ATOM   3821 N  N1    B DA  C 3 9   ? 43.243 4.372   5.378   0.50 18.29  ? 9   DA  P N1    1 
ATOM   3822 C  C2    B DA  C 3 9   ? 43.656 5.460   4.717   0.50 19.20  ? 9   DA  P C2    1 
ATOM   3823 N  N3    B DA  C 3 9   ? 44.866 5.739   4.229   0.50 17.70  ? 9   DA  P N3    1 
ATOM   3824 C  C4    B DA  C 3 9   ? 45.724 4.740   4.486   0.50 18.73  ? 9   DA  P C4    1 
HETATM 3825 MG MG    . MG  D 4 .   ? 52.988 0.596   2.094   0.50 15.18  ? 501 MG  A MG    1 
HETATM 3826 CA CA    A CA  E 5 .   ? 54.838 2.761   3.800   0.15 9.41   ? 502 CA  A CA    1 
HETATM 3827 MG MG    B MG  F 4 .   ? 54.838 2.719   3.800   0.85 9.20   ? 503 MG  A MG    1 
HETATM 3828 C  C1    . GOL G 6 .   ? 60.547 -24.936 12.145  1.00 16.05  ? 507 GOL A C1    1 
HETATM 3829 O  O1    . GOL G 6 .   ? 59.133 -24.946 12.194  1.00 14.06  ? 507 GOL A O1    1 
HETATM 3830 C  C2    . GOL G 6 .   ? 61.115 -24.382 10.821  1.00 13.54  ? 507 GOL A C2    1 
HETATM 3831 O  O2    . GOL G 6 .   ? 60.676 -23.062 10.557  1.00 13.06  ? 507 GOL A O2    1 
HETATM 3832 C  C3    . GOL G 6 .   ? 60.834 -25.305 9.628   1.00 17.46  ? 507 GOL A C3    1 
HETATM 3833 O  O3    . GOL G 6 .   ? 61.632 -24.928 8.511   1.00 15.94  ? 507 GOL A O3    1 
HETATM 3834 C  C1    . GOL H 6 .   ? 54.585 28.170  4.509   1.00 28.02  ? 508 GOL A C1    1 
HETATM 3835 O  O1    . GOL H 6 .   ? 53.282 27.826  4.060   1.00 25.90  ? 508 GOL A O1    1 
HETATM 3836 C  C2    . GOL H 6 .   ? 55.063 27.162  5.557   1.00 37.92  ? 508 GOL A C2    1 
HETATM 3837 O  O2    . GOL H 6 .   ? 54.545 25.878  5.274   1.00 32.92  ? 508 GOL A O2    1 
HETATM 3838 C  C3    . GOL H 6 .   ? 56.589 27.105  5.608   1.00 34.97  ? 508 GOL A C3    1 
HETATM 3839 O  O3    . GOL H 6 .   ? 57.030 26.084  6.494   1.00 28.06  ? 508 GOL A O3    1 
HETATM 3840 P  PG    A DTP I 7 .   ? 55.383 2.793   7.224   0.50 14.89  ? 504 DTP P PG    1 
HETATM 3841 O  O1G   A DTP I 7 .   ? 55.103 1.878   8.392   0.50 15.70  ? 504 DTP P O1G   1 
HETATM 3842 O  O2G   A DTP I 7 .   ? 56.647 3.607   7.418   0.50 11.76  ? 504 DTP P O2G   1 
HETATM 3843 O  O3G   A DTP I 7 .   ? 55.213 2.167   5.849   0.50 14.65  ? 504 DTP P O3G   1 
HETATM 3844 P  PB    A DTP I 7 .   ? 53.193 4.238   6.115   0.50 12.86  ? 504 DTP P PB    1 
HETATM 3845 O  O1B   A DTP I 7 .   ? 53.940 4.366   4.803   0.50 13.64  ? 504 DTP P O1B   1 
HETATM 3846 O  O2B   A DTP I 7 .   ? 52.321 5.387   6.578   0.50 12.46  ? 504 DTP P O2B   1 
HETATM 3847 O  O3B   A DTP I 7 .   ? 54.182 3.867   7.337   0.50 16.42  ? 504 DTP P O3B   1 
HETATM 3848 P  PA    A DTP I 7 .   ? 51.752 2.157   4.828   0.50 18.02  ? 504 DTP P PA    1 
HETATM 3849 O  O1A   A DTP I 7 .   ? 50.869 1.046   5.340   0.50 17.90  ? 504 DTP P O1A   1 
HETATM 3850 O  O2A   A DTP I 7 .   ? 52.904 1.797   3.905   0.50 16.35  ? 504 DTP P O2A   1 
HETATM 3851 O  O3A   A DTP I 7 .   ? 52.324 2.888   6.141   0.50 15.86  ? 504 DTP P O3A   1 
HETATM 3852 O  "O5'" A DTP I 7 .   ? 50.800 3.256   4.135   0.50 15.50  ? 504 DTP P "O5'" 1 
HETATM 3853 C  "C5'" A DTP I 7 .   ? 51.246 4.130   3.102   0.50 15.00  ? 504 DTP P "C5'" 1 
HETATM 3854 C  "C4'" A DTP I 7 .   ? 50.321 5.346   3.055   0.50 13.83  ? 504 DTP P "C4'" 1 
HETATM 3855 O  "O4'" A DTP I 7 .   ? 48.984 4.972   2.701   0.50 13.64  ? 504 DTP P "O4'" 1 
HETATM 3856 C  "C3'" A DTP I 7 .   ? 50.235 6.038   4.410   0.50 13.96  ? 504 DTP P "C3'" 1 
HETATM 3857 O  "O3'" A DTP I 7 .   ? 51.140 7.151   4.485   0.50 10.80  ? 504 DTP P "O3'" 1 
HETATM 3858 C  "C2'" A DTP I 7 .   ? 48.791 6.498   4.518   0.50 13.30  ? 504 DTP P "C2'" 1 
HETATM 3859 C  "C1'" A DTP I 7 .   ? 48.016 5.609   3.547   0.50 16.44  ? 504 DTP P "C1'" 1 
HETATM 3860 N  N9    A DTP I 7 .   ? 47.248 4.592   4.317   0.50 17.20  ? 504 DTP P N9    1 
HETATM 3861 C  C8    A DTP I 7 .   ? 47.751 3.478   4.869   0.50 18.27  ? 504 DTP P C8    1 
HETATM 3862 N  N7    A DTP I 7 .   ? 46.755 2.800   5.490   0.50 17.45  ? 504 DTP P N7    1 
HETATM 3863 C  C5    A DTP I 7 .   ? 45.617 3.501   5.317   0.50 19.14  ? 504 DTP P C5    1 
HETATM 3864 C  C6    A DTP I 7 .   ? 44.304 3.300   5.724   0.50 21.84  ? 504 DTP P C6    1 
HETATM 3865 N  N6    A DTP I 7 .   ? 43.976 2.202   6.449   0.50 21.13  ? 504 DTP P N6    1 
HETATM 3866 N  N1    A DTP I 7 .   ? 43.360 4.209   5.387   0.50 18.38  ? 504 DTP P N1    1 
HETATM 3867 C  C2    A DTP I 7 .   ? 43.689 5.295   4.672   0.50 19.20  ? 504 DTP P C2    1 
HETATM 3868 N  N3    A DTP I 7 .   ? 44.950 5.515   4.264   0.50 17.86  ? 504 DTP P N3    1 
HETATM 3869 C  C4    A DTP I 7 .   ? 45.932 4.628   4.572   0.50 18.72  ? 504 DTP P C4    1 
HETATM 3870 P  P1    B DPO J 8 .   ? 53.204 4.286   6.125   0.50 12.87  ? 505 DPO P P1    1 
HETATM 3871 O  O1    B DPO J 8 .   ? 52.340 3.056   6.224   0.50 15.72  ? 505 DPO P O1    1 
HETATM 3872 O  O2    B DPO J 8 .   ? 53.941 4.455   4.811   0.50 13.60  ? 505 DPO P O2    1 
HETATM 3873 O  O3    B DPO J 8 .   ? 52.525 5.550   6.613   0.50 12.17  ? 505 DPO P O3    1 
HETATM 3874 O  O4    B DPO J 8 .   ? 54.332 4.022   7.249   0.50 16.33  ? 505 DPO P O4    1 
HETATM 3875 P  P2    B DPO J 8 .   ? 55.394 2.807   7.197   0.50 14.89  ? 505 DPO P P2    1 
HETATM 3876 O  O5    B DPO J 8 .   ? 56.726 3.497   7.420   0.50 11.79  ? 505 DPO P O5    1 
HETATM 3877 O  O6    B DPO J 8 .   ? 54.969 1.934   8.354   0.50 15.71  ? 505 DPO P O6    1 
HETATM 3878 O  O7    B DPO J 8 .   ? 55.193 2.171   5.833   0.50 14.64  ? 505 DPO P O7    1 
HETATM 3879 MG MG    B MG  K 4 .   ? 51.784 1.113   6.909   0.50 22.34  ? 506 MG  P MG    1 
HETATM 3880 O  O     B HOH L 9 .   ? 49.539 2.042   7.890   0.50 18.52  ? 601 HOH A O     1 
HETATM 3881 O  O     B HOH L 9 .   ? 49.719 4.496   7.470   0.50 17.22  ? 602 HOH A O     1 
HETATM 3882 O  O     A HOH L 9 .   ? 48.884 0.172   9.853   0.50 22.14  ? 603 HOH A O     1 
HETATM 3883 O  O     . HOH L 9 .   ? 53.112 -0.985  3.644   1.00 20.35  ? 604 HOH A O     1 
HETATM 3884 O  O     . HOH L 9 .   ? 56.440 -13.920 -5.843  1.00 8.77   ? 605 HOH A O     1 
HETATM 3885 O  O     . HOH L 9 .   ? 67.425 -20.674 8.819   1.00 10.14  ? 606 HOH A O     1 
HETATM 3886 O  O     . HOH L 9 .   ? 43.970 -14.423 5.625   1.00 10.09  ? 607 HOH A O     1 
HETATM 3887 O  O     . HOH L 9 .   ? 62.417 7.450   7.136   1.00 10.27  ? 608 HOH A O     1 
