data_4ECW
# 
_entry.id   4ECW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ECW         
NDB   NA1706       
RCSB  RCSB071458   
WWPDB D_1000071458 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ECW 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ECW 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ECW 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ?                                     ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    3   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
9 water       nat water                                                18.015    464 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ECW       4ECW   2 ? ? ? 
3 PDB 4ECW       4ECW   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ECW A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ECW T 1 ? 12  ? 4ECW   1 ? 12  ? 1 12  
3 3 4ECW P 1 ? 9   ? 4ECW   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ECW GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ECW PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ECW HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ?                               'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ECW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ECW 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.896 
_reflns.number_obs                   35749 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.074 
_reflns.pdbx_netI_over_sigmaI        14.8 
_reflns.B_iso_Wilson_estimate        17.510 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.90 
_reflns_shell.d_res_low                   1.93 
_reflns_shell.percent_possible_all        98.7 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.383 
_reflns_shell.meanI_over_sigI_obs         2.8 
_reflns_shell.pdbx_redundancy             3.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ECW 
_refine.ls_number_reflns_obs                     35702 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.16 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.102 
_refine.ls_d_res_high                            1.896 
_refine.ls_percent_reflns_obs                    98.46 
_refine.ls_R_factor_obs                          0.1725 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1702 
_refine.ls_R_factor_R_free                       0.2152 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_number_reflns_R_free                  1790 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               23.5913 
_refine.aniso_B[1][1]                            -0.1618 
_refine.aniso_B[2][2]                            -0.1618 
_refine.aniso_B[3][3]                            0.3236 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.327 
_refine.solvent_model_param_bsol                 35.999 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.21 
_refine.overall_FOM_work_R_set                   0.8720 
_refine.B_iso_max                                98.740 
_refine.B_iso_min                                4.830 
_refine.pdbx_overall_phase_error                 20.4400 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.000 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3372 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
_refine_hist.pdbx_number_atoms_ligand         61 
_refine_hist.number_atoms_solvent             464 
_refine_hist.number_atoms_total               4305 
_refine_hist.d_res_high                       1.896 
_refine_hist.d_res_low                        30.102 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4007 0.011  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5488 1.110  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     611  0.070  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      628  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1546 18.643 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.8961 1.9474  13 86.0000  2254 . 0.1903 0.2283 . 122 . 2376 . 'X-RAY DIFFRACTION' . 
1.9474 2.0047  13 99.0000  2620 . 0.1789 0.2286 . 124 . 2744 . 'X-RAY DIFFRACTION' . 
2.0047 2.0694  13 99.0000  2619 . 0.1840 0.2447 . 147 . 2766 . 'X-RAY DIFFRACTION' . 
2.0694 2.1433  13 99.0000  2635 . 0.1711 0.2146 . 132 . 2767 . 'X-RAY DIFFRACTION' . 
2.1433 2.2291  13 99.0000  2623 . 0.1608 0.2355 . 126 . 2749 . 'X-RAY DIFFRACTION' . 
2.2291 2.3305  13 100.0000 2603 . 0.1677 0.2083 . 167 . 2770 . 'X-RAY DIFFRACTION' . 
2.3305 2.4534  13 99.0000  2628 . 0.1694 0.2386 . 137 . 2765 . 'X-RAY DIFFRACTION' . 
2.4534 2.6070  13 100.0000 2664 . 0.1833 0.2572 . 123 . 2787 . 'X-RAY DIFFRACTION' . 
2.6070 2.8081  13 100.0000 2628 . 0.1827 0.2473 . 148 . 2776 . 'X-RAY DIFFRACTION' . 
2.8081 3.0905  13 100.0000 2641 . 0.1823 0.2215 . 149 . 2790 . 'X-RAY DIFFRACTION' . 
3.0905 3.5371  13 100.0000 2642 . 0.1616 0.1973 . 142 . 2784 . 'X-RAY DIFFRACTION' . 
3.5371 4.4540  13 100.0000 2666 . 0.1458 0.1851 . 137 . 2803 . 'X-RAY DIFFRACTION' . 
4.4540 30.1059 13 99.0000  2689 . 0.1677 0.1852 . 136 . 2825 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ECW 
_struct.title                     
'Human DNA polymerase eta - DNA ternary complex: Reaction in the AT crystal at pH 7.0 for 250 sec' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ECW 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 4 ? 
M N N 9 ? 
N N N 9 ? 
O N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLU A 161 ? VAL A 164 ? GLU A 158 VAL A 161 5 ? 4  
HELX_P HELX_P9  9  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P10 10 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P11 11 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P12 12 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P13 13 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P14 14 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P15 15 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P16 16 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P17 17 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P18 18 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P19 19 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P20 20 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P21 21 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P22 22 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD2   B ? ? 1_555 D MG  . MG  ? ? A ASP 13  A MG  501 1_555 ? ? ? ? ? ? ?            2.037 ? 
metalc2  metalc ? ? C DA  9   OP2   B ? ? 1_555 L MG  . MG  B ? P DA  9   P MG  506 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc3  metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O1B A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.112 ? 
metalc4  metalc ? ? C DA  9   OP1   B ? ? 1_555 D MG  . MG  ? ? P DA  9   A MG  501 1_555 ? ? ? ? ? ? ?            2.118 ? 
metalc5  metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O3G A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.139 ? 
metalc6  metalc ? ? D MG  .   MG    ? ? ? 1_555 M HOH . O   ? ? A MG  501 A HOH 604 1_555 ? ? ? ? ? ? ?            2.153 ? 
metalc7  metalc ? ? L MG  .   MG    B ? ? 1_555 M HOH . O   B ? P MG  506 A HOH 603 1_555 ? ? ? ? ? ? ?            2.156 ? 
metalc8  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MG  . MG  ? ? A GLU 116 A MG  501 1_555 ? ? ? ? ? ? ?            2.165 ? 
metalc9  metalc ? ? A ASP 16  OD1   B ? ? 1_555 F MG  . MG  B ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.174 ? 
metalc10 metalc ? ? F MG  .   MG    B ? ? 1_555 K DPO . O7  B ? A MG  503 P DPO 505 1_555 ? ? ? ? ? ? ?            2.178 ? 
metalc11 metalc ? ? F MG  .   MG    B ? ? 1_555 K DPO . O2  B ? A MG  503 P DPO 505 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc12 metalc ? ? D MG  .   MG    ? ? ? 1_555 J DTP . O2A A ? A MG  501 P DTP 504 1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc13 metalc ? ? K DPO .   O1    B ? ? 1_555 L MG  . MG  B ? P DPO 505 P MG  506 1_555 ? ? ? ? ? ? ?            2.207 ? 
metalc14 metalc ? ? A ASP 16  OD1   A ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.217 ? 
metalc15 metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O2A A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.225 ? 
metalc16 metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc17 metalc ? ? C DT  8   "O3'" A ? ? 1_555 D MG  . MG  ? ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.291 ? 
metalc18 metalc ? ? A MET 17  O     ? ? ? 1_555 F MG  . MG  B ? A MET 14  A MG  503 1_555 ? ? ? ? ? ? ?            2.293 ? 
metalc19 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D MG  . MG  ? ? A ASP 115 A MG  501 1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc20 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F MG  . MG  B ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc21 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc22 metalc ? ? C DA  9   OP1   B ? ? 1_555 F MG  . MG  B ? P DA  9   A MG  503 1_555 ? ? ? ? ? ? ?            2.428 ? 
metalc23 metalc ? ? C DT  8   "O3'" B ? ? 1_555 D MG  . MG  ? ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.455 ? 
metalc24 metalc ? ? L MG  .   MG    B ? ? 1_555 M HOH . O   ? ? P MG  506 A HOH 672 1_555 ? ? ? ? ? ? ?            2.644 ? 
metalc25 metalc ? ? L MG  .   MG    B ? ? 1_555 M HOH . O   ? ? P MG  506 A HOH 984 1_555 ? ? ? ? ? ? ?            2.659 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -0.27 
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -2.81 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -7.98 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 502'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 503'  
AC4 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE DTP P 504' 
AC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE DPO P 505' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG P 506'  
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 506' 
AC8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 507' 
AC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 508' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 9  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2   AC1 9  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3   AC1 9  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4   AC1 9  CA  E .   ? CA  A 502 . ? 1_555 ? 
5   AC1 9  MG  F .   ? MG  A 503 . ? 1_555 ? 
6   AC1 9  HOH M .   ? HOH A 604 . ? 1_555 ? 
7   AC1 9  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8   AC1 9  DA  C 9   ? DA  P 9   . ? 1_555 ? 
9   AC1 9  DTP J .   ? DTP P 504 . ? 1_555 ? 
10  AC2 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
11  AC2 7  MET A 17  ? MET A 14  . ? 1_555 ? 
12  AC2 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
13  AC2 7  MG  D .   ? MG  A 501 . ? 1_555 ? 
14  AC2 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
15  AC2 7  DTP J .   ? DTP P 504 . ? 1_555 ? 
16  AC2 7  DPO K .   ? DPO P 505 . ? 1_555 ? 
17  AC3 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
18  AC3 7  MET A 17  ? MET A 14  . ? 1_555 ? 
19  AC3 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
20  AC3 7  MG  D .   ? MG  A 501 . ? 1_555 ? 
21  AC3 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
22  AC3 7  DTP J .   ? DTP P 504 . ? 1_555 ? 
23  AC3 7  DPO K .   ? DPO P 505 . ? 1_555 ? 
24  AC4 29 ASP A 16  ? ASP A 13  . ? 1_555 ? 
25  AC4 29 MET A 17  ? MET A 14  . ? 1_555 ? 
26  AC4 29 ASP A 18  ? ASP A 15  . ? 1_555 ? 
27  AC4 29 CYS A 19  ? CYS A 16  . ? 1_555 ? 
28  AC4 29 PHE A 20  ? PHE A 17  . ? 1_555 ? 
29  AC4 29 PHE A 21  ? PHE A 18  . ? 1_555 ? 
30  AC4 29 ILE A 51  ? ILE A 48  . ? 1_555 ? 
31  AC4 29 ALA A 52  ? ALA A 49  . ? 1_555 ? 
32  AC4 29 TYR A 55  ? TYR A 52  . ? 1_555 ? 
33  AC4 29 ARG A 58  ? ARG A 55  . ? 1_555 ? 
34  AC4 29 ARG A 64  ? ARG A 61  . ? 1_555 ? 
35  AC4 29 ASP A 118 ? ASP A 115 . ? 1_555 ? 
36  AC4 29 LYS A 234 ? LYS A 231 . ? 1_555 ? 
37  AC4 29 MG  D .   ? MG  A 501 . ? 1_555 ? 
38  AC4 29 CA  E .   ? CA  A 502 . ? 1_555 ? 
39  AC4 29 MG  F .   ? MG  A 503 . ? 1_555 ? 
40  AC4 29 HOH M .   ? HOH A 602 . ? 1_555 ? 
41  AC4 29 HOH M .   ? HOH A 603 . ? 1_555 ? 
42  AC4 29 HOH M .   ? HOH A 604 . ? 1_555 ? 
43  AC4 29 HOH M .   ? HOH A 620 . ? 1_555 ? 
44  AC4 29 HOH M .   ? HOH A 672 . ? 1_555 ? 
45  AC4 29 HOH M .   ? HOH A 775 . ? 1_555 ? 
46  AC4 29 HOH M .   ? HOH A 984 . ? 1_555 ? 
47  AC4 29 HOH M .   ? HOH A 994 . ? 1_555 ? 
48  AC4 29 DT  C 8   ? DT  P 8   . ? 1_555 ? 
49  AC4 29 HOH O .   ? HOH P 206 . ? 1_555 ? 
50  AC4 29 DT  B 3   ? DT  T 3   . ? 1_555 ? 
51  AC4 29 DT  B 4   ? DT  T 4   . ? 1_555 ? 
52  AC4 29 DA  B 5   ? DA  T 5   . ? 1_555 ? 
53  AC5 19 ASP A 16  ? ASP A 13  . ? 1_555 ? 
54  AC5 19 MET A 17  ? MET A 14  . ? 1_555 ? 
55  AC5 19 ASP A 18  ? ASP A 15  . ? 1_555 ? 
56  AC5 19 CYS A 19  ? CYS A 16  . ? 1_555 ? 
57  AC5 19 PHE A 20  ? PHE A 17  . ? 1_555 ? 
58  AC5 19 TYR A 55  ? TYR A 52  . ? 1_555 ? 
59  AC5 19 ARG A 58  ? ARG A 55  . ? 1_555 ? 
60  AC5 19 ARG A 64  ? ARG A 61  . ? 1_555 ? 
61  AC5 19 ASP A 118 ? ASP A 115 . ? 1_555 ? 
62  AC5 19 LYS A 234 ? LYS A 231 . ? 1_555 ? 
63  AC5 19 CA  E .   ? CA  A 502 . ? 1_555 ? 
64  AC5 19 MG  F .   ? MG  A 503 . ? 1_555 ? 
65  AC5 19 HOH M .   ? HOH A 602 . ? 1_555 ? 
66  AC5 19 HOH M .   ? HOH A 620 . ? 1_555 ? 
67  AC5 19 HOH M .   ? HOH A 672 . ? 1_555 ? 
68  AC5 19 HOH M .   ? HOH A 984 . ? 1_555 ? 
69  AC5 19 HOH M .   ? HOH A 994 . ? 1_555 ? 
70  AC5 19 DA  C 9   ? DA  P 9   . ? 1_555 ? 
71  AC5 19 MG  L .   ? MG  P 506 . ? 1_555 ? 
72  AC6 6  ARG A 64  ? ARG A 61  . ? 1_555 ? 
73  AC6 6  HOH M .   ? HOH A 603 . ? 1_555 ? 
74  AC6 6  HOH M .   ? HOH A 672 . ? 1_555 ? 
75  AC6 6  HOH M .   ? HOH A 984 . ? 1_555 ? 
76  AC6 6  DA  C 9   ? DA  P 9   . ? 1_555 ? 
77  AC6 6  DPO K .   ? DPO P 505 . ? 1_555 ? 
78  AC7 9  ARG A 27  ? ARG A 24  . ? 6_545 ? 
79  AC7 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
80  AC7 9  PHE A 250 ? PHE A 247 . ? 1_555 ? 
81  AC7 9  SER A 251 ? SER A 248 . ? 1_555 ? 
82  AC7 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
83  AC7 9  GLU A 280 ? GLU A 277 . ? 1_555 ? 
84  AC7 9  HOH M .   ? HOH A 611 . ? 1_555 ? 
85  AC7 9  HOH M .   ? HOH A 633 . ? 1_555 ? 
86  AC7 9  HOH M .   ? HOH A 652 . ? 6_545 ? 
87  AC8 10 GLU A 97  ? GLU A 94  . ? 1_555 ? 
88  AC8 10 ALA A 98  ? ALA A 95  . ? 1_555 ? 
89  AC8 10 GLU A 101 ? GLU A 98  . ? 1_555 ? 
90  AC8 10 ARG A 306 ? ARG A 303 . ? 5_664 ? 
91  AC8 10 HOH M .   ? HOH A 643 . ? 1_555 ? 
92  AC8 10 HOH M .   ? HOH A 648 . ? 1_555 ? 
93  AC8 10 HOH M .   ? HOH A 738 . ? 5_664 ? 
94  AC8 10 HOH M .   ? HOH A 754 . ? 5_664 ? 
95  AC8 10 HOH M .   ? HOH A 795 . ? 5_664 ? 
96  AC8 10 HOH M .   ? HOH A 945 . ? 5_664 ? 
97  AC9 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
98  AC9 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
99  AC9 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
100 AC9 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
101 AC9 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
102 AC9 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
103 AC9 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
104 AC9 10 HOH M .   ? HOH A 824 . ? 1_555 ? 
105 AC9 10 HOH M .   ? HOH A 846 . ? 5_664 ? 
106 AC9 10 HOH M .   ? HOH A 850 . ? 5_664 ? 
# 
_database_PDB_matrix.entry_id          4ECW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ECW 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 66.136 -34.067 -3.374  1.00 42.17 ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.487 -34.106 -3.908  1.00 45.79 ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.730 -33.155 -5.070  1.00 41.33 ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.420 -31.966 -4.985  1.00 42.97 ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.281 -33.685 -6.173  1.00 44.38 ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.683 -32.925 -7.365  1.00 44.51 ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.519 -32.418 -8.224  1.00 45.18 ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.756 -31.682 -9.186  1.00 48.11 ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.506 -33.944 -8.157  1.00 46.31 ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.928 -35.266 -7.765  1.00 45.81 ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.563 -35.125 -6.313  1.00 43.99 ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.291 -32.803 -7.889  1.00 38.14 ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.124 -32.407 -8.683  1.00 43.02 ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.149 -31.487 -7.938  1.00 51.02 ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.203 -30.964 -8.535  1.00 43.16 ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.374 -33.644 -9.192  1.00 35.29 ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.262 -34.680 -9.806  1.00 36.42 ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.915 -34.488 -11.005 1.00 35.06 ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.605 -35.922 -9.385  1.00 32.67 ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.625 -35.565 -11.295 1.00 35.77 ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.452 -36.449 -10.329 1.00 33.75 ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.374 -31.296 -6.641  1.00 53.22 ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.482 -30.469 -5.828  1.00 55.01 ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.817 -28.978 -5.918  1.00 46.14 ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.782 -28.510 -5.311  1.00 41.96 ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.494 -30.930 -4.366  1.00 59.91 ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.661 -30.056 -3.432  1.00 70.93 ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 60.972 -29.799 -4.024  1.00 98.74 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 60.290 -28.770 -2.718  1.00 68.98 ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 63.011 -28.242 -6.680  1.00 48.36 ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.201 -26.804 -6.842  1.00 42.80 ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.199 -26.104 -5.486  1.00 38.09 ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.581 -26.577 -4.530  1.00 41.38 ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 62.135 -26.217 -7.758  1.00 42.27 ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.899 -24.979 -5.410  1.00 27.88 ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.128 -24.299 -4.141  1.00 25.81 ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.630 -22.854 -4.152  1.00 21.70 ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.862 -22.112 -3.197  1.00 23.92 ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.620 -24.290 -3.802  1.00 27.59 ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.340 -23.669 -4.876  1.00 29.15 ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.129 -25.720 -3.604  1.00 30.93 ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.957 -22.459 -5.233  1.00 24.71 ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.407 -21.115 -5.344  1.00 24.99 ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.480 -20.044 -5.295  1.00 24.14 ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.313 -19.018 -4.627  1.00 20.50 ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.586 -20.292 -5.995  1.00 14.33 ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.752 -19.404 -5.963  1.00 14.93 ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.094 -18.822 -7.338  1.00 16.62 ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.174 -18.267 -7.531  1.00 17.07 ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.972 -20.137 -5.384  1.00 14.28 ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.926 -20.312 -3.854  1.00 20.53 ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.167 -21.002 -3.315  1.00 15.42 ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 69.009 -20.389 -2.653  1.00 23.43 ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.289 -22.278 -3.599  1.00 19.16 ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.148 -18.935 -8.267  1.00 19.46 ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.309 -18.512 -9.658  1.00 21.16 ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.260 -16.992 -9.911  1.00 21.85 ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.775 -16.524 -10.917 1.00 24.31 ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.245 -19.205 -10.536 1.00 25.00 ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.821 -19.072 -9.968  1.00 28.88 ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.590 -19.420 -8.786  1.00 29.36 ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.919 -18.617 -10.704 1.00 38.61 ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.644 -16.231 -9.014  1.00 18.04 ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.455 -14.787 -9.221  1.00 17.72 ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.068 -13.947 -8.108  1.00 15.82 ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.336 -14.451 -7.019  1.00 13.26 ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.962 -14.454 -9.275  1.00 13.90 ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.167 -15.103 -10.397 1.00 18.84 ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.685 -14.689 -10.282 1.00 14.83 ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.009 -15.333 -9.155  1.00 12.96 ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.945 -14.836 -8.522  1.00 11.94 ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.392 -15.511 -7.519  1.00 9.80  ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.422 -13.672 -8.892  1.00 12.89 ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.289 -12.660 -8.379  1.00 11.91 ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.593 -11.700 -7.322  1.00 7.57  ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.468 -10.666 -7.357  1.00 9.48  ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.242 -10.025 -8.389  1.00 12.03 ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.967 -11.004 -7.495  1.00 11.07 ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.190 -9.977  -6.390  1.00 9.37  ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.104 -12.013 -7.528  1.00 9.49  ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.737 -10.542 -6.251  1.00 7.85  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.563 -9.673  -6.191  1.00 8.05  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.740 -8.690  -5.035  1.00 13.07 ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.195 -9.076  -3.963  1.00 11.10 ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.268 -10.501 -5.969  1.00 9.01  ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.084 -9.600  -5.687  1.00 9.77  ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.986 -11.412 -7.169  1.00 9.93  ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.422 -7.414  -5.249  1.00 9.37  ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.414 -6.472  -4.139  1.00 10.25 ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.048 -5.861  -3.911  1.00 11.59 ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.220 -5.801  -4.827  1.00 9.89  ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.479 -5.380  -4.323  1.00 9.54  ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.812 -5.428  -2.674  1.00 7.65  ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.615 -4.662  -2.341  1.00 9.00  ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.051 -3.361  -1.678  1.00 13.70 ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.686 -3.374  -0.621  1.00 10.69 ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.677 -5.452  -1.436  1.00 9.76  ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.324 -4.873  -0.988  1.00 13.80 ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.480 -3.874  0.163   1.00 11.81 ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.533 -4.243  -2.144  1.00 11.56 ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.733 -2.243  -2.324  1.00 8.86  ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.125 -0.933  -1.824  1.00 8.97  ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.909 -0.272  -1.242  1.00 11.51 ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.888 -0.164  -1.907  1.00 10.76 ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.700 -0.047  -2.938  1.00 10.92 ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.014 1.355   -2.403  1.00 11.87 ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.942 -0.699  -3.527  1.00 12.76 ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.030 0.161   0.011   1.00 9.45  ? 13   ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 57.886 0.724   0.780   0.25 11.65 ? 13   ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 57.949 0.796   0.677   0.75 11.65 ? 13   ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.296 2.117   1.340   1.00 8.38  ? 13   ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.220 2.193   2.132   1.00 8.03  ? 13   ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.581 -0.243  1.927   0.25 10.98 ? 13   ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.329 -0.128  1.726   0.75 10.36 ? 13   ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.149 -0.176  2.387   0.25 16.86 ? 13   ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.149 0.523   2.437   0.75 16.00 ? 13   ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 55.713 0.916   2.775   0.25 14.00 ? 13   ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 56.363 1.192   3.452   0.75 16.03 ? 13   ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 55.458 -1.219  2.354   0.25 20.08 ? 13   ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 55.004 0.382   1.966   0.75 21.01 ? 13   ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.583 3.194   0.976   1.00 10.36 ? 14   MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 57.934 4.543   1.481   1.00 11.70 ? 14   MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.679 4.567   2.978   1.00 10.28 ? 14   MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.714 3.996   3.441   1.00 11.50 ? 14   MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.098 5.641   0.805   1.00 9.01  ? 14   MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.142 5.614   -0.721  1.00 10.35 ? 14   MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.841 5.561   -1.337  1.00 15.54 ? 14   MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.484 7.127   -0.795  1.00 15.89 ? 14   MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.542 5.219   3.741   1.00 8.60  ? 15   ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.328 5.305   5.178   1.00 11.87 ? 15   ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.245 6.349   5.476   1.00 14.26 ? 15   ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.243 7.423   4.873   1.00 9.58  ? 15   ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.615 5.726   5.887   1.00 9.14  ? 15   ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.734 4.688   5.777   1.00 12.69 ? 15   ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.466 3.473   5.695   1.00 11.20 ? 15   ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 61.901 5.100   5.820   1.00 14.50 ? 15   ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.355 6.044   6.418   1.00 10.45 ? 16   CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.250 6.935   6.793   1.00 11.73 ? 16   CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.904 7.911   5.671   1.00 9.45  ? 16   CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.076 9.120   5.812   1.00 9.29  ? 16   CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.563 7.691   8.098   1.00 8.62  ? 16   CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.107 8.607   8.169   1.00 14.46 ? 16   CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.398 7.377   4.568   1.00 8.52  ? 17   PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.398 8.103   3.305   1.00 11.79 ? 17   PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.680 9.457   3.331   1.00 9.10  ? 17   PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.274 10.477  2.998   1.00 6.41  ? 17   PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.891 7.221   2.159   1.00 7.98  ? 17   PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 53.942 7.889   0.822   1.00 10.10 ? 17   PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.107 8.514   0.388   1.00 9.87  ? 17   PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.826 7.910   0.003   1.00 12.76 ? 17   PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.159 9.143   -0.856  1.00 12.73 ? 17   PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.866 8.533   -1.235  1.00 12.99 ? 17   PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 54.032 9.147   -1.669  1.00 14.00 ? 17   PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.418 9.485   3.735   1.00 6.49  ? 18   PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.683 10.747  3.676   1.00 8.48  ? 18   PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.338 11.816  4.556   1.00 9.78  ? 18   PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.290 13.003  4.249   1.00 7.85  ? 18   PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.231 10.574  4.110   1.00 7.28  ? 18   PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.359 9.884   3.101   1.00 10.47 ? 18   PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 49.908 9.198   2.028   1.00 9.28  ? 18   PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 47.979 9.920   3.236   1.00 10.94 ? 18   PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.097 8.563   1.103   1.00 12.31 ? 18   PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.152 9.296   2.303   1.00 13.39 ? 18   PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.721 8.612   1.232   1.00 14.49 ? 18   PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.910 11.387  5.679   1.00 8.95  ? 19   VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.644 12.282  6.562   1.00 8.47  ? 19   VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.867 12.917  5.870   1.00 8.88  ? 19   VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.087 14.135  5.967   1.00 6.27  ? 19   VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.089 11.540  7.829   1.00 6.68  ? 19   VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.099 12.370  8.621   1.00 10.01 ? 19   VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.868 11.198  8.692   1.00 10.07 ? 19   VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.668 12.099  5.191   1.00 8.04  ? 20   GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.818 12.636  4.467   1.00 9.85  ? 20   GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.403 13.636  3.392   1.00 6.88  ? 20   GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.129 14.612  3.145   1.00 10.74 ? 20   GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.623 11.534  3.796   1.00 9.29  ? 20   GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.446 10.662  4.730   1.00 13.21 ? 20   GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.550 9.956   3.969   1.00 14.37 ? 20   GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.637 10.504  3.812   1.00 13.24 ? 20   GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.267 8.745   3.464   1.00 11.12 ? 20   GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.284 13.366  2.716   1.00 6.22  ? 21   VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.771 14.300  1.700   1.00 6.17  ? 21   VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.502 15.665  2.362   1.00 8.79  ? 21   VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.893 16.726  1.843   1.00 8.21  ? 21   VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.493 13.769  0.971   1.00 7.33  ? 21   VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.932 14.828  0.012   1.00 6.77  ? 21   VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.801 12.492  0.188   1.00 6.67  ? 21   VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.850 15.637  3.519   1.00 9.11  ? 22   GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.554 16.877  4.249   1.00 9.07  ? 22   GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.812 17.549  4.817   1.00 7.55  ? 22   GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.897 18.779  4.868   1.00 7.96  ? 22   GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.505 16.638  5.358   1.00 5.00  ? 22   GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.147 16.183  4.846   1.00 7.41  ? 22   GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.424 17.224  3.979   1.00 12.78 ? 22   GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.638 18.447  4.167   1.00 12.66 ? 22   GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.624 16.809  3.113   1.00 14.69 ? 22   GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.786 16.749  5.241   1.00 7.14  ? 23   GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.028 17.288  5.806   1.00 7.89  ? 23   GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.916 17.911  4.732   1.00 7.80  ? 23   GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.638 18.862  4.989   1.00 8.52  ? 23   GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.813 16.188  6.526   1.00 9.73  ? 23   GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.189 15.727  7.841   1.00 10.06 ? 23   GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.932 14.545  8.455   1.00 8.30  ? 23   GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.373 13.644  7.750   1.00 9.66  ? 23   GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.075 14.554  9.773   1.00 12.60 ? 23   GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.880 17.353  3.531   1.00 9.66  ? 24   ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.635 17.957  2.443   1.00 10.80 ? 24   ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.086 19.346  2.181   1.00 9.93  ? 24   ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.844 20.292  1.990   1.00 10.03 ? 24   ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.521 17.135  1.171   1.00 7.55  ? 24   ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.413 17.697  0.034   1.00 15.59 ? 24   ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.424 16.767  -1.170  1.00 8.61  ? 24   ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.136 16.758  -1.847  1.00 8.71  ? 24   ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 57.915 16.184  -3.023  1.00 9.10  ? 24   ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 58.899 15.559  -3.668  1.00 6.78  ? 24   ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.710 16.238  -3.557  1.00 12.00 ? 24   ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.759 19.453  2.180   1.00 7.65  ? 25   GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.074 20.708  1.859   1.00 10.61 ? 25   GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.203 21.756  2.968   1.00 9.83  ? 25   GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.315 22.961  2.706   1.00 10.96 ? 25   GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.581 20.445  1.587   1.00 10.67 ? 25   GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.806 21.704  1.155   1.00 13.98 ? 25   GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.309 21.438  0.968   1.00 22.68 ? 25   GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 51.920 20.429  0.401   1.00 18.39 ? 25   GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.475 22.346  1.459   1.00 25.53 ? 25   GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.181 21.293  4.208   1.00 9.16  ? 26   ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.240 22.188  5.358   1.00 12.02 ? 26   ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.376 21.793  6.292   1.00 12.53 ? 26   ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.218 20.929  7.159   1.00 10.22 ? 26   ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.885 22.219  6.092   1.00 14.30 ? 26   ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.897 23.115  7.351   1.00 15.58 ? 26   ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 55.904 23.714  7.693   1.00 12.33 ? 26   ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.757 23.201  8.026   1.00 15.26 ? 26   ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.547 22.416  6.106   1.00 11.28 ? 27   PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.750 22.080  6.874   1.00 11.79 ? 27   PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.560 22.130  8.397   1.00 14.10 ? 27   PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.288 21.441  9.112   1.00 12.70 ? 27   PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.743 23.159  6.432   1.00 16.72 ? 27   PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.300 23.504  5.034   1.00 13.67 ? 27   PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.807 23.461  5.099   1.00 11.95 ? 27   PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.611 22.928  8.878   1.00 13.69 ? 28   HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.312 22.989  10.314  1.00 17.80 ? 28   HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.884 21.629  10.875  1.00 18.69 ? 28   HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 57.923 21.415  12.088  1.00 17.42 ? 28   HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.206 24.012  10.598  1.00 22.30 ? 28   HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.665 25.436  10.544  1.00 26.77 ? 28   HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 56.992 26.408  9.832   1.00 30.28 ? 28   HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.724 26.055  11.117  1.00 26.73 ? 28   HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.617 27.563  9.971   1.00 37.48 ? 28   HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.672 27.377  10.745  1.00 30.77 ? 28   HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.448 20.720  10.006  1.00 15.46 ? 29   LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 56.993 19.397  10.469  1.00 11.65 ? 29   LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.125 18.369  10.467  1.00 12.85 ? 29   LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 57.976 17.285  11.016  1.00 12.50 ? 29   LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.839 18.871  9.615   1.00 9.91  ? 29   LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.631 19.793  9.435   1.00 12.73 ? 29   LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.635 19.159  8.488   1.00 13.23 ? 29   LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 53.977 20.163  10.760  1.00 15.03 ? 29   LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.251 18.701  9.837   1.00 11.89 ? 30   ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.344 17.739  9.696   1.00 11.66 ? 30   ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 60.961 17.375  11.040  1.00 13.46 ? 30   ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.086 18.227  11.922  1.00 13.70 ? 30   ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.425 18.263  8.741   1.00 14.70 ? 30   ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 60.909 18.507  7.332   1.00 13.70 ? 30   ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 61.974 19.057  6.424   1.00 14.00 ? 30   ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.423 19.427  5.120   1.00 13.83 ? 30   ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.135 19.990  4.154   1.00 17.66 ? 30   ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.420 20.253  4.363   1.00 17.96 ? 30   ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.565 20.301  2.993   1.00 11.40 ? 30   ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.337 16.102  11.172  1.00 15.13 ? 31   ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.956 15.561  12.385  1.00 19.15 ? 31   ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.146 15.865  13.637  1.00 21.62 ? 31   ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.694 16.229  14.684  1.00 24.67 ? 31   ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.396 16.066  12.537  1.00 24.42 ? 31   ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.221 15.847  11.282  1.00 27.41 ? 31   ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.483 14.709  10.880  1.00 33.55 ? 31   ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.620 16.940  10.644  1.00 30.20 ? 31   ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.832 15.729  13.517  1.00 12.90 ? 32   LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.935 15.972  14.628  1.00 13.00 ? 32   LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.941 14.829  14.730  1.00 14.44 ? 32   LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.665 14.162  13.736  1.00 11.99 ? 32   LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.154 17.275  14.415  1.00 15.37 ? 32   LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 59.018 18.545  14.462  1.00 19.00 ? 32   LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 59.008 19.169  15.844  1.00 33.69 ? 32   LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 60.165 20.162  16.022  1.00 37.49 ? 32   LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 60.388 21.020  14.822  1.00 31.05 ? 32   LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.382 14.623  15.929  1.00 13.89 ? 33   PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.211 13.752  16.055  1.00 12.33 ? 33   PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.088 14.404  15.310  1.00 11.58 ? 33   PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.619 15.497  15.669  1.00 9.86  ? 33   PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.939 13.749  17.562  1.00 15.47 ? 33   PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.527 15.011  18.064  1.00 20.52 ? 33   PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.731 15.277  17.201  1.00 19.53 ? 33   PRO A CD    1 
ATOM   294  N  N     . CYS A 1 37  ? 54.660 13.739  14.258  1.00 11.40 ? 34   CYS A N     1 
ATOM   295  C  CA    A CYS A 1 37  ? 53.747 14.332  13.234  0.50 12.21 ? 34   CYS A CA    1 
ATOM   296  C  CA    B CYS A 1 37  ? 53.534 14.245  13.607  0.50 11.68 ? 34   CYS A CA    1 
ATOM   297  C  C     . CYS A 1 37  ? 52.744 13.226  12.839  1.00 11.39 ? 34   CYS A C     1 
ATOM   298  O  O     . CYS A 1 37  ? 53.136 12.063  12.719  1.00 11.29 ? 34   CYS A O     1 
ATOM   299  C  CB    A CYS A 1 37  ? 54.541 14.818  12.021  0.50 13.96 ? 34   CYS A CB    1 
ATOM   300  C  CB    B CYS A 1 37  ? 53.984 15.354  12.649  0.50 12.52 ? 34   CYS A CB    1 
ATOM   301  S  SG    A CYS A 1 37  ? 53.570 15.792  10.848  0.50 13.50 ? 34   CYS A SG    1 
ATOM   302  S  SG    B CYS A 1 37  ? 55.058 14.754  11.329  0.50 14.00 ? 34   CYS A SG    1 
ATOM   303  N  N     . ALA A 1 38  ? 51.522 13.621  12.501  1.00 8.40  ? 35   ALA A N     1 
ATOM   304  C  CA    . ALA A 1 38  ? 50.557 12.696  11.912  1.00 7.42  ? 35   ALA A CA    1 
ATOM   305  C  C     . ALA A 1 38  ? 49.739 13.405  10.847  1.00 9.29  ? 35   ALA A C     1 
ATOM   306  O  O     . ALA A 1 38  ? 49.624 14.630  10.874  1.00 10.72 ? 35   ALA A O     1 
ATOM   307  C  CB    . ALA A 1 38  ? 49.642 12.121  12.973  1.00 8.79  ? 35   ALA A CB    1 
ATOM   308  N  N     . VAL A 1 39  ? 49.178 12.635  9.909   1.00 7.60  ? 36   VAL A N     1 
ATOM   309  C  CA    . VAL A 1 39  ? 48.271 13.177  8.905   1.00 9.11  ? 36   VAL A CA    1 
ATOM   310  C  C     . VAL A 1 39  ? 46.878 12.733  9.284   1.00 14.29 ? 36   VAL A C     1 
ATOM   311  O  O     . VAL A 1 39  ? 46.662 11.553  9.587   1.00 10.79 ? 36   VAL A O     1 
ATOM   312  C  CB    . VAL A 1 39  ? 48.617 12.662  7.478   1.00 9.07  ? 36   VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 39  ? 47.521 13.042  6.455   1.00 8.72  ? 36   VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 39  ? 49.985 13.190  7.043   1.00 9.98  ? 36   VAL A CG2   1 
ATOM   315  N  N     . VAL A 1 40  ? 45.941 13.677  9.288   1.00 11.18 ? 37   VAL A N     1 
ATOM   316  C  CA    . VAL A 1 40  ? 44.574 13.414  9.724   1.00 12.24 ? 37   VAL A CA    1 
ATOM   317  C  C     . VAL A 1 40  ? 43.587 13.762  8.617   1.00 14.83 ? 37   VAL A C     1 
ATOM   318  O  O     . VAL A 1 40  ? 43.865 14.635  7.796   1.00 16.14 ? 37   VAL A O     1 
ATOM   319  C  CB    . VAL A 1 40  ? 44.203 14.271  10.967  1.00 15.04 ? 37   VAL A CB    1 
ATOM   320  C  CG1   A VAL A 1 40  ? 45.022 13.843  12.183  0.57 13.78 ? 37   VAL A CG1   1 
ATOM   321  C  CG1   B VAL A 1 40  ? 44.046 15.728  10.580  0.43 11.97 ? 37   VAL A CG1   1 
ATOM   322  C  CG2   A VAL A 1 40  ? 44.353 15.751  10.671  0.57 11.95 ? 37   VAL A CG2   1 
ATOM   323  C  CG2   B VAL A 1 40  ? 42.948 13.762  11.620  0.43 13.67 ? 37   VAL A CG2   1 
ATOM   324  N  N     . GLN A 1 41  ? 42.433 13.098  8.584   1.00 15.96 ? 38   GLN A N     1 
ATOM   325  C  CA    . GLN A 1 41  ? 41.348 13.557  7.704   1.00 16.08 ? 38   GLN A CA    1 
ATOM   326  C  C     . GLN A 1 41  ? 40.098 13.936  8.487   1.00 15.16 ? 38   GLN A C     1 
ATOM   327  O  O     . GLN A 1 41  ? 39.713 13.244  9.432   1.00 12.53 ? 38   GLN A O     1 
ATOM   328  C  CB    . GLN A 1 41  ? 41.046 12.580  6.546   1.00 23.25 ? 38   GLN A CB    1 
ATOM   329  C  CG    . GLN A 1 41  ? 40.938 11.123  6.912   1.00 27.47 ? 38   GLN A CG    1 
ATOM   330  C  CD    . GLN A 1 41  ? 40.816 10.187  5.688   1.00 20.90 ? 38   GLN A CD    1 
ATOM   331  O  OE1   . GLN A 1 41  ? 41.148 10.547  4.552   1.00 21.86 ? 38   GLN A OE1   1 
ATOM   332  N  NE2   . GLN A 1 41  ? 40.341 8.980   5.936   1.00 27.82 ? 38   GLN A NE2   1 
ATOM   333  N  N     . TYR A 1 42  ? 39.476 15.044  8.082   1.00 11.93 ? 39   TYR A N     1 
ATOM   334  C  CA    . TYR A 1 42  ? 38.349 15.635  8.798   1.00 14.61 ? 39   TYR A CA    1 
ATOM   335  C  C     . TYR A 1 42  ? 38.895 16.113  10.155  1.00 22.47 ? 39   TYR A C     1 
ATOM   336  O  O     . TYR A 1 42  ? 40.070 15.911  10.455  1.00 24.63 ? 39   TYR A O     1 
ATOM   337  C  CB    . TYR A 1 42  ? 37.172 14.672  8.865   1.00 14.58 ? 39   TYR A CB    1 
ATOM   338  C  CG    . TYR A 1 42  ? 36.775 14.206  7.477   1.00 13.96 ? 39   TYR A CG    1 
ATOM   339  C  CD1   . TYR A 1 42  ? 36.545 15.121  6.458   1.00 14.94 ? 39   TYR A CD1   1 
ATOM   340  C  CD2   . TYR A 1 42  ? 36.693 12.853  7.171   1.00 17.62 ? 39   TYR A CD2   1 
ATOM   341  C  CE1   . TYR A 1 42  ? 36.192 14.697  5.170   1.00 17.10 ? 39   TYR A CE1   1 
ATOM   342  C  CE2   . TYR A 1 42  ? 36.355 12.420  5.893   1.00 13.75 ? 39   TYR A CE2   1 
ATOM   343  C  CZ    . TYR A 1 42  ? 36.107 13.341  4.901   1.00 14.60 ? 39   TYR A CZ    1 
ATOM   344  O  OH    . TYR A 1 42  ? 35.758 12.896  3.641   1.00 13.90 ? 39   TYR A OH    1 
ATOM   345  N  N     . LYS A 1 43  ? 38.089 16.796  10.947  1.00 25.39 ? 40   LYS A N     1 
ATOM   346  C  CA    . LYS A 1 43  ? 38.649 17.521  12.090  1.00 22.25 ? 40   LYS A CA    1 
ATOM   347  C  C     . LYS A 1 43  ? 37.589 17.680  13.159  1.00 26.91 ? 40   LYS A C     1 
ATOM   348  O  O     . LYS A 1 43  ? 37.894 17.683  14.349  1.00 24.14 ? 40   LYS A O     1 
ATOM   349  C  CB    . LYS A 1 43  ? 39.162 18.897  11.650  1.00 25.89 ? 40   LYS A CB    1 
ATOM   350  C  CG    . LYS A 1 43  ? 40.680 19.047  11.695  1.00 32.09 ? 40   LYS A CG    1 
ATOM   351  C  CD    . LYS A 1 43  ? 41.130 19.787  12.951  1.00 39.18 ? 40   LYS A CD    1 
ATOM   352  C  CE    . LYS A 1 43  ? 42.614 19.565  13.237  1.00 31.05 ? 40   LYS A CE    1 
ATOM   353  N  NZ    . LYS A 1 43  ? 42.795 18.917  14.565  1.00 25.07 ? 40   LYS A NZ    1 
ATOM   354  N  N     . SER A 1 44  ? 36.338 17.798  12.722  1.00 22.78 ? 41   SER A N     1 
ATOM   355  C  CA    . SER A 1 44  ? 35.234 18.102  13.621  1.00 24.82 ? 41   SER A CA    1 
ATOM   356  C  C     . SER A 1 44  ? 34.930 16.950  14.592  1.00 25.99 ? 41   SER A C     1 
ATOM   357  O  O     . SER A 1 44  ? 34.686 17.183  15.774  1.00 32.44 ? 41   SER A O     1 
ATOM   358  C  CB    . SER A 1 44  ? 33.990 18.526  12.829  1.00 29.30 ? 41   SER A CB    1 
ATOM   359  O  OG    . SER A 1 44  ? 33.478 17.449  12.065  1.00 34.90 ? 41   SER A OG    1 
ATOM   360  N  N     . TRP A 1 45  ? 34.968 15.711  14.107  1.00 24.56 ? 42   TRP A N     1 
ATOM   361  C  CA    . TRP A 1 45  ? 34.705 14.555  14.970  1.00 23.20 ? 42   TRP A CA    1 
ATOM   362  C  C     . TRP A 1 45  ? 35.990 14.045  15.640  1.00 25.11 ? 42   TRP A C     1 
ATOM   363  O  O     . TRP A 1 45  ? 36.823 13.398  15.003  1.00 21.23 ? 42   TRP A O     1 
ATOM   364  C  CB    . TRP A 1 45  ? 34.016 13.436  14.179  1.00 25.84 ? 42   TRP A CB    1 
ATOM   365  C  CG    . TRP A 1 45  ? 33.586 12.244  14.999  1.00 30.11 ? 42   TRP A CG    1 
ATOM   366  C  CD1   . TRP A 1 45  ? 34.316 11.119  15.256  1.00 30.78 ? 42   TRP A CD1   1 
ATOM   367  C  CD2   . TRP A 1 45  ? 32.320 12.054  15.643  1.00 34.69 ? 42   TRP A CD2   1 
ATOM   368  N  NE1   . TRP A 1 45  ? 33.588 10.246  16.027  1.00 34.39 ? 42   TRP A NE1   1 
ATOM   369  C  CE2   . TRP A 1 45  ? 32.359 10.796  16.278  1.00 35.10 ? 42   TRP A CE2   1 
ATOM   370  C  CE3   . TRP A 1 45  ? 31.157 12.826  15.745  1.00 39.28 ? 42   TRP A CE3   1 
ATOM   371  C  CZ2   . TRP A 1 45  ? 31.283 10.293  17.010  1.00 38.01 ? 42   TRP A CZ2   1 
ATOM   372  C  CZ3   . TRP A 1 45  ? 30.084 12.324  16.470  1.00 37.06 ? 42   TRP A CZ3   1 
ATOM   373  C  CH2   . TRP A 1 45  ? 30.155 11.069  17.092  1.00 36.13 ? 42   TRP A CH2   1 
ATOM   374  N  N     . LYS A 1 46  ? 36.136 14.366  16.924  1.00 25.20 ? 43   LYS A N     1 
ATOM   375  C  CA    . LYS A 1 46  ? 37.252 13.911  17.756  1.00 20.29 ? 43   LYS A CA    1 
ATOM   376  C  C     . LYS A 1 46  ? 38.629 14.334  17.240  1.00 18.36 ? 43   LYS A C     1 
ATOM   377  O  O     . LYS A 1 46  ? 39.625 13.657  17.495  1.00 19.53 ? 43   LYS A O     1 
ATOM   378  C  CB    . LYS A 1 46  ? 37.186 12.389  17.959  1.00 22.97 ? 43   LYS A CB    1 
ATOM   379  C  CG    . LYS A 1 46  ? 35.971 11.915  18.761  1.00 30.41 ? 43   LYS A CG    1 
ATOM   380  C  CD    . LYS A 1 46  ? 35.853 10.390  18.751  1.00 29.80 ? 43   LYS A CD    1 
ATOM   381  C  CE    . LYS A 1 46  ? 34.815 9.887   19.745  1.00 39.53 ? 43   LYS A CE    1 
ATOM   382  N  NZ    . LYS A 1 46  ? 35.294 10.006  21.157  1.00 47.34 ? 43   LYS A NZ    1 
ATOM   383  N  N     . GLY A 1 47  ? 38.673 15.452  16.517  1.00 15.48 ? 44   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 47  ? 39.915 16.026  16.035  1.00 16.04 ? 44   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 47  ? 40.389 15.448  14.707  1.00 15.87 ? 44   GLY A C     1 
ATOM   386  O  O     . GLY A 1 47  ? 41.444 15.828  14.204  1.00 15.11 ? 44   GLY A O     1 
ATOM   387  N  N     . GLY A 1 48  ? 39.612 14.523  14.150  1.00 17.52 ? 45   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 48  ? 39.960 13.865  12.900  1.00 19.36 ? 45   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 48  ? 40.574 12.487  13.067  1.00 15.06 ? 45   GLY A C     1 
ATOM   390  O  O     . GLY A 1 48  ? 41.138 12.182  14.106  1.00 14.30 ? 45   GLY A O     1 
ATOM   391  N  N     . GLY A 1 49  ? 40.490 11.659  12.030  1.00 13.52 ? 46   GLY A N     1 
ATOM   392  C  CA    . GLY A 1 49  ? 41.048 10.317  12.092  1.00 10.84 ? 46   GLY A CA    1 
ATOM   393  C  C     . GLY A 1 49  ? 42.470 10.280  11.545  1.00 14.16 ? 46   GLY A C     1 
ATOM   394  O  O     . GLY A 1 49  ? 42.714 10.759  10.445  1.00 11.33 ? 46   GLY A O     1 
ATOM   395  N  N     . ILE A 1 50  ? 43.403 9.725   12.312  1.00 10.17 ? 47   ILE A N     1 
ATOM   396  C  CA    . ILE A 1 50  ? 44.806 9.626   11.878  1.00 8.93  ? 47   ILE A CA    1 
ATOM   397  C  C     . ILE A 1 50  ? 44.965 8.550   10.806  1.00 12.55 ? 47   ILE A C     1 
ATOM   398  O  O     . ILE A 1 50  ? 44.465 7.443   10.964  1.00 12.85 ? 47   ILE A O     1 
ATOM   399  C  CB    . ILE A 1 50  ? 45.743 9.360   13.084  1.00 10.68 ? 47   ILE A CB    1 
ATOM   400  C  CG1   . ILE A 1 50  ? 45.793 10.605  13.978  1.00 14.92 ? 47   ILE A CG1   1 
ATOM   401  C  CG2   . ILE A 1 50  ? 47.136 8.939   12.612  1.00 9.97  ? 47   ILE A CG2   1 
ATOM   402  C  CD1   . ILE A 1 50  ? 46.700 10.478  15.185  1.00 16.98 ? 47   ILE A CD1   1 
ATOM   403  N  N     . ILE A 1 51  ? 45.632 8.882   9.702   1.00 9.78  ? 48   ILE A N     1 
ATOM   404  C  CA    . ILE A 1 51  ? 45.898 7.880   8.666   1.00 8.91  ? 48   ILE A CA    1 
ATOM   405  C  C     . ILE A 1 51  ? 47.386 7.593   8.388   1.00 14.39 ? 48   ILE A C     1 
ATOM   406  O  O     . ILE A 1 51  ? 47.709 6.612   7.720   1.00 10.96 ? 48   ILE A O     1 
ATOM   407  C  CB    . ILE A 1 51  ? 45.151 8.184   7.361   1.00 16.54 ? 48   ILE A CB    1 
ATOM   408  C  CG1   . ILE A 1 51  ? 45.555 9.539   6.785   1.00 12.19 ? 48   ILE A CG1   1 
ATOM   409  C  CG2   . ILE A 1 51  ? 43.640 8.114   7.583   1.00 17.94 ? 48   ILE A CG2   1 
ATOM   410  C  CD1   . ILE A 1 51  ? 45.079 9.701   5.339   1.00 15.63 ? 48   ILE A CD1   1 
ATOM   411  N  N     . ALA A 1 52  ? 48.279 8.433   8.914   1.00 10.60 ? 49   ALA A N     1 
ATOM   412  C  CA    . ALA A 1 52  ? 49.732 8.198   8.819   1.00 7.86  ? 49   ALA A CA    1 
ATOM   413  C  C     . ALA A 1 52  ? 50.450 8.830   10.003  1.00 9.03  ? 49   ALA A C     1 
ATOM   414  O  O     . ALA A 1 52  ? 50.026 9.874   10.487  1.00 6.75  ? 49   ALA A O     1 
ATOM   415  C  CB    . ALA A 1 52  ? 50.279 8.751   7.509   1.00 8.31  ? 49   ALA A CB    1 
ATOM   416  N  N     . VAL A 1 53  ? 51.550 8.218   10.448  1.00 9.40  ? 50   VAL A N     1 
ATOM   417  C  CA    . VAL A 1 53  ? 52.215 8.634   11.683  1.00 9.23  ? 50   VAL A CA    1 
ATOM   418  C  C     . VAL A 1 53  ? 53.733 8.592   11.539  1.00 8.19  ? 50   VAL A C     1 
ATOM   419  O  O     . VAL A 1 53  ? 54.283 7.578   11.103  1.00 7.00  ? 50   VAL A O     1 
ATOM   420  C  CB    . VAL A 1 53  ? 51.830 7.688   12.850  1.00 8.60  ? 50   VAL A CB    1 
ATOM   421  C  CG1   . VAL A 1 53  ? 52.370 8.220   14.159  1.00 8.82  ? 50   VAL A CG1   1 
ATOM   422  C  CG2   . VAL A 1 53  ? 50.322 7.524   12.919  1.00 11.32 ? 50   VAL A CG2   1 
ATOM   423  N  N     . SER A 1 54  ? 54.409 9.673   11.913  1.00 6.21  ? 51   SER A N     1 
ATOM   424  C  CA    . SER A 1 54  ? 55.860 9.727   11.804  1.00 10.18 ? 51   SER A CA    1 
ATOM   425  C  C     . SER A 1 54  ? 56.470 8.788   12.838  1.00 13.77 ? 51   SER A C     1 
ATOM   426  O  O     . SER A 1 54  ? 55.838 8.479   13.854  1.00 11.61 ? 51   SER A O     1 
ATOM   427  C  CB    . SER A 1 54  ? 56.397 11.147  12.007  1.00 10.46 ? 51   SER A CB    1 
ATOM   428  O  OG    . SER A 1 54  ? 56.432 11.503  13.387  1.00 11.13 ? 51   SER A OG    1 
ATOM   429  N  N     . TYR A 1 55  ? 57.694 8.331   12.587  1.00 11.05 ? 52   TYR A N     1 
ATOM   430  C  CA    . TYR A 1 55  ? 58.341 7.426   13.526  1.00 13.53 ? 52   TYR A CA    1 
ATOM   431  C  C     . TYR A 1 55  ? 58.545 8.050   14.917  1.00 15.98 ? 52   TYR A C     1 
ATOM   432  O  O     . TYR A 1 55  ? 58.423 7.360   15.917  1.00 13.96 ? 52   TYR A O     1 
ATOM   433  C  CB    . TYR A 1 55  ? 59.617 6.811   12.921  1.00 14.15 ? 52   TYR A CB    1 
ATOM   434  C  CG    . TYR A 1 55  ? 59.240 5.717   11.948  1.00 13.48 ? 52   TYR A CG    1 
ATOM   435  C  CD1   . TYR A 1 55  ? 58.786 6.022   10.665  1.00 11.85 ? 52   TYR A CD1   1 
ATOM   436  C  CD2   . TYR A 1 55  ? 59.257 4.387   12.334  1.00 15.30 ? 52   TYR A CD2   1 
ATOM   437  C  CE1   . TYR A 1 55  ? 58.387 5.017   9.788   1.00 14.62 ? 52   TYR A CE1   1 
ATOM   438  C  CE2   . TYR A 1 55  ? 58.872 3.384   11.475  1.00 13.84 ? 52   TYR A CE2   1 
ATOM   439  C  CZ    . TYR A 1 55  ? 58.440 3.694   10.204  1.00 17.33 ? 52   TYR A CZ    1 
ATOM   440  O  OH    . TYR A 1 55  ? 58.062 2.677   9.358   1.00 17.22 ? 52   TYR A OH    1 
ATOM   441  N  N     . GLU A 1 56  ? 58.786 9.359   14.972  1.00 13.61 ? 53   GLU A N     1 
ATOM   442  C  CA    . GLU A 1 56  ? 58.886 10.076  16.243  1.00 15.10 ? 53   GLU A CA    1 
ATOM   443  C  C     . GLU A 1 56  ? 57.583 9.992   17.050  1.00 12.16 ? 53   GLU A C     1 
