data_4ECX
# 
_entry.id   4ECX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ECX         
NDB   NA1707       
RCSB  RCSB071459   
WWPDB D_1000071459 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ECX 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ECX 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ECX 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ?                                     ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    3   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
9 water       nat water                                                18.015    464 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ECX       4ECX   2 ? ? ? 
3 PDB 4ECX       4ECX   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ECX A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ECX T 1 ? 12  ? 4ECX   1 ? 12  ? 1 12  
3 3 4ECX P 1 ? 9   ? 4ECX   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ECX GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ECX PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ECX HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ?                               'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ECX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ECX 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.744 
_reflns.number_obs                   45785 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.105 
_reflns.pdbx_netI_over_sigmaI        12.5 
_reflns.B_iso_Wilson_estimate        17.580 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.75 
_reflns_shell.d_res_low                   1.78 
_reflns_shell.percent_possible_all        100 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.800 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.pdbx_redundancy             3.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ECX 
_refine.ls_number_reflns_obs                     45672 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.102 
_refine.ls_d_res_high                            1.744 
_refine.ls_percent_reflns_obs                    97.99 
_refine.ls_R_factor_obs                          0.1805 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1781 
_refine.ls_R_factor_R_free                       0.2252 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  2309 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               23.6148 
_refine.aniso_B[1][1]                            0.5555 
_refine.aniso_B[2][2]                            0.5555 
_refine.aniso_B[3][3]                            -1.1109 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.341 
_refine.solvent_model_param_bsol                 35.624 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.23 
_refine.overall_FOM_work_R_set                   0.8542 
_refine.B_iso_max                                86.890 
_refine.B_iso_min                                4.080 
_refine.pdbx_overall_phase_error                 22.2600 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.150 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             464 
_refine_hist.number_atoms_total               4293 
_refine_hist.d_res_high                       1.744 
_refine_hist.d_res_low                        30.102 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4039 0.010  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5541 1.116  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     616  0.066  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      637  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1577 18.486 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.7436 1.7815  16 71.0000  1962 . 0.2480 0.3175 . 100 . 2062 . 'X-RAY DIFFRACTION' . 
1.7815 1.8230  16 100.0000 2711 . 0.2419 0.3111 . 163 . 2874 . 'X-RAY DIFFRACTION' . 
1.8230 1.8685  16 100.0000 2789 . 0.2342 0.2907 . 139 . 2928 . 'X-RAY DIFFRACTION' . 
1.8685 1.9191  16 100.0000 2754 . 0.2279 0.2890 . 137 . 2891 . 'X-RAY DIFFRACTION' . 
1.9191 1.9755  16 100.0000 2744 . 0.2161 0.2632 . 154 . 2898 . 'X-RAY DIFFRACTION' . 
1.9755 2.0393  16 100.0000 2730 . 0.1981 0.2412 . 163 . 2893 . 'X-RAY DIFFRACTION' . 
2.0393 2.1121  16 100.0000 2753 . 0.1802 0.2388 . 151 . 2904 . 'X-RAY DIFFRACTION' . 
2.1121 2.1967  16 100.0000 2719 . 0.1779 0.2254 . 168 . 2887 . 'X-RAY DIFFRACTION' . 
2.1967 2.2966  16 100.0000 2752 . 0.1769 0.2269 . 152 . 2904 . 'X-RAY DIFFRACTION' . 
2.2966 2.4177  16 100.0000 2760 . 0.1708 0.2097 . 122 . 2882 . 'X-RAY DIFFRACTION' . 
2.4177 2.5691  16 100.0000 2783 . 0.1742 0.2338 . 151 . 2934 . 'X-RAY DIFFRACTION' . 
2.5691 2.7673  16 100.0000 2754 . 0.1758 0.2213 . 142 . 2896 . 'X-RAY DIFFRACTION' . 
2.7673 3.0455  16 100.0000 2745 . 0.1787 0.2324 . 169 . 2914 . 'X-RAY DIFFRACTION' . 
3.0455 3.4857  16 100.0000 2782 . 0.1583 0.2036 . 128 . 2910 . 'X-RAY DIFFRACTION' . 
3.4857 4.3894  16 100.0000 2811 . 0.1389 0.1731 . 114 . 2925 . 'X-RAY DIFFRACTION' . 
4.3894 30.1066 16 100.0000 2814 . 0.1638 0.1954 . 156 . 2970 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ECX 
_struct.title                     
'Human DNA polymerase eta - DNA ternary complex: Reaction in the AT crystal at pH 7.0 for 300 sec' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ECX 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 4 ? 
L N N 9 ? 
M N N 9 ? 
N N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? CYS A 305 ? THR A 282 CYS A 302 1 ? 21 
HELX_P HELX_P17 17 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 18 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 19 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 20 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C DA  9   OP2   B ? ? 1_555 K MG  . MG  B ? P DA  9   P MG  506 1_555 ? ? ? ? ? ? ?            2.039 ? 
metalc2  metalc ? ? C DA  9   OP1   B ? ? 1_555 D MG  . MG  ? ? P DA  9   A MG  501 1_555 ? ? ? ? ? ? ?            2.040 ? 
metalc3  metalc ? ? A ASP 16  OD2   B ? ? 1_555 D MG  . MG  ? ? A ASP 13  A MG  501 1_555 ? ? ? ? ? ? ?            2.046 ? 
metalc4  metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O1B A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.072 ? 
metalc5  metalc ? ? F MG  .   MG    B ? ? 1_555 J DPO . O2  B ? A MG  503 P DPO 505 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc6  metalc ? ? K MG  .   MG    B ? ? 1_555 L HOH . O   B ? P MG  506 A HOH 602 1_555 ? ? ? ? ? ? ?            2.113 ? 
metalc7  metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O2A A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc8  metalc ? ? D MG  .   MG    ? ? ? 1_555 I DTP . O2A A ? A MG  501 P DTP 504 1_555 ? ? ? ? ? ? ?            2.143 ? 
metalc9  metalc ? ? F MG  .   MG    B ? ? 1_555 J DPO . O7  B ? A MG  503 P DPO 505 1_555 ? ? ? ? ? ? ?            2.144 ? 
metalc10 metalc ? ? E CA  .   CA    A ? ? 1_555 I DTP . O3G A ? A CA  502 P DTP 504 1_555 ? ? ? ? ? ? ?            2.144 ? 
metalc11 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MG  . MG  ? ? A GLU 116 A MG  501 1_555 ? ? ? ? ? ? ?            2.145 ? 
metalc12 metalc ? ? K MG  .   MG    B ? ? 1_555 L HOH . O   ? ? P MG  506 A HOH 943 1_555 ? ? ? ? ? ? ?            2.149 ? 
metalc13 metalc ? ? J DPO .   O1    B ? ? 1_555 K MG  . MG  B ? P DPO 505 P MG  506 1_555 ? ? ? ? ? ? ?            2.185 ? 
metalc14 metalc ? ? A ASP 16  OD1   A ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.214 ? 
metalc15 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.242 ? 
metalc16 metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.249 ? 
metalc17 metalc ? ? A ASP 16  OD1   B ? ? 1_555 F MG  . MG  B ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.249 ? 
metalc18 metalc ? ? A MET 17  O     ? ? ? 1_555 F MG  . MG  B ? A MET 14  A MG  503 1_555 ? ? ? ? ? ? ?            2.250 ? 
metalc19 metalc ? ? C DT  8   "O3'" A ? ? 1_555 D MG  . MG  ? ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.251 ? 
metalc20 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D MG  . MG  ? ? A ASP 115 A MG  501 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc21 metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F MG  . MG  B ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.253 ? 
metalc22 metalc ? ? D MG  .   MG    ? ? ? 1_555 L HOH . O   ? ? A MG  501 A HOH 603 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc23 metalc ? ? K MG  .   MG    B ? ? 1_555 L HOH . O   ? ? P MG  506 A HOH 888 1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc24 metalc ? ? C DT  8   "O3'" B ? ? 1_555 D MG  . MG  ? ? P DT  8   A MG  501 1_555 ? ? ? ? ? ? ?            2.403 ? 
metalc25 metalc ? ? C DA  9   OP1   B ? ? 1_555 F MG  . MG  B ? P DA  9   A MG  503 1_555 ? ? ? ? ? ? ?            2.448 ? 
metalc26 metalc ? ? K MG  .   MG    B ? ? 1_555 L HOH . O   ? ? P MG  506 A HOH 665 1_555 ? ? ? ? ? ? ?            2.696 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 0.36  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -2.49 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -6.68 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 502'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 503'  
AC4 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE DTP P 504' 
AC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE DPO P 505' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 506' 
AC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 507' 
AC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG P 506'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 9  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2   AC1 9  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3   AC1 9  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4   AC1 9  CA  E .   ? CA  A 502 . ? 1_555 ? 
5   AC1 9  MG  F .   ? MG  A 503 . ? 1_555 ? 
6   AC1 9  HOH L .   ? HOH A 603 . ? 1_555 ? 
7   AC1 9  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8   AC1 9  DA  C 9   ? DA  P 9   . ? 1_555 ? 
9   AC1 9  DTP I .   ? DTP P 504 . ? 1_555 ? 
10  AC2 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
11  AC2 7  MET A 17  ? MET A 14  . ? 1_555 ? 
12  AC2 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
13  AC2 7  MG  D .   ? MG  A 501 . ? 1_555 ? 
14  AC2 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
15  AC2 7  DTP I .   ? DTP P 504 . ? 1_555 ? 
16  AC2 7  DPO J .   ? DPO P 505 . ? 1_555 ? 
17  AC3 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
18  AC3 7  MET A 17  ? MET A 14  . ? 1_555 ? 
19  AC3 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
20  AC3 7  MG  D .   ? MG  A 501 . ? 1_555 ? 
21  AC3 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
22  AC3 7  DTP I .   ? DTP P 504 . ? 1_555 ? 
23  AC3 7  DPO J .   ? DPO P 505 . ? 1_555 ? 
24  AC4 30 ASP A 16  ? ASP A 13  . ? 1_555 ? 
25  AC4 30 MET A 17  ? MET A 14  . ? 1_555 ? 
26  AC4 30 ASP A 18  ? ASP A 15  . ? 1_555 ? 
27  AC4 30 CYS A 19  ? CYS A 16  . ? 1_555 ? 
28  AC4 30 PHE A 20  ? PHE A 17  . ? 1_555 ? 
29  AC4 30 PHE A 21  ? PHE A 18  . ? 1_555 ? 
30  AC4 30 ILE A 51  ? ILE A 48  . ? 1_555 ? 
31  AC4 30 ALA A 52  ? ALA A 49  . ? 1_555 ? 
32  AC4 30 TYR A 55  ? TYR A 52  . ? 1_555 ? 
33  AC4 30 ARG A 58  ? ARG A 55  . ? 1_555 ? 
34  AC4 30 ARG A 64  ? ARG A 61  . ? 1_555 ? 
35  AC4 30 ASP A 118 ? ASP A 115 . ? 1_555 ? 
36  AC4 30 LYS A 234 ? LYS A 231 . ? 1_555 ? 
37  AC4 30 MG  D .   ? MG  A 501 . ? 1_555 ? 
38  AC4 30 CA  E .   ? CA  A 502 . ? 1_555 ? 
39  AC4 30 MG  F .   ? MG  A 503 . ? 1_555 ? 
40  AC4 30 HOH L .   ? HOH A 601 . ? 1_555 ? 
41  AC4 30 HOH L .   ? HOH A 602 . ? 1_555 ? 
42  AC4 30 HOH L .   ? HOH A 603 . ? 1_555 ? 
43  AC4 30 HOH L .   ? HOH A 638 . ? 1_555 ? 
44  AC4 30 HOH L .   ? HOH A 665 . ? 1_555 ? 
45  AC4 30 HOH L .   ? HOH A 733 . ? 1_555 ? 
46  AC4 30 HOH L .   ? HOH A 888 . ? 1_555 ? 
47  AC4 30 HOH L .   ? HOH A 943 . ? 1_555 ? 
48  AC4 30 HOH L .   ? HOH A 994 . ? 1_555 ? 
49  AC4 30 DT  C 8   ? DT  P 8   . ? 1_555 ? 
50  AC4 30 HOH N .   ? HOH P 207 . ? 1_555 ? 
51  AC4 30 DT  B 3   ? DT  T 3   . ? 1_555 ? 
52  AC4 30 DT  B 4   ? DT  T 4   . ? 1_555 ? 
53  AC4 30 DA  B 5   ? DA  T 5   . ? 1_555 ? 
54  AC5 19 ASP A 16  ? ASP A 13  . ? 1_555 ? 
55  AC5 19 MET A 17  ? MET A 14  . ? 1_555 ? 
56  AC5 19 ASP A 18  ? ASP A 15  . ? 1_555 ? 
57  AC5 19 CYS A 19  ? CYS A 16  . ? 1_555 ? 
58  AC5 19 PHE A 20  ? PHE A 17  . ? 1_555 ? 
59  AC5 19 TYR A 55  ? TYR A 52  . ? 1_555 ? 
60  AC5 19 ARG A 58  ? ARG A 55  . ? 1_555 ? 
61  AC5 19 ARG A 64  ? ARG A 61  . ? 1_555 ? 
62  AC5 19 ASP A 118 ? ASP A 115 . ? 1_555 ? 
63  AC5 19 LYS A 234 ? LYS A 231 . ? 1_555 ? 
64  AC5 19 CA  E .   ? CA  A 502 . ? 1_555 ? 
65  AC5 19 MG  F .   ? MG  A 503 . ? 1_555 ? 
66  AC5 19 HOH L .   ? HOH A 601 . ? 1_555 ? 
67  AC5 19 HOH L .   ? HOH A 638 . ? 1_555 ? 
68  AC5 19 HOH L .   ? HOH A 665 . ? 1_555 ? 
69  AC5 19 HOH L .   ? HOH A 888 . ? 1_555 ? 
70  AC5 19 HOH L .   ? HOH A 994 . ? 1_555 ? 
71  AC5 19 DA  C 9   ? DA  P 9   . ? 1_555 ? 
72  AC5 19 MG  K .   ? MG  P 506 . ? 1_555 ? 
73  AC6 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
74  AC6 10 GLN A 28  ? GLN A 25  . ? 6_545 ? 
75  AC6 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
76  AC6 10 SER A 251 ? SER A 248 . ? 1_555 ? 
77  AC6 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
78  AC6 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
79  AC6 10 HOH L .   ? HOH A 610 . ? 1_555 ? 
80  AC6 10 HOH L .   ? HOH A 634 . ? 1_555 ? 
81  AC6 10 HOH L .   ? HOH A 691 . ? 1_555 ? 
82  AC6 10 HOH L .   ? HOH A 716 . ? 1_555 ? 
83  AC7 11 ASN A 29  ? ASN A 26  . ? 1_555 ? 
84  AC7 11 PRO A 30  ? PRO A 27  . ? 1_555 ? 
85  AC7 11 HIS A 31  ? HIS A 28  . ? 1_555 ? 
86  AC7 11 GLY A 274 ? GLY A 271 . ? 5_664 ? 
87  AC7 11 GLU A 276 ? GLU A 273 . ? 5_664 ? 
88  AC7 11 TYR A 277 ? TYR A 274 . ? 5_664 ? 
89  AC7 11 GLU A 280 ? GLU A 277 . ? 5_664 ? 
90  AC7 11 HOH L .   ? HOH A 806 . ? 5_664 ? 
91  AC7 11 HOH L .   ? HOH A 819 . ? 1_555 ? 
92  AC7 11 HOH L .   ? HOH A 898 . ? 1_555 ? 
93  AC7 11 HOH L .   ? HOH A 964 . ? 5_664 ? 
94  AC8 7  ARG A 64  ? ARG A 61  . ? 1_555 ? 
95  AC8 7  HOH L .   ? HOH A 602 . ? 1_555 ? 
96  AC8 7  HOH L .   ? HOH A 665 . ? 1_555 ? 
97  AC8 7  HOH L .   ? HOH A 888 . ? 1_555 ? 
98  AC8 7  HOH L .   ? HOH A 943 . ? 1_555 ? 
99  AC8 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
100 AC8 7  DPO J .   ? DPO P 505 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ECX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ECX 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 66.030 -34.137 -3.537  1.00 44.23 ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.412 -34.159 -3.985  1.00 47.72 ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.730 -33.193 -5.117  1.00 45.47 ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.504 -31.986 -4.998  1.00 44.07 ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.266 -33.723 -6.227  1.00 45.25 ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.690 -32.929 -7.388  1.00 43.82 ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.535 -32.450 -8.270  1.00 47.23 ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.772 -31.781 -9.281  1.00 54.10 ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.574 -33.908 -8.167  1.00 45.54 ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 69.020 -35.247 -7.828  1.00 46.77 ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.585 -35.152 -6.391  1.00 46.16 ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.304 -32.784 -7.895  1.00 42.20 ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.139 -32.396 -8.685  1.00 42.23 ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.186 -31.515 -7.884  1.00 47.24 ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.183 -31.027 -8.410  1.00 40.20 ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.412 -33.640 -9.203  1.00 38.28 ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.321 -34.630 -9.860  1.00 36.45 ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.911 -34.398 -11.084 1.00 36.28 ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.757 -35.846 -9.456  1.00 33.79 ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.667 -35.432 -11.409 1.00 40.02 ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.593 -36.323 -10.437 1.00 35.71 ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.510 -31.309 -6.612  1.00 50.40 ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.670 -30.509 -5.728  1.00 52.99 ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.928 -29.012 -5.907  1.00 47.35 ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.988 -28.504 -5.539  1.00 43.62 ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.899 -30.909 -4.268  1.00 56.54 ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.819 -30.415 -3.320  1.00 64.91 ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.244 -31.243 -3.607  1.00 78.53 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.624 -32.899 -3.040  1.00 64.68 ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.946 -28.314 -6.469  1.00 50.98 ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.050 -26.875 -6.694  1.00 47.11 ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.126 -26.102 -5.377  1.00 36.35 ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.422 -26.422 -4.421  1.00 38.78 ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.881 -26.389 -7.533  1.00 42.68 ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.985 -25.087 -5.335  1.00 31.26 ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.224 -24.338 -4.102  1.00 29.41 ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.696 -22.903 -4.176  1.00 20.58 ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.851 -22.122 -3.229  1.00 25.06 ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.723 -24.318 -3.738  1.00 27.77 ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.470 -23.728 -4.809  1.00 29.01 ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.235 -25.738 -3.478  1.00 30.87 ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.072 -22.562 -5.298  1.00 24.96 ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.531 -21.226 -5.494  1.00 27.65 ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.578 -20.128 -5.379  1.00 26.55 ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.366 -19.124 -4.689  1.00 25.85 ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.710 -20.315 -6.052  1.00 19.08 ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.810 -19.350 -5.978  1.00 15.23 ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.148 -18.759 -7.347  1.00 16.69 ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.241 -18.225 -7.547  1.00 18.35 ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.057 -20.008 -5.373  1.00 14.37 ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.966 -20.263 -3.866  1.00 18.34 ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.175 -21.017 -3.346  1.00 14.95 ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.318 -22.207 -3.605  1.00 22.77 ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 69.061 -20.325 -2.631  1.00 17.29 ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.187 -18.848 -8.263  1.00 20.41 ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.343 -18.460 -9.663  1.00 22.75 ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.334 -16.944 -9.916  1.00 21.18 ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.935 -16.473 -10.876 1.00 24.21 ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.245 -19.127 -10.515 1.00 24.52 ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.835 -18.929 -9.930  1.00 29.08 ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.596 -19.300 -8.758  1.00 26.82 ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.957 -18.395 -10.643 1.00 38.10 ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.659 -16.187 -9.057  1.00 17.62 ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.469 -14.756 -9.285  1.00 13.85 ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.063 -13.936 -8.161  1.00 16.15 ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.272 -14.438 -7.062  1.00 10.21 ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.971 -14.429 -9.340  1.00 14.55 ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.176 -15.127 -10.440 1.00 15.06 ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.690 -14.746 -10.328 1.00 14.05 ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.046 -15.404 -9.194  1.00 13.22 ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 59.007 -14.907 -8.531  1.00 15.45 ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.477 -15.584 -7.520  1.00 10.75 ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.490 -13.741 -8.888  1.00 13.53 ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.320 -12.662 -8.434  1.00 10.47 ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.599 -11.712 -7.366  1.00 5.96  ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.468 -10.686 -7.381  1.00 10.93 ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.208 -10.061 -8.412  1.00 11.59 ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.962 -11.015 -7.556  1.00 7.79  ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.198 -9.997  -6.441  1.00 12.13 ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.093 -12.047 -7.579  1.00 13.59 ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.777 -10.530 -6.254  1.00 9.43  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.589 -9.682  -6.202  1.00 8.80  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.739 -8.734  -5.019  1.00 14.07 ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.141 -9.147  -3.941  1.00 10.28 ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.305 -10.510 -6.026  1.00 12.11 ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.112 -9.604  -5.767  1.00 12.27 ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.054 -11.397 -7.251  1.00 11.63 ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.417 -7.461  -5.214  1.00 10.41 ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.468 -6.507  -4.108  1.00 9.99  ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.105 -5.876  -3.878  1.00 8.40  ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.284 -5.803  -4.794  1.00 10.31 ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.519 -5.437  -4.364  1.00 12.33 ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.856 -5.436  -2.652  1.00 5.96  ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.640 -4.692  -2.352  1.00 7.88  ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.077 -3.396  -1.693  1.00 14.79 ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.712 -3.407  -0.639  1.00 11.18 ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.679 -5.488  -1.468  1.00 9.13  ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.311 -4.944  -0.999  1.00 13.74 ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.425 -3.980  0.194   1.00 14.28 ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.502 -4.292  -2.146  1.00 14.13 ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.767 -2.285  -2.351  1.00 10.20 ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.136 -0.980  -1.838  1.00 9.81  ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.905 -0.309  -1.272  1.00 11.09 ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.875 -0.214  -1.933  1.00 9.49  ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.770 -0.111  -2.924  1.00 11.70 ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.084 1.276   -2.380  1.00 11.65 ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 62.042 -0.785  -3.437  1.00 12.75 ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.016 0.154   -0.034  1.00 10.95 ? 13   ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 57.881 0.722   0.684   0.25 12.18 ? 13   ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 57.878 0.751   0.642   0.75 12.15 ? 13   ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.276 2.068   1.292   1.00 9.90  ? 13   ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.201 2.117   2.090   1.00 10.37 ? 13   ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.511 -0.262  1.797   0.25 12.74 ? 13   ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.297 -0.184  1.698   0.75 12.54 ? 13   ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.100 -0.080  2.300   0.25 17.86 ? 13   ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.111 0.438   2.424   0.75 17.59 ? 13   ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 55.773 1.028   2.757   0.25 15.03 ? 13   ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 56.315 1.087   3.458   0.75 22.29 ? 13   ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 55.320 -1.057  2.242   0.25 21.65 ? 13   ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 54.971 0.292   1.951   0.75 22.28 ? 13   ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.569 3.147   0.950   1.00 10.24 ? 