HETATM 3888 O  O     . HOH L 9 .   ? 57.928 -23.511 14.235  1.00 7.45   ? 609 HOH A O     1 
HETATM 3889 O  O     . HOH L 9 .   ? 69.232 -17.543 -1.311  1.00 8.58   ? 610 HOH A O     1 
HETATM 3890 O  O     . HOH L 9 .   ? 64.074 -3.446  6.068   1.00 9.55   ? 611 HOH A O     1 
HETATM 3891 O  O     . HOH L 9 .   ? 59.507 9.589   10.763  1.00 10.44  ? 612 HOH A O     1 
HETATM 3892 O  O     . HOH L 9 .   ? 67.163 -16.649 9.616   1.00 7.23   ? 613 HOH A O     1 
HETATM 3893 O  O     . HOH L 9 .   ? 54.024 -28.529 4.059   1.00 13.28  ? 614 HOH A O     1 
HETATM 3894 O  O     . HOH L 9 .   ? 68.934 16.323  -4.109  1.00 12.08  ? 615 HOH A O     1 
HETATM 3895 O  O     . HOH L 9 .   ? 55.704 17.337  -0.604  1.00 8.49   ? 616 HOH A O     1 
HETATM 3896 O  O     . HOH L 9 .   ? 52.038 5.800   9.101   1.00 10.70  ? 617 HOH A O     1 
HETATM 3897 O  O     . HOH L 9 .   ? 69.207 -13.513 5.083   1.00 7.40   ? 618 HOH A O     1 
HETATM 3898 O  O     . HOH L 9 .   ? 60.478 -18.468 -4.656  1.00 10.48  ? 619 HOH A O     1 
HETATM 3899 O  O     . HOH L 9 .   ? 62.658 14.898  -9.177  1.00 13.43  ? 620 HOH A O     1 
HETATM 3900 O  O     . HOH L 9 .   ? 54.800 -11.421 3.399   1.00 8.45   ? 621 HOH A O     1 
HETATM 3901 O  O     . HOH L 9 .   ? 58.585 -12.088 -11.415 1.00 13.57  ? 622 HOH A O     1 
HETATM 3902 O  O     . HOH L 9 .   ? 43.643 12.278  -7.355  1.00 16.03  ? 623 HOH A O     1 
HETATM 3903 O  O     . HOH L 9 .   ? 53.818 -20.561 -2.586  1.00 10.93  ? 624 HOH A O     1 
HETATM 3904 O  O     . HOH L 9 .   ? 73.208 -7.326  9.022   1.00 14.38  ? 625 HOH A O     1 
HETATM 3905 O  O     . HOH L 9 .   ? 45.540 16.007  -1.687  1.00 14.07  ? 626 HOH A O     1 
HETATM 3906 O  O     . HOH L 9 .   ? 60.019 11.479  -10.274 1.00 12.16  ? 627 HOH A O     1 
HETATM 3907 O  O     . HOH L 9 .   ? 54.339 -9.519  5.313   1.00 14.88  ? 628 HOH A O     1 
HETATM 3908 O  O     . HOH L 9 .   ? 53.914 17.351  -3.211  1.00 19.79  ? 629 HOH A O     1 
HETATM 3909 O  O     . HOH L 9 .   ? 53.408 -28.218 15.297  1.00 15.09  ? 630 HOH A O     1 
HETATM 3910 O  O     . HOH L 9 .   ? 60.462 -17.703 -7.492  1.00 23.33  ? 631 HOH A O     1 
HETATM 3911 O  O     . HOH L 9 .   ? 52.586 20.222  4.850   1.00 12.96  ? 632 HOH A O     1 
HETATM 3912 O  O     . HOH L 9 .   ? 59.193 11.169  8.473   1.00 12.31  ? 633 HOH A O     1 
HETATM 3913 O  O     . HOH L 9 .   ? 70.689 -16.017 7.713   1.00 14.96  ? 634 HOH A O     1 
HETATM 3914 O  O     . HOH L 9 .   ? 65.699 -22.968 3.226   1.00 12.07  ? 635 HOH A O     1 
HETATM 3915 O  O     . HOH L 9 .   ? 45.166 7.415   -10.316 1.00 15.73  ? 636 HOH A O     1 
HETATM 3916 O  O     . HOH L 9 .   ? 65.689 -6.494  -13.735 1.00 16.37  ? 637 HOH A O     1 
HETATM 3917 O  O     . HOH L 9 .   ? 64.160 -9.211  -14.347 1.00 14.41  ? 638 HOH A O     1 
HETATM 3918 O  O     . HOH L 9 .   ? 45.136 -14.243 10.504  1.00 14.48  ? 639 HOH A O     1 
HETATM 3919 O  O     . HOH L 9 .   ? 42.300 -22.718 -2.504  1.00 18.05  ? 640 HOH A O     1 
HETATM 3920 O  O     . HOH L 9 .   ? 51.493 5.618   -8.298  1.00 18.78  ? 641 HOH A O     1 
HETATM 3921 O  O     . HOH L 9 .   ? 43.532 -33.304 -0.487  1.00 13.68  ? 642 HOH A O     1 
HETATM 3922 O  O     . HOH L 9 .   ? 71.202 3.538   -0.236  1.00 14.90  ? 643 HOH A O     1 
HETATM 3923 O  O     . HOH L 9 .   ? 52.723 1.416   9.218   1.00 16.37  ? 644 HOH A O     1 
HETATM 3924 O  O     . HOH L 9 .   ? 53.697 13.514  -9.992  1.00 13.33  ? 645 HOH A O     1 
HETATM 3925 O  O     . HOH L 9 .   ? 68.467 -15.843 -7.756  1.00 20.52  ? 646 HOH A O     1 
HETATM 3926 O  O     . HOH L 9 .   ? 52.392 15.878  -4.676  1.00 11.54  ? 647 HOH A O     1 
HETATM 3927 O  O     . HOH L 9 .   ? 50.219 -17.215 15.526  1.00 13.29  ? 648 HOH A O     1 
HETATM 3928 O  O     . HOH L 9 .   ? 51.791 -8.614  4.774   1.00 21.36  ? 649 HOH A O     1 
HETATM 3929 O  O     . HOH L 9 .   ? 48.718 -22.351 -5.875  1.00 17.85  ? 650 HOH A O     1 
HETATM 3930 O  O     . HOH L 9 .   ? 49.215 -15.564 13.583  1.00 16.91  ? 651 HOH A O     1 
HETATM 3931 O  O     . HOH L 9 .   ? 40.645 16.785  5.944   1.00 19.37  ? 652 HOH A O     1 
HETATM 3932 O  O     . HOH L 9 .   ? 46.314 16.786  1.173   1.00 10.90  ? 653 HOH A O     1 
HETATM 3933 O  O     . HOH L 9 .   ? 64.526 6.713   -0.452  1.00 14.34  ? 654 HOH A O     1 
HETATM 3934 O  O     . HOH L 9 .   ? 60.855 -23.455 6.347   1.00 15.55  ? 655 HOH A O     1 
HETATM 3935 O  O     . HOH L 9 .   ? 43.717 9.809   -10.010 1.00 15.83  ? 656 HOH A O     1 
HETATM 3936 O  O     . HOH L 9 .   ? 41.094 6.925   19.149  1.00 15.79  ? 657 HOH A O     1 
HETATM 3937 O  O     . HOH L 9 .   ? 58.018 17.511  -6.733  1.00 15.07  ? 658 HOH A O     1 
HETATM 3938 O  O     . HOH L 9 .   ? 43.031 -1.535  -25.032 1.00 21.43  ? 659 HOH A O     1 
HETATM 3939 O  O     . HOH L 9 .   ? 33.351 10.825  5.466   1.00 24.52  ? 660 HOH A O     1 
HETATM 3940 O  O     . HOH L 9 .   ? 48.642 -36.901 2.576   1.00 18.31  ? 661 HOH A O     1 
HETATM 3941 O  O     . HOH L 9 .   ? 59.227 5.026   16.722  1.00 23.74  ? 662 HOH A O     1 
HETATM 3942 O  O     . HOH L 9 .   ? 44.127 -15.241 1.305   1.00 16.98  ? 663 HOH A O     1 
HETATM 3943 O  O     . HOH L 9 .   ? 65.732 -15.266 11.839  1.00 16.01  ? 664 HOH A O     1 
HETATM 3944 O  O     . HOH L 9 .   ? 50.476 -34.798 -0.677  1.00 20.31  ? 665 HOH A O     1 
HETATM 3945 O  O     . HOH L 9 .   ? 43.854 11.077  -12.404 1.00 20.51  ? 666 HOH A O     1 
HETATM 3946 O  O     . HOH L 9 .   ? 35.079 5.569   1.962   1.00 18.37  ? 667 HOH A O     1 
HETATM 3947 O  O     . HOH L 9 .   ? 41.440 17.006  -14.929 1.00 18.18  ? 668 HOH A O     1 
HETATM 3948 O  O     . HOH L 9 .   ? 41.420 -24.028 -5.170  1.00 20.18  ? 669 HOH A O     1 
HETATM 3949 O  O     . HOH L 9 .   ? 57.910 -7.698  8.152   1.00 19.34  ? 670 HOH A O     1 
HETATM 3950 O  O     . HOH L 9 .   ? 53.185 -33.409 -0.264  1.00 19.69  ? 671 HOH A O     1 
HETATM 3951 O  O     . HOH L 9 .   ? 46.874 -0.326  -15.089 1.00 19.96  ? 672 HOH A O     1 
HETATM 3952 O  O     . HOH L 9 .   ? 58.281 -8.889  -14.253 1.00 21.09  ? 673 HOH A O     1 
HETATM 3953 O  O     . HOH L 9 .   ? 42.936 15.787  23.708  1.00 22.86  ? 674 HOH A O     1 
HETATM 3954 O  O     . HOH L 9 .   ? 58.102 -14.271 -13.123 1.00 18.45  ? 675 HOH A O     1 