ATOM   444  O  O     . GLU A 1 56  ? 57.606 9.796   18.259  1.00 13.87 ? 53   GLU A O     1 
ATOM   445  C  CB    . GLU A 1 56  ? 59.276 11.548  16.017  1.00 13.65 ? 53   GLU A CB    1 
ATOM   446  C  CG    . GLU A 1 56  ? 60.692 11.784  15.468  1.00 18.29 ? 53   GLU A CG    1 
ATOM   447  C  CD    . GLU A 1 56  ? 60.834 11.574  13.955  1.00 25.80 ? 53   GLU A CD    1 
ATOM   448  O  OE1   . GLU A 1 56  ? 59.883 11.091  13.293  1.00 20.66 ? 53   GLU A OE1   1 
ATOM   449  O  OE2   . GLU A 1 56  ? 61.923 11.892  13.427  1.00 26.47 ? 53   GLU A OE2   1 
ATOM   450  N  N     . ALA A 1 57  ? 56.440 10.144  16.384  1.00 11.32 ? 54   ALA A N     1 
ATOM   451  C  CA    . ALA A 1 57  ? 55.137 10.020  17.054  1.00 12.98 ? 54   ALA A CA    1 
ATOM   452  C  C     . ALA A 1 57  ? 54.774 8.584   17.456  1.00 11.11 ? 54   ALA A C     1 
ATOM   453  O  O     . ALA A 1 57  ? 54.147 8.366   18.491  1.00 12.08 ? 54   ALA A O     1 
ATOM   454  C  CB    . ALA A 1 57  ? 54.029 10.615  16.178  1.00 12.09 ? 54   ALA A CB    1 
ATOM   455  N  N     . ARG A 1 58  ? 55.170 7.603   16.650  1.00 13.04 ? 55   ARG A N     1 
ATOM   456  C  CA    . ARG A 1 58  ? 54.921 6.195   17.001  1.00 13.28 ? 55   ARG A CA    1 
ATOM   457  C  C     . ARG A 1 58  ? 55.544 5.805   18.337  1.00 14.34 ? 55   ARG A C     1 
ATOM   458  O  O     . ARG A 1 58  ? 55.001 4.963   19.061  1.00 13.36 ? 55   ARG A O     1 
ATOM   459  C  CB    . ARG A 1 58  ? 55.446 5.271   15.915  1.00 11.05 ? 55   ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 58  ? 54.785 5.475   14.574  1.00 13.06 ? 55   ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 58  ? 55.295 4.491   13.540  1.00 15.66 ? 55   ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 58  ? 54.913 4.947   12.208  1.00 14.05 ? 55   ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 58  ? 54.991 4.222   11.100  1.00 17.31 ? 55   ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 58  ? 55.439 2.974   11.145  1.00 15.83 ? 55   ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 58  ? 54.608 4.756   9.940   1.00 15.49 ? 55   ARG A NH2   1 
ATOM   466  N  N     . ALA A 1 59  ? 56.671 6.426   18.661  1.00 12.39 ? 56   ALA A N     1 
ATOM   467  C  CA    . ALA A 1 59  ? 57.351 6.165   19.928  1.00 17.13 ? 56   ALA A CA    1 
ATOM   468  C  C     . ALA A 1 59  ? 56.465 6.508   21.127  1.00 19.23 ? 56   ALA A C     1 
ATOM   469  O  O     . ALA A 1 59  ? 56.607 5.910   22.198  1.00 18.11 ? 56   ALA A O     1 
ATOM   470  C  CB    . ALA A 1 59  ? 58.679 6.920   19.996  1.00 17.93 ? 56   ALA A CB    1 
ATOM   471  N  N     . PHE A 1 60  ? 55.556 7.466   20.950  1.00 13.84 ? 57   PHE A N     1 
ATOM   472  C  CA    . PHE A 1 60  ? 54.590 7.810   21.997  1.00 15.38 ? 57   PHE A CA    1 
ATOM   473  C  C     . PHE A 1 60  ? 53.368 6.896   21.980  1.00 15.97 ? 57   PHE A C     1 
ATOM   474  O  O     . PHE A 1 60  ? 52.488 7.010   22.838  1.00 18.18 ? 57   PHE A O     1 
ATOM   475  C  CB    . PHE A 1 60  ? 54.113 9.258   21.860  1.00 14.95 ? 57   PHE A CB    1 
ATOM   476  C  CG    . PHE A 1 60  ? 55.167 10.281  22.159  1.00 18.71 ? 57   PHE A CG    1 
ATOM   477  C  CD1   . PHE A 1 60  ? 55.266 10.843  23.420  1.00 23.31 ? 57   PHE A CD1   1 
ATOM   478  C  CD2   . PHE A 1 60  ? 56.046 10.691  21.177  1.00 15.53 ? 57   PHE A CD2   1 
ATOM   479  C  CE1   . PHE A 1 60  ? 56.230 11.796  23.697  1.00 30.75 ? 57   PHE A CE1   1 
ATOM   480  C  CE2   . PHE A 1 60  ? 57.015 11.641  21.444  1.00 19.74 ? 57   PHE A CE2   1 
ATOM   481  C  CZ    . PHE A 1 60  ? 57.105 12.198  22.706  1.00 29.08 ? 57   PHE A CZ    1 
ATOM   482  N  N     . GLY A 1 61  ? 53.291 6.008   20.994  1.00 14.71 ? 58   GLY A N     1 
ATOM   483  C  CA    . GLY A 1 61  ? 52.182 5.071   20.907  1.00 14.20 ? 58   GLY A CA    1 
ATOM   484  C  C     . GLY A 1 61  ? 51.067 5.529   19.975  1.00 18.67 ? 58   GLY A C     1 
ATOM   485  O  O     . GLY A 1 61  ? 49.984 4.952   19.944  1.00 13.03 ? 58   GLY A O     1 
ATOM   486  N  N     . VAL A 1 62  ? 51.320 6.582   19.211  1.00 13.78 ? 59   VAL A N     1 
ATOM   487  C  CA    . VAL A 1 62  ? 50.329 7.040   18.243  1.00 12.39 ? 59   VAL A CA    1 
ATOM   488  C  C     . VAL A 1 62  ? 50.272 6.040   17.088  1.00 12.93 ? 59   VAL A C     1 
ATOM   489  O  O     . VAL A 1 62  ? 51.311 5.577   16.617  1.00 13.18 ? 59   VAL A O     1 
ATOM   490  C  CB    . VAL A 1 62  ? 50.672 8.460   17.704  1.00 11.84 ? 59   VAL A CB    1 
ATOM   491  C  CG1   . VAL A 1 62  ? 49.621 8.930   16.693  1.00 12.85 ? 59   VAL A CG1   1 
ATOM   492  C  CG2   . VAL A 1 62  ? 50.743 9.458   18.854  1.00 12.80 ? 59   VAL A CG2   1 
ATOM   493  N  N     . THR A 1 63  ? 49.063 5.716   16.633  1.00 16.48 ? 60   THR A N     1 
ATOM   494  C  CA    . THR A 1 63  ? 48.880 4.764   15.535  1.00 17.17 ? 60   THR A CA    1 
ATOM   495  C  C     . THR A 1 63  ? 47.834 5.261   14.561  1.00 15.06 ? 60   THR A C     1 
ATOM   496  O  O     . THR A 1 63  ? 47.060 6.169   14.856  1.00 15.26 ? 60   THR A O     1 
ATOM   497  C  CB    . THR A 1 63  ? 48.383 3.391   16.058  1.00 19.60 ? 60   THR A CB    1 
ATOM   498  O  OG1   . THR A 1 63  ? 47.067 3.534   16.605  1.00 20.15 ? 60   THR A OG1   1 
ATOM   499  C  CG2   . THR A 1 63  ? 49.311 2.844   17.135  1.00 19.37 ? 60   THR A CG2   1 
ATOM   500  N  N     . ARG A 1 64  ? 47.797 4.633   13.397  1.00 15.02 ? 61   ARG A N     1 
ATOM   501  C  CA    . ARG A 1 64  ? 46.702 4.825   12.469  1.00 17.98 ? 61   ARG A CA    1 
ATOM   502  C  C     . ARG A 1 64  ? 45.368 4.380   13.059  1.00 19.46 ? 61   ARG A C     1 
ATOM   503  O  O     . ARG A 1 64  ? 45.337 3.530   13.946  1.00 18.48 ? 61   ARG A O     1 
ATOM   504  C  CB    . ARG A 1 64  ? 47.046 4.107   11.149  1.00 19.83 ? 61   ARG A CB    1 
ATOM   505  C  CG    A ARG A 1 64  ? 46.010 3.168   10.597  0.40 26.61 ? 61   ARG A CG    1 
ATOM   506  C  CG    B ARG A 1 64  ? 45.862 3.827   10.227  0.60 26.50 ? 61   ARG A CG    1 
ATOM   507  C  CD    A ARG A 1 64  ? 46.564 2.533   9.329   0.40 25.15 ? 61   ARG A CD    1 
ATOM   508  C  CD    B ARG A 1 64  ? 46.253 2.922   9.039   0.60 24.84 ? 61   ARG A CD    1 
ATOM   509  N  NE    A ARG A 1 64  ? 47.339 3.505   8.562   0.40 21.06 ? 61   ARG A NE    1 
ATOM   510  N  NE    B ARG A 1 64  ? 46.782 1.627   9.465   0.60 28.72 ? 61   ARG A NE    1 
ATOM   511  C  CZ    A ARG A 1 64  ? 48.504 3.249   7.974   0.40 20.90 ? 61   ARG A CZ    1 
ATOM   512  C  CZ    B ARG A 1 64  ? 46.106 0.479   9.428   0.60 32.78 ? 61   ARG A CZ    1 
ATOM   513  N  NH1   A ARG A 1 64  ? 49.039 2.038   8.052   0.40 22.60 ? 61   ARG A NH1   1 
ATOM   514  N  NH1   B ARG A 1 64  ? 46.685 -0.642  9.842   0.60 36.68 ? 61   ARG A NH1   1 
ATOM   515  N  NH2   A ARG A 1 64  ? 49.134 4.203   7.299   0.40 17.48 ? 61   ARG A NH2   1 
ATOM   516  N  NH2   B ARG A 1 64  ? 44.857 0.444   8.974   0.60 27.05 ? 61   ARG A NH2   1 
ATOM   517  N  N     . SER A 1 65  ? 44.284 4.992   12.582  1.00 20.80 ? 62   SER A N     1 
ATOM   518  C  CA    . SER A 1 65  ? 42.915 4.702   13.025  1.00 26.61 ? 62   SER A CA    1 
ATOM   519  C  C     . SER A 1 65  ? 42.562 5.365   14.359  1.00 22.99 ? 62   SER A C     1 
ATOM   520  O  O     . SER A 1 65  ? 41.430 5.287   14.822  1.00 36.96 ? 62   SER A O     1 
ATOM   521  C  CB    . SER A 1 65  ? 42.681 3.203   13.144  1.00 28.01 ? 62   SER A CB    1 
ATOM   522  O  OG    . SER A 1 65  ? 42.935 2.774   14.469  1.00 37.73 ? 62   SER A OG    1 
ATOM   523  N  N     . MET A 1 66  ? 43.541 6.000   14.981  1.00 20.21 ? 63   MET A N     1 
ATOM   524  C  CA    . MET A 1 66  ? 43.334 6.665   16.256  1.00 17.00 ? 63   MET A CA    1 
ATOM   525  C  C     . MET A 1 66  ? 42.711 8.024   15.972  1.00 15.74 ? 63   MET A C     1 
ATOM   526  O  O     . MET A 1 66  ? 43.017 8.633   14.948  1.00 15.41 ? 63   MET A O     1 
ATOM   527  C  CB    . MET A 1 66  ? 44.702 6.819   16.912  1.00 17.62 ? 63   MET A CB    1 
ATOM   528  C  CG    . MET A 1 66  ? 44.745 7.361   18.295  1.00 14.83 ? 63   MET A CG    1 
ATOM   529  S  SD    . MET A 1 66  ? 46.400 7.051   18.955  1.00 19.41 ? 63   MET A SD    1 
ATOM   530  C  CE    . MET A 1 66  ? 46.321 5.315   19.342  1.00 14.82 ? 63   MET A CE    1 
ATOM   531  N  N     . TRP A 1 67  ? 41.828 8.494   16.855  1.00 15.01 ? 64   TRP A N     1 
ATOM   532  C  CA    . TRP A 1 67  ? 41.306 9.862   16.742  1.00 14.49 ? 64   TRP A CA    1 
ATOM   533  C  C     . TRP A 1 67  ? 42.380 10.849  17.188  1.00 14.19 ? 64   TRP A C     1 
ATOM   534  O  O     . TRP A 1 67  ? 43.079 10.600  18.162  1.00 12.68 ? 64   TRP A O     1 
ATOM   535  C  CB    . TRP A 1 67  ? 40.042 10.047  17.590  1.00 15.31 ? 64   TRP A CB    1 
ATOM   536  C  CG    . TRP A 1 67  ? 38.916 9.188   17.146  1.00 17.98 ? 64   TRP A CG    1 
ATOM   537  C  CD1   . TRP A 1 67  ? 38.344 8.155   17.835  1.00 23.39 ? 64   TRP A CD1   1 
ATOM   538  C  CD2   . TRP A 1 67  ? 38.232 9.265   15.892  1.00 20.78 ? 64   TRP A CD2   1 
ATOM   539  N  NE1   . TRP A 1 67  ? 37.335 7.590   17.086  1.00 27.66 ? 64   TRP A NE1   1 
ATOM   540  C  CE2   . TRP A 1 67  ? 37.248 8.252   15.888  1.00 28.19 ? 64   TRP A CE2   1 
ATOM   541  C  CE3   . TRP A 1 67  ? 38.350 10.098  14.772  1.00 17.37 ? 64   TRP A CE3   1 
ATOM   542  C  CZ2   . TRP A 1 67  ? 36.391 8.045   14.804  1.00 28.01 ? 64   TRP A CZ2   1 
ATOM   543  C  CZ3   . TRP A 1 67  ? 37.496 9.891   13.696  1.00 21.07 ? 64   TRP A CZ3   1 
ATOM   544  C  CH2   . TRP A 1 67  ? 36.530 8.872   13.722  1.00 24.70 ? 64   TRP A CH2   1 
ATOM   545  N  N     . ALA A 1 68  ? 42.523 11.969  16.487  1.00 10.28 ? 65   ALA A N     1 
ATOM   546  C  CA    . ALA A 1 68  ? 43.574 12.912  16.857  1.00 13.27 ? 65   ALA A CA    1 
ATOM   547  C  C     . ALA A 1 68  ? 43.448 13.418  18.299  1.00 11.46 ? 65   ALA A C     1 
ATOM   548  O  O     . ALA A 1 68  ? 44.451 13.693  18.951  1.00 11.98 ? 65   ALA A O     1 
ATOM   549  C  CB    . ALA A 1 68  ? 43.640 14.080  15.875  1.00 13.94 ? 65   ALA A CB    1 
ATOM   550  N  N     . ASP A 1 69  ? 42.228 13.532  18.814  1.00 15.36 ? 66   ASP A N     1 
ATOM   551  C  CA    . ASP A 1 69  ? 42.081 13.990  20.203  1.00 15.00 ? 66   ASP A CA    1 
ATOM   552  C  C     . ASP A 1 69  ? 42.680 12.964  21.166  1.00 13.21 ? 66   ASP A C     1 
ATOM   553  O  O     . ASP A 1 69  ? 43.216 13.314  22.223  1.00 13.70 ? 66   ASP A O     1 
ATOM   554  C  CB    . ASP A 1 69  ? 40.617 14.236  20.553  1.00 16.56 ? 66   ASP A CB    1 
ATOM   555  C  CG    . ASP A 1 69  ? 40.053 15.489  19.892  1.00 18.64 ? 66   ASP A CG    1 
ATOM   556  O  OD1   . ASP A 1 69  ? 40.828 16.287  19.320  1.00 24.65 ? 66   ASP A OD1   1 
ATOM   557  O  OD2   . ASP A 1 69  ? 38.827 15.680  19.969  1.00 24.94 ? 66   ASP A OD2   1 
ATOM   558  N  N     . ASP A 1 70  ? 42.574 11.694  20.797  1.00 12.02 ? 67   ASP A N     1 
ATOM   559  C  CA    . ASP A 1 70  ? 43.127 10.619  21.603  1.00 14.37 ? 67   ASP A CA    1 
ATOM   560  C  C     . ASP A 1 70  ? 44.640 10.531  21.461  1.00 12.60 ? 67   ASP A C     1 
ATOM   561  O  O     . ASP A 1 70  ? 45.358 10.364  22.448  1.00 14.42 ? 67   ASP A O     1 
ATOM   562  C  CB    . ASP A 1 70  ? 42.453 9.293   21.232  1.00 13.93 ? 67   ASP A CB    1 
ATOM   563  C  CG    . ASP A 1 70  ? 40.983 9.269   21.618  1.00 21.97 ? 67   ASP A CG    1 
ATOM   564  O  OD1   . ASP A 1 70  ? 40.613 9.997   22.568  1.00 22.91 ? 67   ASP A OD1   1 
ATOM   565  O  OD2   . ASP A 1 70  ? 40.200 8.530   20.977  1.00 22.22 ? 67   ASP A OD2   1 
ATOM   566  N  N     . ALA A 1 71  ? 45.130 10.642  20.229  1.00 10.39 ? 68   ALA A N     1 
ATOM   567  C  CA    . ALA A 1 71  ? 46.570 10.709  19.990  1.00 9.32  ? 68   ALA A CA    1 
ATOM   568  C  C     . ALA A 1 71  ? 47.225 11.813  20.826  1.00 10.56 ? 68   ALA A C     1 
ATOM   569  O  O     . ALA A 1 71  ? 48.335 11.650  21.330  1.00 13.15 ? 68   ALA A O     1 
ATOM   570  C  CB    . ALA A 1 71  ? 46.847 10.950  18.510  1.00 11.88 ? 68   ALA A CB    1 
ATOM   571  N  N     . LYS A 1 72  ? 46.552 12.954  20.926  1.00 9.34  ? 69   LYS A N     1 
ATOM   572  C  CA    . LYS A 1 72  ? 47.076 14.105  21.667  1.00 12.07 ? 69   LYS A CA    1 
ATOM   573  C  C     . LYS A 1 72  ? 47.209 13.794  23.160  1.00 15.75 ? 69   LYS A C     1 
ATOM   574  O  O     . LYS A 1 72  ? 48.021 14.399  23.873  1.00 12.80 ? 69   LYS A O     1 
ATOM   575  C  CB    . LYS A 1 72  ? 46.153 15.314  21.465  1.00 15.03 ? 69   LYS A CB    1 
ATOM   576  C  CG    . LYS A 1 72  ? 46.503 16.170  20.231  1.00 17.67 ? 69   LYS A CG    1 
ATOM   577  C  CD    . LYS A 1 72  ? 47.719 17.047  20.530  1.00 16.69 ? 69   LYS A CD    1 
ATOM   578  C  CE    . LYS A 1 72  ? 47.926 18.146  19.482  1.00 21.55 ? 69   LYS A CE    1 
ATOM   579  N  NZ    . LYS A 1 72  ? 49.238 18.858  19.687  1.00 18.65 ? 69   LYS A NZ    1 
ATOM   580  N  N     . LYS A 1 73  ? 46.401 12.854  23.636  1.00 14.83 ? 70   LYS A N     1 
ATOM   581  C  CA    . LYS A 1 73  ? 46.517 12.413  25.020  1.00 13.77 ? 70   LYS A CA    1 
ATOM   582  C  C     . LYS A 1 73  ? 47.826 11.645  25.243  1.00 16.18 ? 70   LYS A C     1 
ATOM   583  O  O     . LYS A 1 73  ? 48.416 11.708  26.320  1.00 16.84 ? 70   LYS A O     1 
ATOM   584  C  CB    . LYS A 1 73  ? 45.312 11.554  25.406  1.00 10.63 ? 70   LYS A CB    1 
ATOM   585  C  CG    . LYS A 1 73  ? 43.978 12.272  25.278  1.00 12.96 ? 70   LYS A CG    1 
ATOM   586  C  CD    . LYS A 1 73  ? 42.822 11.308  25.552  1.00 14.52 ? 70   LYS A CD    1 
ATOM   587  C  CE    . LYS A 1 73  ? 41.476 11.989  25.309  1.00 15.57 ? 70   LYS A CE    1 
ATOM   588  N  NZ    . LYS A 1 73  ? 40.364 10.979  25.204  1.00 20.18 ? 70   LYS A NZ    1 
ATOM   589  N  N     . LEU A 1 74  ? 48.283 10.925  24.219  1.00 10.81 ? 71   LEU A N     1 
ATOM   590  C  CA    . LEU A 1 74  ? 49.541 10.177  24.321  1.00 15.44 ? 71   LEU A CA    1 
ATOM   591  C  C     . LEU A 1 74  ? 50.742 11.063  24.007  1.00 18.62 ? 71   LEU A C     1 
ATOM   592  O  O     . LEU A 1 74  ? 51.858 10.849  24.509  1.00 13.96 ? 71   LEU A O     1 
ATOM   593  C  CB    . LEU A 1 74  ? 49.537 8.990   23.359  1.00 11.94 ? 71   LEU A CB    1 
ATOM   594  C  CG    . LEU A 1 74  ? 48.462 7.927   23.584  1.00 16.40 ? 71   LEU A CG    1 
ATOM   595  C  CD1   . LEU A 1 74  ? 48.545 6.897   22.477  1.00 18.84 ? 71   LEU A CD1   1 
ATOM   596  C  CD2   . LEU A 1 74  ? 48.645 7.256   24.949  1.00 11.35 ? 71   LEU A CD2   1 
ATOM   597  N  N     . CYS A 1 75  ? 50.505 12.052  23.154  1.00 15.35 ? 72   CYS A N     1 
ATOM   598  C  CA    . CYS A 1 75  ? 51.580 12.863  22.603  1.00 13.94 ? 72   CYS A CA    1 
ATOM   599  C  C     . CYS A 1 75  ? 51.080 14.288  22.466  1.00 17.22 ? 72   CYS A C     1 
ATOM   600  O  O     . CYS A 1 75  ? 50.584 14.686  21.403  1.00 14.46 ? 72   CYS A O     1 
ATOM   601  C  CB    . CYS A 1 75  ? 51.995 12.305  21.244  1.00 14.11 ? 72   CYS A CB    1 
ATOM   602  S  SG    . CYS A 1 75  ? 53.378 13.181  20.468  1.00 19.46 ? 72   CYS A SG    1 
ATOM   603  N  N     . PRO A 1 76  ? 51.176 15.064  23.558  1.00 14.05 ? 73   PRO A N     1 
ATOM   604  C  CA    . PRO A 1 76  ? 50.580 16.401  23.606  1.00 18.54 ? 73   PRO A CA    1 
ATOM   605  C  C     . PRO A 1 76  ? 51.182 17.355  22.581  1.00 15.17 ? 73   PRO A C     1 
ATOM   606  O  O     . PRO A 1 76  ? 50.493 18.279  22.142  1.00 20.63 ? 73   PRO A O     1 
ATOM   607  C  CB    . PRO A 1 76  ? 50.881 16.871  25.035  1.00 19.22 ? 73   PRO A CB    1 
ATOM   608  C  CG    . PRO A 1 76  ? 51.034 15.605  25.815  1.00 26.45 ? 73   PRO A CG    1 
ATOM   609  C  CD    . PRO A 1 76  ? 51.685 14.633  24.871  1.00 18.43 ? 73   PRO A CD    1 
ATOM   610  N  N     . ASP A 1 77  ? 52.438 17.140  22.209  1.00 17.84 ? 74   ASP A N     1 
ATOM   611  C  CA    . ASP A 1 77  ? 53.096 18.017  21.246  1.00 20.35 ? 74   ASP A CA    1 
ATOM   612  C  C     . ASP A 1 77  ? 52.988 17.510  19.807  1.00 20.01 ? 74   ASP A C     1 
ATOM   613  O  O     . ASP A 1 77  ? 53.666 18.025  18.912  1.00 16.59 ? 74   ASP A O     1 
ATOM   614  C  CB    . ASP A 1 77  ? 54.565 18.207  21.612  1.00 21.98 ? 74   ASP A CB    1 
ATOM   615  C  CG    . ASP A 1 77  ? 54.741 18.984  22.902  1.00 33.79 ? 74   ASP A CG    1 
ATOM   616  O  OD1   . ASP A 1 77  ? 55.732 18.731  23.615  1.00 36.76 ? 74   ASP A OD1   1 
ATOM   617  O  OD2   . ASP A 1 77  ? 53.883 19.845  23.201  1.00 33.07 ? 74   ASP A OD2   1 
ATOM   618  N  N     . LEU A 1 78  ? 52.147 16.502  19.593  1.00 14.65 ? 75   LEU A N     1 
ATOM   619  C  CA    . LEU A 1 78  ? 51.934 15.951  18.252  1.00 13.83 ? 75   LEU A CA    1 
ATOM   620  C  C     . LEU A 1 78  ? 51.562 17.071  17.285  1.00 12.22 ? 75   LEU A C     1 
ATOM   621  O  O     . LEU A 1 78  ? 50.679 17.878  17.577  1.00 11.56 ? 75   LEU A O     1 
ATOM   622  C  CB    . LEU A 1 78  ? 50.813 14.911  18.281  1.00 10.57 ? 75   LEU A CB    1 
ATOM   623  C  CG    . LEU A 1 78  ? 50.453 14.201  16.970  1.00 7.79  ? 75   LEU A CG    1 
ATOM   624  C  CD1   . LEU A 1 78  ? 51.634 13.351  16.518  1.00 11.32 ? 75   LEU A CD1   1 
ATOM   625  C  CD2   . LEU A 1 78  ? 49.216 13.334  17.160  1.00 12.70 ? 75   LEU A CD2   1 
ATOM   626  N  N     . LEU A 1 79  ? 52.237 17.137  16.140  1.00 10.92 ? 76   LEU A N     1 
ATOM   627  C  CA    . LEU A 1 79  ? 51.845 18.087  15.100  1.00 9.15  ? 76   LEU A CA    1 
ATOM   628  C  C     . LEU A 1 79  ? 50.958 17.370  14.082  1.00 14.72 ? 76   LEU A C     1 
ATOM   629  O  O     . LEU A 1 79  ? 51.098 16.174  13.868  1.00 9.66  ? 76   LEU A O     1 
ATOM   630  C  CB    . LEU A 1 79  ? 53.078 18.668  14.401  1.00 9.91  ? 76   LEU A CB    1 
ATOM   631  C  CG    . LEU A 1 79  ? 54.039 19.399  15.337  1.00 11.92 ? 76   LEU A CG    1 
ATOM   632  C  CD1   . LEU A 1 79  ? 55.206 19.984  14.573  1.00 15.25 ? 76   LEU A CD1   1 
ATOM   633  C  CD2   . LEU A 1 79  ? 53.301 20.474  16.132  1.00 10.25 ? 76   LEU A CD2   1 
ATOM   634  N  N     . LEU A 1 80  ? 50.049 18.095  13.447  1.00 14.75 ? 77   LEU A N     1 
ATOM   635  C  CA    . LEU A 1 80  ? 49.131 17.455  12.509  1.00 11.59 ? 77   LEU A CA    1 
ATOM   636  C  C     . LEU A 1 80  ? 49.122 18.174  11.164  1.00 15.06 ? 77   LEU A C     1 
ATOM   637  O  O     . LEU A 1 80  ? 49.213 19.400  11.099  1.00 15.08 ? 77   LEU A O     1 
ATOM   638  C  CB    . LEU A 1 80  ? 47.712 17.452  13.067  1.00 12.91 ? 77   LEU A CB    1 
ATOM   639  C  CG    . LEU A 1 80  ? 47.482 16.742  14.385  1.00 12.07 ? 77   LEU A CG    1 
ATOM   640  C  CD1   . LEU A 1 80  ? 46.043 16.984  14.828  1.00 16.33 ? 77   LEU A CD1   1 
ATOM   641  C  CD2   . LEU A 1 80  ? 47.788 15.253  14.190  1.00 13.54 ? 77   LEU A CD2   1 
ATOM   642  N  N     . ALA A 1 81  ? 49.020 17.404  10.092  1.00 9.66  ? 78   ALA A N     1 
ATOM   643  C  CA    . ALA A 1 81  ? 48.699 17.964  8.789   1.00 12.34 ? 78   ALA A CA    1 
ATOM   644  C  C     . ALA A 1 81  ? 47.384 17.343  8.347   1.00 11.79 ? 78   ALA A C     1 
ATOM   645  O  O     . ALA A 1 81  ? 47.150 16.146  8.545   1.00 15.53 ? 78   ALA A O     1 
ATOM   646  C  CB    . ALA A 1 81  ? 49.810 17.686  7.793   1.00 13.05 ? 78   ALA A CB    1 
ATOM   647  N  N     . GLN A 1 82  ? 46.507 18.152  7.769   1.00 12.03 ? 79   GLN A N     1 
ATOM   648  C  CA    . GLN A 1 82  ? 45.187 17.678  7.364   1.00 14.21 ? 79   GLN A CA    1 
ATOM   649  C  C     . GLN A 1 82  ? 45.136 17.378  5.884   1.00 13.31 ? 79   GLN A C     1 
ATOM   650  O  O     . GLN A 1 82  ? 45.665 18.144  5.074   1.00 13.39 ? 79   GLN A O     1 
ATOM   651  C  CB    . GLN A 1 82  ? 44.130 18.745  7.627   1.00 17.09 ? 79   GLN A CB    1 
ATOM   652  C  CG    . GLN A 1 82  ? 43.897 19.092  9.061   1.00 27.12 ? 79   GLN A CG    1 
ATOM   653  C  CD    . GLN A 1 82  ? 42.851 20.173  9.184   1.00 34.00 ? 79   GLN A CD    1 
ATOM   654  O  OE1   . GLN A 1 82  ? 43.161 21.311  9.528   1.00 29.13 ? 79   GLN A OE1   1 
ATOM   655  N  NE2   . GLN A 1 82  ? 41.603 19.830  8.869   1.00 31.33 ? 79   GLN A NE2   1 
ATOM   656  N  N     . VAL A 1 83  ? 44.480 16.278  5.533   1.00 10.54 ? 80   VAL A N     1 
ATOM   657  C  CA    . VAL A 1 83  ? 44.201 15.983  4.139   1.00 11.85 ? 80   VAL A CA    1 
ATOM   658  C  C     . VAL A 1 83  ? 43.315 17.081  3.562   1.00 14.04 ? 80   VAL A C     1 
ATOM   659  O  O     . VAL A 1 83  ? 42.381 17.556  4.206   1.00 10.81 ? 80   VAL A O     1 
ATOM   660  C  CB    . VAL A 1 83  ? 43.517 14.620  3.972   1.00 10.58 ? 80   VAL A CB    1 
ATOM   661  C  CG1   . VAL A 1 83  ? 43.182 14.363  2.510   1.00 10.21 ? 80   VAL A CG1   1 
ATOM   662  C  CG2   . VAL A 1 83  ? 44.426 13.500  4.511   1.00 13.96 ? 80   VAL A CG2   1 
ATOM   663  N  N     . ARG A 1 84  ? 43.618 17.478  2.341   1.00 14.71 ? 81   ARG A N     1 
ATOM   664  C  CA    . ARG A 1 84  ? 42.825 18.489  1.653   1.00 15.92 ? 81   ARG A CA    1 
ATOM   665  C  C     . ARG A 1 84  ? 41.367 18.057  1.482   1.00 14.71 ? 81   ARG A C     1 
ATOM   666  O  O     . ARG A 1 84  ? 41.064 16.874  1.299   1.00 11.70 ? 81   ARG A O     1 
ATOM   667  C  CB    . ARG A 1 84  ? 43.448 18.776  0.292   1.00 17.75 ? 81   ARG A CB    1 
ATOM   668  C  CG    . ARG A 1 84  ? 42.559 19.591  -0.636  1.00 21.20 ? 81   ARG A CG    1 
ATOM   669  C  CD    . ARG A 1 84  ? 43.312 19.949  -1.909  1.00 31.12 ? 81   ARG A CD    1 
ATOM   670  N  NE    . ARG A 1 84  ? 42.401 20.104  -3.038  1.00 35.80 ? 81   ARG A NE    1 
ATOM   671  C  CZ    . ARG A 1 84  ? 42.791 20.339  -4.286  1.00 46.11 ? 81   ARG A CZ    1 
ATOM   672  N  NH1   . ARG A 1 84  ? 44.086 20.452  -4.561  1.00 44.56 ? 81   ARG A NH1   1 
ATOM   673  N  NH2   . ARG A 1 84  ? 41.886 20.459  -5.254  1.00 39.47 ? 81   ARG A NH2   1 
ATOM   674  N  N     . GLU A 1 85  ? 40.460 19.026  1.549   1.00 13.12 ? 82   GLU A N     1 
ATOM   675  C  CA    . GLU A 1 85  ? 39.053 18.769  1.317   1.00 14.76 ? 82   GLU A CA    1 
ATOM   676  C  C     . GLU A 1 85  ? 38.582 19.537  0.083   1.00 16.62 ? 82   GLU A C     1 
ATOM   677  O  O     . GLU A 1 85  ? 38.839 20.733  -0.046  1.00 16.68 ? 82   GLU A O     1 
ATOM   678  C  CB    . GLU A 1 85  ? 38.224 19.159  2.540   1.00 17.59 ? 82   GLU A CB    1 
ATOM   679  C  CG    . GLU A 1 85  ? 38.227 18.094  3.631   1.00 19.55 ? 82   GLU A CG    1 
ATOM   680  C  CD    . GLU A 1 85  ? 37.473 18.534  4.882   1.00 27.45 ? 82   GLU A CD    1 
ATOM   681  O  OE1   . GLU A 1 85  ? 36.241 18.782  4.800   1.00 29.11 ? 82   GLU A OE1   1 
ATOM   682  O  OE2   . GLU A 1 85  ? 38.121 18.635  5.946   1.00 31.06 ? 82   GLU A OE2   1 
ATOM   683  N  N     . SER A 1 86  ? 37.922 18.830  -0.829  1.00 14.87 ? 83   SER A N     1 
ATOM   684  C  CA    . SER A 1 86  ? 37.333 19.442  -2.007  1.00 15.62 ? 83   SER A CA    1 
ATOM   685  C  C     . SER A 1 86  ? 35.961 18.837  -2.250  1.00 17.65 ? 83   SER A C     1 
ATOM   686  O  O     . SER A 1 86  ? 35.768 17.633  -2.088  1.00 17.61 ? 83   SER A O     1 
ATOM   687  C  CB    . SER A 1 86  ? 38.208 19.214  -3.241  1.00 16.92 ? 83   SER A CB    1 
ATOM   688  O  OG    . SER A 1 86  ? 39.520 19.707  -3.036  1.00 23.95 ? 83   SER A OG    1 
ATOM   689  N  N     . ARG A 1 87  ? 35.012 19.676  -2.649  1.00 17.26 ? 84   ARG A N     1 
ATOM   690  C  CA    . ARG A 1 87  ? 33.654 19.220  -2.916  1.00 23.25 ? 84   ARG A CA    1 
ATOM   691  C  C     . ARG A 1 87  ? 33.063 18.484  -1.730  1.00 19.45 ? 84   ARG A C     1 
ATOM   692  O  O     . ARG A 1 87  ? 32.281 17.545  -1.891  1.00 22.28 ? 84   ARG A O     1 
ATOM   693  C  CB    . ARG A 1 87  ? 33.617 18.337  -4.162  1.00 19.84 ? 84   ARG A CB    1 
ATOM   694  C  CG    . ARG A 1 87  ? 34.218 19.006  -5.377  1.00 22.90 ? 84   ARG A CG    1 
ATOM   695  C  CD    . ARG A 1 87  ? 33.979 18.182  -6.631  1.00 22.76 ? 84   ARG A CD    1 
ATOM   696  N  NE    . ARG A 1 87  ? 34.789 18.663  -7.742  1.00 28.35 ? 84   ARG A NE    1 
ATOM   697  C  CZ    . ARG A 1 87  ? 36.090 18.422  -7.873  1.00 27.86 ? 84   ARG A CZ    1 
ATOM   698  N  NH1   . ARG A 1 87  ? 36.734 17.706  -6.954  1.00 34.14 ? 84   ARG A NH1   1 
ATOM   699  N  NH2   . ARG A 1 87  ? 36.750 18.903  -8.919  1.00 34.47 ? 84   ARG A NH2   1 
ATOM   700  N  N     . GLY A 1 88  ? 33.434 18.916  -0.533  1.00 13.19 ? 85   GLY A N     1 
ATOM   701  C  CA    . GLY A 1 88  ? 32.902 18.336  0.683   1.00 17.09 ? 85   GLY A CA    1 
ATOM   702  C  C     . GLY A 1 88  ? 33.532 17.031  1.143   1.00 20.52 ? 85   GLY A C     1 
ATOM   703  O  O     . GLY A 1 88  ? 33.047 16.430  2.096   1.00 18.83 ? 85   GLY A O     1 
ATOM   704  N  N     . LYS A 1 89  ? 34.600 16.583  0.480   1.00 12.41 ? 86   LYS A N     1 
ATOM   705  C  CA    . LYS A 1 89  ? 35.207 15.295  0.823   1.00 11.55 ? 86   LYS A CA    1 
ATOM   706  C  C     . LYS A 1 89  ? 36.737 15.336  0.832   1.00 12.92 ? 86   LYS A C     1 
ATOM   707  O  O     . LYS A 1 89  ? 37.344 16.226  0.239   1.00 15.70 ? 86   LYS A O     1 
ATOM   708  C  CB    . LYS A 1 89  ? 34.743 14.208  -0.150  1.00 14.35 ? 86   LYS A CB    1 
ATOM   709  C  CG    . LYS A 1 89  ? 35.248 14.380  -1.585  1.00 15.15 ? 86   LYS A CG    1 
ATOM   710  C  CD    . LYS A 1 89  ? 34.683 13.306  -2.526  1.00 18.78 ? 86   LYS A CD    1 
ATOM   711  C  CE    . LYS A 1 89  ? 35.234 11.922  -2.210  1.00 14.74 ? 86   LYS A CE    1 
ATOM   712  N  NZ    . LYS A 1 89  ? 36.711 11.838  -2.414  1.00 15.31 ? 86   LYS A NZ    1 
ATOM   713  N  N     . ALA A 1 90  ? 37.357 14.371  1.507   1.00 15.31 ? 87   ALA A N     1 
ATOM   714  C  CA    . ALA A 1 90  ? 38.816 14.280  1.522   1.00 12.85 ? 87   ALA A CA    1 
ATOM   715  C  C     . ALA A 1 90  ? 39.259 14.041  0.103   1.00 14.75 ? 87   ALA A C     1 
ATOM   716  O  O     . ALA A 1 90  ? 38.600 13.307  -0.644  1.00 15.08 ? 87   ALA A O     1 
ATOM   717  C  CB    . ALA A 1 90  ? 39.288 13.150  2.419   1.00 16.78 ? 87   ALA A CB    1 
ATOM   718  N  N     . ASN A 1 91  ? 40.358 14.690  -0.268  1.00 14.14 ? 88   ASN A N     1 
ATOM   719  C  CA    . ASN A 1 91  ? 40.905 14.595  -1.617  1.00 13.36 ? 88   ASN A CA    1 
ATOM   720  C  C     . ASN A 1 91  ? 42.385 14.216  -1.568  1.00 10.82 ? 88   ASN A C     1 
ATOM   721  O  O     . ASN A 1 91  ? 43.212 14.965  -1.038  1.00 12.61 ? 88   ASN A O     1 
ATOM   722  C  CB    . ASN A 1 91  ? 40.715 15.921  -2.358  1.00 15.93 ? 88   ASN A CB    1 
ATOM   723  C  CG    . ASN A 1 91  ? 41.144 15.834  -3.812  1.00 21.29 ? 88   ASN A CG    1 
ATOM   724  O  OD1   . ASN A 1 91  ? 42.281 15.486  -4.108  1.00 15.56 ? 88   ASN A OD1   1 
ATOM   725  N  ND2   . ASN A 1 91  ? 40.219 16.102  -4.725  1.00 25.81 ? 88   ASN A ND2   1 
ATOM   726  N  N     . LEU A 1 92  ? 42.713 13.044  -2.101  1.00 12.27 ? 89   LEU A N     1 
ATOM   727  C  CA    . LEU A 1 92  ? 44.050 12.481  -1.919  1.00 14.40 ? 89   LEU A CA    1 
ATOM   728  C  C     . LEU A 1 92  ? 45.008 12.744  -3.084  1.00 13.19 ? 89   LEU A C     1 
ATOM   729  O  O     . LEU A 1 92  ? 46.048 12.088  -3.205  1.00 10.62 ? 89   LEU A O     1 
ATOM   730  C  CB    . LEU A 1 92  ? 43.957 10.970  -1.666  1.00 11.34 ? 89   LEU A CB    1 
ATOM   731  C  CG    . LEU A 1 92  ? 43.023 10.520  -0.538  1.00 13.01 ? 89   LEU A CG    1 
ATOM   732  C  CD1   . LEU A 1 92  ? 42.887 9.012   -0.552  1.00 15.87 ? 89   LEU A CD1   1 
ATOM   733  C  CD2   . LEU A 1 92  ? 43.561 11.004  0.809   1.00 15.40 ? 89   LEU A CD2   1 
ATOM   734  N  N     . THR A 1 93  ? 44.671 13.712  -3.928  1.00 11.96 ? 90   THR A N     1 
ATOM   735  C  CA    . THR A 1 93  ? 45.502 14.020  -5.093  1.00 12.52 ? 90   THR A CA    1 
ATOM   736  C  C     . THR A 1 93  ? 46.988 14.273  -4.790  1.00 14.31 ? 90   THR A C     1 
ATOM   737  O  O     . THR A 1 93  ? 47.866 13.784  -5.509  1.00 11.84 ? 90   THR A O     1 
ATOM   738  C  CB    . THR A 1 93  ? 44.940 15.226  -5.875  1.00 16.61 ? 90   THR A CB    1 
ATOM   739  O  OG1   . THR A 1 93  ? 43.601 14.926  -6.304  1.00 15.86 ? 90   THR A OG1   1 
ATOM   740  C  CG2   . THR A 1 93  ? 45.810 15.513  -7.080  1.00 12.91 ? 90   THR A CG2   1 
ATOM   741  N  N     . LYS A 1 94  ? 47.277 15.045  -3.750  1.00 12.05 ? 91   LYS A N     1 
ATOM   742  C  CA    . LYS A 1 94  ? 48.668 15.368  -3.426  1.00 12.55 ? 91   LYS A CA    1 
ATOM   743  C  C     . LYS A 1 94  ? 49.521 14.104  -3.224  1.00 9.34  ? 91   LYS A C     1 
ATOM   744  O  O     . LYS A 1 94  ? 50.688 14.054  -3.632  1.00 12.29 ? 91   LYS A O     1 
ATOM   745  C  CB    . LYS A 1 94  ? 48.750 16.257  -2.184  1.00 13.77 ? 91   LYS A CB    1 
ATOM   746  C  CG    . LYS A 1 94  ? 50.163 16.780  -1.895  1.00 13.76 ? 91   LYS A CG    1 
ATOM   747  C  CD    . LYS A 1 94  ? 50.296 17.319  -0.455  1.00 13.57 ? 91   LYS A CD    1 
ATOM   748  C  CE    . LYS A 1 94  ? 49.323 18.455  -0.175  1.00 20.36 ? 91   LYS A CE    1 
ATOM   749  N  NZ    . LYS A 1 94  ? 49.470 19.011  1.208   1.00 11.60 ? 91   LYS A NZ    1 
ATOM   750  N  N     . TYR A 1 95  ? 48.937 13.084  -2.606  1.00 10.24 ? 92   TYR A N     1 
ATOM   751  C  CA    . TYR A 1 95  ? 49.673 11.860  -2.296  1.00 10.23 ? 92   TYR A CA    1 
ATOM   752  C  C     . TYR A 1 95  ? 49.780 10.962  -3.525  1.00 9.41  ? 92   TYR A C     1 
ATOM   753  O  O     . TYR A 1 95  ? 50.816 10.316  -3.753  1.00 9.50  ? 92   TYR A O     1 
ATOM   754  C  CB    . TYR A 1 95  ? 49.029 11.132  -1.107  1.00 10.72 ? 92   TYR A CB    1 
ATOM   755  C  CG    . TYR A 1 95  ? 48.702 12.116  -0.012  1.00 9.95  ? 92   TYR A CG    1 
ATOM   756  C  CD1   . TYR A 1 95  ? 47.392 12.499  0.228   1.00 14.14 ? 92   TYR A CD1   1 
ATOM   757  C  CD2   . TYR A 1 95  ? 49.716 12.725  0.724   1.00 9.29  ? 92   TYR A CD2   1 
ATOM   758  C  CE1   . TYR A 1 95  ? 47.092 13.434  1.207   1.00 13.06 ? 92   TYR A CE1   1 
ATOM   759  C  CE2   . TYR A 1 95  ? 49.431 13.645  1.691   1.00 10.08 ? 92   TYR A CE2   1 
ATOM   760  C  CZ    . TYR A 1 95  ? 48.108 14.003  1.923   1.00 10.38 ? 92   TYR A CZ    1 
ATOM   761  O  OH    . TYR A 1 95  ? 47.805 14.933  2.884   1.00 14.56 ? 92   TYR A OH    1 
ATOM   762  N  N     . ARG A 1 96  ? 48.718 10.938  -4.328  1.00 8.12  ? 93   ARG A N     1 
ATOM   763  C  CA    . ARG A 1 96  ? 48.746 10.214  -5.606  1.00 9.81  ? 93   ARG A CA    1 
ATOM   764  C  C     . ARG A 1 96  ? 49.854 10.755  -6.519  1.00 11.88 ? 93   ARG A C     1 
ATOM   765  O  O     . ARG A 1 96  ? 50.587 9.984   -7.158  1.00 12.11 ? 93   ARG A O     1 
ATOM   766  C  CB    . ARG A 1 96  ? 47.384 10.284  -6.313  1.00 10.50 ? 93   ARG A CB    1 
ATOM   767  C  CG    . ARG A 1 96  ? 46.303 9.435   -5.640  1.00 13.41 ? 93   ARG A CG    1 
ATOM   768  C  CD    . ARG A 1 96  ? 45.096 9.169   -6.546  1.00 14.00 ? 93   ARG A CD    1 
ATOM   769  N  NE    . ARG A 1 96  ? 44.039 8.486   -5.806  1.00 17.32 ? 93   ARG A NE    1 
ATOM   770  C  CZ    . ARG A 1 96  ? 43.017 9.100   -5.207  1.00 15.76 ? 93   ARG A CZ    1 
ATOM   771  N  NH1   . ARG A 1 96  ? 42.125 8.383   -4.533  1.00 15.65 ? 93   ARG A NH1   1 
ATOM   772  N  NH2   . ARG A 1 96  ? 42.890 10.426  -5.268  1.00 11.69 ? 93   ARG A NH2   1 
ATOM   773  N  N     . GLU A 1 97  ? 49.981 12.079  -6.571  1.00 8.66  ? 94   GLU A N     1 
ATOM   774  C  CA    . GLU A 1 97  ? 51.005 12.716  -7.395  1.00 12.71 ? 94   GLU A CA    1 
ATOM   775  C  C     . GLU A 1 97  ? 52.416 12.463  -6.862  1.00 13.22 ? 94   GLU A C     1 
ATOM   776  O  O     . GLU A 1 97  ? 53.327 12.183  -7.640  1.00 10.17 ? 94   GLU A O     1 
ATOM   777  C  CB    . GLU A 1 97  ? 50.710 14.207  -7.583  1.00 16.70 ? 94   GLU A CB    1 
ATOM   778  C  CG    . GLU A 1 97  ? 49.410 14.434  -8.377  1.00 21.35 ? 94   GLU A CG    1 
ATOM   779  C  CD    . GLU A 1 97  ? 49.025 15.896  -8.565  1.00 28.52 ? 94   GLU A CD    1 
ATOM   780  O  OE1   . GLU A 1 97  ? 49.633 16.781  -7.936  1.00 30.36 ? 94   GLU A OE1   1 
ATOM   781  O  OE2   . GLU A 1 97  ? 48.091 16.156  -9.354  1.00 28.34 ? 94   GLU A OE2   1 
ATOM   782  N  N     . ALA A 1 98  ? 52.595 12.526  -5.543  1.00 8.37  ? 95   ALA A N     1 
ATOM   783  C  CA    . ALA A 1 98  ? 53.882 12.132  -4.951  1.00 9.89  ? 95   ALA A CA    1 
ATOM   784  C  C     . ALA A 1 98  ? 54.237 10.677  -5.262  1.00 10.58 ? 95   ALA A C     1 
ATOM   785  O  O     . ALA A 1 98  ? 55.403 10.346  -5.489  1.00 13.54 ? 95   ALA A O     1 
ATOM   786  C  CB    . ALA A 1 98  ? 53.882 12.366  -3.449  1.00 8.00  ? 95   ALA A CB    1 
ATOM   787  N  N     . SER A 1 99  ? 53.236 9.804   -5.250  1.00 10.09 ? 96   SER A N     1 
ATOM   788  C  CA    . SER A 1 99  ? 53.454 8.396   -5.566  1.00 12.70 ? 96   SER A CA    1 
ATOM   789  C  C     . SER A 1 99  ? 53.983 8.235   -6.988  1.00 10.28 ? 96   SER A C     1 
ATOM   790  O  O     . SER A 1 99  ? 54.926 7.485   -7.243  1.00 12.45 ? 96   SER A O     1 
ATOM   791  C  CB    . SER A 1 99  ? 52.147 7.627   -5.422  1.00 12.50 ? 96   SER A CB    1 
ATOM   792  O  OG    . SER A 1 99  ? 52.335 6.286   -5.794  1.00 14.56 ? 96   SER A OG    1 
ATOM   793  N  N     . VAL A 1 100 ? 53.366 8.941   -7.924  1.00 11.56 ? 97   VAL A N     1 
ATOM   794  C  CA    . VAL A 1 100 ? 53.883 8.950   -9.291  1.00 12.20 ? 97   VAL A CA    1 
ATOM   795  C  C     . VAL A 1 100 ? 55.360 9.348   -9.356  1.00 12.10 ? 97   VAL A C     1 
ATOM   796  O  O     . VAL A 1 100 ? 56.129 8.728   -10.094 1.00 12.46 ? 97   VAL A O     1 
ATOM   797  C  CB    . VAL A 1 100 ? 53.042 9.853   -10.191 1.00 14.47 ? 97   VAL A CB    1 
ATOM   798  C  CG1   . VAL A 1 100 ? 53.700 9.993   -11.570 1.00 16.91 ? 97   VAL A CG1   1 
ATOM   799  C  CG2   . VAL A 1 100 ? 51.633 9.280   -10.304 1.00 12.48 ? 97   VAL A CG2   1 
ATOM   800  N  N     . GLU A 1 101 ? 55.768 10.361  -8.586  1.00 9.41  ? 98   GLU A N     1 
ATOM   801  C  CA    . GLU A 1 101 ? 57.173 10.788  -8.579  1.00 10.47 ? 98   GLU A CA    1 
ATOM   802  C  C     . GLU A 1 101 ? 58.087 9.609   -8.278  1.00 13.69 ? 98   GLU A C     1 
ATOM   803  O  O     . GLU A 1 101 ? 59.116 9.407   -8.939  1.00 11.24 ? 98   GLU A O     1 
ATOM   804  C  CB    . GLU A 1 101 ? 57.447 11.846  -7.492  1.00 12.22 ? 98   GLU A CB    1 
ATOM   805  C  CG    . GLU A 1 101 ? 57.008 13.269  -7.794  1.00 15.55 ? 98   GLU A CG    1 
ATOM   806  C  CD    . GLU A 1 101 ? 57.363 14.230  -6.653  1.00 15.25 ? 98   GLU A CD    1 
ATOM   807  O  OE1   . GLU A 1 101 ? 58.543 14.617  -6.535  1.00 14.73 ? 98   GLU A OE1   1 
ATOM   808  O  OE2   . GLU A 1 101 ? 56.461 14.580  -5.864  1.00 19.51 ? 98   GLU A OE2   1 
ATOM   809  N  N     . VAL A 1 102 ? 57.730 8.856   -7.243  1.00 9.60  ? 99   VAL A N     1 
ATOM   810  C  CA    . VAL A 1 102 ? 58.569 7.755   -6.808  1.00 10.21 ? 99   VAL A CA    1 
ATOM   811  C  C     . VAL A 1 102 ? 58.520 6.585   -7.785  1.00 11.25 ? 99   VAL A C     1 
ATOM   812  O  O     . VAL A 1 102 ? 59.554 5.979   -8.083  1.00 12.96 ? 99   VAL A O     1 
ATOM   813  C  CB    . VAL A 1 102 ? 58.166 7.248   -5.416  1.00 9.99  ? 99   VAL A CB    1 
ATOM   814  C  CG1   . VAL A 1 102 ? 58.885 5.933   -5.125  1.00 13.22 ? 99   VAL A CG1   1 
ATOM   815  C  CG2   . VAL A 1 102 ? 58.495 8.307   -4.363  1.00 12.65 ? 99   VAL A CG2   1 
ATOM   816  N  N     . MET A 1 103 ? 57.324 6.275   -8.282  1.00 9.08  ? 100  MET A N     1 
ATOM   817  C  CA    . MET A 1 103 ? 57.137 5.138   -9.174  1.00 11.59 ? 100  MET A CA    1 
ATOM   818  C  C     . MET A 1 103 ? 57.933 5.358   -10.458 1.00 16.88 ? 100  MET A C     1 
ATOM   819  O  O     . MET A 1 103 ? 58.514 4.422   -10.997 1.00 12.45 ? 100  MET A O     1 
ATOM   820  C  CB    . MET A 1 103 ? 55.656 4.907   -9.491  1.00 12.93 ? 100  MET A CB    1 
ATOM   821  C  CG    . MET A 1 103 ? 54.778 4.625   -8.278  1.00 22.80 ? 100  MET A CG    1 
ATOM   822  S  SD    . MET A 1 103 ? 55.030 2.974   -7.602  1.00 23.46 ? 100  MET A SD    1 
ATOM   823  C  CE    . MET A 1 103 ? 54.249 3.102   -5.980  1.00 16.44 ? 100  MET A CE    1 
ATOM   824  N  N     . GLU A 1 104 ? 57.978 6.601   -10.933 1.00 10.87 ? 101  GLU A N     1 
ATOM   825  C  CA    . GLU A 1 104 ? 58.720 6.912   -12.156 1.00 14.96 ? 101  GLU A CA    1 
ATOM   826  C  C     . GLU A 1 104 ? 60.237 6.746   -11.988 1.00 13.82 ? 101  GLU A C     1 
ATOM   827  O  O     . GLU A 1 104 ? 60.917 6.257   -12.885 1.00 12.33 ? 101  GLU A O     1 
ATOM   828  C  CB    . GLU A 1 104 ? 58.327 8.298   -12.704 1.00 19.19 ? 101  GLU A CB    1 
ATOM   829  C  CG    . GLU A 1 104 ? 56.890 8.307   -13.236 1.00 19.18 ? 101  GLU A CG    1 
ATOM   830  C  CD    . GLU A 1 104 ? 56.514 9.564   -14.009 1.00 31.11 ? 101  GLU A CD    1 
ATOM   831  O  OE1   . GLU A 1 104 ? 57.294 10.539  -14.005 1.00 32.10 ? 101  GLU A OE1   1 
ATOM   832  O  OE2   . GLU A 1 104 ? 55.425 9.568   -14.623 1.00 33.23 ? 101  GLU A OE2   1 
ATOM   833  N  N     . ILE A 1 105 ? 60.758 7.102   -10.821 1.00 13.08 ? 102  ILE A N     1 
ATOM   834  C  CA    . ILE A 1 105 ? 62.167 6.847   -10.521 1.00 10.83 ? 102  ILE A CA    1 
ATOM   835  C  C     . ILE A 1 105 ? 62.464 5.340   -10.486 1.00 10.47 ? 102  ILE A C     1 
ATOM   836  O  O     . ILE A 1 105 ? 63.407 4.865   -11.120 1.00 12.75 ? 102  ILE A O     1 
ATOM   837  C  CB    . ILE A 1 105 ? 62.591 7.530   -9.210  1.00 7.79  ? 102  ILE A CB    1 
ATOM   838  C  CG1   . ILE A 1 105 ? 62.511 9.051   -9.370  1.00 10.68 ? 102  ILE A CG1   1 
ATOM   839  C  CG2   . ILE A 1 105 ? 64.004 7.101   -8.766  1.00 12.47 ? 102  ILE A CG2   1 
ATOM   840  C  CD1   . ILE A 1 105 ? 62.478 9.791   -8.065  1.00 13.99 ? 102  ILE A CD1   1 
ATOM   841  N  N     . MET A 1 106 ? 61.658 4.582   -9.750  1.00 11.35 ? 103  MET A N     1 
ATOM   842  C  CA    . MET A 1 106 ? 61.868 3.139   -9.668  1.00 12.79 ? 103  MET A CA    1 
ATOM   843  C  C     . MET A 1 106 ? 61.878 2.475   -11.040 1.00 11.01 ? 103  MET A C     1 
ATOM   844  O  O     . MET A 1 106 ? 62.657 1.556   -11.295 1.00 14.01 ? 103  MET A O     1 
ATOM   845  C  CB    . MET A 1 106 ? 60.794 2.503   -8.783  1.00 10.17 ? 103  MET A CB    1 
ATOM   846  C  CG    . MET A 1 106 ? 61.008 2.849   -7.335  1.00 11.31 ? 103  MET A CG    1 
ATOM   847  S  SD    . MET A 1 106 ? 59.822 2.007   -6.285  1.00 18.55 ? 103  MET A SD    1 
ATOM   848  C  CE    . MET A 1 106 ? 60.167 0.295   -6.666  1.00 19.83 ? 103  MET A CE    1 
ATOM   849  N  N     . SER A 1 107 ? 61.002 2.942   -11.919 1.00 11.57 ? 104  SER A N     1 
ATOM   850  C  CA    . SER A 1 107 ? 60.893 2.362   -13.248 1.00 15.06 ? 104  SER A CA    1 
ATOM   851  C  C     . SER A 1 107 ? 62.152 2.547   -14.106 1.00 14.82 ? 104  SER A C     1 
ATOM   852  O  O     . SER A 1 107 ? 62.299 1.861   -15.122 1.00 13.88 ? 104  SER A O     1 
ATOM   853  C  CB    . SER A 1 107 ? 59.654 2.905   -13.977 1.00 14.19 ? 104  SER A CB    1 
ATOM   854  O  OG    A SER A 1 107 ? 59.721 4.308   -14.130 0.21 16.19 ? 104  SER A OG    1 
ATOM   855  O  OG    B SER A 1 107 ? 58.454 2.519   -13.328 0.79 21.37 ? 104  SER A OG    1 
ATOM   856  N  N     . ARG A 1 108 ? 63.062 3.439   -13.705 1.00 15.81 ? 105  ARG A N     1 
ATOM   857  C  CA    . ARG A 1 108 ? 64.324 3.599   -14.438 1.00 17.68 ? 105  ARG A CA    1 
ATOM   858  C  C     . ARG A 1 108 ? 65.241 2.402   -14.214 1.00 22.58 ? 105  ARG A C     1 
ATOM   859  O  O     . ARG A 1 108 ? 66.093 2.101   -15.052 1.00 16.92 ? 105  ARG A O     1 
ATOM   860  C  CB    . ARG A 1 108 ? 65.097 4.876   -14.058 1.00 18.38 ? 105  ARG A CB    1 
ATOM   861  C  CG    . ARG A 1 108 ? 64.362 6.191   -14.278 1.00 18.26 ? 105  ARG A CG    1 
ATOM   862  C  CD    . ARG A 1 108 ? 65.333 7.358   -14.468 1.00 21.70 ? 105  ARG A CD    1 
ATOM   863  N  NE    . ARG A 1 108 ? 66.364 7.435   -13.438 1.00 22.71 ? 105  ARG A NE    1 
ATOM   864  C  CZ    . ARG A 1 108 ? 66.325 8.259   -12.395 1.00 19.02 ? 105  ARG A CZ    1 
ATOM   865  N  NH1   . ARG A 1 108 ? 67.311 8.259   -11.513 1.00 22.52 ? 105  ARG A NH1   1 
ATOM   866  N  NH2   . ARG A 1 108 ? 65.304 9.087   -12.237 1.00 16.87 ? 105  ARG A NH2   1 
ATOM   867  N  N     . PHE A 1 109 ? 65.063 1.719   -13.088 1.00 18.16 ? 106  PHE A N     1 
ATOM   868  C  CA    . PHE A 1 109 ? 65.954 0.619   -12.724 1.00 19.80 ? 106  PHE A CA    1 
ATOM   869  C  C     . PHE A 1 109 ? 65.455 -0.730  -13.202 1.00 19.55 ? 106  PHE A C     1 
ATOM   870  O  O     . PHE A 1 109 ? 66.242 -1.590  -13.591 1.00 24.08 ? 106  PHE A O     1 
ATOM   871  C  CB    . PHE A 1 109 ? 66.172 0.586   -11.214 1.00 16.36 ? 106  PHE A CB    1 
ATOM   872  C  CG    . PHE A 1 109 ? 66.895 1.783   -10.688 1.00 19.20 ? 106  PHE A CG    1 
ATOM   873  C  CD1   . PHE A 1 109 ? 66.233 2.990   -10.518 1.00 13.06 ? 106  PHE A CD1   1 
ATOM   874  C  CD2   . PHE A 1 109 ? 68.243 1.710   -10.375 1.00 16.75 ? 106  PHE A CD2   1 
ATOM   875  C  CE1   . PHE A 1 109 ? 66.901 4.092   -10.033 1.00 16.63 ? 106  PHE A CE1   1 
ATOM   876  C  CE2   . PHE A 1 109 ? 68.916 2.810   -9.887  1.00 20.25 ? 106  PHE A CE2   1 
ATOM   877  C  CZ    . PHE A 1 109 ? 68.248 4.005   -9.715  1.00 17.11 ? 106  PHE A CZ    1 
ATOM   878  N  N     . ALA A 1 110 ? 64.144 -0.914  -13.180 1.00 17.41 ? 107  ALA A N     1 
ATOM   879  C  CA    . ALA A 1 110 ? 63.560 -2.193  -13.538 1.00 16.96 ? 107  ALA A CA    1 
ATOM   880  C  C     . ALA A 1 110 ? 62.066 -2.059  -13.685 1.00 20.62 ? 107  ALA A C     1 
ATOM   881  O  O     . ALA A 1 110 ? 61.483 -1.028  -13.343 1.00 20.87 ? 107  ALA A O     1 
ATOM   882  C  CB    . ALA A 1 110 ? 63.876 -3.230  -12.485 1.00 20.25 ? 107  ALA A CB    1 
ATOM   883  N  N     . VAL A 1 111 ? 61.452 -3.118  -14.192 1.00 24.75 ? 108  VAL A N     1 
ATOM   884  C  CA    . VAL A 1 111 ? 60.009 -3.203  -14.287 1.00 29.24 ? 108  VAL A CA    1 
ATOM   885  C  C     . VAL A 1 111 ? 59.407 -3.287  -12.888 1.00 18.93 ? 108  VAL A C     1 
ATOM   886  O  O     . VAL A 1 111 ? 59.906 -4.031  -12.037 1.00 23.57 ? 108  VAL A O     1 
ATOM   887  C  CB    . VAL A 1 111 ? 59.589 -4.443  -15.090 1.00 36.18 ? 108  VAL A CB    1 
ATOM   888  C  CG1   . VAL A 1 111 ? 58.103 -4.734  -14.895 1.00 31.32 ? 108  VAL A CG1   1 
ATOM   889  C  CG2   . VAL A 1 111 ? 59.935 -4.255  -16.562 1.00 34.91 ? 108  VAL A CG2   1 
ATOM   890  N  N     . ILE A 1 112 ? 58.345 -2.520  -12.642 1.00 21.15 ? 109  ILE A N     1 
ATOM   891  C  CA    . ILE A 1 112 ? 57.713 -2.539  -11.322 1.00 16.54 ? 109  ILE A CA    1 
ATOM   892  C  C     . ILE A 1 112 ? 56.241 -2.908  -11.389 1.00 13.26 ? 109  ILE A C     1 
ATOM   893  O  O     . ILE A 1 112 ? 55.596 -2.745  -12.419 1.00 11.96 ? 109  ILE A O     1 
ATOM   894  C  CB    . ILE A 1 112 ? 57.862 -1.181  -10.590 1.00 18.40 ? 109  ILE A CB    1 
ATOM   895  C  CG1   . ILE A 1 112 ? 56.952 -0.127  -11.217 1.00 18.78 ? 109  ILE A CG1   1 
ATOM   896  C  CG2   . ILE A 1 112 ? 59.327 -0.728  -10.586 1.00 20.03 ? 109  ILE A CG2   1 
ATOM   897  C  CD1   . ILE A 1 112 ? 56.795 1.144   -10.369 1.00 20.18 ? 109  ILE A CD1   1 
ATOM   898  N  N     . GLU A 1 113 ? 55.730 -3.433  -10.279 1.00 11.59 ? 110  GLU A N     1 
ATOM   899  C  CA    . GLU A 1 113 ? 54.309 -3.657  -10.090 1.00 15.37 ? 110  GLU A CA    1 
ATOM   900  C  C     . GLU A 1 113 ? 53.872 -2.730  -8.965  1.00 13.68 ? 110  GLU A C     1 
ATOM   901  O  O     . GLU A 1 113 ? 54.358 -2.839  -7.844  1.00 9.84  ? 110  GLU A O     1 
ATOM   902  C  CB    . GLU A 1 113 ? 54.026 -5.120  -9.716  1.00 11.55 ? 110  GLU A CB    1 
ATOM   903  C  CG    . GLU A 1 113 ? 52.561 -5.408  -9.405  1.00 13.31 ? 110  GLU A CG    1 
ATOM   904  C  CD    . GLU A 1 113 ? 52.304 -6.848  -8.980  1.00 20.94 ? 110  GLU A CD    1 
ATOM   905  O  OE1   . GLU A 1 113 ? 51.210 -7.113  -8.436  1.00 27.82 ? 110  GLU A OE1   1 
ATOM   906  O  OE2   . GLU A 1 113 ? 53.180 -7.716  -9.191  1.00 15.02 ? 110  GLU A OE2   1 
ATOM   907  N  N     . ARG A 1 114 ? 52.992 -1.789  -9.274  1.00 15.15 ? 111  ARG A N     1 
ATOM   908  C  CA    . ARG A 1 114 ? 52.469 -0.891  -8.246  1.00 15.12 ? 111  ARG A CA    1 
ATOM   909  C  C     . ARG A 1 114 ? 51.547 -1.701  -7.351  1.00 17.78 ? 111  ARG A C     1 
ATOM   910  O  O     . ARG A 1 114 ? 50.500 -2.176  -7.793  1.00 17.75 ? 111  ARG A O     1 
ATOM   911  C  CB    . ARG A 1 114 ? 51.700 0.265   -8.893  1.00 15.59 ? 111  ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 114 ? 51.140 1.294   -7.917  1.00 19.90 ? 111  ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 114 ? 50.011 2.093   -8.566  1.00 18.65 ? 111  ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 114 ? 49.695 3.338   -7.870  1.00 20.13 ? 111  ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 114 ? 48.752 3.460   -6.939  1.00 17.47 ? 111  ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 114 ? 48.039 2.407   -6.564  1.00 16.77 ? 111  ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 114 ? 48.533 4.637   -6.368  1.00 18.84 ? 111  ARG A NH2   1 
ATOM   918  N  N     . ALA A 1 115 ? 51.931 -1.872  -6.093  1.00 13.16 ? 112  ALA A N     1 
ATOM   919  C  CA    . ALA A 1 115 ? 51.147 -2.694  -5.190  1.00 13.07 ? 112  ALA A CA    1 
ATOM   920  C  C     . ALA A 1 115 ? 50.182 -1.865  -4.351  1.00 18.43 ? 112  ALA A C     1 
ATOM   921  O  O     . ALA A 1 115 ? 49.165 -2.372  -3.880  1.00 18.75 ? 112  ALA A O     1 
ATOM   922  C  CB    . ALA A 1 115 ? 52.065 -3.521  -4.287  1.00 15.02 ? 112  ALA A CB    1 
ATOM   923  N  N     . SER A 1 116 ? 50.523 -0.594  -4.161  1.00 12.02 ? 113  SER A N     1 
ATOM   924  C  CA    . SER A 1 116 ? 49.685 0.349   -3.430  1.00 15.19 ? 113  SER A CA    1 
ATOM   925  C  C     . SER A 1 116 ? 50.220 1.743   -3.695  1.00 12.16 ? 113  SER A C     1 
ATOM   926  O  O     . SER A 1 116 ? 51.224 1.901   -4.387  1.00 12.54 ? 113  SER A O     1 
ATOM   927  C  CB    . SER A 1 116 ? 49.733 0.080   -1.924  1.00 18.42 ? 113  SER A CB    1 
ATOM   928  O  OG    . SER A 1 116 ? 50.984 0.491   -1.383  1.00 19.73 ? 113  SER A OG    1 
ATOM   929  N  N     . ILE A 1 117 ? 49.565 2.756   -3.132  1.00 11.48 ? 114  ILE A N     1 
ATOM   930  C  CA    . ILE A 1 117 ? 50.007 4.133   -3.326  1.00 9.78  ? 114  ILE A CA    1 
ATOM   931  C  C     . ILE A 1 117 ? 51.476 4.355   -2.947  1.00 13.77 ? 114  ILE A C     1 
ATOM   932  O  O     . ILE A 1 117 ? 52.130 5.249   -3.480  1.00 9.89  ? 114  ILE A O     1 
ATOM   933  C  CB    . ILE A 1 117 ? 49.131 5.130   -2.535  1.00 12.49 ? 114  ILE A CB    1 
ATOM   934  C  CG1   . ILE A 1 117 ? 49.331 6.550   -3.046  1.00 13.14 ? 114  ILE A CG1   1 
ATOM   935  C  CG2   . ILE A 1 117 ? 49.445 5.060   -1.060  1.00 13.39 ? 114  ILE A CG2   1 
ATOM   936  C  CD1   . ILE A 1 117 ? 48.195 7.490   -2.628  1.00 17.06 ? 114  ILE A CD1   1 
ATOM   937  N  N     . ASP A 1 118 ? 52.019 3.546   -2.042  1.00 10.64 ? 115  ASP A N     1 
ATOM   938  C  CA    . ASP A 1 118 ? 53.397 3.799   -1.650  1.00 10.88 ? 115  ASP A CA    1 
ATOM   939  C  C     . ASP A 1 118 ? 54.348 2.597   -1.669  1.00 12.95 ? 115  ASP A C     1 
ATOM   940  O  O     . ASP A 1 118 ? 55.410 2.632   -1.049  1.00 11.89 ? 115  ASP A O     1 
ATOM   941  C  CB    . ASP A 1 118 ? 53.429 4.448   -0.274  1.00 9.58  ? 115  ASP A CB    1 
ATOM   942  C  CG    . ASP A 1 118 ? 53.553 3.439   0.835   1.00 14.81 ? 115  ASP A CG    1 
ATOM   943  O  OD1   . ASP A 1 118 ? 54.334 3.737   1.756   1.00 12.89 ? 115  ASP A OD1   1 
ATOM   944  O  OD2   . ASP A 1 118 ? 52.907 2.352   0.781   1.00 15.44 ? 115  ASP A OD2   1 
ATOM   945  N  N     . GLU A 1 119 ? 53.995 1.545   -2.384  1.00 11.98 ? 116  GLU A N     1 
ATOM   946  C  CA    . GLU A 1 119 ? 54.932 0.439   -2.519  1.00 11.56 ? 116  GLU A CA    1 
ATOM   947  C  C     . GLU A 1 119 ? 54.860 -0.222  -3.884  1.00 12.14 ? 116  GLU A C     1 
ATOM   948  O  O     . GLU A 1 119 ? 53.813 -0.225  -4.543  1.00 10.40 ? 116  GLU A O     1 
ATOM   949  C  CB    . GLU A 1 119 ? 54.752 -0.586  -1.406  1.00 22.07 ? 116  GLU A CB    1 
ATOM   950  C  CG    . GLU A 1 119 ? 53.453 -1.313  -1.428  1.00 23.65 ? 116  GLU A CG    1 
ATOM   951  C  CD    . GLU A 1 119 ? 53.088 -1.840  -0.056  1.00 25.92 ? 116  GLU A CD    1 
ATOM   952  O  OE1   . GLU A 1 119 ? 53.491 -2.975  0.274   1.00 23.53 ? 116  GLU A OE1   1 
ATOM   953  O  OE2   . GLU A 1 119 ? 52.420 -1.105  0.698   1.00 28.44 ? 116  GLU A OE2   1 
ATOM   954  N  N     . ALA A 1 120 ? 55.999 -0.760  -4.304  1.00 9.93  ? 117  ALA A N     1 
ATOM   955  C  CA    . ALA A 1 120 ? 56.100 -1.425  -5.580  1.00 13.41 ? 117  ALA A CA    1 
ATOM   956  C  C     . ALA A 1 120 ? 57.011 -2.629  -5.435  1.00 12.33 ? 117  ALA A C     1 
ATOM   957  O  O     . ALA A 1 120 ? 58.017 -2.568  -4.729  1.00 10.84 ? 117  ALA A O     1 
ATOM   958  C  CB    . ALA A 1 120 ? 56.680 -0.479  -6.608  1.00 12.07 ? 117  ALA A CB    1 
ATOM   959  N  N     . TYR A 1 121 ? 56.660 -3.717  -6.111  1.00 10.39 ? 118  TYR A N     1 
ATOM   960  C  CA    . TYR A 1 121 ? 57.596 -4.816  -6.282  1.00 9.51  ? 118  TYR A CA    1 
ATOM   961  C  C     . TYR A 1 121 ? 58.448 -4.572  -7.503  1.00 14.33 ? 118  TYR A C     1 
ATOM   962  O  O     . TYR A 1 121 ? 57.993 -3.969  -8.479  1.00 11.91 ? 118  TYR A O     1 
ATOM   963  C  CB    . TYR A 1 121 ? 56.842 -6.135  -6.439  1.00 8.95  ? 118  TYR A CB    1 
ATOM   964  C  CG    . TYR A 1 121 ? 56.089 -6.528  -5.208  1.00 10.14 ? 118  TYR A CG    1 
ATOM   965  C  CD1   . TYR A 1 121 ? 54.756 -6.173  -5.045  1.00 9.89  ? 118  TYR A CD1   1 
ATOM   966  C  CD2   . TYR A 1 121 ? 56.711 -7.248  -4.193  1.00 13.72 ? 118  TYR A CD2   1 
ATOM   967  C  CE1   . TYR A 1 121 ? 54.054 -6.530  -3.911  1.00 18.13 ? 118  TYR A CE1   1 
ATOM   968  C  CE2   . TYR A 1 121 ? 56.012 -7.618  -3.053  1.00 11.93 ? 118  TYR A CE2   1 
ATOM   969  C  CZ    . TYR A 1 121 ? 54.689 -7.250  -2.920  1.00 18.21 ? 118  TYR A CZ    1 
ATOM   970  O  OH    . TYR A 1 121 ? 53.989 -7.615  -1.800  1.00 17.37 ? 118  TYR A OH    1 
ATOM   971  N  N     . VAL A 1 122 ? 59.683 -5.060  -7.436  1.00 9.70  ? 119  VAL A N     1 
ATOM   972  C  CA    . VAL A 1 122 ? 60.672 -4.892  -8.473  1.00 13.88 ? 119  VAL A CA    1 
ATOM   973  C  C     . VAL A 1 122 ? 61.209 -6.260  -8.842  1.00 12.38 ? 119  VAL A C     1 
ATOM   974  O  O     . VAL A 1 122 ? 61.659 -6.991  -7.969  1.00 10.73 ? 119  VAL A O     1 
ATOM   975  C  CB    . VAL A 1 122 ? 61.866 -4.075  -7.916  1.00 15.63 ? 119  VAL A CB    1 
ATOM   976  C  CG1   . VAL A 1 122 ? 62.752 -3.603  -9.036  1.00 18.71 ? 119  VAL A CG1   1 
ATOM   977  C  CG2   . VAL A 1 122 ? 61.363 -2.895  -7.095  1.00 17.87 ? 119  VAL A CG2   1 
ATOM   978  N  N     . ASP A 1 123 ? 61.189 -6.612  -10.123 1.00 11.78 ? 120  ASP A N     1 
ATOM   979  C  CA    . ASP A 1 123 ? 61.884 -7.818  -10.577 1.00 13.03 ? 120  ASP A CA    1 
ATOM   980  C  C     . ASP A 1 123 ? 63.323 -7.499  -11.010 1.00 18.85 ? 120  ASP A C     1 
ATOM   981  O  O     . ASP A 1 123 ? 63.552 -6.919  -12.062 1.00 16.79 ? 120  ASP A O     1 
ATOM   982  C  CB    . ASP A 1 123 ? 61.101 -8.481  -11.713 1.00 17.57 ? 120  ASP A CB    1 
ATOM   983  C  CG    . ASP A 1 123 ? 61.565 -9.894  -11.998 1.00 23.74 ? 120  ASP A CG    1 
ATOM   984  O  OD1   . ASP A 1 123 ? 62.787 -10.165 -11.940 1.00 24.04 ? 120  ASP A OD1   1 
ATOM   985  O  OD2   . ASP A 1 123 ? 60.698 -10.746 -12.284 1.00 40.26 ? 120  ASP A OD2   1 
ATOM   986  N  N     . LEU A 1 124 ? 64.297 -7.885  -10.196 1.00 13.87 ? 121  LEU A N     1 
ATOM   987  C  CA    . LEU A 1 124 ? 65.680 -7.491  -10.442 1.00 14.93 ? 121  LEU A CA    1 
ATOM   988  C  C     . LEU A 1 124 ? 66.529 -8.574  -11.113 1.00 9.67  ? 121  LEU A C     1 
ATOM   989  O  O     . LEU A 1 124 ? 67.726 -8.398  -11.282 1.00 11.83 ? 121  LEU A O     1 
ATOM   990  C  CB    . LEU A 1 124 ? 66.346 -7.081  -9.126  1.00 11.74 ? 121  LEU A CB    1 
ATOM   991  C  CG    . LEU A 1 124 ? 65.866 -5.815  -8.414  1.00 14.97 ? 121  LEU A CG    1 
ATOM   992  C  CD1   . LEU A 1 124 ? 66.368 -5.773  -6.976  1.00 19.50 ? 121  LEU A CD1   1 
ATOM   993  C  CD2   . LEU A 1 124 ? 66.313 -4.584  -9.185  1.00 18.79 ? 121  LEU A CD2   1 
ATOM   994  N  N     . THR A 1 125 ? 65.920 -9.696  -11.470 1.00 13.38 ? 122  THR A N     1 
ATOM   995  C  CA    . THR A 1 125 ? 66.697 -10.824 -11.975 1.00 13.23 ? 122  THR A CA    1 
ATOM   996  C  C     . THR A 1 125 ? 67.632 -10.415 -13.131 1.00 14.23 ? 122  THR A C     1 
ATOM   997  O  O     . THR A 1 125 ? 68.823 -10.743 -13.128 1.00 13.95 ? 122  THR A O     1 
ATOM   998  C  CB    . THR A 1 125 ? 65.786 -11.987 -12.373 1.00 16.59 ? 122  THR A CB    1 
ATOM   999  O  OG1   . THR A 1 125 ? 64.885 -12.267 -11.290 1.00 14.74 ? 122  THR A OG1   1 
ATOM   1000 C  CG2   . THR A 1 125 ? 66.618 -13.236 -12.679 1.00 18.98 ? 122  THR A CG2   1 
ATOM   1001 N  N     . SER A 1 126 ? 67.088 -9.677  -14.095 1.00 15.24 ? 123  SER A N     1 
ATOM   1002 C  CA    . SER A 1 126 ? 67.855 -9.211  -15.254 1.00 17.78 ? 123  SER A CA    1 
ATOM   1003 C  C     . SER A 1 126 ? 68.935 -8.203  -14.866 1.00 18.62 ? 123  SER A C     1 
ATOM   1004 O  O     . SER A 1 126 ? 70.085 -8.306  -15.296 1.00 19.30 ? 123  SER A O     1 
ATOM   1005 C  CB    . SER A 1 126 ? 66.918 -8.555  -16.268 1.00 19.05 ? 123  SER A CB    1 
ATOM   1006 O  OG    . SER A 1 126 ? 65.983 -9.490  -16.764 1.00 32.28 ? 123  SER A OG    1 
ATOM   1007 N  N     . ALA A 1 127 ? 68.552 -7.221  -14.059 1.00 14.69 ? 124  ALA A N     1 
ATOM   1008 C  CA    . ALA A 1 127 ? 69.479 -6.193  -13.614 1.00 18.34 ? 124  ALA A CA    1 
ATOM   1009 C  C     . ALA A 1 127 ? 70.665 -6.824  -12.888 1.00 17.79 ? 124  ALA A C     1 
ATOM   1010 O  O     . ALA A 1 127 ? 71.802 -6.385  -13.043 1.00 14.30 ? 124  ALA A O     1 
ATOM   1011 C  CB    . ALA A 1 127 ? 68.768 -5.181  -12.716 1.00 14.51 ? 124  ALA A CB    1 
ATOM   1012 N  N     . VAL A 1 128 ? 70.396 -7.863  -12.100 1.00 15.77 ? 125  VAL A N     1 
ATOM   1013 C  CA    . VAL A 1 128 ? 71.461 -8.547  -11.369 1.00 17.86 ? 125  VAL A CA    1 
ATOM   1014 C  C     . VAL A 1 128 ? 72.447 -9.243  -12.307 1.00 15.96 ? 125  VAL A C     1 
ATOM   1015 O  O     . VAL A 1 128 ? 73.656 -9.151  -12.111 1.00 19.65 ? 125  VAL A O     1 
ATOM   1016 C  CB    . VAL A 1 128 ? 70.899 -9.554  -10.342 1.00 12.79 ? 125  VAL A CB    1 
ATOM   1017 C  CG1   . VAL A 1 128 ? 71.965 -10.570 -9.936  1.00 15.61 ? 125  VAL A CG1   1 
ATOM   1018 C  CG2   . VAL A 1 128 ? 70.362 -8.798  -9.125  1.00 13.12 ? 125  VAL A CG2   1 
ATOM   1019 N  N     . GLN A 1 129 ? 71.928 -9.941  -13.313 1.00 18.05 ? 126  GLN A N     1 
ATOM   1020 C  CA    . GLN A 1 129 ? 72.786 -10.630 -14.272 1.00 27.53 ? 126  GLN A CA    1 
ATOM   1021 C  C     . GLN A 1 129 ? 73.726 -9.625  -14.924 1.00 24.62 ? 126  GLN A C     1 
ATOM   1022 O  O     . GLN A 1 129 ? 74.933 -9.854  -15.018 1.00 24.08 ? 126  GLN A O     1 
ATOM   1023 C  CB    . GLN A 1 129 ? 71.955 -11.336 -15.348 1.00 26.12 ? 126  GLN A CB    1 
ATOM   1024 C  CG    . GLN A 1 129 ? 70.882 -12.283 -14.824 1.00 35.46 ? 126  GLN A CG    1 
ATOM   1025 C  CD    . GLN A 1 129 ? 71.414 -13.655 -14.438 1.00 45.77 ? 126  GLN A CD    1 
ATOM   1026 O  OE1   . GLN A 1 129 ? 72.625 -13.865 -14.328 1.00 50.58 ? 126  GLN A OE1   1 
ATOM   1027 N  NE2   . GLN A 1 129 ? 70.501 -14.603 -14.234 1.00 51.21 ? 126  GLN A NE2   1 
ATOM   1028 N  N     . GLU A 1 130 ? 73.156 -8.507  -15.360 1.00 22.78 ? 127  GLU A N     1 
ATOM   1029 C  CA    . GLU A 1 130 ? 73.913 -7.437  -15.991 1.00 31.60 ? 127  GLU A CA    1 
ATOM   1030 C  C     . GLU A 1 130 ? 75.037 -6.925  -15.090 1.00 30.68 ? 127  GLU A C     1 
ATOM   1031 O  O     . GLU A 1 130 ? 76.194 -6.861  -15.509 1.00 33.00 ? 127  GLU A O     1 
ATOM   1032 C  CB    . GLU A 1 130 ? 72.982 -6.285  -16.389 1.00 29.52 ? 127  GLU A CB    1 
ATOM   1033 N  N     . ARG A 1 131 ? 74.698 -6.564  -13.856 1.00 21.65 ? 128  ARG A N     1 
ATOM   1034 C  CA    . ARG A 1 131 ? 75.694 -6.060  -12.910 1.00 24.96 ? 128  ARG A CA    1 
ATOM   1035 C  C     . ARG A 1 131 ? 76.798 -7.081  -12.635 1.00 28.36 ? 128  ARG A C     1 
ATOM   1036 O  O     . ARG A 1 131 ? 77.971 -6.716  -12.526 1.00 28.62 ? 128  ARG A O     1 
ATOM   1037 C  CB    . ARG A 1 131 ? 75.027 -5.614  -11.605 1.00 22.21 ? 128  ARG A CB    1 
ATOM   1038 C  CG    . ARG A 1 131 ? 75.967 -4.996  -10.577 1.00 27.05 ? 128  ARG A CG    1 
ATOM   1039 C  CD    . ARG A 1 131 ? 76.572 -3.690  -11.090 1.00 26.41 ? 128  ARG A CD    1 
ATOM   1040 N  NE    . ARG A 1 131 ? 75.505 -2.762  -11.418 1.00 34.26 ? 128  ARG A NE    1 
ATOM   1041 C  CZ    . ARG A 1 131 ? 74.982 -1.907  -10.548 1.00 31.19 ? 128  ARG A CZ    1 
ATOM   1042 N  NH1   . ARG A 1 131 ? 75.464 -1.843  -9.313  1.00 22.62 ? 128  ARG A NH1   1 