14   MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 57.920 4.473   1.489   1.00 11.04 ? 14   MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.687 4.510   2.990   1.00 13.08 ? 14   MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.718 3.960   3.482   1.00 11.71 ? 14   MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.114 5.603   0.828   1.00 10.20 ? 14   MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.156 5.611   -0.698  1.00 12.18 ? 14   MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.839 5.589   -1.367  1.00 16.23 ? 14   MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.468 7.173   -0.882  1.00 14.45 ? 14   MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.578 5.148   3.728   1.00 9.12  ? 15   ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.358 5.294   5.166   1.00 10.47 ? 15   ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.287 6.351   5.437   1.00 12.15 ? 15   ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.284 7.412   4.799   1.00 9.39  ? 15   ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.656 5.683   5.866   1.00 10.84 ? 15   ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.747 4.625   5.719   1.00 12.22 ? 15   ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.421 3.428   5.640   1.00 12.98 ? 15   ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 61.935 4.999   5.720   1.00 15.64 ? 15   ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.406 6.057   6.394   1.00 12.12 ? 16   CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.291 6.944   6.788   1.00 13.72 ? 16   CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.930 7.928   5.681   1.00 13.14 ? 16   CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.075 9.140   5.821   1.00 10.95 ? 16   CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.591 7.675   8.111   1.00 9.96  ? 16   CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.112 8.599   8.165   1.00 15.14 ? 16   CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.438 7.386   4.580   1.00 9.93  ? 17   PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.426 8.122   3.320   1.00 12.20 ? 17   PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.704 9.475   3.342   1.00 7.87  ? 17   PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.301 10.494  3.000   1.00 7.92  ? 17   PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.862 7.255   2.203   1.00 8.61  ? 17   PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 53.926 7.904   0.859   1.00 10.17 ? 17   PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.110 8.492   0.409   1.00 10.53 ? 17   PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.808 7.938   0.040   1.00 13.98 ? 17   PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.170 9.084   -0.856  1.00 10.66 ? 17   PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.862 8.531   -1.211  1.00 13.66 ? 17   PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 54.040 9.110   -1.657  1.00 11.84 ? 17   PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.436 9.495   3.740   1.00 6.06  ? 18   PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.686 10.758  3.701   1.00 7.49  ? 18   PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.340 11.820  4.601   1.00 9.95  ? 18   PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.307 13.007  4.302   1.00 7.68  ? 18   PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.216 10.580  4.105   1.00 8.15  ? 18   PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.363 9.862   3.080   1.00 8.29  ? 18   PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 49.935 9.158   2.029   1.00 9.73  ? 18   PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 47.985 9.900   3.186   1.00 12.41 ? 18   PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.142 8.501   1.107   1.00 11.97 ? 18   PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.174 9.250   2.253   1.00 13.48 ? 18   PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.757 8.546   1.223   1.00 12.49 ? 18   PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.922 11.385  5.716   1.00 8.85  ? 19   VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.667 12.291  6.583   1.00 9.44  ? 19   VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.884 12.903  5.876   1.00 9.51  ? 19   VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.124 14.127  5.962   1.00 8.76  ? 19   VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.105 11.569  7.879   1.00 6.24  ? 19   VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.136 12.384  8.629   1.00 11.35 ? 19   VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.879 11.276  8.745   1.00 12.29 ? 19   VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.661 12.064  5.183   1.00 9.32  ? 20   GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.813 12.588  4.448   1.00 6.98  ? 20   GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.391 13.587  3.384   1.00 6.37  ? 20   GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.106 14.574  3.169   1.00 9.10  ? 20   GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.610 11.490  3.776   1.00 7.74  ? 20   GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.442 10.644  4.719   1.00 14.05 ? 20   GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.539 9.944   3.948   1.00 14.98 ? 20   GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.616 10.499  3.771   1.00 15.18 ? 20   GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.253 8.733   3.446   1.00 17.61 ? 20   GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.262 13.339  2.719   1.00 5.22  ? 21   VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.760 14.290  1.701   1.00 4.08  ? 21   VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.488 15.644  2.356   1.00 10.49 ? 21   VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.874 16.699  1.831   1.00 9.01  ? 21   VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.489 13.771  0.970   1.00 7.13  ? 21   VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.961 14.811  -0.038  1.00 8.42  ? 21   VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.814 12.460  0.243   1.00 7.17  ? 21   VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.846 15.612  3.519   1.00 7.94  ? 22   GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.526 16.855  4.242   1.00 9.52  ? 22   GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.792 17.519  4.830   1.00 7.97  ? 22   GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.883 18.744  4.905   1.00 8.33  ? 22   GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.476 16.598  5.349   1.00 6.32  ? 22   GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.097 16.163  4.855   1.00 8.32  ? 22   GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.407 17.198  3.957   1.00 14.64 ? 22   GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.686 18.404  4.096   1.00 15.14 ? 22   GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.574 16.796  3.118   1.00 14.69 ? 22   GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.772 16.716  5.238   1.00 7.94  ? 23   GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.028 17.257  5.772   1.00 7.52  ? 23   GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.912 17.889  4.698   1.00 7.40  ? 23   GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.625 18.850  4.970   1.00 8.36  ? 23   GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.823 16.178  6.505   1.00 8.21  ? 23   GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.191 15.762  7.830   1.00 6.96  ? 23   GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.897 14.565  8.453   1.00 10.56 ? 23   GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.325 13.651  7.750   1.00 9.96  ? 23   GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.056 14.587  9.765   1.00 12.32 ? 23   GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.873 17.354  3.485   1.00 8.91  ? 24   ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.627 17.973  2.402   1.00 8.83  ? 24   ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.067 19.372  2.175   1.00 10.32 ? 24   ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.814 20.328  1.990   1.00 10.36 ? 24   ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.525 17.153  1.114   1.00 10.95 ? 24   ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.394 17.705  -0.027  1.00 15.95 ? 24   ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.386 16.766  -1.226  1.00 8.26  ? 24   ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.083 16.723  -1.886  1.00 9.76  ? 24   ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 57.881 16.128  -3.054  1.00 10.21 ? 24   ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 58.898 15.522  -3.675  1.00 8.18  ? 24   ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.676 16.148  -3.607  1.00 11.99 ? 24   ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.740 19.479  2.199   1.00 7.86  ? 25   GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.063 20.739  1.890   1.00 10.06 ? 25   GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.219 21.770  3.001   1.00 11.45 ? 25   GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.326 22.980  2.751   1.00 10.34 ? 25   GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.571 20.485  1.678   1.00 10.24 ? 25   GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.816 21.697  1.124   1.00 13.00 ? 25   GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.338 21.395  0.910   1.00 19.05 ? 25   GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 51.980 20.343  0.382   1.00 17.68 ? 25   GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.478 22.306  1.341   1.00 24.56 ? 25   GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.181 21.292  4.236   1.00 8.88  ? 26   ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.248 22.176  5.393   1.00 14.42 ? 26   ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.417 21.794  6.282   1.00 8.89  ? 26   ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.321 20.878  7.090   1.00 10.55 ? 26   ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.917 22.185  6.171   1.00 15.74 ? 26   ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.943 23.149  7.377   1.00 10.19 ? 26   ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 55.961 23.786  7.663   1.00 11.59 ? 26   ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.813 23.261  8.066   1.00 15.66 ? 26   ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.552 22.486  6.113   1.00 10.40 ? 27   PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.779 22.163  6.843   1.00 11.68 ? 27   PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.576 22.185  8.357   1.00 14.00 ? 27   PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.305 21.507  9.077   1.00 15.79 ? 27   PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.730 23.280  6.406   1.00 17.52 ? 27   PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.282 23.593  5.010   1.00 11.49 ? 27   PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.790 23.468  5.035   1.00 11.67 ? 27   PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.586 22.941  8.827   1.00 12.62 ? 28   HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.296 23.014  10.266  1.00 17.37 ? 28   HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.856 21.664  10.850  1.00 18.76 ? 28   HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 57.863 21.481  12.070  1.00 16.48 ? 28   HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.196 24.042  10.546  1.00 18.96 ? 28   HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.676 25.460  10.584  1.00 21.63 ? 28   HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 56.966 26.500  10.020  1.00 30.08 ? 28   HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.785 26.014  11.130  1.00 25.50 ? 28   HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.621 27.631  10.211  1.00 31.75 ? 28   HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.729 27.365  10.880  1.00 32.26 ? 28   HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.460 20.731  9.986   1.00 15.08 ? 29   LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 57.000 19.406  10.435  1.00 11.30 ? 29   LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.118 18.360  10.439  1.00 13.90 ? 29   LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 57.944 17.253  10.962  1.00 11.33 ? 29   LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.834 18.901  9.566   1.00 9.18  ? 29   LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.550 19.733  9.457   1.00 11.35 ? 29   LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.557 19.098  8.488   1.00 14.72 ? 29   LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 53.919 19.953  10.819  1.00 17.64 ? 29   LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.266 18.707  9.857   1.00 10.86 ? 30   ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.366 17.759  9.702   1.00 11.00 ? 30   ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 60.979 17.376  11.039  1.00 14.45 ? 30   ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.120 18.213  11.922  1.00 14.72 ? 30   ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.452 18.306  8.771   1.00 11.97 ? 30   ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 60.945 18.570  7.355   1.00 12.93 ? 30   ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 61.992 19.223  6.465   1.00 18.00 ? 30   ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.441 19.538  5.141   1.00 13.91 ? 30   ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.161 20.009  4.130   1.00 19.39 ? 30   ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.465 20.215  4.289   1.00 16.01 ? 30   ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.580 20.266  2.965   1.00 11.42 ? 30   ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.311 16.094  11.169  1.00 14.69 ? 31   ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.949 15.575  12.374  1.00 20.13 ? 31   ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.138 15.847  13.631  1.00 16.97 ? 31   ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.699 16.112  14.697  1.00 24.16 ? 31   ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.364 16.143  12.524  1.00 21.81 ? 31   ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.212 15.923  11.283  1.00 22.94 ? 31   ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.456 14.788  10.871  1.00 32.55 ? 31   ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.658 17.016  10.675  1.00 30.36 ? 31   ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.815 15.783  13.495  1.00 12.21 ? 32   LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.902 16.012  14.603  1.00 15.18 ? 32   LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.944 14.835  14.719  1.00 12.70 ? 32   LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.700 14.130  13.745  1.00 13.50 ? 32   LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.065 17.279  14.373  1.00 16.97 ? 32   LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 58.846 18.602  14.367  1.00 22.00 ? 32   LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 59.141 19.086  15.767  1.00 31.08 ? 32   LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 59.582 20.554  15.756  1.00 42.86 ? 32   LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 60.739 20.801  14.840  1.00 35.74 ? 32   LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.384 14.629  15.917  1.00 15.92 ? 33   PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.206 13.764  16.055  1.00 14.30 ? 33   PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.051 14.438  15.308  1.00 12.41 ? 33   PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.599 15.531  15.661  1.00 12.76 ? 33   PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.956 13.754  17.565  1.00 14.62 ? 33   PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.568 15.015  18.064  1.00 21.10 ? 33   PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.747 15.298  17.179  1.00 18.20 ? 33   PRO A CD    1 
ATOM   294  N  N     . CYS A 1 37  ? 54.585 13.791  14.253  1.00 11.98 ? 34   CYS A N     1 
ATOM   295  C  CA    A CYS A 1 37  ? 53.621 14.375  13.322  0.45 11.80 ? 34   CYS A CA    1 
ATOM   296  C  CA    B CYS A 1 37  ? 53.486 14.361  13.497  0.55 11.68 ? 34   CYS A CA    1 
ATOM   297  C  C     . CYS A 1 37  ? 52.697 13.268  12.825  1.00 9.91  ? 34   CYS A C     1 
ATOM   298  O  O     . CYS A 1 37  ? 53.117 12.112  12.764  1.00 10.49 ? 34   CYS A O     1 
ATOM   299  C  CB    A CYS A 1 37  ? 54.401 14.989  12.148  0.45 14.03 ? 34   CYS A CB    1 
ATOM   300  C  CB    B CYS A 1 37  ? 53.986 15.393  12.486  0.55 14.29 ? 34   CYS A CB    1 
ATOM   301  S  SG    A CYS A 1 37  ? 53.448 15.772  10.818  0.45 10.47 ? 34   CYS A SG    1 
ATOM   302  S  SG    B CYS A 1 37  ? 55.110 14.730  11.261  0.55 13.14 ? 34   CYS A SG    1 
ATOM   303  N  N     . ALA A 1 38  ? 51.487 13.620  12.418  1.00 7.73  ? 35   ALA A N     1 
ATOM   304  C  CA    . ALA A 1 38  ? 50.576 12.646  11.840  1.00 6.98  ? 35   ALA A CA    1 
ATOM   305  C  C     . ALA A 1 38  ? 49.735 13.368  10.835  1.00 11.47 ? 35   ALA A C     1 
ATOM   306  O  O     . ALA A 1 38  ? 49.626 14.593  10.881  1.00 9.76  ? 35   ALA A O     1 
ATOM   307  C  CB    . ALA A 1 38  ? 49.684 12.034  12.904  1.00 9.73  ? 35   ALA A CB    1 
ATOM   308  N  N     . VAL A 1 39  ? 49.143 12.598  9.931   1.00 8.59  ? 36   VAL A N     1 
ATOM   309  C  CA    . VAL A 1 39  ? 48.243 13.141  8.931   1.00 8.03  ? 36   VAL A CA    1 
ATOM   310  C  C     . VAL A 1 39  ? 46.852 12.662  9.287   1.00 13.08 ? 36   VAL A C     1 
ATOM   311  O  O     . VAL A 1 39  ? 46.653 11.488  9.598   1.00 11.90 ? 36   VAL A O     1 
ATOM   312  C  CB    . VAL A 1 39  ? 48.636 12.666  7.524   1.00 8.91  ? 36   VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 39  ? 47.558 13.029  6.492   1.00 8.65  ? 36   VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 39  ? 49.992 13.261  7.155   1.00 11.97 ? 36   VAL A CG2   1 
ATOM   315  N  N     . VAL A 1 40  ? 45.897 13.585  9.251   1.00 10.18 ? 37   VAL A N     1 
ATOM   316  C  CA    . VAL A 1 40  ? 44.543 13.312  9.695   1.00 11.87 ? 37   VAL A CA    1 
ATOM   317  C  C     . VAL A 1 40  ? 43.541 13.693  8.630   1.00 13.03 ? 37   VAL A C     1 
ATOM   318  O  O     . VAL A 1 40  ? 43.782 14.610  7.834   1.00 14.09 ? 37   VAL A O     1 
ATOM   319  C  CB    . VAL A 1 40  ? 44.206 14.130  11.004  1.00 19.06 ? 37   VAL A CB    1 
ATOM   320  C  CG1   A VAL A 1 40  ? 45.030 13.642  12.189  0.51 13.39 ? 37   VAL A CG1   1 
ATOM   321  C  CG1   B VAL A 1 40  ? 44.058 15.612  10.698  0.49 15.54 ? 37   VAL A CG1   1 
ATOM   322  C  CG2   A VAL A 1 40  ? 44.372 15.626  10.784  0.51 15.79 ? 37   VAL A CG2   1 
ATOM   323  C  CG2   B VAL A 1 40  ? 42.972 13.620  11.688  0.49 13.84 ? 37   VAL A CG2   1 
ATOM   324  N  N     . GLN A 1 41  ? 42.409 13.005  8.612   1.00 11.91 ? 38   GLN A N     1 
ATOM   325  C  CA    . GLN A 1 41  ? 41.340 13.443  7.730   1.00 13.93 ? 38   GLN A CA    1 
ATOM   326  C  C     . GLN A 1 41  ? 40.104 13.870  8.502   1.00 12.90 ? 38   GLN A C     1 
ATOM   327  O  O     . GLN A 1 41  ? 39.706 13.232  9.480   1.00 12.78 ? 38   GLN A O     1 
ATOM   328  C  CB    . GLN A 1 41  ? 41.045 12.449  6.599   1.00 21.00 ? 38   GLN A CB    1 
ATOM   329  C  CG    . GLN A 1 41  ? 40.633 11.074  7.001   1.00 25.01 ? 38   GLN A CG    1 
ATOM   330  C  CD    . GLN A 1 41  ? 40.701 10.100  5.825   1.00 20.62 ? 38   GLN A CD    1 
ATOM   331  O  OE1   . GLN A 1 41  ? 41.158 10.447  4.725   1.00 21.84 ? 38   GLN A OE1   1 
ATOM   332  N  NE2   . GLN A 1 41  ? 40.255 8.878   6.058   1.00 29.57 ? 38   GLN A NE2   1 
ATOM   333  N  N     . TYR A 1 42  ? 39.523 14.977  8.049   1.00 16.19 ? 39   TYR A N     1 
ATOM   334  C  CA    . TYR A 1 42  ? 38.407 15.616  8.724   1.00 14.07 ? 39   TYR A CA    1 
ATOM   335  C  C     . TYR A 1 42  ? 38.938 16.103  10.069  1.00 24.45 ? 39   TYR A C     1 
ATOM   336  O  O     . TYR A 1 42  ? 40.139 15.978  10.349  1.00 22.76 ? 39   TYR A O     1 
ATOM   337  C  CB    . TYR A 1 42  ? 37.208 14.674  8.817   1.00 14.87 ? 39   TYR A CB    1 
ATOM   338  C  CG    . TYR A 1 42  ? 36.791 14.176  7.445   1.00 11.40 ? 39   TYR A CG    1 
ATOM   339  C  CD1   . TYR A 1 42  ? 36.521 15.072  6.423   1.00 14.22 ? 39   TYR A CD1   1 
ATOM   340  C  CD2   . TYR A 1 42  ? 36.752 12.809  7.153   1.00 14.77 ? 39   TYR A CD2   1 
ATOM   341  C  CE1   . TYR A 1 42  ? 36.163 14.629  5.149   1.00 16.94 ? 39   TYR A CE1   1 
ATOM   342  C  CE2   . TYR A 1 42  ? 36.401 12.353  5.875   1.00 11.97 ? 39   TYR A CE2   1 
ATOM   343  C  CZ    . TYR A 1 42  ? 36.112 13.269  4.884   1.00 11.91 ? 39   TYR A CZ    1 
ATOM   344  O  OH    . TYR A 1 42  ? 35.742 12.825  3.622   1.00 14.58 ? 39   TYR A OH    1 
ATOM   345  N  N     . LYS A 1 43  ? 38.080 16.688  10.884  1.00 22.37 ? 40   LYS A N     1 
ATOM   346  C  CA    . LYS A 1 43  ? 38.569 17.412  12.057  1.00 27.10 ? 40   LYS A CA    1 
ATOM   347  C  C     . LYS A 1 43  ? 37.488 17.543  13.111  1.00 26.95 ? 40   LYS A C     1 
ATOM   348  O  O     . LYS A 1 43  ? 37.751 17.441  14.307  1.00 22.99 ? 40   LYS A O     1 
ATOM   349  C  CB    . LYS A 1 43  ? 39.049 18.809  11.649  1.00 28.46 ? 40   LYS A CB    1 
ATOM   350  C  CG    . LYS A 1 43  ? 40.215 19.360  12.475  1.00 37.18 ? 40   LYS A CG    1 
ATOM   351  C  CD    . LYS A 1 43  ? 41.512 18.610  12.155  1.00 36.83 ? 40   LYS A CD    1 
ATOM   352  C  CE    . LYS A 1 43  ? 42.726 19.252  12.819  1.00 32.90 ? 40   LYS A CE    1 
ATOM   353  N  NZ    . LYS A 1 43  ? 42.732 19.104  14.306  1.00 32.81 ? 40   LYS A NZ    1 
ATOM   354  N  N     . SER A 1 44  ? 36.264 17.766  12.652  1.00 22.44 ? 41   SER A N     1 
ATOM   355  C  CA    . SER A 1 44  ? 35.130 17.983  13.530  1.00 21.67 ? 41   SER A CA    1 
ATOM   356  C  C     . SER A 1 44  ? 34.934 16.858  14.539  1.00 26.84 ? 41   SER A C     1 
ATOM   357  O  O     . SER A 1 44  ? 34.767 17.111  15.730  1.00 29.89 ? 41   SER A O     1 
ATOM   358  C  CB    . SER A 1 44  ? 33.866 18.150  12.690  1.00 32.94 ? 41   SER A CB    1 
ATOM   359  O  OG    . SER A 1 44  ? 34.069 19.152  11.711  1.00 41.07 ? 41   SER A OG    1 
ATOM   360  N  N     . TRP A 1 45  ? 34.945 15.619  14.057  1.00 24.55 ? 42   TRP A N     1 
ATOM   361  C  CA    . TRP A 1 45  ? 34.699 14.464  14.916  1.00 22.41 ? 42   TRP A CA    1 
ATOM   362  C  C     . TRP A 1 45  ? 35.998 13.997  15.568  1.00 21.46 ? 42   TRP A C     1 
ATOM   363  O  O     . TRP A 1 45  ? 36.854 13.395  14.920  1.00 20.43 ? 42   TRP A O     1 
ATOM   364  C  CB    . TRP A 1 45  ? 34.041 13.321  14.127  1.00 27.23 ? 42   TRP A CB    1 
ATOM   365  C  CG    . TRP A 1 45  ? 33.559 12.162  14.973  1.00 21.68 ? 42   TRP A CG    1 
ATOM   366  C  CD1   . TRP A 1 45  ? 34.253 11.022  15.279  1.00 27.99 ? 42   TRP A CD1   1 
ATOM   367  C  CD2   . TRP A 1 45  ? 32.274 12.024  15.597  1.00 29.83 ? 42   TRP A CD2   1 
ATOM   368  N  NE1   . TRP A 1 45  ? 33.486 10.195  16.065  1.00 30.66 ? 42   TRP A NE1   1 
ATOM   369  C  CE2   . TRP A 1 45  ? 32.268 10.785  16.273  1.00 29.64 ? 42   TRP A CE2   1 
ATOM   370  C  CE3   . TRP A 1 45  ? 31.131 12.831  15.653  1.00 32.36 ? 42   TRP A CE3   1 
ATOM   371  C  CZ2   . TRP A 1 45  ? 31.160 10.333  16.996  1.00 34.52 ? 42   TRP A CZ2   1 
ATOM   372  C  CZ3   . TRP A 1 45  ? 30.032 12.381  16.371  1.00 32.45 ? 42   TRP A CZ3   1 
ATOM   373  C  CH2   . TRP A 1 45  ? 30.053 11.141  17.030  1.00 26.94 ? 42   TRP A CH2   1 
ATOM   374  N  N     . LYS A 1 46  ? 36.132 14.311  16.855  1.00 26.81 ? 43   LYS A N     1 
ATOM   375  C  CA    . LYS A 1 46  ? 37.256 13.881  17.688  1.00 18.80 ? 43   LYS A CA    1 
ATOM   376  C  C     . LYS A 1 46  ? 38.628 14.280  17.153  1.00 16.99 ? 43   LYS A C     1 
ATOM   377  O  O     . LYS A 1 46  ? 39.612 13.575  17.375  1.00 17.47 ? 43   LYS A O     1 
ATOM   378  C  CB    . LYS A 1 46  ? 37.183 12.373  17.955  1.00 20.84 ? 43   LYS A CB    1 
ATOM   379  C  CG    . LYS A 1 46  ? 35.876 11.931  18.616  1.00 26.06 ? 43   LYS A CG    1 
ATOM   380  C  CD    . LYS A 1 46  ? 35.854 10.427  18.878  1.00 26.01 ? 43   LYS A CD    1 
ATOM   381  C  CE    . LYS A 1 46  ? 34.549 10.016  19.549  1.00 38.30 ? 43   LYS A CE    1 
ATOM   382  N  NZ    . LYS A 1 46  ? 34.547 8.577   19.929  1.00 38.31 ? 43   LYS A NZ    1 
ATOM   383  N  N     . GLY A 1 47  ? 38.676 15.409  16.448  1.00 18.07 ? 44   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 47  ? 39.917 16.000  15.991  1.00 14.60 ? 44   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 47  ? 40.399 15.429  14.673  1.00 13.73 ? 44   GLY A C     1 
ATOM   386  O  O     . GLY A 1 47  ? 41.448 15.819  14.174  1.00 17.36 ? 44   GLY A O     1 