HETATM 3955 O  O     . HOH L 9 .   ? 59.891 10.480  19.796  1.00 13.48  ? 676 HOH A O     1 
HETATM 3956 O  O     . HOH L 9 .   ? 47.354 2.504   -1.287  1.00 20.56  ? 677 HOH A O     1 
HETATM 3957 O  O     . HOH L 9 .   ? 70.788 -19.091 1.322   1.00 16.16  ? 678 HOH A O     1 
HETATM 3958 O  O     . HOH L 9 .   ? 55.428 -7.299  6.454   1.00 22.39  ? 679 HOH A O     1 
HETATM 3959 O  O     . HOH L 9 .   ? 49.353 7.394   -7.833  1.00 21.35  ? 680 HOH A O     1 
HETATM 3960 O  O     . HOH L 9 .   ? 37.032 16.115  -4.321  1.00 19.18  ? 681 HOH A O     1 
HETATM 3961 O  O     . HOH L 9 .   ? 69.403 4.553   3.949   1.00 20.40  ? 682 HOH A O     1 
HETATM 3962 O  O     . HOH L 9 .   ? 49.184 6.831   -11.835 1.00 18.10  ? 683 HOH A O     1 
HETATM 3963 O  O     . HOH L 9 .   ? 49.959 -3.214  -17.238 1.00 20.19  ? 684 HOH A O     1 
HETATM 3964 O  O     . HOH L 9 .   ? 70.494 0.408   11.419  1.00 26.71  ? 685 HOH A O     1 
HETATM 3965 O  O     . HOH L 9 .   ? 67.439 -6.320  12.948  1.00 21.68  ? 686 HOH A O     1 
HETATM 3966 O  O     . HOH L 9 .   ? 61.514 14.610  8.711   1.00 22.57  ? 687 HOH A O     1 
HETATM 3967 O  O     . HOH L 9 .   ? 54.143 15.313  -6.954  1.00 21.57  ? 688 HOH A O     1 
HETATM 3968 O  O     . HOH L 9 .   ? 59.824 13.041  11.335  1.00 18.02  ? 689 HOH A O     1 
HETATM 3969 O  O     . HOH L 9 .   ? 69.639 -12.896 -11.146 1.00 24.54  ? 690 HOH A O     1 
HETATM 3970 O  O     . HOH L 9 .   ? 60.075 14.386  -8.685  1.00 19.00  ? 691 HOH A O     1 
HETATM 3971 O  O     . HOH L 9 .   ? 34.776 15.222  11.418  1.00 21.42  ? 692 HOH A O     1 
HETATM 3972 O  O     . HOH L 9 .   ? 54.062 16.356  -9.381  1.00 29.60  ? 693 HOH A O     1 
HETATM 3973 O  O     . HOH L 9 .   ? 65.842 5.817   2.000   1.00 22.10  ? 694 HOH A O     1 
HETATM 3974 O  O     . HOH L 9 .   ? 56.291 18.760  18.189  1.00 20.92  ? 695 HOH A O     1 
HETATM 3975 O  O     . HOH L 9 .   ? 63.543 12.861  -10.890 1.00 18.83  ? 696 HOH A O     1 
HETATM 3976 O  O     . HOH L 9 .   ? 72.285 -3.735  -13.943 1.00 24.59  ? 697 HOH A O     1 
HETATM 3977 O  O     . HOH L 9 .   ? 47.970 -27.293 -7.286  1.00 23.53  ? 698 HOH A O     1 
HETATM 3978 O  O     . HOH L 9 .   ? 83.845 -4.999  2.599   1.00 26.45  ? 699 HOH A O     1 
HETATM 3979 O  O     . HOH L 9 .   ? 41.796 -30.468 -6.570  1.00 22.06  ? 700 HOH A O     1 
HETATM 3980 O  O     . HOH L 9 .   ? 23.287 14.194  -9.204  1.00 27.10  ? 701 HOH A O     1 
HETATM 3981 O  O     . HOH L 9 .   ? 54.415 15.415  23.322  1.00 24.26  ? 702 HOH A O     1 
HETATM 3982 O  O     . HOH L 9 .   ? 41.237 7.564   -18.693 1.00 19.57  ? 703 HOH A O     1 
HETATM 3983 O  O     . HOH L 9 .   ? 53.479 7.400   -14.797 1.00 29.30  ? 704 HOH A O     1 
HETATM 3984 O  O     . HOH L 9 .   ? 71.573 6.033   -7.276  1.00 15.94  ? 705 HOH A O     1 
HETATM 3985 O  O     . HOH L 9 .   ? 46.744 -18.921 -2.583  1.00 26.88  ? 706 HOH A O     1 
HETATM 3986 O  O     . HOH L 9 .   ? 38.955 -19.771 12.527  1.00 27.38  ? 707 HOH A O     1 
HETATM 3987 O  O     . HOH L 9 .   ? 78.013 -0.900  5.455   1.00 20.80  ? 708 HOH A O     1 
HETATM 3988 O  O     . HOH L 9 .   ? 48.108 10.561  -9.743  1.00 29.20  ? 709 HOH A O     1 
HETATM 3989 O  O     . HOH L 9 .   ? 62.933 -17.015 -7.311  1.00 21.83  ? 710 HOH A O     1 
HETATM 3990 O  O     . HOH L 9 .   ? 62.796 9.474   -13.482 1.00 30.09  ? 711 HOH A O     1 
HETATM 3991 O  O     . HOH L 9 .   ? 51.453 3.543   10.445  1.00 18.85  ? 712 HOH A O     1 
HETATM 3992 O  O     . HOH L 9 .   ? 58.754 15.146  -10.899 1.00 25.84  ? 713 HOH A O     1 
HETATM 3993 O  O     . HOH L 9 .   ? 54.158 -32.333 -2.768  1.00 27.33  ? 714 HOH A O     1 
HETATM 3994 O  O     . HOH L 9 .   ? 63.377 -18.994 -1.678  1.00 18.11  ? 715 HOH A O     1 
HETATM 3995 O  O     . HOH L 9 .   ? 47.123 16.432  25.620  1.00 22.77  ? 716 HOH A O     1 
HETATM 3996 O  O     . HOH L 9 .   ? 65.676 8.504   8.897   1.00 27.75  ? 717 HOH A O     1 
HETATM 3997 O  O     . HOH L 9 .   ? 36.781 13.198  11.932  1.00 23.28  ? 718 HOH A O     1 
HETATM 3998 O  O     . HOH L 9 .   ? 75.332 0.642   -3.525  1.00 24.67  ? 719 HOH A O     1 
HETATM 3999 O  O     . HOH L 9 .   ? 41.531 15.757  -23.149 1.00 23.92  ? 720 HOH A O     1 
HETATM 4000 O  O     . HOH L 9 .   ? 41.362 21.634  2.309   1.00 24.01  ? 721 HOH A O     1 
HETATM 4001 O  O     . HOH L 9 .   ? 61.239 21.008  11.690  1.00 24.83  ? 722 HOH A O     1 
HETATM 4002 O  O     . HOH L 9 .   ? 51.185 21.898  7.053   1.00 25.12  ? 723 HOH A O     1 
HETATM 4003 O  O     . HOH L 9 .   ? 55.227 2.572   21.042  1.00 25.19  ? 724 HOH A O     1 
HETATM 4004 O  O     . HOH L 9 .   ? 47.830 8.029   -9.783  1.00 24.18  ? 725 HOH A O     1 
HETATM 4005 O  O     . HOH L 9 .   ? 51.621 5.249   -11.068 1.00 21.53  ? 726 HOH A O     1 
HETATM 4006 O  O     . HOH L 9 .   ? 42.137 8.133   3.270   1.00 23.22  ? 727 HOH A O     1 
HETATM 4007 O  O     . HOH L 9 .   ? 45.148 0.637   -18.459 1.00 22.88  ? 728 HOH A O     1 
HETATM 4008 O  O     . HOH L 9 .   ? 81.855 -19.922 0.000   1.00 32.39  ? 729 HOH A O     1 
HETATM 4009 O  O     . HOH L 9 .   ? 65.191 19.544  1.898   1.00 22.75  ? 730 HOH A O     1 
HETATM 4010 O  O     . HOH L 9 .   ? 58.319 -18.124 19.745  1.00 22.10  ? 731 HOH A O     1 
HETATM 4011 O  O     . HOH L 9 .   ? 50.157 2.909   12.738  1.00 22.37  ? 732 HOH A O     1 
HETATM 4012 O  O     . HOH L 9 .   ? 65.629 -22.299 -8.039  1.00 24.29  ? 733 HOH A O     1 
HETATM 4013 O  O     . HOH L 9 .   ? 51.855 -16.106 17.383  1.00 30.05  ? 734 HOH A O     1 
HETATM 4014 O  O     . HOH L 9 .   ? 84.040 -18.445 -0.813  1.00 40.80  ? 735 HOH A O     1 
HETATM 4015 O  O     . HOH L 9 .   ? 38.582 -17.933 10.239  1.00 22.00  ? 736 HOH A O     1 
HETATM 4016 O  O     . HOH L 9 .   ? 62.110 -12.927 -13.494 1.00 30.32  ? 737 HOH A O     1 
HETATM 4017 O  O     . HOH L 9 .   ? 61.457 -2.609  12.221  1.00 30.15  ? 738 HOH A O     1 
HETATM 4018 O  O     . HOH L 9 .   ? 59.004 4.652   23.015  1.00 24.65  ? 739 HOH A O     1 
HETATM 4019 O  O     . HOH L 9 .   ? 44.934 16.999  -18.230 1.00 29.30  ? 740 HOH A O     1 
HETATM 4020 O  O     . HOH L 9 .   ? 53.708 6.023   -12.387 1.00 25.59  ? 741 HOH A O     1 
HETATM 4021 O  O     . HOH L 9 .   ? 29.211 8.337   -18.772 1.00 29.27  ? 742 HOH A O     1 