ATOM   1043 N  NH2   . ARG A 1 131 ? 73.994 -1.104  -10.922 1.00 38.75 ? 128  ARG A NH2   1 
ATOM   1044 N  N     . LEU A 1 132 ? 76.424 -8.353  -12.524 1.00 22.08 ? 129  LEU A N     1 
ATOM   1045 C  CA    . LEU A 1 132 ? 77.397 -9.425  -12.283 1.00 22.95 ? 129  LEU A CA    1 
ATOM   1046 C  C     . LEU A 1 132 ? 78.427 -9.513  -13.405 1.00 35.05 ? 129  LEU A C     1 
ATOM   1047 O  O     . LEU A 1 132 ? 79.596 -9.809  -13.159 1.00 30.49 ? 129  LEU A O     1 
ATOM   1048 C  CB    . LEU A 1 132 ? 76.696 -10.777 -12.117 1.00 23.09 ? 129  LEU A CB    1 
ATOM   1049 C  CG    . LEU A 1 132 ? 76.225 -11.090 -10.693 1.00 20.78 ? 129  LEU A CG    1 
ATOM   1050 C  CD1   . LEU A 1 132 ? 75.298 -12.294 -10.643 1.00 21.73 ? 129  LEU A CD1   1 
ATOM   1051 C  CD2   . LEU A 1 132 ? 77.425 -11.284 -9.769  1.00 29.19 ? 129  LEU A CD2   1 
ATOM   1052 N  N     . GLN A 1 133 ? 77.982 -9.265  -14.635 1.00 35.12 ? 130  GLN A N     1 
ATOM   1053 C  CA    . GLN A 1 133 ? 78.873 -9.272  -15.792 1.00 36.36 ? 130  GLN A CA    1 
ATOM   1054 C  C     . GLN A 1 133 ? 79.798 -8.060  -15.765 1.00 43.19 ? 130  GLN A C     1 
ATOM   1055 O  O     . GLN A 1 133 ? 80.961 -8.153  -16.147 1.00 50.62 ? 130  GLN A O     1 
ATOM   1056 C  CB    . GLN A 1 133 ? 78.075 -9.286  -17.091 1.00 40.00 ? 130  GLN A CB    1 
ATOM   1057 C  CG    . GLN A 1 133 ? 77.217 -10.526 -17.283 1.00 40.66 ? 130  GLN A CG    1 
ATOM   1058 C  CD    . GLN A 1 133 ? 76.248 -10.383 -18.448 1.00 58.34 ? 130  GLN A CD    1 
ATOM   1059 O  OE1   . GLN A 1 133 ? 76.264 -9.377  -19.161 1.00 57.62 ? 130  GLN A OE1   1 
ATOM   1060 N  NE2   . GLN A 1 133 ? 75.396 -11.388 -18.641 1.00 59.36 ? 130  GLN A NE2   1 
ATOM   1061 N  N     . LYS A 1 134 ? 79.281 -6.920  -15.315 1.00 35.80 ? 131  LYS A N     1 
ATOM   1062 C  CA    . LYS A 1 134 ? 80.107 -5.724  -15.175 1.00 46.38 ? 131  LYS A CA    1 
ATOM   1063 C  C     . LYS A 1 134 ? 81.190 -5.941  -14.128 1.00 49.72 ? 131  LYS A C     1 
ATOM   1064 O  O     . LYS A 1 134 ? 82.349 -5.578  -14.332 1.00 52.26 ? 131  LYS A O     1 
ATOM   1065 C  CB    . LYS A 1 134 ? 79.263 -4.502  -14.795 1.00 44.25 ? 131  LYS A CB    1 
ATOM   1066 C  CG    . LYS A 1 134 ? 78.457 -3.906  -15.942 1.00 46.63 ? 131  LYS A CG    1 
ATOM   1067 C  CD    . LYS A 1 134 ? 77.763 -2.612  -15.523 1.00 51.05 ? 131  LYS A CD    1 
ATOM   1068 C  CE    . LYS A 1 134 ? 76.656 -2.871  -14.503 1.00 50.91 ? 131  LYS A CE    1 
ATOM   1069 N  NZ    . LYS A 1 134 ? 75.937 -1.617  -14.122 1.00 49.26 ? 131  LYS A NZ    1 
ATOM   1070 N  N     . LEU A 1 135 ? 80.811 -6.534  -13.003 1.00 42.95 ? 132  LEU A N     1 
ATOM   1071 C  CA    . LEU A 1 135 ? 81.745 -6.712  -11.905 1.00 46.08 ? 132  LEU A CA    1 
ATOM   1072 C  C     . LEU A 1 135 ? 82.925 -7.590  -12.270 1.00 54.32 ? 132  LEU A C     1 
ATOM   1073 O  O     . LEU A 1 135 ? 84.032 -7.408  -11.762 1.00 57.38 ? 132  LEU A O     1 
ATOM   1074 C  CB    . LEU A 1 135 ? 81.035 -7.305  -10.680 1.00 45.12 ? 132  LEU A CB    1 
ATOM   1075 C  CG    . LEU A 1 135 ? 80.418 -6.343  -9.660  1.00 45.15 ? 132  LEU A CG    1 
ATOM   1076 C  CD1   . LEU A 1 135 ? 79.638 -5.247  -10.352 1.00 47.72 ? 132  LEU A CD1   1 
ATOM   1077 C  CD2   . LEU A 1 135 ? 79.518 -7.101  -8.698  1.00 44.71 ? 132  LEU A CD2   1 
ATOM   1078 N  N     . GLN A 1 136 ? 82.670 -8.546  -13.153 1.00 53.86 ? 133  GLN A N     1 
ATOM   1079 C  CA    . GLN A 1 136 ? 83.660 -9.546  -13.523 1.00 59.58 ? 133  GLN A CA    1 
ATOM   1080 C  C     . GLN A 1 136 ? 84.438 -10.162 -12.323 1.00 58.00 ? 133  GLN A C     1 
ATOM   1081 O  O     . GLN A 1 136 ? 85.613 -9.852  -12.123 1.00 54.43 ? 133  GLN A O     1 
ATOM   1082 C  CB    . GLN A 1 136 ? 84.617 -9.020  -14.599 1.00 57.77 ? 133  GLN A CB    1 
ATOM   1083 C  CG    . GLN A 1 136 ? 83.957 -8.776  -15.959 1.00 65.51 ? 133  GLN A CG    1 
ATOM   1084 C  CD    . GLN A 1 136 ? 83.099 -9.950  -16.436 1.00 72.01 ? 133  GLN A CD    1 
ATOM   1085 O  OE1   . GLN A 1 136 ? 82.314 -10.520 -15.671 1.00 64.56 ? 133  GLN A OE1   1 
ATOM   1086 N  NE2   . GLN A 1 136 ? 83.239 -10.306 -17.711 1.00 70.75 ? 133  GLN A NE2   1 
ATOM   1087 N  N     . GLY A 1 137 ? 83.774 -11.027 -11.542 1.00 51.58 ? 134  GLY A N     1 
ATOM   1088 C  CA    . GLY A 1 137 ? 84.393 -11.771 -10.437 1.00 53.60 ? 134  GLY A CA    1 
ATOM   1089 C  C     . GLY A 1 137 ? 84.838 -10.921 -9.260  1.00 50.55 ? 134  GLY A C     1 
ATOM   1090 O  O     . GLY A 1 137 ? 85.425 -11.424 -8.305  1.00 49.26 ? 134  GLY A O     1 
ATOM   1091 N  N     . GLN A 1 138 ? 84.550 -9.628  -9.328  1.00 47.70 ? 135  GLN A N     1 
ATOM   1092 C  CA    . GLN A 1 138 ? 84.962 -8.686  -8.295  1.00 52.98 ? 135  GLN A CA    1 
ATOM   1093 C  C     . GLN A 1 138 ? 84.103 -8.809  -7.035  1.00 46.44 ? 135  GLN A C     1 
ATOM   1094 O  O     . GLN A 1 138 ? 82.875 -8.820  -7.114  1.00 43.46 ? 135  GLN A O     1 
ATOM   1095 C  CB    . GLN A 1 138 ? 84.869 -7.269  -8.852  1.00 54.65 ? 135  GLN A CB    1 
ATOM   1096 C  CG    . GLN A 1 138 ? 85.929 -6.320  -8.353  1.00 59.67 ? 135  GLN A CG    1 
ATOM   1097 C  CD    . GLN A 1 138 ? 85.923 -5.021  -9.128  1.00 72.32 ? 135  GLN A CD    1 
ATOM   1098 O  OE1   . GLN A 1 138 ? 86.404 -3.995  -8.647  1.00 78.21 ? 135  GLN A OE1   1 
ATOM   1099 N  NE2   . GLN A 1 138 ? 85.375 -5.059  -10.341 1.00 63.02 ? 135  GLN A NE2   1 
ATOM   1100 N  N     . PRO A 1 139 ? 84.752 -8.889  -5.865  1.00 43.32 ? 136  PRO A N     1 
ATOM   1101 C  CA    . PRO A 1 139 ? 84.058 -9.004  -4.577  1.00 41.58 ? 136  PRO A CA    1 
ATOM   1102 C  C     . PRO A 1 139 ? 83.186 -7.787  -4.291  1.00 39.81 ? 136  PRO A C     1 
ATOM   1103 O  O     . PRO A 1 139 ? 83.450 -6.703  -4.806  1.00 40.34 ? 136  PRO A O     1 
ATOM   1104 C  CB    . PRO A 1 139 ? 85.208 -9.069  -3.570  1.00 44.61 ? 136  PRO A CB    1 
ATOM   1105 C  CG    . PRO A 1 139 ? 86.333 -8.382  -4.247  1.00 43.29 ? 136  PRO A CG    1 
ATOM   1106 C  CD    . PRO A 1 139 ? 86.206 -8.757  -5.691  1.00 48.24 ? 136  PRO A CD    1 
ATOM   1107 N  N     . ILE A 1 140 ? 82.152 -7.969  -3.479  1.00 37.52 ? 137  ILE A N     1 
ATOM   1108 C  CA    . ILE A 1 140 ? 81.261 -6.873  -3.131  1.00 26.45 ? 137  ILE A CA    1 
ATOM   1109 C  C     . ILE A 1 140 ? 81.685 -6.280  -1.800  1.00 25.26 ? 137  ILE A C     1 
ATOM   1110 O  O     . ILE A 1 140 ? 81.756 -6.979  -0.795  1.00 26.26 ? 137  ILE A O     1 
ATOM   1111 C  CB    . ILE A 1 140 ? 79.793 -7.340  -3.089  1.00 30.83 ? 137  ILE A CB    1 
ATOM   1112 C  CG1   . ILE A 1 140 ? 79.414 -7.945  -4.445  1.00 37.78 ? 137  ILE A CG1   1 
ATOM   1113 C  CG2   . ILE A 1 140 ? 78.872 -6.191  -2.739  1.00 28.52 ? 137  ILE A CG2   1 
ATOM   1114 C  CD1   . ILE A 1 140 ? 77.979 -8.398  -4.551  1.00 35.15 ? 137  ILE A CD1   1 
ATOM   1115 N  N     . SER A 1 141 ? 81.987 -4.987  -1.807  1.00 27.06 ? 138  SER A N     1 
ATOM   1116 C  CA    . SER A 1 141 ? 82.435 -4.285  -0.609  1.00 26.09 ? 138  SER A CA    1 
ATOM   1117 C  C     . SER A 1 141 ? 81.253 -3.925  0.286   1.00 21.58 ? 138  SER A C     1 
ATOM   1118 O  O     . SER A 1 141 ? 80.174 -3.605  -0.208  1.00 21.78 ? 138  SER A O     1 
ATOM   1119 C  CB    . SER A 1 141 ? 83.190 -3.015  -1.015  1.00 25.20 ? 138  SER A CB    1 
ATOM   1120 O  OG    . SER A 1 141 ? 83.272 -2.088  0.054   1.00 29.08 ? 138  SER A OG    1 
ATOM   1121 N  N     . ALA A 1 142 ? 81.459 -3.971  1.598   1.00 16.40 ? 139  ALA A N     1 
ATOM   1122 C  CA    . ALA A 1 142 ? 80.417 -3.586  2.536   1.00 21.41 ? 139  ALA A CA    1 
ATOM   1123 C  C     . ALA A 1 142 ? 80.003 -2.135  2.290   1.00 25.36 ? 139  ALA A C     1 
ATOM   1124 O  O     . ALA A 1 142 ? 78.897 -1.725  2.640   1.00 21.24 ? 139  ALA A O     1 
ATOM   1125 C  CB    . ALA A 1 142 ? 80.889 -3.766  3.959   1.00 25.80 ? 139  ALA A CB    1 
ATOM   1126 N  N     . ASP A 1 143 ? 80.907 -1.364  1.693   1.00 26.41 ? 140  ASP A N     1 
ATOM   1127 C  CA    . ASP A 1 143 ? 80.650 0.039   1.406   1.00 27.81 ? 140  ASP A CA    1 
ATOM   1128 C  C     . ASP A 1 143 ? 79.513 0.207   0.411   1.00 24.73 ? 140  ASP A C     1 
ATOM   1129 O  O     . ASP A 1 143 ? 78.894 1.266   0.339   1.00 24.11 ? 140  ASP A O     1 
ATOM   1130 C  CB    . ASP A 1 143 ? 81.914 0.724   0.880   1.00 26.72 ? 140  ASP A CB    1 
ATOM   1131 C  CG    . ASP A 1 143 ? 82.995 0.843   1.941   1.00 39.79 ? 140  ASP A CG    1 
ATOM   1132 O  OD1   . ASP A 1 143 ? 82.665 0.750   3.145   1.00 37.05 ? 140  ASP A OD1   1 
ATOM   1133 O  OD2   . ASP A 1 143 ? 84.174 1.034   1.574   1.00 46.87 ? 140  ASP A OD2   1 
ATOM   1134 N  N     . LEU A 1 144 ? 79.238 -0.840  -0.357  1.00 21.78 ? 141  LEU A N     1 
ATOM   1135 C  CA    . LEU A 1 144 ? 78.155 -0.787  -1.327  1.00 18.37 ? 141  LEU A CA    1 
ATOM   1136 C  C     . LEU A 1 144 ? 76.797 -1.114  -0.700  1.00 20.71 ? 141  LEU A C     1 
ATOM   1137 O  O     . LEU A 1 144 ? 75.775 -1.014  -1.368  1.00 16.36 ? 141  LEU A O     1 
ATOM   1138 C  CB    . LEU A 1 144 ? 78.422 -1.746  -2.481  1.00 15.57 ? 141  LEU A CB    1 
ATOM   1139 C  CG    . LEU A 1 144 ? 79.748 -1.572  -3.225  1.00 21.95 ? 141  LEU A CG    1 
ATOM   1140 C  CD1   . LEU A 1 144 ? 79.809 -2.517  -4.396  1.00 28.12 ? 141  LEU A CD1   1 
ATOM   1141 C  CD2   . LEU A 1 144 ? 79.908 -0.138  -3.691  1.00 23.90 ? 141  LEU A CD2   1 
ATOM   1142 N  N     . LEU A 1 145 ? 76.802 -1.513  0.568   1.00 14.85 ? 142  LEU A N     1 
ATOM   1143 C  CA    . LEU A 1 145 ? 75.581 -1.915  1.273   1.00 13.56 ? 142  LEU A CA    1 
ATOM   1144 C  C     . LEU A 1 145 ? 75.447 -1.157  2.596   1.00 14.14 ? 142  LEU A C     1 
ATOM   1145 O  O     . LEU A 1 145 ? 75.364 -1.756  3.668   1.00 11.71 ? 142  LEU A O     1 
ATOM   1146 C  CB    . LEU A 1 145 ? 75.587 -3.443  1.483   1.00 13.43 ? 142  LEU A CB    1 
ATOM   1147 C  CG    . LEU A 1 145 ? 75.569 -4.292  0.209   1.00 14.11 ? 142  LEU A CG    1 
ATOM   1148 C  CD1   . LEU A 1 145 ? 75.953 -5.767  0.443   1.00 17.60 ? 142  LEU A CD1   1 
ATOM   1149 C  CD2   . LEU A 1 145 ? 74.207 -4.221  -0.459  1.00 17.74 ? 142  LEU A CD2   1 
ATOM   1150 N  N     . PRO A 1 146 ? 75.425 0.187   2.533   1.00 20.63 ? 143  PRO A N     1 
ATOM   1151 C  CA    . PRO A 1 146 ? 75.498 0.976   3.772   1.00 18.75 ? 143  PRO A CA    1 
ATOM   1152 C  C     . PRO A 1 146 ? 74.248 0.939   4.642   1.00 15.65 ? 143  PRO A C     1 
ATOM   1153 O  O     . PRO A 1 146 ? 74.316 1.351   5.798   1.00 17.96 ? 143  PRO A O     1 
ATOM   1154 C  CB    . PRO A 1 146 ? 75.741 2.405   3.265   1.00 22.29 ? 143  PRO A CB    1 
ATOM   1155 C  CG    . PRO A 1 146 ? 75.215 2.411   1.873   1.00 20.92 ? 143  PRO A CG    1 
ATOM   1156 C  CD    . PRO A 1 146 ? 75.479 1.038   1.331   1.00 16.88 ? 143  PRO A CD    1 
ATOM   1157 N  N     . SER A 1 147 ? 73.120 0.473   4.108   1.00 16.23 ? 144  SER A N     1 
ATOM   1158 C  CA    . SER A 1 147 ? 71.893 0.461   4.895   1.00 14.68 ? 144  SER A CA    1 
ATOM   1159 C  C     . SER A 1 147 ? 71.217 -0.915  4.877   1.00 12.94 ? 144  SER A C     1 
ATOM   1160 O  O     . SER A 1 147 ? 70.028 -1.038  5.171   1.00 10.18 ? 144  SER A O     1 
ATOM   1161 C  CB    . SER A 1 147 ? 70.914 1.548   4.412   1.00 16.80 ? 144  SER A CB    1 
ATOM   1162 O  OG    . SER A 1 147 ? 70.463 1.299   3.091   1.00 17.82 ? 144  SER A OG    1 
ATOM   1163 N  N     . THR A 1 148 ? 72.000 -1.944  4.569   1.00 12.17 ? 145  THR A N     1 
ATOM   1164 C  CA    . THR A 1 148 ? 71.489 -3.314  4.432   1.00 10.73 ? 145  THR A CA    1 
ATOM   1165 C  C     . THR A 1 148 ? 71.682 -4.179  5.690   1.00 12.66 ? 145  THR A C     1 
ATOM   1166 O  O     . THR A 1 148 ? 72.758 -4.181  6.305   1.00 13.71 ? 145  THR A O     1 
ATOM   1167 C  CB    . THR A 1 148 ? 72.149 -4.021  3.230   1.00 13.15 ? 145  THR A CB    1 
ATOM   1168 O  OG1   . THR A 1 148 ? 71.850 -3.294  2.033   1.00 11.32 ? 145  THR A OG1   1 
ATOM   1169 C  CG2   . THR A 1 148 ? 71.645 -5.454  3.089   1.00 8.97  ? 145  THR A CG2   1 
ATOM   1170 N  N     . TYR A 1 149 ? 70.621 -4.893  6.067   1.00 9.74  ? 146  TYR A N     1 
ATOM   1171 C  CA    . TYR A 1 149 ? 70.657 -5.919  7.105   1.00 13.78 ? 146  TYR A CA    1 
ATOM   1172 C  C     . TYR A 1 149 ? 70.600 -7.284  6.433   1.00 15.62 ? 146  TYR A C     1 
ATOM   1173 O  O     . TYR A 1 149 ? 69.851 -7.466  5.471   1.00 12.14 ? 146  TYR A O     1 
ATOM   1174 C  CB    . TYR A 1 149 ? 69.448 -5.792  8.025   1.00 12.53 ? 146  TYR A CB    1 
ATOM   1175 C  CG    . TYR A 1 149 ? 69.609 -4.734  9.094   1.00 13.11 ? 146  TYR A CG    1 
ATOM   1176 C  CD1   . TYR A 1 149 ? 70.033 -5.085  10.370  1.00 12.89 ? 146  TYR A CD1   1 
ATOM   1177 C  CD2   . TYR A 1 149 ? 69.336 -3.390  8.828   1.00 11.13 ? 146  TYR A CD2   1 
ATOM   1178 C  CE1   . TYR A 1 149 ? 70.190 -4.136  11.351  1.00 17.12 ? 146  TYR A CE1   1 
ATOM   1179 C  CE2   . TYR A 1 149 ? 69.509 -2.421  9.809   1.00 14.21 ? 146  TYR A CE2   1 
ATOM   1180 C  CZ    . TYR A 1 149 ? 69.930 -2.806  11.067  1.00 19.18 ? 146  TYR A CZ    1 
ATOM   1181 O  OH    . TYR A 1 149 ? 70.087 -1.875  12.065  1.00 23.16 ? 146  TYR A OH    1 
ATOM   1182 N  N     . ILE A 1 150 ? 71.367 -8.244  6.945   1.00 10.46 ? 147  ILE A N     1 
ATOM   1183 C  CA    . ILE A 1 150 ? 71.228 -9.629  6.500   1.00 8.56  ? 147  ILE A CA    1 
ATOM   1184 C  C     . ILE A 1 150 ? 70.490 -10.419 7.577   1.00 10.84 ? 147  ILE A C     1 
ATOM   1185 O  O     . ILE A 1 150 ? 71.028 -10.671 8.661   1.00 13.86 ? 147  ILE A O     1 
ATOM   1186 C  CB    . ILE A 1 150 ? 72.586 -10.304 6.208   1.00 10.01 ? 147  ILE A CB    1 
ATOM   1187 C  CG1   . ILE A 1 150 ? 73.471 -9.424  5.320   1.00 11.53 ? 147  ILE A CG1   1 
ATOM   1188 C  CG2   . ILE A 1 150 ? 72.356 -11.683 5.552   1.00 13.98 ? 147  ILE A CG2   1 
ATOM   1189 C  CD1   . ILE A 1 150 ? 72.922 -9.190  3.896   1.00 9.61  ? 147  ILE A CD1   1 
ATOM   1190 N  N     . GLU A 1 151 ? 69.248 -10.789 7.287   1.00 9.45  ? 148  GLU A N     1 
ATOM   1191 C  CA    . GLU A 1 151 ? 68.395 -11.424 8.279   1.00 11.04 ? 148  GLU A CA    1 
ATOM   1192 C  C     . GLU A 1 151 ? 69.029 -12.740 8.761   1.00 13.25 ? 148  GLU A C     1 
ATOM   1193 O  O     . GLU A 1 151 ? 69.434 -13.569 7.949   1.00 11.39 ? 148  GLU A O     1 
ATOM   1194 C  CB    . GLU A 1 151 ? 66.985 -11.658 7.704   1.00 12.65 ? 148  GLU A CB    1 
ATOM   1195 C  CG    . GLU A 1 151 ? 66.028 -12.427 8.626   1.00 12.12 ? 148  GLU A CG    1 
ATOM   1196 C  CD    . GLU A 1 151 ? 65.857 -11.782 9.979   1.00 20.06 ? 148  GLU A CD    1 
ATOM   1197 O  OE1   . GLU A 1 151 ? 65.570 -12.511 10.952  1.00 20.07 ? 148  GLU A OE1   1 
ATOM   1198 O  OE2   . GLU A 1 151 ? 65.988 -10.542 10.065  1.00 22.73 ? 148  GLU A OE2   1 
ATOM   1199 N  N     . GLY A 1 152 ? 69.121 -12.908 10.079  1.00 9.80  ? 149  GLY A N     1 
ATOM   1200 C  CA    . GLY A 1 152 ? 69.662 -14.120 10.666  1.00 15.86 ? 149  GLY A CA    1 
ATOM   1201 C  C     . GLY A 1 152 ? 71.106 -13.966 11.110  1.00 15.75 ? 149  GLY A C     1 
ATOM   1202 O  O     . GLY A 1 152 ? 71.627 -14.807 11.841  1.00 18.71 ? 149  GLY A O     1 
ATOM   1203 N  N     . LEU A 1 153 ? 71.757 -12.899 10.655  1.00 12.20 ? 150  LEU A N     1 
ATOM   1204 C  CA    . LEU A 1 153 ? 73.134 -12.604 11.062  1.00 12.68 ? 150  LEU A CA    1 
ATOM   1205 C  C     . LEU A 1 153 ? 73.209 -11.293 11.865  1.00 20.10 ? 150  LEU A C     1 
ATOM   1206 O  O     . LEU A 1 153 ? 72.347 -10.432 11.726  1.00 14.45 ? 150  LEU A O     1 
ATOM   1207 C  CB    . LEU A 1 153 ? 74.053 -12.547 9.835   1.00 10.41 ? 150  LEU A CB    1 
ATOM   1208 C  CG    . LEU A 1 153 ? 74.078 -13.808 8.966   1.00 13.31 ? 150  LEU A CG    1 
ATOM   1209 C  CD1   . LEU A 1 153 ? 75.019 -13.663 7.753   1.00 10.21 ? 150  LEU A CD1   1 
ATOM   1210 C  CD2   . LEU A 1 153 ? 74.456 -15.031 9.811   1.00 18.37 ? 150  LEU A CD2   1 
ATOM   1211 N  N     . PRO A 1 154 ? 74.243 -11.139 12.714  1.00 17.37 ? 151  PRO A N     1 
ATOM   1212 C  CA    . PRO A 1 154 ? 75.305 -12.127 12.940  1.00 17.32 ? 151  PRO A CA    1 
ATOM   1213 C  C     . PRO A 1 154 ? 74.847 -13.298 13.804  1.00 18.93 ? 151  PRO A C     1 
ATOM   1214 O  O     . PRO A 1 154 ? 73.840 -13.205 14.508  1.00 15.72 ? 151  PRO A O     1 
ATOM   1215 C  CB    . PRO A 1 154 ? 76.376 -11.322 13.693  1.00 19.69 ? 151  PRO A CB    1 
ATOM   1216 C  CG    . PRO A 1 154 ? 75.601 -10.255 14.412  1.00 22.71 ? 151  PRO A CG    1 
ATOM   1217 C  CD    . PRO A 1 154 ? 74.475 -9.892  13.464  1.00 21.20 ? 151  PRO A CD    1 
ATOM   1218 N  N     . GLN A 1 155 ? 75.589 -14.398 13.736  1.00 21.29 ? 152  GLN A N     1 
ATOM   1219 C  CA    . GLN A 1 155 ? 75.310 -15.578 14.546  1.00 30.81 ? 152  GLN A CA    1 
ATOM   1220 C  C     . GLN A 1 155 ? 76.629 -16.075 15.132  1.00 38.05 ? 152  GLN A C     1 
ATOM   1221 O  O     . GLN A 1 155 ? 77.700 -15.718 14.641  1.00 41.71 ? 152  GLN A O     1 
ATOM   1222 C  CB    . GLN A 1 155 ? 74.672 -16.680 13.700  1.00 25.85 ? 152  GLN A CB    1 
ATOM   1223 C  CG    . GLN A 1 155 ? 75.659 -17.335 12.759  1.00 35.91 ? 152  GLN A CG    1 
ATOM   1224 C  CD    . GLN A 1 155 ? 75.265 -18.744 12.375  1.00 36.88 ? 152  GLN A CD    1 
ATOM   1225 O  OE1   . GLN A 1 155 ? 74.158 -19.200 12.676  1.00 41.00 ? 152  GLN A OE1   1 
ATOM   1226 N  NE2   . GLN A 1 155 ? 76.166 -19.442 11.699  1.00 26.91 ? 152  GLN A NE2   1 
ATOM   1227 N  N     . GLY A 1 156 ? 76.552 -16.890 16.180  1.00 40.01 ? 153  GLY A N     1 
ATOM   1228 C  CA    . GLY A 1 156 ? 77.744 -17.393 16.847  1.00 51.34 ? 153  GLY A CA    1 
ATOM   1229 C  C     . GLY A 1 156 ? 78.526 -16.313 17.575  1.00 64.49 ? 153  GLY A C     1 
ATOM   1230 O  O     . GLY A 1 156 ? 77.936 -15.453 18.236  1.00 66.21 ? 153  GLY A O     1 
ATOM   1231 N  N     . PRO A 1 157 ? 79.866 -16.356 17.465  1.00 73.03 ? 154  PRO A N     1 
ATOM   1232 C  CA    . PRO A 1 157 ? 80.753 -15.355 18.074  1.00 75.70 ? 154  PRO A CA    1 
ATOM   1233 C  C     . PRO A 1 157 ? 80.773 -14.039 17.295  1.00 70.01 ? 154  PRO A C     1 
ATOM   1234 O  O     . PRO A 1 157 ? 81.566 -13.154 17.625  1.00 62.13 ? 154  PRO A O     1 
ATOM   1235 C  CB    . PRO A 1 157 ? 82.127 -16.027 18.005  1.00 59.99 ? 154  PRO A CB    1 
ATOM   1236 C  CG    . PRO A 1 157 ? 82.037 -16.925 16.816  1.00 55.83 ? 154  PRO A CG    1 
ATOM   1237 C  CD    . PRO A 1 157 ? 80.624 -17.440 16.812  1.00 64.03 ? 154  PRO A CD    1 
ATOM   1238 N  N     . GLU A 1 161 ? 82.703 -6.249  21.466  1.00 75.37 ? 158  GLU A N     1 
ATOM   1239 C  CA    . GLU A 1 161 ? 81.774 -5.532  22.336  1.00 83.56 ? 158  GLU A CA    1 
ATOM   1240 C  C     . GLU A 1 161 ? 81.041 -4.401  21.612  1.00 81.41 ? 158  GLU A C     1 
ATOM   1241 O  O     . GLU A 1 161 ? 80.229 -3.697  22.213  1.00 78.12 ? 158  GLU A O     1 
ATOM   1242 C  CB    . GLU A 1 161 ? 82.504 -4.987  23.568  1.00 69.06 ? 158  GLU A CB    1 
ATOM   1243 N  N     . GLU A 1 162 ? 81.333 -4.234  20.323  1.00 82.44 ? 159  GLU A N     1 
ATOM   1244 C  CA    . GLU A 1 162 ? 80.696 -3.199  19.508  1.00 81.65 ? 159  GLU A CA    1 
ATOM   1245 C  C     . GLU A 1 162 ? 79.265 -3.589  19.149  1.00 77.03 ? 159  GLU A C     1 
ATOM   1246 O  O     . GLU A 1 162 ? 78.444 -2.738  18.795  1.00 69.14 ? 159  GLU A O     1 
ATOM   1247 C  CB    . GLU A 1 162 ? 81.507 -2.945  18.234  1.00 83.85 ? 159  GLU A CB    1 
ATOM   1248 N  N     . THR A 1 163 ? 78.974 -4.884  19.246  1.00 78.02 ? 160  THR A N     1 
ATOM   1249 C  CA    . THR A 1 163 ? 77.645 -5.405  18.945  1.00 69.09 ? 160  THR A CA    1 
ATOM   1250 C  C     . THR A 1 163 ? 76.602 -4.940  19.964  1.00 67.53 ? 160  THR A C     1 
ATOM   1251 O  O     . THR A 1 163 ? 75.451 -5.380  19.935  1.00 65.57 ? 160  THR A O     1 
ATOM   1252 C  CB    . THR A 1 163 ? 77.646 -6.949  18.862  1.00 73.82 ? 160  THR A CB    1 
ATOM   1253 O  OG1   . THR A 1 163 ? 78.416 -7.491  19.944  1.00 70.85 ? 160  THR A OG1   1 
ATOM   1254 C  CG2   . THR A 1 163 ? 78.237 -7.416  17.532  1.00 61.33 ? 160  THR A CG2   1 
ATOM   1255 N  N     . VAL A 1 164 ? 77.006 -4.047  20.861  1.00 62.10 ? 161  VAL A N     1 
ATOM   1256 C  CA    . VAL A 1 164 ? 76.075 -3.469  21.820  1.00 61.11 ? 161  VAL A CA    1 
ATOM   1257 C  C     . VAL A 1 164 ? 75.057 -2.549  21.135  1.00 59.04 ? 161  VAL A C     1 
ATOM   1258 O  O     . VAL A 1 164 ? 73.891 -2.509  21.534  1.00 53.37 ? 161  VAL A O     1 
ATOM   1259 C  CB    . VAL A 1 164 ? 76.808 -2.700  22.942  1.00 70.09 ? 161  VAL A CB    1 
ATOM   1260 C  CG1   . VAL A 1 164 ? 77.428 -3.675  23.939  1.00 58.75 ? 161  VAL A CG1   1 
ATOM   1261 C  CG2   . VAL A 1 164 ? 77.861 -1.764  22.352  1.00 67.16 ? 161  VAL A CG2   1 
ATOM   1262 N  N     . GLN A 1 165 ? 75.495 -1.825  20.104  1.00 49.20 ? 162  GLN A N     1 
ATOM   1263 C  CA    . GLN A 1 165 ? 74.635 -0.861  19.408  1.00 45.99 ? 162  GLN A CA    1 
ATOM   1264 C  C     . GLN A 1 165 ? 74.149 -1.372  18.047  1.00 41.25 ? 162  GLN A C     1 
ATOM   1265 O  O     . GLN A 1 165 ? 74.783 -2.239  17.444  1.00 33.96 ? 162  GLN A O     1 
ATOM   1266 C  CB    . GLN A 1 165 ? 75.359 0.475   19.243  1.00 47.18 ? 162  GLN A CB    1 
ATOM   1267 C  CG    . GLN A 1 165 ? 75.815 1.082   20.562  1.00 61.37 ? 162  GLN A CG    1 
ATOM   1268 C  CD    . GLN A 1 165 ? 76.376 2.483   20.405  1.00 73.42 ? 162  GLN A CD    1 
ATOM   1269 O  OE1   . GLN A 1 165 ? 76.585 3.192   21.391  1.00 79.60 ? 162  GLN A OE1   1 
ATOM   1270 N  NE2   . GLN A 1 165 ? 76.623 2.890   19.164  1.00 66.55 ? 162  GLN A NE2   1 
ATOM   1271 N  N     . LYS A 1 166 ? 73.030 -0.837  17.559  1.00 27.73 ? 163  LYS A N     1 
ATOM   1272 C  CA    . LYS A 1 166 ? 72.404 -1.413  16.369  1.00 35.56 ? 163  LYS A CA    1 
ATOM   1273 C  C     . LYS A 1 166 ? 73.253 -1.335  15.099  1.00 23.64 ? 163  LYS A C     1 
ATOM   1274 O  O     . LYS A 1 166 ? 73.294 -2.289  14.336  1.00 22.68 ? 163  LYS A O     1 
ATOM   1275 C  CB    . LYS A 1 166 ? 70.984 -0.875  16.103  1.00 28.34 ? 163  LYS A CB    1 
ATOM   1276 C  CG    . LYS A 1 166 ? 70.178 -1.863  15.247  1.00 36.95 ? 163  LYS A CG    1 
ATOM   1277 C  CD    . LYS A 1 166 ? 68.769 -1.416  14.846  1.00 41.51 ? 163  LYS A CD    1 
ATOM   1278 C  CE    . LYS A 1 166 ? 68.008 -2.608  14.229  1.00 35.59 ? 163  LYS A CE    1 
ATOM   1279 N  NZ    . LYS A 1 166 ? 66.948 -2.272  13.205  1.00 36.05 ? 163  LYS A NZ    1 
ATOM   1280 N  N     . GLU A 1 167 ? 73.905 -0.203  14.852  1.00 24.60 ? 164  GLU A N     1 
ATOM   1281 C  CA    . GLU A 1 167 ? 74.721 -0.086  13.647  1.00 25.76 ? 164  GLU A CA    1 
ATOM   1282 C  C     . GLU A 1 167 ? 75.873 -1.099  13.655  1.00 27.67 ? 164  GLU A C     1 
ATOM   1283 O  O     . GLU A 1 167 ? 76.250 -1.630  12.615  1.00 23.01 ? 164  GLU A O     1 
ATOM   1284 C  CB    . GLU A 1 167 ? 75.237 1.345   13.454  1.00 32.61 ? 164  GLU A CB    1 
ATOM   1285 C  CG    . GLU A 1 167 ? 76.143 1.536   12.235  1.00 26.65 ? 164  GLU A CG    1 
ATOM   1286 C  CD    . GLU A 1 167 ? 75.474 1.184   10.905  1.00 33.05 ? 164  GLU A CD    1 
ATOM   1287 O  OE1   . GLU A 1 167 ? 76.186 1.173   9.874   1.00 35.20 ? 164  GLU A OE1   1 
ATOM   1288 O  OE2   . GLU A 1 167 ? 74.250 0.915   10.883  1.00 31.34 ? 164  GLU A OE2   1 
ATOM   1289 N  N     . GLY A 1 168 ? 76.422 -1.372  14.833  1.00 31.05 ? 165  GLY A N     1 
ATOM   1290 C  CA    . GLY A 1 168 ? 77.503 -2.334  14.953  1.00 29.84 ? 165  GLY A CA    1 
ATOM   1291 C  C     . GLY A 1 168 ? 77.046 -3.752  14.670  1.00 22.82 ? 165  GLY A C     1 
ATOM   1292 O  O     . GLY A 1 168 ? 77.734 -4.510  13.989  1.00 22.59 ? 165  GLY A O     1 
ATOM   1293 N  N     . MET A 1 169 ? 75.884 -4.120  15.201  1.00 25.81 ? 166  MET A N     1 
ATOM   1294 C  CA    . MET A 1 169 ? 75.288 -5.412  14.887  1.00 23.22 ? 166  MET A CA    1 
ATOM   1295 C  C     . MET A 1 169 ? 75.048 -5.513  13.381  1.00 20.99 ? 166  MET A C     1 
ATOM   1296 O  O     . MET A 1 169 ? 75.416 -6.505  12.751  1.00 22.79 ? 166  MET A O     1 
ATOM   1297 C  CB    . MET A 1 169 ? 73.972 -5.600  15.646  1.00 30.19 ? 166  MET A CB    1 
ATOM   1298 C  CG    . MET A 1 169 ? 74.139 -5.896  17.134  1.00 48.18 ? 166  MET A CG    1 
ATOM   1299 S  SD    . MET A 1 169 ? 74.659 -7.596  17.475  1.00 66.08 ? 166  MET A SD    1 
ATOM   1300 C  CE    . MET A 1 169 ? 73.229 -8.520  16.904  1.00 37.96 ? 166  MET A CE    1 
ATOM   1301 N  N     . ARG A 1 170 ? 74.449 -4.480  12.797  1.00 19.86 ? 167  ARG A N     1 
ATOM   1302 C  CA    . ARG A 1 170 ? 74.176 -4.513  11.360  1.00 16.41 ? 167  ARG A CA    1 
ATOM   1303 C  C     . ARG A 1 170 ? 75.446 -4.846  10.598  1.00 18.51 ? 167  ARG A C     1 
ATOM   1304 O  O     . ARG A 1 170 ? 75.436 -5.718  9.741   1.00 15.24 ? 167  ARG A O     1 
ATOM   1305 C  CB    . ARG A 1 170 ? 73.609 -3.186  10.853  1.00 17.42 ? 167  ARG A CB    1 
ATOM   1306 C  CG    . ARG A 1 170 ? 73.269 -3.196  9.360   1.00 15.98 ? 167  ARG A CG    1 
ATOM   1307 C  CD    . ARG A 1 170 ? 73.116 -1.776  8.797   1.00 17.15 ? 167  ARG A CD    1 
ATOM   1308 N  NE    . ARG A 1 170 ? 74.411 -1.133  8.569   1.00 18.25 ? 167  ARG A NE    1 
ATOM   1309 C  CZ    . ARG A 1 170 ? 75.177 -1.347  7.504   1.00 18.20 ? 167  ARG A CZ    1 
ATOM   1310 N  NH1   . ARG A 1 170 ? 74.791 -2.194  6.557   1.00 16.06 ? 167  ARG A NH1   1 
ATOM   1311 N  NH2   . ARG A 1 170 ? 76.334 -0.713  7.381   1.00 21.62 ? 167  ARG A NH2   1 
ATOM   1312 N  N     . LYS A 1 171 ? 76.534 -4.142  10.915  1.00 15.69 ? 168  LYS A N     1 
ATOM   1313 C  CA    . LYS A 1 171 ? 77.811 -4.354  10.237  1.00 16.68 ? 168  LYS A CA    1 
ATOM   1314 C  C     . LYS A 1 171 ? 78.435 -5.732  10.499  1.00 16.16 ? 168  LYS A C     1 
ATOM   1315 O  O     . LYS A 1 171 ? 78.991 -6.343  9.586   1.00 18.92 ? 168  LYS A O     1 
ATOM   1316 C  CB    . LYS A 1 171 ? 78.808 -3.244  10.570  1.00 27.40 ? 168  LYS A CB    1 
ATOM   1317 C  CG    . LYS A 1 171 ? 78.604 -1.968  9.759   1.00 28.88 ? 168  LYS A CG    1 
ATOM   1318 C  CD    . LYS A 1 171 ? 79.730 -0.973  10.043  1.00 42.43 ? 168  LYS A CD    1 
ATOM   1319 C  CE    . LYS A 1 171 ? 79.915 0.004   8.890   1.00 47.54 ? 168  LYS A CE    1 
ATOM   1320 N  NZ    . LYS A 1 171 ? 81.117 0.867   9.072   1.00 49.97 ? 168  LYS A NZ    1 
ATOM   1321 N  N     . GLN A 1 172 ? 78.353 -6.223  11.731  1.00 20.37 ? 169  GLN A N     1 
ATOM   1322 C  CA    . GLN A 1 172 ? 78.885 -7.552  12.023  1.00 20.76 ? 169  GLN A CA    1 
ATOM   1323 C  C     . GLN A 1 172 ? 78.174 -8.578  11.147  1.00 20.86 ? 169  GLN A C     1 
ATOM   1324 O  O     . GLN A 1 172 ? 78.808 -9.452  10.554  1.00 17.27 ? 169  GLN A O     1 
ATOM   1325 C  CB    . GLN A 1 172 ? 78.725 -7.901  13.499  1.00 22.85 ? 169  GLN A CB    1 
ATOM   1326 C  CG    . GLN A 1 172 ? 79.741 -7.236  14.418  1.00 41.75 ? 169  GLN A CG    1 
ATOM   1327 C  CD    . GLN A 1 172 ? 81.139 -7.834  14.288  1.00 59.91 ? 169  GLN A CD    1 
ATOM   1328 O  OE1   . GLN A 1 172 ? 81.361 -8.767  13.512  1.00 64.70 ? 169  GLN A OE1   1 
ATOM   1329 N  NE2   . GLN A 1 172 ? 82.086 -7.294  15.051  1.00 63.36 ? 169  GLN A NE2   1 
ATOM   1330 N  N     . GLY A 1 173 ? 76.852 -8.460  11.065  1.00 18.33 ? 170  GLY A N     1 
ATOM   1331 C  CA    . GLY A 1 173 ? 76.059 -9.352  10.234  1.00 14.02 ? 170  GLY A CA    1 
ATOM   1332 C  C     . GLY A 1 173 ? 76.433 -9.279  8.769   1.00 12.62 ? 170  GLY A C     1 
ATOM   1333 O  O     . GLY A 1 173 ? 76.611 -10.308 8.103   1.00 11.60 ? 170  GLY A O     1 
ATOM   1334 N  N     . LEU A 1 174 ? 76.537 -8.061  8.248   1.00 15.53 ? 171  LEU A N     1 
ATOM   1335 C  CA    . LEU A 1 174 ? 76.934 -7.866  6.855   1.00 13.75 ? 171  LEU A CA    1 
ATOM   1336 C  C     . LEU A 1 174 ? 78.313 -8.470  6.566   1.00 18.64 ? 171  LEU A C     1 
ATOM   1337 O  O     . LEU A 1 174 ? 78.535 -9.070  5.517   1.00 14.51 ? 171  LEU A O     1 
ATOM   1338 C  CB    . LEU A 1 174 ? 76.943 -6.374  6.496   1.00 13.42 ? 171  LEU A CB    1 
ATOM   1339 C  CG    . LEU A 1 174 ? 77.331 -6.014  5.058   1.00 11.67 ? 171  LEU A CG    1 
ATOM   1340 C  CD1   . LEU A 1 174 ? 76.408 -6.714  4.055   1.00 13.04 ? 171  LEU A CD1   1 
ATOM   1341 C  CD2   . LEU A 1 174 ? 77.278 -4.491  4.864   1.00 16.39 ? 171  LEU A CD2   1 
ATOM   1342 N  N     . PHE A 1 175 ? 79.247 -8.297  7.492   1.00 17.41 ? 172  PHE A N     1 
ATOM   1343 C  CA    . PHE A 1 175 ? 80.597 -8.803  7.278   1.00 20.10 ? 172  PHE A CA    1 
ATOM   1344 C  C     . PHE A 1 175 ? 80.626 -10.328 7.210   1.00 17.56 ? 172  PHE A C     1 
ATOM   1345 O  O     . PHE A 1 175 ? 81.309 -10.894 6.359   1.00 21.07 ? 172  PHE A O     1 
ATOM   1346 C  CB    . PHE A 1 175 ? 81.540 -8.299  8.373   1.00 21.25 ? 172  PHE A CB    1 
ATOM   1347 C  CG    . PHE A 1 175 ? 82.005 -6.876  8.175   1.00 39.61 ? 172  PHE A CG    1 
ATOM   1348 C  CD1   . PHE A 1 175 ? 81.106 -5.872  7.850   1.00 38.80 ? 172  PHE A CD1   1 
ATOM   1349 C  CD2   . PHE A 1 175 ? 83.341 -6.544  8.322   1.00 53.38 ? 172  PHE A CD2   1 
ATOM   1350 C  CE1   . PHE A 1 175 ? 81.528 -4.569  7.673   1.00 45.57 ? 172  PHE A CE1   1 
ATOM   1351 C  CE2   . PHE A 1 175 ? 83.771 -5.241  8.145   1.00 59.28 ? 172  PHE A CE2   1 
ATOM   1352 C  CZ    . PHE A 1 175 ? 82.862 -4.253  7.820   1.00 51.39 ? 172  PHE A CZ    1 
ATOM   1353 N  N     . GLN A 1 176 ? 79.893 -10.988 8.107   1.00 18.66 ? 173  GLN A N     1 
ATOM   1354 C  CA    . GLN A 1 176 ? 79.811 -12.448 8.090   1.00 23.71 ? 173  GLN A CA    1 
ATOM   1355 C  C     . GLN A 1 176 ? 79.255 -12.926 6.757   1.00 20.30 ? 173  GLN A C     1 
ATOM   1356 O  O     . GLN A 1 176 ? 79.751 -13.899 6.173   1.00 16.64 ? 173  GLN A O     1 
ATOM   1357 C  CB    . GLN A 1 176 ? 78.962 -12.990 9.254   1.00 17.43 ? 173  GLN A CB    1 
ATOM   1358 C  CG    . GLN A 1 176 ? 79.590 -12.793 10.637  1.00 17.97 ? 173  GLN A CG    1 
ATOM   1359 C  CD    . GLN A 1 176 ? 78.768 -13.428 11.739  1.00 27.39 ? 173  GLN A CD    1 
ATOM   1360 O  OE1   . GLN A 1 176 ? 77.682 -13.949 11.494  1.00 20.97 ? 173  GLN A OE1   1 
ATOM   1361 N  NE2   . GLN A 1 176 ? 79.287 -13.395 12.965  1.00 27.48 ? 173  GLN A NE2   1 
ATOM   1362 N  N     . TRP A 1 177 ? 78.229 -12.234 6.271   1.00 15.03 ? 174  TRP A N     1 
ATOM   1363 C  CA    . TRP A 1 177 ? 77.584 -12.590 5.007   1.00 15.86 ? 174  TRP A CA    1 
ATOM   1364 C  C     . TRP A 1 177 ? 78.557 -12.481 3.835   1.00 16.67 ? 174  TRP A C     1 
ATOM   1365 O  O     . TRP A 1 177 ? 78.702 -13.414 3.036   1.00 15.44 ? 174  TRP A O     1 
ATOM   1366 C  CB    . TRP A 1 177 ? 76.350 -11.700 4.770   1.00 11.10 ? 174  TRP A CB    1 
ATOM   1367 C  CG    . TRP A 1 177 ? 75.674 -11.888 3.422   1.00 15.40 ? 174  TRP A CG    1 
ATOM   1368 C  CD1   . TRP A 1 177 ? 75.773 -11.064 2.346   1.00 15.51 ? 174  TRP A CD1   1 
ATOM   1369 C  CD2   . TRP A 1 177 ? 74.777 -12.947 3.030   1.00 13.41 ? 174  TRP A CD2   1 
ATOM   1370 N  NE1   . TRP A 1 177 ? 75.016 -11.533 1.310   1.00 13.41 ? 174  TRP A NE1   1 
ATOM   1371 C  CE2   . TRP A 1 177 ? 74.391 -12.689 1.698   1.00 15.38 ? 174  TRP A CE2   1 
ATOM   1372 C  CE3   . TRP A 1 177 ? 74.277 -14.088 3.671   1.00 11.24 ? 174  TRP A CE3   1 
ATOM   1373 C  CZ2   . TRP A 1 177 ? 73.526 -13.525 0.991   1.00 13.62 ? 174  TRP A CZ2   1 
ATOM   1374 C  CZ3   . TRP A 1 177 ? 73.405 -14.914 2.976   1.00 12.64 ? 174  TRP A CZ3   1 
ATOM   1375 C  CH2   . TRP A 1 177 ? 73.035 -14.628 1.646   1.00 11.22 ? 174  TRP A CH2   1 
ATOM   1376 N  N     . LEU A 1 178 ? 79.225 -11.341 3.738   1.00 14.49 ? 175  LEU A N     1 
ATOM   1377 C  CA    . LEU A 1 178 ? 80.143 -11.096 2.633   1.00 14.22 ? 175  LEU A CA    1 
ATOM   1378 C  C     . LEU A 1 178 ? 81.375 -11.987 2.736   1.00 24.29 ? 175  LEU A C     1 
ATOM   1379 O  O     . LEU A 1 178 ? 81.933 -12.404 1.726   1.00 24.26 ? 175  LEU A O     1 
ATOM   1380 C  CB    . LEU A 1 178 ? 80.576 -9.630  2.615   1.00 16.10 ? 175  LEU A CB    1 
ATOM   1381 C  CG    . LEU A 1 178 ? 79.451 -8.633  2.335   1.00 16.36 ? 175  LEU A CG    1 
ATOM   1382 C  CD1   . LEU A 1 178 ? 80.002 -7.211  2.324   1.00 21.90 ? 175  LEU A CD1   1 
ATOM   1383 C  CD2   . LEU A 1 178 ? 78.767 -8.957  1.015   1.00 18.23 ? 175  LEU A CD2   1 
ATOM   1384 N  N     . ASP A 1 179 ? 81.802 -12.265 3.961   1.00 17.11 ? 176  ASP A N     1 
ATOM   1385 C  CA    . ASP A 1 179 ? 82.970 -13.122 4.160   1.00 25.94 ? 176  ASP A CA    1 
ATOM   1386 C  C     . ASP A 1 179 ? 82.730 -14.511 3.600   1.00 29.41 ? 176  ASP A C     1 
ATOM   1387 O  O     . ASP A 1 179 ? 83.661 -15.164 3.130   1.00 32.56 ? 176  ASP A O     1 
ATOM   1388 C  CB    . ASP A 1 179 ? 83.356 -13.205 5.639   1.00 28.45 ? 176  ASP A CB    1 
ATOM   1389 C  CG    . ASP A 1 179 ? 84.135 -11.995 6.099   1.00 36.45 ? 176  ASP A CG    1 
ATOM   1390 O  OD1   . ASP A 1 179 ? 84.792 -11.364 5.244   1.00 46.54 ? 176  ASP A OD1   1 
ATOM   1391 O  OD2   . ASP A 1 179 ? 84.095 -11.672 7.308   1.00 46.73 ? 176  ASP A OD2   1 
ATOM   1392 N  N     . SER A 1 180 ? 81.473 -14.943 3.641   1.00 26.14 ? 177  SER A N     1 
ATOM   1393 C  CA    . SER A 1 180 ? 81.090 -16.274 3.191   1.00 30.84 ? 177  SER A CA    1 
ATOM   1394 C  C     . SER A 1 180 ? 80.787 -16.349 1.698   1.00 30.99 ? 177  SER A C     1 
ATOM   1395 O  O     . SER A 1 180 ? 80.780 -17.439 1.121   1.00 37.67 ? 177  SER A O     1 
ATOM   1396 C  CB    . SER A 1 180 ? 79.867 -16.756 3.976   1.00 23.83 ? 177  SER A CB    1 
ATOM   1397 O  OG    . SER A 1 180 ? 80.127 -16.765 5.367   1.00 38.57 ? 177  SER A OG    1 
ATOM   1398 N  N     . LEU A 1 181 ? 80.512 -15.203 1.078   1.00 23.81 ? 178  LEU A N     1 
ATOM   1399 C  CA    . LEU A 1 181 ? 80.053 -15.179 -0.312  1.00 22.40 ? 178  LEU A CA    1 
ATOM   1400 C  C     . LEU A 1 181 ? 81.033 -15.800 -1.296  1.00 33.95 ? 178  LEU A C     1 
ATOM   1401 O  O     . LEU A 1 181 ? 82.240 -15.589 -1.199  1.00 28.95 ? 178  LEU A O     1 
ATOM   1402 C  CB    . LEU A 1 181 ? 79.763 -13.747 -0.767  1.00 28.00 ? 178  LEU A CB    1 
ATOM   1403 C  CG    . LEU A 1 181 ? 78.346 -13.202 -0.672  1.00 26.58 ? 178  LEU A CG    1 
ATOM   1404 C  CD1   . LEU A 1 181 ? 78.208 -11.970 -1.577  1.00 17.11 ? 178  LEU A CD1   1 
ATOM   1405 C  CD2   . LEU A 1 181 ? 77.330 -14.275 -1.057  1.00 23.56 ? 178  LEU A CD2   1 
ATOM   1406 N  N     . GLN A 1 182 ? 80.501 -16.546 -2.260  1.00 42.42 ? 179  GLN A N     1 
ATOM   1407 C  CA    . GLN A 1 182 ? 81.311 -17.078 -3.349  1.00 50.04 ? 179  GLN A CA    1 
ATOM   1408 C  C     . GLN A 1 182 ? 81.097 -16.265 -4.626  1.00 53.81 ? 179  GLN A C     1 
ATOM   1409 O  O     . GLN A 1 182 ? 80.230 -16.594 -5.441  1.00 54.43 ? 179  GLN A O     1 
ATOM   1410 C  CB    . GLN A 1 182 ? 80.975 -18.552 -3.599  1.00 51.74 ? 179  GLN A CB    1 
ATOM   1411 C  CG    . GLN A 1 182 ? 81.951 -19.264 -4.524  1.00 52.24 ? 179  GLN A CG    1 
ATOM   1412 C  CD    . GLN A 1 182 ? 83.394 -19.115 -4.071  1.00 64.81 ? 179  GLN A CD    1 
ATOM   1413 O  OE1   . GLN A 1 182 ? 84.129 -18.256 -4.568  1.00 64.54 ? 179  GLN A OE1   1 
ATOM   1414 N  NE2   . GLN A 1 182 ? 83.808 -19.952 -3.122  1.00 52.94 ? 179  GLN A NE2   1 
ATOM   1415 N  N     . ILE A 1 183 ? 81.899 -15.212 -4.795  1.00 44.09 ? 180  ILE A N     1 
ATOM   1416 C  CA    . ILE A 1 183 ? 81.758 -14.277 -5.917  1.00 54.89 ? 180  ILE A CA    1 
ATOM   1417 C  C     . ILE A 1 183 ? 82.187 -14.892 -7.249  1.00 59.26 ? 180  ILE A C     1 
ATOM   1418 O  O     . ILE A 1 183 ? 82.027 -14.283 -8.311  1.00 56.69 ? 180  ILE A O     1 
ATOM   1419 C  CB    . ILE A 1 183 ? 82.534 -12.969 -5.655  1.00 52.38 ? 180  ILE A CB    1 
ATOM   1420 C  CG1   . ILE A 1 183 ? 83.952 -13.268 -5.159  1.00 51.99 ? 180  ILE A CG1   1 
ATOM   1421 C  CG2   . ILE A 1 183 ? 81.804 -12.124 -4.622  1.00 50.80 ? 180  ILE A CG2   1 
ATOM   1422 C  CD1   . ILE A 1 183 ? 84.853 -13.921 -6.184  1.00 61.64 ? 180  ILE A CD1   1 
ATOM   1423 N  N     . ASP A 1 184 ? 82.712 -16.112 -7.178  1.00 62.21 ? 181  ASP A N     1 
ATOM   1424 C  CA    . ASP A 1 184 ? 83.320 -16.773 -8.327  1.00 63.28 ? 181  ASP A CA    1 
ATOM   1425 C  C     . ASP A 1 184 ? 82.309 -17.510 -9.173  1.00 65.10 ? 181  ASP A C     1 
ATOM   1426 O  O     . ASP A 1 184 ? 82.647 -18.150 -10.167 1.00 69.83 ? 181  ASP A O     1 
ATOM   1427 C  CB    . ASP A 1 184 ? 84.394 -17.752 -7.847  1.00 70.44 ? 181  ASP A CB    1 
ATOM   1428 C  CG    . ASP A 1 184 ? 85.389 -18.116 -8.938  1.00 87.66 ? 181  ASP A CG    1 
ATOM   1429 O  OD1   . ASP A 1 184 ? 85.162 -17.750 -10.114 1.00 90.54 ? 181  ASP A OD1   1 
ATOM   1430 O  OD2   . ASP A 1 184 ? 86.401 -18.774 -8.613  1.00 86.36 ? 181  ASP A OD2   1 
ATOM   1431 N  N     . ASN A 1 185 ? 81.056 -17.407 -8.775  1.00 57.11 ? 182  ASN A N     1 
ATOM   1432 C  CA    . ASN A 1 185 ? 80.030 -18.214 -9.380  1.00 55.96 ? 182  ASN A CA    1 
ATOM   1433 C  C     . ASN A 1 185 ? 78.801 -17.363 -9.700  1.00 52.12 ? 182  ASN A C     1 
ATOM   1434 O  O     . ASN A 1 185 ? 78.042 -16.990 -8.801  1.00 49.51 ? 182  ASN A O     1 
ATOM   1435 C  CB    . ASN A 1 185 ? 79.675 -19.347 -8.407  1.00 50.02 ? 182  ASN A CB    1 
ATOM   1436 C  CG    . ASN A 1 185 ? 78.471 -20.155 -8.845  1.00 46.99 ? 182  ASN A CG    1 
ATOM   1437 O  OD1   . ASN A 1 185 ? 78.029 -20.079 -9.994  1.00 50.46 ? 182  ASN A OD1   1 
ATOM   1438 N  ND2   . ASN A 1 185 ? 77.931 -20.944 -7.920  1.00 52.32 ? 182  ASN A ND2   1 
ATOM   1439 N  N     . LEU A 1 186 ? 78.614 -17.058 -10.984 1.00 48.32 ? 183  LEU A N     1 
ATOM   1440 C  CA    . LEU A 1 186 ? 77.542 -16.167 -11.437 1.00 41.87 ? 183  LEU A CA    1 
ATOM   1441 C  C     . LEU A 1 186 ? 76.130 -16.711 -11.193 1.00 44.77 ? 183  LEU A C     1 
ATOM   1442 O  O     . LEU A 1 186 ? 75.146 -16.012 -11.441 1.00 45.86 ? 183  LEU A O     1 
ATOM   1443 C  CB    . LEU A 1 186 ? 77.718 -15.822 -12.919 1.00 47.15 ? 183  LEU A CB    1 
ATOM   1444 C  CG    . LEU A 1 186 ? 78.633 -14.638 -13.251 1.00 51.19 ? 183  LEU A CG    1 
ATOM   1445 C  CD1   . LEU A 1 186 ? 80.068 -14.884 -12.797 1.00 61.05 ? 183  LEU A CD1   1 
ATOM   1446 C  CD2   . LEU A 1 186 ? 78.585 -14.332 -14.736 1.00 47.05 ? 183  LEU A CD2   1 
ATOM   1447 N  N     . THR A 1 187 ? 76.028 -17.948 -10.712 1.00 43.35 ? 184  THR A N     1 
ATOM   1448 C  CA    . THR A 1 187 ? 74.717 -18.561 -10.490 1.00 44.83 ? 184  THR A CA    1 
ATOM   1449 C  C     . THR A 1 187 ? 74.380 -18.844 -9.019  1.00 35.69 ? 184  THR A C     1 
ATOM   1450 O  O     . THR A 1 187 ? 73.332 -19.420 -8.730  1.00 35.31 ? 184  THR A O     1 
ATOM   1451 C  CB    . THR A 1 187 ? 74.526 -19.862 -11.322 1.00 50.16 ? 184  THR A CB    1 
ATOM   1452 O  OG1   . THR A 1 187 ? 75.407 -20.888 -10.841 1.00 48.57 ? 184  THR A OG1   1 
ATOM   1453 C  CG2   . THR A 1 187 ? 74.800 -19.605 -12.799 1.00 50.97 ? 184  THR A CG2   1 
ATOM   1454 N  N     . SER A 1 188 ? 75.255 -18.452 -8.094  1.00 33.99 ? 185  SER A N     1 
ATOM   1455 C  CA    . SER A 1 188 ? 74.922 -18.548 -6.670  1.00 22.75 ? 185  SER A CA    1 
ATOM   1456 C  C     . SER A 1 188 ? 73.744 -17.633 -6.348  1.00 18.69 ? 185  SER A C     1 
ATOM   1457 O  O     . SER A 1 188 ? 73.833 -16.409 -6.513  1.00 15.69 ? 185  SER A O     1 
ATOM   1458 C  CB    . SER A 1 188 ? 76.116 -18.170 -5.794  1.00 27.51 ? 185  SER A CB    1 
ATOM   1459 O  OG    . SER A 1 188 ? 75.732 -18.080 -4.423  1.00 29.50 ? 185  SER A OG    1 
ATOM   1460 N  N     . PRO A 1 189 ? 72.629 -18.223 -5.903  1.00 17.26 ? 186  PRO A N     1 
ATOM   1461 C  CA    . PRO A 1 189 ? 71.470 -17.428 -5.482  1.00 13.98 ? 186  PRO A CA    1 
ATOM   1462 C  C     . PRO A 1 189 ? 71.828 -16.402 -4.405  1.00 14.74 ? 186  PRO A C     1 
ATOM   1463 O  O     . PRO A 1 189 ? 71.272 -15.304 -4.435  1.00 10.15 ? 186  PRO A O     1 
ATOM   1464 C  CB    . PRO A 1 189 ? 70.524 -18.482 -4.902  1.00 18.36 ? 186  PRO A CB    1 
ATOM   1465 C  CG    . PRO A 1 189 ? 70.866 -19.731 -5.657  1.00 22.47 ? 186  PRO A CG    1 
ATOM   1466 C  CD    . PRO A 1 189 ? 72.357 -19.670 -5.860  1.00 19.88 ? 186  PRO A CD    1 
ATOM   1467 N  N     . ASP A 1 190 ? 72.710 -16.742 -3.463  1.00 12.42 ? 187  ASP A N     1 
ATOM   1468 C  CA    . ASP A 1 190 ? 73.075 -15.789 -2.414  1.00 12.43 ? 187  ASP A CA    1 
ATOM   1469 C  C     . ASP A 1 190 ? 73.810 -14.572 -2.984  1.00 11.94 ? 187  ASP A C     1 
ATOM   1470 O  O     . ASP A 1 190 ? 73.612 -13.440 -2.530  1.00 11.59 ? 187  ASP A O     1 
ATOM   1471 C  CB    . ASP A 1 190 ? 73.936 -16.441 -1.329  1.00 11.91 ? 187  ASP A CB    1 
ATOM   1472 C  CG    . ASP A 1 190 ? 73.162 -17.450 -0.487  1.00 18.89 ? 187  ASP A CG    1 
ATOM   1473 O  OD1   . ASP A 1 190 ? 71.916 -17.429 -0.504  1.00 12.96 ? 187  ASP A OD1   1 
ATOM   1474 O  OD2   . ASP A 1 190 ? 73.812 -18.264 0.198   1.00 22.00 ? 187  ASP A OD2   1 
ATOM   1475 N  N     . LEU A 1 191 ? 74.695 -14.816 -3.945  1.00 11.59 ? 188  LEU A N     1 
ATOM   1476 C  CA    . LEU A 1 191 ? 75.390 -13.735 -4.635  1.00 14.53 ? 188  LEU A CA    1 
ATOM   1477 C  C     . LEU A 1 191 ? 74.399 -12.864 -5.393  1.00 13.10 ? 188  LEU A C     1 
ATOM   1478 O  O     . LEU A 1 191 ? 74.484 -11.637 -5.353  1.00 13.47 ? 188  LEU A O     1 
ATOM   1479 C  CB    . LEU A 1 191 ? 76.420 -14.303 -5.621  1.00 15.69 ? 188  LEU A CB    1 
ATOM   1480 C  CG    . LEU A 1 191 ? 77.205 -13.272 -6.441  1.00 17.74 ? 188  LEU A CG    1 
ATOM   1481 C  CD1   . LEU A 1 191 ? 77.869 -12.258 -5.533  1.00 16.19 ? 188  LEU A CD1   1 
ATOM   1482 C  CD2   . LEU A 1 191 ? 78.250 -13.962 -7.332  1.00 25.48 ? 188  LEU A CD2   1 
ATOM   1483 N  N     . GLN A 1 192 ? 73.484 -13.499 -6.113  1.00 10.30 ? 189  GLN A N     1 
ATOM   1484 C  CA    . GLN A 1 192 ? 72.463 -12.757 -6.863  1.00 14.47 ? 189  GLN A CA    1 
ATOM   1485 C  C     . GLN A 1 192 ? 71.641 -11.836 -5.953  1.00 14.06 ? 189  GLN A C     1 
ATOM   1486 O  O     . GLN A 1 192 ? 71.411 -10.664 -6.285  1.00 10.13 ? 189  GLN A O     1 
ATOM   1487 C  CB    . GLN A 1 192 ? 71.567 -13.722 -7.651  1.00 14.67 ? 189  GLN A CB    1 
ATOM   1488 C  CG    . GLN A 1 192 ? 72.314 -14.431 -8.788  1.00 18.97 ? 189  GLN A CG    1 
ATOM   1489 C  CD    . GLN A 1 192 ? 71.544 -15.602 -9.365  1.00 29.61 ? 189  GLN A CD    1 
ATOM   1490 O  OE1   . GLN A 1 192 ? 70.501 -15.996 -8.841  1.00 30.25 ? 189  GLN A OE1   1 
ATOM   1491 N  NE2   . GLN A 1 192 ? 72.060 -16.173 -10.448 1.00 41.31 ? 189  GLN A NE2   1 
ATOM   1492 N  N     . LEU A 1 193 ? 71.216 -12.353 -4.801  1.00 12.39 ? 190  LEU A N     1 
ATOM   1493 C  CA    . LEU A 1 193 ? 70.507 -11.530 -3.821  1.00 9.15  ? 190  LEU A CA    1 
ATOM   1494 C  C     . LEU A 1 193 ? 71.355 -10.334 -3.377  1.00 11.72 ? 190  LEU A C     1 
ATOM   1495 O  O     . LEU A 1 193 ? 70.838 -9.230  -3.217  1.00 10.41 ? 190  LEU A O     1 
ATOM   1496 C  CB    . LEU A 1 193 ? 70.101 -12.337 -2.583  1.00 10.77 ? 190  LEU A CB    1 
ATOM   1497 C  CG    . LEU A 1 193 ? 68.976 -13.372 -2.677  1.00 12.41 ? 190  LEU A CG    1 
ATOM   1498 C  CD1   . LEU A 1 193 ? 68.653 -13.883 -1.273  1.00 10.16 ? 190  LEU A CD1   1 
ATOM   1499 C  CD2   . LEU A 1 193 ? 67.732 -12.798 -3.347  1.00 8.00  ? 190  LEU A CD2   1 
ATOM   1500 N  N     . THR A 1 194 ? 72.646 -10.561 -3.152  1.00 9.76  ? 191  THR A N     1 
ATOM   1501 C  CA    . THR A 1 194 ? 73.528 -9.506  -2.653  1.00 10.04 ? 191  THR A CA    1 
ATOM   1502 C  C     . THR A 1 194 ? 73.673 -8.385  -3.672  1.00 9.64  ? 191  THR A C     1 
ATOM   1503 O  O     . THR A 1 194 ? 73.650 -7.200  -3.323  1.00 10.95 ? 191  THR A O     1 
ATOM   1504 C  CB    . THR A 1 194 ? 74.924 -10.054 -2.324  1.00 12.52 ? 191  THR A CB    1 
ATOM   1505 O  OG1   . THR A 1 194 ? 74.810 -11.096 -1.348  1.00 13.63 ? 191  THR A OG1   1 
ATOM   1506 C  CG2   . THR A 1 194 ? 75.800 -8.942  -1.772  1.00 11.29 ? 191  THR A CG2   1 
ATOM   1507 N  N     . VAL A 1 195 ? 73.807 -8.762  -4.938  1.00 12.27 ? 192  VAL A N     1 
ATOM   1508 C  CA    . VAL A 1 195 ? 73.915 -7.768  -5.993  1.00 14.29 ? 192  VAL A CA    1 
ATOM   1509 C  C     . VAL A 1 195 ? 72.579 -7.063  -6.116  1.00 12.15 ? 192  VAL A C     1 
ATOM   1510 O  O     . VAL A 1 195 ? 72.530 -5.854  -6.322  1.00 11.81 ? 192  VAL A O     1 
ATOM   1511 C  CB    . VAL A 1 195 ? 74.331 -8.410  -7.339  1.00 12.42 ? 192  VAL A CB    1 
ATOM   1512 C  CG1   . VAL A 1 195 ? 74.217 -7.392  -8.474  1.00 18.90 ? 192  VAL A CG1   1 
ATOM   1513 C  CG2   . VAL A 1 195 ? 75.750 -8.929  -7.251  1.00 10.44 ? 192  VAL A CG2   1 
ATOM   1514 N  N     . GLY A 1 196 ? 71.494 -7.819  -5.984  1.00 11.50 ? 193  GLY A N     1 
ATOM   1515 C  CA    . GLY A 1 196 ? 70.164 -7.227  -5.902  1.00 8.90  ? 193  GLY A CA    1 
ATOM   1516 C  C     . GLY A 1 196 ? 70.121 -6.133  -4.847  1.00 12.14 ? 193  GLY A C     1 
ATOM   1517 O  O     . GLY A 1 196 ? 69.621 -5.029  -5.089  1.00 11.71 ? 193  GLY A O     1 
ATOM   1518 N  N     . ALA A 1 197 ? 70.657 -6.428  -3.665  1.00 11.30 ? 194  ALA A N     1 
ATOM   1519 C  CA    . ALA A 1 197 ? 70.716 -5.441  -2.598  1.00 8.34  ? 194  ALA A CA    1 
ATOM   1520 C  C     . ALA A 1 197 ? 71.561 -4.215  -2.979  1.00 11.36 ? 194  ALA A C     1 
ATOM   1521 O  O     . ALA A 1 197 ? 71.246 -3.089  -2.604  1.00 8.95  ? 194  ALA A O     1 
ATOM   1522 C  CB    . ALA A 1 197 ? 71.236 -6.073  -1.311  1.00 9.63  ? 194  ALA A CB    1 
ATOM   1523 N  N     . VAL A 1 198 ? 72.644 -4.426  -3.707  1.00 9.69  ? 195  VAL A N     1 
ATOM   1524 C  CA    . VAL A 1 198 ? 73.452 -3.286  -4.132  1.00 11.49 ? 195  VAL A CA    1 
ATOM   1525 C  C     . VAL A 1 198 ? 72.615 -2.363  -5.015  1.00 13.88 ? 195  VAL A C     1 
ATOM   1526 O  O     . VAL A 1 198 ? 72.643 -1.131  -4.857  1.00 13.31 ? 195  VAL A O     1 
ATOM   1527 C  CB    . VAL A 1 198 ? 74.713 -3.746  -4.866  1.00 10.14 ? 195  VAL A CB    1 
ATOM   1528 C  CG1   . VAL A 1 198 ? 75.425 -2.564  -5.520  1.00 15.39 ? 195  VAL A CG1   1 
ATOM   1529 C  CG2   . VAL A 1 198 ? 75.629 -4.447  -3.878  1.00 12.95 ? 195  VAL A CG2   1 
ATOM   1530 N  N     . ILE A 1 199 ? 71.831 -2.953  -5.911  1.00 8.28  ? 196  ILE A N     1 
ATOM   1531 C  CA    . ILE A 1 199 ? 70.993 -2.161  -6.813  1.00 13.14 ? 196  ILE A CA    1 
ATOM   1532 C  C     . ILE A 1 199 ? 69.891 -1.408  -6.059  1.00 11.94 ? 196  ILE A C     1 
ATOM   1533 O  O     . ILE A 1 199 ? 69.606 -0.247  -6.353  1.00 10.75 ? 196  ILE A O     1 
ATOM   1534 C  CB    . ILE A 1 199 ? 70.401 -3.035  -7.929  1.00 12.25 ? 196  ILE A CB    1 
ATOM   1535 C  CG1   . ILE A 1 199 ? 71.533 -3.587  -8.799  1.00 14.05 ? 196  ILE A CG1   1 
ATOM   1536 C  CG2   . ILE A 1 199 ? 69.414 -2.252  -8.796  1.00 12.58 ? 196  ILE A CG2   1 
ATOM   1537 C  CD1   . ILE A 1 199 ? 71.088 -4.645  -9.793  1.00 15.34 ? 196  ILE A CD1   1 
ATOM   1538 N  N     . VAL A 1 200 ? 69.291 -2.065  -5.077  1.00 9.01  ? 197  VAL A N     1 
ATOM   1539 C  CA    . VAL A 1 200 ? 68.252 -1.442  -4.272  1.00 8.76  ? 197  VAL A CA    1 
ATOM   1540 C  C     . VAL A 1 200 ? 68.796 -0.267  -3.452  1.00 10.64 ? 197  VAL A C     1 
ATOM   1541 O  O     . VAL A 1 200 ? 68.117 0.761   -3.321  1.00 8.31  ? 197  VAL A O     1 
ATOM   1542 C  CB    . VAL A 1 200 ? 67.512 -2.481  -3.385  1.00 5.99  ? 197  VAL A CB    1 
ATOM   1543 C  CG1   . VAL A 1 200 ? 66.467 -1.780  -2.500  1.00 9.64  ? 197  VAL A CG1   1 
ATOM   1544 C  CG2   . VAL A 1 200 ? 66.856 -3.537  -4.279  1.00 12.47 ? 197  VAL A CG2   1 
ATOM   1545 N  N     . GLU A 1 201 ? 70.016 -0.385  -2.928  1.00 10.48 ? 198  GLU A N     1 
ATOM   1546 C  CA    . GLU A 1 201 ? 70.656 0.770   -2.286  1.00 12.25 ? 198  GLU A CA    1 
ATOM   1547 C  C     . GLU A 1 201 ? 70.683 1.953   -3.262  1.00 12.03 ? 198  GLU A C     1 
ATOM   1548 O  O     . GLU A 1 201 ? 70.377 3.095   -2.896  1.00 12.14 ? 198  GLU A O     1 
ATOM   1549 C  CB    . GLU A 1 201 ? 72.093 0.461   -1.816  1.00 14.87 ? 198  GLU A CB    1 
ATOM   1550 C  CG    . GLU A 1 201 ? 72.242 -0.577  -0.675  1.00 12.33 ? 198  GLU A CG    1 
ATOM   1551 C  CD    . GLU A 1 201 ? 72.102 0.008   0.720   1.00 15.07 ? 198  GLU A CD    1 
ATOM   1552 O  OE1   . GLU A 1 201 ? 71.729 1.195   0.849   1.00 18.20 ? 198  GLU A OE1   1 
ATOM   1553 O  OE2   . GLU A 1 201 ? 72.365 -0.722  1.705   1.00 15.18 ? 198  GLU A OE2   1 
ATOM   1554 N  N     . GLU A 1 202 ? 71.063 1.664   -4.499  1.00 11.27 ? 199  GLU A N     1 
ATOM   1555 C  CA    . GLU A 1 202 ? 71.153 2.687   -5.537  1.00 13.21 ? 199  GLU A CA    1 
ATOM   1556 C  C     . GLU A 1 202 ? 69.772 3.281   -5.873  1.00 16.13 ? 199  GLU A C     1 
ATOM   1557 O  O     . GLU A 1 202 ? 69.621 4.508   -5.991  1.00 10.68 ? 199  GLU A O     1 
ATOM   1558 C  CB    . GLU A 1 202 ? 71.833 2.115   -6.783  1.00 17.75 ? 199  GLU A CB    1 
ATOM   1559 C  CG    . GLU A 1 202 ? 73.318 1.810   -6.568  1.00 21.17 ? 199  GLU A CG    1 
ATOM   1560 C  CD    . GLU A 1 202 ? 73.936 0.939   -7.665  1.00 23.17 ? 199  GLU A CD    1 
ATOM   1561 O  OE1   . GLU A 1 202 ? 75.139 0.615   -7.556  1.00 24.74 ? 199  GLU A OE1   1 
ATOM   1562 O  OE2   . GLU A 1 202 ? 73.230 0.575   -8.627  1.00 27.23 ? 199  GLU A OE2   1 
ATOM   1563 N  N     . MET A 1 203 ? 68.771 2.416   -6.032  1.00 12.71 ? 200  MET A N     1 
ATOM   1564 C  CA    . MET A 1 203 ? 67.403 2.882   -6.270  1.00 11.21 ? 200  MET A CA    1 
ATOM   1565 C  C     . MET A 1 203 ? 66.936 3.757   -5.121  1.00 11.10 ? 200  MET A C     1 
ATOM   1566 O  O     . MET A 1 203 ? 66.310 4.802   -5.340  1.00 12.10 ? 200  MET A O     1 
ATOM   1567 C  CB    . MET A 1 203 ? 66.420 1.716   -6.427  1.00 10.39 ? 200  MET A CB    1 
ATOM   1568 C  CG    A MET A 1 203 ? 66.751 0.699   -7.501  0.51 12.29 ? 200  MET A CG    1 
ATOM   1569 C  CG    B MET A 1 203 ? 64.993 2.163   -6.654  0.49 9.75  ? 200  MET A CG    1 
ATOM   1570 S  SD    A MET A 1 203 ? 65.512 -0.622  -7.537  0.51 16.49 ? 200  MET A SD    1 
ATOM   1571 S  SD    B MET A 1 203 ? 63.839 0.783   -6.641  0.49 18.36 ? 200  MET A SD    1 
ATOM   1572 C  CE    A MET A 1 203 ? 64.025 0.357   -7.734  0.51 9.41  ? 200  MET A CE    1 
ATOM   1573 C  CE    B MET A 1 203 ? 64.381 -0.150  -8.058  0.49 12.20 ? 200  MET A CE    1 
ATOM   1574 N  N     . ARG A 1 204 ? 67.216 3.325   -3.895  1.00 10.04 ? 201  ARG A N     1 
ATOM   1575 C  CA    . ARG A 1 204 ? 66.760 4.062   -2.724  1.00 9.06  ? 201  ARG A CA    1 
ATOM   1576 C  C     . ARG A 1 204 ? 67.485 5.407   -2.590  1.00 12.67 ? 201  ARG A C     1 
ATOM   1577 O  O     . ARG A 1 204 ? 66.878 6.413   -2.218  1.00 9.34  ? 201  ARG A O     1 
ATOM   1578 C  CB    . ARG A 1 204 ? 66.861 3.215   -1.450  1.00 12.86 ? 201  ARG A CB    1 
ATOM   1579 C  CG    . ARG A 1 204 ? 65.872 2.045   -1.459  1.00 10.31 ? 201  ARG A CG    1 
ATOM   1580 C  CD    . ARG A 1 204 ? 66.000 1.198   -0.220  1.00 14.44 ? 201  ARG A CD    1 
ATOM   1581 N  NE    . ARG A 1 204 ? 65.994 2.023   0.978   1.00 8.64  ? 201  ARG A NE    1 
ATOM   1582 C  CZ    . ARG A 1 204 ? 67.031 2.149   1.798   1.00 11.35 ? 201  ARG A CZ    1 
ATOM   1583 N  NH1   . ARG A 1 204 ? 66.948 2.941   2.861   1.00 12.70 ? 201  ARG A NH1   1 
ATOM   1584 N  NH2   . ARG A 1 204 ? 68.153 1.489   1.554   1.00 14.99 ? 201  ARG A NH2   1 
ATOM   1585 N  N     . ALA A 1 205 ? 68.767 5.436   -2.940  1.00 11.92 ? 202  ALA A N     1 
ATOM   1586 C  CA    . ALA A 1 205 ? 69.497 6.702   -2.941  1.00 14.23 ? 202  ALA A CA    1 
ATOM   1587 C  C     . ALA A 1 205 ? 68.897 7.674   -3.973  1.00 10.63 ? 202  ALA A C     1 
ATOM   1588 O  O     . ALA A 1 205 ? 68.743 8.874   -3.703  1.00 11.56 ? 202  ALA A O     1 
ATOM   1589 C  CB    . ALA A 1 205 ? 70.991 6.469   -3.201  1.00 13.78 ? 202  ALA A CB    1 
ATOM   1590 N  N     . ALA A 1 206 ? 68.539 7.156   -5.141  1.00 10.30 ? 203  ALA A N     1 
ATOM   1591 C  CA    . ALA A 1 206 ? 67.978 7.992   -6.203  1.00 12.78 ? 203  ALA A CA    1 
ATOM   1592 C  C     . ALA A 1 206 ? 66.620 8.566   -5.807  1.00 11.07 ? 203  ALA A C     1 
ATOM   1593 O  O     . ALA A 1 206 ? 66.318 9.744   -6.071  1.00 11.07 ? 203  ALA A O     1 
ATOM   1594 C  CB    . ALA A 1 206 ? 67.860 7.206   -7.501  1.00 11.70 ? 203  ALA A CB    1 
ATOM   1595 N  N     . ILE A 1 207 ? 65.794 7.734   -5.185  1.00 7.89  ? 204  ILE A N     1 
ATOM   1596 C  CA    . ILE A 1 207 ? 64.508 8.197   -4.673  1.00 11.40 ? 204  ILE A CA    1 
ATOM   1597 C  C     . ILE A 1 207 ? 64.691 9.352   -3.695  1.00 11.53 ? 204  ILE A C     1 
ATOM   1598 O  O     . ILE A 1 207 ? 64.021 10.389  -3.810  1.00 7.61  ? 204  ILE A O     1 
ATOM   1599 C  CB    . ILE A 1 207 ? 63.684 7.052   -4.029  1.00 7.76  ? 204  ILE A CB    1 
ATOM   1600 C  CG1   . ILE A 1 207 ? 63.292 6.039   -5.107  1.00 8.01  ? 204  ILE A CG1   1 
ATOM   1601 C  CG2   . ILE A 1 207 ? 62.434 7.611   -3.368  1.00 9.24  ? 204  ILE A CG2   1 
ATOM   1602 C  CD1   . ILE A 1 207 ? 62.598 4.766   -4.567  1.00 9.10  ? 204  ILE A CD1   1 
ATOM   1603 N  N     . GLU A 1 208 ? 65.604 9.189   -2.742  1.00 9.92  ? 205  GLU A N     1 
ATOM   1604 C  CA    . GLU A 1 208 ? 65.813 10.225  -1.734  1.00 12.06 ? 205  GLU A CA    1 
ATOM   1605 C  C     . GLU A 1 208 ? 66.416 11.484  -2.337  1.00 16.10 ? 205  GLU A C     1 
ATOM   1606 O  O     . GLU A 1 208 ? 65.970 12.593  -2.037  1.00 10.59 ? 205  GLU A O     1 
ATOM   1607 C  CB    . GLU A 1 208 ? 66.697 9.743   -0.578  1.00 11.45 ? 205  GLU A CB    1 
ATOM   1608 C  CG    . GLU A 1 208 ? 66.771 10.775  0.543   1.00 14.55 ? 205  GLU A CG    1 
ATOM   1609 C  CD    . GLU A 1 208 ? 67.490 10.290  1.785   1.00 16.27 ? 205  GLU A CD    1 
ATOM   1610 O  OE1   . GLU A 1 208 ? 67.389 10.976  2.814   1.00 19.92 ? 205  GLU A OE1   1 
ATOM   1611 O  OE2   . GLU A 1 208 ? 68.156 9.240   1.731   1.00 17.27 ? 205  GLU A OE2   1 
ATOM   1612 N  N     . ARG A 1 209 ? 67.421 11.314  -3.192  1.00 10.55 ? 206  ARG A N     1 
ATOM   1613 C  CA    . ARG A 1 209 ? 68.045 12.470  -3.856  1.00 12.80 ? 206  ARG A CA    1 
ATOM   1614 C  C     . ARG A 1 209 ? 67.023 13.296  -4.645  1.00 12.34 ? 206  ARG A C     1 
ATOM   1615 O  O     . ARG A 1 209 ? 67.031 14.527  -4.599  1.00 11.70 ? 206  ARG A O     1 
ATOM   1616 C  CB    . ARG A 1 209 ? 69.176 12.042  -4.816  1.00 11.78 ? 206  ARG A CB    1 
ATOM   1617 C  CG    . ARG A 1 209 ? 69.917 13.258  -5.394  1.00 18.94 ? 206  ARG A CG    1 
ATOM   1618 C  CD    . ARG A 1 209 ? 70.950 12.935  -6.479  1.00 18.93 ? 206  ARG A CD    1 
ATOM   1619 N  NE    . ARG A 1 209 ? 70.388 12.614  -7.800  1.00 23.18 ? 206  ARG A NE    1 
ATOM   1620 C  CZ    . ARG A 1 209 ? 70.022 13.511  -8.720  1.00 25.05 ? 206  ARG A CZ    1 
ATOM   1621 N  NH1   . ARG A 1 209 ? 69.556 13.101  -9.897  1.00 18.26 ? 206  ARG A NH1   1 
ATOM   1622 N  NH2   . ARG A 1 209 ? 70.128 14.813  -8.476  1.00 15.71 ? 206  ARG A NH2   1 
ATOM   1623 N  N     . GLU A 1 210 ? 66.149 12.611  -5.374  1.00 11.69 ? 207  GLU A N     1 
ATOM   1624 C  CA    . GLU A 1 210 ? 65.292 13.266  -6.352  1.00 12.52 ? 207  GLU A CA    1 
ATOM   1625 C  C     . GLU A 1 210 ? 63.896 13.651  -5.844  1.00 10.74 ? 207  GLU A C     1 
ATOM   1626 O  O     . GLU A 1 210 ? 63.165 14.407  -6.511  1.00 8.89  ? 207  GLU A O     1 
ATOM   1627 C  CB    . GLU A 1 210 ? 65.176 12.398  -7.600  1.00 11.70 ? 207  GLU A CB    1 
ATOM   1628 C  CG    . GLU A 1 210 ? 66.521 12.098  -8.225  1.00 13.00 ? 207  GLU A CG    1 
ATOM   1629 C  CD    . GLU A 1 210 ? 66.437 11.154  -9.413  1.00 15.55 ? 207  GLU A CD    1 
ATOM   1630 O  OE1   . GLU A 1 210 ? 65.419 11.171  -10.139 1.00 17.72 ? 207  GLU A OE1   1 
ATOM   1631 O  OE2   . GLU A 1 210 ? 67.398 10.388  -9.619  1.00 19.30 ? 207  GLU A OE2   1 
ATOM   1632 N  N     . THR A 1 211 ? 63.514 13.142  -4.676  1.00 9.17  ? 208  THR A N     1 
ATOM   1633 C  CA    . THR A 1 211 ? 62.196 13.462  -4.141  1.00 8.94  ? 208  THR A CA    1 
ATOM   1634 C  C     . THR A 1 211 ? 62.248 14.006  -2.740  1.00 9.67  ? 208  THR A C     1 
ATOM   1635 O  O     . THR A 1 211 ? 61.338 14.708  -2.330  1.00 9.82  ? 208  THR A O     1 
ATOM   1636 C  CB    . THR A 1 211 ? 61.241 12.252  -4.140  1.00 11.50 ? 208  THR A CB    1 
ATOM   1637 O  OG1   . THR A 1 211 ? 61.690 11.289  -3.180  1.00 9.23  ? 208  THR A OG1   1 
ATOM   1638 C  CG2   . THR A 1 211 ? 61.168 11.633  -5.525  1.00 8.65  ? 208  THR A CG2   1 
ATOM   1639 N  N     . GLY A 1 212 ? 63.298 13.664  -2.001  1.00 9.20  ? 209  GLY A N     1 
ATOM   1640 C  CA    . GLY A 1 212 ? 63.357 13.992  -0.588  1.00 11.11 ? 209  GLY A CA    1 
ATOM   1641 C  C     . GLY A 1 212 ? 62.803 12.879  0.297   1.00 13.58 ? 209  GLY A C     1 