ATOM   387  N  N     . GLY A 1 48  ? 39.630 14.492  14.124  1.00 17.16 ? 45   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 48  ? 39.972 13.847  12.868  1.00 16.84 ? 45   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 48  ? 40.605 12.481  13.052  1.00 16.87 ? 45   GLY A C     1 
ATOM   390  O  O     . GLY A 1 48  ? 41.195 12.185  14.084  1.00 13.71 ? 45   GLY A O     1 
ATOM   391  N  N     . GLY A 1 49  ? 40.496 11.641  12.030  1.00 13.96 ? 46   GLY A N     1 
ATOM   392  C  CA    . GLY A 1 49  ? 41.034 10.298  12.115  1.00 12.64 ? 46   GLY A CA    1 
ATOM   393  C  C     . GLY A 1 49  ? 42.430 10.260  11.529  1.00 14.13 ? 46   GLY A C     1 
ATOM   394  O  O     . GLY A 1 49  ? 42.652 10.751  10.421  1.00 14.77 ? 46   GLY A O     1 
ATOM   395  N  N     . ILE A 1 50  ? 43.369 9.679   12.267  1.00 11.94 ? 47   ILE A N     1 
ATOM   396  C  CA    . ILE A 1 50  ? 44.771 9.618   11.843  1.00 8.66  ? 47   ILE A CA    1 
ATOM   397  C  C     . ILE A 1 50  ? 44.973 8.551   10.772  1.00 10.05 ? 47   ILE A C     1 
ATOM   398  O  O     . ILE A 1 50  ? 44.504 7.426   10.923  1.00 13.74 ? 47   ILE A O     1 
ATOM   399  C  CB    . ILE A 1 50  ? 45.698 9.347   13.063  1.00 12.93 ? 47   ILE A CB    1 
ATOM   400  C  CG1   . ILE A 1 50  ? 45.738 10.593  13.943  1.00 16.14 ? 47   ILE A CG1   1 
ATOM   401  C  CG2   . ILE A 1 50  ? 47.115 8.937   12.633  1.00 9.26  ? 47   ILE A CG2   1 
ATOM   402  C  CD1   . ILE A 1 50  ? 46.507 10.404  15.249  1.00 20.05 ? 47   ILE A CD1   1 
ATOM   403  N  N     . ILE A 1 51  ? 45.654 8.898   9.685   1.00 9.27  ? 48   ILE A N     1 
ATOM   404  C  CA    . ILE A 1 51  ? 45.907 7.897   8.652   1.00 10.74 ? 48   ILE A CA    1 
ATOM   405  C  C     . ILE A 1 51  ? 47.390 7.599   8.389   1.00 13.32 ? 48   ILE A C     1 
ATOM   406  O  O     . ILE A 1 51  ? 47.706 6.636   7.700   1.00 13.00 ? 48   ILE A O     1 
ATOM   407  C  CB    . ILE A 1 51  ? 45.167 8.212   7.327   1.00 14.60 ? 48   ILE A CB    1 
ATOM   408  C  CG1   . ILE A 1 51  ? 45.548 9.591   6.789   1.00 11.33 ? 48   ILE A CG1   1 
ATOM   409  C  CG2   . ILE A 1 51  ? 43.651 8.139   7.534   1.00 17.96 ? 48   ILE A CG2   1 
ATOM   410  C  CD1   . ILE A 1 51  ? 45.065 9.808   5.359   1.00 16.98 ? 48   ILE A CD1   1 
ATOM   411  N  N     . ALA A 1 52  ? 48.281 8.408   8.957   1.00 10.49 ? 49   ALA A N     1 
ATOM   412  C  CA    . ALA A 1 52  ? 49.729 8.218   8.822   1.00 9.41  ? 49   ALA A CA    1 
ATOM   413  C  C     . ALA A 1 52  ? 50.447 8.847   10.000  1.00 10.20 ? 49   ALA A C     1 
ATOM   414  O  O     . ALA A 1 52  ? 50.034 9.895   10.476  1.00 9.89  ? 49   ALA A O     1 
ATOM   415  C  CB    . ALA A 1 52  ? 50.239 8.843   7.513   1.00 7.82  ? 49   ALA A CB    1 
ATOM   416  N  N     . VAL A 1 53  ? 51.526 8.209   10.461  1.00 7.25  ? 50   VAL A N     1 
ATOM   417  C  CA    . VAL A 1 53  ? 52.203 8.620   11.690  1.00 9.15  ? 50   VAL A CA    1 
ATOM   418  C  C     . VAL A 1 53  ? 53.729 8.590   11.539  1.00 8.44  ? 50   VAL A C     1 
ATOM   419  O  O     . VAL A 1 53  ? 54.295 7.577   11.109  1.00 8.64  ? 50   VAL A O     1 
ATOM   420  C  CB    . VAL A 1 53  ? 51.823 7.656   12.842  1.00 8.08  ? 50   VAL A CB    1 
ATOM   421  C  CG1   . VAL A 1 53  ? 52.392 8.146   14.149  1.00 11.89 ? 50   VAL A CG1   1 
ATOM   422  C  CG2   . VAL A 1 53  ? 50.321 7.504   12.933  1.00 12.80 ? 50   VAL A CG2   1 
ATOM   423  N  N     . SER A 1 54  ? 54.401 9.685   11.887  1.00 7.91  ? 51   SER A N     1 
ATOM   424  C  CA    . SER A 1 54  ? 55.867 9.715   11.815  1.00 9.91  ? 51   SER A CA    1 
ATOM   425  C  C     . SER A 1 54  ? 56.462 8.770   12.855  1.00 11.18 ? 51   SER A C     1 
ATOM   426  O  O     . SER A 1 54  ? 55.832 8.475   13.870  1.00 12.22 ? 51   SER A O     1 
ATOM   427  C  CB    . SER A 1 54  ? 56.427 11.127  12.024  1.00 12.21 ? 51   SER A CB    1 
ATOM   428  O  OG    . SER A 1 54  ? 56.432 11.482  13.406  1.00 12.26 ? 51   SER A OG    1 
ATOM   429  N  N     . TYR A 1 55  ? 57.681 8.305   12.608  1.00 12.68 ? 52   TYR A N     1 
ATOM   430  C  CA    . TYR A 1 55  ? 58.321 7.398   13.556  1.00 12.37 ? 52   TYR A CA    1 
ATOM   431  C  C     . TYR A 1 55  ? 58.531 8.022   14.942  1.00 15.06 ? 52   TYR A C     1 
ATOM   432  O  O     . TYR A 1 55  ? 58.409 7.342   15.960  1.00 13.13 ? 52   TYR A O     1 
ATOM   433  C  CB    . TYR A 1 55  ? 59.604 6.797   12.959  1.00 12.07 ? 52   TYR A CB    1 
ATOM   434  C  CG    . TYR A 1 55  ? 59.253 5.697   11.979  1.00 13.21 ? 52   TYR A CG    1 
ATOM   435  C  CD1   . TYR A 1 55  ? 58.826 6.000   10.687  1.00 14.40 ? 52   TYR A CD1   1 
ATOM   436  C  CD2   . TYR A 1 55  ? 59.280 4.366   12.363  1.00 17.20 ? 52   TYR A CD2   1 
ATOM   437  C  CE1   . TYR A 1 55  ? 58.457 5.003   9.800   1.00 13.29 ? 52   TYR A CE1   1 
ATOM   438  C  CE2   . TYR A 1 55  ? 58.919 3.359   11.490  1.00 12.41 ? 52   TYR A CE2   1 
ATOM   439  C  CZ    . TYR A 1 55  ? 58.509 3.677   10.206  1.00 16.47 ? 52   TYR A CZ    1 
ATOM   440  O  OH    . TYR A 1 55  ? 58.157 2.673   9.337   1.00 18.18 ? 52   TYR A OH    1 
ATOM   441  N  N     . GLU A 1 56  ? 58.796 9.323   14.983  1.00 12.83 ? 53   GLU A N     1 
ATOM   442  C  CA    . GLU A 1 56  ? 58.873 10.025  16.254  1.00 17.09 ? 53   GLU A CA    1 
ATOM   443  C  C     . GLU A 1 56  ? 57.561 9.918   17.028  1.00 13.13 ? 53   GLU A C     1 
ATOM   444  O  O     . GLU A 1 56  ? 57.569 9.701   18.238  1.00 15.69 ? 53   GLU A O     1 
ATOM   445  C  CB    . GLU A 1 56  ? 59.245 11.492  16.047  1.00 15.96 ? 53   GLU A CB    1 
ATOM   446  C  CG    . GLU A 1 56  ? 60.647 11.699  15.499  1.00 22.26 ? 53   GLU A CG    1 
ATOM   447  C  CD    . GLU A 1 56  ? 60.761 11.546  13.979  1.00 29.34 ? 53   GLU A CD    1 
ATOM   448  O  OE1   . GLU A 1 56  ? 59.822 11.030  13.318  1.00 20.26 ? 53   GLU A OE1   1 
ATOM   449  O  OE2   . GLU A 1 56  ? 61.813 11.956  13.447  1.00 26.26 ? 53   GLU A OE2   1 
ATOM   450  N  N     . ALA A 1 57  ? 56.435 10.080  16.337  1.00 12.33 ? 54   ALA A N     1 
ATOM   451  C  CA    . ALA A 1 57  ? 55.130 9.986   16.988  1.00 12.77 ? 54   ALA A CA    1 
ATOM   452  C  C     . ALA A 1 57  ? 54.799 8.552   17.400  1.00 11.22 ? 54   ALA A C     1 
ATOM   453  O  O     . ALA A 1 57  ? 54.148 8.336   18.414  1.00 9.95  ? 54   ALA A O     1 
ATOM   454  C  CB    . ALA A 1 57  ? 54.013 10.545  16.071  1.00 13.62 ? 54   ALA A CB    1 
ATOM   455  N  N     . ARG A 1 58  ? 55.236 7.566   16.615  1.00 13.47 ? 55   ARG A N     1 
ATOM   456  C  CA    . ARG A 1 58  ? 54.983 6.153   16.974  1.00 12.65 ? 55   ARG A CA    1 
ATOM   457  C  C     . ARG A 1 58  ? 55.595 5.776   18.324  1.00 15.07 ? 55   ARG A C     1 
ATOM   458  O  O     . ARG A 1 58  ? 55.049 4.936   19.056  1.00 13.23 ? 55   ARG A O     1 
ATOM   459  C  CB    . ARG A 1 58  ? 55.513 5.219   15.899  1.00 8.61  ? 55   ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 58  ? 54.839 5.433   14.579  1.00 15.68 ? 55   ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 58  ? 55.363 4.489   13.546  1.00 16.15 ? 55   ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 58  ? 54.949 4.935   12.228  1.00 14.33 ? 55   ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 58  ? 54.988 4.186   11.143  1.00 14.83 ? 55   ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 58  ? 55.427 2.933   11.227  1.00 14.05 ? 55   ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 58  ? 54.584 4.694   9.978   1.00 15.63 ? 55   ARG A NH2   1 
ATOM   466  N  N     . ALA A 1 59  ? 56.707 6.431   18.658  1.00 12.16 ? 56   ALA A N     1 
ATOM   467  C  CA    . ALA A 1 59  ? 57.395 6.190   19.920  1.00 17.38 ? 56   ALA A CA    1 
ATOM   468  C  C     . ALA A 1 59  ? 56.507 6.546   21.113  1.00 19.12 ? 56   ALA A C     1 
ATOM   469  O  O     . ALA A 1 59  ? 56.684 5.996   22.204  1.00 18.51 ? 56   ALA A O     1 
ATOM   470  C  CB    . ALA A 1 59  ? 58.717 6.960   19.969  1.00 15.87 ? 56   ALA A CB    1 
ATOM   471  N  N     . PHE A 1 60  ? 55.547 7.451   20.907  1.00 10.81 ? 57   PHE A N     1 
ATOM   472  C  CA    . PHE A 1 60  ? 54.594 7.797   21.962  1.00 16.85 ? 57   PHE A CA    1 
ATOM   473  C  C     . PHE A 1 60  ? 53.359 6.904   21.972  1.00 16.86 ? 57   PHE A C     1 
ATOM   474  O  O     . PHE A 1 60  ? 52.496 7.052   22.841  1.00 20.47 ? 57   PHE A O     1 
ATOM   475  C  CB    . PHE A 1 60  ? 54.138 9.253   21.843  1.00 13.83 ? 57   PHE A CB    1 
ATOM   476  C  CG    . PHE A 1 60  ? 55.218 10.260  22.106  1.00 16.60 ? 57   PHE A CG    1 
ATOM   477  C  CD1   . PHE A 1 60  ? 55.325 10.872  23.345  1.00 21.21 ? 57   PHE A CD1   1 
ATOM   478  C  CD2   . PHE A 1 60  ? 56.106 10.625  21.106  1.00 11.50 ? 57   PHE A CD2   1 
ATOM   479  C  CE1   . PHE A 1 60  ? 56.308 11.817  23.587  1.00 27.69 ? 57   PHE A CE1   1 
ATOM   480  C  CE2   . PHE A 1 60  ? 57.096 11.573  21.339  1.00 14.41 ? 57   PHE A CE2   1 
ATOM   481  C  CZ    . PHE A 1 60  ? 57.194 12.170  22.581  1.00 27.57 ? 57   PHE A CZ    1 
ATOM   482  N  N     . GLY A 1 61  ? 53.251 6.004   20.993  1.00 14.28 ? 58   GLY A N     1 
ATOM   483  C  CA    . GLY A 1 61  ? 52.117 5.095   20.898  1.00 16.27 ? 58   GLY A CA    1 
ATOM   484  C  C     . GLY A 1 61  ? 51.021 5.540   19.948  1.00 15.45 ? 58   GLY A C     1 
ATOM   485  O  O     . GLY A 1 61  ? 49.929 4.978   19.925  1.00 13.28 ? 58   GLY A O     1 
ATOM   486  N  N     . VAL A 1 62  ? 51.309 6.565   19.153  1.00 12.06 ? 59   VAL A N     1 
ATOM   487  C  CA    . VAL A 1 62  ? 50.339 7.053   18.189  1.00 11.45 ? 59   VAL A CA    1 
ATOM   488  C  C     . VAL A 1 62  ? 50.287 6.064   17.042  1.00 14.03 ? 59   VAL A C     1 
ATOM   489  O  O     . VAL A 1 62  ? 51.330 5.608   16.552  1.00 14.31 ? 59   VAL A O     1 
ATOM   490  C  CB    . VAL A 1 62  ? 50.715 8.458   17.675  1.00 11.77 ? 59   VAL A CB    1 
ATOM   491  C  CG1   . VAL A 1 62  ? 49.703 8.934   16.637  1.00 16.61 ? 59   VAL A CG1   1 
ATOM   492  C  CG2   . VAL A 1 62  ? 50.755 9.438   18.840  1.00 11.38 ? 59   VAL A CG2   1 
ATOM   493  N  N     . THR A 1 63  ? 49.074 5.726   16.621  1.00 15.43 ? 60   THR A N     1 
ATOM   494  C  CA    . THR A 1 63  ? 48.897 4.790   15.527  1.00 14.13 ? 60   THR A CA    1 
ATOM   495  C  C     . THR A 1 63  ? 47.836 5.241   14.549  1.00 16.06 ? 60   THR A C     1 
ATOM   496  O  O     . THR A 1 63  ? 46.994 6.076   14.849  1.00 15.38 ? 60   THR A O     1 
ATOM   497  C  CB    . THR A 1 63  ? 48.462 3.395   16.028  1.00 22.41 ? 60   THR A CB    1 
ATOM   498  O  OG1   . THR A 1 63  ? 47.151 3.481   16.608  1.00 21.17 ? 60   THR A OG1   1 
ATOM   499  C  CG2   . THR A 1 63  ? 49.450 2.854   17.051  1.00 14.72 ? 60   THR A CG2   1 
ATOM   500  N  N     . ARG A 1 64  ? 47.876 4.636   13.374  1.00 16.25 ? 61   ARG A N     1 
ATOM   501  C  CA    . ARG A 1 64  ? 46.811 4.755   12.398  1.00 18.56 ? 61   ARG A CA    1 
ATOM   502  C  C     . ARG A 1 64  ? 45.460 4.378   13.017  1.00 20.51 ? 61   ARG A C     1 
ATOM   503  O  O     . ARG A 1 64  ? 45.383 3.511   13.880  1.00 19.37 ? 61   ARG A O     1 
ATOM   504  C  CB    . ARG A 1 64  ? 47.161 3.844   11.213  1.00 21.32 ? 61   ARG A CB    1 
ATOM   505  C  CG    A ARG A 1 64  ? 46.076 3.778   10.153  0.30 27.56 ? 61   ARG A CG    1 
ATOM   506  C  CG    B ARG A 1 64  ? 46.159 3.726   10.088  0.70 27.83 ? 61   ARG A CG    1 
ATOM   507  C  CD    A ARG A 1 64  ? 46.575 3.108   8.885   0.30 23.36 ? 61   ARG A CD    1 
ATOM   508  C  CD    B ARG A 1 64  ? 46.539 2.539   9.184   0.70 25.64 ? 61   ARG A CD    1 
ATOM   509  N  NE    A ARG A 1 64  ? 47.631 3.885   8.249   0.30 20.11 ? 61   ARG A NE    1 
ATOM   510  N  NE    B ARG A 1 64  ? 46.598 1.292   9.946   0.70 30.86 ? 61   ARG A NE    1 
ATOM   511  C  CZ    A ARG A 1 64  ? 48.849 3.423   7.986   0.30 20.33 ? 61   ARG A CZ    1 
ATOM   512  C  CZ    B ARG A 1 64  ? 47.680 0.528   10.086  0.70 32.40 ? 61   ARG A CZ    1 
ATOM   513  N  NH1   A ARG A 1 64  ? 49.745 4.208   7.403   0.30 17.79 ? 61   ARG A NH1   1 
ATOM   514  N  NH1   B ARG A 1 64  ? 47.616 -0.579  10.815  0.70 38.49 ? 61   ARG A NH1   1 
ATOM   515  N  NH2   A ARG A 1 64  ? 49.171 2.176   8.299   0.30 23.53 ? 61   ARG A NH2   1 
ATOM   516  N  NH2   B ARG A 1 64  ? 48.824 0.857   9.499   0.70 33.16 ? 61   ARG A NH2   1 
ATOM   517  N  N     . SER A 1 65  ? 44.404 5.058   12.585  1.00 16.87 ? 62   SER A N     1 
ATOM   518  C  CA    . SER A 1 65  ? 43.032 4.760   13.008  1.00 27.24 ? 62   SER A CA    1 
ATOM   519  C  C     . SER A 1 65  ? 42.648 5.382   14.349  1.00 23.53 ? 62   SER A C     1 
ATOM   520  O  O     . SER A 1 65  ? 41.516 5.265   14.797  1.00 32.79 ? 62   SER A O     1 
ATOM   521  C  CB    . SER A 1 65  ? 42.786 3.257   13.079  1.00 33.13 ? 62   SER A CB    1 
ATOM   522  O  OG    . SER A 1 65  ? 42.826 2.813   14.426  1.00 40.52 ? 62   SER A OG    1 
ATOM   523  N  N     . MET A 1 66  ? 43.604 6.032   14.987  1.00 20.73 ? 63   MET A N     1 
ATOM   524  C  CA    . MET A 1 66  ? 43.375 6.695   16.254  1.00 17.29 ? 63   MET A CA    1 
ATOM   525  C  C     . MET A 1 66  ? 42.750 8.052   15.961  1.00 16.46 ? 63   MET A C     1 
ATOM   526  O  O     . MET A 1 66  ? 43.090 8.669   14.954  1.00 17.01 ? 63   MET A O     1 
ATOM   527  C  CB    . MET A 1 66  ? 44.734 6.856   16.917  1.00 19.17 ? 63   MET A CB    1 
ATOM   528  C  CG    . MET A 1 66  ? 44.772 7.370   18.303  1.00 21.84 ? 63   MET A CG    1 
ATOM   529  S  SD    . MET A 1 66  ? 46.459 7.043   18.869  1.00 20.71 ? 63   MET A SD    1 
ATOM   530  C  CE    . MET A 1 66  ? 46.357 5.326   19.317  1.00 19.04 ? 63   MET A CE    1 
ATOM   531  N  N     . TRP A 1 67  ? 41.831 8.510   16.815  1.00 15.01 ? 64   TRP A N     1 
ATOM   532  C  CA    . TRP A 1 67  ? 41.320 9.882   16.714  1.00 15.38 ? 64   TRP A CA    1 
ATOM   533  C  C     . TRP A 1 67  ? 42.417 10.833  17.170  1.00 15.79 ? 64   TRP A C     1 
ATOM   534  O  O     . TRP A 1 67  ? 43.141 10.529  18.113  1.00 17.02 ? 64   TRP A O     1 
ATOM   535  C  CB    . TRP A 1 67  ? 40.062 10.082  17.569  1.00 13.20 ? 64   TRP A CB    1 
ATOM   536  C  CG    . TRP A 1 67  ? 38.933 9.187   17.165  1.00 16.60 ? 64   TRP A CG    1 
ATOM   537  C  CD1   . TRP A 1 67  ? 38.370 8.187   17.910  1.00 18.00 ? 64   TRP A CD1   1 
ATOM   538  C  CD2   . TRP A 1 67  ? 38.238 9.195   15.910  1.00 21.86 ? 64   TRP A CD2   1 
ATOM   539  N  NE1   . TRP A 1 67  ? 37.362 7.576   17.191  1.00 26.08 ? 64   TRP A NE1   1 
ATOM   540  C  CE2   . TRP A 1 67  ? 37.264 8.176   15.962  1.00 27.33 ? 64   TRP A CE2   1 
ATOM   541  C  CE3   . TRP A 1 67  ? 38.345 9.968   14.745  1.00 18.36 ? 64   TRP A CE3   1 
ATOM   542  C  CZ2   . TRP A 1 67  ? 36.403 7.906   14.892  1.00 25.73 ? 64   TRP A CZ2   1 
ATOM   543  C  CZ3   . TRP A 1 67  ? 37.486 9.700   13.685  1.00 21.17 ? 64   TRP A CZ3   1 
ATOM   544  C  CH2   . TRP A 1 67  ? 36.530 8.679   13.769  1.00 21.56 ? 64   TRP A CH2   1 
ATOM   545  N  N     . ALA A 1 68  ? 42.555 11.974  16.501  1.00 11.93 ? 65   ALA A N     1 
ATOM   546  C  CA    . ALA A 1 68  ? 43.611 12.920  16.859  1.00 14.37 ? 65   ALA A CA    1 
ATOM   547  C  C     . ALA A 1 68  ? 43.488 13.389  18.306  1.00 13.11 ? 65   ALA A C     1 
ATOM   548  O  O     . ALA A 1 68  ? 44.504 13.623  18.974  1.00 12.47 ? 65   ALA A O     1 
ATOM   549  C  CB    . ALA A 1 68  ? 43.617 14.115  15.918  1.00 14.67 ? 65   ALA A CB    1 
ATOM   550  N  N     . ASP A 1 69  ? 42.259 13.548  18.784  1.00 13.98 ? 66   ASP A N     1 
ATOM   551  C  CA    . ASP A 1 69  ? 42.071 13.975  20.181  1.00 14.14 ? 66   ASP A CA    1 
ATOM   552  C  C     . ASP A 1 69  ? 42.667 12.950  21.151  1.00 13.24 ? 66   ASP A C     1 
ATOM   553  O  O     . ASP A 1 69  ? 43.182 13.313  22.218  1.00 14.05 ? 66   ASP A O     1 
ATOM   554  C  CB    . ASP A 1 69  ? 40.601 14.222  20.520  1.00 14.50 ? 66   ASP A CB    1 
ATOM   555  C  CG    . ASP A 1 69  ? 40.030 15.471  19.848  1.00 22.09 ? 66   ASP A CG    1 
ATOM   556  O  OD1   . ASP A 1 69  ? 40.799 16.331  19.351  1.00 22.59 ? 66   ASP A OD1   1 
ATOM   557  O  OD2   . ASP A 1 69  ? 38.791 15.591  19.836  1.00 25.98 ? 66   ASP A OD2   1 
ATOM   558  N  N     . ASP A 1 70  ? 42.590 11.671  20.786  1.00 13.57 ? 67   ASP A N     1 
ATOM   559  C  CA    . ASP A 1 70  ? 43.133 10.595  21.614  1.00 12.60 ? 67   ASP A CA    1 
ATOM   560  C  C     . ASP A 1 70  ? 44.643 10.496  21.453  1.00 13.52 ? 67   ASP A C     1 
ATOM   561  O  O     . ASP A 1 70  ? 45.385 10.320  22.420  1.00 12.95 ? 67   ASP A O     1 
ATOM   562  C  CB    . ASP A 1 70  ? 42.452 9.265   21.250  1.00 10.96 ? 67   ASP A CB    1 
ATOM   563  C  CG    . ASP A 1 70  ? 40.971 9.252   21.626  1.00 23.48 ? 67   ASP A CG    1 
ATOM   564  O  OD1   . ASP A 1 70  ? 40.601 9.938   22.608  1.00 23.68 ? 67   ASP A OD1   1 
ATOM   565  O  OD2   . ASP A 1 70  ? 40.178 8.572   20.936  1.00 22.99 ? 67   ASP A OD2   1 
ATOM   566  N  N     . ALA A 1 71  ? 45.110 10.637  20.218  1.00 11.08 ? 68   ALA A N     1 
ATOM   567  C  CA    . ALA A 1 71  ? 46.538 10.694  19.973  1.00 12.08 ? 68   ALA A CA    1 
ATOM   568  C  C     . ALA A 1 71  ? 47.213 11.809  20.793  1.00 11.70 ? 68   ALA A C     1 
ATOM   569  O  O     . ALA A 1 71  ? 48.338 11.649  21.253  1.00 12.16 ? 68   ALA A O     1 
ATOM   570  C  CB    . ALA A 1 71  ? 46.810 10.891  18.486  1.00 16.28 ? 68   ALA A CB    1 
ATOM   571  N  N     . LYS A 1 72  ? 46.522 12.932  20.955  1.00 10.67 ? 69   LYS A N     1 
ATOM   572  C  CA    . LYS A 1 72  ? 47.043 14.088  21.691  1.00 10.59 ? 69   LYS A CA    1 
ATOM   573  C  C     . LYS A 1 72  ? 47.182 13.790  23.176  1.00 14.22 ? 69   LYS A C     1 
ATOM   574  O  O     . LYS A 1 72  ? 47.949 14.435  23.881  1.00 15.05 ? 69   LYS A O     1 
ATOM   575  C  CB    . LYS A 1 72  ? 46.119 15.294  21.503  1.00 14.42 ? 69   LYS A CB    1 
ATOM   576  C  CG    . LYS A 1 72  ? 46.414 16.127  20.260  1.00 17.53 ? 69   LYS A CG    1 
ATOM   577  C  CD    . LYS A 1 72  ? 47.693 16.947  20.480  1.00 21.22 ? 69   LYS A CD    1 
ATOM   578  C  CE    . LYS A 1 72  ? 47.910 17.972  19.388  1.00 22.20 ? 69   LYS A CE    1 
ATOM   579  N  NZ    . LYS A 1 72  ? 49.093 18.857  19.688  1.00 18.13 ? 69   LYS A NZ    1 
ATOM   580  N  N     . LYS A 1 73  ? 46.424 12.812  23.654  1.00 14.90 ? 70   LYS A N     1 
ATOM   581  C  CA    . LYS A 1 73  ? 46.554 12.381  25.043  1.00 11.92 ? 70   LYS A CA    1 
ATOM   582  C  C     . LYS A 1 73  ? 47.866 11.621  25.240  1.00 17.51 ? 70   LYS A C     1 
ATOM   583  O  O     . LYS A 1 73  ? 48.470 11.683  26.306  1.00 15.75 ? 70   LYS A O     1 
ATOM   584  C  CB    . LYS A 1 73  ? 45.346 11.520  25.434  1.00 8.55  ? 70   LYS A CB    1 
ATOM   585  C  CG    . LYS A 1 73  ? 44.021 12.212  25.235  1.00 10.51 ? 70   LYS A CG    1 
ATOM   586  C  CD    . LYS A 1 73  ? 42.844 11.248  25.450  1.00 13.67 ? 70   LYS A CD    1 
ATOM   587  C  CE    . LYS A 1 73  ? 41.502 11.985  25.257  1.00 14.14 ? 70   LYS A CE    1 
ATOM   588  N  NZ    . LYS A 1 73  ? 40.347 11.040  25.228  1.00 26.18 ? 70   LYS A NZ    1 
ATOM   589  N  N     . LEU A 1 74  ? 48.313 10.905  24.210  1.00 11.02 ? 71   LEU A N     1 
ATOM   590  C  CA    . LEU A 1 74  ? 49.578 10.171  24.302  1.00 15.72 ? 71   LEU A CA    1 
ATOM   591  C  C     . LEU A 1 74  ? 50.766 11.064  23.973  1.00 16.65 ? 71   LEU A C     1 
ATOM   592  O  O     . LEU A 1 74  ? 51.884 10.839  24.444  1.00 17.17 ? 71   LEU A O     1 
ATOM   593  C  CB    . LEU A 1 74  ? 49.592 8.987   23.335  1.00 12.08 ? 71   LEU A CB    1 
ATOM   594  C  CG    . LEU A 1 74  ? 48.527 7.902   23.454  1.00 16.83 ? 71   LEU A CG    1 
ATOM   595  C  CD1   . LEU A 1 74  ? 48.825 6.851   22.394  1.00 14.46 ? 71   LEU A CD1   1 
ATOM   596  C  CD2   . LEU A 1 74  ? 48.535 7.274   24.834  1.00 10.88 ? 71   LEU A CD2   1 
ATOM   597  N  N     . CYS A 1 75  ? 50.513 12.070  23.143  1.00 11.61 ? 72   CYS A N     1 
ATOM   598  C  CA    . CYS A 1 75  ? 51.577 12.878  22.567  1.00 11.16 ? 72   CYS A CA    1 
ATOM   599  C  C     . CYS A 1 75  ? 51.085 14.309  22.437  1.00 17.01 ? 72   CYS A C     1 
ATOM   600  O  O     . CYS A 1 75  ? 50.592 14.714  21.382  1.00 16.48 ? 72   CYS A O     1 
ATOM   601  C  CB    . CYS A 1 75  ? 51.966 12.290  21.211  1.00 15.59 ? 72   CYS A CB    1 
ATOM   602  S  SG    . CYS A 1 75  ? 53.353 13.120  20.401  1.00 20.64 ? 72   CYS A SG    1 
ATOM   603  N  N     . PRO A 1 76  ? 51.172 15.072  23.539  1.00 15.31 ? 73   PRO A N     1 
ATOM   604  C  CA    . PRO A 1 76  ? 50.641 16.437  23.630  1.00 18.20 ? 73   PRO A CA    1 
ATOM   605  C  C     . PRO A 1 76  ? 51.206 17.367  22.560  1.00 14.47 ? 73   PRO A C     1 
ATOM   606  O  O     . PRO A 1 76  ? 50.487 18.252  22.087  1.00 21.60 ? 73   PRO A O     1 
ATOM   607  C  CB    . PRO A 1 76  ? 51.078 16.887  25.033  1.00 19.92 ? 73   PRO A CB    1 
ATOM   608  C  CG    . PRO A 1 76  ? 51.168 15.611  25.813  1.00 21.05 ? 73   PRO A CG    1 
ATOM   609  C  CD    . PRO A 1 76  ? 51.645 14.564  24.841  1.00 18.64 ? 73   PRO A CD    1 
ATOM   610  N  N     . ASP A 1 77  ? 52.459 17.163  22.170  1.00 15.76 ? 74   ASP A N     1 
ATOM   611  C  CA    . ASP A 1 77  ? 53.094 18.041  21.191  1.00 20.82 ? 74   ASP A CA    1 
ATOM   612  C  C     . ASP A 1 77  ? 52.987 17.498  19.770  1.00 18.25 ? 74   ASP A C     1 
ATOM   613  O  O     . ASP A 1 77  ? 53.702 17.959  18.877  1.00 16.58 ? 74   ASP A O     1 
ATOM   614  C  CB    . ASP A 1 77  ? 54.568 18.242  21.531  1.00 21.25 ? 74   ASP A CB    1 
ATOM   615  C  CG    . ASP A 1 77  ? 54.769 18.875  22.894  1.00 39.69 ? 74   ASP A CG    1 
ATOM   616  O  OD1   . ASP A 1 77  ? 55.635 18.381  23.649  1.00 39.70 ? 74   ASP A OD1   1 
ATOM   617  O  OD2   . ASP A 1 77  ? 54.056 19.857  23.210  1.00 34.75 ? 74   ASP A OD2   1 
ATOM   618  N  N     . LEU A 1 78  ? 52.113 16.518  19.567  1.00 13.10 ? 75   LEU A N     1 
ATOM   619  C  CA    . LEU A 1 78  ? 51.907 15.953  18.234  1.00 10.87 ? 75   LEU A CA    1 
ATOM   620  C  C     . LEU A 1 78  ? 51.540 17.067  17.265  1.00 10.95 ? 75   LEU A C     1 
ATOM   621  O  O     . LEU A 1 78  ? 50.649 17.861  17.542  1.00 13.26 ? 75   LEU A O     1 
ATOM   622  C  CB    . LEU A 1 78  ? 50.777 14.926  18.260  1.00 14.65 ? 75   LEU A CB    1 
ATOM   623  C  CG    . LEU A 1 78  ? 50.460 14.180  16.959  1.00 10.96 ? 75   LEU A CG    1 
ATOM   624  C  CD1   . LEU A 1 78  ? 51.600 13.233  16.603  1.00 10.97 ? 75   LEU A CD1   1 
ATOM   625  C  CD2   . LEU A 1 78  ? 49.149 13.406  17.119  1.00 12.23 ? 75   LEU A CD2   1 
ATOM   626  N  N     . LEU A 1 79  ? 52.210 17.121  16.122  1.00 8.71  ? 76   LEU A N     1 
ATOM   627  C  CA    . LEU A 1 79  ? 51.817 18.068  15.084  1.00 9.18  ? 76   LEU A CA    1 
ATOM   628  C  C     . LEU A 1 79  ? 50.942 17.348  14.053  1.00 14.45 ? 76   LEU A C     1 
ATOM   629  O  O     . LEU A 1 79  ? 51.103 16.159  13.815  1.00 10.95 ? 76   LEU A O     1 
ATOM   630  C  CB    . LEU A 1 79  ? 53.040 18.690  14.415  1.00 9.04  ? 76   LEU A CB    1 
ATOM   631  C  CG    . LEU A 1 79  ? 54.006 19.415  15.356  1.00 12.32 ? 76   LEU A CG    1 
ATOM   632  C  CD1   . LEU A 1 79  ? 55.217 19.985  14.615  1.00 13.86 ? 76   LEU A CD1   1 
ATOM   633  C  CD2   . LEU A 1 79  ? 53.296 20.497  16.169  1.00 13.36 ? 76   LEU A CD2   1 
ATOM   634  N  N     . LEU A 1 80  ? 50.017 18.080  13.445  1.00 14.52 ? 77   LEU A N     1 
ATOM   635  C  CA    . LEU A 1 80  ? 49.070 17.474  12.523  1.00 13.05 ? 77   LEU A CA    1 
ATOM   636  C  C     . LEU A 1 80  ? 49.105 18.201  11.179  1.00 14.19 ? 77   LEU A C     1 
ATOM   637  O  O     . LEU A 1 80  ? 49.321 19.408  11.115  1.00 18.62 ? 77   LEU A O     1 
ATOM   638  C  CB    . LEU A 1 80  ? 47.657 17.507  13.115  1.00 13.83 ? 77   LEU A CB    1 
ATOM   639  C  CG    . LEU A 1 80  ? 47.502 16.759  14.429  1.00 12.80 ? 77   LEU A CG    1 
ATOM   640  C  CD1   . LEU A 1 80  ? 46.081 16.917  14.967  1.00 18.44 ? 77   LEU A CD1   1 
ATOM   641  C  CD2   . LEU A 1 80  ? 47.870 15.288  14.212  1.00 13.85 ? 77   LEU A CD2   1 
ATOM   642  N  N     . ALA A 1 81  ? 48.927 17.446  10.106  1.00 10.46 ? 78   ALA A N     1 
ATOM   643  C  CA    . ALA A 1 81  ? 48.648 18.023  8.801   1.00 11.37 ? 78   ALA A CA    1 
ATOM   644  C  C     . ALA A 1 81  ? 47.337 17.406  8.353   1.00 13.02 ? 78   ALA A C     1 
ATOM   645  O  O     . ALA A 1 81  ? 47.110 16.227  8.579   1.00 14.03 ? 78   ALA A O     1 
ATOM   646  C  CB    . ALA A 1 81  ? 49.771 17.691  7.828   1.00 13.76 ? 78   ALA A CB    1 
ATOM   647  N  N     . GLN A 1 82  ? 46.463 18.201  7.744   1.00 13.41 ? 79   GLN A N     1 
ATOM   648  C  CA    . GLN A 1 82  ? 45.142 17.724  7.346   1.00 14.36 ? 79   GLN A CA    1 
ATOM   649  C  C     . GLN A 1 82  ? 45.106 17.408  5.869   1.00 10.48 ? 79   GLN A C     1 
ATOM   650  O  O     . GLN A 1 82  ? 45.655 18.160  5.069   1.00 12.66 ? 79   GLN A O     1 
ATOM   651  C  CB    . GLN A 1 82  ? 44.094 18.806  7.588   1.00 16.41 ? 79   GLN A CB    1 
ATOM   652  C  CG    . GLN A 1 82  ? 43.898 19.184  9.016   1.00 27.22 ? 79   GLN A CG    1 
ATOM   653  C  CD    . GLN A 1 82  ? 42.756 20.152  9.156   1.00 34.97 ? 79   GLN A CD    1 