HETATM 4022 O  O     . HOH L 9 .   ? 40.783 -29.612 -2.467  1.00 29.14  ? 743 HOH A O     1 
HETATM 4023 O  O     . HOH L 9 .   ? 51.031 0.404   -16.161 1.00 24.93  ? 744 HOH A O     1 
HETATM 4024 O  O     . HOH L 9 .   ? 66.625 3.959   10.830  1.00 24.23  ? 745 HOH A O     1 
HETATM 4025 O  O     . HOH L 9 .   ? 49.021 -9.500  10.458  1.00 24.76  ? 746 HOH A O     1 
HETATM 4026 O  O     . HOH L 9 .   ? 67.910 1.933   12.730  1.00 30.61  ? 747 HOH A O     1 
HETATM 4027 O  O     . HOH L 9 .   ? 68.012 -14.512 -10.160 1.00 25.39  ? 748 HOH A O     1 
HETATM 4028 O  O     . HOH L 9 .   ? 57.427 -34.823 8.507   1.00 27.32  ? 749 HOH A O     1 
HETATM 4029 O  O     . HOH L 9 .   ? 76.434 2.750   6.870   1.00 26.11  ? 750 HOH A O     1 
HETATM 4030 O  O     . HOH L 9 .   ? 72.282 -7.828  11.785  1.00 15.95  ? 751 HOH A O     1 
HETATM 4031 O  O     . HOH L 9 .   ? 38.979 -3.521  -20.207 1.00 25.11  ? 752 HOH A O     1 
HETATM 4032 O  O     . HOH L 9 .   ? 44.422 15.756  26.091  1.00 26.77  ? 753 HOH A O     1 
HETATM 4033 O  O     . HOH L 9 .   ? 47.093 0.442   6.544   1.00 28.40  ? 754 HOH A O     1 
HETATM 4034 O  O     . HOH L 9 .   ? 45.709 17.998  -3.609  1.00 25.30  ? 755 HOH A O     1 
HETATM 4035 O  O     . HOH L 9 .   ? 51.481 8.927   -15.582 1.00 30.30  ? 756 HOH A O     1 
HETATM 4036 O  O     . HOH L 9 .   ? 49.148 2.629   21.302  1.00 24.55  ? 757 HOH A O     1 
HETATM 4037 O  O     . HOH L 9 .   ? 45.524 2.033   18.405  1.00 31.30  ? 758 HOH A O     1 
HETATM 4038 O  O     . HOH L 9 .   ? 46.834 -14.724 14.926  1.00 26.03  ? 759 HOH A O     1 
HETATM 4039 O  O     . HOH L 9 .   ? 67.451 -8.238  10.023  1.00 22.81  ? 760 HOH A O     1 
HETATM 4040 O  O     . HOH L 9 .   ? 80.748 -3.930  14.265  1.00 34.63  ? 761 HOH A O     1 
HETATM 4041 O  O     . HOH L 9 .   ? 68.291 11.493  -12.592 1.00 29.71  ? 762 HOH A O     1 
HETATM 4042 O  O     . HOH L 9 .   ? 61.968 8.003   16.186  1.00 28.01  ? 763 HOH A O     1 
HETATM 4043 O  O     . HOH L 9 .   ? 55.621 -33.005 5.077   1.00 33.64  ? 764 HOH A O     1 
HETATM 4044 O  O     . HOH L 9 .   ? 42.272 -18.930 14.783  1.00 21.60  ? 765 HOH A O     1 
HETATM 4045 O  O     . HOH L 9 .   ? 62.046 16.163  2.514   1.00 28.07  ? 766 HOH A O     1 
HETATM 4046 O  O     . HOH L 9 .   ? 61.062 -15.795 13.647  1.00 27.10  ? 767 HOH A O     1 
HETATM 4047 O  O     . HOH L 9 .   ? 42.595 13.207  -23.749 1.00 32.89  ? 768 HOH A O     1 
HETATM 4048 O  O     . HOH L 9 .   ? 62.296 -25.511 4.883   1.00 27.06  ? 769 HOH A O     1 
HETATM 4049 O  O     . HOH L 9 .   ? 39.682 18.677  18.193  1.00 24.56  ? 770 HOH A O     1 
HETATM 4050 O  O     . HOH L 9 .   ? 53.268 -19.976 -5.362  1.00 28.19  ? 771 HOH A O     1 
HETATM 4051 O  O     . HOH L 9 .   ? 39.738 7.115   13.598  1.00 27.38  ? 772 HOH A O     1 
HETATM 4052 O  O     . HOH L 9 .   ? 52.888 -19.862 22.235  1.00 28.30  ? 773 HOH A O     1 
HETATM 4053 O  O     . HOH L 9 .   ? 34.038 15.585  18.771  1.00 33.69  ? 774 HOH A O     1 
HETATM 4054 O  O     . HOH L 9 .   ? 53.514 19.304  -1.445  1.00 22.78  ? 775 HOH A O     1 
HETATM 4055 O  O     . HOH L 9 .   ? 46.394 -9.667  10.890  1.00 27.95  ? 776 HOH A O     1 
HETATM 4056 O  O     . HOH L 9 .   ? 70.139 -18.685 -9.674  1.00 35.59  ? 777 HOH A O     1 
HETATM 4057 O  O     . HOH L 9 .   ? 48.919 13.704  28.341  1.00 28.25  ? 778 HOH A O     1 
HETATM 4058 O  O     . HOH L 9 .   ? 47.594 16.100  -18.118 1.00 35.40  ? 779 HOH A O     1 
HETATM 4059 O  O     . HOH L 9 .   ? 60.681 -28.542 8.147   1.00 23.83  ? 780 HOH A O     1 
HETATM 4060 O  O     . HOH L 9 .   ? 51.639 -35.272 7.868   1.00 26.13  ? 781 HOH A O     1 
HETATM 4061 O  O     . HOH L 9 .   ? 62.708 11.715  5.617   1.00 29.32  ? 782 HOH A O     1 
HETATM 4062 O  O     . HOH L 9 .   ? 60.489 6.313   -15.712 1.00 21.95  ? 783 HOH A O     1 
HETATM 4063 O  O     . HOH L 9 .   ? 46.858 19.433  1.371   1.00 19.06  ? 784 HOH A O     1 
HETATM 4064 O  O     . HOH L 9 .   ? 50.894 17.770  -5.984  1.00 26.89  ? 785 HOH A O     1 
HETATM 4065 O  O     . HOH L 9 .   ? 36.130 10.943  10.236  1.00 25.94  ? 786 HOH A O     1 
HETATM 4066 O  O     . HOH L 9 .   ? 56.820 21.659  18.041  1.00 27.00  ? 787 HOH A O     1 
HETATM 4067 O  O     . HOH L 9 .   ? 35.436 22.516  -3.218  1.00 34.34  ? 788 HOH A O     1 
HETATM 4068 O  O     . HOH L 9 .   ? 51.250 -8.726  -5.354  1.00 23.52  ? 789 HOH A O     1 
HETATM 4069 O  O     . HOH L 9 .   ? 63.157 -7.360  12.826  1.00 27.12  ? 790 HOH A O     1 
HETATM 4070 O  O     . HOH L 9 .   ? 52.244 -17.963 -11.115 1.00 29.30  ? 791 HOH A O     1 
HETATM 4071 O  O     . HOH L 9 .   ? 48.552 20.067  4.869   1.00 28.56  ? 792 HOH A O     1 
HETATM 4072 O  O     . HOH L 9 .   ? 58.067 -0.253  -14.594 1.00 30.30  ? 793 HOH A O     1 
HETATM 4073 O  O     . HOH L 9 .   ? 68.879 -10.845 12.311  1.00 25.60  ? 794 HOH A O     1 
HETATM 4074 O  O     . HOH L 9 .   ? 48.324 -17.913 17.137  1.00 25.92  ? 795 HOH A O     1 
HETATM 4075 O  O     . HOH L 9 .   ? 24.522 16.473  3.304   1.00 29.56  ? 796 HOH A O     1 
HETATM 4076 O  O     . HOH L 9 .   ? 49.608 8.424   -13.663 1.00 22.90  ? 797 HOH A O     1 
HETATM 4077 O  O     . HOH L 9 .   ? 58.232 -27.450 11.256  1.00 20.37  ? 798 HOH A O     1 
HETATM 4078 O  O     . HOH L 9 .   ? 41.134 -3.064  -23.212 1.00 26.03  ? 799 HOH A O     1 
HETATM 4079 O  O     . HOH L 9 .   ? 59.765 -31.406 3.769   1.00 25.99  ? 800 HOH A O     1 
HETATM 4080 O  O     . HOH L 9 .   ? 52.974 -12.624 -4.123  1.00 22.51  ? 801 HOH A O     1 
HETATM 4081 O  O     . HOH L 9 .   ? 53.119 -26.339 -4.020  1.00 22.51  ? 802 HOH A O     1 
HETATM 4082 O  O     . HOH L 9 .   ? 49.587 -9.152  -8.409  1.00 26.81  ? 803 HOH A O     1 
HETATM 4083 O  O     . HOH L 9 .   ? 53.828 -8.526  8.704   1.00 30.11  ? 804 HOH A O     1 
HETATM 4084 O  O     . HOH L 9 .   ? 22.045 11.782  -9.376  1.00 30.14  ? 805 HOH A O     1 
HETATM 4085 O  O     . HOH L 9 .   ? 66.097 -25.863 0.495   1.00 28.79  ? 806 HOH A O     1 
HETATM 4086 O  O     . HOH L 9 .   ? 48.427 -33.404 -3.710  1.00 30.93  ? 807 HOH A O     1 
HETATM 4087 O  O     . HOH L 9 .   ? 56.604 -3.296  4.830   1.00 30.34  ? 808 HOH A O     1 
HETATM 4088 O  O     . HOH L 9 .   ? 35.447 20.823  0.346   1.00 26.64  ? 809 HOH A O     1 