ATOM   1642 O  O     . GLY A 1 212 ? 62.966 12.910  1.512   1.00 16.52 ? 209  GLY A O     1 
ATOM   1643 N  N     . PHE A 1 213 ? 62.175 11.877  -0.314  1.00 11.88 ? 210  PHE A N     1 
ATOM   1644 C  CA    . PHE A 1 213 ? 61.489 10.819  0.439   1.00 9.81  ? 210  PHE A CA    1 
ATOM   1645 C  C     . PHE A 1 213 ? 62.407 9.634   0.760   1.00 12.41 ? 210  PHE A C     1 
ATOM   1646 O  O     . PHE A 1 213 ? 63.150 9.187   -0.106  1.00 12.10 ? 210  PHE A O     1 
ATOM   1647 C  CB    . PHE A 1 213 ? 60.292 10.300  -0.366  1.00 8.65  ? 210  PHE A CB    1 
ATOM   1648 C  CG    . PHE A 1 213 ? 59.271 11.355  -0.696  1.00 8.50  ? 210  PHE A CG    1 
ATOM   1649 C  CD1   . PHE A 1 213 ? 58.569 11.302  -1.891  1.00 8.05  ? 210  PHE A CD1   1 
ATOM   1650 C  CD2   . PHE A 1 213 ? 59.005 12.392  0.191   1.00 10.55 ? 210  PHE A CD2   1 
ATOM   1651 C  CE1   . PHE A 1 213 ? 57.630 12.282  -2.198  1.00 10.23 ? 210  PHE A CE1   1 
ATOM   1652 C  CE2   . PHE A 1 213 ? 58.064 13.362  -0.115  1.00 9.12  ? 210  PHE A CE2   1 
ATOM   1653 C  CZ    . PHE A 1 213 ? 57.379 13.300  -1.314  1.00 7.95  ? 210  PHE A CZ    1 
ATOM   1654 N  N     . GLN A 1 214 ? 62.327 9.119   1.994   1.00 7.94  ? 211  GLN A N     1 
ATOM   1655 C  CA    . GLN A 1 214 ? 63.052 7.912   2.381   1.00 10.27 ? 211  GLN A CA    1 
ATOM   1656 C  C     . GLN A 1 214 ? 62.134 6.700   2.352   1.00 10.78 ? 211  GLN A C     1 
ATOM   1657 O  O     . GLN A 1 214 ? 60.917 6.825   2.524   1.00 11.13 ? 211  GLN A O     1 
ATOM   1658 C  CB    . GLN A 1 214 ? 63.645 8.067   3.790   1.00 10.54 ? 211  GLN A CB    1 
ATOM   1659 C  CG    . GLN A 1 214 ? 64.821 9.030   3.849   1.00 12.56 ? 211  GLN A CG    1 
ATOM   1660 C  CD    . GLN A 1 214 ? 65.320 9.263   5.256   1.00 18.24 ? 211  GLN A CD    1 
ATOM   1661 O  OE1   . GLN A 1 214 ? 64.761 8.749   6.226   1.00 17.32 ? 211  GLN A OE1   1 
ATOM   1662 N  NE2   . GLN A 1 214 ? 66.382 10.050  5.376   1.00 17.00 ? 211  GLN A NE2   1 
ATOM   1663 N  N     . CYS A 1 215 ? 62.713 5.524   2.157   1.00 11.70 ? 212  CYS A N     1 
ATOM   1664 C  CA    . CYS A 1 215 ? 61.910 4.308   2.082   1.00 9.12  ? 212  CYS A CA    1 
ATOM   1665 C  C     . CYS A 1 215 ? 62.695 3.150   2.668   1.00 12.13 ? 212  CYS A C     1 
ATOM   1666 O  O     . CYS A 1 215 ? 63.903 3.257   2.910   1.00 12.23 ? 212  CYS A O     1 
ATOM   1667 C  CB    . CYS A 1 215 ? 61.564 3.991   0.627   1.00 11.50 ? 212  CYS A CB    1 
ATOM   1668 S  SG    . CYS A 1 215 ? 63.029 3.773   -0.422  1.00 18.12 ? 212  CYS A SG    1 
ATOM   1669 N  N     . SER A 1 216 ? 62.004 2.041   2.887   1.00 9.54  ? 213  SER A N     1 
ATOM   1670 C  CA    . SER A 1 216 ? 62.658 0.803   3.286   1.00 10.09 ? 213  SER A CA    1 
ATOM   1671 C  C     . SER A 1 216 ? 62.450 -0.194  2.151   1.00 9.33  ? 213  SER A C     1 
ATOM   1672 O  O     . SER A 1 216 ? 61.657 0.067   1.255   1.00 10.14 ? 213  SER A O     1 
ATOM   1673 C  CB    . SER A 1 216 ? 62.041 0.283   4.574   1.00 12.28 ? 213  SER A CB    1 
ATOM   1674 O  OG    . SER A 1 216 ? 62.191 1.231   5.633   1.00 10.39 ? 213  SER A OG    1 
ATOM   1675 N  N     . ALA A 1 217 ? 63.151 -1.328  2.181   1.00 7.70  ? 214  ALA A N     1 
ATOM   1676 C  CA    . ALA A 1 217 ? 62.988 -2.328  1.129   1.00 5.80  ? 214  ALA A CA    1 
ATOM   1677 C  C     . ALA A 1 217 ? 63.338 -3.724  1.615   1.00 8.18  ? 214  ALA A C     1 
ATOM   1678 O  O     . ALA A 1 217 ? 64.131 -3.872  2.543   1.00 9.41  ? 214  ALA A O     1 
ATOM   1679 C  CB    . ALA A 1 217 ? 63.848 -1.976  -0.066  1.00 6.79  ? 214  ALA A CB    1 
ATOM   1680 N  N     . GLY A 1 218 ? 62.710 -4.731  1.011   1.00 7.59  ? 215  GLY A N     1 
ATOM   1681 C  CA    . GLY A 1 218 ? 63.085 -6.117  1.236   1.00 7.59  ? 215  GLY A CA    1 
ATOM   1682 C  C     . GLY A 1 218 ? 63.653 -6.691  -0.051  1.00 10.57 ? 215  GLY A C     1 
ATOM   1683 O  O     . GLY A 1 218 ? 63.161 -6.371  -1.132  1.00 9.67  ? 215  GLY A O     1 
ATOM   1684 N  N     . ILE A 1 219 ? 64.698 -7.513  0.056   1.00 7.03  ? 216  ILE A N     1 
ATOM   1685 C  CA    . ILE A 1 219 ? 65.234 -8.216  -1.108  1.00 6.19  ? 216  ILE A CA    1 
ATOM   1686 C  C     . ILE A 1 219 ? 65.246 -9.714  -0.849  1.00 10.31 ? 216  ILE A C     1 
ATOM   1687 O  O     . ILE A 1 219 ? 65.862 -10.179 0.126   1.00 10.26 ? 216  ILE A O     1 
ATOM   1688 C  CB    . ILE A 1 219 ? 66.681 -7.741  -1.441  1.00 8.83  ? 216  ILE A CB    1 
ATOM   1689 C  CG1   . ILE A 1 219 ? 66.731 -6.220  -1.652  1.00 9.25  ? 216  ILE A CG1   1 
ATOM   1690 C  CG2   . ILE A 1 219 ? 67.220 -8.474  -2.663  1.00 11.44 ? 216  ILE A CG2   1 
ATOM   1691 C  CD1   . ILE A 1 219 ? 67.191 -5.438  -0.440  1.00 12.86 ? 216  ILE A CD1   1 
ATOM   1692 N  N     . SER A 1 220 ? 64.568 -10.475 -1.707  1.00 6.54  ? 217  SER A N     1 
ATOM   1693 C  CA    . SER A 1 220 ? 64.561 -11.922 -1.580  1.00 8.29  ? 217  SER A CA    1 
ATOM   1694 C  C     . SER A 1 220 ? 64.314 -12.567 -2.932  1.00 13.00 ? 217  SER A C     1 
ATOM   1695 O  O     . SER A 1 220 ? 64.584 -11.966 -3.963  1.00 9.27  ? 217  SER A O     1 
ATOM   1696 C  CB    . SER A 1 220 ? 63.500 -12.364 -0.565  1.00 10.08 ? 217  SER A CB    1 
ATOM   1697 O  OG    . SER A 1 220 ? 63.707 -13.714 -0.177  1.00 9.56  ? 217  SER A OG    1 
ATOM   1698 N  N     . HIS A 1 221 ? 63.813 -13.798 -2.923  1.00 10.20 ? 218  HIS A N     1 
ATOM   1699 C  CA    . HIS A 1 221 ? 63.625 -14.550 -4.154  1.00 9.89  ? 218  HIS A CA    1 
ATOM   1700 C  C     . HIS A 1 221 ? 62.175 -14.502 -4.653  1.00 11.39 ? 218  HIS A C     1 
ATOM   1701 O  O     . HIS A 1 221 ? 61.879 -14.989 -5.734  1.00 10.88 ? 218  HIS A O     1 
ATOM   1702 C  CB    . HIS A 1 221 ? 64.048 -16.014 -3.953  1.00 10.07 ? 218  HIS A CB    1 
ATOM   1703 C  CG    . HIS A 1 221 ? 65.527 -16.204 -3.837  1.00 15.98 ? 218  HIS A CG    1 
ATOM   1704 N  ND1   . HIS A 1 221 ? 66.399 -15.866 -4.851  1.00 12.50 ? 218  HIS A ND1   1 
ATOM   1705 C  CD2   . HIS A 1 221 ? 66.286 -16.710 -2.834  1.00 10.85 ? 218  HIS A CD2   1 
ATOM   1706 C  CE1   . HIS A 1 221 ? 67.634 -16.156 -4.475  1.00 16.87 ? 218  HIS A CE1   1 
ATOM   1707 N  NE2   . HIS A 1 221 ? 67.592 -16.670 -3.256  1.00 12.56 ? 218  HIS A NE2   1 
ATOM   1708 N  N     . ASN A 1 222 ? 61.274 -13.918 -3.873  1.00 4.83  ? 219  ASN A N     1 
ATOM   1709 C  CA    . ASN A 1 222 ? 59.872 -13.789 -4.293  1.00 7.04  ? 219  ASN A CA    1 
ATOM   1710 C  C     . ASN A 1 222 ? 59.144 -12.663 -3.572  1.00 9.06  ? 219  ASN A C     1 
ATOM   1711 O  O     . ASN A 1 222 ? 59.679 -12.059 -2.647  1.00 9.57  ? 219  ASN A O     1 
ATOM   1712 C  CB    . ASN A 1 222 ? 59.116 -15.104 -4.090  1.00 7.77  ? 219  ASN A CB    1 
ATOM   1713 C  CG    . ASN A 1 222 ? 59.180 -15.585 -2.661  1.00 9.31  ? 219  ASN A CG    1 
ATOM   1714 O  OD1   . ASN A 1 222 ? 58.674 -14.920 -1.746  1.00 8.31  ? 219  ASN A OD1   1 
ATOM   1715 N  ND2   . ASN A 1 222 ? 59.787 -16.750 -2.454  1.00 9.49  ? 219  ASN A ND2   1 
ATOM   1716 N  N     . LYS A 1 223 ? 57.924 -12.372 -3.999  1.00 9.77  ? 220  LYS A N     1 
ATOM   1717 C  CA    . LYS A 1 223 ? 57.209 -11.200 -3.487  1.00 13.09 ? 220  LYS A CA    1 
ATOM   1718 C  C     . LYS A 1 223 ? 56.865 -11.320 -2.009  1.00 10.25 ? 220  LYS A C     1 
ATOM   1719 O  O     . LYS A 1 223 ? 56.983 -10.342 -1.254  1.00 10.83 ? 220  LYS A O     1 
ATOM   1720 C  CB    . LYS A 1 223 ? 55.934 -10.950 -4.302  1.00 9.30  ? 220  LYS A CB    1 
ATOM   1721 C  CG    . LYS A 1 223 ? 56.205 -10.448 -5.707  1.00 13.17 ? 220  LYS A CG    1 
ATOM   1722 C  CD    . LYS A 1 223 ? 55.020 -9.642  -6.248  1.00 25.10 ? 220  LYS A CD    1 
ATOM   1723 C  CE    . LYS A 1 223 ? 53.926 -10.536 -6.762  1.00 21.53 ? 220  LYS A CE    1 
ATOM   1724 N  NZ    . LYS A 1 223 ? 52.756 -9.764  -7.304  1.00 16.84 ? 220  LYS A NZ    1 
ATOM   1725 N  N     . VAL A 1 224 ? 56.414 -12.500 -1.590  1.00 8.98  ? 221  VAL A N     1 
ATOM   1726 C  CA    . VAL A 1 224 ? 56.029 -12.669 -0.184  1.00 10.37 ? 221  VAL A CA    1 
ATOM   1727 C  C     . VAL A 1 224 ? 57.215 -12.502 0.777   1.00 8.86  ? 221  VAL A C     1 
ATOM   1728 O  O     . VAL A 1 224 ? 57.102 -11.801 1.780   1.00 10.06 ? 221  VAL A O     1 
ATOM   1729 C  CB    . VAL A 1 224 ? 55.278 -14.002 0.083   1.00 9.92  ? 221  VAL A CB    1 
ATOM   1730 C  CG1   . VAL A 1 224 ? 55.055 -14.194 1.562   1.00 11.78 ? 221  VAL A CG1   1 
ATOM   1731 C  CG2   . VAL A 1 224 ? 53.948 -14.002 -0.635  1.00 16.37 ? 221  VAL A CG2   1 
ATOM   1732 N  N     . LEU A 1 225 ? 58.355 -13.112 0.462   1.00 8.43  ? 222  LEU A N     1 
ATOM   1733 C  CA    . LEU A 1 225 ? 59.554 -12.929 1.288   1.00 8.65  ? 222  LEU A CA    1 
ATOM   1734 C  C     . LEU A 1 225 ? 60.090 -11.486 1.204   1.00 9.40  ? 222  LEU A C     1 
ATOM   1735 O  O     . LEU A 1 225 ? 60.581 -10.945 2.196   1.00 10.21 ? 222  LEU A O     1 
ATOM   1736 C  CB    . LEU A 1 225 ? 60.669 -13.923 0.912   1.00 5.33  ? 222  LEU A CB    1 
ATOM   1737 C  CG    . LEU A 1 225 ? 60.415 -15.403 1.247   1.00 8.07  ? 222  LEU A CG    1 
ATOM   1738 C  CD1   . LEU A 1 225 ? 61.649 -16.275 0.899   1.00 10.01 ? 222  LEU A CD1   1 
ATOM   1739 C  CD2   . LEU A 1 225 ? 60.031 -15.564 2.712   1.00 13.10 ? 222  LEU A CD2   1 
ATOM   1740 N  N     . ALA A 1 226 ? 60.010 -10.875 0.022   1.00 7.94  ? 223  ALA A N     1 
ATOM   1741 C  CA    . ALA A 1 226 ? 60.443 -9.488  -0.142  1.00 10.18 ? 223  ALA A CA    1 
ATOM   1742 C  C     . ALA A 1 226 ? 59.637 -8.539  0.740   1.00 10.10 ? 223  ALA A C     1 
ATOM   1743 O  O     . ALA A 1 226 ? 60.204 -7.675  1.409   1.00 7.34  ? 223  ALA A O     1 
ATOM   1744 C  CB    . ALA A 1 226 ? 60.362 -9.057  -1.604  1.00 11.08 ? 223  ALA A CB    1 
ATOM   1745 N  N     A LYS A 1 227 ? 58.318 -8.706  0.723   0.25 9.06  ? 224  LYS A N     1 
ATOM   1746 N  N     B LYS A 1 227 ? 58.318 -8.699  0.716   0.75 9.04  ? 224  LYS A N     1 
ATOM   1747 C  CA    . LYS A 1 227 ? 57.408 -7.914  1.544   1.00 10.26 ? 224  LYS A CA    1 
ATOM   1748 C  C     . LYS A 1 227 ? 57.687 -8.111  3.040   1.00 12.35 ? 224  LYS A C     1 
ATOM   1749 O  O     . LYS A 1 227 ? 57.789 -7.147  3.804   1.00 8.17  ? 224  LYS A O     1 
ATOM   1750 C  CB    . LYS A 1 227 ? 55.962 -8.308  1.238   1.00 9.35  ? 224  LYS A CB    1 
ATOM   1751 C  CG    A LYS A 1 227 ? 54.932 -7.757  2.213   0.25 15.65 ? 224  LYS A CG    1 
ATOM   1752 C  CG    B LYS A 1 227 ? 54.909 -7.629  2.109   0.75 15.75 ? 224  LYS A CG    1 
ATOM   1753 C  CD    A LYS A 1 227 ? 54.813 -6.244  2.112   0.25 18.71 ? 224  LYS A CD    1 
ATOM   1754 C  CD    B LYS A 1 227 ? 55.001 -6.108  2.011   0.75 18.63 ? 224  LYS A CD    1 
ATOM   1755 C  CE    A LYS A 1 227 ? 53.764 -5.712  3.080   0.25 22.97 ? 224  LYS A CE    1 
ATOM   1756 C  CE    B LYS A 1 227 ? 53.785 -5.437  2.648   0.75 25.09 ? 224  LYS A CE    1 
ATOM   1757 N  NZ    A LYS A 1 227 ? 52.429 -6.325  2.842   0.25 18.70 ? 224  LYS A NZ    1 
ATOM   1758 N  NZ    B LYS A 1 227 ? 53.974 -3.964  2.766   0.75 22.96 ? 224  LYS A NZ    1 
ATOM   1759 N  N     . LEU A 1 228 ? 57.819 -9.364  3.452   1.00 8.14  ? 225  LEU A N     1 
ATOM   1760 C  CA    . LEU A 1 228 ? 58.160 -9.679  4.845   1.00 9.34  ? 225  LEU A CA    1 
ATOM   1761 C  C     . LEU A 1 228 ? 59.494 -9.041  5.254   1.00 12.29 ? 225  LEU A C     1 
ATOM   1762 O  O     . LEU A 1 228 ? 59.596 -8.394  6.297   1.00 9.43  ? 225  LEU A O     1 
ATOM   1763 C  CB    . LEU A 1 228 ? 58.221 -11.193 5.041   1.00 10.39 ? 225  LEU A CB    1 
ATOM   1764 C  CG    . LEU A 1 228 ? 58.435 -11.718 6.462   1.00 16.71 ? 225  LEU A CG    1 
ATOM   1765 C  CD1   . LEU A 1 228 ? 57.272 -11.275 7.342   1.00 16.96 ? 225  LEU A CD1   1 
ATOM   1766 C  CD2   . LEU A 1 228 ? 58.559 -13.235 6.450   1.00 15.29 ? 225  LEU A CD2   1 
ATOM   1767 N  N     . ALA A 1 229 ? 60.519 -9.245  4.431   1.00 8.58  ? 226  ALA A N     1 
ATOM   1768 C  CA    . ALA A 1 229 ? 61.846 -8.668  4.661   1.00 9.03  ? 226  ALA A CA    1 
ATOM   1769 C  C     . ALA A 1 229 ? 61.793 -7.155  4.879   1.00 10.99 ? 226  ALA A C     1 
ATOM   1770 O  O     . ALA A 1 229 ? 62.423 -6.625  5.792   1.00 11.36 ? 226  ALA A O     1 
ATOM   1771 C  CB    . ALA A 1 229 ? 62.776 -8.989  3.469   1.00 7.15  ? 226  ALA A CB    1 
ATOM   1772 N  N     . CYS A 1 230 ? 61.056 -6.466  4.016   1.00 7.86  ? 227  CYS A N     1 
ATOM   1773 C  CA    . CYS A 1 230 ? 60.982 -5.008  4.065   1.00 6.69  ? 227  CYS A CA    1 
ATOM   1774 C  C     . CYS A 1 230 ? 60.608 -4.512  5.466   1.00 9.47  ? 227  CYS A C     1 
ATOM   1775 O  O     . CYS A 1 230 ? 61.193 -3.561  5.975   1.00 12.77 ? 227  CYS A O     1 
ATOM   1776 C  CB    . CYS A 1 230 ? 59.949 -4.523  3.037   1.00 7.94  ? 227  CYS A CB    1 
ATOM   1777 S  SG    . CYS A 1 230 ? 59.834 -2.717  2.876   1.00 11.81 ? 227  CYS A SG    1 
ATOM   1778 N  N     . GLY A 1 231 ? 59.629 -5.161  6.081   1.00 9.72  ? 228  GLY A N     1 
ATOM   1779 C  CA    . GLY A 1 231 ? 59.172 -4.777  7.412   1.00 9.80  ? 228  GLY A CA    1 
ATOM   1780 C  C     . GLY A 1 231 ? 60.106 -5.128  8.568   1.00 14.05 ? 228  GLY A C     1 
ATOM   1781 O  O     . GLY A 1 231 ? 59.857 -4.724  9.699   1.00 14.27 ? 228  GLY A O     1 
ATOM   1782 N  N     . LEU A 1 232 ? 61.178 -5.869  8.307   1.00 11.86 ? 229  LEU A N     1 
ATOM   1783 C  CA    . LEU A 1 232 ? 62.015 -6.363  9.409   1.00 11.82 ? 229  LEU A CA    1 
ATOM   1784 C  C     . LEU A 1 232 ? 62.883 -5.259  10.002  1.00 16.84 ? 229  LEU A C     1 
ATOM   1785 O  O     . LEU A 1 232 ? 63.235 -5.299  11.180  1.00 15.38 ? 229  LEU A O     1 
ATOM   1786 C  CB    . LEU A 1 232 ? 62.883 -7.544  8.965   1.00 14.16 ? 229  LEU A CB    1 
ATOM   1787 C  CG    . LEU A 1 232 ? 62.077 -8.806  8.650   1.00 17.07 ? 229  LEU A CG    1 
ATOM   1788 C  CD1   . LEU A 1 232 ? 62.991 -9.927  8.185   1.00 13.96 ? 229  LEU A CD1   1 
ATOM   1789 C  CD2   . LEU A 1 232 ? 61.246 -9.229  9.878   1.00 15.66 ? 229  LEU A CD2   1 
ATOM   1790 N  N     . ASN A 1 233 ? 63.223 -4.269  9.185   1.00 11.93 ? 230  ASN A N     1 
ATOM   1791 C  CA    . ASN A 1 233 ? 64.051 -3.160  9.648   1.00 17.18 ? 230  ASN A CA    1 
ATOM   1792 C  C     . ASN A 1 233 ? 63.593 -1.842  9.022   1.00 16.01 ? 230  ASN A C     1 
ATOM   1793 O  O     . ASN A 1 233 ? 63.973 -1.518  7.906   1.00 24.45 ? 230  ASN A O     1 
ATOM   1794 C  CB    . ASN A 1 233 ? 65.524 -3.404  9.311   1.00 12.92 ? 230  ASN A CB    1 
ATOM   1795 C  CG    . ASN A 1 233 ? 66.108 -4.609  10.037  1.00 14.96 ? 230  ASN A CG    1 
ATOM   1796 O  OD1   . ASN A 1 233 ? 66.417 -4.541  11.229  1.00 14.55 ? 230  ASN A OD1   1 
ATOM   1797 N  ND2   . ASN A 1 233 ? 66.285 -5.705  9.316   1.00 10.98 ? 230  ASN A ND2   1 
ATOM   1798 N  N     . LYS A 1 234 ? 62.741 -1.115  9.729   1.00 20.19 ? 231  LYS A N     1 
ATOM   1799 C  CA    . LYS A 1 234 ? 62.213 0.158   9.248   1.00 15.59 ? 231  LYS A CA    1 
ATOM   1800 C  C     . LYS A 1 234 ? 62.514 1.156   10.352  1.00 19.32 ? 231  LYS A C     1 
ATOM   1801 O  O     . LYS A 1 234 ? 62.656 0.758   11.507  1.00 20.18 ? 231  LYS A O     1 
ATOM   1802 C  CB    . LYS A 1 234 ? 60.689 0.073   9.012   1.00 20.69 ? 231  LYS A CB    1 
ATOM   1803 C  CG    . LYS A 1 234 ? 60.223 -0.445  7.628   1.00 19.59 ? 231  LYS A CG    1 
ATOM   1804 C  CD    . LYS A 1 234 ? 58.785 0.063   7.297   1.00 23.72 ? 231  LYS A CD    1 
ATOM   1805 C  CE    . LYS A 1 234 ? 58.477 0.174   5.781   1.00 28.18 ? 231  LYS A CE    1 
ATOM   1806 N  NZ    . LYS A 1 234 ? 58.300 1.610   5.256   1.00 13.06 ? 231  LYS A NZ    1 
ATOM   1807 N  N     . PRO A 1 235 ? 62.620 2.452   10.016  1.00 12.83 ? 232  PRO A N     1 
ATOM   1808 C  CA    . PRO A 1 235 ? 62.537 3.055   8.680   1.00 14.42 ? 232  PRO A CA    1 
ATOM   1809 C  C     . PRO A 1 235 ? 63.902 3.227   8.041   1.00 10.53 ? 232  PRO A C     1 
ATOM   1810 O  O     . PRO A 1 235 ? 64.918 3.034   8.703   1.00 11.47 ? 232  PRO A O     1 
ATOM   1811 C  CB    . PRO A 1 235 ? 61.982 4.443   8.981   1.00 14.64 ? 232  PRO A CB    1 
ATOM   1812 C  CG    . PRO A 1 235 ? 62.639 4.787   10.285  1.00 15.52 ? 232  PRO A CG    1 
ATOM   1813 C  CD    . PRO A 1 235 ? 62.704 3.483   11.065  1.00 20.70 ? 232  PRO A CD    1 
ATOM   1814 N  N     . ASN A 1 236 ? 63.919 3.598   6.763   1.00 10.53 ? 233  ASN A N     1 
ATOM   1815 C  CA    . ASN A 1 236 ? 65.169 3.982   6.098   1.00 12.26 ? 233  ASN A CA    1 
ATOM   1816 C  C     . ASN A 1 236 ? 66.271 2.915   6.087   1.00 10.99 ? 233  ASN A C     1 
ATOM   1817 O  O     . ASN A 1 236 ? 67.444 3.248   6.216   1.00 11.89 ? 233  ASN A O     1 
ATOM   1818 C  CB    . ASN A 1 236 ? 65.708 5.290   6.722   1.00 13.70 ? 233  ASN A CB    1 
ATOM   1819 C  CG    . ASN A 1 236 ? 66.752 5.983   5.839   1.00 17.14 ? 233  ASN A CG    1 
ATOM   1820 O  OD1   . ASN A 1 236 ? 66.678 5.918   4.620   1.00 16.01 ? 233  ASN A OD1   1 
ATOM   1821 N  ND2   . ASN A 1 236 ? 67.722 6.654   6.463   1.00 17.87 ? 233  ASN A ND2   1 
ATOM   1822 N  N     . ARG A 1 237 ? 65.898 1.641   5.929   1.00 8.77  ? 234  ARG A N     1 
ATOM   1823 C  CA    . ARG A 1 237 ? 66.860 0.533   5.905   1.00 11.66 ? 234  ARG A CA    1 
ATOM   1824 C  C     . ARG A 1 237 ? 66.312 -0.540  4.966   1.00 10.26 ? 234  ARG A C     1 
ATOM   1825 O  O     . ARG A 1 237 ? 65.129 -0.546  4.644   1.00 10.16 ? 234  ARG A O     1 
ATOM   1826 C  CB    . ARG A 1 237 ? 67.053 -0.084  7.299   1.00 10.82 ? 234  ARG A CB    1 
ATOM   1827 C  CG    . ARG A 1 237 ? 67.686 0.837   8.357   1.00 14.93 ? 234  ARG A CG    1 
ATOM   1828 C  CD    . ARG A 1 237 ? 69.147 1.146   8.006   1.00 21.76 ? 234  ARG A CD    1 
ATOM   1829 N  NE    . ARG A 1 237 ? 69.829 1.950   9.028   1.00 23.54 ? 234  ARG A NE    1 
ATOM   1830 C  CZ    . ARG A 1 237 ? 69.878 3.282   9.027   1.00 24.74 ? 234  ARG A CZ    1 
ATOM   1831 N  NH1   . ARG A 1 237 ? 69.279 3.978   8.068   1.00 15.54 ? 234  ARG A NH1   1 
ATOM   1832 N  NH2   . ARG A 1 237 ? 70.523 3.922   9.990   1.00 29.98 ? 234  ARG A NH2   1 
ATOM   1833 N  N     . GLN A 1 238 ? 67.169 -1.443  4.519   1.00 9.18  ? 235  GLN A N     1 
ATOM   1834 C  CA    . GLN A 1 238 ? 66.707 -2.535  3.689   1.00 8.89  ? 235  GLN A CA    1 
ATOM   1835 C  C     . GLN A 1 238 ? 67.219 -3.866  4.222   1.00 8.41  ? 235  GLN A C     1 
ATOM   1836 O  O     . GLN A 1 238 ? 68.287 -3.924  4.845   1.00 10.44 ? 235  GLN A O     1 
ATOM   1837 C  CB    . GLN A 1 238 ? 67.101 -2.335  2.220   1.00 6.66  ? 235  GLN A CB    1 
ATOM   1838 C  CG    . GLN A 1 238 ? 68.606 -2.230  2.000   1.00 10.48 ? 235  GLN A CG    1 
ATOM   1839 C  CD    . GLN A 1 238 ? 68.962 -1.953  0.557   1.00 13.08 ? 235  GLN A CD    1 
ATOM   1840 O  OE1   . GLN A 1 238 ? 68.550 -0.936  -0.026  1.00 13.24 ? 235  GLN A OE1   1 
ATOM   1841 N  NE2   . GLN A 1 238 ? 69.725 -2.860  -0.039  1.00 9.12  ? 235  GLN A NE2   1 
ATOM   1842 N  N     . THR A 1 239 ? 66.453 -4.925  3.968   1.00 6.67  ? 236  THR A N     1 
ATOM   1843 C  CA    . THR A 1 239 ? 66.730 -6.245  4.546   1.00 10.37 ? 236  THR A CA    1 
ATOM   1844 C  C     . THR A 1 239 ? 66.800 -7.334  3.455   1.00 9.88  ? 236  THR A C     1 
ATOM   1845 O  O     . THR A 1 239 ? 65.928 -7.424  2.587   1.00 8.26  ? 236  THR A O     1 
ATOM   1846 C  CB    . THR A 1 239 ? 65.689 -6.613  5.618   1.00 11.05 ? 236  THR A CB    1 
ATOM   1847 O  OG1   . THR A 1 239 ? 65.597 -5.558  6.583   1.00 11.35 ? 236  THR A OG1   1 
ATOM   1848 C  CG2   . THR A 1 239 ? 66.080 -7.901  6.360   1.00 10.33 ? 236  THR A CG2   1 
ATOM   1849 N  N     . LEU A 1 240 ? 67.859 -8.135  3.490   1.00 9.43  ? 237  LEU A N     1 
ATOM   1850 C  CA    . LEU A 1 240 ? 68.023 -9.267  2.587   1.00 6.69  ? 237  LEU A CA    1 
ATOM   1851 C  C     . LEU A 1 240 ? 67.643 -10.562 3.306   1.00 9.58  ? 237  LEU A C     1 
ATOM   1852 O  O     . LEU A 1 240 ? 68.207 -10.900 4.349   1.00 9.00  ? 237  LEU A O     1 
ATOM   1853 C  CB    . LEU A 1 240 ? 69.481 -9.315  2.073   1.00 9.17  ? 237  LEU A CB    1 
ATOM   1854 C  CG    . LEU A 1 240 ? 69.868 -10.335 0.993   1.00 12.29 ? 237  LEU A CG    1 
ATOM   1855 C  CD1   . LEU A 1 240 ? 71.205 -9.969  0.336   1.00 11.96 ? 237  LEU A CD1   1 
ATOM   1856 C  CD2   . LEU A 1 240 ? 69.934 -11.766 1.544   1.00 8.85  ? 237  LEU A CD2   1 
ATOM   1857 N  N     . VAL A 1 241 ? 66.657 -11.272 2.766   1.00 11.44 ? 238  VAL A N     1 
ATOM   1858 C  CA    . VAL A 1 241 ? 66.235 -12.532 3.349   1.00 9.88  ? 238  VAL A CA    1 
ATOM   1859 C  C     . VAL A 1 241 ? 66.598 -13.634 2.380   1.00 10.94 ? 238  VAL A C     1 
ATOM   1860 O  O     . VAL A 1 241 ? 66.014 -13.741 1.302   1.00 9.57  ? 238  VAL A O     1 
ATOM   1861 C  CB    . VAL A 1 241 ? 64.724 -12.563 3.591   1.00 9.34  ? 238  VAL A CB    1 
ATOM   1862 C  CG1   . VAL A 1 241 ? 64.253 -14.011 3.853   1.00 8.83  ? 238  VAL A CG1   1 
ATOM   1863 C  CG2   . VAL A 1 241 ? 64.350 -11.635 4.746   1.00 7.91  ? 238  VAL A CG2   1 
ATOM   1864 N  N     . SER A 1 242 ? 67.603 -14.417 2.735   1.00 9.83  ? 239  SER A N     1 
ATOM   1865 C  CA    . SER A 1 242 ? 68.085 -15.457 1.833   1.00 12.62 ? 239  SER A CA    1 
ATOM   1866 C  C     . SER A 1 242 ? 67.235 -16.713 1.960   1.00 9.66  ? 239  SER A C     1 
ATOM   1867 O  O     . SER A 1 242 ? 66.497 -16.880 2.931   1.00 7.03  ? 239  SER A O     1 
ATOM   1868 C  CB    . SER A 1 242 ? 69.541 -15.791 2.153   1.00 12.63 ? 239  SER A CB    1 
ATOM   1869 O  OG    . SER A 1 242 ? 69.611 -16.370 3.449   1.00 11.89 ? 239  SER A OG    1 
ATOM   1870 N  N     . HIS A 1 243 ? 67.354 -17.615 0.990   1.00 10.58 ? 240  HIS A N     1 
ATOM   1871 C  CA    . HIS A 1 243 ? 66.623 -18.873 1.078   1.00 13.35 ? 240  HIS A CA    1 
ATOM   1872 C  C     . HIS A 1 243 ? 67.003 -19.619 2.366   1.00 12.72 ? 240  HIS A C     1 
ATOM   1873 O  O     . HIS A 1 243 ? 66.148 -20.194 3.052   1.00 10.03 ? 240  HIS A O     1 
ATOM   1874 C  CB    . HIS A 1 243 ? 66.891 -19.771 -0.135  1.00 11.77 ? 240  HIS A CB    1 
ATOM   1875 C  CG    . HIS A 1 243 ? 66.139 -21.068 -0.086  1.00 13.74 ? 240  HIS A CG    1 
ATOM   1876 N  ND1   . HIS A 1 243 ? 64.785 -21.149 -0.328  1.00 15.58 ? 240  HIS A ND1   1 
ATOM   1877 C  CD2   . HIS A 1 243 ? 66.544 -22.324 0.216   1.00 14.37 ? 240  HIS A CD2   1 
ATOM   1878 C  CE1   . HIS A 1 243 ? 64.392 -22.406 -0.204  1.00 18.27 ? 240  HIS A CE1   1 
ATOM   1879 N  NE2   . HIS A 1 243 ? 65.441 -23.138 0.127   1.00 14.62 ? 240  HIS A NE2   1 
ATOM   1880 N  N     . GLY A 1 244 ? 68.296 -19.592 2.676   1.00 11.63 ? 241  GLY A N     1 
ATOM   1881 C  CA    . GLY A 1 244 ? 68.836 -20.272 3.834   1.00 9.80  ? 241  GLY A CA    1 
ATOM   1882 C  C     . GLY A 1 244 ? 68.318 -19.744 5.159   1.00 11.24 ? 241  GLY A C     1 
ATOM   1883 O  O     . GLY A 1 244 ? 68.257 -20.489 6.132   1.00 9.58  ? 241  GLY A O     1 
ATOM   1884 N  N     . SER A 1 245 ? 67.950 -18.466 5.206   1.00 10.09 ? 242  SER A N     1 
ATOM   1885 C  CA    . SER A 1 245 ? 67.453 -17.866 6.455   1.00 10.01 ? 242  SER A CA    1 
ATOM   1886 C  C     . SER A 1 245 ? 66.030 -18.289 6.797   1.00 9.48  ? 242  SER A C     1 
ATOM   1887 O  O     . SER A 1 245 ? 65.556 -18.048 7.911   1.00 8.13  ? 242  SER A O     1 
ATOM   1888 C  CB    . SER A 1 245 ? 67.512 -16.337 6.386   1.00 11.11 ? 242  SER A CB    1 
ATOM   1889 O  OG    . SER A 1 245 ? 66.535 -15.820 5.487   1.00 11.39 ? 242  SER A OG    1 
ATOM   1890 N  N     . VAL A 1 246 ? 65.346 -18.920 5.846   1.00 8.31  ? 243  VAL A N     1 
ATOM   1891 C  CA    . VAL A 1 246 ? 63.906 -19.157 6.003   1.00 9.59  ? 243  VAL A CA    1 
ATOM   1892 C  C     . VAL A 1 246 ? 63.533 -20.095 7.171   1.00 8.54  ? 243  VAL A C     1 
ATOM   1893 O  O     . VAL A 1 246 ? 62.656 -19.776 7.957   1.00 7.49  ? 243  VAL A O     1 
ATOM   1894 C  CB    . VAL A 1 246 ? 63.244 -19.594 4.670   1.00 8.21  ? 243  VAL A CB    1 
ATOM   1895 C  CG1   . VAL A 1 246 ? 61.783 -20.073 4.883   1.00 9.07  ? 243  VAL A CG1   1 
ATOM   1896 C  CG2   . VAL A 1 246 ? 63.284 -18.446 3.683   1.00 9.63  ? 243  VAL A CG2   1 
ATOM   1897 N  N     . PRO A 1 247 ? 64.213 -21.242 7.305   1.00 8.59  ? 244  PRO A N     1 
ATOM   1898 C  CA    . PRO A 1 247 ? 63.761 -22.107 8.405   1.00 8.31  ? 244  PRO A CA    1 
ATOM   1899 C  C     . PRO A 1 247 ? 63.791 -21.432 9.794   1.00 9.67  ? 244  PRO A C     1 
ATOM   1900 O  O     . PRO A 1 247 ? 62.849 -21.579 10.567  1.00 9.15  ? 244  PRO A O     1 
ATOM   1901 C  CB    . PRO A 1 247 ? 64.735 -23.293 8.345   1.00 10.13 ? 244  PRO A CB    1 
ATOM   1902 C  CG    . PRO A 1 247 ? 65.114 -23.367 6.853   1.00 14.26 ? 244  PRO A CG    1 
ATOM   1903 C  CD    . PRO A 1 247 ? 65.189 -21.913 6.412   1.00 9.18  ? 244  PRO A CD    1 
ATOM   1904 N  N     . GLN A 1 248 ? 64.843 -20.693 10.105  1.00 8.45  ? 245  GLN A N     1 
ATOM   1905 C  CA    . GLN A 1 248 ? 64.905 -20.053 11.421  1.00 11.13 ? 245  GLN A CA    1 
ATOM   1906 C  C     . GLN A 1 248 ? 63.916 -18.888 11.516  1.00 8.97  ? 245  GLN A C     1 
ATOM   1907 O  O     . GLN A 1 248 ? 63.234 -18.716 12.535  1.00 10.34 ? 245  GLN A O     1 
ATOM   1908 C  CB    . GLN A 1 248 ? 66.329 -19.581 11.717  1.00 10.03 ? 245  GLN A CB    1 
ATOM   1909 C  CG    . GLN A 1 248 ? 67.315 -20.737 11.975  1.00 17.12 ? 245  GLN A CG    1 
ATOM   1910 C  CD    . GLN A 1 248 ? 68.337 -20.400 13.043  1.00 31.11 ? 245  GLN A CD    1 
ATOM   1911 O  OE1   . GLN A 1 248 ? 67.993 -20.295 14.225  1.00 32.58 ? 245  GLN A OE1   1 
ATOM   1912 N  NE2   . GLN A 1 248 ? 69.601 -20.220 12.635  1.00 20.64 ? 245  GLN A NE2   1 
ATOM   1913 N  N     . LEU A 1 249 ? 63.844 -18.092 10.452  1.00 9.64  ? 246  LEU A N     1 
ATOM   1914 C  CA    . LEU A 1 249 ? 62.892 -16.972 10.401  1.00 8.35  ? 246  LEU A CA    1 
ATOM   1915 C  C     . LEU A 1 249 ? 61.447 -17.453 10.607  1.00 8.25  ? 246  LEU A C     1 
ATOM   1916 O  O     . LEU A 1 249 ? 60.686 -16.885 11.399  1.00 9.51  ? 246  LEU A O     1 
ATOM   1917 C  CB    . LEU A 1 249 ? 63.030 -16.227 9.069   1.00 7.72  ? 246  LEU A CB    1 
ATOM   1918 C  CG    . LEU A 1 249 ? 62.134 -14.997 8.856   1.00 11.31 ? 246  LEU A CG    1 
ATOM   1919 C  CD1   . LEU A 1 249 ? 62.455 -13.919 9.877   1.00 12.55 ? 246  LEU A CD1   1 
ATOM   1920 C  CD2   . LEU A 1 249 ? 62.267 -14.455 7.437   1.00 10.91 ? 246  LEU A CD2   1 
ATOM   1921 N  N     . PHE A 1 250 ? 61.062 -18.505 9.897   1.00 8.56  ? 247  PHE A N     1 
ATOM   1922 C  CA    . PHE A 1 250 ? 59.682 -18.987 9.979   1.00 9.31  ? 247  PHE A CA    1 
ATOM   1923 C  C     . PHE A 1 250 ? 59.389 -19.767 11.263  1.00 9.32  ? 247  PHE A C     1 
ATOM   1924 O  O     . PHE A 1 250 ? 58.224 -19.972 11.617  1.00 9.04  ? 247  PHE A O     1 
ATOM   1925 C  CB    . PHE A 1 250 ? 59.337 -19.840 8.761   1.00 7.45  ? 247  PHE A CB    1 
ATOM   1926 C  CG    . PHE A 1 250 ? 58.976 -19.036 7.531   1.00 9.93  ? 247  PHE A CG    1 
ATOM   1927 C  CD1   . PHE A 1 250 ? 58.449 -19.662 6.414   1.00 8.74  ? 247  PHE A CD1   1 
ATOM   1928 C  CD2   . PHE A 1 250 ? 59.168 -17.661 7.498   1.00 8.74  ? 247  PHE A CD2   1 
ATOM   1929 C  CE1   . PHE A 1 250 ? 58.105 -18.933 5.284   1.00 10.24 ? 247  PHE A CE1   1 
ATOM   1930 C  CE2   . PHE A 1 250 ? 58.832 -16.917 6.366   1.00 10.89 ? 247  PHE A CE2   1 
ATOM   1931 C  CZ    . PHE A 1 250 ? 58.293 -17.557 5.259   1.00 8.02  ? 247  PHE A CZ    1 
ATOM   1932 N  N     . SER A 1 251 ? 60.435 -20.201 11.961  1.00 7.74  ? 248  SER A N     1 
ATOM   1933 C  CA    . SER A 1 251 ? 60.245 -21.075 13.117  1.00 9.72  ? 248  SER A CA    1 
ATOM   1934 C  C     . SER A 1 251 ? 59.482 -20.362 14.240  1.00 11.45 ? 248  SER A C     1 
ATOM   1935 O  O     . SER A 1 251 ? 58.813 -21.003 15.046  1.00 8.58  ? 248  SER A O     1 
ATOM   1936 C  CB    . SER A 1 251 ? 61.592 -21.637 13.626  1.00 10.33 ? 248  SER A CB    1 
ATOM   1937 O  OG    . SER A 1 251 ? 62.332 -20.684 14.381  1.00 8.19  ? 248  SER A OG    1 
ATOM   1938 N  N     . GLN A 1 252 ? 59.599 -19.037 14.298  1.00 9.29  ? 249  GLN A N     1 
ATOM   1939 C  CA    . GLN A 1 252 ? 58.869 -18.269 15.305  1.00 9.49  ? 249  GLN A CA    1 
ATOM   1940 C  C     . GLN A 1 252 ? 58.013 -17.163 14.689  1.00 13.50 ? 249  GLN A C     1 
ATOM   1941 O  O     . GLN A 1 252 ? 57.685 -16.192 15.362  1.00 14.88 ? 249  GLN A O     1 
ATOM   1942 C  CB    . GLN A 1 252 ? 59.835 -17.625 16.288  1.00 12.16 ? 249  GLN A CB    1 
ATOM   1943 C  CG    . GLN A 1 252 ? 60.668 -18.588 17.096  1.00 14.25 ? 249  GLN A CG    1 
ATOM   1944 C  CD    . GLN A 1 252 ? 61.440 -17.860 18.167  1.00 28.25 ? 249  GLN A CD    1 
ATOM   1945 O  OE1   . GLN A 1 252 ? 60.924 -17.617 19.264  1.00 21.23 ? 249  GLN A OE1   1 
ATOM   1946 N  NE2   . GLN A 1 252 ? 62.674 -17.473 17.846  1.00 19.76 ? 249  GLN A NE2   1 
ATOM   1947 N  N     . MET A 1 253 ? 57.677 -17.296 13.411  1.00 9.49  ? 250  MET A N     1 
ATOM   1948 C  CA    . MET A 1 253 ? 56.960 -16.236 12.707  1.00 11.82 ? 250  MET A CA    1 
ATOM   1949 C  C     . MET A 1 253 ? 55.464 -16.543 12.768  1.00 10.57 ? 250  MET A C     1 
ATOM   1950 O  O     . MET A 1 253 ? 55.016 -17.534 12.216  1.00 8.67  ? 250  MET A O     1 
ATOM   1951 C  CB    . MET A 1 253 ? 57.462 -16.120 11.255  1.00 10.63 ? 250  MET A CB    1 
ATOM   1952 C  CG    . MET A 1 253 ? 56.778 -15.042 10.369  1.00 14.54 ? 250  MET A CG    1 
ATOM   1953 S  SD    . MET A 1 253 ? 57.107 -13.353 10.915  1.00 17.58 ? 250  MET A SD    1 
ATOM   1954 C  CE    . MET A 1 253 ? 58.889 -13.246 10.692  1.00 14.26 ? 250  MET A CE    1 
ATOM   1955 N  N     . PRO A 1 254 ? 54.687 -15.683 13.446  1.00 11.25 ? 251  PRO A N     1 
ATOM   1956 C  CA    . PRO A 1 254 ? 53.231 -15.886 13.482  1.00 11.83 ? 251  PRO A CA    1 
ATOM   1957 C  C     . PRO A 1 254 ? 52.657 -15.951 12.064  1.00 10.81 ? 251  PRO A C     1 
ATOM   1958 O  O     . PRO A 1 254 ? 53.027 -15.174 11.199  1.00 9.03  ? 251  PRO A O     1 
ATOM   1959 C  CB    . PRO A 1 254 ? 52.719 -14.648 14.219  1.00 12.25 ? 251  PRO A CB    1 
ATOM   1960 C  CG    . PRO A 1 254 ? 53.897 -14.167 15.017  1.00 15.19 ? 251  PRO A CG    1 
ATOM   1961 C  CD    . PRO A 1 254 ? 55.088 -14.440 14.127  1.00 13.99 ? 251  PRO A CD    1 
ATOM   1962 N  N     . ILE A 1 255 ? 51.770 -16.905 11.830  1.00 11.60 ? 252  ILE A N     1 
ATOM   1963 C  CA    . ILE A 1 255 ? 51.175 -17.087 10.513  1.00 8.54  ? 252  ILE A CA    1 
ATOM   1964 C  C     . ILE A 1 255 ? 50.602 -15.784 9.919   1.00 10.65 ? 252  ILE A C     1 
ATOM   1965 O  O     . ILE A 1 255 ? 50.758 -15.510 8.726   1.00 9.88  ? 252  ILE A O     1 
ATOM   1966 C  CB    . ILE A 1 255 ? 50.167 -18.252 10.546  1.00 14.41 ? 252  ILE A CB    1 
ATOM   1967 C  CG1   . ILE A 1 255 ? 50.959 -19.570 10.620  1.00 14.13 ? 252  ILE A CG1   1 
ATOM   1968 C  CG2   . ILE A 1 255 ? 49.286 -18.244 9.317   1.00 16.64 ? 252  ILE A CG2   1 
ATOM   1969 C  CD1   . ILE A 1 255 ? 50.175 -20.762 11.096  1.00 17.64 ? 252  ILE A CD1   1 
ATOM   1970 N  N     . ARG A 1 256 ? 49.997 -14.957 10.766  1.00 10.04 ? 253  ARG A N     1 
ATOM   1971 C  CA    . ARG A 1 256 ? 49.330 -13.747 10.307  1.00 12.71 ? 253  ARG A CA    1 
ATOM   1972 C  C     . ARG A 1 256 ? 50.273 -12.687 9.734   1.00 15.21 ? 253  ARG A C     1 
ATOM   1973 O  O     . ARG A 1 256 ? 49.812 -11.713 9.136   1.00 13.29 ? 253  ARG A O     1 
ATOM   1974 C  CB    . ARG A 1 256 ? 48.521 -13.127 11.446  1.00 9.97  ? 253  ARG A CB    1 
ATOM   1975 C  CG    . ARG A 1 256 ? 49.397 -12.590 12.569  1.00 12.81 ? 253  ARG A CG    1 
ATOM   1976 C  CD    . ARG A 1 256 ? 48.581 -11.925 13.678  1.00 17.24 ? 253  ARG A CD    1 
ATOM   1977 N  NE    . ARG A 1 256 ? 49.451 -11.490 14.775  1.00 19.43 ? 253  ARG A NE    1 
ATOM   1978 C  CZ    . ARG A 1 256 ? 49.843 -12.274 15.776  1.00 23.14 ? 253  ARG A CZ    1 
ATOM   1979 N  NH1   . ARG A 1 256 ? 49.442 -13.537 15.831  1.00 16.70 ? 253  ARG A NH1   1 
ATOM   1980 N  NH2   . ARG A 1 256 ? 50.645 -11.797 16.722  1.00 22.83 ? 253  ARG A NH2   1 
ATOM   1981 N  N     . LYS A 1 257 ? 51.581 -12.854 9.925   1.00 10.79 ? 254  LYS A N     1 
ATOM   1982 C  CA    . LYS A 1 257 ? 52.529 -11.862 9.421   1.00 13.48 ? 254  LYS A CA    1 
ATOM   1983 C  C     . LYS A 1 257 ? 52.777 -11.995 7.925   1.00 17.10 ? 254  LYS A C     1 
ATOM   1984 O  O     . LYS A 1 257 ? 53.296 -11.071 7.291   1.00 11.34 ? 254  LYS A O     1 
ATOM   1985 C  CB    . LYS A 1 257 ? 53.862 -11.949 10.166  1.00 13.71 ? 254  LYS A CB    1 
ATOM   1986 C  CG    . LYS A 1 257 ? 53.739 -11.801 11.672  1.00 16.70 ? 254  LYS A CG    1 
ATOM   1987 C  CD    . LYS A 1 257 ? 53.201 -10.450 12.072  1.00 22.56 ? 254  LYS A CD    1 
ATOM   1988 C  CE    . LYS A 1 257 ? 53.136 -10.329 13.599  1.00 28.48 ? 254  LYS A CE    1 
ATOM   1989 N  NZ    . LYS A 1 257 ? 52.654 -8.990  14.058  1.00 32.25 ? 254  LYS A NZ    1 
ATOM   1990 N  N     . ILE A 1 258 ? 52.430 -13.151 7.367   1.00 9.96  ? 255  ILE A N     1 
ATOM   1991 C  CA    . ILE A 1 258 ? 52.685 -13.411 5.952   1.00 9.81  ? 255  ILE A CA    1 
ATOM   1992 C  C     . ILE A 1 258 ? 51.537 -12.873 5.115   1.00 13.19 ? 255  ILE A C     1 
ATOM   1993 O  O     . ILE A 1 258 ? 50.371 -13.048 5.463   1.00 12.43 ? 255  ILE A O     1 
ATOM   1994 C  CB    . ILE A 1 258 ? 52.823 -14.926 5.686   1.00 14.49 ? 255  ILE A CB    1 
ATOM   1995 C  CG1   . ILE A 1 258 ? 54.202 -15.425 6.118   1.00 19.47 ? 255  ILE A CG1   1 
ATOM   1996 C  CG2   . ILE A 1 258 ? 52.583 -15.246 4.210   1.00 10.49 ? 255  ILE A CG2   1 
ATOM   1997 C  CD1   . ILE A 1 258 ? 54.511 -15.225 7.571   1.00 21.07 ? 255  ILE A CD1   1 
ATOM   1998 N  N     . ARG A 1 259 ? 51.859 -12.231 4.001   1.00 10.53 ? 256  ARG A N     1 
ATOM   1999 C  CA    . ARG A 1 259 ? 50.832 -11.552 3.224   1.00 12.96 ? 256  ARG A CA    1 
ATOM   2000 C  C     . ARG A 1 259 ? 49.787 -12.526 2.679   1.00 13.03 ? 256  ARG A C     1 
ATOM   2001 O  O     . ARG A 1 259 ? 50.131 -13.550 2.076   1.00 11.79 ? 256  ARG A O     1 
ATOM   2002 C  CB    . ARG A 1 259 ? 51.466 -10.737 2.097   1.00 15.69 ? 256  ARG A CB    1 
ATOM   2003 C  CG    . ARG A 1 259 ? 50.476 -9.888  1.353   1.00 22.08 ? 256  ARG A CG    1 
ATOM   2004 C  CD    . ARG A 1 259 ? 50.279 -10.415 -0.041  1.00 35.94 ? 256  ARG A CD    1 
ATOM   2005 N  NE    . ARG A 1 259 ? 51.322 -9.954  -0.948  1.00 30.48 ? 256  ARG A NE    1 
ATOM   2006 C  CZ    . ARG A 1 259 ? 51.481 -10.405 -2.191  1.00 37.64 ? 256  ARG A CZ    1 
ATOM   2007 N  NH1   . ARG A 1 259 ? 50.666 -11.338 -2.669  1.00 42.90 ? 256  ARG A NH1   1 
ATOM   2008 N  NH2   . ARG A 1 259 ? 52.450 -9.923  -2.959  1.00 24.86 ? 256  ARG A NH2   1 
ATOM   2009 N  N     . SER A 1 260 ? 48.521 -12.192 2.935   1.00 15.21 ? 257  SER A N     1 
ATOM   2010 C  CA    . SER A 1 260 ? 47.337 -12.965 2.537   1.00 14.99 ? 257  SER A CA    1 
ATOM   2011 C  C     . SER A 1 260 ? 46.826 -13.879 3.662   1.00 17.82 ? 257  SER A C     1 
ATOM   2012 O  O     . SER A 1 260 ? 45.744 -14.449 3.563   1.00 14.24 ? 257  SER A O     1 
ATOM   2013 C  CB    . SER A 1 260 ? 47.547 -13.746 1.231   1.00 15.78 ? 257  SER A CB    1 
ATOM   2014 O  OG    . SER A 1 260 ? 48.041 -15.063 1.471   1.00 13.97 ? 257  SER A OG    1 
ATOM   2015 N  N     . LEU A 1 261 ? 47.605 -14.010 4.729   1.00 10.28 ? 258  LEU A N     1 
ATOM   2016 C  CA    . LEU A 1 261 ? 47.214 -14.846 5.862   1.00 10.95 ? 258  LEU A CA    1 
ATOM   2017 C  C     . LEU A 1 261 ? 46.855 -13.998 7.087   1.00 12.24 ? 258  LEU A C     1 
ATOM   2018 O  O     . LEU A 1 261 ? 46.691 -14.522 8.194   1.00 13.06 ? 258  LEU A O     1 
ATOM   2019 C  CB    . LEU A 1 261 ? 48.342 -15.834 6.212   1.00 11.45 ? 258  LEU A CB    1 
ATOM   2020 C  CG    . LEU A 1 261 ? 48.735 -16.822 5.098   1.00 14.53 ? 258  LEU A CG    1 
ATOM   2021 C  CD1   . LEU A 1 261 ? 49.840 -17.760 5.559   1.00 10.57 ? 258  LEU A CD1   1 
ATOM   2022 C  CD2   . LEU A 1 261 ? 47.542 -17.638 4.598   1.00 14.43 ? 258  LEU A CD2   1 
ATOM   2023 N  N     . GLY A 1 262 ? 46.735 -12.685 6.895   1.00 13.86 ? 259  GLY A N     1 
ATOM   2024 C  CA    . GLY A 1 262 ? 46.408 -11.795 7.998   1.00 13.92 ? 259  GLY A CA    1 
ATOM   2025 C  C     . GLY A 1 262 ? 44.939 -11.785 8.419   1.00 18.82 ? 259  GLY A C     1 
ATOM   2026 O  O     . GLY A 1 262 ? 44.580 -11.164 9.421   1.00 17.16 ? 259  GLY A O     1 
ATOM   2027 N  N     . GLY A 1 263 ? 44.091 -12.484 7.669   1.00 14.68 ? 260  GLY A N     1 
ATOM   2028 C  CA    . GLY A 1 263 ? 42.652 -12.456 7.903   1.00 13.53 ? 260  GLY A CA    1 
ATOM   2029 C  C     . GLY A 1 263 ? 42.041 -13.814 8.218   1.00 19.24 ? 260  GLY A C     1 
ATOM   2030 O  O     . GLY A 1 263 ? 42.627 -14.609 8.955   1.00 14.31 ? 260  GLY A O     1 
ATOM   2031 N  N     . LYS A 1 264 ? 40.860 -14.087 7.665   1.00 17.71 ? 261  LYS A N     1 
ATOM   2032 C  CA    . LYS A 1 264 ? 40.120 -15.309 7.996   1.00 15.86 ? 261  LYS A CA    1 
ATOM   2033 C  C     . LYS A 1 264 ? 40.829 -16.612 7.620   1.00 13.80 ? 261  LYS A C     1 
ATOM   2034 O  O     . LYS A 1 264 ? 40.736 -17.588 8.357   1.00 14.38 ? 261  LYS A O     1 
ATOM   2035 C  CB    . LYS A 1 264 ? 38.709 -15.286 7.386   1.00 20.77 ? 261  LYS A CB    1 
ATOM   2036 C  CG    . LYS A 1 264 ? 37.783 -14.246 8.009   1.00 24.20 ? 261  LYS A CG    1 
ATOM   2037 C  CD    . LYS A 1 264 ? 36.426 -14.210 7.289   1.00 27.53 ? 261  LYS A CD    1 
ATOM   2038 C  CE    . LYS A 1 264 ? 35.460 -13.242 7.961   1.00 43.38 ? 261  LYS A CE    1 
ATOM   2039 N  NZ    . LYS A 1 264 ? 34.108 -13.263 7.329   1.00 39.75 ? 261  LYS A NZ    1 
ATOM   2040 N  N     . LEU A 1 265 ? 41.508 -16.645 6.475   1.00 11.98 ? 262  LEU A N     1 
ATOM   2041 C  CA    . LEU A 1 265 ? 42.235 -17.849 6.081   1.00 14.87 ? 262  LEU A CA    1 
ATOM   2042 C  C     . LEU A 1 265 ? 43.329 -18.155 7.094   1.00 15.02 ? 262  LEU A C     1 
ATOM   2043 O  O     . LEU A 1 265 ? 43.487 -19.297 7.516   1.00 15.48 ? 262  LEU A O     1 
ATOM   2044 C  CB    . LEU A 1 265 ? 42.865 -17.718 4.692   1.00 11.67 ? 262  LEU A CB    1 
ATOM   2045 C  CG    . LEU A 1 265 ? 43.752 -18.884 4.223   1.00 14.81 ? 262  LEU A CG    1 
ATOM   2046 C  CD1   . LEU A 1 265 ? 42.943 -20.164 4.110   1.00 17.46 ? 262  LEU A CD1   1 
ATOM   2047 C  CD2   . LEU A 1 265 ? 44.416 -18.574 2.893   1.00 12.65 ? 262  LEU A CD2   1 
ATOM   2048 N  N     . GLY A 1 266 ? 44.097 -17.133 7.470   1.00 13.56 ? 263  GLY A N     1 
ATOM   2049 C  CA    . GLY A 1 266 ? 45.172 -17.314 8.431   1.00 15.19 ? 263  GLY A CA    1 
ATOM   2050 C  C     . GLY A 1 266 ? 44.646 -17.847 9.746   1.00 15.75 ? 263  GLY A C     1 
ATOM   2051 O  O     . GLY A 1 266 ? 45.256 -18.727 10.365  1.00 13.03 ? 263  GLY A O     1 
ATOM   2052 N  N     . ALA A 1 267 ? 43.496 -17.320 10.164  1.00 13.41 ? 264  ALA A N     1 
ATOM   2053 C  CA    . ALA A 1 267 ? 42.851 -17.772 11.384  1.00 16.96 ? 264  ALA A CA    1 
ATOM   2054 C  C     . ALA A 1 267 ? 42.444 -19.224 11.266  1.00 10.80 ? 264  ALA A C     1 
ATOM   2055 O  O     . ALA A 1 267 ? 42.554 -19.974 12.231  1.00 13.25 ? 264  ALA A O     1 
ATOM   2056 C  CB    . ALA A 1 267 ? 41.642 -16.897 11.713  1.00 17.06 ? 264  ALA A CB    1 
ATOM   2057 N  N     . SER A 1 268 ? 41.976 -19.621 10.081  1.00 13.53 ? 265  SER A N     1 
ATOM   2058 C  CA    . SER A 1 268 ? 41.606 -21.014 9.864   1.00 13.17 ? 265  SER A CA    1 
ATOM   2059 C  C     . SER A 1 268 ? 42.757 -21.957 9.901   1.00 13.10 ? 265  SER A C     1 
ATOM   2060 O  O     . SER A 1 268 ? 42.644 -23.074 10.411  1.00 11.77 ? 265  SER A O     1 
ATOM   2061 C  CB    . SER A 1 268 ? 40.781 -21.231 8.578   1.00 14.39 ? 265  SER A CB    1 
ATOM   2062 O  OG    A SER A 1 268 ? 40.010 -20.093 8.247   0.50 21.16 ? 265  SER A OG    1 
ATOM   2063 O  OG    B SER A 1 268 ? 41.558 -20.985 7.426   0.50 13.33 ? 265  SER A OG    1 
ATOM   2064 N  N     . VAL A 1 269 ? 43.858 -21.514 9.329   1.00 13.01 ? 266  VAL A N     1 
ATOM   2065 C  CA    . VAL A 1 269 ? 45.040 -22.333 9.352   1.00 10.24 ? 266  VAL A CA    1 
ATOM   2066 C  C     . VAL A 1 269 ? 45.426 -22.654 10.808  1.00 15.23 ? 266  VAL A C     1 
ATOM   2067 O  O     . VAL A 1 269 ? 45.642 -23.810 11.184  1.00 13.40 ? 266  VAL A O     1 
ATOM   2068 C  CB    . VAL A 1 269 ? 46.218 -21.656 8.606   1.00 13.69 ? 266  VAL A CB    1 
ATOM   2069 C  CG1   . VAL A 1 269 ? 47.514 -22.427 8.818   1.00 14.41 ? 266  VAL A CG1   1 
ATOM   2070 C  CG2   . VAL A 1 269 ? 45.912 -21.557 7.114   1.00 13.84 ? 266  VAL A CG2   1 
ATOM   2071 N  N     . ILE A 1 270 ? 45.468 -21.623 11.636  1.00 12.57 ? 267  ILE A N     1 
ATOM   2072 C  CA    . ILE A 1 270 ? 45.818 -21.783 13.043  1.00 11.73 ? 267  ILE A CA    1 
ATOM   2073 C  C     . ILE A 1 270 ? 44.829 -22.686 13.780  1.00 13.19 ? 267  ILE A C     1 
ATOM   2074 O  O     . ILE A 1 270 ? 45.229 -23.579 14.542  1.00 16.85 ? 267  ILE A O     1 
ATOM   2075 C  CB    . ILE A 1 270 ? 45.855 -20.410 13.725  1.00 14.00 ? 267  ILE A CB    1 
ATOM   2076 C  CG1   . ILE A 1 270 ? 47.012 -19.577 13.157  1.00 15.51 ? 267  ILE A CG1   1 
ATOM   2077 C  CG2   . ILE A 1 270 ? 45.983 -20.561 15.231  1.00 20.25 ? 267  ILE A CG2   1 
ATOM   2078 C  CD1   . ILE A 1 270 ? 46.973 -18.130 13.558  1.00 19.78 ? 267  ILE A CD1   1 
ATOM   2079 N  N     . GLU A 1 271 ? 43.537 -22.454 13.557  1.00 11.80 ? 268  GLU A N     1 
ATOM   2080 C  CA    . GLU A 1 271 ? 42.489 -23.194 14.254  1.00 15.74 ? 268  GLU A CA    1 
ATOM   2081 C  C     . GLU A 1 271 ? 42.427 -24.654 13.816  1.00 17.66 ? 268  GLU A C     1 
ATOM   2082 O  O     . GLU A 1 271 ? 42.436 -25.569 14.647  1.00 15.66 ? 268  GLU A O     1 
ATOM   2083 C  CB    . GLU A 1 271 ? 41.121 -22.539 14.040  1.00 20.56 ? 268  GLU A CB    1 
ATOM   2084 C  CG    . GLU A 1 271 ? 39.953 -23.437 14.443  0.66 20.93 ? 268  GLU A CG    1 
ATOM   2085 C  CD    . GLU A 1 271 ? 38.655 -22.676 14.596  0.68 26.01 ? 268  GLU A CD    1 
ATOM   2086 O  OE1   . GLU A 1 271 ? 38.160 -22.125 13.590  0.00 26.77 ? 268  GLU A OE1   1 
ATOM   2087 O  OE2   . GLU A 1 271 ? 38.134 -22.625 15.728  0.57 31.89 ? 268  GLU A OE2   1 
ATOM   2088 N  N     . ILE A 1 272 ? 42.367 -24.875 12.509  1.00 12.76 ? 269  ILE A N     1 
ATOM   2089 C  CA    . ILE A 1 272 ? 42.226 -26.234 11.997  1.00 11.06 ? 269  ILE A CA    1 
ATOM   2090 C  C     . ILE A 1 272 ? 43.460 -27.092 12.263  1.00 16.07 ? 269  ILE A C     1 
ATOM   2091 O  O     . ILE A 1 272 ? 43.348 -28.264 12.623  1.00 14.42 ? 269  ILE A O     1 
ATOM   2092 C  CB    . ILE A 1 272 ? 41.912 -26.225 10.483  1.00 16.24 ? 269  ILE A CB    1 
ATOM   2093 C  CG1   . ILE A 1 272 ? 40.508 -25.663 10.245  1.00 19.05 ? 269  ILE A CG1   1 
ATOM   2094 C  CG2   . ILE A 1 272 ? 42.019 -27.619 9.903   1.00 17.20 ? 269  ILE A CG2   1 
ATOM   2095 C  CD1   . ILE A 1 272 ? 40.148 -25.506 8.778   1.00 23.04 ? 269  ILE A CD1   1 
ATOM   2096 N  N     . LEU A 1 273 ? 44.648 -26.520 12.072  1.00 15.27 ? 270  LEU A N     1 
ATOM   2097 C  CA    . LEU A 1 273 ? 45.866 -27.312 12.204  1.00 12.71 ? 270  LEU A CA    1 
ATOM   2098 C  C     . LEU A 1 273 ? 46.439 -27.296 13.627  1.00 13.65 ? 270  LEU A C     1 
ATOM   2099 O  O     . LEU A 1 273 ? 47.303 -28.107 13.963  1.00 15.29 ? 270  LEU A O     1 
ATOM   2100 C  CB    . LEU A 1 273 ? 46.913 -26.860 11.182  1.00 14.57 ? 270  LEU A CB    1 
ATOM   2101 C  CG    . LEU A 1 273 ? 46.503 -26.986 9.713   1.00 14.73 ? 270  LEU A CG    1 
ATOM   2102 C  CD1   . LEU A 1 273 ? 47.637 -26.570 8.800   1.00 12.20 ? 270  LEU A CD1   1 
ATOM   2103 C  CD2   . LEU A 1 273 ? 46.084 -28.411 9.395   1.00 17.79 ? 270  LEU A CD2   1 
ATOM   2104 N  N     . GLY A 1 274 ? 45.947 -26.391 14.463  1.00 13.65 ? 271  GLY A N     1 
ATOM   2105 C  CA    . GLY A 1 274 ? 46.445 -26.262 15.823  1.00 13.03 ? 271  GLY A CA    1 
ATOM   2106 C  C     . GLY A 1 274 ? 47.909 -25.861 15.878  1.00 16.60 ? 271  GLY A C     1 
ATOM   2107 O  O     . GLY A 1 274 ? 48.681 -26.418 16.666  1.00 17.54 ? 271  GLY A O     1 
ATOM   2108 N  N     . ILE A 1 275 ? 48.299 -24.904 15.040  1.00 13.97 ? 272  ILE A N     1 
ATOM   2109 C  CA    . ILE A 1 275 ? 49.683 -24.409 15.011  1.00 11.69 ? 272  ILE A CA    1 
ATOM   2110 C  C     . ILE A 1 275 ? 49.702 -22.885 15.159  1.00 15.61 ? 272  ILE A C     1 
ATOM   2111 O  O     . ILE A 1 275 ? 48.659 -22.249 15.069  1.00 15.16 ? 272  ILE A O     1 
ATOM   2112 C  CB    . ILE A 1 275 ? 50.399 -24.774 13.691  1.00 11.90 ? 272  ILE A CB    1 
ATOM   2113 C  CG1   . ILE A 1 275 ? 49.689 -24.120 12.494  1.00 14.26 ? 272  ILE A CG1   1 
ATOM   2114 C  CG2   . ILE A 1 275 ? 50.518 -26.290 13.535  1.00 14.63 ? 272  ILE A CG2   1 
ATOM   2115 C  CD1   . ILE A 1 275 ? 50.368 -24.406 11.161  1.00 17.20 ? 272  ILE A CD1   1 
ATOM   2116 N  N     . GLU A 1 276 ? 50.886 -22.308 15.380  1.00 11.59 ? 273  GLU A N     1 
ATOM   2117 C  CA    . GLU A 1 276 ? 51.021 -20.853 15.535  1.00 12.77 ? 273  GLU A CA    1 
ATOM   2118 C  C     . GLU A 1 276 ? 51.972 -20.217 14.523  1.00 14.58 ? 273  GLU A C     1 
ATOM   2119 O  O     . GLU A 1 276 ? 51.794 -19.060 14.135  1.00 10.95 ? 273  GLU A O     1 
ATOM   2120 C  CB    . GLU A 1 276 ? 51.508 -20.497 16.947  1.00 16.27 ? 273  GLU A CB    1 
ATOM   2121 C  CG    . GLU A 1 276 ? 50.641 -21.029 18.077  1.00 25.31 ? 273  GLU A CG    1 
ATOM   2122 C  CD    . GLU A 1 276 ? 51.194 -20.699 19.466  1.00 36.84 ? 273  GLU A CD    1 
ATOM   2123 O  OE1   . GLU A 1 276 ? 50.895 -21.451 20.418  1.00 41.85 ? 273  GLU A OE1   1 
ATOM   2124 O  OE2   . GLU A 1 276 ? 51.911 -19.684 19.612  1.00 35.20 ? 273  GLU A OE2   1 
ATOM   2125 N  N     . TYR A 1 277 ? 52.983 -20.972 14.104  1.00 11.63 ? 274  TYR A N     1 
ATOM   2126 C  CA    . TYR A 1 277 ? 54.078 -20.400 13.323  1.00 12.17 ? 274  TYR A CA    1 
ATOM   2127 C  C     . TYR A 1 277 ? 54.154 -20.957 11.917  1.00 7.84  ? 274  TYR A C     1 
ATOM   2128 O  O     . TYR A 1 277 ? 53.804 -22.110 11.669  1.00 9.75  ? 274  TYR A O     1 
ATOM   2129 C  CB    . TYR A 1 277 ? 55.419 -20.606 14.033  1.00 12.54 ? 274  TYR A CB    1 
ATOM   2130 C  CG    . TYR A 1 277 ? 55.415 -20.092 15.454  1.00 12.17 ? 274  TYR A CG    1 
ATOM   2131 C  CD1   . TYR A 1 277 ? 55.691 -20.934 16.523  1.00 13.43 ? 274  TYR A CD1   1 
ATOM   2132 C  CD2   . TYR A 1 277 ? 55.108 -18.766 15.724  1.00 11.00 ? 274  TYR A CD2   1 
ATOM   2133 C  CE1   . TYR A 1 277 ? 55.677 -20.462 17.837  1.00 16.73 ? 274  TYR A CE1   1 
ATOM   2134 C  CE2   . TYR A 1 277 ? 55.090 -18.286 17.021  1.00 13.82 ? 274  TYR A CE2   1 
ATOM   2135 C  CZ    . TYR A 1 277 ? 55.370 -19.140 18.079  1.00 20.66 ? 274  TYR A CZ    1 
ATOM   2136 O  OH    . TYR A 1 277 ? 55.347 -18.657 19.378  1.00 19.61 ? 274  TYR A OH    1 
ATOM   2137 N  N     . MET A 1 278 ? 54.626 -20.124 11.003  1.00 7.04  ? 275  MET A N     1 
ATOM   2138 C  CA    . MET A 1 278 ? 54.696 -20.504 9.594   1.00 12.83 ? 275  MET A CA    1 
ATOM   2139 C  C     . MET A 1 278 ? 55.491 -21.807 9.373   1.00 11.40 ? 275  MET A C     1 
ATOM   2140 O  O     . MET A 1 278 ? 55.100 -22.660 8.572   1.00 9.71  ? 275  MET A O     1 
ATOM   2141 C  CB    . MET A 1 278 ? 55.323 -19.368 8.792   1.00 11.99 ? 275  MET A CB    1 
ATOM   2142 C  CG    . MET A 1 278 ? 55.028 -19.426 7.319   1.00 17.91 ? 275  MET A CG    1 
ATOM   2143 S  SD    . MET A 1 278 ? 53.305 -19.030 6.963   1.00 17.50 ? 275  MET A SD    1 
ATOM   2144 C  CE    . MET A 1 278 ? 53.350 -19.273 5.196   1.00 23.02 ? 275  MET A CE    1 
ATOM   2145 N  N     . GLY A 1 279 ? 56.597 -21.959 10.090  1.00 9.92  ? 276  GLY A N     1 
ATOM   2146 C  CA    . GLY A 1 279 ? 57.453 -23.127 9.927   1.00 9.88  ? 276  GLY A CA    1 
ATOM   2147 C  C     . GLY A 1 279 ? 56.750 -24.430 10.284  1.00 14.86 ? 276  GLY A C     1 
ATOM   2148 O  O     . GLY A 1 279 ? 57.062 -25.490 9.731   1.00 10.82 ? 276  GLY A O     1 
ATOM   2149 N  N     . GLU A 1 280 ? 55.790 -24.367 11.204  1.00 8.94  ? 277  GLU A N     1 
ATOM   2150 C  CA    . GLU A 1 280 ? 55.031 -25.561 11.573  1.00 8.18  ? 277  GLU A CA    1 
ATOM   2151 C  C     . GLU A 1 280 ? 54.235 -26.160 10.403  1.00 11.27 ? 277  GLU A C     1 
ATOM   2152 O  O     . GLU A 1 280 ? 53.806 -27.313 10.457  1.00 9.12  ? 277  GLU A O     1 
ATOM   2153 C  CB    . GLU A 1 280 ? 54.075 -25.263 12.736  1.00 8.78  ? 277  GLU A CB    1 
ATOM   2154 C  CG    . GLU A 1 280 ? 54.771 -24.908 14.036  1.00 10.44 ? 277  GLU A CG    1 
ATOM   2155 C  CD    . GLU A 1 280 ? 53.783 -24.660 15.155  1.00 15.46 ? 277  GLU A CD    1 
ATOM   2156 O  OE1   . GLU A 1 280 ? 53.436 -23.488 15.392  1.00 16.18 ? 277  GLU A OE1   1 
ATOM   2157 O  OE2   . GLU A 1 280 ? 53.342 -25.640 15.783  1.00 15.41 ? 277  GLU A OE2   1 
ATOM   2158 N  N     . LEU A 1 281 ? 54.029 -25.383 9.352   1.00 10.71 ? 278  LEU A N     1 
ATOM   2159 C  CA    . LEU A 1 281 ? 53.334 -25.898 8.163   1.00 11.89 ? 278  LEU A CA    1 
ATOM   2160 C  C     . LEU A 1 281 ? 54.084 -27.011 7.410   1.00 11.76 ? 278  LEU A C     1 
ATOM   2161 O  O     . LEU A 1 281 ? 53.463 -27.776 6.670   1.00 10.94 ? 278  LEU A O     1 
ATOM   2162 C  CB    . LEU A 1 281 ? 52.984 -24.747 7.201   1.00 10.24 ? 278  LEU A CB    1 
ATOM   2163 C  CG    . LEU A 1 281 ? 51.819 -23.855 7.647   1.00 15.26 ? 278  LEU A CG    1 
ATOM   2164 C  CD1   . LEU A 1 281 ? 51.790 -22.535 6.870   1.00 15.18 ? 278  LEU A CD1   1 
ATOM   2165 C  CD2   . LEU A 1 281 ? 50.494 -24.609 7.493   1.00 12.36 ? 278  LEU A CD2   1 
ATOM   2166 N  N     . THR A 1 282 ? 55.408 -27.088 7.565   1.00 12.00 ? 279  THR A N     1 
ATOM   2167 C  CA    . THR A 1 282 ? 56.207 -28.029 6.770   1.00 13.65 ? 279  THR A CA    1 
ATOM   2168 C  C     . THR A 1 282 ? 55.838 -29.475 7.069   1.00 13.86 ? 279  THR A C     1 
ATOM   2169 O  O     . THR A 1 282 ? 56.104 -30.351 6.270   1.00 12.84 ? 279  THR A O     1 
ATOM   2170 C  CB    . THR A 1 282 ? 57.739 -27.855 6.976   1.00 12.78 ? 279  THR A CB    1 
ATOM   2171 O  OG1   . THR A 1 282 ? 58.066 -28.117 8.344   1.00 15.38 ? 279  THR A OG1   1 
ATOM   2172 C  CG2   . THR A 1 282 ? 58.187 -26.438 6.611   1.00 12.22 ? 279  THR A CG2   1 
ATOM   2173 N  N     . GLN A 1 283 ? 55.210 -29.718 8.218   1.00 10.92 ? 280  GLN A N     1 
ATOM   2174 C  CA    . GLN A 1 283 ? 54.959 -31.085 8.662   1.00 17.22 ? 280  GLN A CA    1 
ATOM   2175 C  C     . GLN A 1 283 ? 53.698 -31.691 8.039   1.00 18.13 ? 280  GLN A C     1 
ATOM   2176 O  O     . GLN A 1 283 ? 53.367 -32.842 8.294   1.00 24.64 ? 280  GLN A O     1 
ATOM   2177 C  CB    . GLN A 1 283 ? 54.808 -31.102 10.180  1.00 19.81 ? 280  GLN A CB    1 
ATOM   2178 C  CG    . GLN A 1 283 ? 53.498 -30.539 10.627  1.00 21.13 ? 280  GLN A CG    1 
ATOM   2179 C  CD    . GLN A 1 283 ? 53.427 -30.371 12.127  1.00 37.15 ? 280  GLN A CD    1 
ATOM   2180 O  OE1   . GLN A 1 283 ? 53.445 -31.352 12.878  1.00 39.92 ? 280  GLN A OE1   1 
ATOM   2181 N  NE2   . GLN A 1 283 ? 53.348 -29.118 12.576  1.00 20.02 ? 280  GLN A NE2   1 
ATOM   2182 N  N     . PHE A 1 284 ? 52.993 -30.915 7.227   1.00 9.56  ? 281  PHE A N     1 
ATOM   2183 C  CA    . PHE A 1 284 ? 51.806 -31.417 6.543   1.00 10.30 ? 281  PHE A CA    1 
ATOM   2184 C  C     . PHE A 1 284 ? 52.092 -31.698 5.067   1.00 13.22 ? 281  PHE A C     1 
ATOM   2185 O  O     . PHE A 1 284 ? 52.940 -31.051 4.460   1.00 17.05 ? 281  PHE A O     1 
ATOM   2186 C  CB    . PHE A 1 284 ? 50.669 -30.414 6.692   1.00 11.25 ? 281  PHE A CB    1 
ATOM   2187 C  CG    . PHE A 1 284 ? 50.338 -30.118 8.111   1.00 12.14 ? 281  PHE A CG    1 
ATOM   2188 C  CD1   . PHE A 1 284 ? 49.483 -30.948 8.820   1.00 17.06 ? 281  PHE A CD1   1 
ATOM   2189 C  CD2   . PHE A 1 284 ? 50.918 -29.041 8.763   1.00 12.95 ? 281  PHE A CD2   1 
ATOM   2190 C  CE1   . PHE A 1 284 ? 49.183 -30.686 10.145  1.00 20.28 ? 281  PHE A CE1   1 
ATOM   2191 C  CE2   . PHE A 1 284 ? 50.623 -28.777 10.088  1.00 16.06 ? 281  PHE A CE2   1 
ATOM   2192 C  CZ    . PHE A 1 284 ? 49.756 -29.600 10.777  1.00 16.82 ? 281  PHE A CZ    1 
ATOM   2193 N  N     . THR A 1 285 ? 51.384 -32.662 4.489   1.00 9.42  ? 282  THR A N     1 
ATOM   2194 C  CA    . THR A 1 285 ? 51.591 -32.980 3.083   1.00 15.46 ? 282  THR A CA    1 
ATOM   2195 C  C     . THR A 1 285 ? 50.814 -31.967 2.265   1.00 9.40  ? 282  THR A C     1 
ATOM   2196 O  O     . THR A 1 285 ? 49.910 -31.316 2.777   1.00 11.63 ? 282  THR A O     1 
ATOM   2197 C  CB    . THR A 1 285 ? 51.077 -34.387 2.738   1.00 13.01 ? 282  THR A CB    1 
ATOM   2198 O  OG1   . THR A 1 285 ? 49.660 -34.395 2.872   1.00 11.99 ? 282  THR A OG1   1 
ATOM   2199 C  CG2   . THR A 1 285 ? 51.663 -35.417 3.682   1.00 19.21 ? 282  THR A CG2   1 
ATOM   2200 N  N     . GLU A 1 286 ? 51.174 -31.823 0.997   1.00 11.04 ? 283  GLU A N     1 
ATOM   2201 C  CA    . GLU A 1 286 ? 50.452 -30.918 0.122   1.00 12.06 ? 283  GLU A CA    1 
ATOM   2202 C  C     . GLU A 1 286 ? 48.978 -31.333 0.067   1.00 12.47 ? 283  GLU A C     1 
ATOM   2203 O  O     . GLU A 1 286 ? 48.093 -30.491 0.141   1.00 12.89 ? 283  GLU A O     1 
ATOM   2204 C  CB    . GLU A 1 286 ? 51.083 -30.889 -1.270  1.00 11.89 ? 283  GLU A CB    1 
ATOM   2205 C  CG    . GLU A 1 286 ? 50.497 -29.819 -2.172  1.00 15.25 ? 283  GLU A CG    1 
ATOM   2206 C  CD    . GLU A 1 286 ? 51.229 -29.712 -3.504  1.00 20.78 ? 283  GLU A CD    1 
ATOM   2207 O  OE1   . GLU A 1 286 ? 52.111 -30.545 -3.769  1.00 20.53 ? 283  GLU A OE1   1 
ATOM   2208 O  OE2   . GLU A 1 286 ? 50.928 -28.781 -4.275  1.00 21.82 ? 283  GLU A OE2   1 
ATOM   2209 N  N     . SER A 1 287 ? 48.716 -32.639 -0.023  1.00 14.00 ? 284  SER A N     1 
ATOM   2210 C  CA    . SER A 1 287 ? 47.337 -33.126 -0.051  1.00 13.38 ? 284  SER A CA    1 
ATOM   2211 C  C     . SER A 1 287 ? 46.589 -32.735 1.218   1.00 11.96 ? 284  SER A C     1 
ATOM   2212 O  O     . SER A 1 287 ? 45.424 -32.357 1.162   1.00 13.29 ? 284  SER A O     1 
ATOM   2213 C  CB    . SER A 1 287 ? 47.270 -34.651 -0.254  1.00 14.50 ? 284  SER A CB    1 
ATOM   2214 O  OG    . SER A 1 287 ? 47.709 -35.003 -1.559  1.00 18.84 ? 284  SER A OG    1 
ATOM   2215 N  N     . GLN A 1 288 ? 47.255 -32.821 2.366   1.00 11.88 ? 285  GLN A N     1 
ATOM   2216 C  CA    . GLN A 1 288 ? 46.575 -32.472 3.610   1.00 11.52 ? 285  GLN A CA    1 
ATOM   2217 C  C     . GLN A 1 288 ? 46.157 -31.016 3.607   1.00 15.26 ? 285  GLN A C     1 
ATOM   2218 O  O     . GLN A 1 288 ? 45.035 -30.674 3.982   1.00 14.02 ? 285  GLN A O     1 
ATOM   2219 C  CB    . GLN A 1 288 ? 47.467 -32.722 4.821   1.00 11.72 ? 285  GLN A CB    1 
ATOM   2220 C  CG    . GLN A 1 288 ? 47.484 -34.147 5.298   1.00 21.02 ? 285  GLN A CG    1 
ATOM   2221 C  CD    . GLN A 1 288 ? 48.471 -34.343 6.428   1.00 23.99 ? 285  GLN A CD    1 
ATOM   2222 O  OE1   . GLN A 1 288 ? 49.614 -33.890 6.350   1.00 17.14 ? 285  GLN A OE1   1 
ATOM   2223 N  NE2   . GLN A 1 288 ? 48.033 -35.012 7.491   1.00 26.11 ? 285  GLN A NE2   1 
ATOM   2224 N  N     . LEU A 1 289 ? 47.068 -30.147 3.188   1.00 10.09 ? 286  LEU A N     1 
ATOM   2225 C  CA    . LEU A 1 289 ? 46.759 -28.723 3.166   1.00 10.20 ? 286  LEU A CA    1 
ATOM   2226 C  C     . LEU A 1 289 ? 45.665 -28.417 2.151   1.00 11.90 ? 286  LEU A C     1 
ATOM   2227 O  O     . LEU A 1 289 ? 44.790 -27.586 2.396   1.00 13.58 ? 286  LEU A O     1 
ATOM   2228 C  CB    . LEU A 1 289 ? 48.011 -27.900 2.869   1.00 10.22 ? 286  LEU A CB    1 
ATOM   2229 C  CG    . LEU A 1 289 ? 49.134 -27.958 3.912   1.00 10.12 ? 286  LEU A CG    1 
ATOM   2230 C  CD1   . LEU A 1 289 ? 50.356 -27.186 3.417   1.00 10.54 ? 286  LEU A CD1   1 
ATOM   2231 C  CD2   . LEU A 1 289 ? 48.647 -27.391 5.238   1.00 13.23 ? 286  LEU A CD2   1 
ATOM   2232 N  N     . GLN A 1 290 ? 45.715 -29.085 1.004   1.00 13.71 ? 287  GLN A N     1 
ATOM   2233 C  CA    . GLN A 1 290 ? 44.665 -28.912 0.011   1.00 14.20 ? 287  GLN A CA    1 
ATOM   2234 C  C     . GLN A 1 290 ? 43.283 -29.345 0.517   1.00 15.14 ? 287  GLN A C     1 
ATOM   2235 O  O     . GLN A 1 290 ? 42.273 -28.734 0.171   1.00 17.25 ? 287  GLN A O     1 
ATOM   2236 C  CB    . GLN A 1 290 ? 45.011 -29.656 -1.272  1.00 15.91 ? 287  GLN A CB    1 
ATOM   2237 C  CG    . GLN A 1 290 ? 46.160 -29.040 -2.056  1.00 14.41 ? 287  GLN A CG    1 
ATOM   2238 C  CD    . GLN A 1 290 ? 46.537 -29.891 -3.239  1.00 16.13 ? 287  GLN A CD    1 
ATOM   2239 O  OE1   . GLN A 1 290 ? 46.576 -31.119 -3.140  1.00 16.82 ? 287  GLN A OE1   1 
ATOM   2240 N  NE2   . GLN A 1 290 ? 46.806 -29.252 -4.370  1.00 17.48 ? 287  GLN A NE2   1 
ATOM   2241 N  N     . SER A 1 291 ? 43.235 -30.397 1.326   1.00 14.27 ? 288  SER A N     1 