ATOM   654  O  OE1   . GLN A 1 82  ? 42.958 21.312  9.491   1.00 28.97 ? 79   GLN A OE1   1 
ATOM   655  N  NE2   . GLN A 1 82  ? 41.545 19.685  8.871   1.00 29.06 ? 79   GLN A NE2   1 
ATOM   656  N  N     . VAL A 1 83  ? 44.439 16.312  5.517   1.00 10.28 ? 80   VAL A N     1 
ATOM   657  C  CA    . VAL A 1 83  ? 44.183 15.980  4.123   1.00 10.20 ? 80   VAL A CA    1 
ATOM   658  C  C     . VAL A 1 83  ? 43.286 17.062  3.549   1.00 14.12 ? 80   VAL A C     1 
ATOM   659  O  O     . VAL A 1 83  ? 42.378 17.542  4.208   1.00 11.21 ? 80   VAL A O     1 
ATOM   660  C  CB    . VAL A 1 83  ? 43.472 14.623  3.988   1.00 9.39  ? 80   VAL A CB    1 
ATOM   661  C  CG1   . VAL A 1 83  ? 43.017 14.380  2.555   1.00 12.97 ? 80   VAL A CG1   1 
ATOM   662  C  CG2   . VAL A 1 83  ? 44.386 13.490  4.486   1.00 13.78 ? 80   VAL A CG2   1 
ATOM   663  N  N     . ARG A 1 84  ? 43.562 17.448  2.314   1.00 12.57 ? 81   ARG A N     1 
ATOM   664  C  CA    . ARG A 1 84  ? 42.800 18.491  1.655   1.00 11.88 ? 81   ARG A CA    1 
ATOM   665  C  C     . ARG A 1 84  ? 41.353 18.056  1.504   1.00 12.80 ? 81   ARG A C     1 
ATOM   666  O  O     . ARG A 1 84  ? 41.055 16.869  1.361   1.00 12.37 ? 81   ARG A O     1 
ATOM   667  C  CB    . ARG A 1 84  ? 43.423 18.771  0.291   1.00 16.09 ? 81   ARG A CB    1 
ATOM   668  C  CG    . ARG A 1 84  ? 42.563 19.603  -0.651  1.00 21.10 ? 81   ARG A CG    1 
ATOM   669  C  CD    . ARG A 1 84  ? 43.341 19.924  -1.915  1.00 36.90 ? 81   ARG A CD    1 
ATOM   670  N  NE    . ARG A 1 84  ? 42.468 20.201  -3.052  1.00 48.29 ? 81   ARG A NE    1 
ATOM   671  C  CZ    . ARG A 1 84  ? 42.900 20.340  -4.302  1.00 54.57 ? 81   ARG A CZ    1 
ATOM   672  N  NH1   . ARG A 1 84  ? 44.196 20.229  -4.568  1.00 42.49 ? 81   ARG A NH1   1 
ATOM   673  N  NH2   . ARG A 1 84  ? 42.040 20.586  -5.286  1.00 48.37 ? 81   ARG A NH2   1 
ATOM   674  N  N     . GLU A 1 85  ? 40.454 19.026  1.549   1.00 11.59 ? 82   GLU A N     1 
ATOM   675  C  CA    . GLU A 1 85  ? 39.054 18.765  1.317   1.00 12.78 ? 82   GLU A CA    1 
ATOM   676  C  C     . GLU A 1 85  ? 38.622 19.534  0.086   1.00 15.88 ? 82   GLU A C     1 
ATOM   677  O  O     . GLU A 1 85  ? 38.893 20.723  -0.027  1.00 15.88 ? 82   GLU A O     1 
ATOM   678  C  CB    . GLU A 1 85  ? 38.217 19.177  2.526   1.00 17.03 ? 82   GLU A CB    1 
ATOM   679  C  CG    . GLU A 1 85  ? 38.128 18.092  3.588   1.00 27.05 ? 82   GLU A CG    1 
ATOM   680  C  CD    . GLU A 1 85  ? 37.356 18.536  4.823   1.00 38.82 ? 82   GLU A CD    1 
ATOM   681  O  OE1   . GLU A 1 85  ? 36.124 18.766  4.730   1.00 28.66 ? 82   GLU A OE1   1 
ATOM   682  O  OE2   . GLU A 1 85  ? 37.994 18.658  5.890   1.00 41.80 ? 82   GLU A OE2   1 
ATOM   683  N  N     . SER A 1 86  ? 37.950 18.836  -0.825  1.00 16.74 ? 83   SER A N     1 
ATOM   684  C  CA    . SER A 1 86  ? 37.373 19.431  -2.014  1.00 12.02 ? 83   SER A CA    1 
ATOM   685  C  C     . SER A 1 86  ? 35.998 18.825  -2.234  1.00 17.42 ? 83   SER A C     1 
ATOM   686  O  O     . SER A 1 86  ? 35.810 17.624  -2.068  1.00 18.32 ? 83   SER A O     1 
ATOM   687  C  CB    . SER A 1 86  ? 38.246 19.174  -3.243  1.00 17.40 ? 83   SER A CB    1 
ATOM   688  O  OG    . SER A 1 86  ? 39.545 19.700  -3.055  1.00 25.85 ? 83   SER A OG    1 
ATOM   689  N  N     . ARG A 1 87  ? 35.041 19.665  -2.597  1.00 18.86 ? 84   ARG A N     1 
ATOM   690  C  CA    . ARG A 1 87  ? 33.669 19.215  -2.832  1.00 21.11 ? 84   ARG A CA    1 
ATOM   691  C  C     . ARG A 1 87  ? 33.064 18.445  -1.661  1.00 17.58 ? 84   ARG A C     1 
ATOM   692  O  O     . ARG A 1 87  ? 32.274 17.523  -1.858  1.00 23.66 ? 84   ARG A O     1 
ATOM   693  C  CB    . ARG A 1 87  ? 33.584 18.394  -4.120  1.00 21.55 ? 84   ARG A CB    1 
ATOM   694  C  CG    . ARG A 1 87  ? 33.996 19.163  -5.361  1.00 24.58 ? 84   ARG A CG    1 
ATOM   695  C  CD    . ARG A 1 87  ? 33.793 18.336  -6.621  1.00 24.92 ? 84   ARG A CD    1 
ATOM   696  N  NE    . ARG A 1 87  ? 35.043 18.191  -7.353  1.00 29.75 ? 84   ARG A NE    1 
ATOM   697  C  CZ    . ARG A 1 87  ? 35.393 18.943  -8.390  1.00 35.37 ? 84   ARG A CZ    1 
ATOM   698  N  NH1   . ARG A 1 87  ? 34.574 19.888  -8.841  1.00 38.04 ? 84   ARG A NH1   1 
ATOM   699  N  NH2   . ARG A 1 87  ? 36.561 18.742  -8.982  1.00 35.78 ? 84   ARG A NH2   1 
ATOM   700  N  N     . GLY A 1 88  ? 33.424 18.833  -0.442  1.00 16.29 ? 85   GLY A N     1 
ATOM   701  C  CA    . GLY A 1 88  ? 32.862 18.232  0.753   1.00 17.85 ? 85   GLY A CA    1 
ATOM   702  C  C     . GLY A 1 88  ? 33.490 16.920  1.194   1.00 20.41 ? 85   GLY A C     1 
ATOM   703  O  O     . GLY A 1 88  ? 33.003 16.289  2.139   1.00 18.36 ? 85   GLY A O     1 
ATOM   704  N  N     . LYS A 1 89  ? 34.560 16.496  0.517   1.00 12.43 ? 86   LYS A N     1 
ATOM   705  C  CA    . LYS A 1 89  ? 35.174 15.206  0.815   1.00 13.25 ? 86   LYS A CA    1 
ATOM   706  C  C     . LYS A 1 89  ? 36.702 15.264  0.819   1.00 12.49 ? 86   LYS A C     1 
ATOM   707  O  O     . LYS A 1 89  ? 37.303 16.141  0.205   1.00 14.05 ? 86   LYS A O     1 
ATOM   708  C  CB    . LYS A 1 89  ? 34.705 14.140  -0.179  1.00 19.00 ? 86   LYS A CB    1 
ATOM   709  C  CG    . LYS A 1 89  ? 35.179 14.347  -1.611  1.00 18.48 ? 86   LYS A CG    1 
ATOM   710  C  CD    . LYS A 1 89  ? 34.696 13.220  -2.547  1.00 20.62 ? 86   LYS A CD    1 
ATOM   711  C  CE    . LYS A 1 89  ? 35.345 11.876  -2.227  1.00 16.62 ? 86   LYS A CE    1 
ATOM   712  N  NZ    . LYS A 1 89  ? 36.821 11.884  -2.448  1.00 16.94 ? 86   LYS A NZ    1 
ATOM   713  N  N     . ALA A 1 90  ? 37.331 14.315  1.499   1.00 15.93 ? 87   ALA A N     1 
ATOM   714  C  CA    . ALA A 1 90  ? 38.786 14.241  1.481   1.00 14.38 ? 87   ALA A CA    1 
ATOM   715  C  C     . ALA A 1 90  ? 39.257 14.023  0.056   1.00 20.11 ? 87   ALA A C     1 
ATOM   716  O  O     . ALA A 1 90  ? 38.651 13.266  -0.698  1.00 19.72 ? 87   ALA A O     1 
ATOM   717  C  CB    . ALA A 1 90  ? 39.283 13.120  2.382   1.00 19.27 ? 87   ALA A CB    1 
ATOM   718  N  N     . ASN A 1 91  ? 40.334 14.707  -0.308  1.00 12.34 ? 88   ASN A N     1 
ATOM   719  C  CA    . ASN A 1 91  ? 40.894 14.603  -1.643  1.00 15.72 ? 88   ASN A CA    1 
ATOM   720  C  C     . ASN A 1 91  ? 42.358 14.189  -1.571  1.00 15.76 ? 88   ASN A C     1 
ATOM   721  O  O     . ASN A 1 91  ? 43.179 14.899  -0.998  1.00 15.78 ? 88   ASN A O     1 
ATOM   722  C  CB    . ASN A 1 91  ? 40.758 15.940  -2.356  1.00 15.91 ? 88   ASN A CB    1 
ATOM   723  C  CG    . ASN A 1 91  ? 41.155 15.855  -3.808  1.00 25.55 ? 88   ASN A CG    1 
ATOM   724  O  OD1   . ASN A 1 91  ? 42.277 15.478  -4.127  1.00 15.51 ? 88   ASN A OD1   1 
ATOM   725  N  ND2   . ASN A 1 91  ? 40.221 16.162  -4.698  1.00 31.06 ? 88   ASN A ND2   1 
ATOM   726  N  N     . LEU A 1 92  ? 42.693 13.036  -2.141  1.00 12.57 ? 89   LEU A N     1 
ATOM   727  C  CA    . LEU A 1 92  ? 44.036 12.478  -1.940  1.00 14.05 ? 89   LEU A CA    1 
ATOM   728  C  C     . LEU A 1 92  ? 45.024 12.781  -3.068  1.00 13.52 ? 89   LEU A C     1 
ATOM   729  O  O     . LEU A 1 92  ? 46.073 12.141  -3.168  1.00 11.19 ? 89   LEU A O     1 
ATOM   730  C  CB    . LEU A 1 92  ? 43.957 10.967  -1.707  1.00 13.73 ? 89   LEU A CB    1 
ATOM   731  C  CG    . LEU A 1 92  ? 42.967 10.527  -0.631  1.00 12.77 ? 89   LEU A CG    1 
ATOM   732  C  CD1   . LEU A 1 92  ? 42.755 9.036   -0.695  1.00 18.94 ? 89   LEU A CD1   1 
ATOM   733  C  CD2   . LEU A 1 92  ? 43.456 10.976  0.740   1.00 19.37 ? 89   LEU A CD2   1 
ATOM   734  N  N     . THR A 1 93  ? 44.698 13.764  -3.901  1.00 13.14 ? 90   THR A N     1 
ATOM   735  C  CA    . THR A 1 93  ? 45.535 14.088  -5.063  1.00 13.01 ? 90   THR A CA    1 
ATOM   736  C  C     . THR A 1 93  ? 47.026 14.315  -4.757  1.00 13.73 ? 90   THR A C     1 
ATOM   737  O  O     . THR A 1 93  ? 47.900 13.794  -5.458  1.00 13.25 ? 90   THR A O     1 
ATOM   738  C  CB    . THR A 1 93  ? 44.941 15.277  -5.868  1.00 18.46 ? 90   THR A CB    1 
ATOM   739  O  OG1   . THR A 1 93  ? 43.598 14.956  -6.276  1.00 19.25 ? 90   THR A OG1   1 
ATOM   740  C  CG2   . THR A 1 93  ? 45.760 15.542  -7.100  1.00 10.16 ? 90   THR A CG2   1 
ATOM   741  N  N     . LYS A 1 94  ? 47.330 15.082  -3.719  1.00 13.00 ? 91   LYS A N     1 
ATOM   742  C  CA    . LYS A 1 94  ? 48.725 15.364  -3.404  1.00 13.83 ? 91   LYS A CA    1 
ATOM   743  C  C     . LYS A 1 94  ? 49.560 14.084  -3.208  1.00 11.71 ? 91   LYS A C     1 
ATOM   744  O  O     . LYS A 1 94  ? 50.725 14.024  -3.621  1.00 11.66 ? 91   LYS A O     1 
ATOM   745  C  CB    . LYS A 1 94  ? 48.817 16.241  -2.157  1.00 17.66 ? 91   LYS A CB    1 
ATOM   746  C  CG    . LYS A 1 94  ? 50.206 16.801  -1.916  1.00 13.76 ? 91   LYS A CG    1 
ATOM   747  C  CD    . LYS A 1 94  ? 50.345 17.294  -0.469  1.00 15.85 ? 91   LYS A CD    1 
ATOM   748  C  CE    . LYS A 1 94  ? 49.346 18.399  -0.167  1.00 18.01 ? 91   LYS A CE    1 
ATOM   749  N  NZ    . LYS A 1 94  ? 49.541 18.980  1.197   1.00 12.23 ? 91   LYS A NZ    1 
ATOM   750  N  N     . TYR A 1 95  ? 48.956 13.070  -2.593  1.00 8.92  ? 92   TYR A N     1 
ATOM   751  C  CA    . TYR A 1 95  ? 49.645 11.815  -2.286  1.00 9.36  ? 92   TYR A CA    1 
ATOM   752  C  C     . TYR A 1 95  ? 49.755 10.944  -3.518  1.00 10.58 ? 92   TYR A C     1 
ATOM   753  O  O     . TYR A 1 95  ? 50.786 10.314  -3.740  1.00 11.15 ? 92   TYR A O     1 
ATOM   754  C  CB    . TYR A 1 95  ? 48.952 11.076  -1.124  1.00 8.42  ? 92   TYR A CB    1 
ATOM   755  C  CG    . TYR A 1 95  ? 48.652 12.062  -0.027  1.00 5.80  ? 92   TYR A CG    1 
ATOM   756  C  CD1   . TYR A 1 95  ? 47.357 12.516  0.185   1.00 11.66 ? 92   TYR A CD1   1 
ATOM   757  C  CD2   . TYR A 1 95  ? 49.683 12.623  0.723   1.00 10.61 ? 92   TYR A CD2   1 
ATOM   758  C  CE1   . TYR A 1 95  ? 47.087 13.469  1.148   1.00 12.37 ? 92   TYR A CE1   1 
ATOM   759  C  CE2   . TYR A 1 95  ? 49.423 13.555  1.686   1.00 10.02 ? 92   TYR A CE2   1 
ATOM   760  C  CZ    . TYR A 1 95  ? 48.119 13.983  1.890   1.00 13.66 ? 92   TYR A CZ    1 
ATOM   761  O  OH    . TYR A 1 95  ? 47.847 14.941  2.840   1.00 14.07 ? 92   TYR A OH    1 
ATOM   762  N  N     . ARG A 1 96  ? 48.701 10.931  -4.332  1.00 8.80  ? 93   ARG A N     1 
ATOM   763  C  CA    . ARG A 1 96  ? 48.768 10.227  -5.615  1.00 12.28 ? 93   ARG A CA    1 
ATOM   764  C  C     . ARG A 1 96  ? 49.875 10.792  -6.516  1.00 13.07 ? 93   ARG A C     1 
ATOM   765  O  O     . ARG A 1 96  ? 50.613 10.030  -7.142  1.00 13.08 ? 93   ARG A O     1 
ATOM   766  C  CB    . ARG A 1 96  ? 47.418 10.226  -6.332  1.00 13.38 ? 93   ARG A CB    1 
ATOM   767  C  CG    . ARG A 1 96  ? 46.346 9.401   -5.622  1.00 14.43 ? 93   ARG A CG    1 
ATOM   768  C  CD    . ARG A 1 96  ? 45.122 9.160   -6.503  1.00 13.74 ? 93   ARG A CD    1 
ATOM   769  N  NE    . ARG A 1 96  ? 44.078 8.482   -5.743  1.00 18.41 ? 93   ARG A NE    1 
ATOM   770  C  CZ    . ARG A 1 96  ? 43.022 9.074   -5.190  1.00 17.32 ? 93   ARG A CZ    1 
ATOM   771  N  NH1   . ARG A 1 96  ? 42.161 8.334   -4.492  1.00 15.86 ? 93   ARG A NH1   1 
ATOM   772  N  NH2   . ARG A 1 96  ? 42.820 10.385  -5.325  1.00 15.87 ? 93   ARG A NH2   1 
ATOM   773  N  N     . GLU A 1 97  ? 50.003 12.115  -6.574  1.00 11.75 ? 94   GLU A N     1 
ATOM   774  C  CA    . GLU A 1 97  ? 51.031 12.747  -7.410  1.00 10.81 ? 94   GLU A CA    1 
ATOM   775  C  C     . GLU A 1 97  ? 52.442 12.479  -6.874  1.00 11.65 ? 94   GLU A C     1 
ATOM   776  O  O     . GLU A 1 97  ? 53.363 12.220  -7.648  1.00 12.27 ? 94   GLU A O     1 
ATOM   777  C  CB    . GLU A 1 97  ? 50.744 14.243  -7.591  1.00 14.84 ? 94   GLU A CB    1 
ATOM   778  C  CG    . GLU A 1 97  ? 49.403 14.476  -8.282  1.00 17.40 ? 94   GLU A CG    1 
ATOM   779  C  CD    . GLU A 1 97  ? 49.090 15.933  -8.579  1.00 27.51 ? 94   GLU A CD    1 
ATOM   780  O  OE1   . GLU A 1 97  ? 49.805 16.832  -8.086  1.00 38.46 ? 94   GLU A OE1   1 
ATOM   781  O  OE2   . GLU A 1 97  ? 48.107 16.176  -9.313  1.00 34.05 ? 94   GLU A OE2   1 
ATOM   782  N  N     . ALA A 1 98  ? 52.600 12.506  -5.552  1.00 11.90 ? 95   ALA A N     1 
ATOM   783  C  CA    . ALA A 1 98  ? 53.874 12.146  -4.937  1.00 11.47 ? 95   ALA A CA    1 
ATOM   784  C  C     . ALA A 1 98  ? 54.249 10.683  -5.218  1.00 8.34  ? 95   ALA A C     1 
ATOM   785  O  O     . ALA A 1 98  ? 55.425 10.360  -5.427  1.00 12.09 ? 95   ALA A O     1 
ATOM   786  C  CB    . ALA A 1 98  ? 53.841 12.421  -3.443  1.00 10.13 ? 95   ALA A CB    1 
ATOM   787  N  N     . SER A 1 99  ? 53.249 9.807   -5.238  1.00 11.35 ? 96   SER A N     1 
ATOM   788  C  CA    . SER A 1 99  ? 53.457 8.398   -5.563  1.00 11.98 ? 96   SER A CA    1 
ATOM   789  C  C     . SER A 1 99  ? 53.987 8.226   -6.986  1.00 8.95  ? 96   SER A C     1 
ATOM   790  O  O     . SER A 1 99  ? 54.899 7.430   -7.246  1.00 11.24 ? 96   SER A O     1 
ATOM   791  C  CB    . SER A 1 99  ? 52.145 7.625   -5.417  1.00 11.99 ? 96   SER A CB    1 
ATOM   792  O  OG    . SER A 1 99  ? 52.334 6.253   -5.691  1.00 16.31 ? 96   SER A OG    1 
ATOM   793  N  N     . VAL A 1 100 ? 53.397 8.973   -7.910  1.00 10.92 ? 97   VAL A N     1 
ATOM   794  C  CA    . VAL A 1 100 ? 53.862 8.948   -9.292  1.00 10.64 ? 97   VAL A CA    1 
ATOM   795  C  C     . VAL A 1 100 ? 55.342 9.333   -9.375  1.00 13.18 ? 97   VAL A C     1 
ATOM   796  O  O     . VAL A 1 100 ? 56.099 8.707   -10.117 1.00 12.95 ? 97   VAL A O     1 
ATOM   797  C  CB    . VAL A 1 100 ? 52.995 9.844   -10.192 1.00 15.63 ? 97   VAL A CB    1 
ATOM   798  C  CG1   . VAL A 1 100 ? 53.632 9.992   -11.581 1.00 18.09 ? 97   VAL A CG1   1 
ATOM   799  C  CG2   . VAL A 1 100 ? 51.584 9.265   -10.300 1.00 16.17 ? 97   VAL A CG2   1 
ATOM   800  N  N     . GLU A 1 101 ? 55.757 10.344  -8.606  1.00 10.80 ? 98   GLU A N     1 
ATOM   801  C  CA    . GLU A 1 101 ? 57.164 10.778  -8.577  1.00 12.42 ? 98   GLU A CA    1 
ATOM   802  C  C     . GLU A 1 101 ? 58.069 9.598   -8.267  1.00 13.01 ? 98   GLU A C     1 
ATOM   803  O  O     . GLU A 1 101 ? 59.089 9.381   -8.935  1.00 12.71 ? 98   GLU A O     1 
ATOM   804  C  CB    . GLU A 1 101 ? 57.412 11.842  -7.493  1.00 13.56 ? 98   GLU A CB    1 
ATOM   805  C  CG    . GLU A 1 101 ? 56.949 13.269  -7.794  1.00 18.48 ? 98   GLU A CG    1 
ATOM   806  C  CD    . GLU A 1 101 ? 57.331 14.255  -6.678  1.00 18.74 ? 98   GLU A CD    1 
ATOM   807  O  OE1   . GLU A 1 101 ? 58.524 14.636  -6.588  1.00 14.73 ? 98   GLU A OE1   1 
ATOM   808  O  OE2   . GLU A 1 101 ? 56.438 14.644  -5.888  1.00 20.29 ? 98   GLU A OE2   1 
ATOM   809  N  N     . VAL A 1 102 ? 57.696 8.845   -7.235  1.00 10.85 ? 99   VAL A N     1 
ATOM   810  C  CA    . VAL A 1 102 ? 58.522 7.736   -6.791  1.00 10.35 ? 99   VAL A CA    1 
ATOM   811  C  C     . VAL A 1 102 ? 58.507 6.577   -7.776  1.00 10.85 ? 99   VAL A C     1 
ATOM   812  O  O     . VAL A 1 102 ? 59.563 6.023   -8.091  1.00 12.67 ? 99   VAL A O     1 
ATOM   813  C  CB    . VAL A 1 102 ? 58.104 7.235   -5.394  1.00 11.90 ? 99   VAL A CB    1 
ATOM   814  C  CG1   . VAL A 1 102 ? 58.833 5.930   -5.059  1.00 16.24 ? 99   VAL A CG1   1 
ATOM   815  C  CG2   . VAL A 1 102 ? 58.399 8.318   -4.366  1.00 12.20 ? 99   VAL A CG2   1 
ATOM   816  N  N     . MET A 1 103 ? 57.321 6.227   -8.271  1.00 10.65 ? 100  MET A N     1 
ATOM   817  C  CA    . MET A 1 103 ? 57.185 5.096   -9.188  1.00 10.93 ? 100  MET A CA    1 
ATOM   818  C  C     . MET A 1 103 ? 57.979 5.323   -10.481 1.00 16.48 ? 100  MET A C     1 
ATOM   819  O  O     . MET A 1 103 ? 58.579 4.388   -11.019 1.00 12.21 ? 100  MET A O     1 
ATOM   820  C  CB    . MET A 1 103 ? 55.710 4.802   -9.492  1.00 15.15 ? 100  MET A CB    1 
ATOM   821  C  CG    A MET A 1 103 ? 54.835 4.620   -8.241  0.43 18.67 ? 100  MET A CG    1 
ATOM   822  C  CG    B MET A 1 103 ? 54.879 4.497   -8.266  0.57 18.73 ? 100  MET A CG    1 
ATOM   823  S  SD    A MET A 1 103 ? 54.479 2.910   -7.764  0.43 17.48 ? 100  MET A SD    1 
ATOM   824  S  SD    B MET A 1 103 ? 55.446 2.990   -7.474  0.57 18.03 ? 100  MET A SD    1 
ATOM   825  C  CE    A MET A 1 103 ? 53.813 3.139   -6.113  0.43 14.08 ? 100  MET A CE    1 
ATOM   826  C  CE    B MET A 1 103 ? 54.555 3.044   -5.915  0.57 13.35 ? 100  MET A CE    1 
ATOM   827  N  N     . GLU A 1 104 ? 57.998 6.562   -10.965 1.00 11.91 ? 101  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 104 ? 58.741 6.887   -12.184 1.00 12.66 ? 101  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 104 ? 60.257 6.747   -11.996 1.00 12.49 ? 101  GLU A C     1 
ATOM   830  O  O     . GLU A 1 104 ? 60.946 6.261   -12.883 1.00 13.23 ? 101  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 104 ? 58.349 8.275   -12.715 1.00 15.06 ? 101  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 104 ? 56.928 8.296   -13.269 1.00 18.26 ? 101  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 104 ? 56.539 9.624   -13.909 1.00 35.49 ? 101  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 104 ? 57.264 10.627  -13.724 1.00 32.82 ? 101  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 104 ? 55.495 9.658   -14.593 1.00 30.33 ? 101  GLU A OE2   1 
ATOM   836  N  N     . ILE A 1 105 ? 60.770 7.133   -10.830 1.00 13.40 ? 102  ILE A N     1 
ATOM   837  C  CA    . ILE A 1 105 ? 62.178 6.899   -10.514 1.00 8.21  ? 102  ILE A CA    1 
ATOM   838  C  C     . ILE A 1 105 ? 62.487 5.395   -10.459 1.00 9.84  ? 102  ILE A C     1 
ATOM   839  O  O     . ILE A 1 105 ? 63.437 4.935   -11.078 1.00 13.36 ? 102  ILE A O     1 
ATOM   840  C  CB    . ILE A 1 105 ? 62.609 7.611   -9.204  1.00 9.90  ? 102  ILE A CB    1 
ATOM   841  C  CG1   . ILE A 1 105 ? 62.492 9.128   -9.371  1.00 9.75  ? 102  ILE A CG1   1 
ATOM   842  C  CG2   . ILE A 1 105 ? 64.039 7.211   -8.779  1.00 14.07 ? 102  ILE A CG2   1 
ATOM   843  C  CD1   . ILE A 1 105 ? 62.530 9.885   -8.051  1.00 15.44 ? 102  ILE A CD1   1 
ATOM   844  N  N     . MET A 1 106 ? 61.690 4.627   -9.721  1.00 9.77  ? 103  MET A N     1 
ATOM   845  C  CA    . MET A 1 106 ? 61.933 3.186   -9.645  1.00 11.44 ? 103  MET A CA    1 
ATOM   846  C  C     . MET A 1 106 ? 61.919 2.512   -11.014 1.00 12.73 ? 103  MET A C     1 
ATOM   847  O  O     . MET A 1 106 ? 62.699 1.603   -11.276 1.00 13.02 ? 103  MET A O     1 
ATOM   848  C  CB    . MET A 1 106 ? 60.910 2.508   -8.732  1.00 11.93 ? 103  MET A CB    1 
ATOM   849  C  CG    . MET A 1 106 ? 61.133 2.838   -7.287  1.00 12.39 ? 103  MET A CG    1 
ATOM   850  S  SD    . MET A 1 106 ? 59.935 1.977   -6.260  1.00 19.56 ? 103  MET A SD    1 
ATOM   851  C  CE    . MET A 1 106 ? 58.444 2.669   -6.895  1.00 21.51 ? 103  MET A CE    1 
ATOM   852  N  N     . SER A 1 107 ? 61.024 2.956   -11.882 1.00 10.58 ? 104  SER A N     1 
ATOM   853  C  CA    . SER A 1 107 ? 60.918 2.374   -13.212 1.00 12.46 ? 104  SER A CA    1 
ATOM   854  C  C     . SER A 1 107 ? 62.192 2.512   -14.052 1.00 17.15 ? 104  SER A C     1 
ATOM   855  O  O     . SER A 1 107 ? 62.343 1.800   -15.044 1.00 13.82 ? 104  SER A O     1 
ATOM   856  C  CB    . SER A 1 107 ? 59.736 2.990   -13.960 1.00 17.93 ? 104  SER A CB    1 
ATOM   857  O  OG    . SER A 1 107 ? 58.524 2.576   -13.369 1.00 27.16 ? 104  SER A OG    1 
ATOM   858  N  N     . ARG A 1 108 ? 63.094 3.417   -13.674 1.00 13.31 ? 105  ARG A N     1 
ATOM   859  C  CA    . ARG A 1 108 ? 64.348 3.585   -14.426 1.00 15.33 ? 105  ARG A CA    1 
ATOM   860  C  C     . ARG A 1 108 ? 65.269 2.396   -14.179 1.00 25.22 ? 105  ARG A C     1 
ATOM   861  O  O     . ARG A 1 108 ? 66.118 2.072   -15.005 1.00 19.35 ? 105  ARG A O     1 
ATOM   862  C  CB    . ARG A 1 108 ? 65.099 4.862   -14.031 1.00 17.96 ? 105  ARG A CB    1 
ATOM   863  C  CG    . ARG A 1 108 ? 64.343 6.167   -14.219 1.00 19.29 ? 105  ARG A CG    1 
ATOM   864  C  CD    . ARG A 1 108 ? 65.295 7.347   -14.392 1.00 22.00 ? 105  ARG A CD    1 
ATOM   865  N  NE    . ARG A 1 108 ? 66.355 7.409   -13.387 1.00 20.91 ? 105  ARG A NE    1 
ATOM   866  C  CZ    . ARG A 1 108 ? 66.361 8.252   -12.357 1.00 18.44 ? 105  ARG A CZ    1 
ATOM   867  N  NH1   . ARG A 1 108 ? 67.368 8.250   -11.492 1.00 21.67 ? 105  ARG A NH1   1 
ATOM   868  N  NH2   . ARG A 1 108 ? 65.361 9.102   -12.197 1.00 19.01 ? 105  ARG A NH2   1 
ATOM   869  N  N     . PHE A 1 109 ? 65.104 1.750   -13.032 1.00 16.02 ? 106  PHE A N     1 
ATOM   870  C  CA    . PHE A 1 109 ? 65.998 0.662   -12.661 1.00 19.23 ? 106  PHE A CA    1 
ATOM   871  C  C     . PHE A 1 109 ? 65.487 -0.682  -13.144 1.00 22.40 ? 106  PHE A C     1 
ATOM   872  O  O     . PHE A 1 109 ? 66.266 -1.565  -13.515 1.00 27.99 ? 106  PHE A O     1 
ATOM   873  C  CB    . PHE A 1 109 ? 66.215 0.650   -11.147 1.00 18.20 ? 106  PHE A CB    1 
ATOM   874  C  CG    . PHE A 1 109 ? 66.955 1.850   -10.635 1.00 19.17 ? 106  PHE A CG    1 
ATOM   875  C  CD1   . PHE A 1 109 ? 66.297 3.059   -10.445 1.00 13.92 ? 106  PHE A CD1   1 
ATOM   876  C  CD2   . PHE A 1 109 ? 68.304 1.773   -10.342 1.00 15.09 ? 106  PHE A CD2   1 
ATOM   877  C  CE1   . PHE A 1 109 ? 66.975 4.169   -9.975  1.00 15.50 ? 106  PHE A CE1   1 
ATOM   878  C  CE2   . PHE A 1 109 ? 68.994 2.879   -9.864  1.00 19.50 ? 106  PHE A CE2   1 
ATOM   879  C  CZ    . PHE A 1 109 ? 68.331 4.083   -9.678  1.00 14.97 ? 106  PHE A CZ    1 
ATOM   880  N  N     . ALA A 1 110 ? 64.172 -0.834  -13.155 1.00 22.96 ? 107  ALA A N     1 
ATOM   881  C  CA    . ALA A 1 110 ? 63.586 -2.111  -13.507 1.00 21.09 ? 107  ALA A CA    1 
ATOM   882  C  C     . ALA A 1 110 ? 62.080 -2.040  -13.625 1.00 20.71 ? 107  ALA A C     1 
ATOM   883  O  O     . ALA A 1 110 ? 61.456 -1.034  -13.289 1.00 21.32 ? 107  ALA A O     1 
ATOM   884  C  CB    . ALA A 1 110 ? 63.971 -3.165  -12.485 1.00 25.45 ? 107  ALA A CB    1 
ATOM   885  N  N     . VAL A 1 111 ? 61.514 -3.134  -14.117 1.00 23.60 ? 108  VAL A N     1 
ATOM   886  C  CA    . VAL A 1 111 ? 60.076 -3.312  -14.223 1.00 32.11 ? 108  VAL A CA    1 
ATOM   887  C  C     . VAL A 1 111 ? 59.469 -3.350  -12.833 1.00 19.99 ? 108  VAL A C     1 
ATOM   888  O  O     . VAL A 1 111 ? 59.971 -4.055  -11.949 1.00 24.49 ? 108  VAL A O     1 
ATOM   889  C  CB    . VAL A 1 111 ? 59.756 -4.632  -14.941 1.00 29.33 ? 108  VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 111 ? 58.294 -5.020  -14.748 1.00 28.87 ? 108  VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 111 ? 60.114 -4.525  -16.420 1.00 38.36 ? 108  VAL A CG2   1 
ATOM   892  N  N     . ILE A 1 112 ? 58.406 -2.579  -12.625 1.00 20.95 ? 109  ILE A N     1 
ATOM   893  C  CA    . ILE A 1 112 ? 57.777 -2.556  -11.310 1.00 16.56 ? 109  ILE A CA    1 
ATOM   894  C  C     . ILE A 1 112 ? 56.299 -2.907  -11.379 1.00 15.70 ? 109  ILE A C     1 
ATOM   895  O  O     . ILE A 1 112 ? 55.655 -2.734  -12.416 1.00 13.82 ? 109  ILE A O     1 
ATOM   896  C  CB    . ILE A 1 112 ? 57.965 -1.187  -10.594 1.00 21.14 ? 109  ILE A CB    1 
ATOM   897  C  CG1   . ILE A 1 112 ? 57.089 -0.118  -11.243 1.00 19.00 ? 109  ILE A CG1   1 
ATOM   898  C  CG2   . ILE A 1 112 ? 59.453 -0.770  -10.586 1.00 19.81 ? 109  ILE A CG2   1 
ATOM   899  C  CD1   . ILE A 1 112 ? 56.955 1.182   -10.419 1.00 20.36 ? 109  ILE A CD1   1 
ATOM   900  N  N     . GLU A 1 113 ? 55.786 -3.439  -10.270 1.00 11.22 ? 110  GLU A N     1 
ATOM   901  C  CA    . GLU A 1 113 ? 54.357 -3.648  -10.077 1.00 12.15 ? 110  GLU A CA    1 
ATOM   902  C  C     . GLU A 1 113 ? 53.914 -2.738  -8.945  1.00 12.38 ? 110  GLU A C     1 
ATOM   903  O  O     . GLU A 1 113 ? 54.372 -2.884  -7.811  1.00 11.08 ? 110  GLU A O     1 
ATOM   904  C  CB    . GLU A 1 113 ? 54.050 -5.120  -9.731  1.00 14.15 ? 110  GLU A CB    1 
ATOM   905  C  CG    . GLU A 1 113 ? 52.571 -5.379  -9.420  1.00 12.19 ? 110  GLU A CG    1 
ATOM   906  C  CD    . GLU A 1 113 ? 52.270 -6.824  -9.000  1.00 22.80 ? 110  GLU A CD    1 
ATOM   907  O  OE1   . GLU A 1 113 ? 51.179 -7.078  -8.437  1.00 27.15 ? 110  GLU A OE1   1 
ATOM   908  O  OE2   . GLU A 1 113 ? 53.107 -7.711  -9.234  1.00 16.16 ? 110  GLU A OE2   1 
ATOM   909  N  N     . ARG A 1 114 ? 53.038 -1.784  -9.257  1.00 14.13 ? 111  ARG A N     1 
ATOM   910  C  CA    . ARG A 1 114 ? 52.489 -0.891  -8.235  1.00 14.15 ? 111  ARG A CA    1 
ATOM   911  C  C     . ARG A 1 114 ? 51.587 -1.703  -7.313  1.00 16.08 ? 111  ARG A C     1 
ATOM   912  O  O     . ARG A 1 114 ? 50.567 -2.246  -7.738  1.00 18.22 ? 111  ARG A O     1 
ATOM   913  C  CB    . ARG A 1 114 ? 51.709 0.261   -8.881  1.00 15.64 ? 111  ARG A CB    1 
ATOM   914  C  CG    . ARG A 1 114 ? 51.138 1.272   -7.888  1.00 14.05 ? 111  ARG A CG    1 
ATOM   915  C  CD    . ARG A 1 114 ? 49.989 2.045   -8.514  1.00 18.19 ? 111  ARG A CD    1 
ATOM   916  N  NE    . ARG A 1 114 ? 49.685 3.297   -7.826  1.00 23.04 ? 111  ARG A NE    1 
ATOM   917  C  CZ    . ARG A 1 114 ? 48.766 3.430   -6.875  1.00 23.51 ? 111  ARG A CZ    1 
ATOM   918  N  NH1   . ARG A 1 114 ? 48.063 2.377   -6.470  1.00 23.04 ? 111  ARG A NH1   1 
ATOM   919  N  NH2   . ARG A 1 114 ? 48.559 4.617   -6.318  1.00 19.97 ? 111  ARG A NH2   1 