HETATM 4089 O  O     . HOH L 9 .   ? 52.255 -5.802  -0.923  1.00 25.01  ? 810 HOH A O     1 
HETATM 4090 O  O     . HOH L 9 .   ? 51.404 6.245   -19.111 1.00 31.54  ? 811 HOH A O     1 
HETATM 4091 O  O     . HOH L 9 .   ? 47.523 -16.618 -1.151  1.00 30.92  ? 812 HOH A O     1 
HETATM 4092 O  O     . HOH L 9 .   ? 70.541 -17.143 12.648  1.00 27.98  ? 813 HOH A O     1 
HETATM 4093 O  O     . HOH L 9 .   ? 42.371 15.538  -8.924  1.00 26.12  ? 814 HOH A O     1 
HETATM 4094 O  O     . HOH L 9 .   ? 54.596 -35.074 1.238   1.00 32.53  ? 815 HOH A O     1 
HETATM 4095 O  O     . HOH L 9 .   ? 52.642 8.359   25.726  1.00 29.36  ? 816 HOH A O     1 
HETATM 4096 O  O     . HOH L 9 .   ? 47.565 -20.061 18.311  1.00 29.97  ? 817 HOH A O     1 
HETATM 4097 O  O     . HOH L 9 .   ? 67.529 6.303   9.838   1.00 34.37  ? 818 HOH A O     1 
HETATM 4098 O  O     . HOH L 9 .   ? 82.531 -10.102 -0.712  1.00 35.03  ? 819 HOH A O     1 
HETATM 4099 O  O     . HOH L 9 .   ? 47.991 -19.074 -5.404  1.00 29.15  ? 820 HOH A O     1 
HETATM 4100 O  O     . HOH L 9 .   ? 61.369 -28.162 4.274   1.00 29.78  ? 821 HOH A O     1 
HETATM 4101 O  O     . HOH L 9 .   ? 69.695 10.228  -8.569  1.00 23.11  ? 822 HOH A O     1 
HETATM 4102 O  O     . HOH L 9 .   ? 57.828 23.452  14.214  1.00 22.81  ? 823 HOH A O     1 
HETATM 4103 O  O     . HOH L 9 .   ? 61.820 9.159   18.797  1.00 27.92  ? 824 HOH A O     1 
HETATM 4104 O  O     . HOH L 9 .   ? 81.216 -15.462 7.655   1.00 29.25  ? 825 HOH A O     1 
HETATM 4105 O  O     . HOH L 9 .   ? 45.770 8.006   -13.108 1.00 32.50  ? 826 HOH A O     1 
HETATM 4106 O  O     . HOH L 9 .   ? 50.333 -14.798 -3.387  1.00 37.28  ? 827 HOH A O     1 
HETATM 4107 O  O     . HOH L 9 .   ? 63.201 -23.853 3.172   1.00 23.87  ? 828 HOH A O     1 
HETATM 4108 O  O     . HOH L 9 .   ? 73.314 2.108   8.217   1.00 34.27  ? 829 HOH A O     1 
HETATM 4109 O  O     . HOH L 9 .   ? 71.254 -6.849  14.097  1.00 38.17  ? 830 HOH A O     1 
HETATM 4110 O  O     . HOH L 9 .   ? 42.193 -9.117  9.552   1.00 38.33  ? 831 HOH A O     1 
HETATM 4111 O  O     . HOH L 9 .   ? 68.489 -26.251 -0.797  1.00 26.41  ? 832 HOH A O     1 
HETATM 4112 O  O     . HOH L 9 .   ? 62.400 -6.766  -15.039 1.00 35.79  ? 833 HOH A O     1 
HETATM 4113 O  O     . HOH L 9 .   ? 56.388 1.240   13.101  1.00 26.29  ? 834 HOH A O     1 
HETATM 4114 O  O     . HOH L 9 .   ? 65.320 13.151  2.980   1.00 28.29  ? 835 HOH A O     1 
HETATM 4115 O  O     . HOH L 9 .   ? 63.564 -17.128 15.117  1.00 28.73  ? 836 HOH A O     1 
HETATM 4116 O  O     . HOH L 9 .   ? 40.848 -1.784  -16.445 1.00 26.56  ? 837 HOH A O     1 
HETATM 4117 O  O     . HOH L 9 .   ? 57.518 -16.357 -11.324 1.00 26.69  ? 838 HOH A O     1 
HETATM 4118 O  O     . HOH L 9 .   ? 59.985 14.417  3.217   1.00 26.34  ? 839 HOH A O     1 
HETATM 4119 O  O     . HOH L 9 .   ? 59.123 -24.587 -7.384  1.00 32.71  ? 840 HOH A O     1 
HETATM 4120 O  O     . HOH L 9 .   ? 76.566 -17.760 0.720   1.00 27.08  ? 841 HOH A O     1 
HETATM 4121 O  O     . HOH L 9 .   ? 42.970 17.433  -17.026 1.00 30.16  ? 842 HOH A O     1 
HETATM 4122 O  O     . HOH L 9 .   ? 54.030 -0.400  6.017   1.00 24.84  ? 843 HOH A O     1 
HETATM 4123 O  O     . HOH L 9 .   ? 55.593 -20.634 21.323  1.00 24.51  ? 844 HOH A O     1 
HETATM 4124 O  O     . HOH L 9 .   ? 34.531 17.450  -12.961 1.00 25.81  ? 845 HOH A O     1 
HETATM 4125 O  O     . HOH L 9 .   ? 61.138 9.853   7.217   1.00 30.87  ? 846 HOH A O     1 
HETATM 4126 O  O     . HOH L 9 .   ? 59.355 -18.418 -10.039 1.00 35.45  ? 847 HOH A O     1 
HETATM 4127 O  O     . HOH L 9 .   ? 43.527 17.711  -12.855 1.00 31.05  ? 848 HOH A O     1 
HETATM 4128 O  O     . HOH L 9 .   ? 70.263 -21.722 0.618   1.00 27.93  ? 849 HOH A O     1 
HETATM 4129 O  O     . HOH L 9 .   ? 76.515 0.846   -6.026  1.00 30.97  ? 850 HOH A O     1 
HETATM 4130 O  O     . HOH L 9 .   ? 69.757 5.340   1.369   1.00 32.45  ? 851 HOH A O     1 
HETATM 4131 O  O     . HOH L 9 .   ? 61.511 8.074   9.901   1.00 23.68  ? 852 HOH A O     1 
HETATM 4132 O  O     . HOH L 9 .   ? 71.922 -19.119 14.190  1.00 33.22  ? 853 HOH A O     1 
HETATM 4133 O  O     . HOH L 9 .   ? 44.264 -33.388 5.838   1.00 31.23  ? 854 HOH A O     1 
HETATM 4134 O  O     . HOH L 9 .   ? 50.311 -27.537 18.443  1.00 31.39  ? 855 HOH A O     1 
HETATM 4135 O  O     . HOH L 9 .   ? 34.648 6.094   -21.908 1.00 33.98  ? 856 HOH A O     1 
HETATM 4136 O  O     . HOH L 9 .   ? 27.498 20.736  -6.650  1.00 33.82  ? 857 HOH A O     1 
HETATM 4137 O  O     . HOH L 9 .   ? 46.976 -30.809 13.451  1.00 32.98  ? 858 HOH A O     1 
HETATM 4138 O  O     . HOH L 9 .   ? 61.614 -31.577 -10.665 1.00 34.91  ? 859 HOH A O     1 
HETATM 4139 O  O     . HOH L 9 .   ? 61.905 24.214  9.904   1.00 31.53  ? 860 HOH A O     1 
HETATM 4140 O  O     . HOH L 9 .   ? 55.650 -0.619  8.874   1.00 27.57  ? 861 HOH A O     1 
HETATM 4141 O  O     . HOH L 9 .   ? 69.766 -8.788  10.956  1.00 23.04  ? 862 HOH A O     1 
HETATM 4142 O  O     . HOH L 9 .   ? 60.617 13.752  6.042   1.00 29.48  ? 863 HOH A O     1 
HETATM 4143 O  O     . HOH L 9 .   ? 49.976 -8.940  12.795  1.00 27.83  ? 864 HOH A O     1 
HETATM 4144 O  O     . HOH L 9 .   ? 50.138 -15.932 -9.178  1.00 31.99  ? 865 HOH A O     1 
HETATM 4145 O  O     . HOH L 9 .   ? 72.253 2.035   12.497  1.00 36.65  ? 866 HOH A O     1 
HETATM 4146 O  O     . HOH L 9 .   ? 57.664 0.391   10.756  1.00 31.51  ? 867 HOH A O     1 
HETATM 4147 O  O     . HOH L 9 .   ? 47.445 -0.313  -8.454  1.00 26.54  ? 868 HOH A O     1 
HETATM 4148 O  O     . HOH L 9 .   ? 49.692 -14.837 18.635  1.00 27.57  ? 869 HOH A O     1 
HETATM 4149 O  O     . HOH L 9 .   ? 73.453 4.632   -1.069  1.00 31.33  ? 870 HOH A O     1 
HETATM 4150 O  O     . HOH L 9 .   ? 81.396 -10.864 -8.464  1.00 38.48  ? 871 HOH A O     1 
HETATM 4151 O  O     . HOH L 9 .   ? 25.750 14.534  5.402   1.00 25.82  ? 872 HOH A O     1 
HETATM 4152 O  O     . HOH M 9 .   ? 40.765 11.459  -3.560  1.00 14.23  ? 101 HOH T O     1 
HETATM 4153 O  O     . HOH M 9 .   ? 41.016 -3.468  -9.349  1.00 27.13  ? 102 HOH T O     1 
HETATM 4154 O  O     . HOH M 9 .   ? 42.083 -19.893 -3.578  1.00 31.93  ? 103 HOH T O     1 
HETATM 4155 O  O     . HOH M 9 .   ? 36.085 11.080  0.943   1.00 22.81  ? 104 HOH T O     1 