ATOM   2242 C  CA    . SER A 1 291 ? 41.959 -30.871 1.859   1.00 14.65 ? 288  SER A CA    1 
ATOM   2243 C  C     . SER A 1 291 ? 41.268 -29.842 2.756   1.00 18.93 ? 288  SER A C     1 
ATOM   2244 O  O     . SER A 1 291 ? 40.043 -29.769 2.780   1.00 22.75 ? 288  SER A O     1 
ATOM   2245 C  CB    . SER A 1 291 ? 42.106 -32.203 2.605   1.00 13.73 ? 288  SER A CB    1 
ATOM   2246 O  OG    . SER A 1 291 ? 42.821 -32.034 3.827   1.00 23.86 ? 288  SER A OG    1 
ATOM   2247 N  N     . HIS A 1 292 ? 42.045 -29.057 3.496   1.00 15.18 ? 289  HIS A N     1 
ATOM   2248 C  CA    . HIS A 1 292 ? 41.468 -28.074 4.400   1.00 17.14 ? 289  HIS A CA    1 
ATOM   2249 C  C     . HIS A 1 292 ? 41.217 -26.723 3.735   1.00 19.77 ? 289  HIS A C     1 
ATOM   2250 O  O     . HIS A 1 292 ? 40.234 -26.060 4.035   1.00 24.99 ? 289  HIS A O     1 
ATOM   2251 C  CB    . HIS A 1 292 ? 42.373 -27.840 5.610   1.00 18.44 ? 289  HIS A CB    1 
ATOM   2252 C  CG    . HIS A 1 292 ? 42.590 -29.049 6.466   1.00 16.63 ? 289  HIS A CG    1 
ATOM   2253 N  ND1   . HIS A 1 292 ? 41.579 -29.646 7.187   1.00 24.29 ? 289  HIS A ND1   1 
ATOM   2254 C  CD2   . HIS A 1 292 ? 43.717 -29.744 6.750   1.00 19.65 ? 289  HIS A CD2   1 
ATOM   2255 C  CE1   . HIS A 1 292 ? 42.071 -30.668 7.865   1.00 20.60 ? 289  HIS A CE1   1 
ATOM   2256 N  NE2   . HIS A 1 292 ? 43.365 -30.750 7.617   1.00 27.88 ? 289  HIS A NE2   1 
ATOM   2257 N  N     . PHE A 1 293 ? 42.116 -26.304 2.850   1.00 15.58 ? 290  PHE A N     1 
ATOM   2258 C  CA    . PHE A 1 293 ? 42.126 -24.907 2.407   1.00 17.91 ? 290  PHE A CA    1 
ATOM   2259 C  C     . PHE A 1 293 ? 41.909 -24.747 0.898   1.00 21.35 ? 290  PHE A C     1 
ATOM   2260 O  O     . PHE A 1 293 ? 41.939 -23.633 0.359   1.00 19.97 ? 290  PHE A O     1 
ATOM   2261 C  CB    . PHE A 1 293 ? 43.433 -24.240 2.860   1.00 16.04 ? 290  PHE A CB    1 
ATOM   2262 C  CG    . PHE A 1 293 ? 43.780 -24.522 4.301   1.00 15.93 ? 290  PHE A CG    1 
ATOM   2263 C  CD1   . PHE A 1 293 ? 42.985 -24.018 5.326   1.00 16.65 ? 290  PHE A CD1   1 
ATOM   2264 C  CD2   . PHE A 1 293 ? 44.884 -25.294 4.631   1.00 13.33 ? 290  PHE A CD2   1 
ATOM   2265 C  CE1   . PHE A 1 293 ? 43.280 -24.281 6.653   1.00 13.55 ? 290  PHE A CE1   1 
ATOM   2266 C  CE2   . PHE A 1 293 ? 45.194 -25.564 5.967   1.00 13.77 ? 290  PHE A CE2   1 
ATOM   2267 C  CZ    . PHE A 1 293 ? 44.386 -25.062 6.974   1.00 15.92 ? 290  PHE A CZ    1 
ATOM   2268 N  N     . GLY A 1 294 ? 41.680 -25.863 0.216   1.00 14.61 ? 291  GLY A N     1 
ATOM   2269 C  CA    . GLY A 1 294 ? 41.406 -25.818 -1.207  1.00 18.98 ? 291  GLY A CA    1 
ATOM   2270 C  C     . GLY A 1 294 ? 42.650 -26.088 -2.016  1.00 16.86 ? 291  GLY A C     1 
ATOM   2271 O  O     . GLY A 1 294 ? 43.761 -25.942 -1.514  1.00 14.77 ? 291  GLY A O     1 
ATOM   2272 N  N     . GLU A 1 295 ? 42.464 -26.468 -3.277  1.00 15.99 ? 292  GLU A N     1 
ATOM   2273 C  CA    . GLU A 1 295 ? 43.576 -26.857 -4.130  1.00 16.69 ? 292  GLU A CA    1 
ATOM   2274 C  C     . GLU A 1 295 ? 44.627 -25.765 -4.245  1.00 17.50 ? 292  GLU A C     1 
ATOM   2275 O  O     . GLU A 1 295 ? 45.819 -26.024 -4.118  1.00 15.51 ? 292  GLU A O     1 
ATOM   2276 C  CB    . GLU A 1 295 ? 43.065 -27.220 -5.525  1.00 22.34 ? 292  GLU A CB    1 
ATOM   2277 C  CG    . GLU A 1 295 ? 44.142 -27.721 -6.464  1.00 23.88 ? 292  GLU A CG    1 
ATOM   2278 C  CD    . GLU A 1 295 ? 43.604 -28.022 -7.856  1.00 42.80 ? 292  GLU A CD    1 
ATOM   2279 O  OE1   . GLU A 1 295 ? 44.379 -27.914 -8.832  1.00 43.60 ? 292  GLU A OE1   1 
ATOM   2280 O  OE2   . GLU A 1 295 ? 42.406 -28.367 -7.972  1.00 34.58 ? 292  GLU A OE2   1 
ATOM   2281 N  N     . LYS A 1 296 ? 44.178 -24.541 -4.493  1.00 15.87 ? 293  LYS A N     1 
ATOM   2282 C  CA    . LYS A 1 296 ? 45.092 -23.435 -4.747  1.00 18.03 ? 293  LYS A CA    1 
ATOM   2283 C  C     . LYS A 1 296 ? 45.815 -22.992 -3.471  1.00 14.05 ? 293  LYS A C     1 
ATOM   2284 O  O     . LYS A 1 296 ? 47.040 -22.903 -3.444  1.00 13.80 ? 293  LYS A O     1 
ATOM   2285 C  CB    . LYS A 1 296 ? 44.343 -22.260 -5.388  1.00 16.31 ? 293  LYS A CB    1 
ATOM   2286 C  CG    . LYS A 1 296 ? 45.213 -21.076 -5.749  1.00 24.80 ? 293  LYS A CG    1 
ATOM   2287 C  CD    . LYS A 1 296 ? 44.471 -20.093 -6.665  1.00 35.25 ? 293  LYS A CD    1 
ATOM   2288 C  CE    . LYS A 1 296 ? 44.768 -18.634 -6.300  1.00 40.80 ? 293  LYS A CE    1 
ATOM   2289 N  NZ    . LYS A 1 296 ? 44.155 -18.252 -4.982  1.00 36.25 ? 293  LYS A NZ    1 
ATOM   2290 N  N     . ASN A 1 297 ? 45.055 -22.713 -2.422  1.00 14.32 ? 294  ASN A N     1 
ATOM   2291 C  CA    . ASN A 1 297 ? 45.656 -22.312 -1.155  1.00 16.01 ? 294  ASN A CA    1 
ATOM   2292 C  C     . ASN A 1 297 ? 46.555 -23.402 -0.577  1.00 14.55 ? 294  ASN A C     1 
ATOM   2293 O  O     . ASN A 1 297 ? 47.573 -23.098 0.029   1.00 11.21 ? 294  ASN A O     1 
ATOM   2294 C  CB    . ASN A 1 297 ? 44.584 -21.967 -0.122  1.00 18.35 ? 294  ASN A CB    1 
ATOM   2295 C  CG    . ASN A 1 297 ? 43.837 -20.692 -0.449  1.00 21.27 ? 294  ASN A CG    1 
ATOM   2296 O  OD1   . ASN A 1 297 ? 44.405 -19.751 -1.008  1.00 21.10 ? 294  ASN A OD1   1 
ATOM   2297 N  ND2   . ASN A 1 297 ? 42.559 -20.644 -0.077  1.00 19.96 ? 294  ASN A ND2   1 
ATOM   2298 N  N     . GLY A 1 298 ? 46.167 -24.666 -0.737  1.00 15.82 ? 295  GLY A N     1 
ATOM   2299 C  CA    . GLY A 1 298 ? 46.931 -25.765 -0.163  1.00 15.12 ? 295  GLY A CA    1 
ATOM   2300 C  C     . GLY A 1 298 ? 48.302 -25.888 -0.814  1.00 13.77 ? 295  GLY A C     1 
ATOM   2301 O  O     . GLY A 1 298 ? 49.322 -26.090 -0.141  1.00 11.25 ? 295  GLY A O     1 
ATOM   2302 N  N     . SER A 1 299 ? 48.326 -25.782 -2.138  1.00 10.93 ? 296  SER A N     1 
ATOM   2303 C  CA    . SER A 1 299 ? 49.573 -25.799 -2.877  1.00 11.55 ? 296  SER A CA    1 
ATOM   2304 C  C     . SER A 1 299 ? 50.421 -24.587 -2.523  1.00 12.33 ? 296  SER A C     1 
ATOM   2305 O  O     . SER A 1 299 ? 51.629 -24.714 -2.334  1.00 12.20 ? 296  SER A O     1 
ATOM   2306 C  CB    . SER A 1 299 ? 49.320 -25.846 -4.391  1.00 18.14 ? 296  SER A CB    1 
ATOM   2307 O  OG    . SER A 1 299 ? 48.945 -27.150 -4.771  1.00 18.45 ? 296  SER A OG    1 
ATOM   2308 N  N     . TRP A 1 300 ? 49.777 -23.426 -2.411  1.00 12.45 ? 297  TRP A N     1 
ATOM   2309 C  CA    . TRP A 1 300 ? 50.479 -22.183 -2.078  1.00 15.23 ? 297  TRP A CA    1 
ATOM   2310 C  C     . TRP A 1 300 ? 51.157 -22.275 -0.705  1.00 11.91 ? 297  TRP A C     1 
ATOM   2311 O  O     . TRP A 1 300 ? 52.347 -21.954 -0.577  1.00 11.50 ? 297  TRP A O     1 
ATOM   2312 C  CB    . TRP A 1 300 ? 49.523 -20.982 -2.140  1.00 12.26 ? 297  TRP A CB    1 
ATOM   2313 C  CG    . TRP A 1 300 ? 50.211 -19.639 -1.923  1.00 15.04 ? 297  TRP A CG    1 
ATOM   2314 C  CD1   . TRP A 1 300 ? 50.855 -18.881 -2.862  1.00 15.79 ? 297  TRP A CD1   1 
ATOM   2315 C  CD2   . TRP A 1 300 ? 50.310 -18.910 -0.686  1.00 11.99 ? 297  TRP A CD2   1 
ATOM   2316 N  NE1   . TRP A 1 300 ? 51.348 -17.724 -2.283  1.00 15.01 ? 297  TRP A NE1   1 
ATOM   2317 C  CE2   . TRP A 1 300 ? 51.030 -17.725 -0.950  1.00 13.32 ? 297  TRP A CE2   1 
ATOM   2318 C  CE3   . TRP A 1 300 ? 49.862 -19.145 0.613   1.00 14.04 ? 297  TRP A CE3   1 
ATOM   2319 C  CZ2   . TRP A 1 300 ? 51.305 -16.785 0.039   1.00 14.06 ? 297  TRP A CZ2   1 
ATOM   2320 C  CZ3   . TRP A 1 300 ? 50.142 -18.204 1.594   1.00 18.06 ? 297  TRP A CZ3   1 
ATOM   2321 C  CH2   . TRP A 1 300 ? 50.857 -17.045 1.299   1.00 12.32 ? 297  TRP A CH2   1 
ATOM   2322 N  N     . LEU A 1 301 ? 50.397 -22.719 0.305   1.00 10.52 ? 298  LEU A N     1 
ATOM   2323 C  CA    . LEU A 1 301 ? 50.915 -22.894 1.670   1.00 12.26 ? 298  LEU A CA    1 
ATOM   2324 C  C     . LEU A 1 301 ? 52.057 -23.904 1.747   1.00 12.57 ? 298  LEU A C     1 
ATOM   2325 O  O     . LEU A 1 301 ? 53.049 -23.698 2.464   1.00 8.99  ? 298  LEU A O     1 
ATOM   2326 C  CB    . LEU A 1 301 ? 49.796 -23.328 2.620   1.00 7.17  ? 298  LEU A CB    1 
ATOM   2327 C  CG    . LEU A 1 301 ? 48.728 -22.275 2.942   1.00 11.14 ? 298  LEU A CG    1 
ATOM   2328 C  CD1   . LEU A 1 301 ? 47.462 -22.909 3.553   1.00 8.11  ? 298  LEU A CD1   1 
ATOM   2329 C  CD2   . LEU A 1 301 ? 49.301 -21.200 3.870   1.00 11.53 ? 298  LEU A CD2   1 
ATOM   2330 N  N     . TYR A 1 302 ? 51.922 -24.997 1.008   1.00 10.17 ? 299  TYR A N     1 
ATOM   2331 C  CA    . TYR A 1 302 ? 52.955 -26.023 0.992   1.00 8.08  ? 299  TYR A CA    1 
ATOM   2332 C  C     . TYR A 1 302 ? 54.318 -25.472 0.539   1.00 13.60 ? 299  TYR A C     1 
ATOM   2333 O  O     . TYR A 1 302 ? 55.345 -25.678 1.198   1.00 8.03  ? 299  TYR A O     1 
ATOM   2334 C  CB    . TYR A 1 302 ? 52.531 -27.206 0.105   1.00 12.96 ? 299  TYR A CB    1 
ATOM   2335 C  CG    . TYR A 1 302 ? 53.536 -28.330 0.146   1.00 9.60  ? 299  TYR A CG    1 
ATOM   2336 C  CD1   . TYR A 1 302 ? 53.516 -29.267 1.176   1.00 12.75 ? 299  TYR A CD1   1 
ATOM   2337 C  CD2   . TYR A 1 302 ? 54.519 -28.441 -0.823  1.00 14.76 ? 299  TYR A CD2   1 
ATOM   2338 C  CE1   . TYR A 1 302 ? 54.451 -30.292 1.230   1.00 15.11 ? 299  TYR A CE1   1 
ATOM   2339 C  CE2   . TYR A 1 302 ? 55.461 -29.453 -0.776  1.00 19.05 ? 299  TYR A CE2   1 
ATOM   2340 C  CZ    . TYR A 1 302 ? 55.420 -30.379 0.252   1.00 21.77 ? 299  TYR A CZ    1 
ATOM   2341 O  OH    . TYR A 1 302 ? 56.359 -31.388 0.296   1.00 21.91 ? 299  TYR A OH    1 
ATOM   2342 N  N     . ALA A 1 303 ? 54.321 -24.761 -0.582  1.00 11.04 ? 300  ALA A N     1 
ATOM   2343 C  CA    . ALA A 1 303 ? 55.530 -24.098 -1.070  1.00 10.53 ? 300  ALA A CA    1 
ATOM   2344 C  C     . ALA A 1 303 ? 55.940 -22.916 -0.186  1.00 8.77  ? 300  ALA A C     1 
ATOM   2345 O  O     . ALA A 1 303 ? 57.126 -22.727 0.099   1.00 9.10  ? 300  ALA A O     1 
ATOM   2346 C  CB    . ALA A 1 303 ? 55.321 -23.615 -2.517  1.00 11.46 ? 300  ALA A CB    1 
ATOM   2347 N  N     . MET A 1 304 ? 54.972 -22.115 0.245   1.00 9.92  ? 301  MET A N     1 
ATOM   2348 C  CA    . MET A 1 304 ? 55.316 -20.875 0.960   1.00 10.17 ? 301  MET A CA    1 
ATOM   2349 C  C     . MET A 1 304 ? 56.037 -21.141 2.271   1.00 10.24 ? 301  MET A C     1 
ATOM   2350 O  O     . MET A 1 304 ? 56.979 -20.414 2.628   1.00 9.67  ? 301  MET A O     1 
ATOM   2351 C  CB    . MET A 1 304 ? 54.097 -19.995 1.209   1.00 11.64 ? 301  MET A CB    1 
ATOM   2352 C  CG    . MET A 1 304 ? 54.458 -18.566 1.641   1.00 13.00 ? 301  MET A CG    1 
ATOM   2353 S  SD    . MET A 1 304 ? 55.233 -17.630 0.299   1.00 14.73 ? 301  MET A SD    1 
ATOM   2354 C  CE    . MET A 1 304 ? 56.952 -17.554 0.834   1.00 12.73 ? 301  MET A CE    1 
ATOM   2355 N  N     . CYS A 1 305 ? 55.595 -22.156 3.006   1.00 7.36  ? 302  CYS A N     1 
ATOM   2356 C  CA    . CYS A 1 305 ? 56.230 -22.432 4.298   1.00 11.82 ? 302  CYS A CA    1 
ATOM   2357 C  C     . CYS A 1 305 ? 57.671 -22.921 4.119   1.00 8.96  ? 302  CYS A C     1 
ATOM   2358 O  O     . CYS A 1 305 ? 58.428 -22.999 5.083   1.00 9.92  ? 302  CYS A O     1 
ATOM   2359 C  CB    . CYS A 1 305 ? 55.417 -23.432 5.136   1.00 10.23 ? 302  CYS A CB    1 
ATOM   2360 S  SG    . CYS A 1 305 ? 55.424 -25.123 4.493   1.00 10.49 ? 302  CYS A SG    1 
ATOM   2361 N  N     . ARG A 1 306 ? 58.036 -23.242 2.878   1.00 7.78  ? 303  ARG A N     1 
ATOM   2362 C  CA    . ARG A 1 306 ? 59.403 -23.622 2.514   1.00 10.80 ? 303  ARG A CA    1 
ATOM   2363 C  C     . ARG A 1 306 ? 60.167 -22.461 1.849   1.00 11.27 ? 303  ARG A C     1 
ATOM   2364 O  O     . ARG A 1 306 ? 61.324 -22.616 1.437   1.00 12.52 ? 303  ARG A O     1 
ATOM   2365 C  CB    . ARG A 1 306 ? 59.383 -24.860 1.610   1.00 12.90 ? 303  ARG A CB    1 
ATOM   2366 C  CG    . ARG A 1 306 ? 58.877 -26.110 2.335   1.00 12.75 ? 303  ARG A CG    1 
ATOM   2367 C  CD    . ARG A 1 306 ? 58.643 -27.319 1.412   1.00 14.29 ? 303  ARG A CD    1 
ATOM   2368 N  NE    . ARG A 1 306 ? 58.448 -28.509 2.237   1.00 17.04 ? 303  ARG A NE    1 
ATOM   2369 C  CZ    . ARG A 1 306 ? 57.326 -28.778 2.895   1.00 16.30 ? 303  ARG A CZ    1 
ATOM   2370 N  NH1   . ARG A 1 306 ? 57.238 -29.874 3.653   1.00 15.90 ? 303  ARG A NH1   1 
ATOM   2371 N  NH2   . ARG A 1 306 ? 56.289 -27.955 2.785   1.00 12.03 ? 303  ARG A NH2   1 
ATOM   2372 N  N     . GLY A 1 307 ? 59.526 -21.301 1.772   1.00 9.48  ? 304  GLY A N     1 
ATOM   2373 C  CA    . GLY A 1 307 ? 60.181 -20.091 1.296   1.00 10.99 ? 304  GLY A CA    1 
ATOM   2374 C  C     . GLY A 1 307 ? 59.998 -19.920 -0.199  1.00 11.17 ? 304  GLY A C     1 
ATOM   2375 O  O     . GLY A 1 307 ? 60.691 -19.125 -0.848  1.00 11.89 ? 304  GLY A O     1 
ATOM   2376 N  N     . ILE A 1 308 ? 59.049 -20.663 -0.750  1.00 10.26 ? 305  ILE A N     1 
ATOM   2377 C  CA    . ILE A 1 308 ? 58.909 -20.754 -2.204  1.00 10.85 ? 305  ILE A CA    1 
ATOM   2378 C  C     . ILE A 1 308 ? 57.559 -20.209 -2.644  1.00 13.22 ? 305  ILE A C     1 
ATOM   2379 O  O     . ILE A 1 308 ? 56.534 -20.585 -2.099  1.00 9.92  ? 305  ILE A O     1 
ATOM   2380 C  CB    . ILE A 1 308 ? 59.027 -22.221 -2.674  1.00 12.85 ? 305  ILE A CB    1 
ATOM   2381 C  CG1   . ILE A 1 308 ? 60.389 -22.797 -2.292  1.00 14.66 ? 305  ILE A CG1   1 
ATOM   2382 C  CG2   . ILE A 1 308 ? 58.797 -22.336 -4.177  1.00 15.63 ? 305  ILE A CG2   1 
ATOM   2383 C  CD1   . ILE A 1 308 ? 60.543 -24.262 -2.641  1.00 19.98 ? 305  ILE A CD1   1 
ATOM   2384 N  N     . GLU A 1 309 ? 57.566 -19.308 -3.622  1.00 11.08 ? 306  GLU A N     1 
ATOM   2385 C  CA    . GLU A 1 309 ? 56.333 -18.727 -4.142  1.00 14.52 ? 306  GLU A CA    1 
ATOM   2386 C  C     . GLU A 1 309 ? 56.605 -18.271 -5.570  1.00 19.93 ? 306  GLU A C     1 
ATOM   2387 O  O     . GLU A 1 309 ? 57.705 -17.808 -5.869  1.00 17.68 ? 306  GLU A O     1 
ATOM   2388 C  CB    . GLU A 1 309 ? 55.907 -17.527 -3.304  1.00 15.83 ? 306  GLU A CB    1 
ATOM   2389 C  CG    . GLU A 1 309 ? 54.447 -17.191 -3.470  1.00 23.77 ? 306  GLU A CG    1 
ATOM   2390 C  CD    . GLU A 1 309 ? 54.169 -15.705 -3.606  1.00 21.44 ? 306  GLU A CD    1 
ATOM   2391 O  OE1   . GLU A 1 309 ? 55.125 -14.895 -3.760  1.00 19.66 ? 306  GLU A OE1   1 
ATOM   2392 O  OE2   . GLU A 1 309 ? 52.976 -15.355 -3.552  1.00 25.25 ? 306  GLU A OE2   1 
ATOM   2393 N  N     . HIS A 1 310 ? 55.620 -18.380 -6.455  1.00 17.10 ? 307  HIS A N     1 
ATOM   2394 C  CA    . HIS A 1 310 ? 55.896 -18.113 -7.873  1.00 21.59 ? 307  HIS A CA    1 
ATOM   2395 C  C     . HIS A 1 310 ? 55.168 -16.925 -8.503  1.00 16.48 ? 307  HIS A C     1 
ATOM   2396 O  O     . HIS A 1 310 ? 55.378 -16.629 -9.675  1.00 21.16 ? 307  HIS A O     1 
ATOM   2397 C  CB    . HIS A 1 310 ? 55.661 -19.368 -8.708  1.00 28.52 ? 307  HIS A CB    1 
ATOM   2398 C  CG    . HIS A 1 310 ? 56.543 -20.514 -8.325  1.00 34.15 ? 307  HIS A CG    1 
ATOM   2399 N  ND1   . HIS A 1 310 ? 57.920 -20.433 -8.351  1.00 29.93 ? 307  HIS A ND1   1 
ATOM   2400 C  CD2   . HIS A 1 310 ? 56.247 -21.764 -7.901  1.00 30.87 ? 307  HIS A CD2   1 
ATOM   2401 C  CE1   . HIS A 1 310 ? 58.434 -21.587 -7.965  1.00 33.92 ? 307  HIS A CE1   1 
ATOM   2402 N  NE2   . HIS A 1 310 ? 57.439 -22.410 -7.684  1.00 33.48 ? 307  HIS A NE2   1 
ATOM   2403 N  N     . ASP A 1 311 ? 54.322 -16.250 -7.738  1.00 18.93 ? 308  ASP A N     1 
ATOM   2404 C  CA    . ASP A 1 311 ? 53.571 -15.110 -8.261  1.00 17.58 ? 308  ASP A CA    1 
ATOM   2405 C  C     . ASP A 1 311 ? 54.514 -14.129 -8.961  1.00 15.30 ? 308  ASP A C     1 
ATOM   2406 O  O     . ASP A 1 311 ? 55.479 -13.659 -8.364  1.00 11.87 ? 308  ASP A O     1 
ATOM   2407 C  CB    . ASP A 1 311 ? 52.829 -14.418 -7.127  1.00 16.18 ? 308  ASP A CB    1 
ATOM   2408 C  CG    . ASP A 1 311 ? 51.895 -13.330 -7.617  1.00 23.36 ? 308  ASP A CG    1 
ATOM   2409 O  OD1   . ASP A 1 311 ? 51.725 -12.329 -6.900  1.00 28.98 ? 308  ASP A OD1   1 
ATOM   2410 O  OD2   . ASP A 1 311 ? 51.313 -13.482 -8.709  1.00 31.22 ? 308  ASP A OD2   1 
ATOM   2411 N  N     . PRO A 1 312 ? 54.248 -13.824 -10.238 1.00 16.14 ? 309  PRO A N     1 
ATOM   2412 C  CA    . PRO A 1 312 ? 55.171 -12.911 -10.916 1.00 13.26 ? 309  PRO A CA    1 
ATOM   2413 C  C     . PRO A 1 312 ? 54.967 -11.447 -10.544 1.00 11.13 ? 309  PRO A C     1 
ATOM   2414 O  O     . PRO A 1 312 ? 53.879 -11.016 -10.166 1.00 12.42 ? 309  PRO A O     1 
ATOM   2415 C  CB    . PRO A 1 312 ? 54.860 -13.130 -12.405 1.00 17.80 ? 309  PRO A CB    1 
ATOM   2416 C  CG    . PRO A 1 312 ? 53.467 -13.598 -12.432 1.00 14.85 ? 309  PRO A CG    1 
ATOM   2417 C  CD    . PRO A 1 312 ? 53.241 -14.389 -11.161 1.00 15.33 ? 309  PRO A CD    1 
ATOM   2418 N  N     . VAL A 1 313 ? 56.054 -10.693 -10.634 1.00 14.08 ? 310  VAL A N     1 
ATOM   2419 C  CA    . VAL A 1 313 ? 55.998 -9.244  -10.575 1.00 12.63 ? 310  VAL A CA    1 
ATOM   2420 C  C     . VAL A 1 313 ? 55.345 -8.779  -11.872 1.00 12.99 ? 310  VAL A C     1 
ATOM   2421 O  O     . VAL A 1 313 ? 55.947 -8.859  -12.940 1.00 15.03 ? 310  VAL A O     1 
ATOM   2422 C  CB    . VAL A 1 313 ? 57.400 -8.644  -10.490 1.00 13.58 ? 310  VAL A CB    1 
ATOM   2423 C  CG1   . VAL A 1 313 ? 57.340 -7.118  -10.596 1.00 13.44 ? 310  VAL A CG1   1 
ATOM   2424 C  CG2   . VAL A 1 313 ? 58.078 -9.075  -9.192  1.00 10.95 ? 310  VAL A CG2   1 
ATOM   2425 N  N     . LYS A 1 314 ? 54.106 -8.318  -11.776 1.00 13.26 ? 311  LYS A N     1 
ATOM   2426 C  CA    . LYS A 1 314 ? 53.359 -7.923  -12.962 1.00 13.41 ? 311  LYS A CA    1 
ATOM   2427 C  C     . LYS A 1 314 ? 53.812 -6.564  -13.449 1.00 14.00 ? 311  LYS A C     1 
ATOM   2428 O  O     . LYS A 1 314 ? 54.031 -5.652  -12.645 1.00 14.52 ? 311  LYS A O     1 
ATOM   2429 C  CB    . LYS A 1 314 ? 51.860 -7.944  -12.671 1.00 17.23 ? 311  LYS A CB    1 
ATOM   2430 C  CG    . LYS A 1 314 ? 51.352 -9.363  -12.476 1.00 23.13 ? 311  LYS A CG    1 
ATOM   2431 C  CD    . LYS A 1 314 ? 50.077 -9.441  -11.673 1.00 27.46 ? 311  LYS A CD    1 
ATOM   2432 C  CE    . LYS A 1 314 ? 49.820 -10.899 -11.272 1.00 32.37 ? 311  LYS A CE    1 
ATOM   2433 N  NZ    . LYS A 1 314 ? 50.957 -11.481 -10.464 1.00 23.54 ? 311  LYS A NZ    1 
ATOM   2434 N  N     . PRO A 1 315 ? 54.003 -6.436  -14.767 1.00 12.31 ? 312  PRO A N     1 
ATOM   2435 C  CA    . PRO A 1 315 ? 54.373 -5.154  -15.361 1.00 10.43 ? 312  PRO A CA    1 
ATOM   2436 C  C     . PRO A 1 315 ? 53.175 -4.220  -15.357 1.00 18.18 ? 312  PRO A C     1 
ATOM   2437 O  O     . PRO A 1 315 ? 52.447 -4.129  -16.353 1.00 19.37 ? 312  PRO A O     1 
ATOM   2438 C  CB    . PRO A 1 315 ? 54.751 -5.534  -16.796 1.00 19.75 ? 312  PRO A CB    1 
ATOM   2439 C  CG    . PRO A 1 315 ? 53.970 -6.782  -17.069 1.00 20.17 ? 312  PRO A CG    1 
ATOM   2440 C  CD    . PRO A 1 315 ? 53.963 -7.520  -15.767 1.00 17.92 ? 312  PRO A CD    1 
ATOM   2441 N  N     . ARG A 1 316 ? 52.956 -3.537  -14.238 1.00 14.67 ? 313  ARG A N     1 
ATOM   2442 C  CA    . ARG A 1 316 ? 51.835 -2.595  -14.154 1.00 14.57 ? 313  ARG A CA    1 
ATOM   2443 C  C     . ARG A 1 316 ? 52.180 -1.479  -13.180 1.00 18.87 ? 313  ARG A C     1 
ATOM   2444 O  O     . ARG A 1 316 ? 52.241 -1.706  -11.985 1.00 15.59 ? 313  ARG A O     1 
ATOM   2445 C  CB    . ARG A 1 316 ? 50.551 -3.293  -13.711 1.00 16.29 ? 313  ARG A CB    1 
ATOM   2446 C  CG    . ARG A 1 316 ? 49.370 -2.333  -13.600 1.00 19.88 ? 313  ARG A CG    1 
ATOM   2447 C  CD    . ARG A 1 316 ? 48.129 -3.000  -13.026 1.00 20.16 ? 313  ARG A CD    1 
ATOM   2448 N  NE    . ARG A 1 316 ? 48.402 -3.587  -11.722 1.00 21.93 ? 313  ARG A NE    1 
ATOM   2449 C  CZ    . ARG A 1 316 ? 48.520 -2.897  -10.591 1.00 29.61 ? 313  ARG A CZ    1 
ATOM   2450 N  NH1   . ARG A 1 316 ? 48.378 -1.570  -10.596 1.00 23.12 ? 313  ARG A NH1   1 
ATOM   2451 N  NH2   . ARG A 1 316 ? 48.777 -3.539  -9.452  1.00 22.81 ? 313  ARG A NH2   1 
ATOM   2452 N  N     . GLN A 1 317 ? 52.402 -0.277  -13.701 1.00 13.44 ? 314  GLN A N     1 
ATOM   2453 C  CA    . GLN A 1 317 ? 52.819 0.861   -12.889 1.00 21.35 ? 314  GLN A CA    1 
ATOM   2454 C  C     . GLN A 1 317 ? 51.637 1.778   -12.551 1.00 23.37 ? 314  GLN A C     1 
ATOM   2455 O  O     . GLN A 1 317 ? 51.706 2.591   -11.622 1.00 23.37 ? 314  GLN A O     1 
ATOM   2456 C  CB    . GLN A 1 317 ? 53.905 1.635   -13.641 1.00 26.88 ? 314  GLN A CB    1 
ATOM   2457 C  CG    . GLN A 1 317 ? 54.497 2.787   -12.882 1.00 35.19 ? 314  GLN A CG    1 
ATOM   2458 C  CD    . GLN A 1 317 ? 55.499 3.553   -13.708 1.00 29.41 ? 314  GLN A CD    1 
ATOM   2459 O  OE1   . GLN A 1 317 ? 55.873 3.124   -14.808 1.00 37.58 ? 314  GLN A OE1   1 
ATOM   2460 N  NE2   . GLN A 1 317 ? 55.947 4.693   -13.189 1.00 28.55 ? 314  GLN A NE2   1 
ATOM   2461 N  N     . LEU A 1 318 ? 50.545 1.629   -13.296 1.00 15.84 ? 315  LEU A N     1 
ATOM   2462 C  CA    . LEU A 1 318 ? 49.349 2.449   -13.111 1.00 15.54 ? 315  LEU A CA    1 
ATOM   2463 C  C     . LEU A 1 318 ? 48.192 1.668   -12.477 1.00 17.81 ? 315  LEU A C     1 
ATOM   2464 O  O     . LEU A 1 318 ? 47.981 0.491   -12.786 1.00 18.84 ? 315  LEU A O     1 
ATOM   2465 C  CB    . LEU A 1 318 ? 48.863 2.969   -14.477 1.00 17.56 ? 315  LEU A CB    1 
ATOM   2466 C  CG    . LEU A 1 318 ? 49.790 3.829   -15.340 1.00 20.59 ? 315  LEU A CG    1 
ATOM   2467 C  CD1   . LEU A 1 318 ? 49.185 4.024   -16.731 1.00 20.21 ? 315  LEU A CD1   1 
ATOM   2468 C  CD2   . LEU A 1 318 ? 50.070 5.174   -14.681 1.00 16.50 ? 315  LEU A CD2   1 
ATOM   2469 N  N     . PRO A 1 319 ? 47.400 2.334   -11.623 1.00 16.25 ? 316  PRO A N     1 
ATOM   2470 C  CA    . PRO A 1 319 ? 46.202 1.680   -11.066 1.00 17.05 ? 316  PRO A CA    1 
ATOM   2471 C  C     . PRO A 1 319 ? 45.235 1.210   -12.168 1.00 16.44 ? 316  PRO A C     1 
ATOM   2472 O  O     . PRO A 1 319 ? 45.208 1.821   -13.233 1.00 20.25 ? 316  PRO A O     1 
ATOM   2473 C  CB    . PRO A 1 319 ? 45.563 2.774   -10.185 1.00 15.91 ? 316  PRO A CB    1 
ATOM   2474 C  CG    . PRO A 1 319 ? 46.241 4.059   -10.573 1.00 26.59 ? 316  PRO A CG    1 
ATOM   2475 C  CD    . PRO A 1 319 ? 47.564 3.729   -11.177 1.00 14.72 ? 316  PRO A CD    1 
ATOM   2476 N  N     . LYS A 1 320 ? 44.481 0.139   -11.901 1.00 17.63 ? 317  LYS A N     1 
ATOM   2477 C  CA    . LYS A 1 320 ? 43.513 -0.465  -12.828 1.00 19.44 ? 317  LYS A CA    1 
ATOM   2478 C  C     . LYS A 1 320 ? 42.116 0.134   -12.706 1.00 17.25 ? 317  LYS A C     1 
ATOM   2479 O  O     . LYS A 1 320 ? 41.238 -0.136  -13.526 1.00 19.46 ? 317  LYS A O     1 
ATOM   2480 C  CB    . LYS A 1 320 ? 43.355 -1.954  -12.506 1.00 22.93 ? 317  LYS A CB    1 
ATOM   2481 C  CG    . LYS A 1 320 ? 44.471 -2.871  -12.958 1.00 24.22 ? 317  LYS A CG    1 
ATOM   2482 C  CD    . LYS A 1 320 ? 44.033 -4.327  -12.779 1.00 27.76 ? 317  LYS A CD    1 
ATOM   2483 C  CE    . LYS A 1 320 ? 45.014 -5.278  -13.424 1.00 42.51 ? 317  LYS A CE    1 
ATOM   2484 N  NZ    . LYS A 1 320 ? 44.616 -6.691  -13.222 1.00 40.69 ? 317  LYS A NZ    1 
ATOM   2485 N  N     . THR A 1 321 ? 41.894 0.888   -11.638 1.00 17.02 ? 318  THR A N     1 
ATOM   2486 C  CA    . THR A 1 321 ? 40.602 1.508   -11.398 1.00 16.94 ? 318  THR A CA    1 
ATOM   2487 C  C     . THR A 1 321 ? 40.840 2.882   -10.796 1.00 15.97 ? 318  THR A C     1 
ATOM   2488 O  O     . THR A 1 321 ? 41.896 3.143   -10.212 1.00 20.29 ? 318  THR A O     1 
ATOM   2489 C  CB    . THR A 1 321 ? 39.707 0.665   -10.444 1.00 22.14 ? 318  THR A CB    1 
ATOM   2490 O  OG1   . THR A 1 321 ? 40.359 0.506   -9.173  1.00 20.16 ? 318  THR A OG1   1 
ATOM   2491 C  CG2   . THR A 1 321 ? 39.414 -0.702  -11.027 1.00 21.55 ? 318  THR A CG2   1 
ATOM   2492 N  N     . ILE A 1 322 ? 39.875 3.774   -10.981 1.00 15.17 ? 319  ILE A N     1 
ATOM   2493 C  CA    . ILE A 1 322 ? 39.920 5.109   -10.401 1.00 20.29 ? 319  ILE A CA    1 
ATOM   2494 C  C     . ILE A 1 322 ? 38.575 5.324   -9.702  1.00 17.69 ? 319  ILE A C     1 
ATOM   2495 O  O     . ILE A 1 322 ? 37.532 5.358   -10.354 1.00 17.04 ? 319  ILE A O     1 
ATOM   2496 C  CB    . ILE A 1 322 ? 40.127 6.183   -11.485 1.00 16.10 ? 319  ILE A CB    1 
ATOM   2497 C  CG1   . ILE A 1 322 ? 41.500 6.022   -12.147 1.00 21.05 ? 319  ILE A CG1   1 
ATOM   2498 C  CG2   . ILE A 1 322 ? 39.970 7.597   -10.904 1.00 16.12 ? 319  ILE A CG2   1 
ATOM   2499 C  CD1   . ILE A 1 322 ? 41.739 6.999   -13.285 1.00 22.10 ? 319  ILE A CD1   1 
ATOM   2500 N  N     . GLY A 1 323 ? 38.595 5.425   -8.376  1.00 15.05 ? 320  GLY A N     1 
ATOM   2501 C  CA    . GLY A 1 323 ? 37.360 5.534   -7.616  1.00 18.00 ? 320  GLY A CA    1 
ATOM   2502 C  C     . GLY A 1 323 ? 37.302 6.699   -6.644  1.00 13.75 ? 320  GLY A C     1 
ATOM   2503 O  O     . GLY A 1 323 ? 38.329 7.257   -6.260  1.00 16.97 ? 320  GLY A O     1 
ATOM   2504 N  N     . CYS A 1 324 ? 36.079 7.048   -6.250  1.00 14.04 ? 321  CYS A N     1 
ATOM   2505 C  CA    . CYS A 1 324 ? 35.791 8.138   -5.319  1.00 13.43 ? 321  CYS A CA    1 
ATOM   2506 C  C     . CYS A 1 324 ? 34.754 7.600   -4.350  1.00 15.80 ? 321  CYS A C     1 
ATOM   2507 O  O     . CYS A 1 324 ? 33.752 7.027   -4.770  1.00 16.43 ? 321  CYS A O     1 
ATOM   2508 C  CB    . CYS A 1 324 ? 35.201 9.350   -6.062  1.00 18.23 ? 321  CYS A CB    1 
ATOM   2509 S  SG    . CYS A 1 324 ? 36.303 10.118  -7.262  1.00 32.79 ? 321  CYS A SG    1 
ATOM   2510 N  N     . SER A 1 325 ? 34.991 7.781   -3.059  1.00 15.78 ? 322  SER A N     1 
ATOM   2511 C  CA    . SER A 1 325 ? 34.159 7.156   -2.043  1.00 17.00 ? 322  SER A CA    1 
ATOM   2512 C  C     . SER A 1 325 ? 33.947 8.094   -0.862  1.00 17.03 ? 322  SER A C     1 
ATOM   2513 O  O     . SER A 1 325 ? 34.862 8.803   -0.465  1.00 17.31 ? 322  SER A O     1 
ATOM   2514 C  CB    . SER A 1 325 ? 34.860 5.882   -1.549  1.00 19.16 ? 322  SER A CB    1 
ATOM   2515 O  OG    . SER A 1 325 ? 34.182 5.297   -0.467  1.00 31.03 ? 322  SER A OG    1 
ATOM   2516 N  N     . LYS A 1 326 ? 32.750 8.082   -0.280  1.00 13.53 ? 323  LYS A N     1 
ATOM   2517 C  CA    . LYS A 1 326 ? 32.532 8.809   0.964   1.00 17.29 ? 323  LYS A CA    1 
ATOM   2518 C  C     . LYS A 1 326 ? 31.556 8.090   1.887   1.00 18.07 ? 323  LYS A C     1 
ATOM   2519 O  O     . LYS A 1 326 ? 30.492 7.644   1.454   1.00 11.58 ? 323  LYS A O     1 
ATOM   2520 C  CB    . LYS A 1 326 ? 32.059 10.245  0.710   1.00 18.90 ? 323  LYS A CB    1 
ATOM   2521 C  CG    . LYS A 1 326 ? 32.026 11.080  2.004   1.00 18.04 ? 323  LYS A CG    1 
ATOM   2522 C  CD    . LYS A 1 326 ? 31.695 12.533  1.745   1.00 17.88 ? 323  LYS A CD    1 
ATOM   2523 C  CE    . LYS A 1 326 ? 31.450 13.263  3.062   1.00 21.67 ? 323  LYS A CE    1 
ATOM   2524 N  NZ    . LYS A 1 326 ? 32.465 12.858  4.046   1.00 25.78 ? 323  LYS A NZ    1 
ATOM   2525 N  N     . ASN A 1 327 ? 31.944 7.968   3.154   1.00 15.04 ? 324  ASN A N     1 
ATOM   2526 C  CA    . ASN A 1 327 ? 31.072 7.464   4.202   1.00 19.68 ? 324  ASN A CA    1 
ATOM   2527 C  C     . ASN A 1 327 ? 30.240 8.591   4.789   1.00 20.58 ? 324  ASN A C     1 
ATOM   2528 O  O     . ASN A 1 327 ? 30.694 9.733   4.865   1.00 17.19 ? 324  ASN A O     1 
ATOM   2529 C  CB    . ASN A 1 327 ? 31.897 6.850   5.330   1.00 20.88 ? 324  ASN A CB    1 
ATOM   2530 C  CG    . ASN A 1 327 ? 32.487 5.514   4.962   1.00 27.40 ? 324  ASN A CG    1 
ATOM   2531 O  OD1   . ASN A 1 327 ? 32.276 4.999   3.858   1.00 27.77 ? 324  ASN A OD1   1 
ATOM   2532 N  ND2   . ASN A 1 327 ? 33.239 4.937   5.889   1.00 27.85 ? 324  ASN A ND2   1 
ATOM   2533 N  N     . PHE A 1 328 ? 29.028 8.258   5.220   1.00 20.80 ? 325  PHE A N     1 
ATOM   2534 C  CA    . PHE A 1 328 ? 28.152 9.208   5.883   1.00 20.86 ? 325  PHE A CA    1 
ATOM   2535 C  C     . PHE A 1 328 ? 27.714 8.565   7.185   1.00 27.44 ? 325  PHE A C     1 
ATOM   2536 O  O     . PHE A 1 328 ? 26.632 7.979   7.278   1.00 27.22 ? 325  PHE A O     1 
ATOM   2537 C  CB    . PHE A 1 328 ? 26.966 9.558   4.987   1.00 25.50 ? 325  PHE A CB    1 
ATOM   2538 C  CG    . PHE A 1 328 ? 27.377 10.110  3.664   1.00 19.91 ? 325  PHE A CG    1 
ATOM   2539 C  CD1   . PHE A 1 328 ? 27.556 9.265   2.578   1.00 22.84 ? 325  PHE A CD1   1 
ATOM   2540 C  CD2   . PHE A 1 328 ? 27.643 11.465  3.510   1.00 17.04 ? 325  PHE A CD2   1 
ATOM   2541 C  CE1   . PHE A 1 328 ? 27.957 9.764   1.359   1.00 14.57 ? 325  PHE A CE1   1 
ATOM   2542 C  CE2   . PHE A 1 328 ? 28.044 11.974  2.288   1.00 20.80 ? 325  PHE A CE2   1 
ATOM   2543 C  CZ    . PHE A 1 328 ? 28.201 11.121  1.207   1.00 16.92 ? 325  PHE A CZ    1 
ATOM   2544 N  N     . PRO A 1 329 ? 28.584 8.651   8.194   1.00 24.42 ? 326  PRO A N     1 
ATOM   2545 C  CA    . PRO A 1 329 ? 28.435 7.857   9.414   1.00 36.20 ? 326  PRO A CA    1 
ATOM   2546 C  C     . PRO A 1 329 ? 27.349 8.390   10.330  1.00 37.09 ? 326  PRO A C     1 
ATOM   2547 O  O     . PRO A 1 329 ? 26.915 9.541   10.189  1.00 29.14 ? 326  PRO A O     1 
ATOM   2548 C  CB    . PRO A 1 329 ? 29.803 7.994   10.081  1.00 38.00 ? 326  PRO A CB    1 
ATOM   2549 C  CG    . PRO A 1 329 ? 30.293 9.333   9.631   1.00 34.59 ? 326  PRO A CG    1 
ATOM   2550 C  CD    . PRO A 1 329 ? 29.802 9.480   8.214   1.00 32.38 ? 326  PRO A CD    1 
ATOM   2551 N  N     . GLY A 1 330 ? 26.921 7.534   11.255  1.00 41.57 ? 327  GLY A N     1 
ATOM   2552 C  CA    . GLY A 1 330 ? 25.946 7.880   12.271  1.00 43.88 ? 327  GLY A CA    1 
ATOM   2553 C  C     . GLY A 1 330 ? 24.822 8.763   11.778  1.00 40.14 ? 327  GLY A C     1 
ATOM   2554 O  O     . GLY A 1 330 ? 24.036 8.371   10.915  1.00 38.33 ? 327  GLY A O     1 
ATOM   2555 N  N     . LYS A 1 331 ? 24.764 9.974   12.322  1.00 34.39 ? 328  LYS A N     1 
ATOM   2556 C  CA    . LYS A 1 331 ? 23.637 10.866  12.088  1.00 36.66 ? 328  LYS A CA    1 
ATOM   2557 C  C     . LYS A 1 331 ? 23.708 11.618  10.759  1.00 37.49 ? 328  LYS A C     1 
ATOM   2558 O  O     . LYS A 1 331 ? 22.738 12.267  10.373  1.00 41.57 ? 328  LYS A O     1 
ATOM   2559 C  CB    . LYS A 1 331 ? 23.498 11.844  13.261  1.00 46.17 ? 328  LYS A CB    1 
ATOM   2560 C  CG    . LYS A 1 331 ? 22.133 12.501  13.371  1.00 60.83 ? 328  LYS A CG    1 
ATOM   2561 C  CD    . LYS A 1 331 ? 21.956 13.186  14.719  1.00 61.62 ? 328  LYS A CD    1 
ATOM   2562 C  CE    . LYS A 1 331 ? 20.890 14.266  14.646  1.00 58.01 ? 328  LYS A CE    1 
ATOM   2563 N  NZ    . LYS A 1 331 ? 21.258 15.315  13.647  1.00 44.09 ? 328  LYS A NZ    1 
ATOM   2564 N  N     . THR A 1 332 ? 24.841 11.533  10.059  1.00 36.20 ? 329  THR A N     1 
ATOM   2565 C  CA    . THR A 1 332 ? 24.997 12.253  8.788   1.00 36.43 ? 329  THR A CA    1 
ATOM   2566 C  C     . THR A 1 332 ? 24.484 11.470  7.568   1.00 28.55 ? 329  THR A C     1 
ATOM   2567 O  O     . THR A 1 332 ? 24.555 11.969  6.448   1.00 28.10 ? 329  THR A O     1 
ATOM   2568 C  CB    . THR A 1 332 ? 26.470 12.680  8.508   1.00 32.26 ? 329  THR A CB    1 
ATOM   2569 O  OG1   . THR A 1 332 ? 27.265 11.525  8.209   1.00 34.25 ? 329  THR A OG1   1 
ATOM   2570 C  CG2   . THR A 1 332 ? 27.071 13.434  9.695   1.00 31.81 ? 329  THR A CG2   1 
ATOM   2571 N  N     . ALA A 1 333 ? 23.977 10.259  7.790   1.00 28.05 ? 330  ALA A N     1 
ATOM   2572 C  CA    . ALA A 1 333 ? 23.443 9.409   6.715   1.00 26.50 ? 330  ALA A CA    1 
ATOM   2573 C  C     . ALA A 1 333 ? 22.404 10.118  5.851   1.00 31.79 ? 330  ALA A C     1 
ATOM   2574 O  O     . ALA A 1 333 ? 21.551 10.832  6.365   1.00 34.57 ? 330  ALA A O     1 
ATOM   2575 C  CB    . ALA A 1 333 ? 22.857 8.133   7.297   1.00 29.36 ? 330  ALA A CB    1 
ATOM   2576 N  N     . LEU A 1 334 ? 22.462 9.901   4.540   1.00 23.73 ? 331  LEU A N     1 
ATOM   2577 C  CA    . LEU A 1 334 ? 21.620 10.640  3.608   1.00 29.41 ? 331  LEU A CA    1 
ATOM   2578 C  C     . LEU A 1 334 ? 20.195 10.073  3.615   1.00 29.37 ? 331  LEU A C     1 
ATOM   2579 O  O     . LEU A 1 334 ? 19.989 8.898   3.343   1.00 29.03 ? 331  LEU A O     1 
ATOM   2580 C  CB    . LEU A 1 334 ? 22.216 10.591  2.197   1.00 30.80 ? 331  LEU A CB    1 
ATOM   2581 C  CG    . LEU A 1 334 ? 23.738 10.754  2.094   1.00 27.85 ? 331  LEU A CG    1 
ATOM   2582 C  CD1   . LEU A 1 334 ? 24.181 10.696  0.632   1.00 23.33 ? 331  LEU A CD1   1 
ATOM   2583 C  CD2   . LEU A 1 334 ? 24.210 12.047  2.753   1.00 25.93 ? 331  LEU A CD2   1 
ATOM   2584 N  N     . ALA A 1 335 ? 19.221 10.918  3.933   1.00 38.74 ? 332  ALA A N     1 
ATOM   2585 C  CA    . ALA A 1 335 ? 17.851 10.454  4.144   1.00 36.16 ? 332  ALA A CA    1 
ATOM   2586 C  C     . ALA A 1 335 ? 16.855 11.129  3.206   1.00 40.83 ? 332  ALA A C     1 
ATOM   2587 O  O     . ALA A 1 335 ? 15.646 10.920  3.314   1.00 41.43 ? 332  ALA A O     1 
ATOM   2588 C  CB    . ALA A 1 335 ? 17.443 10.664  5.592   1.00 30.92 ? 332  ALA A CB    1 
ATOM   2589 N  N     . THR A 1 336 ? 17.366 11.943  2.291   1.00 33.49 ? 333  THR A N     1 
ATOM   2590 C  CA    . THR A 1 336 ? 16.523 12.586  1.295   1.00 34.98 ? 333  THR A CA    1 
ATOM   2591 C  C     . THR A 1 336 ? 17.093 12.348  -0.098  1.00 43.42 ? 333  THR A C     1 
ATOM   2592 O  O     . THR A 1 336 ? 18.278 12.056  -0.252  1.00 32.38 ? 333  THR A O     1 
ATOM   2593 C  CB    . THR A 1 336 ? 16.384 14.102  1.546   1.00 40.56 ? 333  THR A CB    1 
ATOM   2594 O  OG1   . THR A 1 336 ? 17.579 14.780  1.135   1.00 39.10 ? 333  THR A OG1   1 
ATOM   2595 C  CG2   . THR A 1 336 ? 16.110 14.389  3.028   1.00 34.92 ? 333  THR A CG2   1 
ATOM   2596 N  N     . ARG A 1 337 ? 16.243 12.471  -1.110  1.00 42.67 ? 334  ARG A N     1 
ATOM   2597 C  CA    . ARG A 1 337 ? 16.659 12.240  -2.484  1.00 40.08 ? 334  ARG A CA    1 
ATOM   2598 C  C     . ARG A 1 337 ? 17.602 13.340  -2.949  1.00 39.54 ? 334  ARG A C     1 
ATOM   2599 O  O     . ARG A 1 337 ? 18.557 13.082  -3.685  1.00 40.62 ? 334  ARG A O     1 
ATOM   2600 C  CB    . ARG A 1 337 ? 15.438 12.162  -3.403  1.00 47.09 ? 334  ARG A CB    1 
ATOM   2601 C  CG    . ARG A 1 337 ? 15.778 11.965  -4.871  1.00 50.58 ? 334  ARG A CG    1 
ATOM   2602 C  CD    . ARG A 1 337 ? 14.521 11.856  -5.728  1.00 55.97 ? 334  ARG A CD    1 
ATOM   2603 N  NE    . ARG A 1 337 ? 13.585 12.946  -5.465  1.00 68.21 ? 334  ARG A NE    1 
ATOM   2604 C  CZ    . ARG A 1 337 ? 13.797 14.215  -5.805  1.00 68.18 ? 334  ARG A CZ    1 
ATOM   2605 N  NH1   . ARG A 1 337 ? 14.920 14.562  -6.419  1.00 65.91 ? 334  ARG A NH1   1 
ATOM   2606 N  NH2   . ARG A 1 337 ? 12.887 15.139  -5.524  1.00 72.22 ? 334  ARG A NH2   1 
ATOM   2607 N  N     . GLU A 1 338 ? 17.330 14.568  -2.521  1.00 43.54 ? 335  GLU A N     1 
ATOM   2608 C  CA    . GLU A 1 338 ? 18.185 15.702  -2.855  1.00 41.26 ? 335  GLU A CA    1 
ATOM   2609 C  C     . GLU A 1 338 ? 19.590 15.492  -2.307  1.00 36.17 ? 335  GLU A C     1 
ATOM   2610 O  O     . GLU A 1 338 ? 20.579 15.843  -2.947  1.00 30.83 ? 335  GLU A O     1 
ATOM   2611 C  CB    . GLU A 1 338 ? 17.607 16.997  -2.286  1.00 38.49 ? 335  GLU A CB    1 
ATOM   2612 C  CG    . GLU A 1 338 ? 16.537 17.628  -3.154  1.00 56.96 ? 335  GLU A CG    1 
ATOM   2613 C  CD    . GLU A 1 338 ? 17.091 18.120  -4.476  1.00 63.54 ? 335  GLU A CD    1 
ATOM   2614 O  OE1   . GLU A 1 338 ? 17.324 19.340  -4.604  1.00 68.54 ? 335  GLU A OE1   1 
ATOM   2615 O  OE2   . GLU A 1 338 ? 17.300 17.285  -5.382  1.00 64.58 ? 335  GLU A OE2   1 
ATOM   2616 N  N     . GLN A 1 339 ? 19.668 14.921  -1.112  1.00 38.64 ? 336  GLN A N     1 
ATOM   2617 C  CA    . GLN A 1 339 ? 20.954 14.648  -0.493  1.00 33.27 ? 336  GLN A CA    1 
ATOM   2618 C  C     . GLN A 1 339 ? 21.739 13.631  -1.302  1.00 32.70 ? 336  GLN A C     1 
ATOM   2619 O  O     . GLN A 1 339 ? 22.920 13.830  -1.584  1.00 23.96 ? 336  GLN A O     1 
ATOM   2620 C  CB    . GLN A 1 339 ? 20.765 14.122  0.920   1.00 35.06 ? 336  GLN A CB    1 
ATOM   2621 C  CG    . GLN A 1 339 ? 20.897 15.167  1.989   1.00 30.52 ? 336  GLN A CG    1 
ATOM   2622 C  CD    . GLN A 1 339 ? 21.033 14.536  3.342   1.00 32.05 ? 336  GLN A CD    1 
ATOM   2623 O  OE1   . GLN A 1 339 ? 20.299 13.605  3.678   1.00 31.89 ? 336  GLN A OE1   1 
ATOM   2624 N  NE2   . GLN A 1 339 ? 21.984 15.021  4.127   1.00 30.82 ? 336  GLN A NE2   1 
ATOM   2625 N  N     . VAL A 1 340 ? 21.079 12.537  -1.665  1.00 29.89 ? 337  VAL A N     1 
ATOM   2626 C  CA    . VAL A 1 340 ? 21.736 11.477  -2.415  1.00 29.48 ? 337  VAL A CA    1 
ATOM   2627 C  C     . VAL A 1 340 ? 22.254 12.001  -3.752  1.00 30.28 ? 337  VAL A C     1 
ATOM   2628 O  O     . VAL A 1 340 ? 23.344 11.634  -4.197  1.00 28.85 ? 337  VAL A O     1 
ATOM   2629 C  CB    . VAL A 1 340 ? 20.804 10.279  -2.645  1.00 32.01 ? 337  VAL A CB    1 
ATOM   2630 C  CG1   . VAL A 1 340 ? 21.479 9.245   -3.542  1.00 19.79 ? 337  VAL A CG1   1 
ATOM   2631 C  CG2   . VAL A 1 340 ? 20.410 9.658   -1.314  1.00 28.00 ? 337  VAL A CG2   1 
ATOM   2632 N  N     . GLN A 1 341 ? 21.484 12.881  -4.378  1.00 27.68 ? 338  GLN A N     1 
ATOM   2633 C  CA    . GLN A 1 341 ? 21.841 13.390  -5.693  1.00 29.42 ? 338  GLN A CA    1 
ATOM   2634 C  C     . GLN A 1 341 ? 22.962 14.412  -5.616  1.00 31.48 ? 338  GLN A C     1 
ATOM   2635 O  O     . GLN A 1 341 ? 23.842 14.436  -6.471  1.00 24.93 ? 338  GLN A O     1 
ATOM   2636 C  CB    . GLN A 1 341 ? 20.621 13.979  -6.401  1.00 30.87 ? 338  GLN A CB    1 
ATOM   2637 C  CG    . GLN A 1 341 ? 19.548 12.944  -6.687  1.00 32.97 ? 338  GLN A CG    1 
ATOM   2638 C  CD    . GLN A 1 341 ? 18.338 13.532  -7.380  1.00 44.48 ? 338  GLN A CD    1 
ATOM   2639 O  OE1   . GLN A 1 341 ? 18.182 14.752  -7.467  1.00 46.46 ? 338  GLN A OE1   1 
ATOM   2640 N  NE2   . GLN A 1 341 ? 17.472 12.662  -7.887  1.00 43.02 ? 338  GLN A NE2   1 
ATOM   2641 N  N     . TRP A 1 342 ? 22.935 15.257  -4.593  1.00 25.05 ? 339  TRP A N     1 
ATOM   2642 C  CA    . TRP A 1 342 ? 23.982 16.253  -4.443  1.00 26.73 ? 339  TRP A CA    1 
ATOM   2643 C  C     . TRP A 1 342 ? 25.349 15.593  -4.238  1.00 19.69 ? 339  TRP A C     1 
ATOM   2644 O  O     . TRP A 1 342 ? 26.343 16.014  -4.818  1.00 24.54 ? 339  TRP A O     1 
ATOM   2645 C  CB    . TRP A 1 342 ? 23.672 17.210  -3.293  1.00 24.11 ? 339  TRP A CB    1 
ATOM   2646 C  CG    . TRP A 1 342 ? 24.648 18.339  -3.205  1.00 28.12 ? 339  TRP A CG    1 
ATOM   2647 C  CD1   . TRP A 1 342 ? 24.632 19.502  -3.926  1.00 26.47 ? 339  TRP A CD1   1 
ATOM   2648 C  CD2   . TRP A 1 342 ? 25.796 18.408  -2.358  1.00 26.38 ? 339  TRP A CD2   1 
ATOM   2649 N  NE1   . TRP A 1 342 ? 25.695 20.291  -3.571  1.00 26.15 ? 339  TRP A NE1   1 
ATOM   2650 C  CE2   . TRP A 1 342 ? 26.424 19.644  -2.608  1.00 25.63 ? 339  TRP A CE2   1 
ATOM   2651 C  CE3   . TRP A 1 342 ? 26.352 17.546  -1.409  1.00 23.22 ? 339  TRP A CE3   1 
ATOM   2652 C  CZ2   . TRP A 1 342 ? 27.584 20.039  -1.947  1.00 32.26 ? 339  TRP A CZ2   1 
ATOM   2653 C  CZ3   . TRP A 1 342 ? 27.499 17.938  -0.750  1.00 27.35 ? 339  TRP A CZ3   1 
ATOM   2654 C  CH2   . TRP A 1 342 ? 28.105 19.176  -1.021  1.00 29.50 ? 339  TRP A CH2   1 
ATOM   2655 N  N     . TRP A 1 343 ? 25.391 14.549  -3.421  1.00 21.00 ? 340  TRP A N     1 
ATOM   2656 C  CA    . TRP A 1 343 ? 26.659 13.893  -3.132  1.00 22.42 ? 340  TRP A CA    1 
ATOM   2657 C  C     . TRP A 1 343 ? 27.131 13.016  -4.291  1.00 21.53 ? 340  TRP A C     1 
ATOM   2658 O  O     . TRP A 1 343 ? 28.324 12.932  -4.558  1.00 20.85 ? 340  TRP A O     1 
ATOM   2659 C  CB    . TRP A 1 343 ? 26.578 13.089  -1.838  1.00 20.31 ? 340  TRP A CB    1 
ATOM   2660 C  CG    . TRP A 1 343 ? 26.731 13.931  -0.587  1.00 19.94 ? 340  TRP A CG    1 
ATOM   2661 C  CD1   . TRP A 1 343 ? 25.759 14.235  0.316   1.00 24.65 ? 340  TRP A CD1   1 
ATOM   2662 C  CD2   . TRP A 1 343 ? 27.933 14.564  -0.111  1.00 16.70 ? 340  TRP A CD2   1 
ATOM   2663 N  NE1   . TRP A 1 343 ? 26.274 15.021  1.326   1.00 22.55 ? 340  TRP A NE1   1 
ATOM   2664 C  CE2   . TRP A 1 343 ? 27.607 15.236  1.085   1.00 21.04 ? 340  TRP A CE2   1 
ATOM   2665 C  CE3   . TRP A 1 343 ? 29.248 14.631  -0.584  1.00 18.50 ? 340  TRP A CE3   1 
ATOM   2666 C  CZ2   . TRP A 1 343 ? 28.548 15.960  1.818   1.00 18.81 ? 340  TRP A CZ2   1 
ATOM   2667 C  CZ3   . TRP A 1 343 ? 30.182 15.351  0.148   1.00 17.08 ? 340  TRP A CZ3   1 
ATOM   2668 C  CH2   . TRP A 1 343 ? 29.825 16.006  1.336   1.00 20.29 ? 340  TRP A CH2   1 
ATOM   2669 N  N     . LEU A 1 344 ? 26.204 12.363  -4.984  1.00 21.27 ? 341  LEU A N     1 
ATOM   2670 C  CA    . LEU A 1 344 ? 26.604 11.584  -6.153  1.00 24.98 ? 341  LEU A CA    1 
ATOM   2671 C  C     . LEU A 1 344 ? 27.283 12.527  -7.125  1.00 18.85 ? 341  LEU A C     1 
ATOM   2672 O  O     . LEU A 1 344 ? 28.274 12.176  -7.766  1.00 17.03 ? 341  LEU A O     1 
ATOM   2673 C  CB    . LEU A 1 344 ? 25.412 10.891  -6.823  1.00 20.03 ? 341  LEU A CB    1 
ATOM   2674 C  CG    . LEU A 1 344 ? 24.882 9.609   -6.178  1.00 27.72 ? 341  LEU A CG    1 
ATOM   2675 C  CD1   . LEU A 1 344 ? 23.597 9.170   -6.860  1.00 26.18 ? 341  LEU A CD1   1 
ATOM   2676 C  CD2   . LEU A 1 344 ? 25.929 8.492   -6.211  1.00 25.20 ? 341  LEU A CD2   1 
ATOM   2677 N  N     . LEU A 1 345 ? 26.762 13.747  -7.207  1.00 17.86 ? 342  LEU A N     1 
ATOM   2678 C  CA    . LEU A 1 345 ? 27.339 14.750  -8.080  1.00 19.39 ? 342  LEU A CA    1 
ATOM   2679 C  C     . LEU A 1 345 ? 28.735 15.196  -7.640  1.00 18.08 ? 342  LEU A C     1 
ATOM   2680 O  O     . LEU A 1 345 ? 29.617 15.367  -8.474  1.00 18.05 ? 342  LEU A O     1 
ATOM   2681 C  CB    . LEU A 1 345 ? 26.410 15.963  -8.201  1.00 21.51 ? 342  LEU A CB    1 
ATOM   2682 C  CG    . LEU A 1 345 ? 26.951 17.105  -9.060  1.00 23.44 ? 342  LEU A CG    1 
ATOM   2683 C  CD1   . LEU A 1 345 ? 27.176 16.645  -10.499 1.00 22.07 ? 342  LEU A CD1   1 
ATOM   2684 C  CD2   . LEU A 1 345 ? 26.004 18.298  -9.037  1.00 27.41 ? 342  LEU A CD2   1 
ATOM   2685 N  N     . GLN A 1 346 ? 28.929 15.399  -6.339  1.00 17.28 ? 343  GLN A N     1 
ATOM   2686 C  CA    . GLN A 1 346 ? 30.237 15.812  -5.830  1.00 17.78 ? 343  GLN A CA    1 
ATOM   2687 C  C     . GLN A 1 346 ? 31.265 14.744  -6.183  1.00 16.76 ? 343  GLN A C     1 
ATOM   2688 O  O     . GLN A 1 346 ? 32.367 15.047  -6.646  1.00 14.24 ? 343  GLN A O     1 
ATOM   2689 C  CB    . GLN A 1 346 ? 30.216 16.004  -4.306  1.00 20.76 ? 343  GLN A CB    1 
ATOM   2690 C  CG    . GLN A 1 346 ? 29.243 17.068  -3.803  1.00 17.96 ? 343  GLN A CG    1 
ATOM   2691 C  CD    . GLN A 1 346 ? 29.205 18.296  -4.683  1.00 21.72 ? 343  GLN A CD    1 
ATOM   2692 O  OE1   . GLN A 1 346 ? 30.161 19.079  -4.742  1.00 23.39 ? 343  GLN A OE1   1 
ATOM   2693 N  NE2   . GLN A 1 346 ? 28.090 18.476  -5.379  1.00 24.38 ? 343  GLN A NE2   1 
ATOM   2694 N  N     . LEU A 1 347 ? 30.886 13.496  -5.947  1.00 18.96 ? 344  LEU A N     1 
ATOM   2695 C  CA    . LEU A 1 347 ? 31.752 12.362  -6.246  1.00 21.38 ? 344  LEU A CA    1 
ATOM   2696 C  C     . LEU A 1 347 ? 32.043 12.261  -7.735  1.00 16.87 ? 344  LEU A C     1 
ATOM   2697 O  O     . LEU A 1 347 ? 33.179 11.998  -8.141  1.00 18.68 ? 344  LEU A O     1 
ATOM   2698 C  CB    . LEU A 1 347 ? 31.121 11.061  -5.757  1.00 13.08 ? 344  LEU A CB    1 
ATOM   2699 C  CG    . LEU A 1 347 ? 31.243 10.753  -4.266  1.00 17.40 ? 344  LEU A CG    1 
ATOM   2700 C  CD1   . LEU A 1 347 ? 30.457 9.495   -3.937  1.00 22.36 ? 344  LEU A CD1   1 
ATOM   2701 C  CD2   . LEU A 1 347 ? 32.684 10.570  -3.910  1.00 25.44 ? 344  LEU A CD2   1 
ATOM   2702 N  N     . ALA A 1 348 ? 31.005 12.449  -8.539  1.00 16.21 ? 345  ALA A N     1 
ATOM   2703 C  CA    . ALA A 1 348 ? 31.122 12.362  -9.990  1.00 17.25 ? 345  ALA A CA    1 
ATOM   2704 C  C     . ALA A 1 348 ? 32.023 13.445  -10.536 1.00 17.34 ? 345  ALA A C     1 
ATOM   2705 O  O     . ALA A 1 348 ? 32.719 13.233  -11.528 1.00 14.63 ? 345  ALA A O     1 
ATOM   2706 C  CB    . ALA A 1 348 ? 29.744 12.449  -10.648 1.00 15.84 ? 345  ALA A CB    1 
ATOM   2707 N  N     . GLN A 1 349 ? 31.996 14.613  -9.898  1.00 16.93 ? 346  GLN A N     1 
ATOM   2708 C  CA    . GLN A 1 349 ? 32.841 15.728  -10.303 1.00 14.35 ? 346  GLN A CA    1 
ATOM   2709 C  C     . GLN A 1 349 ? 34.307 15.470  -9.995  1.00 19.89 ? 346  GLN A C     1 
ATOM   2710 O  O     . GLN A 1 349 ? 35.179 15.836  -10.775 1.00 14.68 ? 346  GLN A O     1 
ATOM   2711 C  CB    . GLN A 1 349 ? 32.370 17.033  -9.653  1.00 17.13 ? 346  GLN A CB    1 
ATOM   2712 C  CG    . GLN A 1 349 ? 31.101 17.585  -10.323 1.00 20.14 ? 346  GLN A CG    1 
ATOM   2713 C  CD    . GLN A 1 349 ? 30.613 18.903  -9.734  1.00 31.32 ? 346  GLN A CD    1 
ATOM   2714 O  OE1   . GLN A 1 349 ? 31.132 19.391  -8.728  1.00 29.15 ? 346  GLN A OE1   1 
ATOM   2715 N  NE2   . GLN A 1 349 ? 29.604 19.485  -10.369 1.00 32.41 ? 346  GLN A NE2   1 
ATOM   2716 N  N     . GLU A 1 350 ? 34.588 14.842  -8.862  1.00 14.42 ? 347  GLU A N     1 
ATOM   2717 C  CA    . GLU A 1 350 ? 35.979 14.532  -8.566  1.00 16.21 ? 347  GLU A CA    1 
ATOM   2718 C  C     . GLU A 1 350 ? 36.441 13.460  -9.536  1.00 13.51 ? 347  GLU A C     1 
ATOM   2719 O  O     . GLU A 1 350 ? 37.546 13.541  -10.056 1.00 13.98 ? 347  GLU A O     1 
ATOM   2720 C  CB    . GLU A 1 350 ? 36.198 14.082  -7.120  1.00 15.71 ? 347  GLU A CB    1 
ATOM   2721 C  CG    . GLU A 1 350 ? 37.677 13.782  -6.832  1.00 19.65 ? 347  GLU A CG    1 
ATOM   2722 C  CD    . GLU A 1 350 ? 37.914 13.101  -5.492  1.00 23.00 ? 347  GLU A CD    1 
ATOM   2723 O  OE1   . GLU A 1 350 ? 37.223 13.432  -4.502  1.00 22.08 ? 347  GLU A OE1   1 
ATOM   2724 O  OE2   . GLU A 1 350 ? 38.796 12.225  -5.434  1.00 18.74 ? 347  GLU A OE2   1 
ATOM   2725 N  N     . LEU A 1 351 ? 35.570 12.485  -9.787  1.00 12.63 ? 348  LEU A N     1 
ATOM   2726 C  CA    . LEU A 1 351 ? 35.879 11.363  -10.675 1.00 14.92 ? 348  LEU A CA    1 
ATOM   2727 C  C     . LEU A 1 351 ? 36.140 11.862  -12.097 1.00 19.06 ? 348  LEU A C     1 
ATOM   2728 O  O     . LEU A 1 351 ? 37.097 11.441  -12.740 1.00 12.84 ? 348  LEU A O     1 
ATOM   2729 C  CB    . LEU A 1 351 ? 34.741 10.339  -10.672 1.00 17.40 ? 348  LEU A CB    1 
ATOM   2730 C  CG    . LEU A 1 351 ? 34.993 9.023   -11.430 1.00 16.91 ? 348  LEU A CG    1 
ATOM   2731 C  CD1   . LEU A 1 351 ? 36.207 8.295   -10.846 1.00 19.98 ? 348  LEU A CD1   1 
ATOM   2732 C  CD2   . LEU A 1 351 ? 33.764 8.112   -11.404 1.00 20.34 ? 348  LEU A CD2   1 
ATOM   2733 N  N     . GLU A 1 352 ? 35.292 12.766  -12.584 1.00 13.85 ? 349  GLU A N     1 
ATOM   2734 C  CA    . GLU A 1 352 ? 35.492 13.355  -13.906 1.00 14.87 ? 349  GLU A CA    1 
ATOM   2735 C  C     . GLU A 1 352 ? 36.847 14.026  -14.019 1.00 15.88 ? 349  GLU A C     1 
ATOM   2736 O  O     . GLU A 1 352 ? 37.537 13.894  -15.033 1.00 15.52 ? 349  GLU A O     1 
ATOM   2737 C  CB    . GLU A 1 352 ? 34.398 14.384  -14.247 1.00 14.19 ? 349  GLU A CB    1 
ATOM   2738 C  CG    . GLU A 1 352 ? 34.625 15.009  -15.626 1.00 23.38 ? 349  GLU A CG    1 
ATOM   2739 C  CD    . GLU A 1 352 ? 33.620 16.093  -15.992 1.00 39.72 ? 349  GLU A CD    1 
ATOM   2740 O  OE1   . GLU A 1 352 ? 33.948 16.914  -16.878 1.00 41.56 ? 349  GLU A OE1   1 
ATOM   2741 O  OE2   . GLU A 1 352 ? 32.505 16.118  -15.417 1.00 35.42 ? 349  GLU A OE2   1 
ATOM   2742 N  N     . GLU A 1 353 ? 37.228 14.761  -12.978 1.00 17.44 ? 350  GLU A N     1 
ATOM   2743 C  CA    . GLU A 1 353 ? 38.504 15.465  -12.981 1.00 18.06 ? 350  GLU A CA    1 
ATOM   2744 C  C     . GLU A 1 353 ? 39.670 14.475  -13.047 1.00 17.52 ? 350  GLU A C     1 
ATOM   2745 O  O     . GLU A 1 353 ? 40.604 14.634  -13.827 1.00 17.78 ? 350  GLU A O     1 
ATOM   2746 C  CB    . GLU A 1 353 ? 38.624 16.329  -11.729 1.00 23.26 ? 350  GLU A CB    1 
ATOM   2747 C  CG    . GLU A 1 353 ? 39.830 17.254  -11.719 1.00 29.00 ? 350  GLU A CG    1 
ATOM   2748 C  CD    . GLU A 1 353 ? 39.668 18.374  -10.706 1.00 39.06 ? 350  GLU A CD    1 
ATOM   2749 O  OE1   . GLU A 1 353 ? 39.248 18.082  -9.569  1.00 39.12 ? 350  GLU A OE1   1 
ATOM   2750 O  OE2   . GLU A 1 353 ? 39.931 19.546  -11.053 1.00 47.54 ? 350  GLU A OE2   1 
ATOM   2751 N  N     . ARG A 1 354 ? 39.611 13.441  -12.223 1.00 16.05 ? 351  ARG A N     1 
ATOM   2752 C  CA    . ARG A 1 354 ? 40.685 12.457  -12.222 1.00 19.29 ? 351  ARG A CA    1 
ATOM   2753 C  C     . ARG A 1 354 ? 40.738 11.658  -13.521 1.00 15.19 ? 351  ARG A C     1 
ATOM   2754 O  O     . ARG A 1 354 ? 41.817 11.378  -14.021 1.00 12.74 ? 351  ARG A O     1 
ATOM   2755 C  CB    . ARG A 1 354 ? 40.585 11.545  -11.000 1.00 16.02 ? 351  ARG A CB    1 
ATOM   2756 C  CG    . ARG A 1 354 ? 40.998 12.257  -9.718  1.00 16.45 ? 351  ARG A CG    1 
ATOM   2757 C  CD    . ARG A 1 354 ? 40.537 11.500  -8.495  1.00 17.46 ? 351  ARG A CD    1 
ATOM   2758 N  NE    . ARG A 1 354 ? 41.061 10.143  -8.454  1.00 17.79 ? 351  ARG A NE    1 
ATOM   2759 C  CZ    . ARG A 1 354 ? 40.667 9.232   -7.567  1.00 21.77 ? 351  ARG A CZ    1 
ATOM   2760 N  NH1   . ARG A 1 354 ? 39.740 9.546   -6.660  1.00 20.51 ? 351  ARG A NH1   1 
ATOM   2761 N  NH2   . ARG A 1 354 ? 41.186 8.013   -7.591  1.00 14.99 ? 351  ARG A NH2   1 
ATOM   2762 N  N     . LEU A 1 355 ? 39.575 11.296  -14.061 1.00 13.29 ? 352  LEU A N     1 
ATOM   2763 C  CA    . LEU A 1 355 ? 39.503 10.553  -15.319 1.00 15.08 ? 352  LEU A CA    1 
ATOM   2764 C  C     . LEU A 1 355 ? 40.050 11.363  -16.497 1.00 19.30 ? 352  LEU A C     1 
ATOM   2765 O  O     . LEU A 1 355 ? 40.779 10.842  -17.342 1.00 16.01 ? 352  LEU A O     1 
ATOM   2766 C  CB    . LEU A 1 355 ? 38.063 10.124  -15.616 1.00 12.18 ? 352  LEU A CB    1 
ATOM   2767 C  CG    . LEU A 1 355 ? 37.523 8.941   -14.817 1.00 16.81 ? 352  LEU A CG    1 
ATOM   2768 C  CD1   . LEU A 1 355 ? 36.045 8.722   -15.080 1.00 15.31 ? 352  LEU A CD1   1 
ATOM   2769 C  CD2   . LEU A 1 355 ? 38.313 7.693   -15.178 1.00 19.23 ? 352  LEU A CD2   1 
ATOM   2770 N  N     . THR A 1 356 ? 39.675 12.634  -16.577 1.00 14.97 ? 353  THR A N     1 
ATOM   2771 C  CA    . THR A 1 356 ? 40.155 13.464  -17.672 1.00 15.94 ? 353  THR A CA    1 
ATOM   2772 C  C     . THR A 1 356 ? 41.683 13.565  -17.637 1.00 19.25 ? 353  THR A C     1 
ATOM   2773 O  O     . THR A 1 356 ? 42.357 13.407  -18.661 1.00 18.09 ? 353  THR A O     1 
ATOM   2774 C  CB    . THR A 1 356 ? 39.512 14.855  -17.649 1.00 19.52 ? 353  THR A CB    1 
ATOM   2775 O  OG1   . THR A 1 356 ? 38.107 14.714  -17.860 1.00 19.47 ? 353  THR A OG1   1 
ATOM   2776 C  CG2   . THR A 1 356 ? 40.080 15.714  -18.749 1.00 20.71 ? 353  THR A CG2   1 
ATOM   2777 N  N     . LYS A 1 357 ? 42.237 13.802  -16.455 1.00 20.89 ? 354  LYS A N     1 
ATOM   2778 C  CA    . LYS A 1 357 ? 43.687 13.870  -16.326 1.00 18.15 ? 354  LYS A CA    1 
ATOM   2779 C  C     . LYS A 1 357 ? 44.313 12.526  -16.671 1.00 19.18 ? 354  LYS A C     1 
ATOM   2780 O  O     . LYS A 1 357 ? 45.359 12.475  -17.317 1.00 17.66 ? 354  LYS A O     1 
ATOM   2781 C  CB    . LYS A 1 357 ? 44.111 14.304  -14.924 1.00 21.64 ? 354  LYS A CB    1 
ATOM   2782 C  CG    . LYS A 1 357 ? 45.625 14.336  -14.737 1.00 30.48 ? 354  LYS A CG    1 
ATOM   2783 C  CD    . LYS A 1 357 ? 46.019 15.238  -13.573 1.00 40.26 ? 354  LYS A CD    1 
ATOM   2784 C  CE    . LYS A 1 357 ? 47.234 16.098  -13.919 1.00 45.07 ? 354  LYS A CE    1 
ATOM   2785 N  NZ    . LYS A 1 357 ? 48.425 15.267  -14.256 1.00 40.43 ? 354  LYS A NZ    1 
ATOM   2786 N  N     . ASP A 1 358 ? 43.661 11.437  -16.262 1.00 15.54 ? 355  ASP A N     1 
ATOM   2787 C  CA    . ASP A 1 358 ? 44.189 10.100  -16.552 1.00 18.73 ? 355  ASP A CA    1 
ATOM   2788 C  C     . ASP A 1 358 ? 44.265 9.865   -18.051 1.00 21.95 ? 355  ASP A C     1 
ATOM   2789 O  O     . ASP A 1 358 ? 45.261 9.348   -18.546 1.00 22.99 ? 355  ASP A O     1 
ATOM   2790 C  CB    . ASP A 1 358 ? 43.353 8.995   -15.896 1.00 15.58 ? 355  ASP A CB    1 
ATOM   2791 C  CG    . ASP A 1 358 ? 43.911 7.601   -16.170 1.00 23.75 ? 355  ASP A CG    1 
ATOM   2792 O  OD1   . ASP A 1 358 ? 44.898 7.213   -15.507 1.00 21.93 ? 355  ASP A OD1   1 
ATOM   2793 O  OD2   . ASP A 1 358 ? 43.374 6.894   -17.049 1.00 21.81 ? 355  ASP A OD2   1 
ATOM   2794 N  N     . ARG A 1 359 ? 43.208 10.238  -18.768 1.00 15.21 ? 356  ARG A N     1 
ATOM   2795 C  CA    . ARG A 1 359 ? 43.155 10.048  -20.216 1.00 18.34 ? 356  ARG A CA    1 
ATOM   2796 C  C     . ARG A 1 359 ? 44.296 10.790  -20.910 1.00 19.80 ? 356  ARG A C     1 
ATOM   2797 O  O     . ARG A 1 359 ? 44.932 10.254  -21.803 1.00 19.86 ? 356  ARG A O     1 
ATOM   2798 C  CB    . ARG A 1 359 ? 41.797 10.512  -20.773 1.00 21.06 ? 356  ARG A CB    1 
ATOM   2799 C  CG    . ARG A 1 359 ? 41.515 10.097  -22.224 1.00 21.23 ? 356  ARG A CG    1 
ATOM   2800 C  CD    . ARG A 1 359 ? 40.147 10.617  -22.694 1.00 20.41 ? 356  ARG A CD    1 
ATOM   2801 N  NE    . ARG A 1 359 ? 40.058 12.073  -22.562 1.00 21.98 ? 356  ARG A NE    1 
ATOM   2802 C  CZ    . ARG A 1 359 ? 38.929 12.751  -22.352 1.00 28.12 ? 356  ARG A CZ    1 
ATOM   2803 N  NH1   . ARG A 1 359 ? 37.771 12.112  -22.243 1.00 26.19 ? 356  ARG A NH1   1 
ATOM   2804 N  NH2   . ARG A 1 359 ? 38.961 14.077  -22.249 1.00 29.66 ? 356  ARG A NH2   1 
ATOM   2805 N  N     . ASN A 1 360 ? 44.552 12.021  -20.481 1.00 19.29 ? 357  ASN A N     1 
ATOM   2806 C  CA    . ASN A 1 360 ? 45.629 12.836  -21.042 1.00 19.60 ? 357  ASN A CA    1 
ATOM   2807 C  C     . ASN A 1 360 ? 47.045 12.306  -20.757 1.00 25.85 ? 357  ASN A C     1 
ATOM   2808 O  O     . ASN A 1 360 ? 47.912 12.352  -21.629 1.00 23.21 ? 357  ASN A O     1 
ATOM   2809 C  CB    . ASN A 1 360 ? 45.519 14.278  -20.548 1.00 22.92 ? 357  ASN A CB    1 
ATOM   2810 C  CG    . ASN A 1 360 ? 44.406 15.044  -21.234 1.00 26.72 ? 357  ASN A CG    1 
ATOM   2811 O  OD1   . ASN A 1 360 ? 44.081 14.792  -22.396 1.00 24.97 ? 357  ASN A OD1   1 
ATOM   2812 N  ND2   . ASN A 1 360 ? 43.818 15.987  -20.518 1.00 23.18 ? 357  ASN A ND2   1 
ATOM   2813 N  N     . ASP A 1 361 ? 47.284 11.826  -19.536 1.00 20.58 ? 358  ASP A N     1 
ATOM   2814 C  CA    . ASP A 1 361 ? 48.623 11.371  -19.157 1.00 23.35 ? 358  ASP A CA    1 
ATOM   2815 C  C     . ASP A 1 361 ? 48.939 9.972   -19.673 1.00 23.12 ? 358  ASP A C     1 
ATOM   2816 O  O     . ASP A 1 361 ? 50.086 9.665   -19.997 1.00 21.04 ? 358  ASP A O     1 
ATOM   2817 C  CB    . ASP A 1 361 ? 48.791 11.346  -17.630 1.00 26.19 ? 358  ASP A CB    1 
ATOM   2818 C  CG    . ASP A 1 361 ? 48.725 12.725  -17.003 1.00 32.65 ? 358  ASP A CG    1 
ATOM   2819 O  OD1   . ASP A 1 361 ? 48.902 13.724  -17.731 1.00 28.05 ? 358  ASP A OD1   1 
ATOM   2820 O  OD2   . ASP A 1 361 ? 48.500 12.802  -15.775 1.00 33.46 ? 358  ASP A OD2   1 
ATOM   2821 N  N     . ASN A 1 362 ? 47.919 9.123   -19.729 1.00 17.17 ? 359  ASN A N     1 
ATOM   2822 C  CA    . ASN A 1 362 ? 48.144 7.686   -19.853 1.00 22.35 ? 359  ASN A CA    1 
ATOM   2823 C  C     . ASN A 1 362 ? 47.512 7.035   -21.085 1.00 20.28 ? 359  ASN A C     1 
ATOM   2824 O  O     . ASN A 1 362 ? 47.620 5.829   -21.273 1.00 18.44 ? 359  ASN A O     1 
ATOM   2825 C  CB    . ASN A 1 362 ? 47.695 6.974   -18.563 1.00 18.98 ? 359  ASN A CB    1 
ATOM   2826 C  CG    . ASN A 1 362 ? 48.470 7.451   -17.331 1.00 21.25 ? 359  ASN A CG    1 
ATOM   2827 O  OD1   . ASN A 1 362 ? 49.684 7.641   -17.382 1.00 18.13 ? 359  ASN A OD1   1 
ATOM   2828 N  ND2   . ASN A 1 362 ? 47.766 7.632   -16.218 1.00 18.35 ? 359  ASN A ND2   1 
ATOM   2829 N  N     . ASP A 1 363 ? 46.842 7.827   -21.916 1.00 21.07 ? 360  ASP A N     1 
ATOM   2830 C  CA    . ASP A 1 363 ? 46.314 7.314   -23.180 1.00 18.43 ? 360  ASP A CA    1 
ATOM   2831 C  C     . ASP A 1 363 ? 45.401 6.123   -22.996 1.00 25.40 ? 360  ASP A C     1 
ATOM   2832 O  O     . ASP A 1 363 ? 45.604 5.084   -23.624 1.00 26.36 ? 360  ASP A O     1 
ATOM   2833 C  CB    . ASP A 1 363 ? 47.458 6.900   -24.112 1.00 28.46 ? 360  ASP A CB    1 
ATOM   2834 C  CG    . ASP A 1 363 ? 48.368 8.057   -24.467 1.00 32.09 ? 360  ASP A CG    1 
ATOM   2835 O  OD1   . ASP A 1 363 ? 47.853 9.160   -24.731 1.00 27.86 ? 360  ASP A OD1   1 
ATOM   2836 O  OD2   . ASP A 1 363 ? 49.599 7.859   -24.479 1.00 35.19 ? 360  ASP A OD2   1 
ATOM   2837 N  N     . ARG A 1 364 ? 44.397 6.270   -22.134 1.00 24.65 ? 361  ARG A N     1 
ATOM   2838 C  CA    . ARG A 1 364 ? 43.397 5.224   -21.932 1.00 22.32 ? 361  ARG A CA    1 
ATOM   2839 C  C     . ARG A 1 364 ? 42.077 5.847   -21.509 1.00 20.35 ? 361  ARG A C     1 
ATOM   2840 O  O     . ARG A 1 364 ? 42.036 7.000   -21.071 1.00 20.72 ? 361  ARG A O     1 