ATOM   920  N  N     . ALA A 1 115 ? 51.977 -1.806  -6.048  1.00 12.59 ? 112  ALA A N     1 
ATOM   921  C  CA    . ALA A 1 115 ? 51.264 -2.664  -5.123  1.00 15.18 ? 112  ALA A CA    1 
ATOM   922  C  C     . ALA A 1 115 ? 50.270 -1.864  -4.296  1.00 21.82 ? 112  ALA A C     1 
ATOM   923  O  O     . ALA A 1 115 ? 49.287 -2.411  -3.790  1.00 20.99 ? 112  ALA A O     1 
ATOM   924  C  CB    . ALA A 1 115 ? 52.252 -3.382  -4.218  1.00 15.50 ? 112  ALA A CB    1 
ATOM   925  N  N     . SER A 1 116 ? 50.555 -0.574  -4.145  1.00 12.58 ? 113  SER A N     1 
ATOM   926  C  CA    . SER A 1 116 ? 49.685 0.354   -3.438  1.00 14.86 ? 113  SER A CA    1 
ATOM   927  C  C     . SER A 1 116 ? 50.192 1.770   -3.703  1.00 10.58 ? 113  SER A C     1 
ATOM   928  O  O     . SER A 1 116 ? 51.149 1.954   -4.443  1.00 13.05 ? 113  SER A O     1 
ATOM   929  C  CB    . SER A 1 116 ? 49.726 0.089   -1.936  1.00 16.19 ? 113  SER A CB    1 
ATOM   930  O  OG    . SER A 1 116 ? 50.941 0.561   -1.367  1.00 17.60 ? 113  SER A OG    1 
ATOM   931  N  N     . ILE A 1 117 ? 49.574 2.765   -3.070  1.00 11.14 ? 114  ILE A N     1 
ATOM   932  C  CA    . ILE A 1 117 ? 50.007 4.151   -3.238  1.00 9.55  ? 114  ILE A CA    1 
ATOM   933  C  C     . ILE A 1 117 ? 51.491 4.350   -2.865  1.00 13.75 ? 114  ILE A C     1 
ATOM   934  O  O     . ILE A 1 117 ? 52.148 5.232   -3.391  1.00 11.46 ? 114  ILE A O     1 
ATOM   935  C  CB    . ILE A 1 117 ? 49.103 5.134   -2.435  1.00 8.79  ? 114  ILE A CB    1 
ATOM   936  C  CG1   . ILE A 1 117 ? 49.243 6.564   -2.974  1.00 13.16 ? 114  ILE A CG1   1 
ATOM   937  C  CG2   . ILE A 1 117 ? 49.409 5.049   -0.952  1.00 17.10 ? 114  ILE A CG2   1 
ATOM   938  C  CD1   . ILE A 1 117 ? 48.047 7.474   -2.641  1.00 13.72 ? 114  ILE A CD1   1 
ATOM   939  N  N     . ASP A 1 118 ? 52.045 3.529   -1.974  1.00 8.60  ? 115  ASP A N     1 
ATOM   940  C  CA    . ASP A 1 118 ? 53.426 3.800   -1.583  1.00 11.73 ? 115  ASP A CA    1 
ATOM   941  C  C     . ASP A 1 118 ? 54.378 2.612   -1.640  1.00 14.45 ? 115  ASP A C     1 
ATOM   942  O  O     . ASP A 1 118 ? 55.457 2.631   -1.027  1.00 11.99 ? 115  ASP A O     1 
ATOM   943  C  CB    . ASP A 1 118 ? 53.459 4.417   -0.199  1.00 11.23 ? 115  ASP A CB    1 
ATOM   944  C  CG    . ASP A 1 118 ? 53.561 3.386   0.876   1.00 15.15 ? 115  ASP A CG    1 
ATOM   945  O  OD1   . ASP A 1 118 ? 54.366 3.640   1.785   1.00 12.94 ? 115  ASP A OD1   1 
ATOM   946  O  OD2   . ASP A 1 118 ? 52.872 2.326   0.813   1.00 16.39 ? 115  ASP A OD2   1 
ATOM   947  N  N     . GLU A 1 119 ? 54.011 1.582   -2.384  1.00 12.01 ? 116  GLU A N     1 
ATOM   948  C  CA    . GLU A 1 119 ? 54.935 0.470   -2.519  1.00 11.65 ? 116  GLU A CA    1 
ATOM   949  C  C     . GLU A 1 119 ? 54.890 -0.172  -3.873  1.00 12.14 ? 116  GLU A C     1 
ATOM   950  O  O     . GLU A 1 119 ? 53.852 -0.157  -4.558  1.00 11.32 ? 116  GLU A O     1 
ATOM   951  C  CB    . GLU A 1 119 ? 54.739 -0.565  -1.422  1.00 19.89 ? 116  GLU A CB    1 
ATOM   952  C  CG    . GLU A 1 119 ? 53.457 -1.299  -1.454  1.00 21.40 ? 116  GLU A CG    1 
ATOM   953  C  CD    . GLU A 1 119 ? 53.036 -1.735  -0.061  1.00 26.80 ? 116  GLU A CD    1 
ATOM   954  O  OE1   . GLU A 1 119 ? 53.319 -2.891  0.326   1.00 29.82 ? 116  GLU A OE1   1 
ATOM   955  O  OE2   . GLU A 1 119 ? 52.440 -0.904  0.652   1.00 32.05 ? 116  GLU A OE2   1 
ATOM   956  N  N     . ALA A 1 120 ? 56.039 -0.709  -4.263  1.00 10.23 ? 117  ALA A N     1 
ATOM   957  C  CA    . ALA A 1 120 ? 56.149 -1.390  -5.540  1.00 9.01  ? 117  ALA A CA    1 
ATOM   958  C  C     . ALA A 1 120 ? 57.054 -2.602  -5.421  1.00 11.90 ? 117  ALA A C     1 
ATOM   959  O  O     . ALA A 1 120 ? 58.061 -2.565  -4.715  1.00 11.09 ? 117  ALA A O     1 
ATOM   960  C  CB    . ALA A 1 120 ? 56.683 -0.443  -6.595  1.00 13.64 ? 117  ALA A CB    1 
ATOM   961  N  N     . TYR A 1 121 ? 56.687 -3.672  -6.117  1.00 10.37 ? 118  TYR A N     1 
ATOM   962  C  CA    . TYR A 1 121 ? 57.606 -4.783  -6.312  1.00 10.59 ? 118  TYR A CA    1 
ATOM   963  C  C     . TYR A 1 121 ? 58.484 -4.525  -7.507  1.00 14.83 ? 118  TYR A C     1 
ATOM   964  O  O     . TYR A 1 121 ? 58.065 -3.879  -8.466  1.00 13.87 ? 118  TYR A O     1 
ATOM   965  C  CB    . TYR A 1 121 ? 56.843 -6.085  -6.510  1.00 10.37 ? 118  TYR A CB    1 
ATOM   966  C  CG    . TYR A 1 121 ? 56.085 -6.498  -5.276  1.00 9.77  ? 118  TYR A CG    1 
ATOM   967  C  CD1   . TYR A 1 121 ? 54.759 -6.139  -5.102  1.00 8.99  ? 118  TYR A CD1   1 
ATOM   968  C  CD2   . TYR A 1 121 ? 56.710 -7.227  -4.265  1.00 11.72 ? 118  TYR A CD2   1 
ATOM   969  C  CE1   . TYR A 1 121 ? 54.058 -6.518  -3.958  1.00 14.79 ? 118  TYR A CE1   1 
ATOM   970  C  CE2   . TYR A 1 121 ? 56.018 -7.606  -3.119  1.00 11.30 ? 118  TYR A CE2   1 
ATOM   971  C  CZ    . TYR A 1 121 ? 54.703 -7.246  -2.971  1.00 18.92 ? 118  TYR A CZ    1 
ATOM   972  O  OH    . TYR A 1 121 ? 54.025 -7.629  -1.838  1.00 19.43 ? 118  TYR A OH    1 
ATOM   973  N  N     . VAL A 1 122 ? 59.700 -5.060  -7.445  1.00 9.98  ? 119  VAL A N     1 
ATOM   974  C  CA    . VAL A 1 122 ? 60.693 -4.869  -8.473  1.00 14.75 ? 119  VAL A CA    1 
ATOM   975  C  C     . VAL A 1 122 ? 61.236 -6.232  -8.864  1.00 12.82 ? 119  VAL A C     1 
ATOM   976  O  O     . VAL A 1 122 ? 61.674 -6.983  -8.007  1.00 11.98 ? 119  VAL A O     1 
ATOM   977  C  CB    . VAL A 1 122 ? 61.872 -4.040  -7.898  1.00 15.63 ? 119  VAL A CB    1 
ATOM   978  C  CG1   . VAL A 1 122 ? 62.788 -3.600  -8.995  1.00 19.65 ? 119  VAL A CG1   1 
ATOM   979  C  CG2   . VAL A 1 122 ? 61.351 -2.832  -7.106  1.00 19.81 ? 119  VAL A CG2   1 
ATOM   980  N  N     . ASP A 1 123 ? 61.230 -6.561  -10.150 1.00 15.19 ? 120  ASP A N     1 
ATOM   981  C  CA    . ASP A 1 123 ? 61.901 -7.778  -10.599 1.00 16.62 ? 120  ASP A CA    1 
ATOM   982  C  C     . ASP A 1 123 ? 63.338 -7.457  -11.006 1.00 18.24 ? 120  ASP A C     1 
ATOM   983  O  O     . ASP A 1 123 ? 63.574 -6.868  -12.051 1.00 17.70 ? 120  ASP A O     1 
ATOM   984  C  CB    . ASP A 1 123 ? 61.137 -8.399  -11.766 1.00 22.63 ? 120  ASP A CB    1 
ATOM   985  C  CG    . ASP A 1 123 ? 61.547 -9.828  -12.033 1.00 22.74 ? 120  ASP A CG    1 
ATOM   986  O  OD1   . ASP A 1 123 ? 62.761 -10.125 -11.992 1.00 20.02 ? 120  ASP A OD1   1 
ATOM   987  O  OD2   . ASP A 1 123 ? 60.648 -10.659 -12.286 1.00 42.36 ? 120  ASP A OD2   1 
ATOM   988  N  N     . LEU A 1 124 ? 64.302 -7.837  -10.178 1.00 13.40 ? 121  LEU A N     1 
ATOM   989  C  CA    . LEU A 1 124 ? 65.690 -7.434  -10.397 1.00 13.35 ? 121  LEU A CA    1 
ATOM   990  C  C     . LEU A 1 124 ? 66.543 -8.514  -11.069 1.00 10.87 ? 121  LEU A C     1 
ATOM   991  O  O     . LEU A 1 124 ? 67.749 -8.364  -11.206 1.00 11.44 ? 121  LEU A O     1 
ATOM   992  C  CB    . LEU A 1 124 ? 66.328 -7.046  -9.061  1.00 13.13 ? 121  LEU A CB    1 
ATOM   993  C  CG    . LEU A 1 124 ? 65.796 -5.779  -8.386  1.00 12.50 ? 121  LEU A CG    1 
ATOM   994  C  CD1   . LEU A 1 124 ? 66.361 -5.659  -6.992  1.00 17.11 ? 121  LEU A CD1   1 
ATOM   995  C  CD2   . LEU A 1 124 ? 66.154 -4.563  -9.237  1.00 20.32 ? 121  LEU A CD2   1 
ATOM   996  N  N     . THR A 1 125 ? 65.918 -9.613  -11.464 1.00 11.09 ? 122  THR A N     1 
ATOM   997  C  CA    . THR A 1 125 ? 66.680 -10.754 -11.961 1.00 11.02 ? 122  THR A CA    1 
ATOM   998  C  C     . THR A 1 125 ? 67.630 -10.373 -13.114 1.00 15.42 ? 122  THR A C     1 
ATOM   999  O  O     . THR A 1 125 ? 68.828 -10.678 -13.072 1.00 14.49 ? 122  THR A O     1 
ATOM   1000 C  CB    . THR A 1 125 ? 65.752 -11.900 -12.359 1.00 13.84 ? 122  THR A CB    1 
ATOM   1001 O  OG1   . THR A 1 125 ? 64.891 -12.203 -11.259 1.00 15.10 ? 122  THR A OG1   1 
ATOM   1002 C  CG2   . THR A 1 125 ? 66.557 -13.149 -12.770 1.00 15.85 ? 122  THR A CG2   1 
ATOM   1003 N  N     . SER A 1 126 ? 67.101 -9.683  -14.119 1.00 16.55 ? 123  SER A N     1 
ATOM   1004 C  CA    . SER A 1 126 ? 67.918 -9.289  -15.268 1.00 16.99 ? 123  SER A CA    1 
ATOM   1005 C  C     A SER A 1 126 ? 68.988 -8.261  -14.892 0.42 18.34 ? 123  SER A C     1 
ATOM   1006 C  C     B SER A 1 126 ? 68.989 -8.262  -14.891 0.58 18.33 ? 123  SER A C     1 
ATOM   1007 O  O     A SER A 1 126 ? 70.140 -8.372  -15.313 0.42 18.72 ? 123  SER A O     1 
ATOM   1008 O  O     B SER A 1 126 ? 70.142 -8.373  -15.309 0.58 18.68 ? 123  SER A O     1 
ATOM   1009 C  CB    . SER A 1 126 ? 67.042 -8.763  -16.409 1.00 22.82 ? 123  SER A CB    1 
ATOM   1010 O  OG    A SER A 1 126 ? 66.259 -9.802  -16.960 0.42 20.59 ? 123  SER A OG    1 
ATOM   1011 O  OG    B SER A 1 126 ? 66.415 -7.549  -16.052 0.58 25.10 ? 123  SER A OG    1 
ATOM   1012 N  N     . ALA A 1 127 ? 68.604 -7.268  -14.099 1.00 16.96 ? 124  ALA A N     1 
ATOM   1013 C  CA    . ALA A 1 127 ? 69.533 -6.229  -13.665 1.00 21.05 ? 124  ALA A CA    1 
ATOM   1014 C  C     . ALA A 1 127 ? 70.709 -6.819  -12.886 1.00 20.06 ? 124  ALA A C     1 
ATOM   1015 O  O     . ALA A 1 127 ? 71.845 -6.391  -13.047 1.00 16.64 ? 124  ALA A O     1 
ATOM   1016 C  CB    . ALA A 1 127 ? 68.807 -5.174  -12.825 1.00 14.34 ? 124  ALA A CB    1 
ATOM   1017 N  N     . VAL A 1 128 ? 70.431 -7.813  -12.043 1.00 15.91 ? 125  VAL A N     1 
ATOM   1018 C  CA    . VAL A 1 128 ? 71.483 -8.489  -11.293 1.00 16.00 ? 125  VAL A CA    1 
ATOM   1019 C  C     . VAL A 1 128 ? 72.469 -9.203  -12.226 1.00 17.56 ? 125  VAL A C     1 
ATOM   1020 O  O     . VAL A 1 128 ? 73.687 -9.092  -12.052 1.00 18.17 ? 125  VAL A O     1 
ATOM   1021 C  CB    . VAL A 1 128 ? 70.891 -9.489  -10.272 1.00 16.01 ? 125  VAL A CB    1 
ATOM   1022 C  CG1   . VAL A 1 128 ? 71.926 -10.538 -9.859  1.00 16.74 ? 125  VAL A CG1   1 
ATOM   1023 C  CG2   . VAL A 1 128 ? 70.374 -8.741  -9.055  1.00 13.32 ? 125  VAL A CG2   1 
ATOM   1024 N  N     . GLN A 1 129 ? 71.936 -9.912  -13.219 1.00 19.11 ? 126  GLN A N     1 
ATOM   1025 C  CA    . GLN A 1 129 ? 72.767 -10.599 -14.205 1.00 28.13 ? 126  GLN A CA    1 
ATOM   1026 C  C     . GLN A 1 129 ? 73.708 -9.618  -14.884 1.00 26.34 ? 126  GLN A C     1 
ATOM   1027 O  O     . GLN A 1 129 ? 74.913 -9.842  -14.942 1.00 27.64 ? 126  GLN A O     1 
ATOM   1028 C  CB    . GLN A 1 129 ? 71.907 -11.301 -15.260 1.00 26.20 ? 126  GLN A CB    1 
ATOM   1029 C  CG    . GLN A 1 129 ? 71.155 -12.521 -14.745 1.00 36.46 ? 126  GLN A CG    1 
ATOM   1030 C  CD    . GLN A 1 129 ? 72.075 -13.536 -14.087 1.00 49.46 ? 126  GLN A CD    1 
ATOM   1031 O  OE1   . GLN A 1 129 ? 72.021 -13.749 -12.872 1.00 46.95 ? 126  GLN A OE1   1 
ATOM   1032 N  NE2   . GLN A 1 129 ? 72.927 -14.168 -14.888 1.00 54.84 ? 126  GLN A NE2   1 
ATOM   1033 N  N     . GLU A 1 130 ? 73.146 -8.532  -15.403 1.00 23.56 ? 127  GLU A N     1 
ATOM   1034 C  CA    . GLU A 1 130 ? 73.948 -7.484  -16.021 1.00 31.70 ? 127  GLU A CA    1 
ATOM   1035 C  C     . GLU A 1 130 ? 75.076 -7.028  -15.103 1.00 29.12 ? 127  GLU A C     1 
ATOM   1036 O  O     . GLU A 1 130 ? 76.241 -7.014  -15.496 1.00 33.75 ? 127  GLU A O     1 
ATOM   1037 C  CB    . GLU A 1 130 ? 73.076 -6.280  -16.392 1.00 29.32 ? 127  GLU A CB    1 
ATOM   1038 C  CG    . GLU A 1 130 ? 72.034 -6.562  -17.461 1.00 42.79 ? 127  GLU A CG    1 
ATOM   1039 C  CD    . GLU A 1 130 ? 71.352 -5.293  -17.953 1.00 66.24 ? 127  GLU A CD    1 
ATOM   1040 O  OE1   . GLU A 1 130 ? 72.052 -4.418  -18.512 1.00 61.10 ? 127  GLU A OE1   1 
ATOM   1041 O  OE2   . GLU A 1 130 ? 70.118 -5.167  -17.776 1.00 63.36 ? 127  GLU A OE2   1 
ATOM   1042 N  N     . ARG A 1 131 ? 74.720 -6.652  -13.879 1.00 21.15 ? 128  ARG A N     1 
ATOM   1043 C  CA    . ARG A 1 131 ? 75.680 -6.093  -12.936 1.00 24.17 ? 128  ARG A CA    1 
ATOM   1044 C  C     . ARG A 1 131 ? 76.765 -7.109  -12.590 1.00 26.47 ? 128  ARG A C     1 
ATOM   1045 O  O     . ARG A 1 131 ? 77.924 -6.741  -12.377 1.00 27.98 ? 128  ARG A O     1 
ATOM   1046 C  CB    . ARG A 1 131 ? 74.953 -5.611  -11.677 1.00 20.31 ? 128  ARG A CB    1 
ATOM   1047 C  CG    A ARG A 1 131 ? 75.811 -4.873  -10.664 0.56 22.87 ? 128  ARG A CG    1 
ATOM   1048 C  CG    B ARG A 1 131 ? 75.864 -4.936  -10.659 0.44 22.90 ? 128  ARG A CG    1 
ATOM   1049 C  CD    A ARG A 1 131 ? 76.300 -3.543  -11.220 0.56 22.51 ? 128  ARG A CD    1 
ATOM   1050 C  CD    B ARG A 1 131 ? 76.546 -3.715  -11.267 0.44 22.74 ? 128  ARG A CD    1 
ATOM   1051 N  NE    A ARG A 1 131 ? 76.996 -2.763  -10.204 0.56 24.64 ? 128  ARG A NE    1 
ATOM   1052 N  NE    B ARG A 1 131 ? 75.562 -2.742  -11.723 0.44 22.37 ? 128  ARG A NE    1 
ATOM   1053 C  CZ    A ARG A 1 131 ? 76.405 -1.879  -9.406  0.56 19.26 ? 128  ARG A CZ    1 
ATOM   1054 C  CZ    B ARG A 1 131 ? 74.981 -1.855  -10.924 0.44 23.28 ? 128  ARG A CZ    1 
ATOM   1055 N  NH1   A ARG A 1 131 ? 77.120 -1.213  -8.507  0.56 18.28 ? 128  ARG A NH1   1 
ATOM   1056 N  NH1   B ARG A 1 131 ? 74.085 -1.008  -11.407 0.44 28.25 ? 128  ARG A NH1   1 
ATOM   1057 N  NH2   A ARG A 1 131 ? 75.101 -1.660  -9.511  0.56 23.06 ? 128  ARG A NH2   1 
ATOM   1058 N  NH2   B ARG A 1 131 ? 75.299 -1.816  -9.638  0.44 22.75 ? 128  ARG A NH2   1 
ATOM   1059 N  N     . LEU A 1 132 ? 76.396 -8.386  -12.541 1.00 20.44 ? 129  LEU A N     1 
ATOM   1060 C  CA    . LEU A 1 132 ? 77.369 -9.444  -12.276 1.00 21.66 ? 129  LEU A CA    1 
ATOM   1061 C  C     . LEU A 1 132 ? 78.434 -9.513  -13.375 1.00 36.52 ? 129  LEU A C     1 
ATOM   1062 O  O     . LEU A 1 132 ? 79.598 -9.815  -13.103 1.00 27.98 ? 129  LEU A O     1 
ATOM   1063 C  CB    . LEU A 1 132 ? 76.681 -10.803 -12.100 1.00 26.21 ? 129  LEU A CB    1 
ATOM   1064 C  CG    . LEU A 1 132 ? 76.227 -11.062 -10.662 1.00 28.63 ? 129  LEU A CG    1 
ATOM   1065 C  CD1   . LEU A 1 132 ? 75.309 -12.272 -10.563 1.00 24.51 ? 129  LEU A CD1   1 
ATOM   1066 C  CD2   . LEU A 1 132 ? 77.448 -11.214 -9.752  1.00 24.59 ? 129  LEU A CD2   1 
ATOM   1067 N  N     . GLN A 1 133 ? 78.031 -9.221  -14.609 1.00 35.74 ? 130  GLN A N     1 
ATOM   1068 C  CA    . GLN A 1 133 ? 78.964 -9.178  -15.734 1.00 34.00 ? 130  GLN A CA    1 
ATOM   1069 C  C     . GLN A 1 133 ? 79.976 -8.058  -15.585 1.00 42.25 ? 130  GLN A C     1 
ATOM   1070 O  O     . GLN A 1 133 ? 81.175 -8.267  -15.761 1.00 52.99 ? 130  GLN A O     1 
ATOM   1071 C  CB    . GLN A 1 133 ? 78.214 -9.027  -17.057 1.00 34.29 ? 130  GLN A CB    1 
ATOM   1072 C  CG    . GLN A 1 133 ? 77.178 -10.109 -17.317 1.00 48.88 ? 130  GLN A CG    1 
ATOM   1073 C  CD    . GLN A 1 133 ? 77.770 -11.508 -17.335 1.00 61.74 ? 130  GLN A CD    1 
ATOM   1074 O  OE1   . GLN A 1 133 ? 78.973 -11.693 -17.134 1.00 64.46 ? 130  GLN A OE1   1 
ATOM   1075 N  NE2   . GLN A 1 133 ? 76.922 -12.504 -17.580 1.00 65.25 ? 130  GLN A NE2   1 
ATOM   1076 N  N     . LYS A 1 134 ? 79.492 -6.866  -15.258 1.00 39.89 ? 131  LYS A N     1 
ATOM   1077 C  CA    . LYS A 1 134 ? 80.386 -5.733  -15.077 1.00 44.69 ? 131  LYS A CA    1 
ATOM   1078 C  C     . LYS A 1 134 ? 81.320 -5.992  -13.931 1.00 54.80 ? 131  LYS A C     1 
ATOM   1079 O  O     . LYS A 1 134 ? 82.441 -5.488  -13.889 1.00 56.36 ? 131  LYS A O     1 
ATOM   1080 C  CB    . LYS A 1 134 ? 79.605 -4.438  -14.820 1.00 50.35 ? 131  LYS A CB    1 
ATOM   1081 C  CG    . LYS A 1 134 ? 78.702 -4.001  -15.964 1.00 49.70 ? 131  LYS A CG    1 
ATOM   1082 C  CD    . LYS A 1 134 ? 78.225 -2.564  -15.778 1.00 59.06 ? 131  LYS A CD    1 
ATOM   1083 C  CE    . LYS A 1 134 ? 77.738 -2.314  -14.356 1.00 50.81 ? 131  LYS A CE    1 
ATOM   1084 N  NZ    . LYS A 1 134 ? 76.948 -1.049  -14.228 1.00 48.99 ? 131  LYS A NZ    1 
ATOM   1085 N  N     . LEU A 1 135 ? 80.848 -6.797  -12.996 1.00 45.71 ? 132  LEU A N     1 
ATOM   1086 C  CA    . LEU A 1 135 ? 81.606 -7.034  -11.799 1.00 50.41 ? 132  LEU A CA    1 
ATOM   1087 C  C     . LEU A 1 135 ? 82.887 -7.839  -12.027 1.00 58.39 ? 132  LEU A C     1 
ATOM   1088 O  O     . LEU A 1 135 ? 83.906 -7.586  -11.384 1.00 56.52 ? 132  LEU A O     1 
ATOM   1089 C  CB    . LEU A 1 135 ? 80.739 -7.677  -10.712 1.00 44.42 ? 132  LEU A CB    1 
ATOM   1090 C  CG    . LEU A 1 135 ? 80.408 -6.697  -9.584  1.00 47.72 ? 132  LEU A CG    1 
ATOM   1091 C  CD1   . LEU A 1 135 ? 80.060 -5.335  -10.163 1.00 47.86 ? 132  LEU A CD1   1 
ATOM   1092 C  CD2   . LEU A 1 135 ? 79.285 -7.221  -8.707  1.00 40.11 ? 132  LEU A CD2   1 
ATOM   1093 N  N     . GLN A 1 136 ? 82.829 -8.803  -12.939 1.00 53.67 ? 133  GLN A N     1 
ATOM   1094 C  CA    . GLN A 1 136 ? 84.012 -9.573  -13.317 1.00 62.85 ? 133  GLN A CA    1 
ATOM   1095 C  C     . GLN A 1 136 ? 84.666 -10.298 -12.148 1.00 58.78 ? 133  GLN A C     1 
ATOM   1096 O  O     . GLN A 1 136 ? 85.868 -10.161 -11.919 1.00 48.39 ? 133  GLN A O     1 
ATOM   1097 C  CB    . GLN A 1 136 ? 85.040 -8.673  -14.010 1.00 55.92 ? 133  GLN A CB    1 
ATOM   1098 C  CG    . GLN A 1 136 ? 84.548 -8.044  -15.305 1.00 64.62 ? 133  GLN A CG    1 
ATOM   1099 C  CD    . GLN A 1 136 ? 84.207 -9.073  -16.370 1.00 75.98 ? 133  GLN A CD    1 
ATOM   1100 O  OE1   . GLN A 1 136 ? 83.414 -9.990  -16.140 1.00 72.81 ? 133  GLN A OE1   1 
ATOM   1101 N  NE2   . GLN A 1 136 ? 84.810 -8.926  -17.543 1.00 78.34 ? 133  GLN A NE2   1 
ATOM   1102 N  N     . GLY A 1 137 ? 83.871 -11.073 -11.417 1.00 55.94 ? 134  GLY A N     1 
ATOM   1103 C  CA    . GLY A 1 137 ? 84.380 -11.851 -10.303 1.00 49.28 ? 134  GLY A CA    1 
ATOM   1104 C  C     . GLY A 1 137 ? 84.878 -10.984 -9.159  1.00 53.33 ? 134  GLY A C     1 
ATOM   1105 O  O     . GLY A 1 137 ? 85.438 -11.488 -8.187  1.00 51.51 ? 134  GLY A O     1 
ATOM   1106 N  N     . GLN A 1 138 ? 84.673 -9.676  -9.273  1.00 42.93 ? 135  GLN A N     1 
ATOM   1107 C  CA    . GLN A 1 138 ? 85.128 -8.744  -8.249  1.00 50.97 ? 135  GLN A CA    1 
ATOM   1108 C  C     . GLN A 1 138 ? 84.261 -8.835  -6.992  1.00 46.47 ? 135  GLN A C     1 
ATOM   1109 O  O     . GLN A 1 138 ? 83.036 -8.891  -7.081  1.00 44.48 ? 135  GLN A O     1 
ATOM   1110 C  CB    . GLN A 1 138 ? 85.124 -7.317  -8.794  1.00 53.02 ? 135  GLN A CB    1 
ATOM   1111 C  CG    . GLN A 1 138 ? 85.809 -6.303  -7.902  1.00 60.89 ? 135  GLN A CG    1 
ATOM   1112 C  CD    . GLN A 1 138 ? 85.841 -4.922  -8.524  1.00 70.36 ? 135  GLN A CD    1 
ATOM   1113 O  OE1   . GLN A 1 138 ? 85.394 -4.729  -9.656  1.00 71.49 ? 135  GLN A OE1   1 
ATOM   1114 N  NE2   . GLN A 1 138 ? 86.368 -3.951  -7.786  1.00 56.02 ? 135  GLN A NE2   1 
ATOM   1115 N  N     . PRO A 1 139 ? 84.900 -8.843  -5.812  1.00 44.20 ? 136  PRO A N     1 
ATOM   1116 C  CA    . PRO A 1 139 ? 84.183 -8.979  -4.541  1.00 40.10 ? 136  PRO A CA    1 
ATOM   1117 C  C     . PRO A 1 139 ? 83.288 -7.781  -4.270  1.00 41.24 ? 136  PRO A C     1 
ATOM   1118 O  O     . PRO A 1 139 ? 83.550 -6.690  -4.774  1.00 40.85 ? 136  PRO A O     1 
ATOM   1119 C  CB    . PRO A 1 139 ? 85.313 -9.030  -3.511  1.00 43.94 ? 136  PRO A CB    1 
ATOM   1120 C  CG    . PRO A 1 139 ? 86.430 -8.291  -4.153  1.00 42.96 ? 136  PRO A CG    1 
ATOM   1121 C  CD    . PRO A 1 139 ? 86.344 -8.637  -5.607  1.00 45.33 ? 136  PRO A CD    1 
ATOM   1122 N  N     . ILE A 1 140 ? 82.240 -7.989  -3.482  1.00 38.38 ? 137  ILE A N     1 
ATOM   1123 C  CA    . ILE A 1 140 ? 81.333 -6.908  -3.129  1.00 29.48 ? 137  ILE A CA    1 
ATOM   1124 C  C     . ILE A 1 140 ? 81.718 -6.304  -1.795  1.00 28.40 ? 137  ILE A C     1 
ATOM   1125 O  O     . ILE A 1 140 ? 81.750 -6.990  -0.775  1.00 29.57 ? 137  ILE A O     1 
ATOM   1126 C  CB    . ILE A 1 140 ? 79.877 -7.388  -3.068  1.00 25.36 ? 137  ILE A CB    1 
ATOM   1127 C  CG1   . ILE A 1 140 ? 79.478 -7.992  -4.417  1.00 30.50 ? 137  ILE A CG1   1 
ATOM   1128 C  CG2   . ILE A 1 140 ? 78.953 -6.235  -2.697  1.00 27.62 ? 137  ILE A CG2   1 
ATOM   1129 C  CD1   . ILE A 1 140 ? 78.080 -8.563  -4.452  1.00 31.68 ? 137  ILE A CD1   1 
ATOM   1130 N  N     . SER A 1 141 ? 82.009 -5.010  -1.813  1.00 28.20 ? 138  SER A N     1 
ATOM   1131 C  CA    . SER A 1 141 ? 82.438 -4.292  -0.622  1.00 27.23 ? 138  SER A CA    1 
ATOM   1132 C  C     . SER A 1 141 ? 81.251 -3.920  0.262   1.00 24.15 ? 138  SER A C     1 
ATOM   1133 O  O     . SER A 1 141 ? 80.165 -3.623  -0.245  1.00 21.68 ? 138  SER A O     1 
ATOM   1134 C  CB    . SER A 1 141 ? 83.205 -3.031  -1.037  1.00 30.34 ? 138  SER A CB    1 
ATOM   1135 O  OG    . SER A 1 141 ? 83.216 -2.061  -0.005  1.00 30.08 ? 138  SER A OG    1 
ATOM   1136 N  N     . ALA A 1 142 ? 81.461 -3.950  1.575   1.00 19.51 ? 139  ALA A N     1 
ATOM   1137 C  CA    . ALA A 1 142 ? 80.435 -3.540  2.531   1.00 19.87 ? 139  ALA A CA    1 
ATOM   1138 C  C     . ALA A 1 142 ? 80.014 -2.085  2.311   1.00 23.85 ? 139  ALA A C     1 
ATOM   1139 O  O     . ALA A 1 142 ? 78.887 -1.697  2.638   1.00 20.45 ? 139  ALA A O     1 
ATOM   1140 C  CB    . ALA A 1 142 ? 80.918 -3.738  3.955   1.00 24.78 ? 139  ALA A CB    1 
ATOM   1141 N  N     . ASP A 1 143 ? 80.925 -1.286  1.762   1.00 23.06 ? 140  ASP A N     1 
ATOM   1142 C  CA    . ASP A 1 143 ? 80.650 0.118   1.481   1.00 29.14 ? 140  ASP A CA    1 
ATOM   1143 C  C     . ASP A 1 143 ? 79.505 0.298   0.493   1.00 28.45 ? 140  ASP A C     1 
ATOM   1144 O  O     . ASP A 1 143 ? 78.866 1.347   0.466   1.00 24.89 ? 140  ASP A O     1 
ATOM   1145 C  CB    . ASP A 1 143 ? 81.906 0.815   0.948   1.00 30.23 ? 140  ASP A CB    1 
ATOM   1146 C  CG    . ASP A 1 143 ? 83.000 0.907   1.989   1.00 43.37 ? 140  ASP A CG    1 
ATOM   1147 O  OD1   . ASP A 1 143 ? 82.699 0.695   3.185   1.00 38.06 ? 140  ASP A OD1   1 
ATOM   1148 O  OD2   . ASP A 1 143 ? 84.158 1.197   1.614   1.00 59.45 ? 140  ASP A OD2   1 
ATOM   1149 N  N     . LEU A 1 144 ? 79.254 -0.725  -0.319  1.00 20.51 ? 141  LEU A N     1 
ATOM   1150 C  CA    . LEU A 1 144 ? 78.169 -0.684  -1.291  1.00 21.05 ? 141  LEU A CA    1 
ATOM   1151 C  C     . LEU A 1 144 ? 76.815 -1.028  -0.665  1.00 19.60 ? 141  LEU A C     1 
ATOM   1152 O  O     . LEU A 1 144 ? 75.785 -0.943  -1.325  1.00 19.60 ? 141  LEU A O     1 
ATOM   1153 C  CB    . LEU A 1 144 ? 78.456 -1.637  -2.445  1.00 17.31 ? 141  LEU A CB    1 
ATOM   1154 C  CG    . LEU A 1 144 ? 79.766 -1.367  -3.188  1.00 24.23 ? 141  LEU A CG    1 
ATOM   1155 C  CD1   . LEU A 1 144 ? 79.883 -2.239  -4.427  1.00 30.14 ? 141  LEU A CD1   1 
ATOM   1156 C  CD2   . LEU A 1 144 ? 79.846 0.100   -3.555  1.00 28.49 ? 141  LEU A CD2   1 
ATOM   1157 N  N     . LEU A 1 145 ? 76.832 -1.420  0.603   1.00 17.74 ? 142  LEU A N     1 
ATOM   1158 C  CA    . LEU A 1 145 ? 75.628 -1.875  1.289   1.00 18.80 ? 142  LEU A CA    1 
ATOM   1159 C  C     . LEU A 1 145 ? 75.461 -1.151  2.629   1.00 17.48 ? 142  LEU A C     1 
ATOM   1160 O  O     . LEU A 1 145 ? 75.304 -1.780  3.676   1.00 15.03 ? 142  LEU A O     1 
ATOM   1161 C  CB    . LEU A 1 145 ? 75.706 -3.399  1.484   1.00 16.48 ? 142  LEU A CB    1 
ATOM   1162 C  CG    . LEU A 1 145 ? 75.617 -4.243  0.205   1.00 15.11 ? 142  LEU A CG    1 
ATOM   1163 C  CD1   . LEU A 1 145 ? 76.111 -5.685  0.398   1.00 16.98 ? 142  LEU A CD1   1 
ATOM   1164 C  CD2   . LEU A 1 145 ? 74.195 -4.250  -0.331  1.00 13.92 ? 142  LEU A CD2   1 
ATOM   1165 N  N     . PRO A 1 146 ? 75.483 0.192   2.601   1.00 21.45 ? 143  PRO A N     1 
ATOM   1166 C  CA    . PRO A 1 146 ? 75.542 1.000   3.827   1.00 17.59 ? 143  PRO A CA    1 
ATOM   1167 C  C     . PRO A 1 146 ? 74.275 0.981   4.681   1.00 19.38 ? 143  PRO A C     1 
ATOM   1168 O  O     . PRO A 1 146 ? 74.323 1.407   5.827   1.00 18.80 ? 143  PRO A O     1 
ATOM   1169 C  CB    . PRO A 1 146 ? 75.800 2.417   3.295   1.00 24.79 ? 143  PRO A CB    1 
ATOM   1170 C  CG    . PRO A 1 146 ? 75.206 2.407   1.924   1.00 23.75 ? 143  PRO A CG    1 
ATOM   1171 C  CD    . PRO A 1 146 ? 75.500 1.030   1.388   1.00 16.12 ? 143  PRO A CD    1 
ATOM   1172 N  N     . SER A 1 147 ? 73.157 0.494   4.153   1.00 15.01 ? 144  SER A N     1 
ATOM   1173 C  CA    . SER A 1 147 ? 71.939 0.481   4.963   1.00 12.40 ? 144  SER A CA    1 
ATOM   1174 C  C     . SER A 1 147 ? 71.235 -0.878  4.937   1.00 13.85 ? 144  SER A C     1 
ATOM   1175 O  O     . SER A 1 147 ? 70.037 -0.958  5.212   1.00 9.94  ? 144  SER A O     1 
ATOM   1176 C  CB    . SER A 1 147 ? 70.978 1.597   4.536   1.00 19.64 ? 144  SER A CB    1 
ATOM   1177 O  OG    . SER A 1 147 ? 70.491 1.386   3.223   1.00 18.81 ? 144  SER A OG    1 
ATOM   1178 N  N     . THR A 1 148 ? 72.000 -1.929  4.645   1.00 14.11 ? 145  THR A N     1 
ATOM   1179 C  CA    . THR A 1 148 ? 71.465 -3.290  4.449   1.00 11.02 ? 145  THR A CA    1 
ATOM   1180 C  C     . THR A 1 148 ? 71.654 -4.175  5.675   1.00 10.81 ? 145  THR A C     1 
ATOM   1181 O  O     . THR A 1 148 ? 72.742 -4.209  6.274   1.00 14.88 ? 145  THR A O     1 
ATOM   1182 C  CB    . THR A 1 148 ? 72.163 -3.998  3.241   1.00 13.18 ? 145  THR A CB    1 
ATOM   1183 O  OG1   . THR A 1 148 ? 71.846 -3.311  2.029   1.00 10.95 ? 145  THR A OG1   1 
ATOM   1184 C  CG2   . THR A 1 148 ? 71.728 -5.459  3.116   1.00 10.76 ? 145  THR A CG2   1 
ATOM   1185 N  N     . TYR A 1 149 ? 70.592 -4.890  6.041   1.00 9.68  ? 146  TYR A N     1 
ATOM   1186 C  CA    . TYR A 1 149 ? 70.637 -5.895  7.096   1.00 10.33 ? 146  TYR A CA    1 