HETATM 4156 O  O     . HOH M 9 .   ? 39.422 2.580   -7.159  1.00 29.28  ? 105 HOH T O     1 
HETATM 4157 O  O     . HOH M 9 .   ? 36.950 -23.118 -5.369  1.00 26.05  ? 106 HOH T O     1 
HETATM 4158 O  O     . HOH M 9 .   ? 35.246 5.809   18.179  1.00 35.97  ? 107 HOH T O     1 
HETATM 4159 O  O     . HOH M 9 .   ? 38.888 -2.365  -6.538  1.00 33.94  ? 108 HOH T O     1 
HETATM 4160 O  O     . HOH M 9 .   ? 42.178 -7.174  -10.654 1.00 32.53  ? 109 HOH T O     1 
HETATM 4161 O  O     . HOH M 9 .   ? 43.411 5.462   -9.025  1.00 25.04  ? 110 HOH T O     1 
HETATM 4162 O  O     . HOH M 9 .   ? 37.546 0.179   4.855   1.00 33.41  ? 111 HOH T O     1 
HETATM 4163 O  O     . HOH M 9 .   ? 31.284 -16.180 -4.521  1.00 27.38  ? 112 HOH T O     1 
HETATM 4164 O  O     . HOH M 9 .   ? 40.327 -0.489  8.087   1.00 37.04  ? 113 HOH T O     1 
HETATM 4165 O  O     . HOH M 9 .   ? 36.440 2.742   4.707   1.00 28.29  ? 114 HOH T O     1 
HETATM 4166 O  O     . HOH M 9 .   ? 37.631 -12.697 -11.329 1.00 27.19  ? 115 HOH T O     1 
HETATM 4167 O  O     . HOH M 9 .   ? 37.030 -2.890  -4.335  1.00 35.06  ? 116 HOH T O     1 
HETATM 4168 O  O     . HOH M 9 .   ? 36.588 -1.651  -1.259  1.00 31.86  ? 117 HOH T O     1 
HETATM 4169 O  O     A HOH N 9 .   ? 49.359 2.339   0.978   0.50 18.61  ? 201 HOH P O     1 
HETATM 4170 O  O     . HOH N 9 .   ? 49.637 -10.121 6.547   1.00 12.58  ? 202 HOH P O     1 
HETATM 4171 O  O     . HOH N 9 .   ? 43.012 -9.149  7.024   1.00 18.85  ? 203 HOH P O     1 
HETATM 4172 O  O     . HOH N 9 .   ? 44.356 -12.930 -0.413  1.00 21.57  ? 204 HOH P O     1 
HETATM 4173 O  O     . HOH N 9 .   ? 41.604 -15.619 1.775   1.00 16.09  ? 205 HOH P O     1 
HETATM 4174 O  O     . HOH N 9 .   ? 42.018 -11.442 -1.128  1.00 25.46  ? 206 HOH P O     1 
HETATM 4175 O  O     . HOH N 9 .   ? 44.941 -8.248  -1.174  1.00 25.08  ? 207 HOH P O     1 
HETATM 4176 O  O     . HOH N 9 .   ? 44.521 7.325   2.234   1.00 16.93  ? 208 HOH P O     1 
HETATM 4177 O  O     . HOH N 9 .   ? 40.296 -5.440  5.640   1.00 27.80  ? 209 HOH P O     1 
HETATM 4178 O  O     . HOH N 9 .   ? 46.247 3.949   0.793   1.00 29.75  ? 210 HOH P O     1 
HETATM 4179 O  O     . HOH N 9 .   ? 40.627 -9.237  5.708   1.00 25.23  ? 211 HOH P O     1 
HETATM 4180 O  O     . HOH N 9 .   ? 47.973 -1.950  6.922   1.00 30.85  ? 212 HOH P O     1 
HETATM 4181 O  O     . HOH N 9 .   ? 40.254 -13.996 -0.152  1.00 30.77  ? 213 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   501 501 MG  MG  A . 
E 5 CA  1   502 502 CA  CA  A . 
F 4 MG  1   503 502 MG  MG  A . 
G 6 GOL 1   507 436 GOL GOL A . 
H 6 GOL 1   508 439 GOL GOL A . 
I 7 DTP 1   504 9   DTP DTP P . 
J 8 DPO 1   505 9   DPO DPO P . 
K 4 MG  1   506 9   MG  MG  P . 
L 9 HOH 1   601 61  HOH HOH A . 
L 9 HOH 2   602 61  HOH HOH A . 
L 9 HOH 3   603 61  HOH HOH A . 
L 9 HOH 4   604 1   HOH HOH A . 
L 9 HOH 5   605 2   HOH HOH A . 
L 9 HOH 6   606 3   HOH HOH A . 
L 9 HOH 7   607 4   HOH HOH A . 
L 9 HOH 8   608 5   HOH HOH A . 
L 9 HOH 9   609 6   HOH HOH A . 
L 9 HOH 10  610 7   HOH HOH A . 
L 9 HOH 11  611 8   HOH HOH A . 
L 9 HOH 12  612 9   HOH HOH A . 
L 9 HOH 13  613 10  HOH HOH A . 
L 9 HOH 14  614 11  HOH HOH A . 
L 9 HOH 15  615 12  HOH HOH A . 
L 9 HOH 16  616 14  HOH HOH A . 
L 9 HOH 17  617 15  HOH HOH A . 
L 9 HOH 18  618 16  HOH HOH A . 
L 9 HOH 19  619 17  HOH HOH A . 
L 9 HOH 20  620 18  HOH HOH A . 
L 9 HOH 21  621 19  HOH HOH A . 
L 9 HOH 22  622 21  HOH HOH A . 
L 9 HOH 23  623 24  HOH HOH A . 
L 9 HOH 24  624 26  HOH HOH A . 
L 9 HOH 25  625 27  HOH HOH A . 
L 9 HOH 26  626 28  HOH HOH A . 
L 9 HOH 27  627 29  HOH HOH A . 
L 9 HOH 28  628 30  HOH HOH A . 
L 9 HOH 29  629 31  HOH HOH A . 
L 9 HOH 30  630 32  HOH HOH A . 
L 9 HOH 31  631 33  HOH HOH A . 
L 9 HOH 32  632 34  HOH HOH A . 
L 9 HOH 33  633 35  HOH HOH A . 
L 9 HOH 34  634 36  HOH HOH A . 
L 9 HOH 35  635 37  HOH HOH A . 
L 9 HOH 36  636 38  HOH HOH A . 
L 9 HOH 37  637 39  HOH HOH A . 
L 9 HOH 38  638 40  HOH HOH A . 
L 9 HOH 39  639 41  HOH HOH A . 
L 9 HOH 40  640 42  HOH HOH A . 
L 9 HOH 41  641 43  HOH HOH A . 
L 9 HOH 42  642 44  HOH HOH A . 
L 9 HOH 43  643 45  HOH HOH A . 
L 9 HOH 44  644 46  HOH HOH A . 
L 9 HOH 45  645 47  HOH HOH A . 
L 9 HOH 46  646 48  HOH HOH A . 
L 9 HOH 47  647 49  HOH HOH A . 
L 9 HOH 48  648 50  HOH HOH A . 
L 9 HOH 49  649 51  HOH HOH A . 
L 9 HOH 50  650 52  HOH HOH A . 
L 9 HOH 51  651 53  HOH HOH A . 
L 9 HOH 52  652 54  HOH HOH A . 
L 9 HOH 53  653 55  HOH HOH A . 
L 9 HOH 54  654 56  HOH HOH A . 
L 9 HOH 55  655 57  HOH HOH A . 
L 9 HOH 56  656 58  HOH HOH A . 
L 9 HOH 57  657 60  HOH HOH A . 
L 9 HOH 58  658 61  HOH HOH A . 
L 9 HOH 59  659 62  HOH HOH A . 
L 9 HOH 60  660 63  HOH HOH A . 
L 9 HOH 61  661 64  HOH HOH A . 
L 9 HOH 62  662 65  HOH HOH A . 
L 9 HOH 63  663 66  HOH HOH A . 
L 9 HOH 64  664 67  HOH HOH A . 
L 9 HOH 65  665 68  HOH HOH A . 
L 9 HOH 66  666 69  HOH HOH A . 
L 9 HOH 67  667 70  HOH HOH A . 
L 9 HOH 68  668 71  HOH HOH A . 
L 9 HOH 69  669 72  HOH HOH A . 
L 9 HOH 70  670 73  HOH HOH A . 
L 9 HOH 71  671 74  HOH HOH A . 
L 9 HOH 72  672 75  HOH HOH A . 
L 9 HOH 73  673 76  HOH HOH A . 
L 9 HOH 74  674 77  HOH HOH A . 
L 9 HOH 75  675 78  HOH HOH A . 
L 9 HOH 76  676 80  HOH HOH A . 
L 9 HOH 77  677 81  HOH HOH A . 
L 9 HOH 78  678 82  HOH HOH A . 
L 9 HOH 79  679 83  HOH HOH A . 
L 9 HOH 80  680 84  HOH HOH A . 
L 9 HOH 81  681 85  HOH HOH A . 
L 9 HOH 82  682 86  HOH HOH A . 
L 9 HOH 83  683 87  HOH HOH A . 
L 9 HOH 84  684 88  HOH HOH A . 
L 9 HOH 85  685 89  HOH HOH A . 
L 9 HOH 86  686 91  HOH HOH A . 
L 9 HOH 87  687 95  HOH HOH A . 
L 9 HOH 88  688 96  HOH HOH A . 
L 9 HOH 89  689 97  HOH HOH A . 
L 9 HOH 90  690 98  HOH HOH A . 
L 9 HOH 91  691 99  HOH HOH A . 
L 9 HOH 92  692 100 HOH HOH A . 
L 9 HOH 93  693 101 HOH HOH A . 
L 9 HOH 94  694 102 HOH HOH A . 
L 9 HOH 95  695 103 HOH HOH A . 
L 9 HOH 96  696 104 HOH HOH A . 
L 9 HOH 97  697 105 HOH HOH A . 
L 9 HOH 98  698 106 HOH HOH A . 
L 9 HOH 99  699 107 HOH HOH A . 
L 9 HOH 100 700 108 HOH HOH A . 
L 9 HOH 101 701 110 HOH HOH A . 
L 9 HOH 102 702 111 HOH HOH A . 
L 9 HOH 103 703 112 HOH HOH A . 
L 9 HOH 104 704 113 HOH HOH A . 
L 9 HOH 105 705 114 HOH HOH A . 