ATOM   2841 C  CB    . ARG A 1 364 ? 43.868 4.213   -20.882 1.00 22.53 ? 361  ARG A CB    1 
ATOM   2842 C  CG    . ARG A 1 364 ? 44.188 4.835   -19.531 1.00 21.57 ? 361  ARG A CG    1 
ATOM   2843 C  CD    . ARG A 1 364 ? 44.592 3.782   -18.504 1.00 20.85 ? 361  ARG A CD    1 
ATOM   2844 N  NE    . ARG A 1 364 ? 44.699 4.363   -17.167 1.00 21.59 ? 361  ARG A NE    1 
ATOM   2845 C  CZ    . ARG A 1 364 ? 44.987 3.670   -16.069 1.00 24.26 ? 361  ARG A CZ    1 
ATOM   2846 N  NH1   . ARG A 1 364 ? 45.066 4.288   -14.891 1.00 18.35 ? 361  ARG A NH1   1 
ATOM   2847 N  NH2   . ARG A 1 364 ? 45.208 2.368   -16.153 1.00 18.97 ? 361  ARG A NH2   1 
ATOM   2848 N  N     . VAL A 1 365 ? 41.000 5.086   -21.652 1.00 21.77 ? 362  VAL A N     1 
ATOM   2849 C  CA    . VAL A 1 365 ? 39.674 5.533   -21.243 1.00 28.18 ? 362  VAL A CA    1 
ATOM   2850 C  C     . VAL A 1 365 ? 38.955 4.423   -20.487 1.00 28.05 ? 362  VAL A C     1 
ATOM   2851 O  O     . VAL A 1 365 ? 38.968 3.267   -20.911 1.00 23.70 ? 362  VAL A O     1 
ATOM   2852 C  CB    . VAL A 1 365 ? 38.816 5.920   -22.456 1.00 25.37 ? 362  VAL A CB    1 
ATOM   2853 C  CG1   . VAL A 1 365 ? 39.331 7.213   -23.075 1.00 30.96 ? 362  VAL A CG1   1 
ATOM   2854 C  CG2   . VAL A 1 365 ? 38.817 4.796   -23.480 1.00 35.00 ? 362  VAL A CG2   1 
ATOM   2855 N  N     . ALA A 1 366 ? 38.330 4.771   -19.366 1.00 19.70 ? 363  ALA A N     1 
ATOM   2856 C  CA    . ALA A 1 366 ? 37.517 3.808   -18.628 1.00 20.56 ? 363  ALA A CA    1 
ATOM   2857 C  C     . ALA A 1 366 ? 36.211 3.534   -19.375 1.00 26.03 ? 363  ALA A C     1 
ATOM   2858 O  O     . ALA A 1 366 ? 35.652 4.433   -20.022 1.00 25.14 ? 363  ALA A O     1 
ATOM   2859 C  CB    . ALA A 1 366 ? 37.218 4.334   -17.239 1.00 17.59 ? 363  ALA A CB    1 
ATOM   2860 N  N     . THR A 1 367 ? 35.696 2.312   -19.277 1.00 19.20 ? 364  THR A N     1 
ATOM   2861 C  CA    . THR A 1 367 ? 34.473 2.006   -20.017 1.00 22.08 ? 364  THR A CA    1 
ATOM   2862 C  C     . THR A 1 367 ? 33.318 1.498   -19.168 1.00 22.54 ? 364  THR A C     1 
ATOM   2863 O  O     . THR A 1 367 ? 32.210 1.302   -19.677 1.00 20.60 ? 364  THR A O     1 
ATOM   2864 C  CB    . THR A 1 367 ? 34.742 0.992   -21.147 1.00 22.83 ? 364  THR A CB    1 
ATOM   2865 O  OG1   . THR A 1 367 ? 35.053 -0.287  -20.577 1.00 21.82 ? 364  THR A OG1   1 
ATOM   2866 C  CG2   . THR A 1 367 ? 35.906 1.464   -22.004 1.00 27.01 ? 364  THR A CG2   1 
ATOM   2867 N  N     . GLN A 1 368 ? 33.578 1.257   -17.886 1.00 21.99 ? 365  GLN A N     1 
ATOM   2868 C  CA    . GLN A 1 368 ? 32.536 0.799   -16.975 1.00 24.04 ? 365  GLN A CA    1 
ATOM   2869 C  C     . GLN A 1 368 ? 32.507 1.683   -15.732 1.00 20.96 ? 365  GLN A C     1 
ATOM   2870 O  O     . GLN A 1 368 ? 33.551 2.079   -15.217 1.00 20.06 ? 365  GLN A O     1 
ATOM   2871 C  CB    . GLN A 1 368 ? 32.755 -0.659  -16.580 1.00 24.60 ? 365  GLN A CB    1 
ATOM   2872 C  CG    . GLN A 1 368 ? 31.592 -1.271  -15.814 1.00 31.96 ? 365  GLN A CG    1 
ATOM   2873 C  CD    . GLN A 1 368 ? 31.718 -2.777  -15.646 1.00 35.12 ? 365  GLN A CD    1 
ATOM   2874 O  OE1   . GLN A 1 368 ? 32.569 -3.263  -14.900 1.00 46.23 ? 365  GLN A OE1   1 
ATOM   2875 N  NE2   . GLN A 1 368 ? 30.866 -3.522  -16.338 1.00 41.64 ? 365  GLN A NE2   1 
ATOM   2876 N  N     . LEU A 1 369 ? 31.303 2.012   -15.281 1.00 21.82 ? 366  LEU A N     1 
ATOM   2877 C  CA    . LEU A 1 369 ? 31.111 2.747   -14.031 1.00 25.65 ? 366  LEU A CA    1 
ATOM   2878 C  C     . LEU A 1 369 ? 30.465 1.803   -13.034 1.00 20.40 ? 366  LEU A C     1 
ATOM   2879 O  O     . LEU A 1 369 ? 29.399 1.252   -13.291 1.00 24.29 ? 366  LEU A O     1 
ATOM   2880 C  CB    . LEU A 1 369 ? 30.209 3.969   -14.237 1.00 22.11 ? 366  LEU A CB    1 
ATOM   2881 C  CG    . LEU A 1 369 ? 29.923 4.812   -12.988 1.00 21.45 ? 366  LEU A CG    1 
ATOM   2882 C  CD1   . LEU A 1 369 ? 31.193 5.551   -12.544 1.00 20.49 ? 366  LEU A CD1   1 
ATOM   2883 C  CD2   . LEU A 1 369 ? 28.783 5.796   -13.235 1.00 24.50 ? 366  LEU A CD2   1 
ATOM   2884 N  N     . VAL A 1 370 ? 31.122 1.606   -11.902 1.00 17.51 ? 367  VAL A N     1 
ATOM   2885 C  CA    . VAL A 1 370 ? 30.592 0.763   -10.843 1.00 17.86 ? 367  VAL A CA    1 
ATOM   2886 C  C     . VAL A 1 370 ? 30.057 1.641   -9.716  1.00 23.30 ? 367  VAL A C     1 
ATOM   2887 O  O     . VAL A 1 370 ? 30.741 2.552   -9.266  1.00 20.69 ? 367  VAL A O     1 
ATOM   2888 C  CB    . VAL A 1 370 ? 31.702 -0.154  -10.301 1.00 19.03 ? 367  VAL A CB    1 
ATOM   2889 C  CG1   . VAL A 1 370 ? 31.227 -0.916  -9.068  1.00 21.70 ? 367  VAL A CG1   1 
ATOM   2890 C  CG2   . VAL A 1 370 ? 32.168 -1.103  -11.402 1.00 21.32 ? 367  VAL A CG2   1 
ATOM   2891 N  N     . VAL A 1 371 ? 28.830 1.370   -9.277  1.00 21.49 ? 368  VAL A N     1 
ATOM   2892 C  CA    . VAL A 1 371 ? 28.174 2.187   -8.268  1.00 20.11 ? 368  VAL A CA    1 
ATOM   2893 C  C     . VAL A 1 371 ? 27.874 1.307   -7.079  1.00 22.85 ? 368  VAL A C     1 
ATOM   2894 O  O     . VAL A 1 371 ? 27.273 0.241   -7.223  1.00 23.57 ? 368  VAL A O     1 
ATOM   2895 C  CB    . VAL A 1 371 ? 26.850 2.789   -8.784  1.00 24.64 ? 368  VAL A CB    1 
ATOM   2896 C  CG1   . VAL A 1 371 ? 26.248 3.734   -7.736  1.00 24.14 ? 368  VAL A CG1   1 
ATOM   2897 C  CG2   . VAL A 1 371 ? 27.077 3.521   -10.095 1.00 19.86 ? 368  VAL A CG2   1 
ATOM   2898 N  N     . SER A 1 372 ? 28.306 1.743   -5.902  1.00 23.56 ? 369  SER A N     1 
ATOM   2899 C  CA    . SER A 1 372 ? 28.144 0.950   -4.697  1.00 20.89 ? 369  SER A CA    1 
ATOM   2900 C  C     . SER A 1 372 ? 27.614 1.814   -3.556  1.00 21.43 ? 369  SER A C     1 
ATOM   2901 O  O     . SER A 1 372 ? 27.971 2.983   -3.434  1.00 20.75 ? 369  SER A O     1 
ATOM   2902 C  CB    . SER A 1 372 ? 29.480 0.312   -4.311  1.00 24.30 ? 369  SER A CB    1 
ATOM   2903 O  OG    . SER A 1 372 ? 29.362 -0.435  -3.118  1.00 33.33 ? 369  SER A OG    1 
ATOM   2904 N  N     . ILE A 1 373 ? 26.741 1.242   -2.734  1.00 20.86 ? 370  ILE A N     1 
ATOM   2905 C  CA    . ILE A 1 373 ? 26.195 1.963   -1.592  1.00 24.78 ? 370  ILE A CA    1 
ATOM   2906 C  C     . ILE A 1 373 ? 26.123 1.060   -0.374  1.00 29.40 ? 370  ILE A C     1 
ATOM   2907 O  O     . ILE A 1 373 ? 26.114 -0.166  -0.497  1.00 26.76 ? 370  ILE A O     1 
ATOM   2908 C  CB    . ILE A 1 373 ? 24.784 2.536   -1.862  1.00 25.44 ? 370  ILE A CB    1 
ATOM   2909 C  CG1   . ILE A 1 373 ? 23.755 1.409   -1.979  1.00 26.85 ? 370  ILE A CG1   1 
ATOM   2910 C  CG2   . ILE A 1 373 ? 24.785 3.455   -3.076  1.00 18.12 ? 370  ILE A CG2   1 
ATOM   2911 C  CD1   . ILE A 1 373 ? 22.374 1.895   -2.332  1.00 30.71 ? 370  ILE A CD1   1 
ATOM   2912 N  N     . ARG A 1 374 ? 26.091 1.675   0.804   1.00 26.76 ? 371  ARG A N     1 
ATOM   2913 C  CA    . ARG A 1 374 ? 25.849 0.935   2.030   1.00 28.18 ? 371  ARG A CA    1 
ATOM   2914 C  C     . ARG A 1 374 ? 24.585 1.511   2.636   1.00 33.74 ? 371  ARG A C     1 
ATOM   2915 O  O     . ARG A 1 374 ? 24.308 2.702   2.483   1.00 26.66 ? 371  ARG A O     1 
ATOM   2916 C  CB    . ARG A 1 374 ? 27.029 1.038   3.002   1.00 31.06 ? 371  ARG A CB    1 
ATOM   2917 C  CG    . ARG A 1 374 ? 26.949 0.070   4.190   1.00 32.27 ? 371  ARG A CG    1 
ATOM   2918 C  CD    . ARG A 1 374 ? 28.245 0.018   4.995   1.00 44.32 ? 371  ARG A CD    1 
ATOM   2919 N  NE    . ARG A 1 374 ? 28.537 1.281   5.668   1.00 53.00 ? 371  ARG A NE    1 
ATOM   2920 C  CZ    . ARG A 1 374 ? 29.689 1.942   5.566   1.00 48.97 ? 371  ARG A CZ    1 
ATOM   2921 N  NH1   . ARG A 1 374 ? 30.670 1.454   4.813   1.00 50.41 ? 371  ARG A NH1   1 
ATOM   2922 N  NH2   . ARG A 1 374 ? 29.857 3.094   6.216   1.00 42.55 ? 371  ARG A NH2   1 
ATOM   2923 N  N     . VAL A 1 375 ? 23.795 0.655   3.276   1.00 33.91 ? 372  VAL A N     1 
ATOM   2924 C  CA    . VAL A 1 375 ? 22.571 1.099   3.928   1.00 39.32 ? 372  VAL A CA    1 
ATOM   2925 C  C     . VAL A 1 375 ? 22.669 0.909   5.433   1.00 29.92 ? 372  VAL A C     1 
ATOM   2926 O  O     . VAL A 1 375 ? 23.287 -0.042  5.915   1.00 34.57 ? 372  VAL A O     1 
ATOM   2927 C  CB    . VAL A 1 375 ? 21.326 0.379   3.384   1.00 42.04 ? 372  VAL A CB    1 
ATOM   2928 C  CG1   . VAL A 1 375 ? 20.849 1.039   2.097   1.00 39.92 ? 372  VAL A CG1   1 
ATOM   2929 C  CG2   . VAL A 1 375 ? 21.622 -1.092  3.175   1.00 43.29 ? 372  VAL A CG2   1 
ATOM   2930 N  N     . GLN A 1 376 ? 22.075 1.838   6.168   1.00 34.41 ? 373  GLN A N     1 
ATOM   2931 C  CA    . GLN A 1 376 ? 22.132 1.822   7.620   1.00 37.40 ? 373  GLN A CA    1 
ATOM   2932 C  C     . GLN A 1 376 ? 21.755 0.455   8.173   1.00 39.14 ? 373  GLN A C     1 
ATOM   2933 O  O     . GLN A 1 376 ? 20.655 -0.030  7.933   1.00 42.00 ? 373  GLN A O     1 
ATOM   2934 C  CB    . GLN A 1 376 ? 21.195 2.894   8.175   1.00 36.68 ? 373  GLN A CB    1 
ATOM   2935 C  CG    . GLN A 1 376 ? 21.516 3.336   9.591   1.00 42.83 ? 373  GLN A CG    1 
ATOM   2936 C  CD    . GLN A 1 376 ? 20.938 4.700   9.902   1.00 45.74 ? 373  GLN A CD    1 
ATOM   2937 O  OE1   . GLN A 1 376 ? 19.725 4.908   9.816   1.00 54.04 ? 373  GLN A OE1   1 
ATOM   2938 N  NE2   . GLN A 1 376 ? 21.807 5.646   10.246  1.00 46.82 ? 373  GLN A NE2   1 
ATOM   2939 N  N     . GLY A 1 377 ? 22.674 -0.170  8.902   1.00 38.75 ? 374  GLY A N     1 
ATOM   2940 C  CA    . GLY A 1 377 ? 22.386 -1.439  9.549   1.00 53.84 ? 374  GLY A CA    1 
ATOM   2941 C  C     . GLY A 1 377 ? 23.323 -2.563  9.148   1.00 59.15 ? 374  GLY A C     1 
ATOM   2942 O  O     . GLY A 1 377 ? 23.683 -3.412  9.967   1.00 51.95 ? 374  GLY A O     1 
ATOM   2943 N  N     . ASP A 1 378 ? 23.722 -2.561  7.881   1.00 51.83 ? 375  ASP A N     1 
ATOM   2944 C  CA    . ASP A 1 378 ? 24.592 -3.591  7.331   1.00 49.78 ? 375  ASP A CA    1 
ATOM   2945 C  C     . ASP A 1 378 ? 26.041 -3.401  7.790   1.00 64.67 ? 375  ASP A C     1 
ATOM   2946 O  O     . ASP A 1 378 ? 26.580 -2.293  7.723   1.00 67.50 ? 375  ASP A O     1 
ATOM   2947 C  CB    . ASP A 1 378 ? 24.514 -3.534  5.805   1.00 54.50 ? 375  ASP A CB    1 
ATOM   2948 C  CG    . ASP A 1 378 ? 24.999 -4.803  5.145   1.00 53.00 ? 375  ASP A CG    1 
ATOM   2949 O  OD1   . ASP A 1 378 ? 25.797 -5.538  5.763   1.00 53.18 ? 375  ASP A OD1   1 
ATOM   2950 O  OD2   . ASP A 1 378 ? 24.577 -5.059  4.001   1.00 48.40 ? 375  ASP A OD2   1 
ATOM   2951 N  N     . LYS A 1 379 ? 26.673 -4.479  8.249   1.00 63.60 ? 376  LYS A N     1 
ATOM   2952 C  CA    . LYS A 1 379 ? 28.055 -4.397  8.719   1.00 71.11 ? 376  LYS A CA    1 
ATOM   2953 C  C     . LYS A 1 379 ? 29.044 -4.767  7.617   1.00 72.49 ? 376  LYS A C     1 
ATOM   2954 O  O     . LYS A 1 379 ? 30.192 -5.120  7.891   1.00 75.76 ? 376  LYS A O     1 
ATOM   2955 C  CB    . LYS A 1 379 ? 28.271 -5.297  9.939   1.00 81.08 ? 376  LYS A CB    1 
ATOM   2956 C  CG    . LYS A 1 379 ? 29.430 -4.862  10.831  1.00 85.32 ? 376  LYS A CG    1 
ATOM   2957 C  CD    . LYS A 1 379 ? 30.116 -6.055  11.479  1.00 84.73 ? 376  LYS A CD    1 
ATOM   2958 C  CE    . LYS A 1 379 ? 30.806 -6.920  10.433  1.00 81.70 ? 376  LYS A CE    1 
ATOM   2959 N  NZ    . LYS A 1 379 ? 31.490 -8.096  11.034  1.00 70.74 ? 376  LYS A NZ    1 
ATOM   2960 N  N     . ARG A 1 380 ? 28.593 -4.681  6.369   1.00 69.66 ? 377  ARG A N     1 
ATOM   2961 C  CA    . ARG A 1 380 ? 29.437 -5.002  5.222   1.00 67.41 ? 377  ARG A CA    1 
ATOM   2962 C  C     . ARG A 1 380 ? 29.933 -3.736  4.530   1.00 65.02 ? 377  ARG A C     1 
ATOM   2963 O  O     . ARG A 1 380 ? 29.192 -2.761  4.414   1.00 66.37 ? 377  ARG A O     1 
ATOM   2964 C  CB    . ARG A 1 380 ? 28.655 -5.851  4.213   1.00 61.23 ? 377  ARG A CB    1 
ATOM   2965 C  CG    . ARG A 1 380 ? 28.106 -7.159  4.764   1.00 60.32 ? 377  ARG A CG    1 
ATOM   2966 C  CD    . ARG A 1 380 ? 27.327 -7.926  3.699   1.00 49.29 ? 377  ARG A CD    1 
ATOM   2967 N  NE    . ARG A 1 380 ? 26.120 -7.219  3.274   1.00 45.06 ? 377  ARG A NE    1 
ATOM   2968 C  CZ    . ARG A 1 380 ? 25.361 -7.586  2.245   1.00 43.87 ? 377  ARG A CZ    1 
ATOM   2969 N  NH1   . ARG A 1 380 ? 25.678 -8.652  1.526   1.00 36.74 ? 377  ARG A NH1   1 
ATOM   2970 N  NH2   . ARG A 1 380 ? 24.282 -6.884  1.929   1.00 47.22 ? 377  ARG A NH2   1 
ATOM   2971 N  N     . LEU A 1 381 ? 31.185 -3.759  4.077   1.00 57.22 ? 378  LEU A N     1 
ATOM   2972 C  CA    . LEU A 1 381 ? 31.734 -2.675  3.273   1.00 58.40 ? 378  LEU A CA    1 
ATOM   2973 C  C     . LEU A 1 381 ? 30.645 -2.153  2.345   1.00 57.08 ? 378  LEU A C     1 
ATOM   2974 O  O     . LEU A 1 381 ? 30.127 -1.047  2.523   1.00 54.44 ? 378  LEU A O     1 
ATOM   2975 C  CB    . LEU A 1 381 ? 32.926 -3.175  2.448   1.00 64.53 ? 378  LEU A CB    1 
ATOM   2976 C  CG    . LEU A 1 381 ? 34.221 -2.352  2.427   1.00 67.11 ? 378  LEU A CG    1 
ATOM   2977 C  CD1   . LEU A 1 381 ? 35.280 -3.045  1.577   1.00 52.82 ? 378  LEU A CD1   1 
ATOM   2978 C  CD2   . LEU A 1 381 ? 33.981 -0.930  1.929   1.00 57.00 ? 378  LEU A CD2   1 
ATOM   2979 N  N     . SER A 1 382 ? 30.291 -2.968  1.359   1.00 56.58 ? 379  SER A N     1 
ATOM   2980 C  CA    . SER A 1 382 ? 29.241 -2.614  0.421   1.00 48.54 ? 379  SER A CA    1 
ATOM   2981 C  C     . SER A 1 382 ? 27.978 -3.399  0.708   1.00 45.32 ? 379  SER A C     1 
ATOM   2982 O  O     . SER A 1 382 ? 28.032 -4.571  1.082   1.00 46.78 ? 379  SER A O     1 
ATOM   2983 C  CB    . SER A 1 382 ? 29.678 -2.885  -1.016  1.00 45.21 ? 379  SER A CB    1 
ATOM   2984 O  OG    . SER A 1 382 ? 28.549 -2.927  -1.880  1.00 40.30 ? 379  SER A OG    1 
ATOM   2985 N  N     . SER A 1 383 ? 26.841 -2.742  0.521   1.00 44.46 ? 380  SER A N     1 
ATOM   2986 C  CA    . SER A 1 383 ? 25.556 -3.409  0.612   1.00 42.78 ? 380  SER A CA    1 
ATOM   2987 C  C     . SER A 1 383 ? 25.139 -3.860  -0.775  1.00 52.04 ? 380  SER A C     1 
ATOM   2988 O  O     . SER A 1 383 ? 24.593 -4.950  -0.954  1.00 46.38 ? 380  SER A O     1 
ATOM   2989 C  CB    . SER A 1 383 ? 24.494 -2.465  1.184   1.00 40.16 ? 380  SER A CB    1 
ATOM   2990 O  OG    . SER A 1 383 ? 24.686 -2.255  2.574   1.00 39.07 ? 380  SER A OG    1 
ATOM   2991 N  N     . LEU A 1 384 ? 25.402 -3.007  -1.758  1.00 43.69 ? 381  LEU A N     1 
ATOM   2992 C  CA    . LEU A 1 384 ? 24.988 -3.270  -3.126  1.00 36.72 ? 381  LEU A CA    1 
ATOM   2993 C  C     . LEU A 1 384 ? 25.977 -2.689  -4.127  1.00 39.12 ? 381  LEU A C     1 
ATOM   2994 O  O     . LEU A 1 384 ? 26.567 -1.632  -3.899  1.00 28.58 ? 381  LEU A O     1 
ATOM   2995 C  CB    . LEU A 1 384 ? 23.586 -2.711  -3.371  1.00 37.61 ? 381  LEU A CB    1 
ATOM   2996 C  CG    . LEU A 1 384 ? 23.123 -2.627  -4.828  1.00 39.56 ? 381  LEU A CG    1 
ATOM   2997 C  CD1   . LEU A 1 384 ? 21.638 -2.915  -4.957  1.00 40.99 ? 381  LEU A CD1   1 
ATOM   2998 C  CD2   . LEU A 1 384 ? 23.463 -1.273  -5.433  1.00 39.09 ? 381  LEU A CD2   1 
ATOM   2999 N  N     . ARG A 1 385 ? 26.152 -3.388  -5.241  1.00 30.06 ? 382  ARG A N     1 
ATOM   3000 C  CA    . ARG A 1 385 ? 27.106 -2.973  -6.252  1.00 26.59 ? 382  ARG A CA    1 
ATOM   3001 C  C     . ARG A 1 385 ? 26.441 -3.220  -7.595  1.00 32.74 ? 382  ARG A C     1 
ATOM   3002 O  O     . ARG A 1 385 ? 25.974 -4.325  -7.871  1.00 34.23 ? 382  ARG A O     1 
ATOM   3003 C  CB    . ARG A 1 385 ? 28.386 -3.802  -6.127  1.00 38.03 ? 382  ARG A CB    1 
ATOM   3004 C  CG    . ARG A 1 385 ? 29.657 -3.078  -6.527  1.00 40.51 ? 382  ARG A CG    1 
ATOM   3005 C  CD    . ARG A 1 385 ? 30.881 -3.952  -6.276  1.00 51.44 ? 382  ARG A CD    1 
ATOM   3006 N  NE    . ARG A 1 385 ? 30.881 -4.532  -4.932  1.00 58.39 ? 382  ARG A NE    1 
ATOM   3007 C  CZ    . ARG A 1 385 ? 31.833 -5.335  -4.458  1.00 62.59 ? 382  ARG A CZ    1 
ATOM   3008 N  NH1   . ARG A 1 385 ? 32.876 -5.658  -5.219  1.00 51.83 ? 382  ARG A NH1   1 
ATOM   3009 N  NH2   . ARG A 1 385 ? 31.745 -5.819  -3.221  1.00 47.84 ? 382  ARG A NH2   1 
ATOM   3010 N  N     . ARG A 1 386 ? 26.362 -2.180  -8.412  1.00 21.49 ? 383  ARG A N     1 
ATOM   3011 C  CA    . ARG A 1 386 ? 25.733 -2.285  -9.716  1.00 29.22 ? 383  ARG A CA    1 
ATOM   3012 C  C     . ARG A 1 386 ? 26.585 -1.552  -10.733 1.00 30.36 ? 383  ARG A C     1 
ATOM   3013 O  O     . ARG A 1 386 ? 27.052 -0.443  -10.473 1.00 22.73 ? 383  ARG A O     1 
ATOM   3014 C  CB    . ARG A 1 386 ? 24.349 -1.646  -9.683  1.00 27.28 ? 383  ARG A CB    1 
ATOM   3015 C  CG    . ARG A 1 386 ? 23.347 -2.373  -8.818  1.00 35.55 ? 383  ARG A CG    1 
ATOM   3016 C  CD    . ARG A 1 386 ? 22.874 -3.638  -9.493  1.00 34.25 ? 383  ARG A CD    1 
ATOM   3017 N  NE    . ARG A 1 386 ? 21.652 -4.150  -8.881  1.00 28.95 ? 383  ARG A NE    1 
ATOM   3018 C  CZ    . ARG A 1 386 ? 21.626 -5.046  -7.901  1.00 37.47 ? 383  ARG A CZ    1 
ATOM   3019 N  NH1   . ARG A 1 386 ? 22.762 -5.534  -7.413  1.00 32.98 ? 383  ARG A NH1   1 
ATOM   3020 N  NH2   . ARG A 1 386 ? 20.460 -5.460  -7.415  1.00 38.76 ? 383  ARG A NH2   1 
ATOM   3021 N  N     . CYS A 1 387 ? 26.790 -2.164  -11.891 1.00 27.74 ? 384  CYS A N     1 
ATOM   3022 C  CA    . CYS A 1 387 ? 27.565 -1.506  -12.936 1.00 29.42 ? 384  CYS A CA    1 
ATOM   3023 C  C     . CYS A 1 387 ? 26.672 -0.985  -14.059 1.00 32.36 ? 384  CYS A C     1 
ATOM   3024 O  O     . CYS A 1 387 ? 25.606 -1.535  -14.323 1.00 33.05 ? 384  CYS A O     1 
ATOM   3025 C  CB    . CYS A 1 387 ? 28.644 -2.450  -13.488 1.00 29.18 ? 384  CYS A CB    1 
ATOM   3026 S  SG    . CYS A 1 387 ? 27.996 -3.856  -14.425 1.00 50.31 ? 384  CYS A SG    1 
ATOM   3027 N  N     . CYS A 1 388 ? 27.107 0.090   -14.705 1.00 31.33 ? 385  CYS A N     1 
ATOM   3028 C  CA    . CYS A 1 388 ? 26.469 0.555   -15.929 1.00 35.63 ? 385  CYS A CA    1 
ATOM   3029 C  C     . CYS A 1 388 ? 27.561 1.008   -16.879 1.00 29.03 ? 385  CYS A C     1 
ATOM   3030 O  O     . CYS A 1 388 ? 28.734 1.021   -16.514 1.00 31.91 ? 385  CYS A O     1 
ATOM   3031 C  CB    . CYS A 1 388 ? 25.481 1.691   -15.656 1.00 31.65 ? 385  CYS A CB    1 
ATOM   3032 S  SG    . CYS A 1 388 ? 26.198 3.173   -14.914 1.00 35.83 ? 385  CYS A SG    1 
ATOM   3033 N  N     . ALA A 1 389 ? 27.185 1.382   -18.097 1.00 29.43 ? 386  ALA A N     1 
ATOM   3034 C  CA    . ALA A 1 389 ? 28.177 1.810   -19.071 1.00 30.83 ? 386  ALA A CA    1 
ATOM   3035 C  C     . ALA A 1 389 ? 28.675 3.219   -18.774 1.00 26.12 ? 386  ALA A C     1 
ATOM   3036 O  O     . ALA A 1 389 ? 27.910 4.097   -18.373 1.00 31.03 ? 386  ALA A O     1 
ATOM   3037 C  CB    . ALA A 1 389 ? 27.620 1.725   -20.484 1.00 33.37 ? 386  ALA A CB    1 
ATOM   3038 N  N     . LEU A 1 390 ? 29.968 3.421   -18.967 1.00 23.81 ? 387  LEU A N     1 
ATOM   3039 C  CA    . LEU A 1 390 ? 30.577 4.727   -18.811 1.00 25.45 ? 387  LEU A CA    1 
ATOM   3040 C  C     . LEU A 1 390 ? 31.028 5.174   -20.192 1.00 27.13 ? 387  LEU A C     1 
ATOM   3041 O  O     . LEU A 1 390 ? 32.088 4.763   -20.666 1.00 27.35 ? 387  LEU A O     1 
ATOM   3042 C  CB    . LEU A 1 390 ? 31.780 4.638   -17.867 1.00 27.89 ? 387  LEU A CB    1 
ATOM   3043 C  CG    . LEU A 1 390 ? 32.246 5.907   -17.150 1.00 27.03 ? 387  LEU A CG    1 
ATOM   3044 C  CD1   . LEU A 1 390 ? 33.418 5.574   -16.246 1.00 22.76 ? 387  LEU A CD1   1 
ATOM   3045 C  CD2   . LEU A 1 390 ? 32.634 6.999   -18.124 1.00 25.72 ? 387  LEU A CD2   1 
ATOM   3046 N  N     . THR A 1 391 ? 30.225 6.018   -20.830 1.00 26.65 ? 388  THR A N     1 
ATOM   3047 C  CA    . THR A 1 391 ? 30.407 6.340   -22.238 1.00 30.67 ? 388  THR A CA    1 
ATOM   3048 C  C     . THR A 1 391 ? 30.969 7.735   -22.464 1.00 30.18 ? 388  THR A C     1 
ATOM   3049 O  O     . THR A 1 391 ? 31.445 8.037   -23.552 1.00 29.45 ? 388  THR A O     1 
ATOM   3050 C  CB    . THR A 1 391 ? 29.082 6.212   -23.019 1.00 33.27 ? 388  THR A CB    1 
ATOM   3051 O  OG1   . THR A 1 391 ? 28.097 7.081   -22.444 1.00 38.25 ? 388  THR A OG1   1 
ATOM   3052 C  CG2   . THR A 1 391 ? 28.575 4.784   -22.969 1.00 27.86 ? 388  THR A CG2   1 
ATOM   3053 N  N     . ARG A 1 392 ? 30.905 8.580   -21.439 1.00 27.17 ? 389  ARG A N     1 
ATOM   3054 C  CA    . ARG A 1 392 ? 31.426 9.940   -21.528 1.00 28.13 ? 389  ARG A CA    1 
ATOM   3055 C  C     . ARG A 1 392 ? 31.941 10.447  -20.183 1.00 24.58 ? 389  ARG A C     1 
ATOM   3056 O  O     . ARG A 1 392 ? 31.350 10.180  -19.141 1.00 30.89 ? 389  ARG A O     1 
ATOM   3057 C  CB    . ARG A 1 392 ? 30.368 10.902  -22.084 1.00 34.37 ? 389  ARG A CB    1 
ATOM   3058 C  CG    . ARG A 1 392 ? 30.195 10.815  -23.599 1.00 43.60 ? 389  ARG A CG    1 
ATOM   3059 C  CD    . ARG A 1 392 ? 29.495 12.044  -24.155 1.00 47.07 ? 389  ARG A CD    1 
ATOM   3060 N  NE    . ARG A 1 392 ? 28.084 12.087  -23.788 1.00 54.37 ? 389  ARG A NE    1 
ATOM   3061 C  CZ    . ARG A 1 392 ? 27.080 12.041  -24.661 1.00 50.36 ? 389  ARG A CZ    1 
ATOM   3062 N  NH1   . ARG A 1 392 ? 27.323 11.958  -25.968 1.00 37.77 ? 389  ARG A NH1   1 
ATOM   3063 N  NH2   . ARG A 1 392 ? 25.828 12.086  -24.221 1.00 43.90 ? 389  ARG A NH2   1 
ATOM   3064 N  N     . TYR A 1 393 ? 33.047 11.176  -20.217 1.00 22.23 ? 390  TYR A N     1 
ATOM   3065 C  CA    . TYR A 1 393 ? 33.597 11.782  -19.011 1.00 20.61 ? 390  TYR A CA    1 
ATOM   3066 C  C     . TYR A 1 393 ? 32.818 13.051  -18.699 1.00 26.66 ? 390  TYR A C     1 
ATOM   3067 O  O     . TYR A 1 393 ? 33.290 14.166  -18.950 1.00 27.24 ? 390  TYR A O     1 
ATOM   3068 C  CB    . TYR A 1 393 ? 35.081 12.083  -19.188 1.00 25.69 ? 390  TYR A CB    1 
ATOM   3069 C  CG    . TYR A 1 393 ? 35.960 10.850  -19.123 1.00 21.19 ? 390  TYR A CG    1 
ATOM   3070 C  CD1   . TYR A 1 393 ? 37.342 10.959  -19.144 1.00 20.34 ? 390  TYR A CD1   1 
ATOM   3071 C  CD2   . TYR A 1 393 ? 35.402 9.578   -19.029 1.00 23.19 ? 390  TYR A CD2   1 
ATOM   3072 C  CE1   . TYR A 1 393 ? 38.150 9.832   -19.081 1.00 17.69 ? 390  TYR A CE1   1 
ATOM   3073 C  CE2   . TYR A 1 393 ? 36.201 8.450   -18.960 1.00 23.24 ? 390  TYR A CE2   1 
ATOM   3074 C  CZ    . TYR A 1 393 ? 37.577 8.586   -18.985 1.00 20.44 ? 390  TYR A CZ    1 
ATOM   3075 O  OH    . TYR A 1 393 ? 38.380 7.460   -18.913 1.00 21.06 ? 390  TYR A OH    1 
ATOM   3076 N  N     . ASP A 1 394 ? 31.608 12.866  -18.182 1.00 22.39 ? 391  ASP A N     1 
ATOM   3077 C  CA    . ASP A 1 394 ? 30.749 13.978  -17.817 1.00 27.12 ? 391  ASP A CA    1 
ATOM   3078 C  C     . ASP A 1 394 ? 30.099 13.716  -16.466 1.00 17.71 ? 391  ASP A C     1 
ATOM   3079 O  O     . ASP A 1 394 ? 29.355 12.751  -16.305 1.00 19.63 ? 391  ASP A O     1 
ATOM   3080 C  CB    . ASP A 1 394 ? 29.675 14.216  -18.877 1.00 27.50 ? 391  ASP A CB    1 
ATOM   3081 C  CG    . ASP A 1 394 ? 28.851 15.457  -18.587 1.00 34.61 ? 391  ASP A CG    1 
ATOM   3082 O  OD1   . ASP A 1 394 ? 27.834 15.339  -17.871 1.00 31.84 ? 391  ASP A OD1   1 
ATOM   3083 O  OD2   . ASP A 1 394 ? 29.240 16.553  -19.050 1.00 45.53 ? 391  ASP A OD2   1 
ATOM   3084 N  N     . ALA A 1 395 ? 30.387 14.584  -15.500 1.00 22.72 ? 392  ALA A N     1 
ATOM   3085 C  CA    . ALA A 1 395 ? 29.948 14.379  -14.121 1.00 23.17 ? 392  ALA A CA    1 
ATOM   3086 C  C     . ALA A 1 395 ? 28.429 14.311  -13.950 1.00 20.40 ? 392  ALA A C     1 
ATOM   3087 O  O     . ALA A 1 395 ? 27.914 13.427  -13.267 1.00 19.89 ? 392  ALA A O     1 
ATOM   3088 C  CB    . ALA A 1 395 ? 30.549 15.449  -13.207 1.00 21.85 ? 392  ALA A CB    1 
ATOM   3089 N  N     . HIS A 1 396 ? 27.707 15.244  -14.560 1.00 24.87 ? 393  HIS A N     1 
ATOM   3090 C  CA    . HIS A 1 396 ? 26.248 15.228  -14.445 1.00 29.42 ? 393  HIS A CA    1 
ATOM   3091 C  C     . HIS A 1 396 ? 25.654 13.932  -15.003 1.00 21.33 ? 393  HIS A C     1 
ATOM   3092 O  O     . HIS A 1 396 ? 24.763 13.341  -14.395 1.00 24.33 ? 393  HIS A O     1 
ATOM   3093 C  CB    . HIS A 1 396 ? 25.621 16.474  -15.086 1.00 31.36 ? 393  HIS A CB    1 
ATOM   3094 C  CG    . HIS A 1 396 ? 25.917 17.741  -14.340 1.00 30.72 ? 393  HIS A CG    1 
ATOM   3095 N  ND1   . HIS A 1 396 ? 26.967 18.572  -14.667 1.00 42.10 ? 393  HIS A ND1   1 
ATOM   3096 C  CD2   . HIS A 1 396 ? 25.321 18.300  -13.259 1.00 36.03 ? 393  HIS A CD2   1 
ATOM   3097 C  CE1   . HIS A 1 396 ? 26.995 19.597  -13.833 1.00 39.23 ? 393  HIS A CE1   1 
ATOM   3098 N  NE2   . HIS A 1 396 ? 26.008 19.455  -12.967 1.00 40.62 ? 393  HIS A NE2   1 
ATOM   3099 N  N     . LYS A 1 397 ? 26.162 13.482  -16.148 1.00 21.38 ? 394  LYS A N     1 
ATOM   3100 C  CA    . LYS A 1 397 ? 25.732 12.201  -16.711 1.00 23.93 ? 394  LYS A CA    1 
ATOM   3101 C  C     . LYS A 1 397 ? 26.051 11.027  -15.799 1.00 23.77 ? 394  LYS A C     1 
ATOM   3102 O  O     . LYS A 1 397 ? 25.209 10.163  -15.574 1.00 25.11 ? 394  LYS A O     1 
ATOM   3103 C  CB    . LYS A 1 397 ? 26.347 11.943  -18.086 1.00 23.39 ? 394  LYS A CB    1 
ATOM   3104 C  CG    . LYS A 1 397 ? 26.138 10.500  -18.564 1.00 30.45 ? 394  LYS A CG    1 
ATOM   3105 C  CD    . LYS A 1 397 ? 26.346 10.353  -20.070 1.00 36.95 ? 394  LYS A CD    1 
ATOM   3106 C  CE    . LYS A 1 397 ? 26.191 8.905   -20.522 1.00 38.59 ? 394  LYS A CE    1 
ATOM   3107 N  NZ    . LYS A 1 397 ? 24.897 8.283   -20.112 1.00 40.06 ? 394  LYS A NZ    1 
ATOM   3108 N  N     . MET A 1 398 ? 27.273 10.987  -15.282 1.00 20.82 ? 395  MET A N     1 
ATOM   3109 C  CA    . MET A 1 398 ? 27.673 9.877   -14.430 1.00 22.27 ? 395  MET A CA    1 
ATOM   3110 C  C     . MET A 1 398 ? 26.830 9.813   -13.155 1.00 22.34 ? 395  MET A C     1 
ATOM   3111 O  O     . MET A 1 398 ? 26.410 8.735   -12.738 1.00 21.44 ? 395  MET A O     1 
ATOM   3112 C  CB    . MET A 1 398 ? 29.168 9.963   -14.110 1.00 22.00 ? 395  MET A CB    1 
ATOM   3113 C  CG    . MET A 1 398 ? 30.046 9.478   -15.261 1.00 21.85 ? 395  MET A CG    1 
ATOM   3114 S  SD    . MET A 1 398 ? 31.769 9.277   -14.795 1.00 27.43 ? 395  MET A SD    1 
ATOM   3115 C  CE    . MET A 1 398 ? 32.268 10.996  -14.706 1.00 19.14 ? 395  MET A CE    1 
ATOM   3116 N  N     . SER A 1 399 ? 26.593 10.968  -12.538 1.00 25.15 ? 396  SER A N     1 
ATOM   3117 C  CA    . SER A 1 399 ? 25.782 11.017  -11.326 1.00 23.39 ? 396  SER A CA    1 
ATOM   3118 C  C     . SER A 1 399 ? 24.323 10.659  -11.620 1.00 22.12 ? 396  SER A C     1 
ATOM   3119 O  O     . SER A 1 399 ? 23.652 10.030  -10.808 1.00 21.92 ? 396  SER A O     1 
ATOM   3120 C  CB    . SER A 1 399 ? 25.884 12.384  -10.632 1.00 25.71 ? 396  SER A CB    1 
ATOM   3121 O  OG    . SER A 1 399 ? 25.520 13.453  -11.491 1.00 27.58 ? 396  SER A OG    1 
ATOM   3122 N  N     . HIS A 1 400 ? 23.835 11.064  -12.784 1.00 25.72 ? 397  HIS A N     1 
ATOM   3123 C  CA    . HIS A 1 400 ? 22.477 10.709  -13.173 1.00 30.52 ? 397  HIS A CA    1 
ATOM   3124 C  C     . HIS A 1 400 ? 22.364 9.193   -13.355 1.00 26.60 ? 397  HIS A C     1 
ATOM   3125 O  O     . HIS A 1 400 ? 21.436 8.562   -12.843 1.00 28.33 ? 397  HIS A O     1 
ATOM   3126 C  CB    . HIS A 1 400 ? 22.061 11.453  -14.443 1.00 32.69 ? 397  HIS A CB    1 
ATOM   3127 C  CG    . HIS A 1 400 ? 20.631 11.231  -14.828 1.00 43.80 ? 397  HIS A CG    1 
ATOM   3128 N  ND1   . HIS A 1 400 ? 20.187 10.057  -15.399 1.00 44.95 ? 397  HIS A ND1   1 
ATOM   3129 C  CD2   . HIS A 1 400 ? 19.545 12.032  -14.723 1.00 48.08 ? 397  HIS A CD2   1 
ATOM   3130 C  CE1   . HIS A 1 400 ? 18.889 10.146  -15.631 1.00 43.20 ? 397  HIS A CE1   1 
ATOM   3131 N  NE2   . HIS A 1 400 ? 18.476 11.334  -15.230 1.00 45.02 ? 397  HIS A NE2   1 
ATOM   3132 N  N     . ASP A 1 401 ? 23.331 8.607   -14.057 1.00 27.22 ? 398  ASP A N     1 
ATOM   3133 C  CA    . ASP A 1 401 ? 23.343 7.164   -14.275 1.00 23.29 ? 398  ASP A CA    1 
ATOM   3134 C  C     . ASP A 1 401 ? 23.474 6.382   -12.976 1.00 30.56 ? 398  ASP A C     1 
ATOM   3135 O  O     . ASP A 1 401 ? 22.840 5.335   -12.806 1.00 28.44 ? 398  ASP A O     1 
ATOM   3136 C  CB    . ASP A 1 401 ? 24.460 6.763   -15.240 1.00 26.33 ? 398  ASP A CB    1 
ATOM   3137 C  CG    . ASP A 1 401 ? 24.243 7.311   -16.631 1.00 32.12 ? 398  ASP A CG    1 
ATOM   3138 O  OD1   . ASP A 1 401 ? 23.098 7.703   -16.944 1.00 35.54 ? 398  ASP A OD1   1 
ATOM   3139 O  OD2   . ASP A 1 401 ? 25.216 7.355   -17.409 1.00 29.47 ? 398  ASP A OD2   1 
ATOM   3140 N  N     . ALA A 1 402 ? 24.301 6.887   -12.063 1.00 26.55 ? 399  ALA A N     1 
ATOM   3141 C  CA    . ALA A 1 402 ? 24.492 6.243   -10.769 1.00 24.01 ? 399  ALA A CA    1 
ATOM   3142 C  C     . ALA A 1 402 ? 23.179 6.228   -9.994  1.00 22.77 ? 399  ALA A C     1 
ATOM   3143 O  O     . ALA A 1 402 ? 22.832 5.237   -9.353  1.00 22.67 ? 399  ALA A O     1 
ATOM   3144 C  CB    . ALA A 1 402 ? 25.575 6.970   -9.970  1.00 22.54 ? 399  ALA A CB    1 
ATOM   3145 N  N     . PHE A 1 403 ? 22.456 7.339   -10.051 1.00 28.49 ? 400  PHE A N     1 
ATOM   3146 C  CA    . PHE A 1 403 ? 21.170 7.430   -9.371  1.00 29.79 ? 400  PHE A CA    1 
ATOM   3147 C  C     . PHE A 1 403 ? 20.162 6.461   -9.972  1.00 30.77 ? 400  PHE A C     1 
ATOM   3148 O  O     . PHE A 1 403 ? 19.477 5.739   -9.252  1.00 32.50 ? 400  PHE A O     1 
ATOM   3149 C  CB    . PHE A 1 403 ? 20.613 8.842   -9.457  1.00 28.96 ? 400  PHE A CB    1 
ATOM   3150 C  CG    . PHE A 1 403 ? 19.300 9.008   -8.757  1.00 39.46 ? 400  PHE A CG    1 
ATOM   3151 C  CD1   . PHE A 1 403 ? 18.146 9.278   -9.474  1.00 39.14 ? 400  PHE A CD1   1 
ATOM   3152 C  CD2   . PHE A 1 403 ? 19.217 8.874   -7.379  1.00 33.60 ? 400  PHE A CD2   1 
ATOM   3153 C  CE1   . PHE A 1 403 ? 16.934 9.426   -8.829  1.00 45.29 ? 400  PHE A CE1   1 
ATOM   3154 C  CE2   . PHE A 1 403 ? 18.010 9.022   -6.729  1.00 43.61 ? 400  PHE A CE2   1 
ATOM   3155 C  CZ    . PHE A 1 403 ? 16.865 9.298   -7.454  1.00 45.84 ? 400  PHE A CZ    1 
ATOM   3156 N  N     . THR A 1 404 ? 20.070 6.454   -11.296 1.00 30.22 ? 401  THR A N     1 
ATOM   3157 C  CA    . THR A 1 404 ? 19.188 5.515   -11.973 1.00 34.48 ? 401  THR A CA    1 
ATOM   3158 C  C     . THR A 1 404 ? 19.466 4.092   -11.512 1.00 33.92 ? 401  THR A C     1 
ATOM   3159 O  O     . THR A 1 404 ? 18.540 3.329   -11.238 1.00 39.31 ? 401  THR A O     1 
ATOM   3160 C  CB    . THR A 1 404 ? 19.352 5.589   -13.498 1.00 28.82 ? 401  THR A CB    1 
ATOM   3161 O  OG1   . THR A 1 404 ? 19.105 6.930   -13.938 1.00 31.16 ? 401  THR A OG1   1 
ATOM   3162 C  CG2   . THR A 1 404 ? 18.377 4.650   -14.183 1.00 42.59 ? 401  THR A CG2   1 
ATOM   3163 N  N     . VAL A 1 405 ? 20.739 3.725   -11.409 1.00 31.08 ? 402  VAL A N     1 
ATOM   3164 C  CA    . VAL A 1 405 ? 21.043 2.348   -11.046 1.00 29.76 ? 402  VAL A CA    1 
ATOM   3165 C  C     . VAL A 1 405 ? 20.761 1.977   -9.591  1.00 28.50 ? 402  VAL A C     1 
ATOM   3166 O  O     . VAL A 1 405 ? 20.574 0.804   -9.278  1.00 32.26 ? 402  VAL A O     1 
ATOM   3167 C  CB    . VAL A 1 405 ? 22.465 1.886   -11.472 1.00 37.66 ? 402  VAL A CB    1 
ATOM   3168 C  CG1   . VAL A 1 405 ? 22.551 1.777   -12.992 1.00 37.55 ? 402  VAL A CG1   1 
ATOM   3169 C  CG2   . VAL A 1 405 ? 23.524 2.815   -10.940 1.00 36.61 ? 402  VAL A CG2   1 
ATOM   3170 N  N     . ILE A 1 406 ? 20.717 2.970   -8.708  1.00 28.93 ? 403  ILE A N     1 
ATOM   3171 C  CA    . ILE A 1 406 ? 20.479 2.691   -7.300  1.00 34.52 ? 403  ILE A CA    1 
ATOM   3172 C  C     . ILE A 1 406 ? 19.101 3.127   -6.795  1.00 34.97 ? 403  ILE A C     1 
ATOM   3173 O  O     . ILE A 1 406 ? 18.710 2.774   -5.680  1.00 37.79 ? 403  ILE A O     1 
ATOM   3174 C  CB    . ILE A 1 406 ? 21.531 3.370   -6.390  1.00 30.12 ? 403  ILE A CB    1 
ATOM   3175 C  CG1   . ILE A 1 406 ? 21.328 4.883   -6.382  1.00 32.98 ? 403  ILE A CG1   1 
ATOM   3176 C  CG2   . ILE A 1 406 ? 22.937 2.980   -6.797  1.00 30.20 ? 403  ILE A CG2   1 
ATOM   3177 C  CD1   . ILE A 1 406 ? 21.962 5.573   -5.186  1.00 30.97 ? 403  ILE A CD1   1 
ATOM   3178 N  N     . LYS A 1 407 ? 18.376 3.897   -7.600  1.00 33.67 ? 404  LYS A N     1 
ATOM   3179 C  CA    . LYS A 1 407 ? 17.118 4.490   -7.148  1.00 40.52 ? 404  LYS A CA    1 
ATOM   3180 C  C     . LYS A 1 407 ? 16.108 3.472   -6.607  1.00 48.21 ? 404  LYS A C     1 
ATOM   3181 O  O     . LYS A 1 407 ? 15.262 3.809   -5.777  1.00 50.11 ? 404  LYS A O     1 
ATOM   3182 C  CB    . LYS A 1 407 ? 16.489 5.351   -8.248  1.00 35.82 ? 404  LYS A CB    1 
ATOM   3183 C  CG    . LYS A 1 407 ? 16.148 4.608   -9.523  1.00 39.55 ? 404  LYS A CG    1 
ATOM   3184 C  CD    . LYS A 1 407 ? 15.570 5.568   -10.555 1.00 45.93 ? 404  LYS A CD    1 
ATOM   3185 C  CE    . LYS A 1 407 ? 15.114 4.838   -11.805 1.00 50.48 ? 404  LYS A CE    1 
ATOM   3186 N  NZ    . LYS A 1 407 ? 14.501 5.780   -12.786 1.00 56.87 ? 404  LYS A NZ    1 
ATOM   3187 N  N     . ASN A 1 408 ? 16.209 2.226   -7.059  1.00 46.78 ? 405  ASN A N     1 
ATOM   3188 C  CA    . ASN A 1 408 ? 15.252 1.199   -6.654  1.00 50.24 ? 405  ASN A CA    1 
ATOM   3189 C  C     . ASN A 1 408 ? 15.554 0.561   -5.301  1.00 48.12 ? 405  ASN A C     1 
ATOM   3190 O  O     . ASN A 1 408 ? 14.869 -0.370  -4.882  1.00 42.52 ? 405  ASN A O     1 
ATOM   3191 C  CB    . ASN A 1 408 ? 15.110 0.134   -7.744  1.00 48.19 ? 405  ASN A CB    1 
ATOM   3192 C  CG    . ASN A 1 408 ? 14.461 0.682   -9.003  1.00 61.15 ? 405  ASN A CG    1 
ATOM   3193 O  OD1   . ASN A 1 408 ? 15.058 0.675   -10.082 1.00 57.63 ? 405  ASN A OD1   1 
ATOM   3194 N  ND2   . ASN A 1 408 ? 13.232 1.176   -8.865  1.00 59.05 ? 405  ASN A ND2   1 
ATOM   3195 N  N     . CYS A 1 409 ? 16.574 1.066   -4.617  1.00 46.19 ? 406  CYS A N     1 
ATOM   3196 C  CA    . CYS A 1 409 ? 16.895 0.585   -3.278  1.00 48.99 ? 406  CYS A CA    1 
ATOM   3197 C  C     . CYS A 1 409 ? 16.068 1.351   -2.222  1.00 47.06 ? 406  CYS A C     1 
ATOM   3198 O  O     . CYS A 1 409 ? 15.906 0.876   -1.100  1.00 59.58 ? 406  CYS A O     1 
ATOM   3199 C  CB    . CYS A 1 409 ? 18.383 0.749   -2.982  1.00 51.61 ? 406  CYS A CB    1 
ATOM   3200 S  SG    . CYS A 1 409 ? 19.426 -0.314  -3.965  1.00 53.51 ? 406  CYS A SG    1 
ATOM   3201 N  N     . ASN A 1 410 ? 15.553 2.530   -2.587  1.00 42.91 ? 407  ASN A N     1 
ATOM   3202 C  CA    . ASN A 1 410 ? 14.772 3.396   -1.683  1.00 39.68 ? 407  ASN A CA    1 
ATOM   3203 C  C     . ASN A 1 410 ? 13.461 2.744   -1.235  1.00 51.60 ? 407  ASN A C     1 
ATOM   3204 O  O     . ASN A 1 410 ? 12.495 2.679   -1.997  1.00 48.29 ? 407  ASN A O     1 
ATOM   3205 C  CB    . ASN A 1 410 ? 14.494 4.730   -2.371  1.00 39.38 ? 407  ASN A CB    1 
ATOM   3206 C  CG    . ASN A 1 410 ? 13.826 5.723   -1.458  1.00 46.81 ? 407  ASN A CG    1 
ATOM   3207 O  OD1   . ASN A 1 410 ? 13.643 5.458   -0.268  1.00 48.89 ? 407  ASN A OD1   1 
ATOM   3208 N  ND2   . ASN A 1 410 ? 13.461 6.884   -2.004  1.00 47.54 ? 407  ASN A ND2   1 
ATOM   3209 N  N     . THR A 1 411 ? 13.441 2.258   0.002   1.00 51.25 ? 408  THR A N     1 
ATOM   3210 C  CA    . THR A 1 411 ? 12.255 1.631   0.579   1.00 51.54 ? 408  THR A CA    1 
ATOM   3211 C  C     . THR A 1 411 ? 11.114 2.625   0.736   1.00 54.97 ? 408  THR A C     1 
ATOM   3212 O  O     . THR A 1 411 ? 9.956  2.297   0.488   1.00 58.94 ? 408  THR A O     1 
ATOM   3213 C  CB    . THR A 1 411 ? 12.565 0.979   1.943   1.00 50.84 ? 408  THR A CB    1 
ATOM   3214 O  OG1   . THR A 1 411 ? 13.208 -0.285  1.734   1.00 60.76 ? 408  THR A OG1   1 
ATOM   3215 C  CG2   . THR A 1 411 ? 11.287 0.759   2.736   1.00 64.63 ? 408  THR A CG2   1 
ATOM   3216 N  N     . SER A 1 412 ? 11.456 3.843   1.145   1.00 56.00 ? 409  SER A N     1 
ATOM   3217 C  CA    . SER A 1 412 ? 10.474 4.900   1.344   1.00 60.74 ? 409  SER A CA    1 
ATOM   3218 C  C     . SER A 1 412 ? 9.394  4.886   0.272   1.00 64.71 ? 409  SER A C     1 
ATOM   3219 O  O     . SER A 1 412 ? 9.690  4.874   -0.923  1.00 65.33 ? 409  SER A O     1 
ATOM   3220 C  CB    . SER A 1 412 ? 11.161 6.269   1.351   1.00 58.22 ? 409  SER A CB    1 
ATOM   3221 O  OG    . SER A 1 412 ? 10.230 7.318   1.136   1.00 58.08 ? 409  SER A OG    1 
ATOM   3222 N  N     . GLY A 1 413 ? 8.138  4.891   0.706   1.00 69.62 ? 410  GLY A N     1 
ATOM   3223 C  CA    . GLY A 1 413 ? 7.027  5.005   -0.219  1.00 70.53 ? 410  GLY A CA    1 
ATOM   3224 C  C     . GLY A 1 413 ? 6.912  6.427   -0.732  1.00 72.89 ? 410  GLY A C     1 
ATOM   3225 O  O     . GLY A 1 413 ? 6.216  6.701   -1.711  1.00 68.77 ? 410  GLY A O     1 
ATOM   3226 N  N     . ILE A 1 414 ? 7.606  7.337   -0.058  1.00 74.19 ? 411  ILE A N     1 
ATOM   3227 C  CA    . ILE A 1 414 ? 7.651  8.734   -0.462  1.00 71.18 ? 411  ILE A CA    1 
ATOM   3228 C  C     . ILE A 1 414 ? 8.778  8.946   -1.469  1.00 72.33 ? 411  ILE A C     1 
ATOM   3229 O  O     . ILE A 1 414 ? 9.857  8.364   -1.341  1.00 67.93 ? 411  ILE A O     1 
ATOM   3230 C  CB    . ILE A 1 414 ? 7.877  9.650   0.755   1.00 68.46 ? 411  ILE A CB    1 
ATOM   3231 C  CG1   . ILE A 1 414 ? 7.065  9.145   1.950   1.00 67.06 ? 411  ILE A CG1   1 
ATOM   3232 C  CG2   . ILE A 1 414 ? 7.524  11.088  0.413   1.00 62.53 ? 411  ILE A CG2   1 
ATOM   3233 C  CD1   . ILE A 1 414 ? 7.295  9.919   3.218   1.00 60.82 ? 411  ILE A CD1   1 
ATOM   3234 N  N     . GLN A 1 415 ? 8.519  9.783   -2.469  1.00 79.85 ? 412  GLN A N     1 
ATOM   3235 C  CA    . GLN A 1 415 ? 9.485  10.052  -3.530  1.00 74.62 ? 412  GLN A CA    1 
ATOM   3236 C  C     . GLN A 1 415 ? 10.669 10.864  -3.003  1.00 71.08 ? 412  GLN A C     1 
ATOM   3237 O  O     . GLN A 1 415 ? 11.823 10.585  -3.332  1.00 72.29 ? 412  GLN A O     1 
ATOM   3238 C  CB    . GLN A 1 415 ? 8.805  10.806  -4.677  1.00 76.00 ? 412  GLN A CB    1 
ATOM   3239 C  CG    . GLN A 1 415 ? 9.589  10.827  -5.983  1.00 81.64 ? 412  GLN A CG    1 
ATOM   3240 C  CD    . GLN A 1 415 ? 9.564  9.492   -6.710  1.00 83.48 ? 412  GLN A CD    1 
ATOM   3241 O  OE1   . GLN A 1 415 ? 9.644  8.429   -6.091  1.00 74.72 ? 412  GLN A OE1   1 
ATOM   3242 N  NE2   . GLN A 1 415 ? 9.446  9.543   -8.034  1.00 75.97 ? 412  GLN A NE2   1 
ATOM   3243 N  N     . THR A 1 416 ? 10.369 11.860  -2.173  1.00 66.44 ? 413  THR A N     1 
ATOM   3244 C  CA    . THR A 1 416 ? 11.370 12.809  -1.688  1.00 64.84 ? 413  THR A CA    1 
ATOM   3245 C  C     . THR A 1 416 ? 12.263 12.252  -0.578  1.00 59.77 ? 413  THR A C     1 
ATOM   3246 O  O     . THR A 1 416 ? 13.381 12.725  -0.380  1.00 56.15 ? 413  THR A O     1 
ATOM   3247 C  CB    . THR A 1 416 ? 10.697 14.097  -1.184  1.00 64.08 ? 413  THR A CB    1 
ATOM   3248 O  OG1   . THR A 1 416 ? 9.917  14.669  -2.240  1.00 72.07 ? 413  THR A OG1   1 
ATOM   3249 C  CG2   . THR A 1 416 ? 11.739 15.104  -0.724  1.00 63.90 ? 413  THR A CG2   1 
ATOM   3250 N  N     . GLU A 1 417 ? 11.772 11.254  0.146   1.00 58.94 ? 414  GLU A N     1 
ATOM   3251 C  CA    . GLU A 1 417 ? 12.533 10.686  1.253   1.00 54.68 ? 414  GLU A CA    1 
ATOM   3252 C  C     . GLU A 1 417 ? 13.362 9.488   0.819   1.00 56.20 ? 414  GLU A C     1 
ATOM   3253 O  O     . GLU A 1 417 ? 12.963 8.734   -0.071  1.00 56.16 ? 414  GLU A O     1 
ATOM   3254 C  CB    . GLU A 1 417 ? 11.601 10.278  2.397   1.00 53.87 ? 414  GLU A CB    1 
ATOM   3255 C  CG    . GLU A 1 417 ? 10.656 11.376  2.842   1.00 57.90 ? 414  GLU A CG    1 
ATOM   3256 C  CD    . GLU A 1 417 ? 11.380 12.667  3.155   1.00 53.28 ? 414  GLU A CD    1 
ATOM   3257 O  OE1   . GLU A 1 417 ? 12.133 12.700  4.151   1.00 43.57 ? 414  GLU A OE1   1 
ATOM   3258 O  OE2   . GLU A 1 417 ? 11.201 13.645  2.397   1.00 59.60 ? 414  GLU A OE2   1 
ATOM   3259 N  N     . TRP A 1 418 ? 14.518 9.311   1.450   1.00 42.65 ? 415  TRP A N     1 
ATOM   3260 C  CA    . TRP A 1 418 ? 15.313 8.121   1.198   1.00 41.52 ? 415  TRP A CA    1 
ATOM   3261 C  C     . TRP A 1 418 ? 15.402 7.198   2.446   1.00 44.31 ? 415  TRP A C     1 
ATOM   3262 O  O     . TRP A 1 418 ? 15.815 7.644   3.517   1.00 45.70 ? 415  TRP A O     1 
ATOM   3263 C  CB    . TRP A 1 418 ? 16.715 8.461   0.681   1.00 39.41 ? 415  TRP A CB    1 
ATOM   3264 C  CG    . TRP A 1 418 ? 17.352 7.268   0.045   1.00 31.90 ? 415  TRP A CG    1 
ATOM   3265 C  CD1   . TRP A 1 418 ? 17.812 6.156   0.676   1.00 30.83 ? 415  TRP A CD1   1 
ATOM   3266 C  CD2   . TRP A 1 418 ? 17.559 7.052   -1.356  1.00 28.32 ? 415  TRP A CD2   1 
ATOM   3267 N  NE1   . TRP A 1 418 ? 18.303 5.258   -0.244  1.00 33.68 ? 415  TRP A NE1   1 
ATOM   3268 C  CE2   . TRP A 1 418 ? 18.162 5.788   -1.499  1.00 31.34 ? 415  TRP A CE2   1 
ATOM   3269 C  CE3   . TRP A 1 418 ? 17.298 7.809   -2.502  1.00 35.70 ? 415  TRP A CE3   1 
ATOM   3270 C  CZ2   . TRP A 1 418 ? 18.513 5.264   -2.742  1.00 34.02 ? 415  TRP A CZ2   1 
ATOM   3271 C  CZ3   . TRP A 1 418 ? 17.649 7.290   -3.735  1.00 37.81 ? 415  TRP A CZ3   1 
ATOM   3272 C  CH2   . TRP A 1 418 ? 18.249 6.030   -3.846  1.00 32.78 ? 415  TRP A CH2   1 
ATOM   3273 N  N     . SER A 1 419 ? 15.014 5.924   2.307   1.00 43.94 ? 416  SER A N     1 
ATOM   3274 C  CA    . SER A 1 419 ? 15.110 4.940   3.409   1.00 41.62 ? 416  SER A CA    1 
ATOM   3275 C  C     . SER A 1 419 ? 15.363 3.536   2.886   1.00 44.91 ? 416  SER A C     1 
ATOM   3276 O  O     . SER A 1 419 ? 14.922 3.196   1.794   1.00 44.17 ? 416  SER A O     1 
ATOM   3277 C  CB    . SER A 1 419 ? 13.859 4.976   4.292   1.00 52.27 ? 416  SER A CB    1 
ATOM   3278 O  OG    . SER A 1 419 ? 12.697 4.653   3.551   1.00 56.80 ? 416  SER A OG    1 
ATOM   3279 N  N     . PRO A 1 420 ? 16.120 2.731   3.650   1.00 43.39 ? 417  PRO A N     1 
ATOM   3280 C  CA    . PRO A 1 420 ? 16.818 3.231   4.839   1.00 42.85 ? 417  PRO A CA    1 
ATOM   3281 C  C     . PRO A 1 420 ? 17.994 4.108   4.418   1.00 43.23 ? 417  PRO A C     1 
ATOM   3282 O  O     . PRO A 1 420 ? 18.548 3.892   3.340   1.00 46.48 ? 417  PRO A O     1 
ATOM   3283 C  CB    . PRO A 1 420 ? 17.310 1.953   5.522   1.00 43.41 ? 417  PRO A CB    1 
ATOM   3284 C  CG    . PRO A 1 420 ? 17.397 0.948   4.430   1.00 47.22 ? 417  PRO A CG    1 
ATOM   3285 C  CD    . PRO A 1 420 ? 16.302 1.282   3.464   1.00 43.93 ? 417  PRO A CD    1 
ATOM   3286 N  N     . PRO A 1 421 ? 18.369 5.087   5.256   1.00 40.59 ? 418  PRO A N     1 
ATOM   3287 C  CA    . PRO A 1 421 ? 19.398 6.072   4.901   1.00 37.05 ? 418  PRO A CA    1 
ATOM   3288 C  C     . PRO A 1 421 ? 20.686 5.426   4.398   1.00 25.55 ? 418  PRO A C     1 
ATOM   3289 O  O     . PRO A 1 421 ? 20.999 4.290   4.758   1.00 28.68 ? 418  PRO A O     1 
ATOM   3290 C  CB    . PRO A 1 421 ? 19.653 6.806   6.222   1.00 35.90 ? 418  PRO A CB    1 
ATOM   3291 C  CG    . PRO A 1 421 ? 18.384 6.638   6.992   1.00 46.33 ? 418  PRO A CG    1 
ATOM   3292 C  CD    . PRO A 1 421 ? 17.875 5.272   6.632   1.00 44.26 ? 418  PRO A CD    1 
ATOM   3293 N  N     . LEU A 1 422 ? 21.417 6.163   3.566   1.00 29.77 ? 419  LEU A N     1 
ATOM   3294 C  CA    . LEU A 1 422 ? 22.655 5.678   2.970   1.00 29.54 ? 419  LEU A CA    1 
ATOM   3295 C  C     . LEU A 1 422 ? 23.862 6.169   3.765   1.00 23.64 ? 419  LEU A C     1 
ATOM   3296 O  O     . LEU A 1 422 ? 23.982 7.358   4.067   1.00 29.64 ? 419  LEU A O     1 
ATOM   3297 C  CB    . LEU A 1 422 ? 22.767 6.135   1.509   1.00 23.00 ? 419  LEU A CB    1 
ATOM   3298 C  CG    . LEU A 1 422 ? 21.641 5.722   0.560   1.00 27.19 ? 419  LEU A CG    1 
ATOM   3299 C  CD1   . LEU A 1 422 ? 21.948 6.185   -0.868  1.00 26.62 ? 419  LEU A CD1   1 
ATOM   3300 C  CD2   . LEU A 1 422 ? 21.424 4.217   0.609   1.00 26.42 ? 419  LEU A CD2   1 
ATOM   3301 N  N     . THR A 1 423 ? 24.752 5.244   4.096   1.00 26.41 ? 420  THR A N     1 
ATOM   3302 C  CA    . THR A 1 423 ? 25.916 5.562   4.910   1.00 30.08 ? 420  THR A CA    1 
ATOM   3303 C  C     . THR A 1 423 ? 27.219 5.427   4.126   1.00 23.14 ? 420  THR A C     1 
ATOM   3304 O  O     . THR A 1 423 ? 28.303 5.537   4.693   1.00 24.73 ? 420  THR A O     1 
ATOM   3305 C  CB    . THR A 1 423 ? 25.980 4.639   6.118   1.00 27.59 ? 420  THR A CB    1 
ATOM   3306 O  OG1   . THR A 1 423 ? 25.900 3.281   5.663   1.00 32.80 ? 420  THR A OG1   1 
ATOM   3307 C  CG2   . THR A 1 423 ? 24.805 4.926   7.064   1.00 28.91 ? 420  THR A CG2   1 
ATOM   3308 N  N     . MET A 1 424 ? 27.106 5.190   2.823   1.00 20.10 ? 421  MET A N     1 
ATOM   3309 C  CA    . MET A 1 424 ? 28.285 5.136   1.952   1.00 18.19 ? 421  MET A CA    1 
ATOM   3310 C  C     . MET A 1 424 ? 27.864 5.236   0.495   1.00 22.16 ? 421  MET A C     1 
ATOM   3311 O  O     . MET A 1 424 ? 26.870 4.628   0.095   1.00 19.10 ? 421  MET A O     1 
ATOM   3312 C  CB    . MET A 1 424 ? 29.092 3.856   2.192   1.00 22.96 ? 421  MET A CB    1 
ATOM   3313 C  CG    . MET A 1 424 ? 30.416 3.763   1.391   1.00 21.99 ? 421  MET A CG    1 
ATOM   3314 S  SD    . MET A 1 424 ? 30.185 3.125   -0.286  1.00 27.21 ? 421  MET A SD    1 
ATOM   3315 C  CE    . MET A 1 424 ? 29.803 1.414   0.077   1.00 25.54 ? 421  MET A CE    1 
ATOM   3316 N  N     . LEU A 1 425 ? 28.601 6.037   -0.272  1.00 14.85 ? 422  LEU A N     1 
ATOM   3317 C  CA    . LEU A 1 425 ? 28.440 6.136   -1.717  1.00 15.28 ? 422  LEU A CA    1 
ATOM   3318 C  C     . LEU A 1 425 ? 29.820 5.922   -2.333  1.00 19.46 ? 422  LEU A C     1 
ATOM   3319 O  O     . LEU A 1 425 ? 30.833 6.348   -1.765  1.00 17.93 ? 422  LEU A O     1 
ATOM   3320 C  CB    . LEU A 1 425 ? 27.928 7.515   -2.130  1.00 14.33 ? 422  LEU A CB    1 
ATOM   3321 C  CG    . LEU A 1 425 ? 26.537 7.993   -1.716  1.00 22.87 ? 422  LEU A CG    1 
ATOM   3322 C  CD1   . LEU A 1 425 ? 26.304 9.410   -2.242  1.00 24.11 ? 422  LEU A CD1   1 
ATOM   3323 C  CD2   . LEU A 1 425 ? 25.454 7.051   -2.224  1.00 15.99 ? 422  LEU A CD2   1 
ATOM   3324 N  N     . PHE A 1 426 ? 29.861 5.257   -3.481  1.00 18.02 ? 423  PHE A N     1 
ATOM   3325 C  CA    . PHE A 1 426 ? 31.131 4.900   -4.112  1.00 17.03 ? 423  PHE A CA    1 
ATOM   3326 C  C     . PHE A 1 426 ? 30.940 4.861   -5.619  1.00 20.40 ? 423  PHE A C     1 
ATOM   3327 O  O     . PHE A 1 426 ? 30.051 4.161   -6.117  1.00 25.93 ? 423  PHE A O     1 
ATOM   3328 C  CB    . PHE A 1 426 ? 31.596 3.525   -3.604  1.00 19.68 ? 423  PHE A CB    1 
ATOM   3329 C  CG    . PHE A 1 426 ? 32.974 3.125   -4.073  1.00 23.23 ? 423  PHE A CG    1 
ATOM   3330 C  CD1   . PHE A 1 426 ? 33.352 1.794   -4.089  1.00 38.25 ? 423  PHE A CD1   1 
ATOM   3331 C  CD2   . PHE A 1 426 ? 33.898 4.080   -4.480  1.00 26.24 ? 423  PHE A CD2   1 
ATOM   3332 C  CE1   . PHE A 1 426 ? 34.617 1.419   -4.518  1.00 35.09 ? 423  PHE A CE1   1 
ATOM   3333 C  CE2   . PHE A 1 426 ? 35.169 3.712   -4.904  1.00 23.93 ? 423  PHE A CE2   1 
ATOM   3334 C  CZ    . PHE A 1 426 ? 35.527 2.384   -4.923  1.00 28.48 ? 423  PHE A CZ    1 
ATOM   3335 N  N     . LEU A 1 427 ? 31.740 5.638   -6.344  1.00 13.69 ? 424  LEU A N     1 
ATOM   3336 C  CA    . LEU A 1 427 ? 31.776 5.554   -7.803  1.00 15.88 ? 424  LEU A CA    1 
ATOM   3337 C  C     . LEU A 1 427 ? 33.157 5.123   -8.235  1.00 15.96 ? 424  LEU A C     1 
ATOM   3338 O  O     . LEU A 1 427 ? 34.147 5.671   -7.766  1.00 16.54 ? 424  LEU A O     1 
ATOM   3339 C  CB    . LEU A 1 427 ? 31.459 6.899   -8.456  1.00 14.73 ? 424  LEU A CB    1 
ATOM   3340 C  CG    . LEU A 1 427 ? 30.114 7.549   -8.159  1.00 17.53 ? 424  LEU A CG    1 
ATOM   3341 C  CD1   . LEU A 1 427 ? 30.048 8.923   -8.792  1.00 16.69 ? 424  LEU A CD1   1 
ATOM   3342 C  CD2   . LEU A 1 427 ? 28.955 6.673   -8.639  1.00 17.11 ? 424  LEU A CD2   1 
ATOM   3343 N  N     . CYS A 1 428 ? 33.224 4.151   -9.143  1.00 16.56 ? 425  CYS A N     1 
ATOM   3344 C  CA    . CYS A 1 428 ? 34.509 3.618   -9.584  1.00 18.80 ? 425  CYS A CA    1 
ATOM   3345 C  C     . CYS A 1 428 ? 34.527 3.374   -11.095 1.00 19.41 ? 425  CYS A C     1 
ATOM   3346 O  O     . CYS A 1 428 ? 33.648 2.697   -11.640 1.00 18.90 ? 425  CYS A O     1 
ATOM   3347 C  CB    . CYS A 1 428 ? 34.839 2.328   -8.826  1.00 21.60 ? 425  CYS A CB    1 
ATOM   3348 S  SG    . CYS A 1 428 ? 36.493 1.656   -9.162  1.00 28.89 ? 425  CYS A SG    1 
ATOM   3349 N  N     . ALA A 1 429 ? 35.510 3.956   -11.766 1.00 19.08 ? 426  ALA A N     1 
ATOM   3350 C  CA    . ALA A 1 429 ? 35.673 3.767   -13.197 1.00 18.27 ? 426  ALA A CA    1 
ATOM   3351 C  C     . ALA A 1 429 ? 36.637 2.610   -13.405 1.00 22.62 ? 426  ALA A C     1 
ATOM   3352 O  O     . ALA A 1 429 ? 37.693 2.546   -12.764 1.00 18.55 ? 426  ALA A O     1 
ATOM   3353 C  CB    . ALA A 1 429 ? 36.208 5.026   -13.835 1.00 14.94 ? 426  ALA A CB    1 
ATOM   3354 N  N     . THR A 1 430 ? 36.264 1.697   -14.298 1.00 20.71 ? 427  THR A N     1 
ATOM   3355 C  CA    . THR A 1 430 ? 36.984 0.447   -14.462 1.00 23.02 ? 427  THR A CA    1 
ATOM   3356 C  C     . THR A 1 430 ? 36.994 0.047   -15.925 1.00 21.33 ? 427  THR A C     1 
ATOM   3357 O  O     . THR A 1 430 ? 36.362 0.699   -16.753 1.00 17.35 ? 427  THR A O     1 
ATOM   3358 C  CB    . THR A 1 430 ? 36.310 -0.706  -13.674 1.00 22.26 ? 427  THR A CB    1 
ATOM   3359 O  OG1   . THR A 1 430 ? 35.035 -1.000  -14.257 1.00 29.04 ? 427  THR A OG1   1 
ATOM   3360 C  CG2   . THR A 1 430 ? 36.118 -0.338  -12.196 1.00 24.41 ? 427  THR A CG2   1 
ATOM   3361 N  N     . LYS A 1 431 ? 37.703 -1.039  -16.227 1.00 21.69 ? 428  LYS A N     1 
ATOM   3362 C  CA    . LYS A 1 431 ? 37.725 -1.614  -17.570 1.00 24.19 ? 428  LYS A CA    1 
ATOM   3363 C  C     . LYS A 1 431 ? 38.260 -0.620  -18.596 1.00 19.74 ? 428  LYS A C     1 
ATOM   3364 O  O     . LYS A 1 431 ? 37.551 -0.204  -19.520 1.00 22.97 ? 428  LYS A O     1 
ATOM   3365 C  CB    . LYS A 1 431 ? 36.333 -2.097  -17.966 1.00 22.85 ? 428  LYS A CB    1 
ATOM   3366 C  CG    . LYS A 1 431 ? 35.816 -3.246  -17.111 1.00 34.56 ? 428  LYS A CG    1 
ATOM   3367 C  CD    . LYS A 1 431 ? 34.591 -3.890  -17.753 1.00 37.99 ? 428  LYS A CD    1 
ATOM   3368 C  CE    . LYS A 1 431 ? 34.120 -5.114  -16.975 1.00 46.45 ? 428  LYS A CE    1 
ATOM   3369 N  NZ    . LYS A 1 431 ? 35.221 -6.083  -16.726 1.00 45.57 ? 428  LYS A NZ    1 
ATOM   3370 N  N     . PHE A 1 432 ? 39.513 -0.229  -18.408 1.00 22.50 ? 429  PHE A N     1 
ATOM   3371 C  CA    . PHE A 1 432 ? 40.165 0.729   -19.282 1.00 20.46 ? 429  PHE A CA    1 
ATOM   3372 C  C     . PHE A 1 432 ? 40.504 0.111   -20.641 1.00 29.69 ? 429  PHE A C     1 
ATOM   3373 O  O     . PHE A 1 432 ? 40.761 -1.099  -20.738 1.00 25.68 ? 429  PHE A O     1 
ATOM   3374 C  CB    . PHE A 1 432 ? 41.451 1.245   -18.629 1.00 19.68 ? 429  PHE A CB    1 
ATOM   3375 C  CG    . PHE A 1 432 ? 41.222 2.261   -17.547 1.00 21.77 ? 429  PHE A CG    1 
ATOM   3376 C  CD1   . PHE A 1 432 ? 41.069 3.600   -17.859 1.00 16.92 ? 429  PHE A CD1   1 
ATOM   3377 C  CD2   . PHE A 1 432 ? 41.165 1.879   -16.215 1.00 23.23 ? 429  PHE A CD2   1 
ATOM   3378 C  CE1   . PHE A 1 432 ? 40.856 4.542   -16.868 1.00 18.65 ? 429  PHE A CE1   1 
ATOM   3379 C  CE2   . PHE A 1 432 ? 40.955 2.812   -15.218 1.00 25.19 ? 429  PHE A CE2   1 
ATOM   3380 C  CZ    . PHE A 1 432 ? 40.802 4.150   -15.544 1.00 21.10 ? 429  PHE A CZ    1 
ATOM   3381 N  N     . SER A 1 433 ? 40.505 0.950   -21.678 1.00 24.24 ? 430  SER A N     1 
ATOM   3382 C  CA    . SER A 1 433 ? 40.965 0.570   -23.017 1.00 22.22 ? 430  SER A CA    1 
ATOM   3383 C  C     . SER A 1 433 ? 41.877 1.656   -23.558 1.00 27.36 ? 430  SER A C     1 
ATOM   3384 O  O     . SER A 1 433 ? 41.762 2.823   -23.178 1.00 22.36 ? 430  SER A O     1 
ATOM   3385 C  CB    . SER A 1 433 ? 39.774 0.400   -23.971 1.00 24.64 ? 430  SER A CB    1 
ATOM   3386 O  OG    . SER A 1 433 ? 38.776 -0.440  -23.421 1.00 40.51 ? 430  SER A OG    1 
ATOM   3387 N  N     . ALA A 1 434 ? 42.784 1.274   -24.448 1.00 29.06 ? 431  ALA A N     1 
ATOM   3388 C  CA    . ALA A 1 434 ? 43.724 2.225   -25.017 1.00 28.37 ? 431  ALA A CA    1 
ATOM   3389 C  C     . ALA A 1 434 ? 42.980 3.307   -25.780 1.00 30.97 ? 431  ALA A C     1 
ATOM   3390 O  O     . ALA A 1 434 ? 41.931 3.049   -26.374 1.00 35.14 ? 431  ALA A O     1 
ATOM   3391 C  CB    . ALA A 1 434 ? 44.724 1.517   -25.927 1.00 32.91 ? 431  ALA A CB    1 
ATOM   3392 N  N     . SER A 1 435 ? 43.521 4.521   -25.750 1.00 29.39 ? 432  SER A N     1 
ATOM   3393 C  CA    . SER A 1 435 ? 42.949 5.629   -26.506 1.00 33.34 ? 432  SER A CA    1 
ATOM   3394 C  C     . SER A 1 435 ? 44.056 6.539   -27.024 1.00 38.82 ? 432  SER A C     1 
ATOM   3395 O  O     . SER A 1 435 ? 43.791 7.605   -27.577 1.00 40.19 ? 432  SER A O     1 
ATOM   3396 C  CB    . SER A 1 435 ? 41.979 6.426   -25.641 1.00 31.03 ? 432  SER A CB    1 
ATOM   3397 O  OG    . SER A 1 435 ? 42.643 6.946   -24.503 1.00 42.32 ? 432  SER A OG    1 
ATOM   3398 O  OXT   . SER A 1 435 ? 45.243 6.229   -26.897 1.00 45.10 ? 432  SER A OXT   1 
ATOM   3399 O  "O3'" . DC  B 2 1   ? 28.155 4.643   11.660  1.00 59.05 ? 1    DC  T "O3'" 1 
ATOM   3400 P  P     . DA  B 2 2   ? 28.389 4.286   13.211  1.00 76.38 ? 2    DA  T P     1 
ATOM   3401 O  OP1   . DA  B 2 2   ? 28.302 2.813   13.362  1.00 75.28 ? 2    DA  T OP1   1 
ATOM   3402 O  OP2   . DA  B 2 2   ? 27.520 5.173   14.019  1.00 64.47 ? 2    DA  T OP2   1 
ATOM   3403 O  "O5'" . DA  B 2 2   ? 29.895 4.744   13.478  1.00 59.45 ? 2    DA  T "O5'" 1 
ATOM   3404 C  "C5'" . DA  B 2 2   ? 30.939 4.398   12.583  1.00 57.81 ? 2    DA  T "C5'" 1 
ATOM   3405 C  "C4'" . DA  B 2 2   ? 32.185 5.163   12.978  1.00 54.66 ? 2    DA  T "C4'" 1 
ATOM   3406 O  "O4'" . DA  B 2 2   ? 32.004 6.567   12.666  1.00 49.21 ? 2    DA  T "O4'" 1 
ATOM   3407 C  "C3'" . DA  B 2 2   ? 32.498 5.113   14.471  1.00 51.74 ? 2    DA  T "C3'" 1 
ATOM   3408 O  "O3'" . DA  B 2 2   ? 33.896 5.184   14.667  1.00 51.52 ? 2    DA  T "O3'" 1 
ATOM   3409 C  "C2'" . DA  B 2 2   ? 31.812 6.362   15.006  1.00 49.56 ? 2    DA  T "C2'" 1 
ATOM   3410 C  "C1'" . DA  B 2 2   ? 32.084 7.325   13.859  1.00 47.11 ? 2    DA  T "C1'" 1 
ATOM   3411 N  N9    . DA  B 2 2   ? 31.124 8.420   13.782  1.00 43.95 ? 2    DA  T N9    1 
ATOM   3412 C  C8    . DA  B 2 2   ? 29.876 8.495   14.338  1.00 41.59 ? 2    DA  T C8    1 
ATOM   3413 N  N7    . DA  B 2 2   ? 29.252 9.624   14.083  1.00 40.02 ? 2    DA  T N7    1 
ATOM   3414 C  C5    . DA  B 2 2   ? 30.158 10.331  13.311  1.00 35.95 ? 2    DA  T C5    1 
ATOM   3415 C  C6    . DA  B 2 2   ? 30.112 11.605  12.715  1.00 39.02 ? 2    DA  T C6    1 
ATOM   3416 N  N6    . DA  B 2 2   ? 29.064 12.432  12.811  1.00 43.59 ? 2    DA  T N6    1 
ATOM   3417 N  N1    . DA  B 2 2   ? 31.194 11.996  12.010  1.00 33.73 ? 2    DA  T N1    1 
ATOM   3418 C  C2    . DA  B 2 2   ? 32.245 11.178  11.906  1.00 35.03 ? 2    DA  T C2    1 
ATOM   3419 N  N3    . DA  B 2 2   ? 32.407 9.960   12.419  1.00 38.97 ? 2    DA  T N3    1 
ATOM   3420 C  C4    . DA  B 2 2   ? 31.315 9.600   13.115  1.00 37.95 ? 2    DA  T C4    1 
ATOM   3421 P  P     . DT  B 2 3   ? 34.724 3.860   15.034  1.00 49.14 ? 3    DT  T P     1 
ATOM   3422 O  OP1   . DT  B 2 3   ? 33.755 2.757   15.221  1.00 53.01 ? 3    DT  T OP1   1 
ATOM   3423 O  OP2   . DT  B 2 3   ? 35.695 4.212   16.095  1.00 53.42 ? 3    DT  T OP2   1 
ATOM   3424 O  "O5'" . DT  B 2 3   ? 35.551 3.548   13.700  1.00 49.25 ? 3    DT  T "O5'" 1 
ATOM   3425 C  "C5'" . DT  B 2 3   ? 36.892 3.994   13.556  1.00 49.08 ? 3    DT  T "C5'" 1 
ATOM   3426 C  "C4'" . DT  B 2 3   ? 36.956 5.057   12.479  1.00 47.40 ? 3    DT  T "C4'" 1 
ATOM   3427 O  "O4'" . DT  B 2 3   ? 38.340 5.297   12.121  1.00 53.26 ? 3    DT  T "O4'" 1 
ATOM   3428 C  "C3'" . DT  B 2 3   ? 36.215 4.677   11.200  1.00 51.29 ? 3    DT  T "C3'" 1 
ATOM   3429 O  "O3'" . DT  B 2 3   ? 35.320 5.715   10.820  1.00 42.25 ? 3    DT  T "O3'" 1 
ATOM   3430 C  "C2'" . DT  B 2 3   ? 37.310 4.461   10.160  1.00 43.79 ? 3    DT  T "C2'" 1 
ATOM   3431 C  "C1'" . DT  B 2 3   ? 38.506 5.228   10.717  1.00 48.84 ? 3    DT  T "C1'" 1 
ATOM   3432 N  N1    . DT  B 2 3   ? 39.803 4.535   10.438  1.00 51.55 ? 3    DT  T N1    1 
ATOM   3433 C  C2    . DT  B 2 3   ? 40.873 5.236   9.904   1.00 41.91 ? 3    DT  T C2    1 
ATOM   3434 O  O2    . DT  B 2 3   ? 40.834 6.428   9.640   1.00 46.13 ? 3    DT  T O2    1 
ATOM   3435 N  N3    . DT  B 2 3   ? 42.005 4.479   9.695   1.00 38.07 ? 3    DT  T N3    1 
ATOM   3436 C  C4    . DT  B 2 3   ? 42.157 3.125   9.960   1.00 39.76 ? 3    DT  T C4    1 
ATOM   3437 O  O4    . DT  B 2 3   ? 43.208 2.532   9.737   1.00 44.91 ? 3    DT  T O4    1 
ATOM   3438 C  C5    . DT  B 2 3   ? 40.999 2.455   10.511  1.00 42.61 ? 3    DT  T C5    1 
ATOM   3439 C  C7    . DT  B 2 3   ? 41.041 0.988   10.842  1.00 45.20 ? 3    DT  T C7    1 
ATOM   3440 C  C6    . DT  B 2 3   ? 39.895 3.183   10.721  1.00 47.02 ? 3    DT  T C6    1 