ATOM   1187 C  C     . TYR A 1 149 ? 70.566 -7.251  6.437   1.00 13.39 ? 146  TYR A C     1 
ATOM   1188 O  O     . TYR A 1 149 ? 69.799 -7.427  5.490   1.00 12.10 ? 146  TYR A O     1 
ATOM   1189 C  CB    . TYR A 1 149 ? 69.429 -5.764  8.007   1.00 15.29 ? 146  TYR A CB    1 
ATOM   1190 C  CG    . TYR A 1 149 ? 69.604 -4.715  9.064   1.00 14.82 ? 146  TYR A CG    1 
ATOM   1191 C  CD1   . TYR A 1 149 ? 70.062 -5.063  10.327  1.00 11.56 ? 146  TYR A CD1   1 
ATOM   1192 C  CD2   . TYR A 1 149 ? 69.318 -3.372  8.800   1.00 12.50 ? 146  TYR A CD2   1 
ATOM   1193 C  CE1   . TYR A 1 149 ? 70.225 -4.111  11.307  1.00 15.99 ? 146  TYR A CE1   1 
ATOM   1194 C  CE2   . TYR A 1 149 ? 69.492 -2.406  9.778   1.00 17.35 ? 146  TYR A CE2   1 
ATOM   1195 C  CZ    . TYR A 1 149 ? 69.944 -2.786  11.025  1.00 20.69 ? 146  TYR A CZ    1 
ATOM   1196 O  OH    . TYR A 1 149 ? 70.109 -1.851  12.012  1.00 25.89 ? 146  TYR A OH    1 
ATOM   1197 N  N     . ILE A 1 150 ? 71.349 -8.209  6.929   1.00 9.88  ? 147  ILE A N     1 
ATOM   1198 C  CA    . ILE A 1 150 ? 71.208 -9.598  6.479   1.00 10.36 ? 147  ILE A CA    1 
ATOM   1199 C  C     . ILE A 1 150 ? 70.454 -10.404 7.533   1.00 12.79 ? 147  ILE A C     1 
ATOM   1200 O  O     . ILE A 1 150 ? 70.977 -10.673 8.615   1.00 14.01 ? 147  ILE A O     1 
ATOM   1201 C  CB    . ILE A 1 150 ? 72.572 -10.275 6.242   1.00 11.62 ? 147  ILE A CB    1 
ATOM   1202 C  CG1   . ILE A 1 150 ? 73.469 -9.408  5.346   1.00 10.22 ? 147  ILE A CG1   1 
ATOM   1203 C  CG2   . ILE A 1 150 ? 72.363 -11.682 5.642   1.00 11.27 ? 147  ILE A CG2   1 
ATOM   1204 C  CD1   . ILE A 1 150 ? 72.934 -9.189  3.917   1.00 9.90  ? 147  ILE A CD1   1 
ATOM   1205 N  N     . GLU A 1 151 ? 69.219 -10.782 7.230   1.00 10.44 ? 148  GLU A N     1 
ATOM   1206 C  CA    . GLU A 1 151 ? 68.376 -11.419 8.229   1.00 11.23 ? 148  GLU A CA    1 
ATOM   1207 C  C     . GLU A 1 151 ? 69.005 -12.720 8.732   1.00 15.99 ? 148  GLU A C     1 
ATOM   1208 O  O     . GLU A 1 151 ? 69.448 -13.546 7.934   1.00 13.69 ? 148  GLU A O     1 
ATOM   1209 C  CB    . GLU A 1 151 ? 66.991 -11.709 7.652   1.00 15.08 ? 148  GLU A CB    1 
ATOM   1210 C  CG    . GLU A 1 151 ? 66.093 -12.513 8.599   1.00 14.51 ? 148  GLU A CG    1 
ATOM   1211 C  CD    . GLU A 1 151 ? 65.861 -11.815 9.919   1.00 22.38 ? 148  GLU A CD    1 
ATOM   1212 O  OE1   . GLU A 1 151 ? 65.567 -12.514 10.914  1.00 18.72 ? 148  GLU A OE1   1 
ATOM   1213 O  OE2   . GLU A 1 151 ? 65.954 -10.567 9.956   1.00 25.04 ? 148  GLU A OE2   1 
ATOM   1214 N  N     . GLY A 1 152 ? 69.050 -12.876 10.054  1.00 12.75 ? 149  GLY A N     1 
ATOM   1215 C  CA    . GLY A 1 152 ? 69.623 -14.052 10.681  1.00 15.32 ? 149  GLY A CA    1 
ATOM   1216 C  C     . GLY A 1 152 ? 71.081 -13.911 11.087  1.00 17.57 ? 149  GLY A C     1 
ATOM   1217 O  O     . GLY A 1 152 ? 71.618 -14.778 11.776  1.00 18.66 ? 149  GLY A O     1 
ATOM   1218 N  N     . LEU A 1 153 ? 71.731 -12.833 10.656  1.00 14.38 ? 150  LEU A N     1 
ATOM   1219 C  CA    . LEU A 1 153 ? 73.115 -12.566 11.058  1.00 13.47 ? 150  LEU A CA    1 
ATOM   1220 C  C     . LEU A 1 153 ? 73.198 -11.263 11.855  1.00 16.58 ? 150  LEU A C     1 
ATOM   1221 O  O     . LEU A 1 153 ? 72.331 -10.402 11.724  1.00 13.24 ? 150  LEU A O     1 
ATOM   1222 C  CB    . LEU A 1 153 ? 74.042 -12.514 9.841   1.00 10.70 ? 150  LEU A CB    1 
ATOM   1223 C  CG    . LEU A 1 153 ? 74.069 -13.766 8.972   1.00 16.27 ? 150  LEU A CG    1 
ATOM   1224 C  CD1   . LEU A 1 153 ? 74.972 -13.563 7.761   1.00 13.41 ? 150  LEU A CD1   1 
ATOM   1225 C  CD2   . LEU A 1 153 ? 74.488 -14.991 9.797   1.00 18.10 ? 150  LEU A CD2   1 
ATOM   1226 N  N     . PRO A 1 154 ? 74.237 -11.114 12.697  1.00 16.23 ? 151  PRO A N     1 
ATOM   1227 C  CA    . PRO A 1 154 ? 75.311 -12.089 12.919  1.00 15.13 ? 151  PRO A CA    1 
ATOM   1228 C  C     . PRO A 1 154 ? 74.852 -13.271 13.776  1.00 15.12 ? 151  PRO A C     1 
ATOM   1229 O  O     . PRO A 1 154 ? 73.841 -13.203 14.482  1.00 16.34 ? 151  PRO A O     1 
ATOM   1230 C  CB    . PRO A 1 154 ? 76.362 -11.280 13.690  1.00 15.84 ? 151  PRO A CB    1 
ATOM   1231 C  CG    . PRO A 1 154 ? 75.547 -10.243 14.423  1.00 19.90 ? 151  PRO A CG    1 
ATOM   1232 C  CD    . PRO A 1 154 ? 74.452 -9.870  13.458  1.00 16.97 ? 151  PRO A CD    1 
ATOM   1233 N  N     . GLN A 1 155 ? 75.614 -14.352 13.706  1.00 19.44 ? 152  GLN A N     1 
ATOM   1234 C  CA    . GLN A 1 155 ? 75.330 -15.546 14.469  1.00 27.03 ? 152  GLN A CA    1 
ATOM   1235 C  C     . GLN A 1 155 ? 76.645 -16.137 14.969  1.00 37.58 ? 152  GLN A C     1 
ATOM   1236 O  O     . GLN A 1 155 ? 77.715 -15.802 14.460  1.00 37.74 ? 152  GLN A O     1 
ATOM   1237 C  CB    . GLN A 1 155 ? 74.613 -16.563 13.585  1.00 30.09 ? 152  GLN A CB    1 
ATOM   1238 C  CG    . GLN A 1 155 ? 74.836 -17.993 14.022  1.00 41.27 ? 152  GLN A CG    1 
ATOM   1239 C  CD    . GLN A 1 155 ? 74.843 -18.951 12.858  1.00 37.31 ? 152  GLN A CD    1 
ATOM   1240 O  OE1   . GLN A 1 155 ? 73.791 -19.434 12.440  1.00 38.26 ? 152  GLN A OE1   1 
ATOM   1241 N  NE2   . GLN A 1 155 ? 76.027 -19.225 12.318  1.00 28.37 ? 152  GLN A NE2   1 
ATOM   1242 N  N     . GLY A 1 156 ? 76.564 -16.998 15.977  1.00 40.68 ? 153  GLY A N     1 
ATOM   1243 C  CA    . GLY A 1 156 ? 77.692 -17.828 16.361  1.00 49.01 ? 153  GLY A CA    1 
ATOM   1244 C  C     . GLY A 1 156 ? 78.673 -17.218 17.342  1.00 57.23 ? 153  GLY A C     1 
ATOM   1245 O  O     . GLY A 1 156 ? 78.389 -16.190 17.959  1.00 65.25 ? 153  GLY A O     1 
ATOM   1246 N  N     . PRO A 1 157 ? 79.842 -17.863 17.492  1.00 66.51 ? 154  PRO A N     1 
ATOM   1247 C  CA    . PRO A 1 157 ? 80.907 -17.470 18.420  1.00 62.59 ? 154  PRO A CA    1 
ATOM   1248 C  C     . PRO A 1 157 ? 81.869 -16.449 17.815  1.00 57.06 ? 154  PRO A C     1 
ATOM   1249 O  O     . PRO A 1 157 ? 82.073 -16.451 16.600  1.00 60.17 ? 154  PRO A O     1 
ATOM   1250 C  CB    . PRO A 1 157 ? 81.635 -18.790 18.674  1.00 55.39 ? 154  PRO A CB    1 
ATOM   1251 C  CG    . PRO A 1 157 ? 81.495 -19.530 17.383  1.00 40.12 ? 154  PRO A CG    1 
ATOM   1252 C  CD    . PRO A 1 157 ? 80.161 -19.124 16.794  1.00 51.94 ? 154  PRO A CD    1 
ATOM   1253 N  N     . THR A 1 163 ? 80.053 -5.763  20.682  1.00 66.38 ? 160  THR A N     1 
ATOM   1254 C  CA    . THR A 1 163 ? 79.298 -4.557  20.357  1.00 68.30 ? 160  THR A CA    1 
ATOM   1255 C  C     . THR A 1 163 ? 77.877 -4.634  20.903  1.00 61.95 ? 160  THR A C     1 
ATOM   1256 O  O     . THR A 1 163 ? 77.256 -5.699  20.917  1.00 63.72 ? 160  THR A O     1 
ATOM   1257 C  CB    . THR A 1 163 ? 79.225 -4.314  18.836  1.00 64.61 ? 160  THR A CB    1 
ATOM   1258 O  OG1   . THR A 1 163 ? 78.545 -3.078  18.578  1.00 58.41 ? 160  THR A OG1   1 
ATOM   1259 C  CG2   . THR A 1 163 ? 78.476 -5.446  18.156  1.00 54.30 ? 160  THR A CG2   1 
ATOM   1260 N  N     . VAL A 1 164 ? 77.364 -3.495  21.349  1.00 54.67 ? 161  VAL A N     1 
ATOM   1261 C  CA    . VAL A 1 164 ? 76.026 -3.439  21.916  1.00 54.68 ? 161  VAL A CA    1 
ATOM   1262 C  C     . VAL A 1 164 ? 75.195 -2.353  21.235  1.00 54.99 ? 161  VAL A C     1 
ATOM   1263 O  O     . VAL A 1 164 ? 74.150 -1.945  21.748  1.00 55.17 ? 161  VAL A O     1 
ATOM   1264 C  CB    . VAL A 1 164 ? 76.073 -3.187  23.442  1.00 58.17 ? 161  VAL A CB    1 
ATOM   1265 C  CG1   . VAL A 1 164 ? 76.887 -4.276  24.140  1.00 41.28 ? 161  VAL A CG1   1 
ATOM   1266 C  CG2   . VAL A 1 164 ? 76.651 -1.807  23.743  1.00 48.89 ? 161  VAL A CG2   1 
ATOM   1267 N  N     . GLN A 1 165 ? 75.668 -1.892  20.079  1.00 42.54 ? 162  GLN A N     1 
ATOM   1268 C  CA    . GLN A 1 165 ? 74.986 -0.849  19.315  1.00 43.22 ? 162  GLN A CA    1 
ATOM   1269 C  C     . GLN A 1 165 ? 74.317 -1.423  18.069  1.00 43.51 ? 162  GLN A C     1 
ATOM   1270 O  O     . GLN A 1 165 ? 74.739 -2.453  17.542  1.00 36.90 ? 162  GLN A O     1 
ATOM   1271 C  CB    . GLN A 1 165 ? 75.971 0.243   18.909  1.00 41.92 ? 162  GLN A CB    1 
ATOM   1272 C  CG    . GLN A 1 165 ? 77.141 -0.270  18.081  1.00 59.42 ? 162  GLN A CG    1 
ATOM   1273 C  CD    . GLN A 1 165 ? 78.175 0.803   17.794  1.00 66.08 ? 162  GLN A CD    1 
ATOM   1274 O  OE1   . GLN A 1 165 ? 78.027 1.952   18.215  1.00 76.32 ? 162  GLN A OE1   1 
ATOM   1275 N  NE2   . GLN A 1 165 ? 79.232 0.433   17.077  1.00 57.64 ? 162  GLN A NE2   1 
ATOM   1276 N  N     . LYS A 1 166 ? 73.276 -0.745  17.601  1.00 34.14 ? 163  LYS A N     1 
ATOM   1277 C  CA    . LYS A 1 166 ? 72.487 -1.229  16.475  1.00 37.56 ? 163  LYS A CA    1 
ATOM   1278 C  C     . LYS A 1 166 ? 73.276 -1.259  15.157  1.00 27.46 ? 163  LYS A C     1 
ATOM   1279 O  O     . LYS A 1 166 ? 73.254 -2.255  14.435  1.00 25.58 ? 163  LYS A O     1 
ATOM   1280 C  CB    . LYS A 1 166 ? 71.223 -0.381  16.324  1.00 36.52 ? 163  LYS A CB    1 
ATOM   1281 C  CG    . LYS A 1 166 ? 70.248 -0.882  15.278  1.00 36.96 ? 163  LYS A CG    1 
ATOM   1282 C  CD    . LYS A 1 166 ? 69.081 0.081   15.143  1.00 53.58 ? 163  LYS A CD    1 
ATOM   1283 C  CE    . LYS A 1 166 ? 69.568 1.484   14.786  1.00 57.45 ? 163  LYS A CE    1 
ATOM   1284 N  NZ    . LYS A 1 166 ? 68.459 2.484   14.780  1.00 68.16 ? 163  LYS A NZ    1 
ATOM   1285 N  N     . GLU A 1 167 ? 73.955 -0.162  14.838  1.00 25.35 ? 164  GLU A N     1 
ATOM   1286 C  CA    . GLU A 1 167 ? 74.723 -0.085  13.604  1.00 27.54 ? 164  GLU A CA    1 
ATOM   1287 C  C     . GLU A 1 167 ? 75.912 -1.043  13.637  1.00 29.92 ? 164  GLU A C     1 
ATOM   1288 O  O     . GLU A 1 167 ? 76.396 -1.486  12.599  1.00 24.91 ? 164  GLU A O     1 
ATOM   1289 C  CB    . GLU A 1 167 ? 75.186 1.356   13.345  1.00 38.76 ? 164  GLU A CB    1 
ATOM   1290 C  CG    . GLU A 1 167 ? 76.124 1.534   12.148  1.00 29.54 ? 164  GLU A CG    1 
ATOM   1291 C  CD    . GLU A 1 167 ? 75.482 1.176   10.808  1.00 36.83 ? 164  GLU A CD    1 
ATOM   1292 O  OE1   . GLU A 1 167 ? 76.218 1.145   9.796   1.00 34.70 ? 164  GLU A OE1   1 
ATOM   1293 O  OE2   . GLU A 1 167 ? 74.254 0.935   10.759  1.00 30.01 ? 164  GLU A OE2   1 
ATOM   1294 N  N     . GLY A 1 168 ? 76.387 -1.358  14.837  1.00 33.23 ? 165  GLY A N     1 
ATOM   1295 C  CA    . GLY A 1 168 ? 77.494 -2.283  14.980  1.00 34.50 ? 165  GLY A CA    1 
ATOM   1296 C  C     . GLY A 1 168 ? 77.063 -3.696  14.650  1.00 26.70 ? 165  GLY A C     1 
ATOM   1297 O  O     . GLY A 1 168 ? 77.761 -4.421  13.943  1.00 24.72 ? 165  GLY A O     1 
ATOM   1298 N  N     . MET A 1 169 ? 75.901 -4.085  15.165  1.00 26.34 ? 166  MET A N     1 
ATOM   1299 C  CA    . MET A 1 169 ? 75.332 -5.389  14.866  1.00 22.38 ? 166  MET A CA    1 
ATOM   1300 C  C     . MET A 1 169 ? 75.073 -5.517  13.363  1.00 20.15 ? 166  MET A C     1 
ATOM   1301 O  O     . MET A 1 169 ? 75.421 -6.527  12.755  1.00 21.74 ? 166  MET A O     1 
ATOM   1302 C  CB    . MET A 1 169 ? 74.039 -5.611  15.659  1.00 27.84 ? 166  MET A CB    1 
ATOM   1303 C  CG    . MET A 1 169 ? 73.476 -7.036  15.546  1.00 43.06 ? 166  MET A CG    1 
ATOM   1304 S  SD    . MET A 1 169 ? 73.601 -8.025  17.064  1.00 54.55 ? 166  MET A SD    1 
ATOM   1305 C  CE    . MET A 1 169 ? 75.243 -7.577  17.640  1.00 34.13 ? 166  MET A CE    1 
ATOM   1306 N  N     . ARG A 1 170 ? 74.483 -4.483  12.763  1.00 18.72 ? 167  ARG A N     1 
ATOM   1307 C  CA    . ARG A 1 170 ? 74.234 -4.490  11.320  1.00 17.91 ? 167  ARG A CA    1 
ATOM   1308 C  C     . ARG A 1 170 ? 75.500 -4.828  10.553  1.00 18.62 ? 167  ARG A C     1 
ATOM   1309 O  O     . ARG A 1 170 ? 75.496 -5.706  9.697   1.00 15.78 ? 167  ARG A O     1 
ATOM   1310 C  CB    . ARG A 1 170 ? 73.702 -3.138  10.830  1.00 19.18 ? 167  ARG A CB    1 
ATOM   1311 C  CG    . ARG A 1 170 ? 73.215 -3.165  9.374   1.00 15.42 ? 167  ARG A CG    1 
ATOM   1312 C  CD    . ARG A 1 170 ? 73.056 -1.756  8.786   1.00 16.91 ? 167  ARG A CD    1 
ATOM   1313 N  NE    . ARG A 1 170 ? 74.356 -1.114  8.576   1.00 19.89 ? 167  ARG A NE    1 
ATOM   1314 C  CZ    . ARG A 1 170 ? 75.133 -1.328  7.517   1.00 15.98 ? 167  ARG A CZ    1 
ATOM   1315 N  NH1   . ARG A 1 170 ? 74.755 -2.172  6.559   1.00 19.71 ? 167  ARG A NH1   1 
ATOM   1316 N  NH2   . ARG A 1 170 ? 76.292 -0.693  7.406   1.00 20.01 ? 167  ARG A NH2   1 
ATOM   1317 N  N     . LYS A 1 171 ? 76.577 -4.111  10.855  1.00 15.46 ? 168  LYS A N     1 
ATOM   1318 C  CA    . LYS A 1 171 ? 77.844 -4.302  10.161  1.00 19.46 ? 168  LYS A CA    1 
ATOM   1319 C  C     . LYS A 1 171 ? 78.473 -5.672  10.424  1.00 18.82 ? 168  LYS A C     1 
ATOM   1320 O  O     . LYS A 1 171 ? 79.066 -6.262  9.522   1.00 18.55 ? 168  LYS A O     1 
ATOM   1321 C  CB    . LYS A 1 171 ? 78.842 -3.193  10.508  1.00 27.63 ? 168  LYS A CB    1 
ATOM   1322 C  CG    . LYS A 1 171 ? 78.584 -1.852  9.822   1.00 29.32 ? 168  LYS A CG    1 
ATOM   1323 C  CD    . LYS A 1 171 ? 79.895 -1.059  9.742   1.00 43.81 ? 168  LYS A CD    1 
ATOM   1324 C  CE    . LYS A 1 171 ? 79.701 0.349   9.207   1.00 52.74 ? 168  LYS A CE    1 
ATOM   1325 N  NZ    . LYS A 1 171 ? 79.205 1.291   10.256  1.00 47.93 ? 168  LYS A NZ    1 
ATOM   1326 N  N     . GLN A 1 172 ? 78.356 -6.174  11.650  1.00 21.20 ? 169  GLN A N     1 
ATOM   1327 C  CA    . GLN A 1 172 ? 78.860 -7.512  11.954  1.00 21.09 ? 169  GLN A CA    1 
ATOM   1328 C  C     . GLN A 1 172 ? 78.156 -8.551  11.087  1.00 18.07 ? 169  GLN A C     1 
ATOM   1329 O  O     . GLN A 1 172 ? 78.798 -9.419  10.503  1.00 18.35 ? 169  GLN A O     1 
ATOM   1330 C  CB    . GLN A 1 172 ? 78.671 -7.858  13.430  1.00 23.59 ? 169  GLN A CB    1 
ATOM   1331 C  CG    . GLN A 1 172 ? 79.730 -7.287  14.346  1.00 40.47 ? 169  GLN A CG    1 
ATOM   1332 C  CD    . GLN A 1 172 ? 79.400 -7.496  15.814  1.00 52.17 ? 169  GLN A CD    1 
ATOM   1333 O  OE1   . GLN A 1 172 ? 78.252 -7.778  16.172  1.00 44.16 ? 169  GLN A OE1   1 
ATOM   1334 N  NE2   . GLN A 1 172 ? 80.408 -7.355  16.673  1.00 59.82 ? 169  GLN A NE2   1 
ATOM   1335 N  N     . GLY A 1 173 ? 76.832 -8.447  10.996  1.00 17.80 ? 170  GLY A N     1 
ATOM   1336 C  CA    . GLY A 1 173 ? 76.050 -9.391  10.215  1.00 14.81 ? 170  GLY A CA    1 
ATOM   1337 C  C     . GLY A 1 173 ? 76.453 -9.303  8.764   1.00 14.75 ? 170  GLY A C     1 
ATOM   1338 O  O     . GLY A 1 173 ? 76.702 -10.315 8.107   1.00 13.98 ? 170  GLY A O     1 
ATOM   1339 N  N     . LEU A 1 174 ? 76.527 -8.074  8.260   1.00 14.10 ? 171  LEU A N     1 
ATOM   1340 C  CA    . LEU A 1 174 ? 76.941 -7.829  6.883   1.00 15.26 ? 171  LEU A CA    1 
ATOM   1341 C  C     . LEU A 1 174 ? 78.313 -8.450  6.581   1.00 18.16 ? 171  LEU A C     1 
ATOM   1342 O  O     . LEU A 1 174 ? 78.501 -9.094  5.548   1.00 14.94 ? 171  LEU A O     1 
ATOM   1343 C  CB    . LEU A 1 174 ? 76.956 -6.319  6.591   1.00 14.11 ? 171  LEU A CB    1 
ATOM   1344 C  CG    . LEU A 1 174 ? 77.304 -5.947  5.154   1.00 12.94 ? 171  LEU A CG    1 
ATOM   1345 C  CD1   . LEU A 1 174 ? 76.391 -6.695  4.169   1.00 13.06 ? 171  LEU A CD1   1 
ATOM   1346 C  CD2   . LEU A 1 174 ? 77.238 -4.423  4.938   1.00 17.58 ? 171  LEU A CD2   1 
ATOM   1347 N  N     . PHE A 1 175 ? 79.266 -8.252  7.489   1.00 17.40 ? 172  PHE A N     1 
ATOM   1348 C  CA    . PHE A 1 175 ? 80.613 -8.808  7.334   1.00 18.26 ? 172  PHE A CA    1 
ATOM   1349 C  C     . PHE A 1 175 ? 80.611 -10.335 7.260   1.00 16.36 ? 172  PHE A C     1 
ATOM   1350 O  O     . PHE A 1 175 ? 81.285 -10.913 6.408   1.00 19.00 ? 172  PHE A O     1 
ATOM   1351 C  CB    . PHE A 1 175 ? 81.519 -8.357  8.478   1.00 18.81 ? 172  PHE A CB    1 
ATOM   1352 C  CG    . PHE A 1 175 ? 81.906 -6.907  8.413   1.00 36.54 ? 172  PHE A CG    1 
ATOM   1353 C  CD1   . PHE A 1 175 ? 81.999 -6.251  7.194   1.00 42.96 ? 172  PHE A CD1   1 
ATOM   1354 C  CD2   . PHE A 1 175 ? 82.176 -6.197  9.575   1.00 39.29 ? 172  PHE A CD2   1 
ATOM   1355 C  CE1   . PHE A 1 175 ? 82.356 -4.917  7.134   1.00 45.77 ? 172  PHE A CE1   1 
ATOM   1356 C  CE2   . PHE A 1 175 ? 82.538 -4.860  9.522   1.00 46.62 ? 172  PHE A CE2   1 
ATOM   1357 C  CZ    . PHE A 1 175 ? 82.624 -4.220  8.299   1.00 46.79 ? 172  PHE A CZ    1 
ATOM   1358 N  N     . GLN A 1 176 ? 79.876 -10.985 8.162   1.00 16.95 ? 173  GLN A N     1 
ATOM   1359 C  CA    . GLN A 1 176 ? 79.777 -12.446 8.147   1.00 20.94 ? 173  GLN A CA    1 
ATOM   1360 C  C     . GLN A 1 176 ? 79.225 -12.937 6.819   1.00 21.17 ? 173  GLN A C     1 
ATOM   1361 O  O     . GLN A 1 176 ? 79.708 -13.916 6.249   1.00 21.59 ? 173  GLN A O     1 
ATOM   1362 C  CB    . GLN A 1 176 ? 78.907 -12.953 9.304   1.00 18.95 ? 173  GLN A CB    1 
ATOM   1363 C  CG    . GLN A 1 176 ? 79.502 -12.686 10.679  1.00 18.49 ? 173  GLN A CG    1 
ATOM   1364 C  CD    . GLN A 1 176 ? 78.761 -13.410 11.772  1.00 24.47 ? 173  GLN A CD    1 
ATOM   1365 O  OE1   . GLN A 1 176 ? 77.673 -13.920 11.552  1.00 20.94 ? 173  GLN A OE1   1 
ATOM   1366 N  NE2   . GLN A 1 176 ? 79.352 -13.463 12.966  1.00 30.34 ? 173  GLN A NE2   1 
ATOM   1367 N  N     . TRP A 1 177 ? 78.217 -12.231 6.321   1.00 17.07 ? 174  TRP A N     1 
ATOM   1368 C  CA    . TRP A 1 177 ? 77.593 -12.572 5.046   1.00 16.48 ? 174  TRP A CA    1 
ATOM   1369 C  C     . TRP A 1 177 ? 78.579 -12.424 3.890   1.00 14.80 ? 174  TRP A C     1 
ATOM   1370 O  O     . TRP A 1 177 ? 78.727 -13.323 3.060   1.00 17.36 ? 174  TRP A O     1 
ATOM   1371 C  CB    . TRP A 1 177 ? 76.381 -11.664 4.809   1.00 11.85 ? 174  TRP A CB    1 
ATOM   1372 C  CG    . TRP A 1 177 ? 75.709 -11.856 3.468   1.00 12.76 ? 174  TRP A CG    1 
ATOM   1373 C  CD1   . TRP A 1 177 ? 75.814 -11.041 2.393   1.00 13.60 ? 174  TRP A CD1   1 
ATOM   1374 C  CD2   . TRP A 1 177 ? 74.812 -12.917 3.084   1.00 14.16 ? 174  TRP A CD2   1 
ATOM   1375 N  NE1   . TRP A 1 177 ? 75.054 -11.514 1.359   1.00 10.92 ? 174  TRP A NE1   1 
ATOM   1376 C  CE2   . TRP A 1 177 ? 74.428 -12.667 1.751   1.00 15.91 ? 174  TRP A CE2   1 
ATOM   1377 C  CE3   . TRP A 1 177 ? 74.310 -14.051 3.734   1.00 12.34 ? 174  TRP A CE3   1 
ATOM   1378 C  CZ2   . TRP A 1 177 ? 73.565 -13.507 1.045   1.00 11.88 ? 174  TRP A CZ2   1 
ATOM   1379 C  CZ3   . TRP A 1 177 ? 73.446 -14.895 3.032   1.00 15.69 ? 174  TRP A CZ3   1 
ATOM   1380 C  CH2   . TRP A 1 177 ? 73.076 -14.612 1.703   1.00 15.22 ? 174  TRP A CH2   1 
ATOM   1381 N  N     . LEU A 1 178 ? 79.250 -11.280 3.829   1.00 15.30 ? 175  LEU A N     1 
ATOM   1382 C  CA    . LEU A 1 178 ? 80.151 -11.010 2.712   1.00 15.97 ? 175  LEU A CA    1 
ATOM   1383 C  C     . LEU A 1 178 ? 81.379 -11.916 2.802   1.00 27.73 ? 175  LEU A C     1 
ATOM   1384 O  O     . LEU A 1 178 ? 81.937 -12.326 1.787   1.00 24.72 ? 175  LEU A O     1 
ATOM   1385 C  CB    . LEU A 1 178 ? 80.574 -9.539  2.700   1.00 16.61 ? 175  LEU A CB    1 
ATOM   1386 C  CG    . LEU A 1 178 ? 79.442 -8.554  2.358   1.00 18.55 ? 175  LEU A CG    1 
ATOM   1387 C  CD1   . LEU A 1 178 ? 79.934 -7.119  2.420   1.00 23.99 ? 175  LEU A CD1   1 
ATOM   1388 C  CD2   . LEU A 1 178 ? 78.869 -8.853  0.980   1.00 18.43 ? 175  LEU A CD2   1 
ATOM   1389 N  N     . ASP A 1 179 ? 81.790 -12.231 4.024   1.00 21.19 ? 176  ASP A N     1 
ATOM   1390 C  CA    . ASP A 1 179 ? 82.951 -13.103 4.223   1.00 31.56 ? 176  ASP A CA    1 
ATOM   1391 C  C     . ASP A 1 179 ? 82.696 -14.510 3.706   1.00 29.74 ? 176  ASP A C     1 
ATOM   1392 O  O     . ASP A 1 179 ? 83.628 -15.212 3.309   1.00 36.51 ? 176  ASP A O     1 
ATOM   1393 C  CB    . ASP A 1 179 ? 83.371 -13.151 5.696   1.00 30.23 ? 176  ASP A CB    1 
ATOM   1394 C  CG    . ASP A 1 179 ? 84.120 -11.905 6.126   1.00 37.79 ? 176  ASP A CG    1 
ATOM   1395 O  OD1   . ASP A 1 179 ? 84.721 -11.249 5.249   1.00 48.23 ? 176  ASP A OD1   1 
ATOM   1396 O  OD2   . ASP A 1 179 ? 84.115 -11.582 7.338   1.00 44.09 ? 176  ASP A OD2   1 
ATOM   1397 N  N     . SER A 1 180 ? 81.428 -14.912 3.699   1.00 27.76 ? 177  SER A N     1 
ATOM   1398 C  CA    . SER A 1 180 ? 81.049 -16.265 3.309   1.00 29.20 ? 177  SER A CA    1 
ATOM   1399 C  C     . SER A 1 180 ? 80.713 -16.384 1.831   1.00 33.69 ? 177  SER A C     1 
ATOM   1400 O  O     . SER A 1 180 ? 80.600 -17.490 1.302   1.00 36.45 ? 177  SER A O     1 
ATOM   1401 C  CB    . SER A 1 180 ? 79.841 -16.727 4.125   1.00 27.34 ? 177  SER A CB    1 
ATOM   1402 O  OG    . SER A 1 180 ? 80.134 -16.736 5.509   1.00 42.27 ? 177  SER A OG    1 
ATOM   1403 N  N     . LEU A 1 181 ? 80.549 -15.243 1.173   1.00 21.78 ? 178  LEU A N     1 
ATOM   1404 C  CA    A LEU A 1 181 ? 80.043 -15.226 -0.192  0.40 21.43 ? 178  LEU A CA    1 
ATOM   1405 C  CA    B LEU A 1 181 ? 80.060 -15.200 -0.204  0.60 21.34 ? 178  LEU A CA    1 
ATOM   1406 C  C     . LEU A 1 181 ? 81.045 -15.759 -1.218  1.00 32.98 ? 178  LEU A C     1 
ATOM   1407 O  O     . LEU A 1 181 ? 82.222 -15.407 -1.198  1.00 32.70 ? 178  LEU A O     1 
ATOM   1408 C  CB    A LEU A 1 181 ? 79.590 -13.813 -0.564  0.40 25.05 ? 178  LEU A CB    1 
ATOM   1409 C  CB    B LEU A 1 181 ? 79.728 -13.762 -0.601  0.60 25.20 ? 178  LEU A CB    1 
ATOM   1410 C  CG    A LEU A 1 181 ? 78.864 -13.642 -1.897  0.40 22.25 ? 178  LEU A CG    1 
ATOM   1411 C  CG    B LEU A 1 181 ? 78.294 -13.264 -0.478  0.60 19.32 ? 178  LEU A CG    1 
ATOM   1412 C  CD1   A LEU A 1 181 ? 77.693 -14.614 -2.016  0.40 20.45 ? 178  LEU A CD1   1 
ATOM   1413 C  CD1   B LEU A 1 181 ? 78.182 -11.915 -1.182  0.60 14.21 ? 178  LEU A CD1   1 
ATOM   1414 C  CD2   A LEU A 1 181 ? 78.398 -12.199 -2.049  0.40 16.38 ? 178  LEU A CD2   1 
ATOM   1415 C  CD2   B LEU A 1 181 ? 77.306 -14.266 -1.062  0.60 19.52 ? 178  LEU A CD2   1 
ATOM   1416 N  N     . GLN A 1 182 ? 80.557 -16.615 -2.114  1.00 35.11 ? 179  GLN A N     1 
ATOM   1417 C  CA    . GLN A 1 182 ? 81.383 -17.143 -3.197  1.00 46.76 ? 179  GLN A CA    1 
ATOM   1418 C  C     . GLN A 1 182 ? 81.112 -16.392 -4.504  1.00 50.28 ? 179  GLN A C     1 
ATOM   1419 O  O     . GLN A 1 182 ? 80.109 -16.639 -5.179  1.00 50.16 ? 179  GLN A O     1 
ATOM   1420 C  CB    . GLN A 1 182 ? 81.147 -18.643 -3.384  1.00 54.44 ? 179  GLN A CB    1 
ATOM   1421 C  CG    . GLN A 1 182 ? 82.066 -19.287 -4.418  1.00 65.73 ? 179  GLN A CG    1 
ATOM   1422 C  CD    . GLN A 1 182 ? 83.535 -18.988 -4.163  1.00 70.90 ? 179  GLN A CD    1 
ATOM   1423 O  OE1   . GLN A 1 182 ? 84.061 -17.964 -4.610  1.00 59.04 ? 179  GLN A OE1   1 
ATOM   1424 N  NE2   . GLN A 1 182 ? 84.204 -19.881 -3.441  1.00 74.75 ? 179  GLN A NE2   1 
ATOM   1425 N  N     . ILE A 1 183 ? 82.023 -15.489 -4.859  1.00 43.45 ? 180  ILE A N     1 
ATOM   1426 C  CA    . ILE A 1 183 ? 81.817 -14.561 -5.974  1.00 54.44 ? 180  ILE A CA    1 
ATOM   1427 C  C     . ILE A 1 183 ? 82.222 -15.091 -7.352  1.00 56.58 ? 180  ILE A C     1 
ATOM   1428 O  O     . ILE A 1 183 ? 81.958 -14.446 -8.369  1.00 55.98 ? 180  ILE A O     1 
ATOM   1429 C  CB    . ILE A 1 183 ? 82.557 -13.234 -5.729  1.00 49.30 ? 180  ILE A CB    1 
ATOM   1430 C  CG1   . ILE A 1 183 ? 84.048 -13.501 -5.506  1.00 51.03 ? 180  ILE A CG1   1 
ATOM   1431 C  CG2   . ILE A 1 183 ? 81.949 -12.503 -4.542  1.00 42.36 ? 180  ILE A CG2   1 
ATOM   1432 C  CD1   . ILE A 1 183 ? 84.849 -12.272 -5.154  1.00 47.02 ? 180  ILE A CD1   1 
ATOM   1433 N  N     . ASP A 1 184 ? 82.867 -16.253 -7.389  1.00 57.47 ? 181  ASP A N     1 
ATOM   1434 C  CA    . ASP A 1 184 ? 83.287 -16.836 -8.660  1.00 59.82 ? 181  ASP A CA    1 
ATOM   1435 C  C     . ASP A 1 184 ? 82.135 -17.581 -9.324  1.00 59.74 ? 181  ASP A C     1 
ATOM   1436 O  O     . ASP A 1 184 ? 82.234 -18.000 -10.477 1.00 52.51 ? 181  ASP A O     1 
ATOM   1437 C  CB    . ASP A 1 184 ? 84.491 -17.765 -8.469  1.00 66.70 ? 181  ASP A CB    1 
ATOM   1438 C  CG    . ASP A 1 184 ? 84.184 -18.953 -7.571  1.00 74.94 ? 181  ASP A CG    1 
ATOM   1439 O  OD1   . ASP A 1 184 ? 83.071 -19.514 -7.663  1.00 74.38 ? 181  ASP A OD1   1 
ATOM   1440 O  OD2   . ASP A 1 184 ? 85.066 -19.330 -6.772  1.00 84.76 ? 181  ASP A OD2   1 
ATOM   1441 N  N     . ASN A 1 185 ? 81.043 -17.745 -8.585  1.00 54.41 ? 182  ASN A N     1 
ATOM   1442 C  CA    . ASN A 1 185 ? 79.865 -18.427 -9.102  1.00 54.39 ? 182  ASN A CA    1 
ATOM   1443 C  C     . ASN A 1 185 ? 78.744 -17.444 -9.420  1.00 52.92 ? 182  ASN A C     1 
ATOM   1444 O  O     . ASN A 1 185 ? 78.043 -16.974 -8.522  1.00 48.66 ? 182  ASN A O     1 
ATOM   1445 C  CB    . ASN A 1 185 ? 79.382 -19.489 -8.111  1.00 49.11 ? 182  ASN A CB    1 
ATOM   1446 C  CG    . ASN A 1 185 ? 78.205 -20.288 -8.639  1.00 48.89 ? 182  ASN A CG    1 
ATOM   1447 O  OD1   . ASN A 1 185 ? 77.875 -20.222 -9.825  1.00 48.68 ? 182  ASN A OD1   1 
ATOM   1448 N  ND2   . ASN A 1 185 ? 77.566 -21.053 -7.758  1.00 50.44 ? 182  ASN A ND2   1 
ATOM   1449 N  N     . LEU A 1 186 ? 78.580 -17.137 -10.704 1.00 50.61 ? 183  LEU A N     1 
ATOM   1450 C  CA    . LEU A 1 186 ? 77.578 -16.172 -11.145 1.00 48.63 ? 183  LEU A CA    1 
ATOM   1451 C  C     . LEU A 1 186 ? 76.148 -16.684 -10.977 1.00 48.79 ? 183  LEU A C     1 
ATOM   1452 O  O     . LEU A 1 186 ? 75.190 -15.923 -11.107 1.00 50.68 ? 183  LEU A O     1 