L 9 HOH 106 706 115 HOH HOH A . 
L 9 HOH 107 707 116 HOH HOH A . 
L 9 HOH 108 708 118 HOH HOH A . 
L 9 HOH 109 709 119 HOH HOH A . 
L 9 HOH 110 710 120 HOH HOH A . 
L 9 HOH 111 711 121 HOH HOH A . 
L 9 HOH 112 712 122 HOH HOH A . 
L 9 HOH 113 713 125 HOH HOH A . 
L 9 HOH 114 714 126 HOH HOH A . 
L 9 HOH 115 715 128 HOH HOH A . 
L 9 HOH 116 716 129 HOH HOH A . 
L 9 HOH 117 717 130 HOH HOH A . 
L 9 HOH 118 718 131 HOH HOH A . 
L 9 HOH 119 719 132 HOH HOH A . 
L 9 HOH 120 720 133 HOH HOH A . 
L 9 HOH 121 721 134 HOH HOH A . 
L 9 HOH 122 722 135 HOH HOH A . 
L 9 HOH 123 723 136 HOH HOH A . 
L 9 HOH 124 724 137 HOH HOH A . 
L 9 HOH 125 725 138 HOH HOH A . 
L 9 HOH 126 726 139 HOH HOH A . 
L 9 HOH 127 727 141 HOH HOH A . 
L 9 HOH 128 728 142 HOH HOH A . 
L 9 HOH 129 729 143 HOH HOH A . 
L 9 HOH 130 730 144 HOH HOH A . 
L 9 HOH 131 731 145 HOH HOH A . 
L 9 HOH 132 732 146 HOH HOH A . 
L 9 HOH 133 733 147 HOH HOH A . 
L 9 HOH 134 734 148 HOH HOH A . 
L 9 HOH 135 735 149 HOH HOH A . 
L 9 HOH 136 736 151 HOH HOH A . 
L 9 HOH 137 737 152 HOH HOH A . 
L 9 HOH 138 738 153 HOH HOH A . 
L 9 HOH 139 739 154 HOH HOH A . 
L 9 HOH 140 740 155 HOH HOH A . 
L 9 HOH 141 741 156 HOH HOH A . 
L 9 HOH 142 742 157 HOH HOH A . 
L 9 HOH 143 743 158 HOH HOH A . 
L 9 HOH 144 744 159 HOH HOH A . 
L 9 HOH 145 745 160 HOH HOH A . 
L 9 HOH 146 746 161 HOH HOH A . 
L 9 HOH 147 747 162 HOH HOH A . 
L 9 HOH 148 748 163 HOH HOH A . 
L 9 HOH 149 749 164 HOH HOH A . 
L 9 HOH 150 750 165 HOH HOH A . 
L 9 HOH 151 751 167 HOH HOH A . 
L 9 HOH 152 752 168 HOH HOH A . 
L 9 HOH 153 753 169 HOH HOH A . 
L 9 HOH 154 754 170 HOH HOH A . 
L 9 HOH 155 755 171 HOH HOH A . 
L 9 HOH 156 756 172 HOH HOH A . 
L 9 HOH 157 757 173 HOH HOH A . 
L 9 HOH 158 758 174 HOH HOH A . 
L 9 HOH 159 759 175 HOH HOH A . 
L 9 HOH 160 760 176 HOH HOH A . 
L 9 HOH 161 761 177 HOH HOH A . 
L 9 HOH 162 762 180 HOH HOH A . 
L 9 HOH 163 763 181 HOH HOH A . 
L 9 HOH 164 764 182 HOH HOH A . 
L 9 HOH 165 765 183 HOH HOH A . 
L 9 HOH 166 766 184 HOH HOH A . 
L 9 HOH 167 767 185 HOH HOH A . 
L 9 HOH 168 768 186 HOH HOH A . 
L 9 HOH 169 769 187 HOH HOH A . 
L 9 HOH 170 770 188 HOH HOH A . 
L 9 HOH 171 771 189 HOH HOH A . 
L 9 HOH 172 772 190 HOH HOH A . 
L 9 HOH 173 773 191 HOH HOH A . 
L 9 HOH 174 774 192 HOH HOH A . 
L 9 HOH 175 775 193 HOH HOH A . 
L 9 HOH 176 776 194 HOH HOH A . 
L 9 HOH 177 777 195 HOH HOH A . 
L 9 HOH 178 778 196 HOH HOH A . 
L 9 HOH 179 779 197 HOH HOH A . 
L 9 HOH 180 780 198 HOH HOH A . 
L 9 HOH 181 781 199 HOH HOH A . 
L 9 HOH 182 782 200 HOH HOH A . 
L 9 HOH 183 783 201 HOH HOH A . 
L 9 HOH 184 784 202 HOH HOH A . 
L 9 HOH 185 785 203 HOH HOH A . 
L 9 HOH 186 786 205 HOH HOH A . 
L 9 HOH 187 787 206 HOH HOH A . 
L 9 HOH 188 788 207 HOH HOH A . 
L 9 HOH 189 789 208 HOH HOH A . 
L 9 HOH 190 790 209 HOH HOH A . 
L 9 HOH 191 791 210 HOH HOH A . 
L 9 HOH 192 792 211 HOH HOH A . 
L 9 HOH 193 793 212 HOH HOH A . 
L 9 HOH 194 794 213 HOH HOH A . 
L 9 HOH 195 795 214 HOH HOH A . 
L 9 HOH 196 796 215 HOH HOH A . 
L 9 HOH 197 797 216 HOH HOH A . 
L 9 HOH 198 798 217 HOH HOH A . 
L 9 HOH 199 799 218 HOH HOH A . 
L 9 HOH 200 800 220 HOH HOH A . 
L 9 HOH 201 801 221 HOH HOH A . 
L 9 HOH 202 802 222 HOH HOH A . 
L 9 HOH 203 803 229 HOH HOH A . 
L 9 HOH 204 804 230 HOH HOH A . 
L 9 HOH 205 805 231 HOH HOH A . 
L 9 HOH 206 806 232 HOH HOH A . 
L 9 HOH 207 807 233 HOH HOH A . 
L 9 HOH 208 808 234 HOH HOH A . 
L 9 HOH 209 809 235 HOH HOH A . 
L 9 HOH 210 810 236 HOH HOH A . 
L 9 HOH 211 811 238 HOH HOH A . 
L 9 HOH 212 812 239 HOH HOH A . 
L 9 HOH 213 813 240 HOH HOH A . 
L 9 HOH 214 814 241 HOH HOH A . 
L 9 HOH 215 815 242 HOH HOH A . 
L 9 HOH 216 816 243 HOH HOH A . 
L 9 HOH 217 817 244 HOH HOH A . 
L 9 HOH 218 818 246 HOH HOH A . 
L 9 HOH 219 819 247 HOH HOH A . 
L 9 HOH 220 820 248 HOH HOH A . 
L 9 HOH 221 821 249 HOH HOH A . 
L 9 HOH 222 822 250 HOH HOH A . 
L 9 HOH 223 823 251 HOH HOH A . 
L 9 HOH 224 824 252 HOH HOH A . 
L 9 HOH 225 825 255 HOH HOH A . 
L 9 HOH 226 826 256 HOH HOH A . 
L 9 HOH 227 827 257 HOH HOH A . 
L 9 HOH 228 828 258 HOH HOH A . 
L 9 HOH 229 829 259 HOH HOH A . 
L 9 HOH 230 830 261 HOH HOH A . 
L 9 HOH 231 831 262 HOH HOH A . 
L 9 HOH 232 832 263 HOH HOH A . 
L 9 HOH 233 833 264 HOH HOH A . 
L 9 HOH 234 834 265 HOH HOH A . 
L 9 HOH 235 835 266 HOH HOH A . 
L 9 HOH 236 836 267 HOH HOH A . 
L 9 HOH 237 837 269 HOH HOH A . 
L 9 HOH 238 838 270 HOH HOH A . 
L 9 HOH 239 839 271 HOH HOH A . 
L 9 HOH 240 840 272 HOH HOH A . 
L 9 HOH 241 841 273 HOH HOH A . 
L 9 HOH 242 842 274 HOH HOH A . 
L 9 HOH 243 843 275 HOH HOH A . 
L 9 HOH 244 844 277 HOH HOH A . 
L 9 HOH 245 845 278 HOH HOH A . 
L 9 HOH 246 846 279 HOH HOH A . 
L 9 HOH 247 847 280 HOH HOH A . 
L 9 HOH 248 848 281 HOH HOH A . 
L 9 HOH 249 849 283 HOH HOH A . 
L 9 HOH 250 850 284 HOH HOH A . 
L 9 HOH 251 851 285 HOH HOH A . 
L 9 HOH 252 852 288 HOH HOH A . 
L 9 HOH 253 853 290 HOH HOH A . 
L 9 HOH 254 854 291 HOH HOH A . 
L 9 HOH 255 855 292 HOH HOH A . 
L 9 HOH 256 856 293 HOH HOH A . 
L 9 HOH 257 857 294 HOH HOH A . 
L 9 HOH 258 858 295 HOH HOH A . 
L 9 HOH 259 859 296 HOH HOH A . 
L 9 HOH 260 860 297 HOH HOH A . 
L 9 HOH 261 861 298 HOH HOH A . 
L 9 HOH 262 862 302 HOH HOH A . 
L 9 HOH 263 863 303 HOH HOH A . 
L 9 HOH 264 864 305 HOH HOH A . 
L 9 HOH 265 865 306 HOH HOH A . 
L 9 HOH 266 866 307 HOH HOH A . 
L 9 HOH 267 867 308 HOH HOH A . 
L 9 HOH 268 868 309 HOH HOH A . 
L 9 HOH 269 869 310 HOH HOH A . 
L 9 HOH 270 870 311 HOH HOH A . 
L 9 HOH 271 871 312 HOH HOH A . 
L 9 HOH 272 872 314 HOH HOH A . 
M 9 HOH 1   101 25  HOH HOH T . 
M 9 HOH 2   102 90  HOH HOH T . 