ATOM   3441 P  P     . DT  B 2 4   ? 34.641 5.699   9.365   1.00 52.48 ? 4    DT  T P     1 
ATOM   3442 O  OP1   . DT  B 2 4   ? 33.449 6.582   9.407   1.00 39.73 ? 4    DT  T OP1   1 
ATOM   3443 O  OP2   . DT  B 2 4   ? 34.547 4.289   8.921   1.00 40.63 ? 4    DT  T OP2   1 
ATOM   3444 O  "O5'" . DT  B 2 4   ? 35.736 6.395   8.433   1.00 40.89 ? 4    DT  T "O5'" 1 
ATOM   3445 C  "C5'" . DT  B 2 4   ? 35.996 7.785   8.547   1.00 30.51 ? 4    DT  T "C5'" 1 
ATOM   3446 C  "C4'" . DT  B 2 4   ? 36.756 8.206   7.309   1.00 25.45 ? 4    DT  T "C4'" 1 
ATOM   3447 O  "O4'" . DT  B 2 4   ? 37.988 7.456   7.231   1.00 23.13 ? 4    DT  T "O4'" 1 
ATOM   3448 C  "C3'" . DT  B 2 4   ? 36.027 7.909   6.014   1.00 19.52 ? 4    DT  T "C3'" 1 
ATOM   3449 O  "O3'" . DT  B 2 4   ? 36.351 8.937   5.113   1.00 22.32 ? 4    DT  T "O3'" 1 
ATOM   3450 C  "C2'" . DT  B 2 4   ? 36.590 6.554   5.591   1.00 23.74 ? 4    DT  T "C2'" 1 
ATOM   3451 C  "C1'" . DT  B 2 4   ? 38.036 6.726   6.024   1.00 27.53 ? 4    DT  T "C1'" 1 
ATOM   3452 N  N1    . DT  B 2 4   ? 38.770 5.472   6.324   1.00 23.51 ? 4    DT  T N1    1 
ATOM   3453 C  C2    . DT  B 2 4   ? 40.091 5.424   5.956   1.00 22.72 ? 4    DT  T C2    1 
ATOM   3454 O  O2    . DT  B 2 4   ? 40.660 6.349   5.396   1.00 19.61 ? 4    DT  T O2    1 
ATOM   3455 N  N3    . DT  B 2 4   ? 40.713 4.244   6.266   1.00 28.83 ? 4    DT  T N3    1 
ATOM   3456 C  C4    . DT  B 2 4   ? 40.173 3.140   6.896   1.00 23.30 ? 4    DT  T C4    1 
ATOM   3457 O  O4    . DT  B 2 4   ? 40.843 2.139   7.122   1.00 23.12 ? 4    DT  T O4    1 
ATOM   3458 C  C5    . DT  B 2 4   ? 38.785 3.257   7.262   1.00 35.91 ? 4    DT  T C5    1 
ATOM   3459 C  C7    . DT  B 2 4   ? 38.103 2.105   7.952   1.00 28.10 ? 4    DT  T C7    1 
ATOM   3460 C  C6    . DT  B 2 4   ? 38.153 4.409   6.964   1.00 27.88 ? 4    DT  T C6    1 
ATOM   3461 P  P     . DA  B 2 5   ? 35.662 8.987   3.672   1.00 17.98 ? 5    DA  T P     1 
ATOM   3462 O  OP1   . DA  B 2 5   ? 35.298 10.384  3.395   1.00 21.25 ? 5    DA  T OP1   1 
ATOM   3463 O  OP2   . DA  B 2 5   ? 34.630 7.927   3.621   1.00 17.91 ? 5    DA  T OP2   1 
ATOM   3464 O  "O5'" . DA  B 2 5   ? 36.838 8.534   2.687   1.00 17.66 ? 5    DA  T "O5'" 1 
ATOM   3465 C  "C5'" . DA  B 2 5   ? 37.990 9.365   2.522   1.00 14.36 ? 5    DA  T "C5'" 1 
ATOM   3466 C  "C4'" . DA  B 2 5   ? 38.969 8.698   1.579   1.00 15.24 ? 5    DA  T "C4'" 1 
ATOM   3467 O  "O4'" . DA  B 2 5   ? 39.508 7.483   2.180   1.00 17.42 ? 5    DA  T "O4'" 1 
ATOM   3468 C  "C3'" . DA  B 2 5   ? 38.336 8.275   0.258   1.00 14.98 ? 5    DA  T "C3'" 1 
ATOM   3469 O  "O3'" . DA  B 2 5   ? 39.244 8.559   -0.804  1.00 16.27 ? 5    DA  T "O3'" 1 
ATOM   3470 C  "C2'" . DA  B 2 5   ? 38.143 6.771   0.429   1.00 19.49 ? 5    DA  T "C2'" 1 
ATOM   3471 C  "C1'" . DA  B 2 5   ? 39.392 6.432   1.243   1.00 20.80 ? 5    DA  T "C1'" 1 
ATOM   3472 N  N9    . DA  B 2 5   ? 39.296 5.186   1.988   1.00 18.13 ? 5    DA  T N9    1 
ATOM   3473 C  C8    . DA  B 2 5   ? 38.196 4.678   2.616   1.00 18.74 ? 5    DA  T C8    1 
ATOM   3474 N  N7    . DA  B 2 5   ? 38.426 3.529   3.221   1.00 20.27 ? 5    DA  T N7    1 
ATOM   3475 C  C5    . DA  B 2 5   ? 39.763 3.279   2.970   1.00 20.85 ? 5    DA  T C5    1 
ATOM   3476 C  C6    . DA  B 2 5   ? 40.613 2.213   3.327   1.00 22.39 ? 5    DA  T C6    1 
ATOM   3477 N  N6    . DA  B 2 5   ? 40.206 1.170   4.057   1.00 21.23 ? 5    DA  T N6    1 
ATOM   3478 N  N1    . DA  B 2 5   ? 41.899 2.271   2.916   1.00 22.38 ? 5    DA  T N1    1 
ATOM   3479 C  C2    . DA  B 2 5   ? 42.294 3.319   2.182   1.00 21.86 ? 5    DA  T C2    1 
ATOM   3480 N  N3    . DA  B 2 5   ? 41.584 4.374   1.780   1.00 18.06 ? 5    DA  T N3    1 
ATOM   3481 C  C4    . DA  B 2 5   ? 40.315 4.289   2.213   1.00 18.01 ? 5    DA  T C4    1 
ATOM   3482 P  P     . DT  B 2 6   ? 38.737 8.539   -2.331  1.00 16.24 ? 6    DT  T P     1 
ATOM   3483 O  OP1   . DT  B 2 6   ? 39.884 8.902   -3.181  1.00 17.54 ? 6    DT  T OP1   1 
ATOM   3484 O  OP2   . DT  B 2 6   ? 37.490 9.305   -2.407  1.00 18.11 ? 6    DT  T OP2   1 
ATOM   3485 O  "O5'" . DT  B 2 6   ? 38.350 7.007   -2.570  1.00 18.78 ? 6    DT  T "O5'" 1 
ATOM   3486 C  "C5'" . DT  B 2 6   ? 39.090 6.163   -3.447  1.00 18.12 ? 6    DT  T "C5'" 1 
ATOM   3487 C  "C4'" . DT  B 2 6   ? 40.363 5.585   -2.855  1.00 19.63 ? 6    DT  T "C4'" 1 
ATOM   3488 O  "O4'" . DT  B 2 6   ? 40.085 4.906   -1.613  1.00 18.50 ? 6    DT  T "O4'" 1 
ATOM   3489 C  "C3'" . DT  B 2 6   ? 40.936 4.512   -3.769  1.00 20.77 ? 6    DT  T "C3'" 1 
ATOM   3490 O  "O3'" . DT  B 2 6   ? 41.995 5.044   -4.510  1.00 20.56 ? 6    DT  T "O3'" 1 
ATOM   3491 C  "C2'" . DT  B 2 6   ? 41.427 3.380   -2.876  1.00 25.46 ? 6    DT  T "C2'" 1 
ATOM   3492 C  "C1'" . DT  B 2 6   ? 40.927 3.781   -1.496  1.00 20.98 ? 6    DT  T "C1'" 1 
ATOM   3493 N  N1    . DT  B 2 6   ? 40.193 2.717   -0.784  1.00 20.02 ? 6    DT  T N1    1 
ATOM   3494 C  C2    . DT  B 2 6   ? 40.931 1.660   -0.305  1.00 17.37 ? 6    DT  T C2    1 
ATOM   3495 O  O2    . DT  B 2 6   ? 42.128 1.556   -0.470  1.00 20.44 ? 6    DT  T O2    1 
ATOM   3496 N  N3    . DT  B 2 6   ? 40.210 0.723   0.376   1.00 16.93 ? 6    DT  T N3    1 
ATOM   3497 C  C4    . DT  B 2 6   ? 38.857 0.742   0.633   1.00 21.59 ? 6    DT  T C4    1 
ATOM   3498 O  O4    . DT  B 2 6   ? 38.307 -0.151  1.266   1.00 22.03 ? 6    DT  T O4    1 
ATOM   3499 C  C5    . DT  B 2 6   ? 38.140 1.876   0.116   1.00 25.31 ? 6    DT  T C5    1 
ATOM   3500 C  C7    . DT  B 2 6   ? 36.656 1.958   0.355   1.00 23.61 ? 6    DT  T C7    1 
ATOM   3501 C  C6    . DT  B 2 6   ? 38.832 2.807   -0.563  1.00 18.27 ? 6    DT  T C6    1 
ATOM   3502 P  P     . DG  B 2 7   ? 42.135 4.686   -6.066  1.00 18.45 ? 7    DG  T P     1 
ATOM   3503 O  OP1   . DG  B 2 7   ? 43.258 5.476   -6.607  1.00 22.65 ? 7    DG  T OP1   1 
ATOM   3504 O  OP2   . DG  B 2 7   ? 40.789 4.708   -6.666  1.00 16.62 ? 7    DG  T OP2   1 
ATOM   3505 O  "O5'" . DG  B 2 7   ? 42.509 3.111   -6.070  1.00 22.20 ? 7    DG  T "O5'" 1 
ATOM   3506 C  "C5'" . DG  B 2 7   ? 43.815 2.671   -5.757  1.00 26.98 ? 7    DG  T "C5'" 1 
ATOM   3507 C  "C4'" . DG  B 2 7   ? 43.874 1.154   -5.652  1.00 19.98 ? 7    DG  T "C4'" 1 
ATOM   3508 O  "O4'" . DG  B 2 7   ? 43.171 0.719   -4.469  1.00 21.64 ? 7    DG  T "O4'" 1 
ATOM   3509 C  "C3'" . DG  B 2 7   ? 43.253 0.390   -6.817  1.00 24.07 ? 7    DG  T "C3'" 1 
ATOM   3510 O  "O3'" . DG  B 2 7   ? 44.281 -0.305  -7.498  1.00 25.18 ? 7    DG  T "O3'" 1 
ATOM   3511 C  "C2'" . DG  B 2 7   ? 42.252 -0.568  -6.172  1.00 24.00 ? 7    DG  T "C2'" 1 
ATOM   3512 C  "C1'" . DG  B 2 7   ? 42.715 -0.583  -4.724  1.00 23.56 ? 7    DG  T "C1'" 1 
ATOM   3513 N  N9    . DG  B 2 7   ? 41.649 -0.925  -3.791  1.00 23.42 ? 7    DG  T N9    1 
ATOM   3514 C  C8    . DG  B 2 7   ? 40.443 -0.297  -3.610  1.00 18.25 ? 7    DG  T C8    1 
ATOM   3515 N  N7    . DG  B 2 7   ? 39.699 -0.858  -2.693  1.00 23.39 ? 7    DG  T N7    1 
ATOM   3516 C  C5    . DG  B 2 7   ? 40.467 -1.936  -2.264  1.00 24.16 ? 7    DG  T C5    1 
ATOM   3517 C  C6    . DG  B 2 7   ? 40.191 -2.922  -1.295  1.00 18.37 ? 7    DG  T C6    1 
ATOM   3518 O  O6    . DG  B 2 7   ? 39.177 -3.032  -0.600  1.00 18.74 ? 7    DG  T O6    1 
ATOM   3519 N  N1    . DG  B 2 7   ? 41.237 -3.836  -1.168  1.00 19.34 ? 7    DG  T N1    1 
ATOM   3520 C  C2    . DG  B 2 7   ? 42.408 -3.807  -1.890  1.00 24.44 ? 7    DG  T C2    1 
ATOM   3521 N  N2    . DG  B 2 7   ? 43.304 -4.774  -1.628  1.00 19.17 ? 7    DG  T N2    1 
ATOM   3522 N  N3    . DG  B 2 7   ? 42.679 -2.884  -2.801  1.00 25.95 ? 7    DG  T N3    1 
ATOM   3523 C  C4    . DG  B 2 7   ? 41.666 -1.990  -2.928  1.00 22.83 ? 7    DG  T C4    1 
ATOM   3524 P  P     . DA  B 2 8   ? 43.928 -1.275  -8.730  1.00 22.77 ? 8    DA  T P     1 
ATOM   3525 O  OP1   . DA  B 2 8   ? 44.928 -1.051  -9.779  1.00 23.45 ? 8    DA  T OP1   1 
ATOM   3526 O  OP2   . DA  B 2 8   ? 42.476 -1.176  -9.008  1.00 26.39 ? 8    DA  T OP2   1 
ATOM   3527 O  "O5'" . DA  B 2 8   ? 44.178 -2.742  -8.137  1.00 25.93 ? 8    DA  T "O5'" 1 
ATOM   3528 C  "C5'" . DA  B 2 8   ? 45.415 -3.017  -7.490  1.00 22.29 ? 8    DA  T "C5'" 1 
ATOM   3529 C  "C4'" . DA  B 2 8   ? 45.493 -4.481  -7.113  1.00 22.05 ? 8    DA  T "C4'" 1 
ATOM   3530 O  "O4'" . DA  B 2 8   ? 44.642 -4.695  -5.959  1.00 28.71 ? 8    DA  T "O4'" 1 
ATOM   3531 C  "C3'" . DA  B 2 8   ? 45.014 -5.429  -8.211  1.00 25.23 ? 8    DA  T "C3'" 1 
ATOM   3532 O  "O3'" . DA  B 2 8   ? 45.823 -6.597  -8.258  1.00 22.16 ? 8    DA  T "O3'" 1 
ATOM   3533 C  "C2'" . DA  B 2 8   ? 43.597 -5.768  -7.778  1.00 28.15 ? 8    DA  T "C2'" 1 
ATOM   3534 C  "C1'" . DA  B 2 8   ? 43.691 -5.689  -6.258  1.00 32.07 ? 8    DA  T "C1'" 1 
ATOM   3535 N  N9    . DA  B 2 8   ? 42.394 -5.337  -5.698  1.00 27.51 ? 8    DA  T N9    1 
ATOM   3536 C  C8    . DA  B 2 8   ? 41.584 -4.311  -6.104  1.00 27.17 ? 8    DA  T C8    1 
ATOM   3537 N  N7    . DA  B 2 8   ? 40.462 -4.240  -5.440  1.00 23.40 ? 8    DA  T N7    1 
ATOM   3538 C  C5    . DA  B 2 8   ? 40.537 -5.299  -4.545  1.00 24.74 ? 8    DA  T C5    1 
ATOM   3539 C  C6    . DA  B 2 8   ? 39.651 -5.774  -3.559  1.00 21.70 ? 8    DA  T C6    1 
ATOM   3540 N  N6    . DA  B 2 8   ? 38.465 -5.211  -3.289  1.00 18.36 ? 8    DA  T N6    1 
ATOM   3541 N  N1    . DA  B 2 8   ? 40.044 -6.855  -2.843  1.00 23.67 ? 8    DA  T N1    1 
ATOM   3542 C  C2    . DA  B 2 8   ? 41.227 -7.418  -3.109  1.00 19.08 ? 8    DA  T C2    1 
ATOM   3543 N  N3    . DA  B 2 8   ? 42.142 -7.068  -4.010  1.00 22.18 ? 8    DA  T N3    1 
ATOM   3544 C  C4    . DA  B 2 8   ? 41.725 -5.990  -4.697  1.00 26.66 ? 8    DA  T C4    1 
ATOM   3545 P  P     . DC  B 2 9   ? 45.684 -7.636  -9.477  1.00 31.33 ? 9    DC  T P     1 
ATOM   3546 O  OP1   . DC  B 2 9   ? 47.036 -8.115  -9.815  1.00 27.20 ? 9    DC  T OP1   1 
ATOM   3547 O  OP2   . DC  B 2 9   ? 44.842 -7.020  -10.526 1.00 30.86 ? 9    DC  T OP2   1 
ATOM   3548 O  "O5'" . DC  B 2 9   ? 44.847 -8.839  -8.846  1.00 22.72 ? 9    DC  T "O5'" 1 
ATOM   3549 C  "C5'" . DC  B 2 9   ? 45.395 -9.429  -7.683  1.00 24.33 ? 9    DC  T "C5'" 1 
ATOM   3550 C  "C4'" . DC  B 2 9   ? 44.368 -10.332 -7.056  1.00 28.55 ? 9    DC  T "C4'" 1 
ATOM   3551 O  "O4'" . DC  B 2 9   ? 43.288 -9.534  -6.514  1.00 30.45 ? 9    DC  T "O4'" 1 
ATOM   3552 C  "C3'" . DC  B 2 9   ? 43.736 -11.303 -8.046  1.00 27.23 ? 9    DC  T "C3'" 1 
ATOM   3553 O  "O3'" . DC  B 2 9   ? 43.652 -12.547 -7.400  1.00 34.83 ? 9    DC  T "O3'" 1 
ATOM   3554 C  "C2'" . DC  B 2 9   ? 42.349 -10.712 -8.262  1.00 23.41 ? 9    DC  T "C2'" 1 
ATOM   3555 C  "C1'" . DC  B 2 9   ? 42.087 -10.180 -6.861  1.00 29.52 ? 9    DC  T "C1'" 1 
ATOM   3556 N  N1    . DC  B 2 9   ? 40.954 -9.231  -6.796  1.00 25.36 ? 9    DC  T N1    1 
ATOM   3557 C  C2    . DC  B 2 9   ? 40.061 -9.344  -5.736  1.00 23.34 ? 9    DC  T C2    1 
ATOM   3558 O  O2    . DC  B 2 9   ? 40.257 -10.218 -4.881  1.00 27.23 ? 9    DC  T O2    1 
ATOM   3559 N  N3    . DC  B 2 9   ? 39.014 -8.497  -5.669  1.00 26.41 ? 9    DC  T N3    1 
ATOM   3560 C  C4    . DC  B 2 9   ? 38.843 -7.568  -6.613  1.00 26.16 ? 9    DC  T C4    1 
ATOM   3561 N  N4    . DC  B 2 9   ? 37.787 -6.763  -6.491  1.00 23.37 ? 9    DC  T N4    1 
ATOM   3562 C  C5    . DC  B 2 9   ? 39.739 -7.438  -7.712  1.00 29.65 ? 9    DC  T C5    1 
ATOM   3563 C  C6    . DC  B 2 9   ? 40.775 -8.288  -7.765  1.00 28.31 ? 9    DC  T C6    1 
ATOM   3564 P  P     . DG  B 2 10  ? 43.513 -13.903 -8.249  1.00 34.14 ? 10   DG  T P     1 
ATOM   3565 O  OP1   . DG  B 2 10  ? 44.836 -14.557 -8.277  1.00 40.73 ? 10   DG  T OP1   1 
ATOM   3566 O  OP2   . DG  B 2 10  ? 42.810 -13.592 -9.515  1.00 29.13 ? 10   DG  T OP2   1 
ATOM   3567 O  "O5'" . DG  B 2 10  ? 42.520 -14.782 -7.368  1.00 30.65 ? 10   DG  T "O5'" 1 
ATOM   3568 C  "C5'" . DG  B 2 10  ? 42.545 -14.649 -5.959  1.00 30.72 ? 10   DG  T "C5'" 1 
ATOM   3569 C  "C4'" . DG  B 2 10  ? 41.362 -15.372 -5.354  1.00 24.43 ? 10   DG  T "C4'" 1 
ATOM   3570 O  "O4'" . DG  B 2 10  ? 40.285 -14.431 -5.116  1.00 30.75 ? 10   DG  T "O4'" 1 
ATOM   3571 C  "C3'" . DG  B 2 10  ? 40.776 -16.483 -6.223  1.00 33.61 ? 10   DG  T "C3'" 1 
ATOM   3572 O  "O3'" . DG  B 2 10  ? 40.280 -17.510 -5.368  1.00 31.95 ? 10   DG  T "O3'" 1 
ATOM   3573 C  "C2'" . DG  B 2 10  ? 39.663 -15.760 -6.974  1.00 26.27 ? 10   DG  T "C2'" 1 
ATOM   3574 C  "C1'" . DG  B 2 10  ? 39.175 -14.761 -5.931  1.00 29.10 ? 10   DG  T "C1'" 1 
ATOM   3575 N  N9    . DG  B 2 10  ? 38.643 -13.528 -6.512  1.00 25.47 ? 10   DG  T N9    1 
ATOM   3576 C  C8    . DG  B 2 10  ? 39.234 -12.716 -7.447  1.00 26.26 ? 10   DG  T C8    1 
ATOM   3577 N  N7    . DG  B 2 10  ? 38.507 -11.683 -7.773  1.00 23.67 ? 10   DG  T N7    1 
ATOM   3578 C  C5    . DG  B 2 10  ? 37.360 -11.812 -7.000  1.00 24.78 ? 10   DG  T C5    1 
ATOM   3579 C  C6    . DG  B 2 10  ? 36.208 -10.991 -6.923  1.00 22.20 ? 10   DG  T C6    1 
ATOM   3580 O  O6    . DG  B 2 10  ? 35.961 -9.946  -7.538  1.00 27.81 ? 10   DG  T O6    1 
ATOM   3581 N  N1    . DG  B 2 10  ? 35.281 -11.492 -6.013  1.00 27.94 ? 10   DG  T N1    1 
ATOM   3582 C  C2    . DG  B 2 10  ? 35.443 -12.650 -5.280  1.00 25.45 ? 10   DG  T C2    1 
ATOM   3583 N  N2    . DG  B 2 10  ? 34.439 -12.969 -4.456  1.00 24.63 ? 10   DG  T N2    1 
ATOM   3584 N  N3    . DG  B 2 10  ? 36.516 -13.432 -5.340  1.00 25.40 ? 10   DG  T N3    1 
ATOM   3585 C  C4    . DG  B 2 10  ? 37.431 -12.946 -6.216  1.00 23.75 ? 10   DG  T C4    1 
ATOM   3586 P  P     . DC  B 2 11  ? 39.578 -18.818 -5.987  1.00 29.93 ? 11   DC  T P     1 
ATOM   3587 O  OP1   . DC  B 2 11  ? 40.095 -19.993 -5.262  1.00 35.10 ? 11   DC  T OP1   1 
ATOM   3588 O  OP2   . DC  B 2 11  ? 39.712 -18.770 -7.456  1.00 27.32 ? 11   DC  T OP2   1 
ATOM   3589 O  "O5'" . DC  B 2 11  ? 38.023 -18.577 -5.691  1.00 26.86 ? 11   DC  T "O5'" 1 
ATOM   3590 C  "C5'" . DC  B 2 11  ? 37.527 -18.425 -4.381  1.00 25.42 ? 11   DC  T "C5'" 1 
ATOM   3591 C  "C4'" . DC  B 2 11  ? 36.011 -18.307 -4.428  1.00 25.91 ? 11   DC  T "C4'" 1 
ATOM   3592 O  "O4'" . DC  B 2 11  ? 35.618 -17.028 -4.994  1.00 22.67 ? 11   DC  T "O4'" 1 
ATOM   3593 C  "C3'" . DC  B 2 11  ? 35.299 -19.377 -5.258  1.00 18.99 ? 11   DC  T "C3'" 1 
ATOM   3594 O  "O3'" . DC  B 2 11  ? 34.224 -19.876 -4.488  1.00 19.30 ? 11   DC  T "O3'" 1 
ATOM   3595 C  "C2'" . DC  B 2 11  ? 34.809 -18.626 -6.497  1.00 19.43 ? 11   DC  T "C2'" 1 
ATOM   3596 C  "C1'" . DC  B 2 11  ? 34.609 -17.207 -5.974  1.00 25.63 ? 11   DC  T "C1'" 1 
ATOM   3597 N  N1    . DC  B 2 11  ? 34.791 -16.117 -6.996  1.00 21.31 ? 11   DC  T N1    1 
ATOM   3598 C  C2    . DC  B 2 11  ? 33.783 -15.166 -7.222  1.00 25.88 ? 11   DC  T C2    1 
ATOM   3599 O  O2    . DC  B 2 11  ? 32.716 -15.219 -6.599  1.00 21.57 ? 11   DC  T O2    1 
ATOM   3600 N  N3    . DC  B 2 11  ? 33.992 -14.195 -8.149  1.00 22.37 ? 11   DC  T N3    1 
ATOM   3601 C  C4    . DC  B 2 11  ? 35.137 -14.143 -8.826  1.00 23.64 ? 11   DC  T C4    1 
ATOM   3602 N  N4    . DC  B 2 11  ? 35.271 -13.151 -9.720  1.00 23.05 ? 11   DC  T N4    1 
ATOM   3603 C  C5    . DC  B 2 11  ? 36.183 -15.092 -8.608  1.00 21.97 ? 11   DC  T C5    1 
ATOM   3604 C  C6    . DC  B 2 11  ? 35.963 -16.054 -7.695  1.00 20.41 ? 11   DC  T C6    1 
ATOM   3605 P  P     . DT  B 2 12  ? 33.517 -21.268 -4.887  1.00 21.71 ? 12   DT  T P     1 
ATOM   3606 O  OP1   . DT  B 2 12  ? 33.011 -21.889 -3.641  1.00 21.01 ? 12   DT  T OP1   1 
ATOM   3607 O  OP2   . DT  B 2 12  ? 34.435 -22.016 -5.764  1.00 18.86 ? 12   DT  T OP2   1 
ATOM   3608 O  "O5'" . DT  B 2 12  ? 32.267 -20.808 -5.772  1.00 21.75 ? 12   DT  T "O5'" 1 
ATOM   3609 C  "C5'" . DT  B 2 12  ? 31.120 -20.259 -5.123  1.00 17.93 ? 12   DT  T "C5'" 1 
ATOM   3610 C  "C4'" . DT  B 2 12  ? 30.158 -19.738 -6.167  1.00 21.83 ? 12   DT  T "C4'" 1 
ATOM   3611 O  "O4'" . DT  B 2 12  ? 30.795 -18.630 -6.846  1.00 23.50 ? 12   DT  T "O4'" 1 
ATOM   3612 C  "C3'" . DT  B 2 12  ? 29.823 -20.770 -7.249  1.00 20.87 ? 12   DT  T "C3'" 1 
ATOM   3613 O  "O3'" . DT  B 2 12  ? 28.430 -20.764 -7.538  1.00 21.82 ? 12   DT  T "O3'" 1 
ATOM   3614 C  "C2'" . DT  B 2 12  ? 30.661 -20.312 -8.435  1.00 17.88 ? 12   DT  T "C2'" 1 
ATOM   3615 C  "C1'" . DT  B 2 12  ? 30.566 -18.808 -8.226  1.00 24.46 ? 12   DT  T "C1'" 1 
ATOM   3616 N  N1    . DT  B 2 12  ? 31.526 -17.998 -9.030  1.00 25.83 ? 12   DT  T N1    1 
ATOM   3617 C  C2    . DT  B 2 12  ? 31.103 -16.765 -9.465  1.00 23.10 ? 12   DT  T C2    1 
ATOM   3618 O  O2    . DT  B 2 12  ? 30.001 -16.318 -9.221  1.00 27.96 ? 12   DT  T O2    1 
ATOM   3619 N  N3    . DT  B 2 12  ? 32.014 -16.072 -10.208 1.00 22.08 ? 12   DT  T N3    1 
ATOM   3620 C  C4    . DT  B 2 12  ? 33.284 -16.475 -10.563 1.00 25.19 ? 12   DT  T C4    1 
ATOM   3621 O  O4    . DT  B 2 12  ? 34.006 -15.752 -11.248 1.00 23.89 ? 12   DT  T O4    1 
ATOM   3622 C  C5    . DT  B 2 12  ? 33.671 -17.784 -10.078 1.00 24.74 ? 12   DT  T C5    1 
ATOM   3623 C  C7    . DT  B 2 12  ? 35.027 -18.345 -10.378 1.00 20.01 ? 12   DT  T C7    1 
ATOM   3624 C  C6    . DT  B 2 12  ? 32.783 -18.477 -9.346  1.00 24.83 ? 12   DT  T C6    1 
ATOM   3625 O  "O5'" . DA  C 3 1   ? 29.345 -7.888  -15.302 1.00 42.82 ? 1    DA  P "O5'" 1 
ATOM   3626 C  "C5'" . DA  C 3 1   ? 28.002 -8.022  -15.737 1.00 37.15 ? 1    DA  P "C5'" 1 
ATOM   3627 C  "C4'" . DA  C 3 1   ? 27.133 -8.553  -14.613 1.00 32.39 ? 1    DA  P "C4'" 1 
ATOM   3628 O  "O4'" . DA  C 3 1   ? 27.523 -9.918  -14.328 1.00 34.74 ? 1    DA  P "O4'" 1 
ATOM   3629 C  "C3'" . DA  C 3 1   ? 27.221 -7.787  -13.294 1.00 29.75 ? 1    DA  P "C3'" 1 
ATOM   3630 O  "O3'" . DA  C 3 1   ? 25.934 -7.658  -12.733 1.00 32.32 ? 1    DA  P "O3'" 1 
ATOM   3631 C  "C2'" . DA  C 3 1   ? 28.081 -8.645  -12.383 1.00 28.90 ? 1    DA  P "C2'" 1 
ATOM   3632 C  "C1'" . DA  C 3 1   ? 28.015 -10.036 -13.009 1.00 33.45 ? 1    DA  P "C1'" 1 
ATOM   3633 N  N9    . DA  C 3 1   ? 29.338 -10.634 -13.085 1.00 29.09 ? 1    DA  P N9    1 
ATOM   3634 C  C8    . DA  C 3 1   ? 30.364 -10.250 -13.902 1.00 29.39 ? 1    DA  P C8    1 
ATOM   3635 N  N7    . DA  C 3 1   ? 31.451 -10.970 -13.752 1.00 33.40 ? 1    DA  P N7    1 
ATOM   3636 C  C5    . DA  C 3 1   ? 31.108 -11.887 -12.770 1.00 24.26 ? 1    DA  P C5    1 
ATOM   3637 C  C6    . DA  C 3 1   ? 31.827 -12.932 -12.162 1.00 27.29 ? 1    DA  P C6    1 
ATOM   3638 N  N6    . DA  C 3 1   ? 33.090 -13.231 -12.477 1.00 24.48 ? 1    DA  P N6    1 
ATOM   3639 N  N1    . DA  C 3 1   ? 31.192 -13.656 -11.218 1.00 30.39 ? 1    DA  P N1    1 
ATOM   3640 C  C2    . DA  C 3 1   ? 29.922 -13.356 -10.912 1.00 24.50 ? 1    DA  P C2    1 
ATOM   3641 N  N3    . DA  C 3 1   ? 29.145 -12.397 -11.416 1.00 29.75 ? 1    DA  P N3    1 
ATOM   3642 C  C4    . DA  C 3 1   ? 29.809 -11.694 -12.347 1.00 27.66 ? 1    DA  P C4    1 
ATOM   3643 P  P     . DG  C 3 2   ? 25.637 -6.504  -11.653 1.00 38.68 ? 2    DG  P P     1 
ATOM   3644 O  OP1   . DG  C 3 2   ? 24.191 -6.221  -11.684 1.00 30.90 ? 2    DG  P OP1   1 
ATOM   3645 O  OP2   . DG  C 3 2   ? 26.652 -5.437  -11.831 1.00 30.22 ? 2    DG  P OP2   1 
ATOM   3646 O  "O5'" . DG  C 3 2   ? 25.975 -7.202  -10.254 1.00 30.52 ? 2    DG  P "O5'" 1 
ATOM   3647 C  "C5'" . DG  C 3 2   ? 25.021 -8.057  -9.669  1.00 32.51 ? 2    DG  P "C5'" 1 
ATOM   3648 C  "C4'" . DG  C 3 2   ? 25.649 -8.695  -8.454  1.00 27.96 ? 2    DG  P "C4'" 1 
ATOM   3649 O  "O4'" . DG  C 3 2   ? 26.855 -9.391  -8.852  1.00 24.30 ? 2    DG  P "O4'" 1 
ATOM   3650 C  "C3'" . DG  C 3 2   ? 26.039 -7.722  -7.340  1.00 22.94 ? 2    DG  P "C3'" 1 
ATOM   3651 O  "O3'" . DG  C 3 2   ? 25.426 -8.273  -6.197  1.00 31.41 ? 2    DG  P "O3'" 1 
ATOM   3652 C  "C2'" . DG  C 3 2   ? 27.564 -7.800  -7.292  1.00 21.30 ? 2    DG  P "C2'" 1 
ATOM   3653 C  "C1'" . DG  C 3 2   ? 27.845 -9.184  -7.870  1.00 23.74 ? 2    DG  P "C1'" 1 
ATOM   3654 N  N9    . DG  C 3 2   ? 29.157 -9.340  -8.494  1.00 23.15 ? 2    DG  P N9    1 
ATOM   3655 C  C8    . DG  C 3 2   ? 29.819 -8.464  -9.325  1.00 26.70 ? 2    DG  P C8    1 
ATOM   3656 N  N7    . DG  C 3 2   ? 30.987 -8.903  -9.718  1.00 24.94 ? 2    DG  P N7    1 
ATOM   3657 C  C5    . DG  C 3 2   ? 31.105 -10.155 -9.118  1.00 25.60 ? 2    DG  P C5    1 
ATOM   3658 C  C6    . DG  C 3 2   ? 32.145 -11.118 -9.163  1.00 24.33 ? 2    DG  P C6    1 
ATOM   3659 O  O6    . DG  C 3 2   ? 33.219 -11.069 -9.777  1.00 20.63 ? 2    DG  P O6    1 
ATOM   3660 N  N1    . DG  C 3 2   ? 31.848 -12.247 -8.396  1.00 24.02 ? 2    DG  P N1    1 
ATOM   3661 C  C2    . DG  C 3 2   ? 30.687 -12.424 -7.679  1.00 21.40 ? 2    DG  P C2    1 
ATOM   3662 N  N2    . DG  C 3 2   ? 30.549 -13.575 -7.001  1.00 26.50 ? 2    DG  P N2    1 
ATOM   3663 N  N3    . DG  C 3 2   ? 29.710 -11.534 -7.634  1.00 26.88 ? 2    DG  P N3    1 
ATOM   3664 C  C4    . DG  C 3 2   ? 29.984 -10.432 -8.369  1.00 27.12 ? 2    DG  P C4    1 
ATOM   3665 P  P     . DC  C 3 3   ? 25.569 -7.573  -4.759  1.00 32.70 ? 3    DC  P P     1 
ATOM   3666 O  OP1   . DC  C 3 3   ? 24.259 -7.674  -4.082  1.00 36.46 ? 3    DC  P OP1   1 
ATOM   3667 O  OP2   . DC  C 3 3   ? 26.247 -6.268  -4.935  1.00 32.80 ? 3    DC  P OP2   1 
ATOM   3668 O  "O5'" . DC  C 3 3   ? 26.603 -8.520  -3.993  1.00 35.50 ? 3    DC  P "O5'" 1 
ATOM   3669 C  "C5'" . DC  C 3 3   ? 26.348 -9.918  -3.922  1.00 40.38 ? 3    DC  P "C5'" 1 
ATOM   3670 C  "C4'" . DC  C 3 3   ? 27.566 -10.628 -3.369  1.00 33.78 ? 3    DC  P "C4'" 1 
ATOM   3671 O  "O4'" . DC  C 3 3   ? 28.586 -10.634 -4.393  1.00 32.28 ? 3    DC  P "O4'" 1 
ATOM   3672 C  "C3'" . DC  C 3 3   ? 28.176 -9.949  -2.140  1.00 32.66 ? 3    DC  P "C3'" 1 
ATOM   3673 O  "O3'" . DC  C 3 3   ? 28.057 -10.786 -0.999  1.00 34.81 ? 3    DC  P "O3'" 1 
ATOM   3674 C  "C2'" . DC  C 3 3   ? 29.641 -9.706  -2.495  1.00 35.21 ? 3    DC  P "C2'" 1 
ATOM   3675 C  "C1'" . DC  C 3 3   ? 29.839 -10.536 -3.759  1.00 37.01 ? 3    DC  P "C1'" 1 
ATOM   3676 N  N1    . DC  C 3 3   ? 30.772 -9.890  -4.697  1.00 34.84 ? 3    DC  P N1    1 
ATOM   3677 C  C2    . DC  C 3 3   ? 31.948 -10.561 -5.005  1.00 25.74 ? 3    DC  P C2    1 
ATOM   3678 O  O2    . DC  C 3 3   ? 32.140 -11.664 -4.477  1.00 28.95 ? 3    DC  P O2    1 
ATOM   3679 N  N3    . DC  C 3 3   ? 32.831 -9.985  -5.856  1.00 31.48 ? 3    DC  P N3    1 
ATOM   3680 C  C4    . DC  C 3 3   ? 32.556 -8.790  -6.383  1.00 32.19 ? 3    DC  P C4    1 
ATOM   3681 N  N4    . DC  C 3 3   ? 33.452 -8.259  -7.223  1.00 33.47 ? 3    DC  P N4    1 
ATOM   3682 C  C5    . DC  C 3 3   ? 31.349 -8.091  -6.073  1.00 31.56 ? 3    DC  P C5    1 
ATOM   3683 C  C6    . DC  C 3 3   ? 30.490 -8.667  -5.226  1.00 30.88 ? 3    DC  P C6    1 
ATOM   3684 P  P     . DG  C 3 4   ? 28.617 -10.293 0.426   1.00 36.91 ? 4    DG  P P     1 
ATOM   3685 O  OP1   . DG  C 3 4   ? 27.813 -10.950 1.482   1.00 43.01 ? 4    DG  P OP1   1 
ATOM   3686 O  OP2   . DG  C 3 4   ? 28.728 -8.813  0.391   1.00 39.42 ? 4    DG  P OP2   1 
ATOM   3687 O  "O5'" . DG  C 3 4   ? 30.116 -10.860 0.456   1.00 34.73 ? 4    DG  P "O5'" 1 
ATOM   3688 C  "C5'" . DG  C 3 4   ? 30.350 -12.247 0.266   1.00 32.09 ? 4    DG  P "C5'" 1 
ATOM   3689 C  "C4'" . DG  C 3 4   ? 31.842 -12.531 0.299   1.00 43.55 ? 4    DG  P "C4'" 1 
ATOM   3690 O  "O4'" . DG  C 3 4   ? 32.491 -11.984 -0.879  1.00 36.12 ? 4    DG  P "O4'" 1 
ATOM   3691 C  "C3'" . DG  C 3 4   ? 32.548 -11.945 1.520   1.00 33.50 ? 4    DG  P "C3'" 1 
ATOM   3692 O  "O3'" . DG  C 3 4   ? 33.169 -13.009 2.234   1.00 38.63 ? 4    DG  P "O3'" 1 
ATOM   3693 C  "C2'" . DG  C 3 4   ? 33.543 -10.937 0.947   1.00 32.25 ? 4    DG  P "C2'" 1 
ATOM   3694 C  "C1'" . DG  C 3 4   ? 33.707 -11.371 -0.505  1.00 31.49 ? 4    DG  P "C1'" 1 
ATOM   3695 N  N9    . DG  C 3 4   ? 33.942 -10.252 -1.417  1.00 26.64 ? 4    DG  P N9    1 
ATOM   3696 C  C8    . DG  C 3 4   ? 33.118 -9.177  -1.656  1.00 32.59 ? 4    DG  P C8    1 
ATOM   3697 N  N7    . DG  C 3 4   ? 33.595 -8.335  -2.535  1.00 30.57 ? 4    DG  P N7    1 
ATOM   3698 C  C5    . DG  C 3 4   ? 34.816 -8.887  -2.896  1.00 25.31 ? 4    DG  P C5    1 
ATOM   3699 C  C6    . DG  C 3 4   ? 35.779 -8.427  -3.814  1.00 27.04 ? 4    DG  P C6    1 
ATOM   3700 O  O6    . DG  C 3 4   ? 35.748 -7.394  -4.501  1.00 28.20 ? 4    DG  P O6    1 
ATOM   3701 N  N1    . DG  C 3 4   ? 36.870 -9.292  -3.885  1.00 27.00 ? 4    DG  P N1    1 
ATOM   3702 C  C2    . DG  C 3 4   ? 37.002 -10.454 -3.159  1.00 23.88 ? 4    DG  P C2    1 
ATOM   3703 N  N2    . DG  C 3 4   ? 38.122 -11.166 -3.349  1.00 23.43 ? 4    DG  P N2    1 
ATOM   3704 N  N3    . DG  C 3 4   ? 36.100 -10.900 -2.301  1.00 24.29 ? 4    DG  P N3    1 
ATOM   3705 C  C4    . DG  C 3 4   ? 35.040 -10.064 -2.221  1.00 25.26 ? 4    DG  P C4    1 
ATOM   3706 P  P     . DT  C 3 5   ? 34.012 -12.705 3.566   1.00 42.39 ? 5    DT  P P     1 
ATOM   3707 O  OP1   . DT  C 3 5   ? 34.038 -13.941 4.376   1.00 41.64 ? 5    DT  P OP1   1 
ATOM   3708 O  OP2   . DT  C 3 5   ? 33.515 -11.439 4.142   1.00 34.72 ? 5    DT  P OP2   1 
ATOM   3709 O  "O5'" . DT  C 3 5   ? 35.485 -12.414 3.014   1.00 33.09 ? 5    DT  P "O5'" 1 
ATOM   3710 C  "C5'" . DT  C 3 5   ? 36.146 -13.430 2.297   1.00 28.95 ? 5    DT  P "C5'" 1 
ATOM   3711 C  "C4'" . DT  C 3 5   ? 37.580 -13.043 1.976   1.00 27.02 ? 5    DT  P "C4'" 1 
ATOM   3712 O  "O4'" . DT  C 3 5   ? 37.635 -12.090 0.884   1.00 23.03 ? 5    DT  P "O4'" 1 
ATOM   3713 C  "C3'" . DT  C 3 5   ? 38.399 -12.474 3.132   1.00 19.61 ? 5    DT  P "C3'" 1 
ATOM   3714 O  "O3'" . DT  C 3 5   ? 39.567 -13.263 3.158   1.00 22.12 ? 5    DT  P "O3'" 1 
ATOM   3715 C  "C2'" . DT  C 3 5   ? 38.685 -11.032 2.719   1.00 16.94 ? 5    DT  P "C2'" 1 
ATOM   3716 C  "C1'" . DT  C 3 5   ? 38.586 -11.090 1.196   1.00 20.33 ? 5    DT  P "C1'" 1 
ATOM   3717 N  N1    . DT  C 3 5   ? 38.131 -9.825  0.546   1.00 21.88 ? 5    DT  P N1    1 
ATOM   3718 C  C2    . DT  C 3 5   ? 38.930 -9.257  -0.417  1.00 18.17 ? 5    DT  P C2    1 
ATOM   3719 O  O2    . DT  C 3 5   ? 39.999 -9.727  -0.766  1.00 20.44 ? 5    DT  P O2    1 
ATOM   3720 N  N3    . DT  C 3 5   ? 38.434 -8.106  -0.968  1.00 19.68 ? 5    DT  P N3    1 
ATOM   3721 C  C4    . DT  C 3 5   ? 37.251 -7.475  -0.663  1.00 21.29 ? 5    DT  P C4    1 
ATOM   3722 O  O4    . DT  C 3 5   ? 36.914 -6.431  -1.221  1.00 19.29 ? 5    DT  P O4    1 
ATOM   3723 C  C5    . DT  C 3 5   ? 36.461 -8.119  0.356   1.00 26.56 ? 5    DT  P C5    1 
ATOM   3724 C  C7    . DT  C 3 5   ? 35.152 -7.519  0.777   1.00 20.38 ? 5    DT  P C7    1 
ATOM   3725 C  C6    . DT  C 3 5   ? 36.932 -9.249  0.913   1.00 19.44 ? 5    DT  P C6    1 
ATOM   3726 P  P     . DC  C 3 6   ? 40.585 -13.188 4.396   1.00 14.95 ? 6    DC  P P     1 
ATOM   3727 O  OP1   . DC  C 3 6   ? 41.320 -14.472 4.453   1.00 19.93 ? 6    DC  P OP1   1 
ATOM   3728 O  OP2   . DC  C 3 6   ? 39.886 -12.602 5.548   1.00 13.13 ? 6    DC  P OP2   1 
ATOM   3729 O  "O5'" . DC  C 3 6   ? 41.638 -12.075 3.939   1.00 18.72 ? 6    DC  P "O5'" 1 
ATOM   3730 C  "C5'" . DC  C 3 6   ? 42.509 -12.338 2.848   1.00 13.83 ? 6    DC  P "C5'" 1 
ATOM   3731 C  "C4'" . DC  C 3 6   ? 43.283 -11.068 2.533   1.00 19.13 ? 6    DC  P "C4'" 1 
ATOM   3732 O  "O4'" . DC  C 3 6   ? 42.394 -10.161 1.839   1.00 19.90 ? 6    DC  P "O4'" 1 
ATOM   3733 C  "C3'" . DC  C 3 6   ? 43.855 -10.302 3.735   1.00 15.09 ? 6    DC  P "C3'" 1 
ATOM   3734 O  "O3'" . DC  C 3 6   ? 45.283 -10.483 3.729   1.00 14.72 ? 6    DC  P "O3'" 1 
ATOM   3735 C  "C2'" . DC  C 3 6   ? 43.424 -8.843  3.488   1.00 15.32 ? 6    DC  P "C2'" 1 
ATOM   3736 C  "C1'" . DC  C 3 6   ? 42.848 -8.848  2.070   1.00 16.12 ? 6    DC  P "C1'" 1 
ATOM   3737 N  N1    . DC  C 3 6   ? 41.712 -7.896  1.895   1.00 15.71 ? 6    DC  P N1    1 
ATOM   3738 C  C2    . DC  C 3 6   ? 41.769 -6.941  0.869   1.00 19.24 ? 6    DC  P C2    1 
ATOM   3739 O  O2    . DC  C 3 6   ? 42.751 -6.932  0.116   1.00 16.61 ? 6    DC  P O2    1 
ATOM   3740 N  N3    . DC  C 3 6   ? 40.746 -6.063  0.722   1.00 15.49 ? 6    DC  P N3    1 
ATOM   3741 C  C4    . DC  C 3 6   ? 39.701 -6.116  1.546   1.00 18.07 ? 6    DC  P C4    1 
ATOM   3742 N  N4    . DC  C 3 6   ? 38.722 -5.229  1.349   1.00 17.45 ? 6    DC  P N4    1 
ATOM   3743 C  C5    . DC  C 3 6   ? 39.614 -7.077  2.600   1.00 19.37 ? 6    DC  P C5    1 
ATOM   3744 C  C6    . DC  C 3 6   ? 40.631 -7.941  2.739   1.00 18.44 ? 6    DC  P C6    1 
ATOM   3745 P  P     . DA  C 3 7   ? 46.227 -9.720  4.800   1.00 14.28 ? 7    DA  P P     1 
ATOM   3746 O  OP1   . DA  C 3 7   ? 47.470 -10.504 4.941   1.00 16.69 ? 7    DA  P OP1   1 
ATOM   3747 O  OP2   . DA  C 3 7   ? 45.424 -9.420  5.996   1.00 14.08 ? 7    DA  P OP2   1 
ATOM   3748 O  "O5'" . DA  C 3 7   ? 46.512 -8.300  4.114   1.00 21.45 ? 7    DA  P "O5'" 1 
ATOM   3749 C  "C5'" . DA  C 3 7   ? 47.166 -8.147  2.873   1.00 26.01 ? 7    DA  P "C5'" 1 
ATOM   3750 C  "C4'" . DA  C 3 7   ? 47.021 -6.709  2.368   1.00 27.78 ? 7    DA  P "C4'" 1 
ATOM   3751 O  "O4'" . DA  C 3 7   ? 45.646 -6.441  1.999   1.00 25.53 ? 7    DA  P "O4'" 1 
ATOM   3752 C  "C3'" . DA  C 3 7   ? 47.338 -5.589  3.356   1.00 27.96 ? 7    DA  P "C3'" 1 
ATOM   3753 O  "O3'" . DA  C 3 7   ? 48.719 -5.267  3.349   1.00 29.59 ? 7    DA  P "O3'" 1 
ATOM   3754 C  "C2'" . DA  C 3 7   ? 46.563 -4.400  2.805   1.00 25.55 ? 7    DA  P "C2'" 1 
ATOM   3755 C  "C1'" . DA  C 3 7   ? 45.502 -5.037  1.921   1.00 27.75 ? 7    DA  P "C1'" 1 
ATOM   3756 N  N9    . DA  C 3 7   ? 44.171 -4.616  2.337   1.00 22.00 ? 7    DA  P N9    1 
ATOM   3757 C  C8    . DA  C 3 7   ? 43.328 -5.187  3.251   1.00 21.92 ? 7    DA  P C8    1 
ATOM   3758 N  N7    . DA  C 3 7   ? 42.192 -4.536  3.385   1.00 20.63 ? 7    DA  P N7    1 
ATOM   3759 C  C5    . DA  C 3 7   ? 42.312 -3.468  2.509   1.00 19.28 ? 7    DA  P C5    1 
ATOM   3760 C  C6    . DA  C 3 7   ? 41.455 -2.400  2.178   1.00 21.07 ? 7    DA  P C6    1 
ATOM   3761 N  N6    . DA  C 3 7   ? 40.251 -2.247  2.726   1.00 17.34 ? 7    DA  P N6    1 
ATOM   3762 N  N1    . DA  C 3 7   ? 41.886 -1.501  1.267   1.00 18.36 ? 7    DA  P N1    1 
ATOM   3763 C  C2    . DA  C 3 7   ? 43.097 -1.665  0.723   1.00 24.18 ? 7    DA  P C2    1 
ATOM   3764 N  N3    . DA  C 3 7   ? 43.996 -2.623  0.953   1.00 19.74 ? 7    DA  P N3    1 
ATOM   3765 C  C4    . DA  C 3 7   ? 43.529 -3.500  1.861   1.00 21.79 ? 7    DA  P C4    1 
ATOM   3766 P  P     A DT  C 3 8   ? 49.315 -4.257  4.445   0.40 29.93 ? 8    DT  P P     1 
ATOM   3767 P  P     B DT  C 3 8   ? 49.261 -3.986  4.158   0.60 29.30 ? 8    DT  P P     1 
ATOM   3768 O  OP1   A DT  C 3 8   ? 50.737 -4.618  4.678   0.40 24.79 ? 8    DT  P OP1   1 
ATOM   3769 O  OP1   B DT  C 3 8   ? 50.740 -4.098  4.243   0.60 25.73 ? 8    DT  P OP1   1 
ATOM   3770 O  OP2   A DT  C 3 8   ? 48.368 -4.206  5.584   0.40 27.42 ? 8    DT  P OP2   1 
ATOM   3771 O  OP2   B DT  C 3 8   ? 48.469 -3.863  5.406   0.60 26.89 ? 8    DT  P OP2   1 
ATOM   3772 O  "O5'" A DT  C 3 8   ? 49.249 -2.842  3.713   0.40 26.96 ? 8    DT  P "O5'" 1 
ATOM   3773 O  "O5'" B DT  C 3 8   ? 48.873 -2.740  3.217   0.60 26.49 ? 8    DT  P "O5'" 1 
ATOM   3774 C  "C5'" A DT  C 3 8   ? 49.557 -2.759  2.327   0.40 24.13 ? 8    DT  P "C5'" 1 
ATOM   3775 C  "C5'" B DT  C 3 8   ? 49.749 -2.274  2.180   0.60 23.90 ? 8    DT  P "C5'" 1 
ATOM   3776 C  "C4'" A DT  C 3 8   ? 49.249 -1.347  1.885   0.40 23.32 ? 8    DT  P "C4'" 1 
ATOM   3777 C  "C4'" B DT  C 3 8   ? 49.275 -0.950  1.584   0.60 23.11 ? 8    DT  P "C4'" 1 
ATOM   3778 O  "O4'" A DT  C 3 8   ? 47.812 -1.152  1.889   0.40 21.51 ? 8    DT  P "O4'" 1 
ATOM   3779 O  "O4'" B DT  C 3 8   ? 47.878 -1.053  1.209   0.60 20.29 ? 8    DT  P "O4'" 1 
ATOM   3780 C  "C3'" A DT  C 3 8   ? 49.852 -0.323  2.837   0.40 21.67 ? 8    DT  P "C3'" 1 
ATOM   3781 C  "C3'" B DT  C 3 8   ? 49.316 0.261   2.514   0.60 23.07 ? 8    DT  P "C3'" 1 
ATOM   3782 O  "O3'" A DT  C 3 8   ? 50.686 0.596   2.112   0.40 17.23 ? 8    DT  P "O3'" 1 
ATOM   3783 O  "O3'" B DT  C 3 8   ? 50.591 0.892   2.505   0.60 17.11 ? 8    DT  P "O3'" 1 
ATOM   3784 C  "C2'" A DT  C 3 8   ? 48.646 0.318   3.540   0.40 19.31 ? 8    DT  P "C2'" 1 
ATOM   3785 C  "C2'" B DT  C 3 8   ? 48.255 1.185   1.921   0.60 20.90 ? 8    DT  P "C2'" 1 
ATOM   3786 C  "C1'" A DT  C 3 8   ? 47.476 0.019   2.607   0.40 21.43 ? 8    DT  P "C1'" 1 
ATOM   3787 C  "C1'" B DT  C 3 8   ? 47.219 0.188   1.411   0.60 21.40 ? 8    DT  P "C1'" 1 
ATOM   3788 N  N1    A DT  C 3 8   ? 46.149 -0.179  3.288   0.40 22.33 ? 8    DT  P N1    1 
ATOM   3789 N  N1    B DT  C 3 8   ? 46.027 -0.000  2.311   0.60 21.09 ? 8    DT  P N1    1 
ATOM   3790 C  C2    A DT  C 3 8   ? 45.174 0.783   3.117   0.40 21.48 ? 8    DT  P C2    1 
ATOM   3791 C  C2    B DT  C 3 8   ? 44.923 0.798   2.099   0.60 21.92 ? 8    DT  P C2    1 
ATOM   3792 O  O2    A DT  C 3 8   ? 45.336 1.784   2.443   0.40 20.51 ? 8    DT  P O2    1 
ATOM   3793 O  O2    B DT  C 3 8   ? 44.869 1.644   1.228   0.60 20.32 ? 8    DT  P O2    1 
ATOM   3794 N  N3    A DT  C 3 8   ? 43.992 0.533   3.763   0.40 20.51 ? 8    DT  P N3    1 
ATOM   3795 N  N3    B DT  C 3 8   ? 43.870 0.573   2.947   0.60 22.06 ? 8    DT  P N3    1 
ATOM   3796 C  C4    A DT  C 3 8   ? 43.683 -0.559  4.548   0.40 22.29 ? 8    DT  P C4    1 
ATOM   3797 C  C4    B DT  C 3 8   ? 43.802 -0.348  3.968   0.60 21.61 ? 8    DT  P C4    1 
ATOM   3798 O  O4    A DT  C 3 8   ? 42.586 -0.688  5.086   0.40 20.48 ? 8    DT  P O4    1 
ATOM   3799 O  O4    B DT  C 3 8   ? 42.804 -0.473  4.673   0.60 20.57 ? 8    DT  P O4    1 
ATOM   3800 C  C5    A DT  C 3 8   ? 44.741 -1.528  4.693   0.40 22.88 ? 8    DT  P C5    1 
ATOM   3801 C  C5    B DT  C 3 8   ? 44.984 -1.153  4.144   0.60 23.59 ? 8    DT  P C5    1 
ATOM   3802 C  C7    A DT  C 3 8   ? 44.509 -2.753  5.529   0.40 21.47 ? 8    DT  P C7    1 
ATOM   3803 C  C7    B DT  C 3 8   ? 44.997 -2.182  5.236   0.60 22.95 ? 8    DT  P C7    1 
ATOM   3804 C  C6    A DT  C 3 8   ? 45.907 -1.297  4.065   0.40 22.78 ? 8    DT  P C6    1 
ATOM   3805 C  C6    B DT  C 3 8   ? 46.030 -0.947  3.322   0.60 21.83 ? 8    DT  P C6    1 
ATOM   3806 P  P     B DA  C 3 9   ? 51.141 1.610   3.836   0.60 20.75 ? 9    DA  P P     1 
ATOM   3807 O  OP1   B DA  C 3 9   ? 52.602 1.787   3.699   0.60 18.17 ? 9    DA  P OP1   1 
ATOM   3808 O  OP2   B DA  C 3 9   ? 50.601 0.871   5.011   0.60 18.46 ? 9    DA  P OP2   1 
ATOM   3809 O  "O5'" B DA  C 3 9   ? 50.463 3.051   3.789   0.60 16.88 ? 9    DA  P "O5'" 1 
ATOM   3810 C  "C5'" B DA  C 3 9   ? 50.826 3.987   2.775   0.60 14.73 ? 9    DA  P "C5'" 1 
ATOM   3811 C  "C4'" B DA  C 3 9   ? 50.018 5.264   2.949   0.60 14.14 ? 9    DA  P "C4'" 1 
ATOM   3812 O  "O4'" B DA  C 3 9   ? 48.644 4.972   2.600   0.60 16.13 ? 9    DA  P "O4'" 1 
ATOM   3813 C  "C3'" B DA  C 3 9   ? 49.958 5.824   4.369   0.60 15.26 ? 9    DA  P "C3'" 1 
ATOM   3814 O  "O3'" B DA  C 3 9   ? 51.025 6.744   4.601   0.60 12.65 ? 9    DA  P "O3'" 1 
ATOM   3815 C  "C2'" B DA  C 3 9   ? 48.602 6.529   4.387   0.60 14.00 ? 9    DA  P "C2'" 1 
ATOM   3816 C  "C1'" B DA  C 3 9   ? 47.758 5.633   3.481   0.60 16.00 ? 9    DA  P "C1'" 1 
ATOM   3817 N  N9    B DA  C 3 9   ? 47.005 4.624   4.216   0.60 18.08 ? 9    DA  P N9    1 
ATOM   3818 C  C8    B DA  C 3 9   ? 47.470 3.434   4.708   0.60 18.49 ? 9    DA  P C8    1 
ATOM   3819 N  N7    B DA  C 3 9   ? 46.549 2.732   5.333   0.60 19.23 ? 9    DA  P N7    1 
ATOM   3820 C  C5    B DA  C 3 9   ? 45.407 3.514   5.238   0.60 19.56 ? 9    DA  P C5    1 
ATOM   3821 C  C6    B DA  C 3 9   ? 44.085 3.337   5.698   0.60 22.23 ? 9    DA  P C6    1 
ATOM   3822 N  N6    B DA  C 3 9   ? 43.690 2.252   6.372   0.60 21.09 ? 9    DA  P N6    1 
ATOM   3823 N  N1    B DA  C 3 9   ? 43.186 4.315   5.440   0.60 21.02 ? 9    DA  P N1    1 
ATOM   3824 C  C2    B DA  C 3 9   ? 43.595 5.393   4.764   0.60 20.41 ? 9    DA  P C2    1 
ATOM   3825 N  N3    B DA  C 3 9   ? 44.809 5.672   4.278   0.60 17.54 ? 9    DA  P N3    1 
ATOM   3826 C  C4    B DA  C 3 9   ? 45.673 4.683   4.552   0.60 18.57 ? 9    DA  P C4    1 
HETATM 3827 MG MG    . MG  D 4 .   ? 52.972 0.453   2.096   0.40 14.03 ? 501  MG  A MG    1 
HETATM 3828 CA CA    A CA  E 5 .   ? 54.895 2.713   3.783   0.15 11.87 ? 502  CA  A CA    1 
HETATM 3829 MG MG    B MG  F 4 .   ? 54.845 2.713   3.783   0.85 11.61 ? 503  MG  A MG    1 
HETATM 3830 C  C1    . GOL G 6 .   ? 60.583 -25.121 12.087  1.00 21.21 ? 506  GOL A C1    1 
HETATM 3831 O  O1    . GOL G 6 .   ? 59.240 -24.749 12.320  1.00 17.06 ? 506  GOL A O1    1 
HETATM 3832 C  C2    . GOL G 6 .   ? 61.142 -24.489 10.803  1.00 17.85 ? 506  GOL A C2    1 
HETATM 3833 O  O2    . GOL G 6 .   ? 60.673 -23.175 10.626  1.00 13.89 ? 506  GOL A O2    1 
HETATM 3834 C  C3    . GOL G 6 .   ? 60.824 -25.324 9.558   1.00 23.32 ? 506  GOL A C3    1 
HETATM 3835 O  O3    . GOL G 6 .   ? 61.621 -24.875 8.468   1.00 16.41 ? 506  GOL A O3    1 
HETATM 3836 C  C1    . GOL H 6 .   ? 54.180 16.747  -7.182  1.00 33.31 ? 507  GOL A C1    1 
HETATM 3837 O  O1    . GOL H 6 .   ? 54.013 15.399  -6.814  1.00 18.48 ? 507  GOL A O1    1 
HETATM 3838 C  C2    . GOL H 6 .   ? 54.834 16.788  -8.559  1.00 30.58 ? 507  GOL A C2    1 
HETATM 3839 O  O2    . GOL H 6 .   ? 53.902 16.323  -9.511  1.00 33.44 ? 507  GOL A O2    1 
HETATM 3840 C  C3    . GOL H 6 .   ? 55.272 18.217  -8.875  1.00 29.88 ? 507  GOL A C3    1 
HETATM 3841 O  O3    . GOL H 6 .   ? 55.952 18.255  -10.114 1.00 30.78 ? 507  GOL A O3    1 
HETATM 3842 C  C1    . GOL I 6 .   ? 54.717 28.155  4.488   1.00 29.29 ? 508  GOL A C1    1 
HETATM 3843 O  O1    . GOL I 6 .   ? 53.340 27.969  4.201   1.00 30.49 ? 508  GOL A O1    1 
HETATM 3844 C  C2    . GOL I 6 .   ? 55.149 27.214  5.613   1.00 36.75 ? 508  GOL A C2    1 
HETATM 3845 O  O2    . GOL I 6 .   ? 54.497 25.966  5.485   1.00 38.14 ? 508  GOL A O2    1 
HETATM 3846 C  C3    . GOL I 6 .   ? 56.657 26.996  5.577   1.00 33.64 ? 508  GOL A C3    1 
HETATM 3847 O  O3    . GOL I 6 .   ? 57.048 26.098  6.602   1.00 25.71 ? 508  GOL A O3    1 
HETATM 3848 P  PG    A DTP J 7 .   ? 55.352 2.800   7.161   0.40 17.13 ? 504  DTP P PG    1 
HETATM 3849 O  O1G   A DTP J 7 .   ? 55.090 1.927   8.365   0.40 17.16 ? 504  DTP P O1G   1 
HETATM 3850 O  O2G   A DTP J 7 .   ? 56.637 3.588   7.267   0.40 15.61 ? 504  DTP P O2G   1 
HETATM 3851 O  O3G   A DTP J 7 .   ? 55.120 2.124   5.827   0.40 16.24 ? 504  DTP P O3G   1 
HETATM 3852 P  PB    A DTP J 7 .   ? 53.180 4.238   6.065   0.40 14.24 ? 504  DTP P PB    1 
HETATM 3853 O  O1B   A DTP J 7 .   ? 53.932 4.324   4.752   0.40 13.94 ? 504  DTP P O1B   1 
HETATM 3854 O  O2B   A DTP J 7 .   ? 52.294 5.382   6.501   0.40 14.03 ? 504  DTP P O2B   1 
HETATM 3855 O  O3B   A DTP J 7 .   ? 54.191 3.921   7.276   0.40 14.49 ? 504  DTP P O3B   1 
HETATM 3856 P  PA    A DTP J 7 .   ? 51.743 2.105   4.817   0.40 17.19 ? 504  DTP P PA    1 
HETATM 3857 O  O1A   A DTP J 7 .   ? 50.914 0.955   5.342   0.40 18.52 ? 504  DTP P O1A   1 
HETATM 3858 O  O2A   A DTP J 7 .   ? 52.873 1.787   3.850   0.40 17.97 ? 504  DTP P O2A   1 
HETATM 3859 O  O3A   A DTP J 7 .   ? 52.323 2.871   6.114   0.40 17.15 ? 504  DTP P O3A   1 
HETATM 3860 O  "O5'" A DTP J 7 .   ? 50.733 3.175   4.160   0.40 16.46 ? 504  DTP P "O5'" 1 
HETATM 3861 C  "C5'" A DTP J 7 .   ? 51.143 4.061   3.118   0.40 15.61 ? 504  DTP P "C5'" 1 
HETATM 3862 C  "C4'" A DTP J 7 .   ? 50.241 5.297   3.081   0.40 14.37 ? 504  DTP P "C4'" 1 
HETATM 3863 O  "O4'" A DTP J 7 .   ? 48.906 4.948   2.701   0.40 15.82 ? 504  DTP P "O4'" 1 
HETATM 3864 C  "C3'" A DTP J 7 .   ? 50.144 5.994   4.432   0.40 15.09 ? 504  DTP P "C3'" 1 
HETATM 3865 O  "O3'" A DTP J 7 .   ? 51.009 7.134   4.501   0.40 12.18 ? 504  DTP P "O3'" 1 
HETATM 3866 C  "C2'" A DTP J 7 .   ? 48.700 6.448   4.535   0.40 14.07 ? 504  DTP P "C2'" 1 
HETATM 3867 C  "C1'" A DTP J 7 .   ? 47.936 5.571   3.554   0.40 16.08 ? 504  DTP P "C1'" 1 
HETATM 3868 N  N9    A DTP J 7 .   ? 47.187 4.546   4.322   0.40 18.04 ? 504  DTP P N9    1 
HETATM 3869 C  C8    A DTP J 7 .   ? 47.698 3.423   4.845   0.40 18.35 ? 504  DTP P C8    1 
HETATM 3870 N  N7    A DTP J 7 .   ? 46.707 2.742   5.470   0.40 19.23 ? 504  DTP P N7    1 
HETATM 3871 C  C5    A DTP J 7 .   ? 45.569 3.452   5.324   0.40 19.58 ? 504  DTP P C5    1 
HETATM 3872 C  C6    A DTP J 7 .   ? 44.261 3.253   5.742   0.40 22.12 ? 504  DTP P C6    1 
HETATM 3873 N  N6    A DTP J 7 .   ? 43.939 2.145   6.453   0.40 21.00 ? 504  DTP P N6    1 
HETATM 3874 N  N1    A DTP J 7 .   ? 43.318 4.174   5.433   0.40 21.20 ? 504  DTP P N1    1 
HETATM 3875 C  C2    A DTP J 7 .   ? 43.642 5.267   4.729   0.40 20.40 ? 504  DTP P C2    1 
HETATM 3876 N  N3    A DTP J 7 .   ? 44.900 5.482   4.310   0.40 17.70 ? 504  DTP P N3    1 
HETATM 3877 C  C4    A DTP J 7 .   ? 45.878 4.585   4.593   0.40 18.62 ? 504  DTP P C4    1 
HETATM 3878 P  P1    B DPO K 8 .   ? 53.142 4.245   6.067   0.60 14.21 ? 505  DPO P P1    1 
HETATM 3879 O  O1    B DPO K 8 .   ? 52.281 3.006   6.113   0.60 17.12 ? 505  DPO P O1    1 
HETATM 3880 O  O2    B DPO K 8 .   ? 53.889 4.415   4.756   0.60 13.89 ? 505  DPO P O2    1 
HETATM 3881 O  O3    B DPO K 8 .   ? 52.393 5.462   6.547   0.60 13.94 ? 505  DPO P O3    1 
HETATM 3882 O  O4    B DPO K 8 .   ? 54.257 3.964   7.197   0.60 14.45 ? 505  DPO P O4    1 
HETATM 3883 P  P2    B DPO K 8 .   ? 55.386 2.796   7.159   0.60 17.15 ? 505  DPO P P2    1 
HETATM 3884 O  O5    B DPO K 8 .   ? 56.668 3.560   7.361   0.60 15.63 ? 505  DPO P O5    1 
HETATM 3885 O  O6    B DPO K 8 .   ? 55.008 1.920   8.328   0.60 17.15 ? 505  DPO P O6    1 
HETATM 3886 O  O7    B DPO K 8 .   ? 55.230 2.090   5.834   0.60 16.20 ? 505  DPO P O7    1 
HETATM 3887 MG MG    B MG  L 4 .   ? 51.554 1.068   6.879   0.60 26.54 ? 506  MG  P MG    1 
HETATM 3888 O  O     A HOH M 9 .   ? 48.690 0.151   9.740   0.40 23.76 ? 601  HOH A O     1 
HETATM 3889 O  O     B HOH M 9 .   ? 49.773 4.558   7.529   0.60 16.72 ? 602  HOH A O     1 
HETATM 3890 O  O     B HOH M 9 .   ? 49.643 1.818   7.537   0.60 19.77 ? 603  HOH A O     1 
HETATM 3891 O  O     . HOH M 9 .   ? 52.957 -1.075  3.613   1.00 21.33 ? 604  HOH A O     1 
HETATM 3892 O  O     . HOH M 9 .   ? 56.362 -13.939 -5.882  1.00 10.15 ? 605  HOH A O     1 
HETATM 3893 O  O     . HOH M 9 .   ? 67.514 -20.776 8.690   1.00 10.29 ? 606  HOH A O     1 
HETATM 3894 O  O     . HOH M 9 .   ? 63.973 -3.486  5.999   1.00 10.80 ? 607  HOH A O     1 
HETATM 3895 O  O     . HOH M 9 .   ? 43.853 -14.477 5.719   1.00 11.31 ? 608  HOH A O     1 
HETATM 3896 O  O     . HOH M 9 .   ? 62.442 7.432   7.034   1.00 12.07 ? 609  HOH A O     1 
HETATM 3897 O  O     . HOH M 9 .   ? 59.466 9.557   10.640  1.00 10.65 ? 610  HOH A O     1 
HETATM 3898 O  O     . HOH M 9 .   ? 58.019 -23.503 14.182  1.00 9.28  ? 611  HOH A O     1 
HETATM 3899 O  O     . HOH M 9 .   ? 53.877 -28.527 4.084   1.00 13.45 ? 612  HOH A O     1 
HETATM 3900 O  O     . HOH M 9 .   ? 67.096 -16.631 9.643   1.00 11.41 ? 613  HOH A O     1 
HETATM 3901 O  O     . HOH M 9 .   ? 68.939 16.389  -4.060  1.00 12.54 ? 614  HOH A O     1 
HETATM 3902 O  O     . HOH M 9 .   ? 69.184 -17.558 -1.267  1.00 11.55 ? 615  HOH A O     1 
HETATM 3903 O  O     . HOH M 9 .   ? 54.280 -9.529  5.381   1.00 13.65 ? 616  HOH A O     1 
HETATM 3904 O  O     . HOH M 9 .   ? 60.465 -18.543 -4.654  1.00 11.79 ? 617  HOH A O     1 
HETATM 3905 O  O     . HOH M 9 .   ? 60.023 11.500  -10.294 1.00 14.47 ? 618  HOH A O     1 
HETATM 3906 O  O     . HOH M 9 .   ? 43.623 12.238  -7.277  1.00 17.23 ? 619  HOH A O     1 
HETATM 3907 O  O     . HOH M 9 .   ? 52.054 5.785   9.092   1.00 13.40 ? 620  HOH A O     1 
HETATM 3908 O  O     . HOH M 9 .   ? 69.246 -13.512 5.139   1.00 9.66  ? 621  HOH A O     1 
HETATM 3909 O  O     . HOH M 9 .   ? 54.761 -11.338 3.407   1.00 12.60 ? 622  HOH A O     1 
HETATM 3910 O  O     . HOH M 9 .   ? 73.212 -7.388  9.014   1.00 16.41 ? 623  HOH A O     1 
HETATM 3911 O  O     . HOH M 9 .   ? 62.653 14.871  -9.226  1.00 11.34 ? 624  HOH A O     1 
HETATM 3912 O  O     . HOH M 9 .   ? 71.163 3.596   -0.272  1.00 15.68 ? 625  HOH A O     1 
HETATM 3913 O  O     . HOH M 9 .   ? 55.555 17.379  -0.653  1.00 10.10 ? 626  HOH A O     1 
HETATM 3914 O  O     . HOH M 9 .   ? 53.961 17.442  -3.254  1.00 18.97 ? 627  HOH A O     1 
HETATM 3915 O  O     . HOH M 9 .   ? 53.801 -20.580 -2.522  1.00 13.98 ? 628  HOH A O     1 
HETATM 3916 O  O     . HOH M 9 .   ? 53.485 -28.316 15.223  1.00 17.51 ? 629  HOH A O     1 
HETATM 3917 O  O     . HOH M 9 .   ? 51.501 5.594   -8.332  1.00 16.20 ? 630  HOH A O     1 
HETATM 3918 O  O     . HOH M 9 .   ? 59.282 11.140  8.478   1.00 13.68 ? 631  HOH A O     1 
HETATM 3919 O  O     . HOH M 9 .   ? 49.110 6.811   -11.734 1.00 17.76 ? 632  HOH A O     1 
HETATM 3920 O  O     . HOH M 9 .   ? 60.775 -23.520 6.331   1.00 19.42 ? 633  HOH A O     1 
HETATM 3921 O  O     . HOH M 9 .   ? 52.436 20.320  4.978   1.00 15.04 ? 634  HOH A O     1 
HETATM 3922 O  O     . HOH M 9 .   ? 45.067 7.452   -10.300 1.00 19.15 ? 635  HOH A O     1 
HETATM 3923 O  O     . HOH M 9 .   ? 42.193 -22.622 -2.457  1.00 20.52 ? 636  HOH A O     1 
HETATM 3924 O  O     . HOH M 9 .   ? 60.055 14.206  -8.724  1.00 18.36 ? 637  HOH A O     1 
HETATM 3925 O  O     . HOH M 9 .   ? 41.190 6.851   19.070  1.00 13.29 ? 638  HOH A O     1 
HETATM 3926 O  O     . HOH M 9 .   ? 46.229 16.787  1.171   1.00 12.48 ? 639  HOH A O     1 
HETATM 3927 O  O     . HOH M 9 .   ? 45.020 -14.283 10.447  1.00 16.06 ? 640  HOH A O     1 
HETATM 3928 O  O     . HOH M 9 .   ? 70.662 -16.035 7.729   1.00 14.62 ? 641  HOH A O     1 
HETATM 3929 O  O     . HOH M 9 .   ? 65.750 -22.962 3.225   1.00 13.29 ? 642  HOH A O     1 
HETATM 3930 O  O     . HOH M 9 .   ? 53.677 13.510  -9.925  1.00 16.32 ? 643  HOH A O     1 
HETATM 3931 O  O     . HOH M 9 .   ? 49.123 -15.569 13.590  1.00 15.77 ? 644  HOH A O     1 
HETATM 3932 O  O     . HOH M 9 .   ? 45.589 16.083  -1.637  1.00 14.84 ? 645  HOH A O     1 
HETATM 3933 O  O     . HOH M 9 .   ? 33.189 10.802  5.586   1.00 24.20 ? 646  HOH A O     1 
HETATM 3934 O  O     . HOH M 9 .   ? 44.168 -15.218 1.443   1.00 16.99 ? 647  HOH A O     1 
HETATM 3935 O  O     . HOH M 9 .   ? 52.336 15.965  -4.623  1.00 14.10 ? 648  HOH A O     1 
HETATM 3936 O  O     . HOH M 9 .   ? 58.589 -12.178 -11.366 1.00 12.95 ? 649  HOH A O     1 
HETATM 3937 O  O     . HOH M 9 .   ? 50.408 20.931  13.247  1.00 17.98 ? 650  HOH A O     1 
HETATM 3938 O  O     . HOH M 9 .   ? 65.713 -6.515  -13.742 1.00 14.21 ? 651  HOH A O     1 
HETATM 3939 O  O     . HOH M 9 .   ? 57.987 17.464  -6.758  1.00 14.87 ? 652  HOH A O     1 
HETATM 3940 O  O     . HOH M 9 .   ? 60.426 -17.697 -7.392  1.00 23.60 ? 653  HOH A O     1 
HETATM 3941 O  O     . HOH M 9 .   ? 53.210 -33.456 -0.172  1.00 17.84 ? 654  HOH A O     1 
HETATM 3942 O  O     . HOH M 9 .   ? 65.866 -15.197 11.718  1.00 16.80 ? 655  HOH A O     1 
HETATM 3943 O  O     . HOH M 9 .   ? 43.608 9.865   -10.019 1.00 17.86 ? 656  HOH A O     1 
HETATM 3944 O  O     . HOH M 9 .   ? 50.215 -17.157 15.477  1.00 14.50 ? 657  HOH A O     1 
HETATM 3945 O  O     . HOH M 9 .   ? 57.850 -7.710  8.183   1.00 18.65 ? 658  HOH A O     1 
HETATM 3946 O  O     . HOH M 9 .   ? 42.690 15.511  23.666  1.00 23.06 ? 659  HOH A O     1 
HETATM 3947 O  O     . HOH M 9 .   ? 49.869 -3.208  -17.339 1.00 21.06 ? 660  HOH A O     1 
HETATM 3948 O  O     . HOH M 9 .   ? 64.157 -9.259  -14.315 1.00 18.60 ? 661  HOH A O     1 
HETATM 3949 O  O     . HOH M 9 .   ? 41.384 17.032  -14.905 1.00 21.09 ? 662  HOH A O     1 
HETATM 3950 O  O     . HOH M 9 .   ? 71.633 6.067   -7.238  1.00 18.33 ? 663  HOH A O     1 
HETATM 3951 O  O     . HOH M 9 .   ? 41.182 7.613   -18.579 1.00 16.28 ? 664  HOH A O     1 
HETATM 3952 O  O     . HOH M 9 .   ? 35.050 5.630   1.959   1.00 16.95 ? 665  HOH A O     1 
HETATM 3953 O  O     . HOH M 9 .   ? 68.286 -15.778 -7.556  1.00 22.63 ? 666  HOH A O     1 
HETATM 3954 O  O     . HOH M 9 .   ? 51.660 -8.543  4.828   1.00 24.88 ? 667  HOH A O     1 
HETATM 3955 O  O     . HOH M 9 .   ? 58.369 -9.058  -14.139 1.00 22.33 ? 668  HOH A O     1 
HETATM 3956 O  O     . HOH M 9 .   ? 59.337 4.810   16.593  1.00 20.73 ? 669  HOH A O     1 
HETATM 3957 O  O     . HOH M 9 .   ? 67.402 -6.442  12.804  1.00 22.91 ? 670  HOH A O     1 
HETATM 3958 O  O     . HOH M 9 .   ? 59.886 10.381  19.761  1.00 16.54 ? 671  HOH A O     1 
HETATM 3959 O  O     . HOH M 9 .   ? 52.713 1.290   9.245   1.00 20.85 ? 672  HOH A O     1 
HETATM 3960 O  O     . HOH M 9 .   ? 51.521 5.213   -10.915 1.00 19.83 ? 673  HOH A O     1 
HETATM 3961 O  O     . HOH M 9 .   ? 49.259 7.415   -7.738  1.00 19.20 ? 674  HOH A O     1 
HETATM 3962 O  O     . HOH M 9 .   ? 44.025 11.080  -12.506 1.00 21.26 ? 675  HOH A O     1 
HETATM 3963 O  O     . HOH M 9 .   ? 51.274 3.517   10.371  1.00 23.22 ? 676  HOH A O     1 
HETATM 3964 O  O     . HOH M 9 .   ? 46.784 -0.209  -15.105 1.00 22.33 ? 677  HOH A O     1 
HETATM 3965 O  O     . HOH M 9 .   ? 40.645 16.858  6.119   1.00 20.29 ? 678  HOH A O     1 
HETATM 3966 O  O     . HOH M 9 .   ? 58.208 -14.298 -13.081 1.00 21.94 ? 679  HOH A O     1 
HETATM 3967 O  O     . HOH M 9 .   ? 50.240 3.024   12.683  1.00 23.22 ? 680  HOH A O     1 
HETATM 3968 O  O     . HOH M 9 .   ? 48.931 2.732   21.294  1.00 20.50 ? 681  HOH A O     1 
HETATM 3969 O  O     . HOH M 9 .   ? 41.323 -23.972 -5.168  1.00 21.04 ? 682  HOH A O     1 
HETATM 3970 O  O     . HOH M 9 .   ? 78.146 -0.845  5.407   1.00 18.90 ? 683  HOH A O     1 
HETATM 3971 O  O     . HOH M 9 .   ? 41.642 -30.455 -6.486  1.00 23.05 ? 684  HOH A O     1 
HETATM 3972 O  O     . HOH M 9 .   ? 53.233 -20.081 -5.488  1.00 27.76 ? 685  HOH A O     1 
HETATM 3973 O  O     . HOH M 9 .   ? 45.584 2.005   18.230  1.00 29.02 ? 686  HOH A O     1 
HETATM 3974 O  O     . HOH M 9 .   ? 48.518 -36.816 2.604   1.00 19.87 ? 687  HOH A O     1 
HETATM 3975 O  O     . HOH M 9 .   ? 23.335 14.162  -9.182  1.00 28.95 ? 688  HOH A O     1 
HETATM 3976 O  O     . HOH M 9 .   ? 69.433 4.613   3.847   1.00 22.80 ? 689  HOH A O     1 
HETATM 3977 O  O     . HOH M 9 .   ? 55.567 -7.285  6.430   1.00 27.90 ? 690  HOH A O     1 
HETATM 3978 O  O     . HOH M 9 .   ? 47.288 2.625   -1.320  1.00 21.91 ? 691  HOH A O     1 
HETATM 3979 O  O     . HOH M 9 .   ? 42.336 -18.951 14.767  1.00 18.84 ? 692  HOH A O     1 
HETATM 3980 O  O     . HOH M 9 .   ? 48.604 -22.300 -5.635  1.00 20.60 ? 693  HOH A O     1 
HETATM 3981 O  O     . HOH M 9 .   ? 62.910 -16.992 -7.295  1.00 24.39 ? 694  HOH A O     1 
HETATM 3982 O  O     . HOH M 9 .   ? 70.841 -19.043 1.423   1.00 16.95 ? 695  HOH A O     1 
HETATM 3983 O  O     . HOH M 9 .   ? 49.373 8.555   -13.611 1.00 26.92 ? 696  HOH A O     1 
HETATM 3984 O  O     . HOH M 9 .   ? 51.168 0.570   -16.099 1.00 24.29 ? 697  HOH A O     1 
HETATM 3985 O  O     . HOH M 9 .   ? 62.862 9.348   -13.570 1.00 29.85 ? 698  HOH A O     1 
HETATM 3986 O  O     . HOH M 9 .   ? 34.706 15.071  11.383  1.00 21.82 ? 699  HOH A O     1 
HETATM 3987 O  O     . HOH M 9 .   ? 53.555 6.154   -12.379 1.00 27.18 ? 700  HOH A O     1 
HETATM 3988 O  O     . HOH M 9 .   ? 48.028 10.722  -9.800  1.00 26.74 ? 701  HOH A O     1 
HETATM 3989 O  O     . HOH M 9 .   ? 56.278 18.638  18.060  1.00 21.34 ? 702  HOH A O     1 
HETATM 3990 O  O     . HOH M 9 .   ? 46.725 -14.526 14.710  1.00 28.80 ? 703  HOH A O     1 
HETATM 3991 O  O     . HOH M 9 .   ? 43.095 -1.437  -24.836 1.00 28.70 ? 704  HOH A O     1 
HETATM 3992 O  O     . HOH M 9 .   ? 61.253 20.900  11.860  1.00 26.02 ? 705  HOH A O     1 
HETATM 3993 O  O     . HOH M 9 .   ? 70.411 0.516   11.416  1.00 32.35 ? 706  HOH A O     1 
HETATM 3994 O  O     . HOH M 9 .   ? 36.926 16.117  -4.251  1.00 20.08 ? 707  HOH A O     1 
HETATM 3995 O  O     . HOH M 9 .   ? 47.939 -27.194 -7.258  1.00 25.53 ? 708  HOH A O     1 
HETATM 3996 O  O     . HOH M 9 .   ? 63.186 -23.849 3.204   1.00 26.04 ? 709  HOH A O     1 
HETATM 3997 O  O     . HOH M 9 .   ? 58.456 -18.116 19.802  1.00 25.71 ? 710  HOH A O     1 
HETATM 3998 O  O     . HOH M 9 .   ? 47.726 8.124   -9.725  1.00 25.50 ? 711  HOH A O     1 
HETATM 3999 O  O     . HOH M 9 .   ? 54.566 15.330  23.267  1.00 28.69 ? 712  HOH A O     1 
HETATM 4000 O  O     . HOH M 9 .   ? 59.841 13.027  11.195  1.00 18.87 ? 713  HOH A O     1 
HETATM 4001 O  O     . HOH M 9 .   ? 64.632 6.565   -0.402  1.00 18.54 ? 714  HOH A O     1 
HETATM 4002 O  O     . HOH M 9 .   ? 72.168 -3.731  -13.685 1.00 20.85 ? 715  HOH A O     1 
HETATM 4003 O  O     . HOH M 9 .   ? 29.026 8.018   -18.787 1.00 28.80 ? 716  HOH A O     1 
HETATM 4004 O  O     . HOH M 9 .   ? 50.598 -34.804 -0.801  1.00 20.45 ? 717  HOH A O     1 
HETATM 4005 O  O     . HOH M 9 .   ? 61.683 14.686  8.613   1.00 25.70 ? 718  HOH A O     1 
HETATM 4006 O  O     . HOH M 9 .   ? 75.395 0.556   -3.531  1.00 25.35 ? 719  HOH A O     1 
HETATM 4007 O  O     . HOH M 9 .   ? 63.414 12.838  -10.790 1.00 21.84 ? 720  HOH A O     1 
HETATM 4008 O  O     . HOH M 9 .   ? 49.036 -9.412  10.551  1.00 24.51 ? 721  HOH A O     1 
HETATM 4009 O  O     . HOH M 9 .   ? 36.792 13.113  12.134  1.00 21.81 ? 722  HOH A O     1 
HETATM 4010 O  O     . HOH M 9 .   ? 58.707 15.153  -10.816 1.00 28.89 ? 723  HOH A O     1 
HETATM 4011 O  O     . HOH M 9 .   ? 51.273 -8.727  -5.354  1.00 23.35 ? 724  HOH A O     1 
HETATM 4012 O  O     . HOH M 9 .   ? 45.043 17.050  -18.328 1.00 28.83 ? 725  HOH A O     1 
HETATM 4013 O  O     . HOH M 9 .   ? 70.498 -17.225 12.513  1.00 25.72 ? 726  HOH A O     1 
HETATM 4014 O  O     . HOH M 9 .   ? 53.718 7.471   -14.603 1.00 27.38 ? 727  HOH A O     1 
HETATM 4015 O  O     . HOH M 9 .   ? 56.710 21.617  18.201  1.00 27.48 ? 728  HOH A O     1 
HETATM 4016 O  O     . HOH M 9 .   ? 62.556 11.917  5.410   1.00 32.26 ? 729  HOH A O     1 
HETATM 4017 O  O     . HOH M 9 .   ? 38.827 -19.734 12.403  1.00 31.30 ? 730  HOH A O     1 
HETATM 4018 O  O     . HOH M 9 .   ? 53.236 19.467  -1.550  1.00 26.46 ? 731  HOH A O     1 
HETATM 4019 O  O     . HOH M 9 .   ? 39.573 18.707  18.289  1.00 24.73 ? 732  HOH A O     1 
HETATM 4020 O  O     . HOH M 9 .   ? 35.531 22.538  -3.183  1.00 31.06 ? 733  HOH A O     1 
HETATM 4021 O  O     . HOH M 9 .   ? 65.413 13.107  3.004   1.00 24.45 ? 734  HOH A O     1 
HETATM 4022 O  O     . HOH M 9 .   ? 49.721 -9.338  -8.575  1.00 25.62 ? 735  HOH A O     1 
HETATM 4023 O  O     . HOH M 9 .   ? 58.099 -27.532 11.231  1.00 18.92 ? 736  HOH A O     1 
HETATM 4024 O  O     . HOH M 9 .   ? 46.819 19.557  1.500   1.00 23.47 ? 737  HOH A O     1 
HETATM 4025 O  O     . HOH M 9 .   ? 59.514 -31.501 3.692   1.00 26.51 ? 738  HOH A O     1 
HETATM 4026 O  O     . HOH M 9 .   ? 61.409 8.137   9.747   1.00 25.25 ? 739  HOH A O     1 
HETATM 4027 O  O     . HOH M 9 .   ? 46.114 7.639   -12.950 1.00 30.66 ? 740  HOH A O     1 
HETATM 4028 O  O     . HOH M 9 .   ? 69.788 -12.969 -11.598 1.00 26.10 ? 741  HOH A O     1 
HETATM 4029 O  O     . HOH M 9 .   ? 47.705 15.937  -17.730 1.00 31.93 ? 742  HOH A O     1 
HETATM 4030 O  O     . HOH M 9 .   ? 62.121 23.958  9.812   1.00 25.68 ? 743  HOH A O     1 
HETATM 4031 O  O     . HOH M 9 .   ? 83.985 -5.019  2.609   1.00 26.55 ? 744  HOH A O     1 
HETATM 4032 O  O     . HOH M 9 .   ? 76.643 1.205   -5.746  1.00 32.96 ? 745  HOH A O     1 
HETATM 4033 O  O     . HOH M 9 .   ? 55.509 -32.895 4.892   1.00 28.92 ? 746  HOH A O     1 
HETATM 4034 O  O     . HOH M 9 .   ? 41.250 21.669  2.293   1.00 23.87 ? 747  HOH A O     1 
HETATM 4035 O  O     . HOH M 9 .   ? 41.565 15.754  -23.051 1.00 23.65 ? 748  HOH A O     1 
HETATM 4036 O  O     . HOH M 9 .   ? 69.635 5.499   1.165   1.00 29.91 ? 749  HOH A O     1 
HETATM 4037 O  O     . HOH M 9 .   ? 47.524 -20.296 18.357  1.00 26.99 ? 750  HOH A O     1 
HETATM 4038 O  O     . HOH M 9 .   ? 63.123 -7.362  12.920  1.00 26.90 ? 751  HOH A O     1 
HETATM 4039 O  O     . HOH M 9 .   ? 80.973 -15.925 7.544   1.00 30.85 ? 752  HOH A O     1 