ATOM   1453 C  CB    . LEU A 1 186 ? 77.824 -15.773 -12.602 1.00 47.50 ? 183  LEU A CB    1 
ATOM   1454 C  CG    . LEU A 1 186 ? 78.737 -14.566 -12.833 1.00 60.10 ? 183  LEU A CG    1 
ATOM   1455 C  CD1   . LEU A 1 186 ? 80.056 -14.707 -12.074 1.00 61.98 ? 183  LEU A CD1   1 
ATOM   1456 C  CD2   . LEU A 1 186 ? 78.978 -14.358 -14.320 1.00 48.79 ? 183  LEU A CD2   1 
ATOM   1457 N  N     . THR A 1 187 ? 76.010 -17.973 -10.687 1.00 49.06 ? 184  THR A N     1 
ATOM   1458 C  CA    . THR A 1 187 ? 74.693 -18.576 -10.523 1.00 44.48 ? 184  THR A CA    1 
ATOM   1459 C  C     . THR A 1 187 ? 74.354 -18.849 -9.057  1.00 38.04 ? 184  THR A C     1 
ATOM   1460 O  O     . THR A 1 187 ? 73.318 -19.440 -8.763  1.00 38.82 ? 184  THR A O     1 
ATOM   1461 C  CB    . THR A 1 187 ? 74.564 -19.897 -11.320 1.00 52.29 ? 184  THR A CB    1 
ATOM   1462 O  OG1   . THR A 1 187 ? 75.538 -20.841 -10.852 1.00 52.37 ? 184  THR A OG1   1 
ATOM   1463 C  CG2   . THR A 1 187 ? 74.770 -19.651 -12.810 1.00 57.34 ? 184  THR A CG2   1 
ATOM   1464 N  N     . SER A 1 188 ? 75.225 -18.435 -8.141  1.00 33.63 ? 185  SER A N     1 
ATOM   1465 C  CA    . SER A 1 188 ? 74.916 -18.555 -6.714  1.00 23.99 ? 185  SER A CA    1 
ATOM   1466 C  C     . SER A 1 188 ? 73.753 -17.642 -6.350  1.00 16.79 ? 185  SER A C     1 
ATOM   1467 O  O     . SER A 1 188 ? 73.843 -16.426 -6.487  1.00 18.33 ? 185  SER A O     1 
ATOM   1468 C  CB    . SER A 1 188 ? 76.128 -18.220 -5.853  1.00 29.69 ? 185  SER A CB    1 
ATOM   1469 O  OG    . SER A 1 188 ? 75.783 -18.248 -4.474  1.00 34.10 ? 185  SER A OG    1 
ATOM   1470 N  N     . PRO A 1 189 ? 72.641 -18.231 -5.907  1.00 17.79 ? 186  PRO A N     1 
ATOM   1471 C  CA    . PRO A 1 189 ? 71.492 -17.427 -5.473  1.00 15.38 ? 186  PRO A CA    1 
ATOM   1472 C  C     . PRO A 1 189 ? 71.865 -16.413 -4.385  1.00 14.80 ? 186  PRO A C     1 
ATOM   1473 O  O     . PRO A 1 189 ? 71.354 -15.304 -4.423  1.00 11.82 ? 186  PRO A O     1 
ATOM   1474 C  CB    . PRO A 1 189 ? 70.524 -18.478 -4.929  1.00 18.71 ? 186  PRO A CB    1 
ATOM   1475 C  CG    . PRO A 1 189 ? 70.890 -19.744 -5.710  1.00 18.64 ? 186  PRO A CG    1 
ATOM   1476 C  CD    . PRO A 1 189 ? 72.381 -19.679 -5.816  1.00 20.24 ? 186  PRO A CD    1 
ATOM   1477 N  N     . ASP A 1 190 ? 72.718 -16.771 -3.424  1.00 12.71 ? 187  ASP A N     1 
ATOM   1478 C  CA    . ASP A 1 190 ? 73.089 -15.803 -2.396  1.00 12.93 ? 187  ASP A CA    1 
ATOM   1479 C  C     . ASP A 1 190 ? 73.824 -14.594 -2.987  1.00 11.50 ? 187  ASP A C     1 
ATOM   1480 O  O     . ASP A 1 190 ? 73.620 -13.456 -2.557  1.00 12.18 ? 187  ASP A O     1 
ATOM   1481 C  CB    . ASP A 1 190 ? 73.928 -16.446 -1.288  1.00 12.79 ? 187  ASP A CB    1 
ATOM   1482 C  CG    . ASP A 1 190 ? 73.126 -17.439 -0.455  1.00 24.11 ? 187  ASP A CG    1 
ATOM   1483 O  OD1   . ASP A 1 190 ? 71.881 -17.352 -0.446  1.00 13.82 ? 187  ASP A OD1   1 
ATOM   1484 O  OD2   . ASP A 1 190 ? 73.740 -18.311 0.185   1.00 22.78 ? 187  ASP A OD2   1 
ATOM   1485 N  N     . LEU A 1 191 ? 74.697 -14.852 -3.953  1.00 12.69 ? 188  LEU A N     1 
ATOM   1486 C  CA    . LEU A 1 191 ? 75.397 -13.770 -4.638  1.00 16.97 ? 188  LEU A CA    1 
ATOM   1487 C  C     . LEU A 1 191 ? 74.405 -12.893 -5.393  1.00 12.13 ? 188  LEU A C     1 
ATOM   1488 O  O     . LEU A 1 191 ? 74.500 -11.664 -5.362  1.00 13.72 ? 188  LEU A O     1 
ATOM   1489 C  CB    . LEU A 1 191 ? 76.437 -14.328 -5.613  1.00 15.77 ? 188  LEU A CB    1 
ATOM   1490 C  CG    . LEU A 1 191 ? 77.263 -13.304 -6.405  1.00 15.93 ? 188  LEU A CG    1 
ATOM   1491 C  CD1   . LEU A 1 191 ? 77.916 -12.297 -5.498  1.00 20.38 ? 188  LEU A CD1   1 
ATOM   1492 C  CD2   . LEU A 1 191 ? 78.315 -14.011 -7.285  1.00 20.98 ? 188  LEU A CD2   1 
ATOM   1493 N  N     . GLN A 1 192 ? 73.464 -13.532 -6.074  1.00 12.39 ? 189  GLN A N     1 
ATOM   1494 C  CA    . GLN A 1 192 ? 72.451 -12.815 -6.842  1.00 14.57 ? 189  GLN A CA    1 
ATOM   1495 C  C     . GLN A 1 192 ? 71.654 -11.879 -5.939  1.00 13.80 ? 189  GLN A C     1 
ATOM   1496 O  O     . GLN A 1 192 ? 71.404 -10.726 -6.292  1.00 14.61 ? 189  GLN A O     1 
ATOM   1497 C  CB    . GLN A 1 192 ? 71.542 -13.801 -7.575  1.00 14.85 ? 189  GLN A CB    1 
ATOM   1498 C  CG    . GLN A 1 192 ? 72.259 -14.475 -8.736  1.00 18.39 ? 189  GLN A CG    1 
ATOM   1499 C  CD    . GLN A 1 192 ? 71.527 -15.670 -9.298  1.00 30.75 ? 189  GLN A CD    1 
ATOM   1500 O  OE1   . GLN A 1 192 ? 70.443 -16.027 -8.843  1.00 33.76 ? 189  GLN A OE1   1 
ATOM   1501 N  NE2   . GLN A 1 192 ? 72.127 -16.306 -10.298 1.00 41.30 ? 189  GLN A NE2   1 
ATOM   1502 N  N     . LEU A 1 193 ? 71.269 -12.374 -4.766  1.00 10.82 ? 190  LEU A N     1 
ATOM   1503 C  CA    . LEU A 1 193 ? 70.530 -11.545 -3.820  1.00 7.14  ? 190  LEU A CA    1 
ATOM   1504 C  C     . LEU A 1 193 ? 71.363 -10.340 -3.375  1.00 10.10 ? 190  LEU A C     1 
ATOM   1505 O  O     . LEU A 1 193 ? 70.845 -9.240  -3.206  1.00 12.46 ? 190  LEU A O     1 
ATOM   1506 C  CB    . LEU A 1 193 ? 70.099 -12.360 -2.595  1.00 11.20 ? 190  LEU A CB    1 
ATOM   1507 C  CG    . LEU A 1 193 ? 68.996 -13.410 -2.760  1.00 9.94  ? 190  LEU A CG    1 
ATOM   1508 C  CD1   . LEU A 1 193 ? 68.648 -13.977 -1.369  1.00 10.31 ? 190  LEU A CD1   1 
ATOM   1509 C  CD2   . LEU A 1 193 ? 67.770 -12.816 -3.405  1.00 10.10 ? 190  LEU A CD2   1 
ATOM   1510 N  N     . THR A 1 194 ? 72.656 -10.569 -3.169  1.00 9.07  ? 191  THR A N     1 
ATOM   1511 C  CA    . THR A 1 194 ? 73.557 -9.549  -2.681  1.00 10.12 ? 191  THR A CA    1 
ATOM   1512 C  C     . THR A 1 194 ? 73.710 -8.429  -3.688  1.00 11.76 ? 191  THR A C     1 
ATOM   1513 O  O     . THR A 1 194 ? 73.709 -7.259  -3.316  1.00 11.37 ? 191  THR A O     1 
ATOM   1514 C  CB    . THR A 1 194 ? 74.936 -10.136 -2.393  1.00 11.50 ? 191  THR A CB    1 
ATOM   1515 O  OG1   . THR A 1 194 ? 74.796 -11.178 -1.424  1.00 14.38 ? 191  THR A OG1   1 
ATOM   1516 C  CG2   . THR A 1 194 ? 75.885 -9.044  -1.864  1.00 12.29 ? 191  THR A CG2   1 
ATOM   1517 N  N     . VAL A 1 195 ? 73.862 -8.796  -4.953  1.00 13.38 ? 192  VAL A N     1 
ATOM   1518 C  CA    . VAL A 1 195 ? 73.948 -7.804  -6.012  1.00 14.24 ? 192  VAL A CA    1 
ATOM   1519 C  C     . VAL A 1 195 ? 72.608 -7.088  -6.128  1.00 11.04 ? 192  VAL A C     1 
ATOM   1520 O  O     . VAL A 1 195 ? 72.560 -5.881  -6.384  1.00 14.78 ? 192  VAL A O     1 
ATOM   1521 C  CB    . VAL A 1 195 ? 74.361 -8.446  -7.360  1.00 13.18 ? 192  VAL A CB    1 
ATOM   1522 C  CG1   . VAL A 1 195 ? 74.240 -7.427  -8.495  1.00 17.65 ? 192  VAL A CG1   1 
ATOM   1523 C  CG2   . VAL A 1 195 ? 75.776 -8.973  -7.260  1.00 13.30 ? 192  VAL A CG2   1 
ATOM   1524 N  N     . GLY A 1 196 ? 71.523 -7.825  -5.921  1.00 10.07 ? 193  GLY A N     1 
ATOM   1525 C  CA    . GLY A 1 196 ? 70.197 -7.229  -5.876  1.00 9.80  ? 193  GLY A CA    1 
ATOM   1526 C  C     . GLY A 1 196 ? 70.132 -6.139  -4.820  1.00 12.88 ? 193  GLY A C     1 
ATOM   1527 O  O     . GLY A 1 196 ? 69.590 -5.043  -5.048  1.00 14.03 ? 193  GLY A O     1 
ATOM   1528 N  N     . ALA A 1 197 ? 70.706 -6.418  -3.654  1.00 10.74 ? 194  ALA A N     1 
ATOM   1529 C  CA    . ALA A 1 197 ? 70.722 -5.433  -2.592  1.00 8.48  ? 194  ALA A CA    1 
ATOM   1530 C  C     . ALA A 1 197 ? 71.549 -4.199  -2.959  1.00 12.26 ? 194  ALA A C     1 
ATOM   1531 O  O     . ALA A 1 197 ? 71.190 -3.089  -2.582  1.00 11.12 ? 194  ALA A O     1 
ATOM   1532 C  CB    . ALA A 1 197 ? 71.215 -6.058  -1.277  1.00 9.98  ? 194  ALA A CB    1 
ATOM   1533 N  N     . VAL A 1 198 ? 72.643 -4.396  -3.689  1.00 10.32 ? 195  VAL A N     1 
ATOM   1534 C  CA    . VAL A 1 198 ? 73.482 -3.275  -4.122  1.00 13.37 ? 195  VAL A CA    1 
ATOM   1535 C  C     . VAL A 1 198 ? 72.661 -2.333  -4.985  1.00 15.97 ? 195  VAL A C     1 
ATOM   1536 O  O     . VAL A 1 198 ? 72.719 -1.108  -4.823  1.00 14.94 ? 195  VAL A O     1 
ATOM   1537 C  CB    . VAL A 1 198 ? 74.722 -3.767  -4.893  1.00 14.83 ? 195  VAL A CB    1 
ATOM   1538 C  CG1   . VAL A 1 198 ? 75.475 -2.585  -5.544  1.00 13.82 ? 195  VAL A CG1   1 
ATOM   1539 C  CG2   . VAL A 1 198 ? 75.639 -4.536  -3.944  1.00 15.57 ? 195  VAL A CG2   1 
ATOM   1540 N  N     . ILE A 1 199 ? 71.867 -2.919  -5.876  1.00 9.92  ? 196  ILE A N     1 
ATOM   1541 C  CA    . ILE A 1 199 ? 71.044 -2.149  -6.802  1.00 12.58 ? 196  ILE A CA    1 
ATOM   1542 C  C     . ILE A 1 199 ? 69.941 -1.399  -6.066  1.00 12.61 ? 196  ILE A C     1 
ATOM   1543 O  O     . ILE A 1 199 ? 69.679 -0.241  -6.361  1.00 12.12 ? 196  ILE A O     1 
ATOM   1544 C  CB    . ILE A 1 199 ? 70.451 -3.046  -7.895  1.00 10.14 ? 196  ILE A CB    1 
ATOM   1545 C  CG1   . ILE A 1 199 ? 71.585 -3.574  -8.786  1.00 11.85 ? 196  ILE A CG1   1 
ATOM   1546 C  CG2   . ILE A 1 199 ? 69.427 -2.285  -8.752  1.00 12.83 ? 196  ILE A CG2   1 
ATOM   1547 C  CD1   . ILE A 1 199 ? 71.154 -4.629  -9.784  1.00 13.95 ? 196  ILE A CD1   1 
ATOM   1548 N  N     . VAL A 1 200 ? 69.319 -2.056  -5.091  1.00 10.68 ? 197  VAL A N     1 
ATOM   1549 C  CA    . VAL A 1 200 ? 68.277 -1.424  -4.287  1.00 10.07 ? 197  VAL A CA    1 
ATOM   1550 C  C     . VAL A 1 200 ? 68.823 -0.265  -3.449  1.00 10.90 ? 197  VAL A C     1 
ATOM   1551 O  O     . VAL A 1 200 ? 68.147 0.760   -3.302  1.00 10.49 ? 197  VAL A O     1 
ATOM   1552 C  CB    . VAL A 1 200 ? 67.528 -2.450  -3.408  1.00 10.74 ? 197  VAL A CB    1 
ATOM   1553 C  CG1   . VAL A 1 200 ? 66.443 -1.755  -2.560  1.00 10.58 ? 197  VAL A CG1   1 
ATOM   1554 C  CG2   . VAL A 1 200 ? 66.901 -3.522  -4.290  1.00 13.04 ? 197  VAL A CG2   1 
ATOM   1555 N  N     . GLU A 1 201 ? 70.041 -0.395  -2.922  1.00 11.21 ? 198  GLU A N     1 
ATOM   1556 C  CA    . GLU A 1 201 ? 70.696 0.758   -2.295  1.00 12.61 ? 198  GLU A CA    1 
ATOM   1557 C  C     . GLU A 1 201 ? 70.714 1.945   -3.266  1.00 12.80 ? 198  GLU A C     1 
ATOM   1558 O  O     . GLU A 1 201 ? 70.420 3.082   -2.894  1.00 14.13 ? 198  GLU A O     1 
ATOM   1559 C  CB    . GLU A 1 201 ? 72.135 0.436   -1.847  1.00 15.29 ? 198  GLU A CB    1 
ATOM   1560 C  CG    . GLU A 1 201 ? 72.267 -0.553  -0.672  1.00 18.58 ? 198  GLU A CG    1 
ATOM   1561 C  CD    . GLU A 1 201 ? 72.072 0.069   0.705   1.00 15.74 ? 198  GLU A CD    1 
ATOM   1562 O  OE1   . GLU A 1 201 ? 71.687 1.256   0.808   1.00 17.79 ? 198  GLU A OE1   1 
ATOM   1563 O  OE2   . GLU A 1 201 ? 72.295 -0.647  1.711   1.00 15.30 ? 198  GLU A OE2   1 
ATOM   1564 N  N     . GLU A 1 202 ? 71.084 1.674   -4.506  1.00 12.86 ? 199  GLU A N     1 
ATOM   1565 C  CA    . GLU A 1 202 ? 71.225 2.732   -5.500  1.00 13.48 ? 199  GLU A CA    1 
ATOM   1566 C  C     . GLU A 1 202 ? 69.847 3.319   -5.833  1.00 17.26 ? 199  GLU A C     1 
ATOM   1567 O  O     . GLU A 1 202 ? 69.681 4.538   -5.937  1.00 11.78 ? 199  GLU A O     1 
ATOM   1568 C  CB    . GLU A 1 202 ? 71.908 2.174   -6.747  1.00 16.44 ? 199  GLU A CB    1 
ATOM   1569 C  CG    . GLU A 1 202 ? 73.364 1.778   -6.487  1.00 16.88 ? 199  GLU A CG    1 
ATOM   1570 C  CD    . GLU A 1 202 ? 73.985 0.919   -7.593  1.00 19.26 ? 199  GLU A CD    1 
ATOM   1571 O  OE1   . GLU A 1 202 ? 75.211 0.681   -7.540  1.00 26.73 ? 199  GLU A OE1   1 
ATOM   1572 O  OE2   . GLU A 1 202 ? 73.264 0.483   -8.511  1.00 27.35 ? 199  GLU A OE2   1 
ATOM   1573 N  N     . MET A 1 203 ? 68.856 2.445   -5.987  1.00 11.21 ? 200  MET A N     1 
ATOM   1574 C  CA    . MET A 1 203 ? 67.491 2.885   -6.247  1.00 10.06 ? 200  MET A CA    1 
ATOM   1575 C  C     . MET A 1 203 ? 66.979 3.745   -5.104  1.00 10.32 ? 200  MET A C     1 
ATOM   1576 O  O     . MET A 1 203 ? 66.353 4.793   -5.318  1.00 11.04 ? 200  MET A O     1 
ATOM   1577 C  CB    . MET A 1 203 ? 66.547 1.682   -6.398  1.00 11.40 ? 200  MET A CB    1 
ATOM   1578 C  CG    A MET A 1 203 ? 65.129 2.072   -6.723  0.44 13.38 ? 200  MET A CG    1 
ATOM   1579 C  CG    B MET A 1 203 ? 66.889 0.691   -7.489  0.56 13.80 ? 200  MET A CG    1 
ATOM   1580 S  SD    A MET A 1 203 ? 64.019 0.658   -6.691  0.44 22.76 ? 200  MET A SD    1 
ATOM   1581 S  SD    B MET A 1 203 ? 65.642 -0.622  -7.572  0.56 18.94 ? 200  MET A SD    1 
ATOM   1582 C  CE    A MET A 1 203 ? 64.536 -0.254  -8.139  0.44 16.26 ? 200  MET A CE    1 
ATOM   1583 C  CE    B MET A 1 203 ? 64.156 0.361   -7.775  0.56 12.50 ? 200  MET A CE    1 
ATOM   1584 N  N     . ARG A 1 204 ? 67.243 3.317   -3.877  1.00 10.80 ? 201  ARG A N     1 
ATOM   1585 C  CA    . ARG A 1 204 ? 66.784 4.071   -2.714  1.00 10.10 ? 201  ARG A CA    1 
ATOM   1586 C  C     . ARG A 1 204 ? 67.506 5.421   -2.594  1.00 11.43 ? 201  ARG A C     1 
ATOM   1587 O  O     . ARG A 1 204 ? 66.894 6.415   -2.216  1.00 11.79 ? 201  ARG A O     1 
ATOM   1588 C  CB    . ARG A 1 204 ? 66.902 3.238   -1.436  1.00 11.89 ? 201  ARG A CB    1 
ATOM   1589 C  CG    . ARG A 1 204 ? 65.877 2.086   -1.414  1.00 11.35 ? 201  ARG A CG    1 
ATOM   1590 C  CD    . ARG A 1 204 ? 66.022 1.222   -0.186  1.00 12.37 ? 201  ARG A CD    1 
ATOM   1591 N  NE    . ARG A 1 204 ? 66.005 2.052   1.006   1.00 11.23 ? 201  ARG A NE    1 
ATOM   1592 C  CZ    . ARG A 1 204 ? 67.023 2.169   1.846   1.00 15.82 ? 201  ARG A CZ    1 
ATOM   1593 N  NH1   . ARG A 1 204 ? 66.923 2.976   2.895   1.00 13.06 ? 201  ARG A NH1   1 
ATOM   1594 N  NH2   . ARG A 1 204 ? 68.139 1.481   1.636   1.00 17.03 ? 201  ARG A NH2   1 
ATOM   1595 N  N     . ALA A 1 205 ? 68.792 5.462   -2.943  1.00 12.59 ? 202  ALA A N     1 
ATOM   1596 C  CA    . ALA A 1 205 ? 69.510 6.739   -2.909  1.00 12.80 ? 202  ALA A CA    1 
ATOM   1597 C  C     . ALA A 1 205 ? 68.927 7.702   -3.949  1.00 11.12 ? 202  ALA A C     1 
ATOM   1598 O  O     . ALA A 1 205 ? 68.804 8.915   -3.706  1.00 11.51 ? 202  ALA A O     1 
ATOM   1599 C  CB    . ALA A 1 205 ? 71.009 6.537   -3.134  1.00 14.50 ? 202  ALA A CB    1 
ATOM   1600 N  N     . ALA A 1 206 ? 68.558 7.161   -5.104  1.00 11.39 ? 203  ALA A N     1 
ATOM   1601 C  CA    . ALA A 1 206 ? 67.981 7.964   -6.171  1.00 13.62 ? 203  ALA A CA    1 
ATOM   1602 C  C     . ALA A 1 206 ? 66.639 8.547   -5.739  1.00 10.84 ? 203  ALA A C     1 
ATOM   1603 O  O     . ALA A 1 206 ? 66.362 9.726   -5.958  1.00 13.12 ? 203  ALA A O     1 
ATOM   1604 C  CB    . ALA A 1 206 ? 67.817 7.129   -7.437  1.00 14.91 ? 203  ALA A CB    1 
ATOM   1605 N  N     . ILE A 1 207 ? 65.804 7.719   -5.123  1.00 8.69  ? 204  ILE A N     1 
ATOM   1606 C  CA    . ILE A 1 207 ? 64.505 8.188   -4.665  1.00 9.27  ? 204  ILE A CA    1 
ATOM   1607 C  C     . ILE A 1 207 ? 64.711 9.340   -3.685  1.00 11.61 ? 204  ILE A C     1 
ATOM   1608 O  O     . ILE A 1 207 ? 64.058 10.387  -3.791  1.00 9.32  ? 204  ILE A O     1 
ATOM   1609 C  CB    . ILE A 1 207 ? 63.674 7.061   -4.020  1.00 5.67  ? 204  ILE A CB    1 
ATOM   1610 C  CG1   . ILE A 1 207 ? 63.230 6.058   -5.093  1.00 8.19  ? 204  ILE A CG1   1 
ATOM   1611 C  CG2   . ILE A 1 207 ? 62.459 7.643   -3.280  1.00 8.53  ? 204  ILE A CG2   1 
ATOM   1612 C  CD1   . ILE A 1 207 ? 62.636 4.741   -4.537  1.00 11.90 ? 204  ILE A CD1   1 
ATOM   1613 N  N     . GLU A 1 208 ? 65.633 9.170   -2.745  1.00 10.89 ? 205  GLU A N     1 
ATOM   1614 C  CA    . GLU A 1 208 ? 65.820 10.207  -1.737  1.00 10.10 ? 205  GLU A CA    1 
ATOM   1615 C  C     . GLU A 1 208 ? 66.416 11.465  -2.346  1.00 12.96 ? 205  GLU A C     1 
ATOM   1616 O  O     . GLU A 1 208 ? 65.974 12.572  -2.052  1.00 13.29 ? 205  GLU A O     1 
ATOM   1617 C  CB    . GLU A 1 208 ? 66.679 9.736   -0.567  1.00 11.47 ? 205  GLU A CB    1 
ATOM   1618 C  CG    . GLU A 1 208 ? 66.677 10.760  0.577   1.00 16.05 ? 205  GLU A CG    1 
ATOM   1619 C  CD    . GLU A 1 208 ? 67.422 10.292  1.813   1.00 19.77 ? 205  GLU A CD    1 
ATOM   1620 O  OE1   . GLU A 1 208 ? 67.358 10.996  2.843   1.00 22.72 ? 205  GLU A OE1   1 
ATOM   1621 O  OE2   . GLU A 1 208 ? 68.063 9.228   1.757   1.00 21.86 ? 205  GLU A OE2   1 
ATOM   1622 N  N     . ARG A 1 209 ? 67.425 11.297  -3.195  1.00 10.93 ? 206  ARG A N     1 
ATOM   1623 C  CA    . ARG A 1 209 ? 68.054 12.454  -3.833  1.00 10.13 ? 206  ARG A CA    1 
ATOM   1624 C  C     . ARG A 1 209 ? 67.028 13.279  -4.617  1.00 11.98 ? 206  ARG A C     1 
ATOM   1625 O  O     . ARG A 1 209 ? 67.020 14.513  -4.548  1.00 13.64 ? 206  ARG A O     1 
ATOM   1626 C  CB    . ARG A 1 209 ? 69.206 12.037  -4.769  1.00 12.11 ? 206  ARG A CB    1 
ATOM   1627 C  CG    . ARG A 1 209 ? 69.908 13.256  -5.414  1.00 18.33 ? 206  ARG A CG    1 
ATOM   1628 C  CD    . ARG A 1 209 ? 70.951 12.920  -6.493  1.00 22.47 ? 206  ARG A CD    1 
ATOM   1629 N  NE    . ARG A 1 209 ? 70.399 12.638  -7.826  1.00 27.36 ? 206  ARG A NE    1 
ATOM   1630 C  CZ    . ARG A 1 209 ? 70.036 13.560  -8.719  1.00 26.23 ? 206  ARG A CZ    1 
ATOM   1631 N  NH1   . ARG A 1 209 ? 69.564 13.187  -9.912  1.00 19.64 ? 206  ARG A NH1   1 
ATOM   1632 N  NH2   . ARG A 1 209 ? 70.131 14.851  -8.423  1.00 15.84 ? 206  ARG A NH2   1 
ATOM   1633 N  N     . GLU A 1 210 ? 66.166 12.601  -5.364  1.00 10.57 ? 207  GLU A N     1 
ATOM   1634 C  CA    . GLU A 1 210 ? 65.324 13.286  -6.342  1.00 8.32  ? 207  GLU A CA    1 
ATOM   1635 C  C     . GLU A 1 210 ? 63.918 13.631  -5.832  1.00 11.38 ? 207  GLU A C     1 
ATOM   1636 O  O     . GLU A 1 210 ? 63.168 14.366  -6.487  1.00 9.80  ? 207  GLU A O     1 
ATOM   1637 C  CB    . GLU A 1 210 ? 65.213 12.459  -7.612  1.00 10.40 ? 207  GLU A CB    1 
ATOM   1638 C  CG    . GLU A 1 210 ? 66.546 12.146  -8.249  1.00 14.85 ? 207  GLU A CG    1 
ATOM   1639 C  CD    . GLU A 1 210 ? 66.409 11.191  -9.415  1.00 17.25 ? 207  GLU A CD    1 
ATOM   1640 O  OE1   . GLU A 1 210 ? 65.367 11.235  -10.111 1.00 19.11 ? 207  GLU A OE1   1 
ATOM   1641 O  OE2   . GLU A 1 210 ? 67.346 10.397  -9.634  1.00 22.48 ? 207  GLU A OE2   1 
ATOM   1642 N  N     . THR A 1 211 ? 63.548 13.115  -4.665  1.00 10.44 ? 208  THR A N     1 
ATOM   1643 C  CA    . THR A 1 211 ? 62.224 13.440  -4.145  1.00 9.75  ? 208  THR A CA    1 
ATOM   1644 C  C     . THR A 1 211 ? 62.280 13.999  -2.745  1.00 8.64  ? 208  THR A C     1 
ATOM   1645 O  O     . THR A 1 211 ? 61.363 14.691  -2.308  1.00 12.37 ? 208  THR A O     1 
ATOM   1646 C  CB    . THR A 1 211 ? 61.255 12.224  -4.137  1.00 13.35 ? 208  THR A CB    1 
ATOM   1647 O  OG1   . THR A 1 211 ? 61.687 11.259  -3.171  1.00 12.10 ? 208  THR A OG1   1 
ATOM   1648 C  CG2   . THR A 1 211 ? 61.123 11.596  -5.518  1.00 11.30 ? 208  THR A CG2   1 
ATOM   1649 N  N     . GLY A 1 212 ? 63.342 13.666  -2.021  1.00 9.35  ? 209  GLY A N     1 
ATOM   1650 C  CA    . GLY A 1 212 ? 63.377 13.976  -0.604  1.00 10.99 ? 209  GLY A CA    1 
ATOM   1651 C  C     . GLY A 1 212 ? 62.828 12.863  0.283   1.00 12.46 ? 209  GLY A C     1 
ATOM   1652 O  O     . GLY A 1 212 ? 62.971 12.921  1.499   1.00 15.22 ? 209  GLY A O     1 
ATOM   1653 N  N     . PHE A 1 213 ? 62.220 11.845  -0.318  1.00 15.59 ? 210  PHE A N     1 
ATOM   1654 C  CA    . PHE A 1 213 ? 61.528 10.809  0.453   1.00 8.92  ? 210  PHE A CA    1 
ATOM   1655 C  C     . PHE A 1 213 ? 62.445 9.630   0.787   1.00 8.97  ? 210  PHE A C     1 
ATOM   1656 O  O     . PHE A 1 213 ? 63.202 9.179   -0.056  1.00 13.54 ? 210  PHE A O     1 
ATOM   1657 C  CB    . PHE A 1 213 ? 60.305 10.286  -0.312  1.00 10.14 ? 210  PHE A CB    1 
ATOM   1658 C  CG    . PHE A 1 213 ? 59.293 11.342  -0.668  1.00 10.17 ? 210  PHE A CG    1 
ATOM   1659 C  CD1   . PHE A 1 213 ? 58.605 11.261  -1.864  1.00 10.99 ? 210  PHE A CD1   1 
ATOM   1660 C  CD2   . PHE A 1 213 ? 59.004 12.393  0.199   1.00 11.33 ? 210  PHE A CD2   1 
ATOM   1661 C  CE1   . PHE A 1 213 ? 57.643 12.213  -2.205  1.00 9.92  ? 210  PHE A CE1   1 
ATOM   1662 C  CE2   . PHE A 1 213 ? 58.053 13.359  -0.144  1.00 9.72  ? 210  PHE A CE2   1 
ATOM   1663 C  CZ    . PHE A 1 213 ? 57.377 13.265  -1.345  1.00 7.92  ? 210  PHE A CZ    1 
ATOM   1664 N  N     . GLN A 1 214 ? 62.359 9.135   2.022   1.00 8.04  ? 211  GLN A N     1 
ATOM   1665 C  CA    . GLN A 1 214 ? 63.065 7.925   2.422   1.00 9.62  ? 211  GLN A CA    1 
ATOM   1666 C  C     . GLN A 1 214 ? 62.143 6.711   2.364   1.00 11.24 ? 211  GLN A C     1 
ATOM   1667 O  O     . GLN A 1 214 ? 60.925 6.836   2.509   1.00 9.21  ? 211  GLN A O     1 
ATOM   1668 C  CB    . GLN A 1 214 ? 63.609 8.078   3.839   1.00 14.82 ? 211  GLN A CB    1 
ATOM   1669 C  CG    . GLN A 1 214 ? 64.778 9.055   3.907   1.00 17.51 ? 211  GLN A CG    1 
ATOM   1670 C  CD    . GLN A 1 214 ? 65.303 9.220   5.315   1.00 17.05 ? 211  GLN A CD    1 
ATOM   1671 O  OE1   . GLN A 1 214 ? 64.687 8.760   6.276   1.00 16.21 ? 211  GLN A OE1   1 
ATOM   1672 N  NE2   . GLN A 1 214 ? 66.458 9.864   5.441   1.00 23.14 ? 211  GLN A NE2   1 
ATOM   1673 N  N     . CYS A 1 215 ? 62.722 5.534   2.161   1.00 11.72 ? 212  CYS A N     1 
ATOM   1674 C  CA    . CYS A 1 215 ? 61.924 4.308   2.136   1.00 8.45  ? 212  CYS A CA    1 
ATOM   1675 C  C     . CYS A 1 215 ? 62.719 3.147   2.705   1.00 10.40 ? 212  CYS A C     1 
ATOM   1676 O  O     . CYS A 1 215 ? 63.928 3.257   2.949   1.00 13.13 ? 212  CYS A O     1 
ATOM   1677 C  CB    . CYS A 1 215 ? 61.513 3.958   0.712   1.00 9.29  ? 212  CYS A CB    1 
ATOM   1678 S  SG    . CYS A 1 215 ? 62.929 3.746   -0.400  1.00 19.41 ? 212  CYS A SG    1 
ATOM   1679 N  N     . SER A 1 216 ? 62.021 2.038   2.921   1.00 8.77  ? 213  SER A N     1 
ATOM   1680 C  CA    . SER A 1 216 ? 62.671 0.782   3.287   1.00 9.87  ? 213  SER A CA    1 
ATOM   1681 C  C     . SER A 1 216 ? 62.458 -0.219  2.158   1.00 10.91 ? 213  SER A C     1 
ATOM   1682 O  O     . SER A 1 216 ? 61.664 0.029   1.241   1.00 10.63 ? 213  SER A O     1 
ATOM   1683 C  CB    . SER A 1 216 ? 62.083 0.254   4.586   1.00 13.84 ? 213  SER A CB    1 
ATOM   1684 O  OG    . SER A 1 216 ? 62.255 1.214   5.622   1.00 14.72 ? 213  SER A OG    1 
ATOM   1685 N  N     . ALA A 1 217 ? 63.168 -1.344  2.200   1.00 9.67  ? 214  ALA A N     1 
ATOM   1686 C  CA    . ALA A 1 217 ? 63.003 -2.327  1.138   1.00 6.74  ? 214  ALA A CA    1 
ATOM   1687 C  C     . ALA A 1 217 ? 63.361 -3.714  1.623   1.00 8.17  ? 214  ALA A C     1 
ATOM   1688 O  O     . ALA A 1 217 ? 64.167 -3.859  2.539   1.00 8.79  ? 214  ALA A O     1 
ATOM   1689 C  CB    . ALA A 1 217 ? 63.881 -1.967  -0.060  1.00 7.29  ? 214  ALA A CB    1 
ATOM   1690 N  N     . GLY A 1 218 ? 62.747 -4.717  1.009   1.00 8.87  ? 215  GLY A N     1 
ATOM   1691 C  CA    . GLY A 1 218 ? 63.125 -6.104  1.229   1.00 6.94  ? 215  GLY A CA    1 
ATOM   1692 C  C     . GLY A 1 218 ? 63.631 -6.687  -0.070  1.00 9.78  ? 215  GLY A C     1 
ATOM   1693 O  O     . GLY A 1 218 ? 63.129 -6.360  -1.144  1.00 10.56 ? 215  GLY A O     1 
ATOM   1694 N  N     . ILE A 1 219 ? 64.648 -7.537  0.019   1.00 8.43  ? 216  ILE A N     1 
ATOM   1695 C  CA    . ILE A 1 219 ? 65.185 -8.210  -1.153  1.00 6.97  ? 216  ILE A CA    1 
ATOM   1696 C  C     . ILE A 1 219 ? 65.195 -9.709  -0.862  1.00 12.41 ? 216  ILE A C     1 
ATOM   1697 O  O     . ILE A 1 219 ? 65.783 -10.141 0.130   1.00 10.22 ? 216  ILE A O     1 
ATOM   1698 C  CB    . ILE A 1 219 ? 66.650 -7.742  -1.443  1.00 11.93 ? 216  ILE A CB    1 
ATOM   1699 C  CG1   . ILE A 1 219 ? 66.731 -6.211  -1.655  1.00 11.34 ? 216  ILE A CG1   1 
ATOM   1700 C  CG2   . ILE A 1 219 ? 67.238 -8.486  -2.644  1.00 11.92 ? 216  ILE A CG2   1 
ATOM   1701 C  CD1   . ILE A 1 219 ? 67.146 -5.409  -0.414  1.00 13.86 ? 216  ILE A CD1   1 
ATOM   1702 N  N     . SER A 1 220 ? 64.520 -10.497 -1.693  1.00 7.57  ? 217  SER A N     1 
ATOM   1703 C  CA    . SER A 1 220 ? 64.550 -11.949 -1.556  1.00 8.57  ? 217  SER A CA    1 
ATOM   1704 C  C     . SER A 1 220 ? 64.298 -12.587 -2.912  1.00 11.21 ? 217  SER A C     1 
ATOM   1705 O  O     . SER A 1 220 ? 64.510 -11.946 -3.941  1.00 11.22 ? 217  SER A O     1 
ATOM   1706 C  CB    . SER A 1 220 ? 63.509 -12.415 -0.527  1.00 11.96 ? 217  SER A CB    1 
ATOM   1707 O  OG    . SER A 1 220 ? 63.722 -13.772 -0.173  1.00 11.24 ? 217  SER A OG    1 
ATOM   1708 N  N     . HIS A 1 221 ? 63.843 -13.836 -2.911  1.00 9.22  ? 218  HIS A N     1 
ATOM   1709 C  CA    . HIS A 1 221 ? 63.618 -14.579 -4.145  1.00 8.52  ? 218  HIS A CA    1 
ATOM   1710 C  C     . HIS A 1 221 ? 62.171 -14.517 -4.662  1.00 8.98  ? 218  HIS A C     1 
ATOM   1711 O  O     . HIS A 1 221 ? 61.880 -15.026 -5.738  1.00 9.65  ? 218  HIS A O     1 
ATOM   1712 C  CB    . HIS A 1 221 ? 64.053 -16.045 -3.969  1.00 9.38  ? 218  HIS A CB    1 
ATOM   1713 C  CG    . HIS A 1 221 ? 65.535 -16.224 -3.864  1.00 14.36 ? 218  HIS A CG    1 
ATOM   1714 N  ND1   . HIS A 1 221 ? 66.393 -15.919 -4.898  1.00 13.16 ? 218  HIS A ND1   1 
ATOM   1715 C  CD2   . HIS A 1 221 ? 66.309 -16.676 -2.846  1.00 8.72  ? 218  HIS A CD2   1 
ATOM   1716 C  CE1   . HIS A 1 221 ? 67.636 -16.183 -4.525  1.00 14.10 ? 218  HIS A CE1   1 
ATOM   1717 N  NE2   . HIS A 1 221 ? 67.613 -16.639 -3.285  1.00 14.65 ? 218  HIS A NE2   1 
ATOM   1718 N  N     . ASN A 1 222 ? 61.270 -13.899 -3.908  1.00 7.95  ? 219  ASN A N     1 
ATOM   1719 C  CA    . ASN A 1 222 ? 59.870 -13.802 -4.326  1.00 8.98  ? 219  ASN A CA    1 