M 9 HOH 3   103 94  HOH HOH T . 
M 9 HOH 4   104 109 HOH HOH T . 
M 9 HOH 5   105 117 HOH HOH T . 
M 9 HOH 6   106 127 HOH HOH T . 
M 9 HOH 7   107 166 HOH HOH T . 
M 9 HOH 8   108 178 HOH HOH T . 
M 9 HOH 9   109 219 HOH HOH T . 
M 9 HOH 10  110 228 HOH HOH T . 
M 9 HOH 11  111 245 HOH HOH T . 
M 9 HOH 12  112 254 HOH HOH T . 
M 9 HOH 13  113 260 HOH HOH T . 
M 9 HOH 14  114 282 HOH HOH T . 
M 9 HOH 15  115 286 HOH HOH T . 
M 9 HOH 16  116 299 HOH HOH T . 
M 9 HOH 17  117 304 HOH HOH T . 
N 9 HOH 1   201 8   HOH HOH P . 
N 9 HOH 2   202 22  HOH HOH P . 
N 9 HOH 3   203 59  HOH HOH P . 
N 9 HOH 4   204 92  HOH HOH P . 
N 9 HOH 5   205 93  HOH HOH P . 
N 9 HOH 6   206 123 HOH HOH P . 
N 9 HOH 7   207 124 HOH HOH P . 
N 9 HOH 8   208 150 HOH HOH P . 
N 9 HOH 9   209 204 HOH HOH P . 
N 9 HOH 10  210 227 HOH HOH P . 
N 9 HOH 11  211 276 HOH HOH P . 
N 9 HOH 12  212 287 HOH HOH P . 
N 9 HOH 13  213 289 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6520  ? 
1 MORE         -77   ? 
1 'SSA (A^2)'  21600 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 105.7 ? 
2  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   A I DTP .   ? P DTP 504 ? 1_555 97.3  ? 
3  OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   A I DTP .   ? P DTP 504 ? 1_555 9.3   ? 
4  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 87.1  ? 
5  OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 90.0  ? 
6  O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 93.6  ? 
7  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 604 ? 1_555 93.3  ? 
8  OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 604 ? 1_555 83.0  ? 
9  O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 604 ? 1_555 79.3  ? 
10 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 604 ? 1_555 172.8 ? 
11 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 103.3 ? 
12 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 150.0 ? 
13 O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 156.3 ? 
14 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 98.9  ? 
15 O     ? L HOH .   ? A HOH 604 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 88.0  ? 
16 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 171.7 ? 
17 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 78.6  ? 
18 O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 87.4  ? 
19 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 85.8  ? 
20 O     ? L HOH .   ? A HOH 604 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 94.4  ? 
21 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 73.6  ? 
22 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 170.1 ? 
23 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 65.5  ? 
24 O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 74.2  ? 
25 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 88.3  ? 
26 O     ? L HOH .   ? A HOH 604 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 90.2  ? 
27 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 86.1  ? 
28 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 13.3  ? 
29 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   A I DTP .   ? P DTP 504 ? 1_555 86.3  ? 
30 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   A I DTP .   ? P DTP 504 ? 1_555 80.3  ? 
31 O2A   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   A I DTP .   ? P DTP 504 ? 1_555 89.2  ? 
32 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 178.0 ? 
33 O2A   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 92.7  ? 
34 O3G   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 97.9  ? 
35 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 91.7  ? 
36 O2A   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 91.6  ? 
37 O3G   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 171.9 ? 
38 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 90.1  ? 
39 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 91.6  ? 
40 O2A   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 172.4 ? 
41 O3G   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 97.6  ? 
42 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 89.6  ? 
43 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 81.1  ? 
44 O1    B J DPO .   ? P DPO 505 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 OP2   B C DA  9   ? P DA  9   ? 1_555 84.8  ? 
45 O1    B J DPO .   ? P DPO 505 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 644 ? 1_555 95.0  ? 
46 OP2   B C DA  9   ? P DA  9   ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 644 ? 1_555 166.3 ? 
47 O1    B J DPO .   ? P DPO 505 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     B L HOH .   ? A HOH 601 ? 1_555 91.2  ? 
48 OP2   B C DA  9   ? P DA  9   ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     B L HOH .   ? A HOH 601 ? 1_555 80.2  ? 
49 O     ? L HOH .   ? A HOH 644 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     B L HOH .   ? A HOH 601 ? 1_555 86.2  ? 
50 O1    B J DPO .   ? P DPO 505 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 843 ? 1_555 100.2 ? 
51 OP2   B C DA  9   ? P DA  9   ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 843 ? 1_555 100.2 ? 
52 O     ? L HOH .   ? A HOH 644 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 843 ? 1_555 93.3  ? 
53 O     B L HOH .   ? A HOH 601 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 843 ? 1_555 168.6 ? 
54 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O2    B J DPO .   ? P DPO 505 ? 1_555 80.4  ? 
55 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 78.9  ? 
56 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 154.9 ? 
57 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 169.9 ? 
58 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 89.6  ? 
59 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 110.3 ? 
60 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 97.7  ? 
61 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 88.9  ? 
62 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 80.0  ? 
63 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 80.3  ? 
64 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 93.8  ? 
65 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 84.2  ? 
66 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 111.1 ? 
67 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 86.9  ? 
68 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 165.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ECU 
_pdbx_entry_details.nonpolymer_details   'CA A 502 AND MG A 503 ARE IN ALTERNATE CONFORMATIONS OF EACH OTHER.' 
_pdbx_entry_details.sequence_details     
;ARG A 61 HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS ARG 61 (OCCUPANCY 0.50) + HOH A 603
ALTERNATE B HAS ARG 61 (OCCUPANCY 0.50) + HOH A 601 + HOH A 602
CHAIN P HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS DT 8 + DTP 504 + HOH P 201, 
ALTERNATE B HAS DT 8 + DA 9 + DPO 505 + MG 506.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 7  ? ? "C1'" T DG 7  ? ? N9    T DG 7  ? ? 111.71 108.30 3.41  0.30 N 
2 1 "O4'" T DA 8  ? ? "C1'" T DA 8  ? ? N9    T DA 8  ? ? 110.14 108.30 1.84  0.30 N 
3 1 "O4'" T DC 9  ? ? "C1'" T DC 9  ? ? N1    T DC 9  ? ? 110.68 108.30 2.38  0.30 N 
4 1 "O4'" T DT 12 ? ? "C1'" T DT 12 ? ? N1    T DT 12 ? ? 111.69 108.30 3.39  0.30 N 
5 1 "O4'" P DG 2  ? ? "C1'" P DG 2  ? ? N9    P DG 2  ? ? 110.14 108.30 1.84  0.30 N 
6 1 "O4'" P DA 7  ? ? "C4'" P DA 7  ? ? "C3'" P DA 7  ? ? 101.64 104.50 -2.86 0.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 21.44   67.65   
2 1 TYR A 39  ? ? 68.57   179.78  
3 1 LYS A 40  ? ? -158.64 -27.12  
4 1 SER A 62  ? ? 89.50   -10.08  
5 1 GLN A 133 ? ? 41.96   76.90   
6 1 SER A 217 ? ? -153.17 -158.85 
7 1 SER A 257 ? ? 96.66   -10.68  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLU 268 ? OE1   ? A GLU 271 OE1   
2  1 Y 1 T DC  1   ? "O5'" ? B DC  1   "O5'" 
3  1 Y 1 T DC  1   ? "C5'" ? B DC  1   "C5'" 
4  1 Y 1 T DC  1   ? "C4'" ? B DC  1   "C4'" 
5  1 Y 1 T DC  1   ? "O4'" ? B DC  1   "O4'" 
6  1 Y 1 T DC  1   ? "C3'" ? B DC  1   "C3'" 
7  1 Y 1 T DC  1   ? "C2'" ? B DC  1   "C2'" 
8  1 Y 1 T DC  1   ? "C1'" ? B DC  1   "C1'" 
9  1 Y 1 T DC  1   ? N1    ? B DC  1   N1    
10 1 Y 1 T DC  1   ? C2    ? B DC  1   C2    
11 1 Y 1 T DC  1   ? O2    ? B DC  1   O2    
12 1 Y 1 T DC  1   ? N3    ? B DC  1   N3    
13 1 Y 1 T DC  1   ? C4    ? B DC  1   C4    
14 1 Y 1 T DC  1   ? N4    ? B DC  1   N4    
15 1 Y 1 T DC  1   ? C5    ? B DC  1   C5    
16 1 Y 1 T DC  1   ? C6    ? B DC  1   C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ECU 'double helix'        
4ECU 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 -0.065 -0.238 0.300  0.460  -3.605  4.526  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.015 -0.072 0.249  -0.846 -15.929 2.612  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.234 -0.238 -0.430 -9.812 -4.607  -2.916 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.115  -0.130 -0.050 3.759  -1.326  0.962  4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.378  -0.199 -0.474 11.154 -7.990  -0.803 5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.563 -0.096 -0.122 -3.223 -6.383  4.633  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.142  -0.057 0.133  -6.362 -3.788  0.256  7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.245 -0.166 -0.206 17.745 0.267   4.386  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.826  -1.163 3.532 -0.935 1.059  26.263 -2.860 -2.085 3.452 2.329  2.057 
26.301 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.510 -1.224 3.446 6.113  10.500 29.053 -4.181 2.060  2.694 19.870 
-11.568 31.440 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.433 -0.434 3.105 -2.185 0.948  34.201 -0.877 0.408  3.113 1.609  3.710 
34.281 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.366  -0.740 3.261 3.917  0.821  30.535 -1.554 0.076  3.261 1.550  -7.398 
30.790 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.253 -0.604 3.824 -5.627 5.987  34.056 -2.050 -0.564 3.663 10.041 9.438 
35.005 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.509 -0.521 3.467 -1.682 0.519  37.029 -0.894 0.561  3.478 0.816  2.646 
37.069 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.464  0.037  2.906 -1.606 1.599  26.493 -0.291 -1.382 2.870 3.482  3.495 
26.588 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 DIPHOSPHATE                         DPO 
9 water                               HOH 
#