HETATM 4040 O  O     . HOH M 9 .   ? 61.085 -15.744 13.660  1.00 25.10 ? 753  HOH A O     1 
HETATM 4041 O  O     . HOH M 9 .   ? 62.342 -25.600 4.929   1.00 25.16 ? 754  HOH A O     1 
HETATM 4042 O  O     . HOH M 9 .   ? 42.159 -9.008  9.486   1.00 33.29 ? 755  HOH A O     1 
HETATM 4043 O  O     . HOH M 9 .   ? 53.545 -8.454  8.622   1.00 25.60 ? 756  HOH A O     1 
HETATM 4044 O  O     . HOH M 9 .   ? 68.187 -14.674 -10.088 1.00 24.35 ? 757  HOH A O     1 
HETATM 4045 O  O     . HOH M 9 .   ? 43.368 -2.694  -20.159 1.00 24.49 ? 758  HOH A O     1 
HETATM 4046 O  O     . HOH M 9 .   ? 73.693 -20.628 1.139   1.00 27.37 ? 759  HOH A O     1 
HETATM 4047 O  O     . HOH M 9 .   ? 53.008 -19.601 22.063  1.00 28.55 ? 760  HOH A O     1 
HETATM 4048 O  O     . HOH M 9 .   ? 49.045 -34.554 10.203  1.00 31.67 ? 761  HOH A O     1 
HETATM 4049 O  O     . HOH M 9 .   ? 52.788 -12.673 -3.932  1.00 27.98 ? 762  HOH A O     1 
HETATM 4050 O  O     . HOH M 9 .   ? 69.068 -10.892 12.051  1.00 25.97 ? 763  HOH A O     1 
HETATM 4051 O  O     . HOH M 9 .   ? 51.415 -29.183 16.671  1.00 35.30 ? 764  HOH A O     1 
HETATM 4052 O  O     . HOH M 9 .   ? 52.634 8.413   25.465  1.00 26.58 ? 765  HOH A O     1 
HETATM 4053 O  O     . HOH M 9 .   ? 48.228 -33.421 -3.717  1.00 29.07 ? 766  HOH A O     1 
HETATM 4054 O  O     . HOH M 9 .   ? 50.133 -8.901  13.080  1.00 29.78 ? 767  HOH A O     1 
HETATM 4055 O  O     . HOH M 9 .   ? 33.244 2.677   -0.368  1.00 28.70 ? 768  HOH A O     1 
HETATM 4056 O  O     . HOH M 9 .   ? 38.514 -17.918 10.151  1.00 26.70 ? 769  HOH A O     1 
HETATM 4057 O  O     . HOH M 9 .   ? 58.118 -0.080  -14.525 1.00 23.58 ? 770  HOH A O     1 
HETATM 4058 O  O     . HOH M 9 .   ? 44.014 0.420   -21.111 1.00 28.19 ? 771  HOH A O     1 
HETATM 4059 O  O     . HOH M 9 .   ? 21.767 13.653  6.774   1.00 35.29 ? 772  HOH A O     1 
HETATM 4060 O  O     . HOH M 9 .   ? 76.395 2.837   6.895   1.00 26.46 ? 773  HOH A O     1 
HETATM 4061 O  O     . HOH M 9 .   ? 47.870 18.440  -5.276  1.00 31.72 ? 774  HOH A O     1 
HETATM 4062 O  O     . HOH M 9 .   ? 47.325 0.331   6.591   1.00 29.60 ? 775  HOH A O     1 
HETATM 4063 O  O     . HOH M 9 .   ? 60.504 9.503   6.780   1.00 29.67 ? 776  HOH A O     1 
HETATM 4064 O  O     . HOH M 9 .   ? 61.376 -2.626  11.969  1.00 30.07 ? 777  HOH A O     1 
HETATM 4065 O  O     . HOH M 9 .   ? 81.645 -19.990 0.420   1.00 32.37 ? 778  HOH A O     1 
HETATM 4066 O  O     . HOH M 9 .   ? 65.653 8.718   8.944   1.00 27.21 ? 779  HOH A O     1 
HETATM 4067 O  O     . HOH M 9 .   ? 45.033 0.583   -18.402 1.00 25.36 ? 780  HOH A O     1 
HETATM 4068 O  O     . HOH M 9 .   ? 45.623 18.034  -3.611  1.00 26.18 ? 781  HOH A O     1 
HETATM 4069 O  O     . HOH M 9 .   ? 51.512 8.825   -15.511 1.00 31.95 ? 782  HOH A O     1 
HETATM 4070 O  O     . HOH M 9 .   ? 66.019 -4.102  -15.348 1.00 27.52 ? 783  HOH A O     1 
HETATM 4071 O  O     . HOH M 9 .   ? 72.118 -7.775  11.681  1.00 17.56 ? 784  HOH A O     1 
HETATM 4072 O  O     . HOH M 9 .   ? 47.170 16.306  25.463  1.00 25.24 ? 785  HOH A O     1 
HETATM 4073 O  O     . HOH M 9 .   ? 35.445 20.996  0.542   1.00 25.17 ? 786  HOH A O     1 
HETATM 4074 O  O     . HOH M 9 .   ? 51.757 -35.169 7.760   1.00 26.05 ? 787  HOH A O     1 
HETATM 4075 O  O     . HOH M 9 .   ? 70.434 -6.815  13.703  1.00 32.08 ? 788  HOH A O     1 
HETATM 4076 O  O     . HOH M 9 .   ? 66.043 -26.069 0.424   1.00 24.73 ? 789  HOH A O     1 
HETATM 4077 O  O     . HOH M 9 .   ? 46.320 -9.374  10.752  1.00 31.48 ? 790  HOH A O     1 
HETATM 4078 O  O     . HOH M 9 .   ? 48.820 13.514  28.148  1.00 27.68 ? 791  HOH A O     1 
HETATM 4079 O  O     . HOH M 9 .   ? 66.549 3.951   10.804  1.00 26.15 ? 792  HOH A O     1 
HETATM 4080 O  O     . HOH M 9 .   ? 42.842 17.392  -17.216 1.00 29.40 ? 793  HOH A O     1 
HETATM 4081 O  O     . HOH M 9 .   ? 48.173 -17.876 17.191  1.00 30.99 ? 794  HOH A O     1 
HETATM 4082 O  O     . HOH M 9 .   ? 60.636 -28.336 8.349   1.00 26.02 ? 795  HOH A O     1 
HETATM 4083 O  O     . HOH M 9 .   ? 34.359 5.797   -21.917 1.00 30.57 ? 796  HOH A O     1 
HETATM 4084 O  O     . HOH M 9 .   ? 71.849 -19.036 14.104  1.00 32.88 ? 797  HOH A O     1 
HETATM 4085 O  O     . HOH M 9 .   ? 58.903 4.655   23.116  1.00 26.92 ? 798  HOH A O     1 
HETATM 4086 O  O     . HOH M 9 .   ? 34.308 17.615  -12.880 1.00 28.79 ? 799  HOH A O     1 
HETATM 4087 O  O     . HOH M 9 .   ? 82.473 -10.289 -0.742  1.00 35.39 ? 800  HOH A O     1 
HETATM 4088 O  O     . HOH M 9 .   ? 69.685 10.145  -8.450  1.00 24.92 ? 801  HOH A O     1 
HETATM 4089 O  O     . HOH M 9 .   ? 50.836 17.769  -5.955  1.00 31.29 ? 802  HOH A O     1 
HETATM 4090 O  O     . HOH M 9 .   ? 63.419 -4.706  -15.947 1.00 35.13 ? 803  HOH A O     1 
HETATM 4091 O  O     . HOH M 9 .   ? 83.698 -8.144  0.699   1.00 35.88 ? 804  HOH A O     1 
HETATM 4092 O  O     . HOH M 9 .   ? 60.128 14.359  3.366   1.00 24.04 ? 805  HOH A O     1 
HETATM 4093 O  O     . HOH M 9 .   ? 67.376 -8.344  10.064  1.00 21.51 ? 806  HOH A O     1 
HETATM 4094 O  O     . HOH M 9 .   ? 67.812 2.091   12.318  1.00 33.96 ? 807  HOH A O     1 
HETATM 4095 O  O     . HOH M 9 .   ? 57.280 -16.573 -11.340 1.00 26.05 ? 808  HOH A O     1 
HETATM 4096 O  O     . HOH M 9 .   ? 63.437 -18.943 -1.566  1.00 21.46 ? 809  HOH A O     1 
HETATM 4097 O  O     . HOH M 9 .   ? 54.676 -35.133 1.206   1.00 36.62 ? 810  HOH A O     1 
HETATM 4098 O  O     . HOH M 9 .   ? 65.183 19.684  1.821   1.00 20.95 ? 811  HOH A O     1 
HETATM 4099 O  O     . HOH M 9 .   ? 48.256 19.904  4.440   1.00 29.77 ? 812  HOH A O     1 
HETATM 4100 O  O     . HOH M 9 .   ? 73.541 4.795   -0.591  1.00 34.65 ? 813  HOH A O     1 
HETATM 4101 O  O     . HOH M 9 .   ? 60.492 13.821  6.161   1.00 27.30 ? 814  HOH A O     1 
HETATM 4102 O  O     . HOH M 9 .   ? 60.403 6.368   -15.554 1.00 27.61 ? 815  HOH A O     1 
HETATM 4103 O  O     . HOH M 9 .   ? 52.602 3.643   17.723  1.00 26.41 ? 816  HOH A O     1 
HETATM 4104 O  O     . HOH M 9 .   ? 50.151 -15.950 -9.271  1.00 34.21 ? 817  HOH A O     1 
HETATM 4105 O  O     . HOH M 9 .   ? 55.815 13.729  -11.493 1.00 23.08 ? 818  HOH A O     1 
HETATM 4106 O  O     . HOH M 9 .   ? 34.335 20.015  -16.254 1.00 34.31 ? 819  HOH A O     1 
HETATM 4107 O  O     . HOH M 9 .   ? 40.491 -28.726 -9.823  1.00 30.84 ? 820  HOH A O     1 
HETATM 4108 O  O     . HOH M 9 .   ? 65.543 -22.311 -7.805  1.00 29.45 ? 821  HOH A O     1 
HETATM 4109 O  O     . HOH M 9 .   ? 56.335 -3.108  4.290   1.00 32.17 ? 822  HOH A O     1 
HETATM 4110 O  O     . HOH M 9 .   ? 40.778 15.734  -8.675  1.00 39.69 ? 823  HOH A O     1 
HETATM 4111 O  O     . HOH M 9 .   ? 53.201 24.270  4.202   1.00 29.70 ? 824  HOH A O     1 
HETATM 4112 O  O     . HOH M 9 .   ? 41.505 20.297  4.812   1.00 22.08 ? 825  HOH A O     1 
HETATM 4113 O  O     . HOH M 9 .   ? 70.365 -21.777 0.725   1.00 23.97 ? 826  HOH A O     1 
HETATM 4114 O  O     . HOH M 9 .   ? 34.061 15.487  18.582  1.00 34.15 ? 827  HOH A O     1 
HETATM 4115 O  O     . HOH M 9 .   ? 44.545 10.361  -24.650 1.00 30.52 ? 828  HOH A O     1 
HETATM 4116 O  O     . HOH M 9 .   ? 68.350 -26.191 -0.781  1.00 26.33 ? 829  HOH A O     1 
HETATM 4117 O  O     . HOH M 9 .   ? 48.099 0.744   -19.019 1.00 33.16 ? 830  HOH A O     1 
HETATM 4118 O  O     . HOH M 9 .   ? 18.761 21.405  -5.217  1.00 39.40 ? 831  HOH A O     1 
HETATM 4119 O  O     . HOH M 9 .   ? 79.124 3.398   2.179   1.00 29.44 ? 832  HOH A O     1 
HETATM 4120 O  O     . HOH M 9 .   ? 55.577 -1.347  -14.719 1.00 26.04 ? 833  HOH A O     1 
HETATM 4121 O  O     . HOH M 9 .   ? 52.993 -26.517 -3.996  1.00 23.44 ? 834  HOH A O     1 
HETATM 4122 O  O     . HOH M 9 .   ? 41.052 -29.724 12.928  1.00 26.33 ? 835  HOH A O     1 
HETATM 4123 O  O     . HOH M 9 .   ? 53.881 -32.548 -2.916  1.00 29.11 ? 836  HOH A O     1 
HETATM 4124 O  O     . HOH M 9 .   ? 51.996 11.828  -19.767 1.00 33.27 ? 837  HOH A O     1 
HETATM 4125 O  O     . HOH M 9 .   ? 71.323 9.045   -6.541  1.00 24.76 ? 838  HOH A O     1 
HETATM 4126 O  O     . HOH M 9 .   ? 61.552 -31.611 -10.758 1.00 28.77 ? 839  HOH A O     1 
HETATM 4127 O  O     . HOH M 9 .   ? 68.316 -16.818 -12.083 1.00 36.09 ? 840  HOH A O     1 
HETATM 4128 O  O     . HOH M 9 .   ? 46.406 10.612  -13.648 1.00 36.08 ? 841  HOH A O     1 
HETATM 4129 O  O     . HOH M 9 .   ? 68.912 -1.342  -13.822 1.00 33.57 ? 842  HOH A O     1 
HETATM 4130 O  O     . HOH M 9 .   ? 65.226 -9.266  12.411  1.00 31.18 ? 843  HOH A O     1 
HETATM 4131 O  O     . HOH M 9 .   ? 57.591 3.077   18.154  1.00 22.73 ? 844  HOH A O     1 
HETATM 4132 O  O     . HOH M 9 .   ? 47.514 -16.641 -1.024  1.00 29.09 ? 845  HOH A O     1 
HETATM 4133 O  O     . HOH M 9 .   ? 55.595 -20.641 21.255  1.00 23.09 ? 846  HOH A O     1 
HETATM 4134 O  O     . HOH M 9 .   ? 27.626 6.646   -16.976 1.00 26.00 ? 847  HOH A O     1 
HETATM 4135 O  O     . HOH M 9 .   ? 25.563 14.617  5.202   1.00 29.04 ? 848  HOH A O     1 
HETATM 4136 O  O     . HOH M 9 .   ? 33.637 7.668   17.301  1.00 35.46 ? 849  HOH A O     1 
HETATM 4137 O  O     . HOH M 9 .   ? 50.140 -27.415 18.592  1.00 32.09 ? 850  HOH A O     1 
HETATM 4138 O  O     . HOH M 9 .   ? 85.320 -9.243  7.950   1.00 45.25 ? 851  HOH A O     1 
HETATM 4139 O  O     . HOH M 9 .   ? 39.407 4.758   18.484  1.00 33.75 ? 852  HOH A O     1 
HETATM 4140 O  O     . HOH M 9 .   ? 38.312 -25.337 6.020   1.00 35.36 ? 853  HOH A O     1 
HETATM 4141 O  O     . HOH M 9 .   ? 46.023 -10.590 -0.183  1.00 29.60 ? 854  HOH A O     1 
HETATM 4142 O  O     . HOH M 9 .   ? 43.527 17.685  -12.877 1.00 39.77 ? 855  HOH A O     1 
HETATM 4143 O  O     . HOH M 9 .   ? 49.208 14.898  -22.604 1.00 30.71 ? 856  HOH A O     1 
HETATM 4144 O  O     . HOH M 9 .   ? 57.815 12.152  -12.119 1.00 31.35 ? 857  HOH A O     1 
HETATM 4145 O  O     . HOH M 9 .   ? 37.162 15.262  -20.552 1.00 37.75 ? 858  HOH A O     1 
HETATM 4146 O  O     . HOH M 9 .   ? 68.721 -21.662 -8.382  1.00 34.15 ? 859  HOH A O     1 
HETATM 4147 O  O     . HOH M 9 .   ? 61.922 16.116  2.365   1.00 27.28 ? 860  HOH A O     1 
HETATM 4148 O  O     . HOH M 9 .   ? 69.821 -8.776  10.616  1.00 22.09 ? 861  HOH A O     1 
HETATM 4149 O  O     . HOH M 9 .   ? 57.502 -19.017 22.090  1.00 30.97 ? 862  HOH A O     1 
HETATM 4150 O  O     . HOH M 9 .   ? 38.940 4.797   15.901  1.00 35.17 ? 863  HOH A O     1 
HETATM 4151 O  O     . HOH M 9 .   ? 21.804 11.821  -9.507  1.00 29.54 ? 864  HOH A O     1 
HETATM 4152 O  O     . HOH M 9 .   ? 57.516 0.154   10.810  1.00 26.74 ? 865  HOH A O     1 
HETATM 4153 O  O     . HOH M 9 .   ? 65.963 21.879  1.568   1.00 28.26 ? 866  HOH A O     1 
HETATM 4154 O  O     . HOH M 9 .   ? 44.055 15.696  26.143  1.00 28.66 ? 867  HOH A O     1 
HETATM 4155 O  O     . HOH M 9 .   ? 62.296 -13.119 -13.462 1.00 31.23 ? 868  HOH A O     1 
HETATM 4156 O  O     . HOH M 9 .   ? 50.549 -13.280 -0.906  1.00 29.60 ? 869  HOH A O     1 
HETATM 4157 O  O     . HOH M 9 .   ? 44.697 -17.032 -0.446  1.00 27.59 ? 870  HOH A O     1 
HETATM 4158 O  O     . HOH M 9 .   ? 38.583 13.638  24.436  1.00 32.68 ? 871  HOH A O     1 
HETATM 4159 O  O     . HOH M 9 .   ? 61.866 4.744   -17.214 1.00 30.62 ? 872  HOH A O     1 
HETATM 4160 O  O     . HOH M 9 .   ? 48.608 -6.038  -11.413 1.00 35.26 ? 873  HOH A O     1 
HETATM 4161 O  O     . HOH M 9 .   ? 49.097 -0.330  -16.859 1.00 28.66 ? 874  HOH A O     1 
HETATM 4162 O  O     . HOH M 9 .   ? 83.036 -21.636 2.481   1.00 30.44 ? 875  HOH A O     1 
HETATM 4163 O  O     . HOH M 9 .   ? 37.877 -15.684 12.073  1.00 35.27 ? 876  HOH A O     1 
HETATM 4164 O  O     . HOH M 9 .   ? 50.488 -6.401  -5.548  1.00 32.12 ? 877  HOH A O     1 
HETATM 4165 O  O     . HOH M 9 .   ? 62.153 12.303  9.448   1.00 37.09 ? 878  HOH A O     1 
HETATM 4166 O  O     . HOH M 9 .   ? 81.916 -21.372 -1.497  1.00 36.80 ? 879  HOH A O     1 
HETATM 4167 O  O     . HOH M 9 .   ? 38.334 10.467  9.630   1.00 26.00 ? 880  HOH A O     1 
HETATM 4168 O  O     . HOH M 9 .   ? 75.272 -22.371 -6.263  1.00 35.25 ? 881  HOH A O     1 
HETATM 4169 O  O     . HOH M 9 .   ? 53.267 1.819   19.345  1.00 35.44 ? 882  HOH A O     1 
HETATM 4170 O  O     . HOH M 9 .   ? 49.136 -38.264 0.444   1.00 26.80 ? 883  HOH A O     1 
HETATM 4171 O  O     . HOH M 9 .   ? 38.435 -27.919 7.146   1.00 30.60 ? 884  HOH A O     1 
HETATM 4172 O  O     . HOH M 9 .   ? 44.777 -33.181 -3.042  1.00 28.44 ? 885  HOH A O     1 
HETATM 4173 O  O     . HOH M 9 .   ? 40.845 -1.810  -16.363 1.00 28.42 ? 886  HOH A O     1 
HETATM 4174 O  O     . HOH M 9 .   ? 51.612 19.722  -4.308  1.00 28.77 ? 887  HOH A O     1 
HETATM 4175 O  O     . HOH M 9 .   ? 59.822 3.530   21.007  1.00 32.50 ? 888  HOH A O     1 
HETATM 4176 O  O     . HOH M 9 .   ? 51.574 -34.086 10.626  1.00 39.06 ? 889  HOH A O     1 
HETATM 4177 O  O     . HOH M 9 .   ? 37.768 7.596   21.725  1.00 32.44 ? 890  HOH A O     1 
HETATM 4178 O  O     . HOH M 9 .   ? 48.740 11.174  -13.768 1.00 36.04 ? 891  HOH A O     1 
HETATM 4179 O  O     . HOH M 9 .   ? 56.161 -33.206 2.288   1.00 25.94 ? 892  HOH A O     1 
HETATM 4180 O  O     . HOH M 9 .   ? 11.696 1.063   -4.311  1.00 50.38 ? 893  HOH A O     1 
HETATM 4181 O  O     . HOH M 9 .   ? 61.821 11.507  -12.265 1.00 31.04 ? 894  HOH A O     1 
HETATM 4182 O  O     . HOH M 9 .   ? 55.435 -17.362 -13.294 1.00 34.61 ? 895  HOH A O     1 
HETATM 4183 O  O     . HOH M 9 .   ? 48.017 -11.430 -1.645  1.00 37.73 ? 896  HOH A O     1 
HETATM 4184 O  O     . HOH M 9 .   ? 61.110 -0.247  -16.109 1.00 28.65 ? 897  HOH A O     1 
HETATM 4185 O  O     . HOH M 9 .   ? 64.717 -15.755 13.830  1.00 31.29 ? 898  HOH A O     1 
HETATM 4186 O  O     . HOH M 9 .   ? 43.951 -33.229 5.791   1.00 36.04 ? 899  HOH A O     1 
HETATM 4187 O  O     . HOH M 9 .   ? 59.316 -18.593 -9.856  1.00 32.41 ? 900  HOH A O     1 
HETATM 4188 O  O     . HOH M 9 .   ? 63.794 17.902  15.683  1.00 37.59 ? 901  HOH A O     1 
HETATM 4189 O  O     . HOH M 9 .   ? 50.001 0.660   20.197  1.00 37.84 ? 902  HOH A O     1 
HETATM 4190 O  O     . HOH M 9 .   ? 55.946 5.578   25.012  1.00 35.96 ? 903  HOH A O     1 
HETATM 4191 O  O     . HOH M 9 .   ? 53.820 -22.494 -5.340  1.00 31.57 ? 904  HOH A O     1 
HETATM 4192 O  O     . HOH M 9 .   ? 42.725 5.605   21.022  1.00 30.29 ? 905  HOH A O     1 
HETATM 4193 O  O     . HOH M 9 .   ? 59.328 9.056   22.459  1.00 34.28 ? 906  HOH A O     1 
HETATM 4194 O  O     . HOH M 9 .   ? 51.588 13.506  -11.591 1.00 30.59 ? 907  HOH A O     1 
HETATM 4195 O  O     . HOH M 9 .   ? 44.404 -1.651  -16.385 1.00 32.96 ? 908  HOH A O     1 
HETATM 4196 O  O     . HOH M 9 .   ? 34.688 14.176  21.929  1.00 37.87 ? 909  HOH A O     1 
HETATM 4197 O  O     . HOH M 9 .   ? 37.489 13.980  21.894  1.00 29.20 ? 910  HOH A O     1 
HETATM 4198 O  O     . HOH M 9 .   ? 38.347 -22.660 10.882  1.00 31.58 ? 911  HOH A O     1 
HETATM 4199 O  O     . HOH M 9 .   ? 47.375 -4.837  -16.233 1.00 30.09 ? 912  HOH A O     1 
HETATM 4200 O  O     . HOH M 9 .   ? 72.758 -23.491 -5.385  1.00 34.83 ? 913  HOH A O     1 
HETATM 4201 O  O     . HOH M 9 .   ? 81.530 -10.912 -8.320  1.00 39.18 ? 914  HOH A O     1 
HETATM 4202 O  O     . HOH M 9 .   ? 51.528 6.275   -18.907 1.00 32.30 ? 915  HOH A O     1 
HETATM 4203 O  O     . HOH M 9 .   ? 33.952 3.098   2.733   1.00 36.91 ? 916  HOH A O     1 
HETATM 4204 O  O     . HOH M 9 .   ? 52.119 -5.959  -0.917  1.00 29.93 ? 917  HOH A O     1 
HETATM 4205 O  O     . HOH M 9 .   ? 42.418 -30.274 -3.896  1.00 33.60 ? 918  HOH A O     1 
HETATM 4206 O  O     . HOH M 9 .   ? 52.938 1.776   16.162  1.00 37.97 ? 919  HOH A O     1 
HETATM 4207 O  O     . HOH M 9 .   ? 48.572 22.304  3.255   1.00 39.16 ? 920  HOH A O     1 
HETATM 4208 O  O     . HOH M 9 .   ? 85.808 -4.117  -3.001  1.00 41.77 ? 921  HOH A O     1 
HETATM 4209 O  O     . HOH M 9 .   ? 39.359 -2.033  -14.247 1.00 32.13 ? 922  HOH A O     1 
HETATM 4210 O  O     . HOH M 9 .   ? 65.306 20.059  6.565   1.00 32.95 ? 923  HOH A O     1 
HETATM 4211 O  O     . HOH M 9 .   ? 83.028 -3.243  -4.128  1.00 34.13 ? 924  HOH A O     1 
HETATM 4212 O  O     . HOH M 9 .   ? 61.941 8.949   18.732  1.00 35.36 ? 925  HOH A O     1 
HETATM 4213 O  O     . HOH M 9 .   ? 51.828 -17.965 -6.346  1.00 31.44 ? 926  HOH A O     1 
HETATM 4214 O  O     . HOH M 9 .   ? 46.328 1.753   20.705  1.00 35.14 ? 927  HOH A O     1 
HETATM 4215 O  O     . HOH M 9 .   ? 43.244 -25.470 17.419  1.00 31.97 ? 928  HOH A O     1 
HETATM 4216 O  O     . HOH M 9 .   ? 49.298 12.364  -11.467 1.00 35.80 ? 929  HOH A O     1 
HETATM 4217 O  O     . HOH M 9 .   ? 63.513 8.107   11.433  1.00 35.91 ? 930  HOH A O     1 
HETATM 4218 O  O     . HOH M 9 .   ? 43.495 16.053  -10.704 1.00 34.19 ? 931  HOH A O     1 
HETATM 4219 O  O     . HOH M 9 .   ? 40.337 15.688  25.199  1.00 41.58 ? 932  HOH A O     1 
HETATM 4220 O  O     . HOH M 9 .   ? 30.730 1.704   -22.001 1.00 36.93 ? 933  HOH A O     1 
HETATM 4221 O  O     . HOH M 9 .   ? 54.251 -0.959  -17.239 1.00 38.03 ? 934  HOH A O     1 
HETATM 4222 O  O     . HOH M 9 .   ? 69.967 -18.573 -9.495  1.00 36.86 ? 935  HOH A O     1 
HETATM 4223 O  O     . HOH M 9 .   ? 32.046 -1.336  -2.952  1.00 37.65 ? 936  HOH A O     1 
HETATM 4224 O  O     . HOH M 9 .   ? 44.137 -7.369  10.305  1.00 40.51 ? 937  HOH A O     1 
HETATM 4225 O  O     . HOH M 9 .   ? 34.686 11.788  -22.475 1.00 39.51 ? 938  HOH A O     1 
HETATM 4226 O  O     . HOH M 9 .   ? 65.208 17.438  7.570   1.00 35.64 ? 939  HOH A O     1 
HETATM 4227 O  O     . HOH M 9 .   ? 49.756 -14.888 -3.623  1.00 37.99 ? 940  HOH A O     1 
HETATM 4228 O  O     . HOH M 9 .   ? 40.068 -12.964 10.937  1.00 37.14 ? 941  HOH A O     1 
HETATM 4229 O  O     . HOH M 9 .   ? 59.156 -24.498 -7.366  1.00 33.33 ? 942  HOH A O     1 
HETATM 4230 O  O     . HOH M 9 .   ? 37.160 18.777  16.705  1.00 34.66 ? 943  HOH A O     1 
HETATM 4231 O  O     . HOH M 9 .   ? 45.635 12.197  -9.219  1.00 34.52 ? 944  HOH A O     1 
HETATM 4232 O  O     . HOH M 9 .   ? 61.425 -29.250 1.358   1.00 36.17 ? 945  HOH A O     1 
HETATM 4233 O  O     . HOH M 9 .   ? 61.554 -17.610 -13.163 1.00 35.93 ? 946  HOH A O     1 
HETATM 4234 O  O     . HOH M 9 .   ? 63.198 -25.067 0.208   1.00 31.77 ? 947  HOH A O     1 
HETATM 4235 O  O     . HOH M 9 .   ? 50.798 5.624   -23.533 1.00 39.08 ? 948  HOH A O     1 
HETATM 4236 O  O     . HOH M 9 .   ? 37.478 -11.816 10.837  1.00 47.60 ? 949  HOH A O     1 
HETATM 4237 O  O     . HOH M 9 .   ? 49.404 19.780  -3.262  1.00 25.00 ? 950  HOH A O     1 
HETATM 4238 O  O     . HOH M 9 .   ? 47.165 15.982  -23.878 1.00 26.47 ? 951  HOH A O     1 
HETATM 4239 O  O     . HOH M 9 .   ? 73.322 -19.676 -2.875  1.00 20.63 ? 952  HOH A O     1 
HETATM 4240 O  O     . HOH M 9 .   ? 76.577 -17.881 0.550   1.00 29.59 ? 953  HOH A O     1 
HETATM 4241 O  O     . HOH M 9 .   ? 33.352 10.648  8.361   1.00 36.62 ? 954  HOH A O     1 
HETATM 4242 O  O     . HOH M 9 .   ? 40.724 -29.497 -2.115  1.00 24.99 ? 955  HOH A O     1 
HETATM 4243 O  O     . HOH M 9 .   ? 49.116 -24.034 19.174  1.00 36.31 ? 956  HOH A O     1 
HETATM 4244 O  O     . HOH M 9 .   ? 39.995 -22.562 3.003   1.00 32.04 ? 957  HOH A O     1 
HETATM 4245 O  O     . HOH M 9 .   ? 42.925 20.064  -12.119 1.00 40.44 ? 958  HOH A O     1 
HETATM 4246 O  O     . HOH M 9 .   ? 33.544 22.410  -0.499  1.00 39.96 ? 959  HOH A O     1 
HETATM 4247 O  O     . HOH M 9 .   ? 29.176 18.016  -16.114 1.00 34.70 ? 960  HOH A O     1 
HETATM 4248 O  O     . HOH M 9 .   ? 46.797 19.727  -2.624  1.00 28.92 ? 961  HOH A O     1 
HETATM 4249 O  O     . HOH M 9 .   ? 36.017 11.051  10.289  1.00 31.31 ? 962  HOH A O     1 
HETATM 4250 O  O     . HOH M 9 .   ? 32.672 2.885   -24.145 1.00 35.75 ? 963  HOH A O     1 
HETATM 4251 O  O     . HOH M 9 .   ? 58.210 17.839  19.729  1.00 28.57 ? 964  HOH A O     1 
HETATM 4252 O  O     . HOH M 9 .   ? 27.419 20.783  -6.717  1.00 35.97 ? 965  HOH A O     1 
HETATM 4253 O  O     . HOH M 9 .   ? 30.247 -1.345  -21.861 1.00 43.27 ? 966  HOH A O     1 
HETATM 4254 O  O     . HOH M 9 .   ? 65.681 5.722   12.787  1.00 37.20 ? 967  HOH A O     1 
HETATM 4255 O  O     . HOH M 9 .   ? 43.311 -16.104 -2.773  1.00 37.39 ? 968  HOH A O     1 
HETATM 4256 O  O     . HOH M 9 .   ? 83.507 -4.264  -16.589 1.00 40.75 ? 969  HOH A O     1 
HETATM 4257 O  O     . HOH M 9 .   ? 48.896 -29.595 15.826  1.00 34.22 ? 970  HOH A O     1 
HETATM 4258 O  O     . HOH M 9 .   ? 56.677 1.279   13.500  1.00 30.54 ? 971  HOH A O     1 
HETATM 4259 O  O     . HOH M 9 .   ? 37.758 -28.849 9.558   1.00 33.85 ? 972  HOH A O     1 
HETATM 4260 O  O     . HOH M 9 .   ? 67.847 -5.252  -17.575 1.00 32.37 ? 973  HOH A O     1 
HETATM 4261 O  O     . HOH M 9 .   ? 38.093 -24.659 2.060   1.00 36.04 ? 974  HOH A O     1 
HETATM 4262 O  O     . HOH M 9 .   ? 83.296 -13.967 9.240   1.00 36.41 ? 975  HOH A O     1 
HETATM 4263 O  O     . HOH M 9 .   ? 47.110 -22.701 17.242  1.00 25.95 ? 976  HOH A O     1 
HETATM 4264 O  O     . HOH M 9 .   ? 67.235 6.444   9.873   1.00 33.42 ? 977  HOH A O     1 
HETATM 4265 O  O     . HOH M 9 .   ? 47.731 -24.091 -7.674  1.00 33.36 ? 978  HOH A O     1 
HETATM 4266 O  O     . HOH M 9 .   ? 51.143 -22.551 -5.593  1.00 28.74 ? 979  HOH A O     1 
HETATM 4267 O  O     . HOH M 9 .   ? 58.962 6.859   25.138  1.00 39.00 ? 980  HOH A O     1 
HETATM 4268 O  O     . HOH M 9 .   ? 51.273 21.737  6.984   1.00 23.14 ? 981  HOH A O     1 
HETATM 4269 O  O     . HOH M 9 .   ? 65.737 5.799   2.023   1.00 21.00 ? 982  HOH A O     1 
HETATM 4270 O  O     . HOH M 9 .   ? 73.516 9.521   -5.156  1.00 39.63 ? 983  HOH A O     1 
HETATM 4271 O  O     . HOH M 9 .   ? 53.734 -0.306  6.224   1.00 27.44 ? 984  HOH A O     1 
HETATM 4272 O  O     . HOH M 9 .   ? 70.354 1.651   -13.568 1.00 31.69 ? 985  HOH A O     1 
HETATM 4273 O  O     . HOH M 9 .   ? 72.368 2.147   12.415  1.00 35.61 ? 986  HOH A O     1 
HETATM 4274 O  O     . HOH M 9 .   ? 70.347 6.960   -11.791 1.00 33.91 ? 987  HOH A O     1 
HETATM 4275 O  O     . HOH M 9 .   ? 74.197 3.894   -3.161  1.00 34.56 ? 988  HOH A O     1 
HETATM 4276 O  O     . HOH M 9 .   ? 77.378 -16.187 2.481   1.00 30.40 ? 989  HOH A O     1 
HETATM 4277 O  O     . HOH M 9 .   ? 50.559 14.241  -19.983 1.00 40.27 ? 990  HOH A O     1 
HETATM 4278 O  O     . HOH M 9 .   ? 44.067 21.819  -13.529 1.00 41.95 ? 991  HOH A O     1 
HETATM 4279 O  O     . HOH M 9 .   ? 39.593 22.323  -3.398  1.00 37.35 ? 992  HOH A O     1 
HETATM 4280 O  O     . HOH M 9 .   ? 45.592 -33.035 8.649   1.00 37.91 ? 993  HOH A O     1 
HETATM 4281 O  O     . HOH M 9 .   ? 55.560 -0.565  8.761   1.00 30.31 ? 994  HOH A O     1 
HETATM 4282 O  O     . HOH M 9 .   ? 63.492 4.848   14.048  1.00 37.69 ? 995  HOH A O     1 
HETATM 4283 O  O     . HOH M 9 .   ? 80.918 -20.538 2.821   1.00 31.61 ? 996  HOH A O     1 
HETATM 4284 O  O     . HOH M 9 .   ? 54.323 -36.549 6.408   1.00 36.08 ? 997  HOH A O     1 
HETATM 4285 O  O     . HOH M 9 .   ? 46.316 2.362   -4.043  1.00 32.01 ? 998  HOH A O     1 
HETATM 4286 O  O     . HOH M 9 .   ? 20.310 10.095  8.961   1.00 43.63 ? 999  HOH A O     1 
HETATM 4287 O  O     . HOH M 9 .   ? 70.431 -2.933  -15.520 1.00 37.16 ? 1000 HOH A O     1 
HETATM 4288 O  O     . HOH M 9 .   ? 48.197 -4.949  -5.201  1.00 38.68 ? 1001 HOH A O     1 
HETATM 4289 O  O     . HOH M 9 .   ? 37.775 11.025  21.597  1.00 38.11 ? 1002 HOH A O     1 
HETATM 4290 O  O     . HOH M 9 .   ? 69.085 2.348   -15.705 1.00 36.07 ? 1003 HOH A O     1 
HETATM 4291 O  O     . HOH M 9 .   ? 63.150 24.359  12.178  1.00 34.70 ? 1004 HOH A O     1 
HETATM 4292 O  O     . HOH M 9 .   ? 39.527 19.233  -7.376  1.00 40.03 ? 1005 HOH A O     1 
HETATM 4293 O  O     . HOH M 9 .   ? 33.378 0.086   -24.868 1.00 39.91 ? 1006 HOH A O     1 
HETATM 4294 O  O     . HOH M 9 .   ? 53.160 -0.176  12.364  1.00 36.46 ? 1007 HOH A O     1 
HETATM 4295 O  O     . HOH M 9 .   ? 79.472 -23.572 -0.594  1.00 36.65 ? 1008 HOH A O     1 
HETATM 4296 O  O     . HOH M 9 .   ? 47.650 -0.161  -8.180  1.00 27.67 ? 1009 HOH A O     1 
HETATM 4297 O  O     . HOH M 9 .   ? 39.790 7.112   13.623  1.00 27.03 ? 1010 HOH A O     1 
HETATM 4298 O  O     . HOH M 9 .   ? 42.054 8.106   3.225   1.00 24.88 ? 1011 HOH A O     1 
HETATM 4299 O  O     . HOH N 9 .   ? 40.742 11.486  -3.527  1.00 14.00 ? 101  HOH T O     1 
HETATM 4300 O  O     . HOH N 9 .   ? 40.920 -3.504  -9.340  1.00 28.94 ? 102  HOH T O     1 
HETATM 4301 O  O     . HOH N 9 .   ? 42.096 -7.224  -10.697 1.00 29.82 ? 103  HOH T O     1 
HETATM 4302 O  O     . HOH N 9 .   ? 37.078 -23.051 -5.243  1.00 25.77 ? 104  HOH T O     1 
HETATM 4303 O  O     . HOH N 9 .   ? 31.100 -16.285 -4.579  1.00 30.46 ? 105  HOH T O     1 
HETATM 4304 O  O     . HOH N 9 .   ? 36.065 11.107  0.831   1.00 21.99 ? 106  HOH T O     1 
HETATM 4305 O  O     . HOH N 9 .   ? 41.766 -20.057 -3.451  1.00 35.98 ? 107  HOH T O     1 
HETATM 4306 O  O     . HOH N 9 .   ? 43.404 5.437   -9.054  1.00 24.65 ? 108  HOH T O     1 
HETATM 4307 O  O     . HOH N 9 .   ? 38.680 -2.409  -6.322  1.00 34.68 ? 109  HOH T O     1 
HETATM 4308 O  O     . HOH N 9 .   ? 39.004 2.544   -6.629  1.00 33.49 ? 110  HOH T O     1 
HETATM 4309 O  O     . HOH N 9 .   ? 40.309 -18.183 -1.819  1.00 31.70 ? 111  HOH T O     1 
HETATM 4310 O  O     . HOH N 9 .   ? 36.537 -8.412  -9.957  1.00 39.57 ? 112  HOH T O     1 
HETATM 4311 O  O     . HOH N 9 .   ? 36.579 -2.958  -4.311  1.00 31.09 ? 113  HOH T O     1 
HETATM 4312 O  O     . HOH N 9 .   ? 36.168 2.540   4.530   1.00 28.07 ? 114  HOH T O     1 
HETATM 4313 O  O     . HOH N 9 .   ? 37.635 -0.036  4.775   1.00 33.15 ? 115  HOH T O     1 
HETATM 4314 O  O     . HOH N 9 .   ? 44.552 -8.489  -3.606  1.00 31.73 ? 116  HOH T O     1 
HETATM 4315 O  O     . HOH N 9 .   ? 35.437 5.714   18.306  1.00 40.64 ? 117  HOH T O     1 
HETATM 4316 O  O     . HOH N 9 .   ? 37.897 -4.303  -8.463  1.00 41.50 ? 118  HOH T O     1 
HETATM 4317 O  O     . HOH N 9 .   ? 36.672 -1.942  -1.059  1.00 32.26 ? 119  HOH T O     1 
HETATM 4318 O  O     . HOH N 9 .   ? 37.714 -12.904 -11.271 1.00 30.39 ? 120  HOH T O     1 
HETATM 4319 O  O     . HOH N 9 .   ? 43.575 5.605   0.449   1.00 28.80 ? 121  HOH T O     1 
HETATM 4320 O  O     . HOH N 9 .   ? 38.846 -10.367 -10.062 1.00 33.20 ? 122  HOH T O     1 
HETATM 4321 O  O     . HOH N 9 .   ? 45.397 -4.946  -3.311  1.00 30.17 ? 123  HOH T O     1 
HETATM 4322 O  O     . HOH N 9 .   ? 45.799 5.610   -5.134  1.00 26.73 ? 124  HOH T O     1 
HETATM 4323 O  O     . HOH N 9 .   ? 38.190 -21.776 -3.054  1.00 31.47 ? 125  HOH T O     1 
HETATM 4324 O  O     . HOH N 9 .   ? 25.866 -19.377 -6.846  1.00 32.23 ? 126  HOH T O     1 
HETATM 4325 O  O     . HOH N 9 .   ? 32.602 -17.119 -2.511  1.00 36.01 ? 127  HOH T O     1 
HETATM 4326 O  O     . HOH N 9 .   ? 46.907 -8.375  -4.727  1.00 37.70 ? 128  HOH T O     1 
HETATM 4327 O  O     . HOH N 9 .   ? 44.845 6.531   -2.993  1.00 33.03 ? 129  HOH T O     1 
HETATM 4328 O  O     . HOH N 9 .   ? 41.229 -10.011 -11.470 1.00 41.78 ? 130  HOH T O     1 
HETATM 4329 O  O     . HOH N 9 .   ? 40.327 8.902   8.775   1.00 33.72 ? 131  HOH T O     1 
HETATM 4330 O  O     . HOH N 9 .   ? 32.013 14.213  10.890  1.00 36.64 ? 132  HOH T O     1 
HETATM 4331 O  O     . HOH N 9 .   ? 37.219 0.093   -3.227  1.00 35.22 ? 133  HOH T O     1 
HETATM 4332 O  O     . HOH O 9 .   ? 49.582 -10.140 6.594   1.00 16.17 ? 201  HOH P O     1 
HETATM 4333 O  O     . HOH O 9 .   ? 42.009 -11.591 -0.948  1.00 21.96 ? 202  HOH P O     1 
HETATM 4334 O  O     . HOH O 9 .   ? 42.908 -8.958  7.106   1.00 19.68 ? 203  HOH P O     1 
HETATM 4335 O  O     . HOH O 9 .   ? 41.581 -15.656 1.859   1.00 16.72 ? 204  HOH P O     1 
HETATM 4336 O  O     . HOH O 9 .   ? 44.202 -12.897 -0.369  1.00 25.61 ? 205  HOH P O     1 
HETATM 4337 O  O     . HOH O 9 .   ? 44.390 7.273   2.260   1.00 20.80 ? 206  HOH P O     1 
HETATM 4338 O  O     . HOH O 9 .   ? 33.758 -11.087 -15.073 1.00 44.06 ? 207  HOH P O     1 
HETATM 4339 O  O     . HOH O 9 .   ? 26.257 -12.975 -10.578 1.00 29.57 ? 208  HOH P O     1 
HETATM 4340 O  O     . HOH O 9 .   ? 40.411 -5.278  5.583   1.00 27.19 ? 209  HOH P O     1 
HETATM 4341 O  O     . HOH O 9 .   ? 46.278 4.000   0.696   1.00 29.45 ? 210  HOH P O     1 
HETATM 4342 O  O     . HOH O 9 .   ? 38.273 -10.700 6.410   1.00 28.97 ? 211  HOH P O     1 
HETATM 4343 O  O     . HOH O 9 .   ? 40.508 -9.122  5.961   1.00 27.28 ? 212  HOH P O     1 
HETATM 4344 O  O     . HOH O 9 .   ? 46.207 -2.644  -0.775  1.00 27.07 ? 213  HOH P O     1 
HETATM 4345 O  O     . HOH O 9 .   ? 31.543 -14.020 -2.857  1.00 35.03 ? 214  HOH P O     1 
HETATM 4346 O  O     . HOH O 9 .   ? 40.375 -14.057 -0.061  1.00 31.96 ? 215  HOH P O     1 
HETATM 4347 O  O     . HOH O 9 .   ? 32.488 -7.367  -11.559 1.00 37.35 ? 216  HOH P O     1 
HETATM 4348 O  O     . HOH O 9 .   ? 31.035 -6.382  -13.447 1.00 41.45 ? 217  HOH P O     1 
HETATM 4349 O  O     . HOH O 9 .   ? 41.553 -4.238  7.928   1.00 30.22 ? 218  HOH P O     1 
HETATM 4350 O  O     . HOH O 9 .   ? 38.554 -3.785  4.538   1.00 33.90 ? 219  HOH P O     1 
HETATM 4351 O  O     . HOH O 9 .   ? 44.990 -7.989  -1.086  1.00 28.21 ? 220  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 158 GLU GLU A . n 
A 1 162 GLU 162 159 159 GLU GLU A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   501  501 MG  MG  A . 
E 5 CA  1   502  502 CA  CA  A . 
F 4 MG  1   503  502 MG  MG  A . 
G 6 GOL 1   506  436 GOL GOL A . 
H 6 GOL 1   507  437 GOL GOL A . 
I 6 GOL 1   508  438 GOL GOL A . 
J 7 DTP 1   504  9   DTP DTP P . 
K 8 DPO 1   505  9   DPO DPO P . 
L 4 MG  1   506  9   MG  MG  P . 
M 9 HOH 1   601  61  HOH HOH A . 
M 9 HOH 2   602  61  HOH HOH A . 
M 9 HOH 3   603  61  HOH HOH A . 
M 9 HOH 4   604  1   HOH HOH A . 
M 9 HOH 5   605  3   HOH HOH A . 
M 9 HOH 6   606  4   HOH HOH A . 
M 9 HOH 7   607  5   HOH HOH A . 
M 9 HOH 8   608  6   HOH HOH A . 
M 9 HOH 9   609  7   HOH HOH A . 
M 9 HOH 10  610  8   HOH HOH A . 
M 9 HOH 11  611  9   HOH HOH A . 
M 9 HOH 12  612  10  HOH HOH A . 
M 9 HOH 13  613  11  HOH HOH A . 
M 9 HOH 14  614  12  HOH HOH A . 
M 9 HOH 15  615  13  HOH HOH A . 
M 9 HOH 16  616  14  HOH HOH A . 
M 9 HOH 17  617  15  HOH HOH A . 
M 9 HOH 18  618  16  HOH HOH A . 
M 9 HOH 19  619  17  HOH HOH A . 
M 9 HOH 20  620  19  HOH HOH A . 
M 9 HOH 21  621  20  HOH HOH A . 
M 9 HOH 22  622  21  HOH HOH A . 
M 9 HOH 23  623  22  HOH HOH A . 
M 9 HOH 24  624  23  HOH HOH A . 
M 9 HOH 25  625  24  HOH HOH A . 
M 9 HOH 26  626  25  HOH HOH A . 
M 9 HOH 27  627  26  HOH HOH A . 
M 9 HOH 28  628  28  HOH HOH A . 
M 9 HOH 29  629  29  HOH HOH A . 
M 9 HOH 30  630  30  HOH HOH A . 
M 9 HOH 31  631  31  HOH HOH A . 
M 9 HOH 32  632  32  HOH HOH A . 
M 9 HOH 33  633  33  HOH HOH A . 
M 9 HOH 34  634  34  HOH HOH A . 
M 9 HOH 35  635  36  HOH HOH A . 
M 9 HOH 36  636  37  HOH HOH A . 
M 9 HOH 37  637  38  HOH HOH A . 
M 9 HOH 38  638  39  HOH HOH A . 
M 9 HOH 39  639  40  HOH HOH A . 
M 9 HOH 40  640  41  HOH HOH A . 
M 9 HOH 41  641  42  HOH HOH A . 
M 9 HOH 42  642  43  HOH HOH A . 
M 9 HOH 43  643  44  HOH HOH A . 
M 9 HOH 44  644  45  HOH HOH A . 
M 9 HOH 45  645  46  HOH HOH A . 
M 9 HOH 46  646  47  HOH HOH A . 
M 9 HOH 47  647  48  HOH HOH A . 
M 9 HOH 48  648  49  HOH HOH A . 
M 9 HOH 49  649  50  HOH HOH A . 
M 9 HOH 50  650  51  HOH HOH A . 
M 9 HOH 51  651  52  HOH HOH A . 
M 9 HOH 52  652  53  HOH HOH A . 
M 9 HOH 53  653  54  HOH HOH A . 
M 9 HOH 54  654  55  HOH HOH A . 
M 9 HOH 55  655  56  HOH HOH A . 
M 9 HOH 56  656  57  HOH HOH A . 
M 9 HOH 57  657  58  HOH HOH A . 
M 9 HOH 58  658  59  HOH HOH A . 
M 9 HOH 59  659  60  HOH HOH A . 
M 9 HOH 60  660  62  HOH HOH A . 
M 9 HOH 61  661  63  HOH HOH A . 
M 9 HOH 62  662  64  HOH HOH A . 
M 9 HOH 63  663  65  HOH HOH A . 
M 9 HOH 64  664  66  HOH HOH A . 
M 9 HOH 65  665  67  HOH HOH A . 
M 9 HOH 66  666  68  HOH HOH A . 
M 9 HOH 67  667  69  HOH HOH A . 
M 9 HOH 68  668  70  HOH HOH A . 
M 9 HOH 69  669  71  HOH HOH A . 
M 9 HOH 70  670  72  HOH HOH A . 
M 9 HOH 71  671  74  HOH HOH A . 
M 9 HOH 72  672  76  HOH HOH A . 
M 9 HOH 73  673  77  HOH HOH A . 
M 9 HOH 74  674  78  HOH HOH A . 
M 9 HOH 75  675  79  HOH HOH A . 
M 9 HOH 76  676  80  HOH HOH A . 
M 9 HOH 77  677  81  HOH HOH A . 
M 9 HOH 78  678  82  HOH HOH A . 
M 9 HOH 79  679  83  HOH HOH A . 
M 9 HOH 80  680  84  HOH HOH A . 
M 9 HOH 81  681  86  HOH HOH A . 
M 9 HOH 82  682  87  HOH HOH A . 
M 9 HOH 83  683  88  HOH HOH A . 
M 9 HOH 84  684  89  HOH HOH A . 
M 9 HOH 85  685  90  HOH HOH A . 
M 9 HOH 86  686  91  HOH HOH A . 
M 9 HOH 87  687  92  HOH HOH A . 
M 9 HOH 88  688  93  HOH HOH A . 
M 9 HOH 89  689  94  HOH HOH A . 
M 9 HOH 90  690  95  HOH HOH A . 
M 9 HOH 91  691  96  HOH HOH A . 
M 9 HOH 92  692  97  HOH HOH A . 
M 9 HOH 93  693  98  HOH HOH A . 
M 9 HOH 94  694  99  HOH HOH A . 
M 9 HOH 95  695  102 HOH HOH A . 
M 9 HOH 96  696  103 HOH HOH A . 
M 9 HOH 97  697  105 HOH HOH A . 
M 9 HOH 98  698  106 HOH HOH A . 
M 9 HOH 99  699  107 HOH HOH A . 
M 9 HOH 100 700  108 HOH HOH A . 
M 9 HOH 101 701  109 HOH HOH A . 
M 9 HOH 102 702  110 HOH HOH A . 
M 9 HOH 103 703  111 HOH HOH A . 
M 9 HOH 104 704  112 HOH HOH A . 
M 9 HOH 105 705  114 HOH HOH A . 
M 9 HOH 106 706  116 HOH HOH A . 
M 9 HOH 107 707  117 HOH HOH A . 
M 9 HOH 108 708  118 HOH HOH A . 
M 9 HOH 109 709  119 HOH HOH A . 
M 9 HOH 110 710  122 HOH HOH A . 
M 9 HOH 111 711  123 HOH HOH A . 
M 9 HOH 112 712  125 HOH HOH A . 
M 9 HOH 113 713  126 HOH HOH A . 
M 9 HOH 114 714  127 HOH HOH A . 
M 9 HOH 115 715  129 HOH HOH A . 
M 9 HOH 116 716  130 HOH HOH A . 
M 9 HOH 117 717  131 HOH HOH A . 
M 9 HOH 118 718  132 HOH HOH A . 
M 9 HOH 119 719  133 HOH HOH A . 
M 9 HOH 120 720  134 HOH HOH A . 
M 9 HOH 121 721  136 HOH HOH A . 
M 9 HOH 122 722  137 HOH HOH A . 
M 9 HOH 123 723  138 HOH HOH A . 
M 9 HOH 124 724  140 HOH HOH A . 
M 9 HOH 125 725  141 HOH HOH A . 
M 9 HOH 126 726  142 HOH HOH A . 
M 9 HOH 127 727  143 HOH HOH A . 
M 9 HOH 128 728  144 HOH HOH A . 
M 9 HOH 129 729  145 HOH HOH A . 
M 9 HOH 130 730  146 HOH HOH A . 
M 9 HOH 131 731  147 HOH HOH A . 
M 9 HOH 132 732  148 HOH HOH A . 
M 9 HOH 133 733  149 HOH HOH A . 
M 9 HOH 134 734  150 HOH HOH A . 
M 9 HOH 135 735  151 HOH HOH A . 
M 9 HOH 136 736  152 HOH HOH A . 
M 9 HOH 137 737  153 HOH HOH A . 
M 9 HOH 138 738  154 HOH HOH A . 
M 9 HOH 139 739  155 HOH HOH A . 
M 9 HOH 140 740  157 HOH HOH A . 
M 9 HOH 141 741  158 HOH HOH A . 
M 9 HOH 142 742  159 HOH HOH A . 
M 9 HOH 143 743  160 HOH HOH A . 
M 9 HOH 144 744  161 HOH HOH A . 
M 9 HOH 145 745  162 HOH HOH A . 
M 9 HOH 146 746  165 HOH HOH A . 
M 9 HOH 147 747  166 HOH HOH A . 
M 9 HOH 148 748  167 HOH HOH A . 
M 9 HOH 149 749  168 HOH HOH A . 
M 9 HOH 150 750  169 HOH HOH A . 
M 9 HOH 151 751  170 HOH HOH A . 
M 9 HOH 152 752  171 HOH HOH A . 
M 9 HOH 153 753  172 HOH HOH A . 
M 9 HOH 154 754  173 HOH HOH A . 
M 9 HOH 155 755  174 HOH HOH A . 
M 9 HOH 156 756  175 HOH HOH A . 
M 9 HOH 157 757  176 HOH HOH A . 
M 9 HOH 158 758  178 HOH HOH A . 
M 9 HOH 159 759  181 HOH HOH A . 
M 9 HOH 160 760  182 HOH HOH A . 
M 9 HOH 161 761  183 HOH HOH A . 
M 9 HOH 162 762  184 HOH HOH A . 
M 9 HOH 163 763  187 HOH HOH A . 
M 9 HOH 164 764  189 HOH HOH A . 
M 9 HOH 165 765  190 HOH HOH A . 
M 9 HOH 166 766  191 HOH HOH A . 
M 9 HOH 167 767  192 HOH HOH A . 
M 9 HOH 168 768  193 HOH HOH A . 
M 9 HOH 169 769  194 HOH HOH A . 
M 9 HOH 170 770  195 HOH HOH A . 
M 9 HOH 171 771  196 HOH HOH A . 
M 9 HOH 172 772  197 HOH HOH A . 
M 9 HOH 173 773  198 HOH HOH A . 
M 9 HOH 174 774  199 HOH HOH A . 
M 9 HOH 175 775  200 HOH HOH A . 
M 9 HOH 176 776  201 HOH HOH A . 
M 9 HOH 177 777  204 HOH HOH A . 
M 9 HOH 178 778  205 HOH HOH A . 
M 9 HOH 179 779  206 HOH HOH A . 
M 9 HOH 180 780  207 HOH HOH A . 
M 9 HOH 181 781  208 HOH HOH A . 
M 9 HOH 182 782  209 HOH HOH A . 
M 9 HOH 183 783  210 HOH HOH A . 
M 9 HOH 184 784  211 HOH HOH A . 
M 9 HOH 185 785  212 HOH HOH A . 
M 9 HOH 186 786  213 HOH HOH A . 
M 9 HOH 187 787  214 HOH HOH A . 
M 9 HOH 188 788  215 HOH HOH A . 
M 9 HOH 189 789  216 HOH HOH A . 
M 9 HOH 190 790  217 HOH HOH A . 
M 9 HOH 191 791  218 HOH HOH A . 
M 9 HOH 192 792  219 HOH HOH A . 
M 9 HOH 193 793  220 HOH HOH A . 
M 9 HOH 194 794  221 HOH HOH A . 
M 9 HOH 195 795  222 HOH HOH A . 
M 9 HOH 196 796  223 HOH HOH A . 
M 9 HOH 197 797  224 HOH HOH A . 
M 9 HOH 198 798  225 HOH HOH A . 
M 9 HOH 199 799  226 HOH HOH A . 
M 9 HOH 200 800  227 HOH HOH A . 
M 9 HOH 201 801  228 HOH HOH A . 
M 9 HOH 202 802  230 HOH HOH A . 
M 9 HOH 203 803  231 HOH HOH A . 
M 9 HOH 204 804  232 HOH HOH A . 
M 9 HOH 205 805  233 HOH HOH A . 
M 9 HOH 206 806  235 HOH HOH A . 
M 9 HOH 207 807  237 HOH HOH A . 
M 9 HOH 208 808  238 HOH HOH A . 
M 9 HOH 209 809  239 HOH HOH A . 
M 9 HOH 210 810  240 HOH HOH A . 
M 9 HOH 211 811  241 HOH HOH A . 
M 9 HOH 212 812  243 HOH HOH A . 
M 9 HOH 213 813  246 HOH HOH A . 
M 9 HOH 214 814  247 HOH HOH A . 
M 9 HOH 215 815  248 HOH HOH A . 
M 9 HOH 216 816  249 HOH HOH A . 
M 9 HOH 217 817  250 HOH HOH A . 
M 9 HOH 218 818  251 HOH HOH A . 
M 9 HOH 219 819  252 HOH HOH A . 
M 9 HOH 220 820  253 HOH HOH A . 
M 9 HOH 221 821  255 HOH HOH A . 
M 9 HOH 222 822  256 HOH HOH A . 
M 9 HOH 223 823  257 HOH HOH A . 
M 9 HOH 224 824  258 HOH HOH A . 
M 9 HOH 225 825  260 HOH HOH A . 
M 9 HOH 226 826  261 HOH HOH A . 
M 9 HOH 227 827  262 HOH HOH A . 
M 9 HOH 228 828  263 HOH HOH A . 
M 9 HOH 229 829  264 HOH HOH A . 
M 9 HOH 230 830  267 HOH HOH A . 
M 9 HOH 231 831  268 HOH HOH A . 
M 9 HOH 232 832  269 HOH HOH A . 
M 9 HOH 233 833  270 HOH HOH A . 
M 9 HOH 234 834  272 HOH HOH A . 
M 9 HOH 235 835  273 HOH HOH A . 
M 9 HOH 236 836  274 HOH HOH A . 
M 9 HOH 237 837  275 HOH HOH A . 
M 9 HOH 238 838  276 HOH HOH A . 
M 9 HOH 239 839  277 HOH HOH A . 
M 9 HOH 240 840  278 HOH HOH A . 
M 9 HOH 241 841  279 HOH HOH A . 
M 9 HOH 242 842  282 HOH HOH A . 
M 9 HOH 243 843  283 HOH HOH A . 
M 9 HOH 244 844  284 HOH HOH A . 
M 9 HOH 245 845  285 HOH HOH A . 
M 9 HOH 246 846  286 HOH HOH A . 
M 9 HOH 247 847  287 HOH HOH A . 
M 9 HOH 248 848  288 HOH HOH A . 
M 9 HOH 249 849  289 HOH HOH A . 
M 9 HOH 250 850  290 HOH HOH A . 
M 9 HOH 251 851  291 HOH HOH A . 
M 9 HOH 252 852  292 HOH HOH A . 
M 9 HOH 253 853  293 HOH HOH A . 
M 9 HOH 254 854  294 HOH HOH A . 
M 9 HOH 255 855  296 HOH HOH A . 
M 9 HOH 256 856  297 HOH HOH A . 
M 9 HOH 257 857  298 HOH HOH A . 
M 9 HOH 258 858  300 HOH HOH A . 
M 9 HOH 259 859  301 HOH HOH A . 
M 9 HOH 260 860  302 HOH HOH A . 
M 9 HOH 261 861  304 HOH HOH A . 
M 9 HOH 262 862  305 HOH HOH A . 
M 9 HOH 263 863  306 HOH HOH A . 
M 9 HOH 264 864  307 HOH HOH A . 
M 9 HOH 265 865  308 HOH HOH A . 
M 9 HOH 266 866  309 HOH HOH A . 
M 9 HOH 267 867  310 HOH HOH A . 
M 9 HOH 268 868  314 HOH HOH A . 
M 9 HOH 269 869  315 HOH HOH A . 
M 9 HOH 270 870  318 HOH HOH A . 
M 9 HOH 271 871  319 HOH HOH A . 
M 9 HOH 272 872  320 HOH HOH A . 
M 9 HOH 273 873  321 HOH HOH A . 
M 9 HOH 274 874  322 HOH HOH A . 
M 9 HOH 275 875  323 HOH HOH A . 
M 9 HOH 276 876  324 HOH HOH A . 
M 9 HOH 277 877  325 HOH HOH A . 
M 9 HOH 278 878  326 HOH HOH A . 
M 9 HOH 279 879  327 HOH HOH A . 
M 9 HOH 280 880  328 HOH HOH A . 
M 9 HOH 281 881  329 HOH HOH A . 
M 9 HOH 282 882  330 HOH HOH A . 
M 9 HOH 283 883  331 HOH HOH A . 
M 9 HOH 284 884  332 HOH HOH A . 
M 9 HOH 285 885  333 HOH HOH A . 
M 9 HOH 286 886  334 HOH HOH A . 
M 9 HOH 287 887  335 HOH HOH A . 
M 9 HOH 288 888  336 HOH HOH A . 
M 9 HOH 289 889  337 HOH HOH A . 
M 9 HOH 290 890  338 HOH HOH A . 
M 9 HOH 291 891  339 HOH HOH A . 
M 9 HOH 292 892  340 HOH HOH A . 
M 9 HOH 293 893  341 HOH HOH A . 
M 9 HOH 294 894  342 HOH HOH A . 
M 9 HOH 295 895  343 HOH HOH A . 
M 9 HOH 296 896  344 HOH HOH A . 
M 9 HOH 297 897  345 HOH HOH A . 
M 9 HOH 298 898  346 HOH HOH A . 
M 9 HOH 299 899  347 HOH HOH A . 
M 9 HOH 300 900  348 HOH HOH A . 
M 9 HOH 301 901  351 HOH HOH A . 
M 9 HOH 302 902  352 HOH HOH A . 
M 9 HOH 303 903  353 HOH HOH A . 
M 9 HOH 304 904  354 HOH HOH A . 
M 9 HOH 305 905  355 HOH HOH A . 
M 9 HOH 306 906  356 HOH HOH A . 
M 9 HOH 307 907  357 HOH HOH A . 
M 9 HOH 308 908  358 HOH HOH A . 
M 9 HOH 309 909  359 HOH HOH A . 
M 9 HOH 310 910  360 HOH HOH A . 
M 9 HOH 311 911  361 HOH HOH A . 
M 9 HOH 312 912  362 HOH HOH A . 
M 9 HOH 313 913  363 HOH HOH A . 
M 9 HOH 314 914  364 HOH HOH A . 
M 9 HOH 315 915  365 HOH HOH A . 
M 9 HOH 316 916  366 HOH HOH A . 
M 9 HOH 317 917  367 HOH HOH A . 
M 9 HOH 318 918  369 HOH HOH A . 
M 9 HOH 319 919  370 HOH HOH A . 
M 9 HOH 320 920  371 HOH HOH A . 
M 9 HOH 321 921  373 HOH HOH A . 
M 9 HOH 322 922  374 HOH HOH A . 
M 9 HOH 323 923  375 HOH HOH A . 
M 9 HOH 324 924  376 HOH HOH A . 
M 9 HOH 325 925  377 HOH HOH A . 
M 9 HOH 326 926  378 HOH HOH A . 
M 9 HOH 327 927  380 HOH HOH A . 
M 9 HOH 328 928  381 HOH HOH A . 
M 9 HOH 329 929  382 HOH HOH A . 
M 9 HOH 330 930  383 HOH HOH A . 
M 9 HOH 331 931  384 HOH HOH A . 
M 9 HOH 332 932  385 HOH HOH A . 
M 9 HOH 333 933  387 HOH HOH A . 
M 9 HOH 334 934  388 HOH HOH A . 
M 9 HOH 335 935  389 HOH HOH A . 
M 9 HOH 336 936  390 HOH HOH A . 
M 9 HOH 337 937  392 HOH HOH A . 
M 9 HOH 338 938  393 HOH HOH A . 
M 9 HOH 339 939  394 HOH HOH A . 
M 9 HOH 340 940  395 HOH HOH A . 
M 9 HOH 341 941  397 HOH HOH A . 
M 9 HOH 342 942  398 HOH HOH A . 
M 9 HOH 343 943  399 HOH HOH A . 
M 9 HOH 344 944  401 HOH HOH A . 
M 9 HOH 345 945  402 HOH HOH A . 
M 9 HOH 346 946  404 HOH HOH A . 
M 9 HOH 347 947  405 HOH HOH A . 
M 9 HOH 348 948  406 HOH HOH A . 
M 9 HOH 349 949  407 HOH HOH A . 
M 9 HOH 350 950  408 HOH HOH A . 
M 9 HOH 351 951  409 HOH HOH A . 
M 9 HOH 352 952  411 HOH HOH A . 
M 9 HOH 353 953  412 HOH HOH A . 
M 9 HOH 354 954  413 HOH HOH A . 
M 9 HOH 355 955  414 HOH HOH A . 
M 9 HOH 356 956  415 HOH HOH A . 
M 9 HOH 357 957  418 HOH HOH A . 
M 9 HOH 358 958  419 HOH HOH A . 
M 9 HOH 359 959  422 HOH HOH A . 
M 9 HOH 360 960  423 HOH HOH A . 
M 9 HOH 361 961  424 HOH HOH A . 
M 9 HOH 362 962  425 HOH HOH A . 
M 9 HOH 363 963  427 HOH HOH A . 
M 9 HOH 364 964  428 HOH HOH A . 
M 9 HOH 365 965  429 HOH HOH A . 
M 9 HOH 366 966  433 HOH HOH A . 
M 9 HOH 367 967  434 HOH HOH A . 
M 9 HOH 368 968  435 HOH HOH A . 
M 9 HOH 369 969  436 HOH HOH A . 
M 9 HOH 370 970  437 HOH HOH A . 
M 9 HOH 371 971  438 HOH HOH A . 
M 9 HOH 372 972  439 HOH HOH A . 
M 9 HOH 373 973  440 HOH HOH A . 
M 9 HOH 374 974  441 HOH HOH A . 
M 9 HOH 375 975  443 HOH HOH A . 
M 9 HOH 376 976  444 HOH HOH A . 
M 9 HOH 377 977  445 HOH HOH A . 
M 9 HOH 378 978  446 HOH HOH A . 
M 9 HOH 379 979  447 HOH HOH A . 
M 9 HOH 380 980  451 HOH HOH A . 
M 9 HOH 381 981  452 HOH HOH A . 
M 9 HOH 382 982  453 HOH HOH A . 
M 9 HOH 383 983  454 HOH HOH A . 
M 9 HOH 384 984  456 HOH HOH A . 
M 9 HOH 385 985  460 HOH HOH A . 
M 9 HOH 386 986  461 HOH HOH A . 
M 9 HOH 387 987  462 HOH HOH A . 
M 9 HOH 388 988  463 HOH HOH A . 
M 9 HOH 389 989  464 HOH HOH A . 
M 9 HOH 390 990  465 HOH HOH A . 
M 9 HOH 391 991  466 HOH HOH A . 
M 9 HOH 392 992  467 HOH HOH A . 
M 9 HOH 393 993  468 HOH HOH A . 
M 9 HOH 394 994  470 HOH HOH A . 
M 9 HOH 395 995  471 HOH HOH A . 
M 9 HOH 396 996  473 HOH HOH A . 
M 9 HOH 397 997  475 HOH HOH A . 
M 9 HOH 398 998  477 HOH HOH A . 
M 9 HOH 399 999  479 HOH HOH A . 
M 9 HOH 400 1000 480 HOH HOH A . 
M 9 HOH 401 1001 481 HOH HOH A . 
M 9 HOH 402 1002 482 HOH HOH A . 
M 9 HOH 403 1003 483 HOH HOH A . 
M 9 HOH 404 1004 484 HOH HOH A . 
M 9 HOH 405 1005 487 HOH HOH A . 
M 9 HOH 406 1006 488 HOH HOH A . 
M 9 HOH 407 1007 489 HOH HOH A . 
M 9 HOH 408 1008 490 HOH HOH A . 
M 9 HOH 409 1009 491 HOH HOH A . 
M 9 HOH 410 1010 492 HOH HOH A . 
M 9 HOH 411 1011 120 HOH HOH A . 
N 9 HOH 1   101  35  HOH HOH T . 
N 9 HOH 2   102  75  HOH HOH T . 
N 9 HOH 3   103  101 HOH HOH T . 
N 9 HOH 4   104  104 HOH HOH T . 
N 9 HOH 5   105  124 HOH HOH T . 
N 9 HOH 6   106  139 HOH HOH T . 
N 9 HOH 7   107  177 HOH HOH T . 
N 9 HOH 8   108  179 HOH HOH T . 
N 9 HOH 9   109  180 HOH HOH T . 
N 9 HOH 10  110  186 HOH HOH T . 
N 9 HOH 11  111  188 HOH HOH T . 
N 9 HOH 12  112  202 HOH HOH T . 
N 9 HOH 13  113  229 HOH HOH T . 
N 9 HOH 14  114  236 HOH HOH T . 
N 9 HOH 15  115  245 HOH HOH T . 
N 9 HOH 16  116  254 HOH HOH T . 
N 9 HOH 17  117  259 HOH HOH T . 
N 9 HOH 18  118  265 HOH HOH T . 
N 9 HOH 19  119  280 HOH HOH T . 
N 9 HOH 20  120  295 HOH HOH T . 
N 9 HOH 21  121  312 HOH HOH T . 
N 9 HOH 22  122  316 HOH HOH T . 
N 9 HOH 23  123  317 HOH HOH T . 
N 9 HOH 24  124  350 HOH HOH T . 
N 9 HOH 25  125  372 HOH HOH T . 
N 9 HOH 26  126  403 HOH HOH T . 
N 9 HOH 27  127  426 HOH HOH T . 
N 9 HOH 28  128  431 HOH HOH T . 
N 9 HOH 29  129  442 HOH HOH T . 
N 9 HOH 30  130  448 HOH HOH T . 
N 9 HOH 31  131  455 HOH HOH T . 
N 9 HOH 32  132  469 HOH HOH T . 
N 9 HOH 33  133  485 HOH HOH T . 
O 9 HOH 1   201  61  HOH HOH P . 
O 9 HOH 2   202  85  HOH HOH P . 
O 9 HOH 3   203  100 HOH HOH P . 
O 9 HOH 4   204  115 HOH HOH P . 
O 9 HOH 5   205  121 HOH HOH P . 
O 9 HOH 6   206  128 HOH HOH P . 
O 9 HOH 7   207  156 HOH HOH P . 
O 9 HOH 8   208  203 HOH HOH P . 
O 9 HOH 9   209  234 HOH HOH P . 
O 9 HOH 10  210  242 HOH HOH P . 
O 9 HOH 11  211  266 HOH HOH P . 
O 9 HOH 12  212  271 HOH HOH P . 
O 9 HOH 13  213  313 HOH HOH P . 
O 9 HOH 14  214  349 HOH HOH P . 
O 9 HOH 15  215  368 HOH HOH P . 
O 9 HOH 16  216  386 HOH HOH P . 
O 9 HOH 17  217  391 HOH HOH P . 
O 9 HOH 18  218  400 HOH HOH P . 
O 9 HOH 19  219  432 HOH HOH P . 
O 9 HOH 20  220  457 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6680  ? 
1 MORE         -79   ? 
1 'SSA (A^2)'  21840 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 104.2 ? 
2  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? M HOH .   ? A HOH 604 ? 1_555 91.6  ? 
3  OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? M HOH .   ? A HOH 604 ? 1_555 85.0  ? 
4  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 100.8 ? 
5  OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 153.8 ? 
6  O     ? M HOH .   ? A HOH 604 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 86.7  ? 
7  OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   A J DTP .   ? P DTP 504 ? 1_555 96.7  ? 
8  OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   A J DTP .   ? P DTP 504 ? 1_555 7.9   ? 
9  O     ? M HOH .   ? A HOH 604 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   A J DTP .   ? P DTP 504 ? 1_555 82.5  ? 
10 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   A J DTP .   ? P DTP 504 ? 1_555 159.6 ? 
11 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 176.4 ? 
12 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 77.4  ? 
13 O     ? M HOH .   ? A HOH 604 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 91.9  ? 
14 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 78.2  ? 
15 O2A   A J DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 84.9  ? 
16 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 91.2  ? 
17 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 84.7  ? 
18 O     ? M HOH .   ? A HOH 604 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 169.7 ? 
19 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 102.5 ? 
20 O2A   A J DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 87.4  ? 
21 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 85.7  ? 
22 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 169.7 ? 
23 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 65.9  ? 
24 O     ? M HOH .   ? A HOH 604 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 90.2  ? 
25 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 89.4  ? 
26 O2A   A J DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 73.5  ? 
27 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 11.5  ? 
28 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 85.4  ? 
29 OP2   B C DA  9   ? P DA  9   ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O     B M HOH .   ? A HOH 603 ? 1_555 84.4  ? 
30 OP2   B C DA  9   ? P DA  9   ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O1    B K DPO .   ? P DPO 505 ? 1_555 85.6  ? 
31 O     B M HOH .   ? A HOH 603 ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O1    B K DPO .   ? P DPO 505 ? 1_555 95.3  ? 
32 OP2   B C DA  9   ? P DA  9   ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O     ? M HOH .   ? A HOH 672 ? 1_555 178.9 ? 
33 O     B M HOH .   ? A HOH 603 ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O     ? M HOH .   ? A HOH 672 ? 1_555 94.9  ? 
34 O1    B K DPO .   ? P DPO 505 ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O     ? M HOH .   ? A HOH 672 ? 1_555 95.3  ? 
35 OP2   B C DA  9   ? P DA  9   ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O     ? M HOH .   ? A HOH 984 ? 1_555 96.0  ? 
36 O     B M HOH .   ? A HOH 603 ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O     ? M HOH .   ? A HOH 984 ? 1_555 169.1 ? 
37 O1    B K DPO .   ? P DPO 505 ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O     ? M HOH .   ? A HOH 984 ? 1_555 95.6  ? 
38 O     ? M HOH .   ? A HOH 672 ? 1_555 MG B L MG . ? P MG 506 ? 1_555 O     ? M HOH .   ? A HOH 984 ? 1_555 84.5  ? 
39 O1B   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   A J DTP .   ? P DTP 504 ? 1_555 79.6  ? 
40 O1B   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 174.3 ? 
41 O3G   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 99.9  ? 
42 O1B   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   A J DTP .   ? P DTP 504 ? 1_555 83.6  ? 
43 O3G   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   A J DTP .   ? P DTP 504 ? 1_555 87.3  ? 
44 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   A J DTP .   ? P DTP 504 ? 1_555 90.7  ? 
45 O1B   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 90.2  ? 
46 O3G   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 102.5 ? 
47 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 95.4  ? 
48 O2A   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 167.3 ? 
49 O1B   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 87.4  ? 
50 O3G   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 166.9 ? 
51 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 92.8  ? 
52 O2A   A J DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 89.4  ? 
53 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 79.2  ? 
54 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O7    B K DPO .   ? P DPO 505 ? 1_555 79.6  ? 
55 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O2    B K DPO .   ? P DPO 505 ? 1_555 156.9 ? 
56 O7    B K DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O2    B K DPO .   ? P DPO 505 ? 1_555 83.1  ? 
57 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 78.4  ? 
58 O7    B K DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 99.0  ? 
59 O2    B K DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 89.3  ? 
60 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 109.2 ? 
61 O7    B K DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 170.0 ? 
62 O2    B K DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 87.1  ? 
63 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 78.6  ? 
64 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 111.9 ? 
65 O7    B K DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 95.0  ? 
66 O2    B K DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 84.7  ? 
67 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 164.0 ? 
68 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 86.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ECW 
_pdbx_entry_details.nonpolymer_details   'CA A 502 AND MG A 503 ARE IN ALTERNATE CONFORMATIONS OF EACH OTHER.' 
_pdbx_entry_details.sequence_details     
;ARG A 61 HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS ARG 61 (OCCUPANCY 0.40) + HOH A 601, 
ALTERNATE B HAS ARG 61 (OCCUPANCY 0.60) + HOH A 602 + HOH A 603.
CHAIN P HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS DT 8 + DTP 504, 
ALTERNATE B HAS DT 8 + DA 9 + DPO 505 + MG 506.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DA 8  ? ? "C1'" T DA 8  ? ? N9 T DA 8  ? ? 110.45 108.30 2.15 0.30 N 
2 1 "O4'" T DC 9  ? ? "C1'" T DC 9  ? ? N1 T DC 9  ? ? 110.39 108.30 2.09 0.30 N 
3 1 "O4'" T DT 12 ? ? "C1'" T DT 12 ? ? N1 T DT 12 ? ? 110.76 108.30 2.46 0.30 N 
4 1 "O4'" P DA 7  ? ? "C1'" P DA 7  ? ? N9 P DA 7  ? ? 111.37 108.30 3.07 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 16  ? ? 22.99   66.46   
2  1 TYR A 39  ? ? 65.65   174.07  
3  1 LYS A 40  ? ? -154.48 -32.13  
4  1 SER A 62  ? ? 79.02   -5.50   
5  1 GLN A 133 ? ? 44.75   73.37   
6  1 THR A 160 ? ? -67.74  6.77    
7  1 SER A 217 ? ? -153.66 -156.65 
8  1 SER A 257 ? ? 96.47   -9.99   
9  1 LEU A 378 ? ? -37.05  -70.37  
10 1 SER A 409 ? ? -39.14  128.61  
11 1 LYS A 428 ? ? 60.24   62.41   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 127 ? CG    ? A GLU 130 CG    
2  1 Y 1 A GLU 127 ? CD    ? A GLU 130 CD    
3  1 Y 1 A GLU 127 ? OE1   ? A GLU 130 OE1   
4  1 Y 1 A GLU 127 ? OE2   ? A GLU 130 OE2   
5  1 Y 1 A GLU 158 ? CG    ? A GLU 161 CG    
6  1 Y 1 A GLU 158 ? CD    ? A GLU 161 CD    
7  1 Y 1 A GLU 158 ? OE1   ? A GLU 161 OE1   
8  1 Y 1 A GLU 158 ? OE2   ? A GLU 161 OE2   
9  1 Y 1 A GLU 159 ? CG    ? A GLU 162 CG    
10 1 Y 1 A GLU 159 ? CD    ? A GLU 162 CD    
11 1 Y 1 A GLU 159 ? OE1   ? A GLU 162 OE1   
12 1 Y 1 A GLU 159 ? OE2   ? A GLU 162 OE2   
13 1 Y 0 A GLU 268 ? OE1   ? A GLU 271 OE1   
14 1 Y 1 T DC  1   ? "O5'" ? B DC  1   "O5'" 
15 1 Y 1 T DC  1   ? "C5'" ? B DC  1   "C5'" 
16 1 Y 1 T DC  1   ? "C4'" ? B DC  1   "C4'" 
17 1 Y 1 T DC  1   ? "O4'" ? B DC  1   "O4'" 
18 1 Y 1 T DC  1   ? "C3'" ? B DC  1   "C3'" 
19 1 Y 1 T DC  1   ? "C2'" ? B DC  1   "C2'" 
20 1 Y 1 T DC  1   ? "C1'" ? B DC  1   "C1'" 
21 1 Y 1 T DC  1   ? N1    ? B DC  1   N1    
22 1 Y 1 T DC  1   ? C2    ? B DC  1   C2    
23 1 Y 1 T DC  1   ? O2    ? B DC  1   O2    
24 1 Y 1 T DC  1   ? N3    ? B DC  1   N3    
25 1 Y 1 T DC  1   ? C4    ? B DC  1   C4    
26 1 Y 1 T DC  1   ? N4    ? B DC  1   N4    
27 1 Y 1 T DC  1   ? C5    ? B DC  1   C5    
28 1 Y 1 T DC  1   ? C6    ? B DC  1   C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ECW 'double helix'        
4ECW 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 -0.016 -0.103 0.561  3.700  -3.736  4.521  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.133  -0.034 0.144  0.855  -15.523 2.205  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.257 -0.091 -0.374 -5.666 -2.947  0.181  3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.096  -0.198 -0.080 1.906  -3.938  -0.110 4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.247  -0.140 -0.510 12.412 -8.829  1.183  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.443 -0.146 -0.221 -2.735 -4.956  4.243  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.242  -0.102 0.111  -9.485 -5.334  1.329  7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.129 -0.167 -0.045 14.587 1.565   2.927  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.785  -1.139 3.491 2.239  1.459  26.521 -2.877 -1.077 3.478 3.170  -4.864 
26.653 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.380 -1.205 3.443 5.726  11.084 27.390 -4.542 1.879  2.637 22.016 
-11.375 30.048 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.543 -0.449 3.264 -2.375 1.499  34.926 -0.972 0.545  3.271 2.493  3.949 
35.035 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.419  -0.638 3.178 4.344  0.676  30.362 -1.336 0.044  3.191 1.283  -8.239 
30.671 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.360 -0.566 3.820 -5.355 7.564  34.206 -2.221 -0.322 3.630 12.576 8.903 
35.403 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.528 -0.513 3.558 -2.173 0.176  37.856 -0.814 0.509  3.579 0.272  3.346 
37.917 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.270  0.106  2.926 -2.282 3.375  25.796 -0.587 -1.154 2.882 7.501  5.071 
26.111 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 DIPHOSPHATE                         DPO 
9 water                               HOH 
#