ATOM   1720 C  C     . ASN A 1 222 ? 59.179 -12.646 -3.619  1.00 10.40 ? 219  ASN A C     1 
ATOM   1721 O  O     . ASN A 1 222 ? 59.760 -12.014 -2.730  1.00 10.68 ? 219  ASN A O     1 
ATOM   1722 C  CB    . ASN A 1 222 ? 59.113 -15.125 -4.084  1.00 8.96  ? 219  ASN A CB    1 
ATOM   1723 C  CG    . ASN A 1 222 ? 59.184 -15.583 -2.630  1.00 11.13 ? 219  ASN A CG    1 
ATOM   1724 O  OD1   . ASN A 1 222 ? 58.676 -14.906 -1.748  1.00 9.24  ? 219  ASN A OD1   1 
ATOM   1725 N  ND2   . ASN A 1 222 ? 59.786 -16.747 -2.385  1.00 12.24 ? 219  ASN A ND2   1 
ATOM   1726 N  N     . LYS A 1 223 ? 57.945 -12.370 -4.015  1.00 10.36 ? 220  LYS A N     1 
ATOM   1727 C  CA    . LYS A 1 223 ? 57.211 -11.212 -3.496  1.00 8.45  ? 220  LYS A CA    1 
ATOM   1728 C  C     . LYS A 1 223 ? 56.881 -11.328 -2.013  1.00 9.61  ? 220  LYS A C     1 
ATOM   1729 O  O     . LYS A 1 223 ? 57.034 -10.363 -1.250  1.00 10.57 ? 220  LYS A O     1 
ATOM   1730 C  CB    . LYS A 1 223 ? 55.921 -11.010 -4.317  1.00 10.65 ? 220  LYS A CB    1 
ATOM   1731 C  CG    . LYS A 1 223 ? 56.165 -10.527 -5.731  1.00 13.41 ? 220  LYS A CG    1 
ATOM   1732 C  CD    . LYS A 1 223 ? 54.919 -10.732 -6.628  1.00 20.75 ? 220  LYS A CD    1 
ATOM   1733 C  CE    . LYS A 1 223 ? 53.932 -9.610  -6.494  1.00 20.14 ? 220  LYS A CE    1 
ATOM   1734 N  NZ    . LYS A 1 223 ? 52.763 -9.738  -7.444  1.00 16.35 ? 220  LYS A NZ    1 
ATOM   1735 N  N     . VAL A 1 224 ? 56.417 -12.502 -1.598  1.00 9.17  ? 221  VAL A N     1 
ATOM   1736 C  CA    . VAL A 1 224 ? 56.002 -12.673 -0.205  1.00 8.57  ? 221  VAL A CA    1 
ATOM   1737 C  C     . VAL A 1 224 ? 57.195 -12.477 0.731   1.00 11.23 ? 221  VAL A C     1 
ATOM   1738 O  O     . VAL A 1 224 ? 57.090 -11.761 1.733   1.00 11.03 ? 221  VAL A O     1 
ATOM   1739 C  CB    . VAL A 1 224 ? 55.312 -14.033 0.040   1.00 12.17 ? 221  VAL A CB    1 
ATOM   1740 C  CG1   . VAL A 1 224 ? 55.186 -14.320 1.531   1.00 15.02 ? 221  VAL A CG1   1 
ATOM   1741 C  CG2   . VAL A 1 224 ? 53.938 -14.019 -0.597  1.00 13.57 ? 221  VAL A CG2   1 
ATOM   1742 N  N     . LEU A 1 225 ? 58.330 -13.094 0.403   1.00 7.79  ? 222  LEU A N     1 
ATOM   1743 C  CA    . LEU A 1 225 ? 59.512 -12.921 1.257   1.00 8.53  ? 222  LEU A CA    1 
ATOM   1744 C  C     . LEU A 1 225 ? 60.069 -11.496 1.187   1.00 10.95 ? 222  LEU A C     1 
ATOM   1745 O  O     . LEU A 1 225 ? 60.578 -10.977 2.180   1.00 8.86  ? 222  LEU A O     1 
ATOM   1746 C  CB    . LEU A 1 225 ? 60.626 -13.912 0.905   1.00 6.02  ? 222  LEU A CB    1 
ATOM   1747 C  CG    . LEU A 1 225 ? 60.394 -15.383 1.293   1.00 9.50  ? 222  LEU A CG    1 
ATOM   1748 C  CD1   . LEU A 1 225 ? 61.628 -16.251 0.939   1.00 12.40 ? 222  LEU A CD1   1 
ATOM   1749 C  CD2   . LEU A 1 225 ? 60.060 -15.501 2.772   1.00 12.22 ? 222  LEU A CD2   1 
ATOM   1750 N  N     . ALA A 1 226 ? 60.000 -10.873 0.013   1.00 9.67  ? 223  ALA A N     1 
ATOM   1751 C  CA    . ALA A 1 226 ? 60.481 -9.499  -0.119  1.00 10.32 ? 223  ALA A CA    1 
ATOM   1752 C  C     . ALA A 1 226 ? 59.650 -8.557  0.752   1.00 9.65  ? 223  ALA A C     1 
ATOM   1753 O  O     . ALA A 1 226 ? 60.196 -7.663  1.425   1.00 9.91  ? 223  ALA A O     1 
ATOM   1754 C  CB    . ALA A 1 226 ? 60.441 -9.048  -1.569  1.00 8.49  ? 223  ALA A CB    1 
ATOM   1755 N  N     . LYS A 1 227 ? 58.334 -8.745  0.731   1.00 4.58  ? 224  LYS A N     1 
ATOM   1756 C  CA    . LYS A 1 227 ? 57.425 -7.928  1.530   1.00 10.57 ? 224  LYS A CA    1 
ATOM   1757 C  C     . LYS A 1 227 ? 57.691 -8.125  3.020   1.00 12.26 ? 224  LYS A C     1 
ATOM   1758 O  O     . LYS A 1 227 ? 57.763 -7.158  3.786   1.00 9.95  ? 224  LYS A O     1 
ATOM   1759 C  CB    . LYS A 1 227 ? 55.965 -8.284  1.212   1.00 8.92  ? 224  LYS A CB    1 
ATOM   1760 C  CG    . LYS A 1 227 ? 54.925 -7.608  2.131   1.00 14.80 ? 224  LYS A CG    1 
ATOM   1761 C  CD    A LYS A 1 227 ? 54.998 -6.089  2.037   0.75 19.41 ? 224  LYS A CD    1 
ATOM   1762 C  CD    B LYS A 1 227 ? 54.982 -6.093  2.016   0.25 19.37 ? 224  LYS A CD    1 
ATOM   1763 C  CE    A LYS A 1 227 ? 53.900 -5.435  2.874   0.75 25.53 ? 224  LYS A CE    1 
ATOM   1764 C  CE    B LYS A 1 227 ? 53.839 -5.436  2.782   0.25 25.29 ? 224  LYS A CE    1 
ATOM   1765 N  NZ    A LYS A 1 227 ? 52.577 -6.055  2.600   0.75 26.11 ? 224  LYS A NZ    1 
ATOM   1766 N  NZ    B LYS A 1 227 ? 53.957 -3.951  2.795   0.25 16.16 ? 224  LYS A NZ    1 
ATOM   1767 N  N     . LEU A 1 228 ? 57.845 -9.383  3.422   1.00 7.91  ? 225  LEU A N     1 
ATOM   1768 C  CA    . LEU A 1 228 ? 58.143 -9.701  4.812   1.00 7.71  ? 225  LEU A CA    1 
ATOM   1769 C  C     . LEU A 1 228 ? 59.482 -9.073  5.225   1.00 10.43 ? 225  LEU A C     1 
ATOM   1770 O  O     . LEU A 1 228 ? 59.583 -8.409  6.258   1.00 11.22 ? 225  LEU A O     1 
ATOM   1771 C  CB    . LEU A 1 228 ? 58.172 -11.223 5.015   1.00 11.75 ? 225  LEU A CB    1 
ATOM   1772 C  CG    . LEU A 1 228 ? 58.393 -11.682 6.458   1.00 13.74 ? 225  LEU A CG    1 
ATOM   1773 C  CD1   . LEU A 1 228 ? 57.224 -11.267 7.360   1.00 17.68 ? 225  LEU A CD1   1 
ATOM   1774 C  CD2   . LEU A 1 228 ? 58.604 -13.190 6.504   1.00 10.30 ? 225  LEU A CD2   1 
ATOM   1775 N  N     . ALA A 1 229 ? 60.501 -9.268  4.393   1.00 10.32 ? 226  ALA A N     1 
ATOM   1776 C  CA    . ALA A 1 229 ? 61.820 -8.677  4.613   1.00 12.54 ? 226  ALA A CA    1 
ATOM   1777 C  C     . ALA A 1 229 ? 61.771 -7.164  4.797   1.00 12.17 ? 226  ALA A C     1 
ATOM   1778 O  O     . ALA A 1 229 ? 62.434 -6.621  5.662   1.00 11.79 ? 226  ALA A O     1 
ATOM   1779 C  CB    . ALA A 1 229 ? 62.774 -9.032  3.465   1.00 10.88 ? 226  ALA A CB    1 
ATOM   1780 N  N     . CYS A 1 230 ? 60.996 -6.479  3.961   1.00 8.73  ? 227  CYS A N     1 
ATOM   1781 C  CA    . CYS A 1 230 ? 60.957 -5.026  4.024   1.00 9.77  ? 227  CYS A CA    1 
ATOM   1782 C  C     . CYS A 1 230 ? 60.578 -4.529  5.426   1.00 12.91 ? 227  CYS A C     1 
ATOM   1783 O  O     . CYS A 1 230 ? 61.171 -3.580  5.941   1.00 14.33 ? 227  CYS A O     1 
ATOM   1784 C  CB    . CYS A 1 230 ? 59.983 -4.499  2.969   1.00 10.97 ? 227  CYS A CB    1 
ATOM   1785 S  SG    . CYS A 1 230 ? 59.852 -2.701  2.911   1.00 12.90 ? 227  CYS A SG    1 
ATOM   1786 N  N     . GLY A 1 231 ? 59.609 -5.188  6.046   1.00 9.85  ? 228  GLY A N     1 
ATOM   1787 C  CA    . GLY A 1 231 ? 59.146 -4.797  7.373   1.00 9.14  ? 228  GLY A CA    1 
ATOM   1788 C  C     . GLY A 1 231 ? 60.071 -5.111  8.548   1.00 14.12 ? 228  GLY A C     1 
ATOM   1789 O  O     . GLY A 1 231 ? 59.787 -4.712  9.684   1.00 17.13 ? 228  GLY A O     1 
ATOM   1790 N  N     . LEU A 1 232 ? 61.176 -5.813  8.302   1.00 12.98 ? 229  LEU A N     1 
ATOM   1791 C  CA    . LEU A 1 232 ? 62.008 -6.298  9.409   1.00 13.41 ? 229  LEU A CA    1 
ATOM   1792 C  C     . LEU A 1 232 ? 62.870 -5.202  10.019  1.00 14.61 ? 229  LEU A C     1 
ATOM   1793 O  O     . LEU A 1 232 ? 63.215 -5.258  11.198  1.00 16.26 ? 229  LEU A O     1 
ATOM   1794 C  CB    . LEU A 1 232 ? 62.908 -7.466  8.967   1.00 14.09 ? 229  LEU A CB    1 
ATOM   1795 C  CG    . LEU A 1 232 ? 62.139 -8.750  8.639   1.00 14.32 ? 229  LEU A CG    1 
ATOM   1796 C  CD1   . LEU A 1 232 ? 63.084 -9.859  8.177   1.00 12.17 ? 229  LEU A CD1   1 
ATOM   1797 C  CD2   . LEU A 1 232 ? 61.291 -9.177  9.852   1.00 16.43 ? 229  LEU A CD2   1 
ATOM   1798 N  N     . ASN A 1 233 ? 63.220 -4.213  9.210   1.00 10.13 ? 230  ASN A N     1 
ATOM   1799 C  CA    . ASN A 1 233 ? 64.066 -3.119  9.654   1.00 13.62 ? 230  ASN A CA    1 
ATOM   1800 C  C     . ASN A 1 233 ? 63.601 -1.823  9.005   1.00 14.11 ? 230  ASN A C     1 
ATOM   1801 O  O     . ASN A 1 233 ? 63.996 -1.505  7.887   1.00 22.54 ? 230  ASN A O     1 
ATOM   1802 C  CB    . ASN A 1 233 ? 65.522 -3.379  9.273   1.00 11.23 ? 230  ASN A CB    1 
ATOM   1803 C  CG    . ASN A 1 233 ? 66.115 -4.569  10.003  1.00 12.41 ? 230  ASN A CG    1 
ATOM   1804 O  OD1   . ASN A 1 233 ? 66.456 -4.462  11.182  1.00 14.58 ? 230  ASN A OD1   1 
ATOM   1805 N  ND2   . ASN A 1 233 ? 66.273 -5.698  9.303   1.00 13.47 ? 230  ASN A ND2   1 
ATOM   1806 N  N     . LYS A 1 234 ? 62.726 -1.116  9.698   1.00 18.32 ? 231  LYS A N     1 
ATOM   1807 C  CA    . LYS A 1 234 ? 62.201 0.166   9.244   1.00 14.86 ? 231  LYS A CA    1 
ATOM   1808 C  C     . LYS A 1 234 ? 62.516 1.140   10.365  1.00 16.60 ? 231  LYS A C     1 
ATOM   1809 O  O     . LYS A 1 234 ? 62.673 0.732   11.523  1.00 19.85 ? 231  LYS A O     1 
ATOM   1810 C  CB    . LYS A 1 234 ? 60.672 0.098   9.011   1.00 18.47 ? 231  LYS A CB    1 
ATOM   1811 C  CG    . LYS A 1 234 ? 60.211 -0.365  7.605   1.00 20.88 ? 231  LYS A CG    1 
ATOM   1812 C  CD    . LYS A 1 234 ? 58.751 0.083   7.306   1.00 26.72 ? 231  LYS A CD    1 
ATOM   1813 C  CE    . LYS A 1 234 ? 58.401 0.148   5.789   1.00 26.96 ? 231  LYS A CE    1 
ATOM   1814 N  NZ    . LYS A 1 234 ? 58.312 1.569   5.206   1.00 12.87 ? 231  LYS A NZ    1 
ATOM   1815 N  N     . PRO A 1 235 ? 62.649 2.434   10.047  1.00 14.58 ? 232  PRO A N     1 
ATOM   1816 C  CA    . PRO A 1 235 ? 62.581 3.066   8.729   1.00 14.40 ? 232  PRO A CA    1 
ATOM   1817 C  C     . PRO A 1 235 ? 63.958 3.212   8.085   1.00 11.65 ? 232  PRO A C     1 
ATOM   1818 O  O     . PRO A 1 235 ? 64.980 2.981   8.726   1.00 12.55 ? 232  PRO A O     1 
ATOM   1819 C  CB    . PRO A 1 235 ? 62.044 4.458   9.062   1.00 17.01 ? 232  PRO A CB    1 
ATOM   1820 C  CG    . PRO A 1 235 ? 62.669 4.764   10.407  1.00 15.10 ? 232  PRO A CG    1 
ATOM   1821 C  CD    . PRO A 1 235 ? 62.788 3.429   11.125  1.00 17.49 ? 232  PRO A CD    1 
ATOM   1822 N  N     . ASN A 1 236 ? 63.970 3.585   6.812   1.00 12.26 ? 233  ASN A N     1 
ATOM   1823 C  CA    . ASN A 1 236 ? 65.204 3.977   6.126   1.00 13.90 ? 233  ASN A CA    1 
ATOM   1824 C  C     . ASN A 1 236 ? 66.286 2.891   6.064   1.00 10.71 ? 233  ASN A C     1 
ATOM   1825 O  O     . ASN A 1 236 ? 67.473 3.186   6.094   1.00 11.96 ? 233  ASN A O     1 
ATOM   1826 C  CB    . ASN A 1 236 ? 65.767 5.271   6.737   1.00 14.39 ? 233  ASN A CB    1 
ATOM   1827 C  CG    . ASN A 1 236 ? 66.758 5.970   5.824   1.00 17.21 ? 233  ASN A CG    1 
ATOM   1828 O  OD1   . ASN A 1 236 ? 66.639 5.907   4.611   1.00 14.43 ? 233  ASN A OD1   1 
ATOM   1829 N  ND2   . ASN A 1 236 ? 67.748 6.637   6.413   1.00 21.21 ? 233  ASN A ND2   1 
ATOM   1830 N  N     . ARG A 1 237 ? 65.876 1.630   5.947   1.00 10.12 ? 234  ARG A N     1 
ATOM   1831 C  CA    . ARG A 1 237 ? 66.846 0.534   5.891   1.00 11.38 ? 234  ARG A CA    1 
ATOM   1832 C  C     . ARG A 1 237 ? 66.325 -0.516  4.944   1.00 10.55 ? 234  ARG A C     1 
ATOM   1833 O  O     . ARG A 1 237 ? 65.160 -0.489  4.595   1.00 10.54 ? 234  ARG A O     1 
ATOM   1834 C  CB    . ARG A 1 237 ? 67.026 -0.118  7.266   1.00 14.01 ? 234  ARG A CB    1 
ATOM   1835 C  CG    . ARG A 1 237 ? 67.704 0.757   8.321   1.00 13.28 ? 234  ARG A CG    1 
ATOM   1836 C  CD    . ARG A 1 237 ? 69.161 1.054   7.979   1.00 20.45 ? 234  ARG A CD    1 
ATOM   1837 N  NE    . ARG A 1 237 ? 69.814 1.840   9.033   1.00 23.75 ? 234  ARG A NE    1 
ATOM   1838 C  CZ    . ARG A 1 237 ? 69.897 3.171   9.038   1.00 31.48 ? 234  ARG A CZ    1 
ATOM   1839 N  NH1   . ARG A 1 237 ? 69.383 3.885   8.042   1.00 22.21 ? 234  ARG A NH1   1 
ATOM   1840 N  NH2   . ARG A 1 237 ? 70.498 3.795   10.041  1.00 32.02 ? 234  ARG A NH2   1 
ATOM   1841 N  N     . GLN A 1 238 ? 67.188 -1.436  4.529   1.00 8.32  ? 235  GLN A N     1 
ATOM   1842 C  CA    . GLN A 1 238 ? 66.745 -2.543  3.684   1.00 8.92  ? 235  GLN A CA    1 
ATOM   1843 C  C     . GLN A 1 238 ? 67.259 -3.885  4.217   1.00 10.23 ? 235  GLN A C     1 
ATOM   1844 O  O     . GLN A 1 238 ? 68.289 -3.939  4.885   1.00 12.27 ? 235  GLN A O     1 
ATOM   1845 C  CB    . GLN A 1 238 ? 67.172 -2.323  2.236   1.00 10.16 ? 235  GLN A CB    1 
ATOM   1846 C  CG    . GLN A 1 238 ? 68.667 -2.177  2.040   1.00 11.35 ? 235  GLN A CG    1 
ATOM   1847 C  CD    . GLN A 1 238 ? 69.021 -1.915  0.588   1.00 14.65 ? 235  GLN A CD    1 
ATOM   1848 O  OE1   . GLN A 1 238 ? 68.605 -0.910  0.007   1.00 17.08 ? 235  GLN A OE1   1 
ATOM   1849 N  NE2   . GLN A 1 238 ? 69.759 -2.839  -0.019  1.00 11.44 ? 235  GLN A NE2   1 
ATOM   1850 N  N     . THR A 1 239 ? 66.520 -4.959  3.944   1.00 7.43  ? 236  THR A N     1 
ATOM   1851 C  CA    . THR A 1 239 ? 66.817 -6.255  4.555   1.00 10.48 ? 236  THR A CA    1 
ATOM   1852 C  C     . THR A 1 239 ? 66.852 -7.346  3.496   1.00 11.24 ? 236  THR A C     1 
ATOM   1853 O  O     . THR A 1 239 ? 65.939 -7.445  2.691   1.00 9.51  ? 236  THR A O     1 
ATOM   1854 C  CB    . THR A 1 239 ? 65.759 -6.612  5.611   1.00 12.88 ? 236  THR A CB    1 
ATOM   1855 O  OG1   . THR A 1 239 ? 65.672 -5.557  6.580   1.00 12.34 ? 236  THR A OG1   1 
ATOM   1856 C  CG2   . THR A 1 239 ? 66.103 -7.949  6.327   1.00 11.18 ? 236  THR A CG2   1 
ATOM   1857 N  N     . LEU A 1 240 ? 67.906 -8.164  3.514   1.00 7.90  ? 237  LEU A N     1 
ATOM   1858 C  CA    . LEU A 1 240 ? 68.050 -9.273  2.584   1.00 6.88  ? 237  LEU A CA    1 
ATOM   1859 C  C     . LEU A 1 240 ? 67.638 -10.550 3.319   1.00 9.83  ? 237  LEU A C     1 
ATOM   1860 O  O     . LEU A 1 240 ? 68.175 -10.849 4.376   1.00 10.21 ? 237  LEU A O     1 
ATOM   1861 C  CB    . LEU A 1 240 ? 69.505 -9.362  2.105   1.00 10.45 ? 237  LEU A CB    1 
ATOM   1862 C  CG    . LEU A 1 240 ? 69.924 -10.387 1.051   1.00 11.10 ? 237  LEU A CG    1 
ATOM   1863 C  CD1   . LEU A 1 240 ? 71.284 -9.990  0.437   1.00 13.93 ? 237  LEU A CD1   1 
ATOM   1864 C  CD2   . LEU A 1 240 ? 70.001 -11.789 1.649   1.00 10.01 ? 237  LEU A CD2   1 
ATOM   1865 N  N     . VAL A 1 241 ? 66.654 -11.263 2.776   1.00 7.66  ? 238  VAL A N     1 
ATOM   1866 C  CA    . VAL A 1 241 ? 66.234 -12.551 3.329   1.00 9.13  ? 238  VAL A CA    1 
ATOM   1867 C  C     . VAL A 1 241 ? 66.604 -13.662 2.353   1.00 11.08 ? 238  VAL A C     1 
ATOM   1868 O  O     . VAL A 1 241 ? 66.011 -13.806 1.279   1.00 9.75  ? 238  VAL A O     1 
ATOM   1869 C  CB    . VAL A 1 241 ? 64.726 -12.579 3.631   1.00 9.76  ? 238  VAL A CB    1 
ATOM   1870 C  CG1   . VAL A 1 241 ? 64.222 -14.036 3.833   1.00 10.96 ? 238  VAL A CG1   1 
ATOM   1871 C  CG2   . VAL A 1 241 ? 64.414 -11.713 4.854   1.00 9.18  ? 238  VAL A CG2   1 
ATOM   1872 N  N     . SER A 1 242 ? 67.625 -14.429 2.714   1.00 9.98  ? 239  SER A N     1 
ATOM   1873 C  CA    . SER A 1 242 ? 68.096 -15.497 1.848   1.00 11.75 ? 239  SER A CA    1 
ATOM   1874 C  C     . SER A 1 242 ? 67.229 -16.750 1.976   1.00 8.31  ? 239  SER A C     1 
ATOM   1875 O  O     . SER A 1 242 ? 66.454 -16.888 2.919   1.00 9.39  ? 239  SER A O     1 
ATOM   1876 C  CB    . SER A 1 242 ? 69.548 -15.831 2.193   1.00 14.54 ? 239  SER A CB    1 
ATOM   1877 O  OG    . SER A 1 242 ? 69.601 -16.362 3.506   1.00 13.54 ? 239  SER A OG    1 
ATOM   1878 N  N     . HIS A 1 243 ? 67.367 -17.667 1.024   1.00 9.49  ? 240  HIS A N     1 
ATOM   1879 C  CA    . HIS A 1 243 ? 66.635 -18.920 1.109   1.00 11.11 ? 240  HIS A CA    1 
ATOM   1880 C  C     . HIS A 1 243 ? 67.026 -19.646 2.391   1.00 12.17 ? 240  HIS A C     1 
ATOM   1881 O  O     . HIS A 1 243 ? 66.176 -20.213 3.080   1.00 11.26 ? 240  HIS A O     1 
ATOM   1882 C  CB    . HIS A 1 243 ? 66.927 -19.821 -0.090  1.00 12.06 ? 240  HIS A CB    1 
ATOM   1883 C  CG    . HIS A 1 243 ? 66.149 -21.101 -0.072  1.00 12.57 ? 240  HIS A CG    1 
ATOM   1884 N  ND1   . HIS A 1 243 ? 64.800 -21.153 -0.335  1.00 14.05 ? 240  HIS A ND1   1 
ATOM   1885 C  CD2   . HIS A 1 243 ? 66.528 -22.373 0.205   1.00 15.34 ? 240  HIS A CD2   1 
ATOM   1886 C  CE1   . HIS A 1 243 ? 64.381 -22.403 -0.241  1.00 16.89 ? 240  HIS A CE1   1 
ATOM   1887 N  NE2   . HIS A 1 243 ? 65.411 -23.164 0.087   1.00 18.00 ? 240  HIS A NE2   1 
ATOM   1888 N  N     . GLY A 1 244 ? 68.313 -19.590 2.709   1.00 11.23 ? 241  GLY A N     1 
ATOM   1889 C  CA    . GLY A 1 244 ? 68.850 -20.277 3.875   1.00 13.91 ? 241  GLY A CA    1 
ATOM   1890 C  C     . GLY A 1 244 ? 68.301 -19.754 5.188   1.00 14.62 ? 241  GLY A C     1 
ATOM   1891 O  O     . GLY A 1 244 ? 68.240 -20.492 6.172   1.00 14.25 ? 241  GLY A O     1 
ATOM   1892 N  N     . SER A 1 245 ? 67.888 -18.488 5.204   1.00 8.41  ? 242  SER A N     1 
ATOM   1893 C  CA    . SER A 1 245 ? 67.402 -17.852 6.430   1.00 9.91  ? 242  SER A CA    1 
ATOM   1894 C  C     . SER A 1 245 ? 65.976 -18.252 6.772   1.00 8.82  ? 242  SER A C     1 
ATOM   1895 O  O     . SER A 1 245 ? 65.519 -18.002 7.872   1.00 8.40  ? 242  SER A O     1 
ATOM   1896 C  CB    . SER A 1 245 ? 67.488 -16.321 6.332   1.00 13.92 ? 242  SER A CB    1 
ATOM   1897 O  OG    . SER A 1 245 ? 66.454 -15.802 5.501   1.00 12.90 ? 242  SER A OG    1 
ATOM   1898 N  N     . VAL A 1 246 ? 65.288 -18.889 5.834   1.00 9.72  ? 243  VAL A N     1 
ATOM   1899 C  CA    . VAL A 1 246 ? 63.863 -19.143 6.012   1.00 8.84  ? 243  VAL A CA    1 
ATOM   1900 C  C     . VAL A 1 246 ? 63.492 -20.080 7.184   1.00 8.30  ? 243  VAL A C     1 
ATOM   1901 O  O     . VAL A 1 246 ? 62.617 -19.752 7.970   1.00 9.46  ? 243  VAL A O     1 
ATOM   1902 C  CB    . VAL A 1 246 ? 63.201 -19.589 4.687   1.00 9.15  ? 243  VAL A CB    1 
ATOM   1903 C  CG1   . VAL A 1 246 ? 61.777 -20.118 4.944   1.00 9.02  ? 243  VAL A CG1   1 
ATOM   1904 C  CG2   . VAL A 1 246 ? 63.180 -18.417 3.731   1.00 11.22 ? 243  VAL A CG2   1 
ATOM   1905 N  N     . PRO A 1 247 ? 64.171 -21.235 7.324   1.00 9.70  ? 244  PRO A N     1 
ATOM   1906 C  CA    . PRO A 1 247 ? 63.759 -22.113 8.431   1.00 9.13  ? 244  PRO A CA    1 
ATOM   1907 C  C     . PRO A 1 247 ? 63.803 -21.440 9.798   1.00 10.09 ? 244  PRO A C     1 
ATOM   1908 O  O     . PRO A 1 247 ? 62.842 -21.590 10.545  1.00 10.41 ? 244  PRO A O     1 
ATOM   1909 C  CB    . PRO A 1 247 ? 64.762 -23.270 8.360   1.00 10.75 ? 244  PRO A CB    1 
ATOM   1910 C  CG    . PRO A 1 247 ? 65.122 -23.330 6.886   1.00 13.54 ? 244  PRO A CG    1 
ATOM   1911 C  CD    . PRO A 1 247 ? 65.212 -21.866 6.484   1.00 10.59 ? 244  PRO A CD    1 
ATOM   1912 N  N     . GLN A 1 248 ? 64.869 -20.714 10.120  1.00 9.92  ? 245  GLN A N     1 
ATOM   1913 C  CA    . GLN A 1 248 ? 64.926 -20.042 11.417  1.00 10.10 ? 245  GLN A CA    1 
ATOM   1914 C  C     . GLN A 1 248 ? 63.930 -18.885 11.486  1.00 10.24 ? 245  GLN A C     1 
ATOM   1915 O  O     . GLN A 1 248 ? 63.219 -18.714 12.483  1.00 9.30  ? 245  GLN A O     1 
ATOM   1916 C  CB    . GLN A 1 248 ? 66.335 -19.555 11.725  1.00 11.39 ? 245  GLN A CB    1 
ATOM   1917 C  CG    . GLN A 1 248 ? 67.300 -20.698 11.993  1.00 18.98 ? 245  GLN A CG    1 
ATOM   1918 C  CD    . GLN A 1 248 ? 68.313 -20.361 13.060  1.00 31.69 ? 245  GLN A CD    1 
ATOM   1919 O  OE1   . GLN A 1 248 ? 67.977 -20.288 14.248  1.00 36.85 ? 245  GLN A OE1   1 
ATOM   1920 N  NE2   . GLN A 1 248 ? 69.566 -20.158 12.650  1.00 22.46 ? 245  GLN A NE2   1 
ATOM   1921 N  N     . LEU A 1 249 ? 63.885 -18.088 10.425  1.00 9.74  ? 246  LEU A N     1 
ATOM   1922 C  CA    . LEU A 1 249 ? 62.939 -16.973 10.371  1.00 10.55 ? 246  LEU A CA    1 
ATOM   1923 C  C     . LEU A 1 249 ? 61.507 -17.447 10.581  1.00 8.53  ? 246  LEU A C     1 
ATOM   1924 O  O     . LEU A 1 249 ? 60.755 -16.869 11.374  1.00 10.49 ? 246  LEU A O     1 
ATOM   1925 C  CB    . LEU A 1 249 ? 63.054 -16.245 9.038   1.00 9.64  ? 246  LEU A CB    1 
ATOM   1926 C  CG    . LEU A 1 249 ? 62.175 -15.002 8.880   1.00 15.56 ? 246  LEU A CG    1 
ATOM   1927 C  CD1   . LEU A 1 249 ? 62.477 -13.965 9.962   1.00 13.41 ? 246  LEU A CD1   1 
ATOM   1928 C  CD2   . LEU A 1 249 ? 62.374 -14.405 7.506   1.00 16.08 ? 246  LEU A CD2   1 
ATOM   1929 N  N     . PHE A 1 250 ? 61.118 -18.507 9.877   1.00 7.92  ? 247  PHE A N     1 
ATOM   1930 C  CA    . PHE A 1 250 ? 59.747 -18.996 9.985   1.00 10.21 ? 247  PHE A CA    1 
ATOM   1931 C  C     . PHE A 1 250 ? 59.437 -19.768 11.259  1.00 8.80  ? 247  PHE A C     1 
ATOM   1932 O  O     . PHE A 1 250 ? 58.264 -19.968 11.576  1.00 10.84 ? 247  PHE A O     1 
ATOM   1933 C  CB    . PHE A 1 250 ? 59.397 -19.870 8.787   1.00 7.88  ? 247  PHE A CB    1 
ATOM   1934 C  CG    . PHE A 1 250 ? 59.005 -19.098 7.573   1.00 7.08  ? 247  PHE A CG    1 
ATOM   1935 C  CD1   . PHE A 1 250 ? 58.507 -19.760 6.457   1.00 8.40  ? 247  PHE A CD1   1 
ATOM   1936 C  CD2   . PHE A 1 250 ? 59.157 -17.715 7.529   1.00 11.84 ? 247  PHE A CD2   1 
ATOM   1937 C  CE1   . PHE A 1 250 ? 58.148 -19.059 5.328   1.00 11.77 ? 247  PHE A CE1   1 
ATOM   1938 C  CE2   . PHE A 1 250 ? 58.804 -16.999 6.392   1.00 11.60 ? 247  PHE A CE2   1 
ATOM   1939 C  CZ    . PHE A 1 250 ? 58.288 -17.673 5.294   1.00 9.31  ? 247  PHE A CZ    1 
ATOM   1940 N  N     . SER A 1 251 ? 60.473 -20.206 11.975  1.00 6.61  ? 248  SER A N     1 
ATOM   1941 C  CA    . SER A 1 251 ? 60.268 -21.082 13.123  1.00 9.28  ? 248  SER A CA    1 
ATOM   1942 C  C     . SER A 1 251 ? 59.485 -20.380 14.233  1.00 10.28 ? 248  SER A C     1 
ATOM   1943 O  O     . SER A 1 251 ? 58.853 -21.040 15.055  1.00 8.31  ? 248  SER A O     1 
ATOM   1944 C  CB    . SER A 1 251 ? 61.604 -21.613 13.673  1.00 10.17 ? 248  SER A CB    1 
ATOM   1945 O  OG    . SER A 1 251 ? 62.347 -20.592 14.330  1.00 10.34 ? 248  SER A OG    1 
ATOM   1946 N  N     . GLN A 1 252 ? 59.546 -19.046 14.260  1.00 10.00 ? 249  GLN A N     1 
ATOM   1947 C  CA    . GLN A 1 252 ? 58.798 -18.272 15.260  1.00 10.65 ? 249  GLN A CA    1 
ATOM   1948 C  C     . GLN A 1 252 ? 57.957 -17.148 14.653  1.00 11.78 ? 249  GLN A C     1 
ATOM   1949 O  O     . GLN A 1 252 ? 57.619 -16.190 15.350  1.00 14.15 ? 249  GLN A O     1 
ATOM   1950 C  CB    . GLN A 1 252 ? 59.746 -17.629 16.272  1.00 14.65 ? 249  GLN A CB    1 
ATOM   1951 C  CG    . GLN A 1 252 ? 60.634 -18.581 17.034  1.00 15.45 ? 249  GLN A CG    1 
ATOM   1952 C  CD    . GLN A 1 252 ? 61.387 -17.852 18.116  1.00 27.11 ? 249  GLN A CD    1 
ATOM   1953 O  OE1   . GLN A 1 252 ? 60.883 -17.675 19.230  1.00 20.41 ? 249  GLN A OE1   1 
ATOM   1954 N  NE2   . GLN A 1 252 ? 62.585 -17.381 17.785  1.00 19.33 ? 249  GLN A NE2   1 
ATOM   1955 N  N     . MET A 1 253 ? 57.658 -17.248 13.363  1.00 12.16 ? 250  MET A N     1 
ATOM   1956 C  CA    . MET A 1 253 ? 56.945 -16.197 12.646  1.00 10.04 ? 250  MET A CA    1 
ATOM   1957 C  C     . MET A 1 253 ? 55.451 -16.517 12.707  1.00 11.34 ? 250  MET A C     1 
ATOM   1958 O  O     . MET A 1 253 ? 55.007 -17.488 12.126  1.00 10.06 ? 250  MET A O     1 
ATOM   1959 C  CB    . MET A 1 253 ? 57.432 -16.155 11.187  1.00 10.62 ? 250  MET A CB    1 
ATOM   1960 C  CG    . MET A 1 253 ? 56.791 -15.066 10.306  1.00 17.30 ? 250  MET A CG    1 
ATOM   1961 S  SD    . MET A 1 253 ? 57.097 -13.391 10.911  1.00 18.50 ? 250  MET A SD    1 
ATOM   1962 C  CE    . MET A 1 253 ? 58.875 -13.194 10.737  1.00 14.16 ? 250  MET A CE    1 
ATOM   1963 N  N     . PRO A 1 254 ? 54.666 -15.687 13.408  1.00 12.85 ? 251  PRO A N     1 
ATOM   1964 C  CA    . PRO A 1 254 ? 53.217 -15.929 13.436  1.00 10.59 ? 251  PRO A CA    1 
ATOM   1965 C  C     . PRO A 1 254 ? 52.659 -15.963 12.015  1.00 9.76  ? 251  PRO A C     1 
ATOM   1966 O  O     . PRO A 1 254 ? 53.049 -15.161 11.175  1.00 10.01 ? 251  PRO A O     1 
ATOM   1967 C  CB    . PRO A 1 254 ? 52.666 -14.709 14.194  1.00 10.91 ? 251  PRO A CB    1 
ATOM   1968 C  CG    . PRO A 1 254 ? 53.839 -14.198 14.974  1.00 13.46 ? 251  PRO A CG    1 
ATOM   1969 C  CD    . PRO A 1 254 ? 55.035 -14.443 14.097  1.00 14.59 ? 251  PRO A CD    1 
ATOM   1970 N  N     . ILE A 1 255 ? 51.753 -16.893 11.765  1.00 10.91 ? 252  ILE A N     1 
ATOM   1971 C  CA    . ILE A 1 255 ? 51.167 -17.061 10.446  1.00 13.80 ? 252  ILE A CA    1 
ATOM   1972 C  C     . ILE A 1 255 ? 50.586 -15.748 9.879   1.00 11.18 ? 252  ILE A C     1 
ATOM   1973 O  O     . ILE A 1 255 ? 50.710 -15.475 8.684   1.00 11.18 ? 252  ILE A O     1 
ATOM   1974 C  CB    . ILE A 1 255 ? 50.146 -18.214 10.477  1.00 13.13 ? 252  ILE A CB    1 
ATOM   1975 C  CG1   . ILE A 1 255 ? 50.905 -19.547 10.587  1.00 16.84 ? 252  ILE A CG1   1 
ATOM   1976 C  CG2   . ILE A 1 255 ? 49.256 -18.209 9.244   1.00 17.03 ? 252  ILE A CG2   1 
ATOM   1977 C  CD1   . ILE A 1 255 ? 50.086 -20.669 11.141  1.00 19.56 ? 252  ILE A CD1   1 
ATOM   1978 N  N     . ARG A 1 256 ? 49.992 -14.921 10.743  1.00 9.45  ? 253  ARG A N     1 
ATOM   1979 C  CA    . ARG A 1 256 ? 49.280 -13.734 10.281  1.00 11.73 ? 253  ARG A CA    1 
ATOM   1980 C  C     . ARG A 1 256 ? 50.219 -12.676 9.706   1.00 13.88 ? 253  ARG A C     1 
ATOM   1981 O  O     . ARG A 1 256 ? 49.764 -11.701 9.111   1.00 13.20 ? 253  ARG A O     1 
ATOM   1982 C  CB    . ARG A 1 256 ? 48.464 -13.117 11.421  1.00 12.48 ? 253  ARG A CB    1 
ATOM   1983 C  CG    . ARG A 1 256 ? 49.337 -12.558 12.529  1.00 12.88 ? 253  ARG A CG    1 
ATOM   1984 C  CD    . ARG A 1 256 ? 48.525 -11.899 13.650  1.00 19.73 ? 253  ARG A CD    1 
ATOM   1985 N  NE    . ARG A 1 256 ? 49.401 -11.426 14.724  1.00 18.43 ? 253  ARG A NE    1 
ATOM   1986 C  CZ    . ARG A 1 256 ? 49.827 -12.178 15.739  1.00 23.71 ? 253  ARG A CZ    1 
ATOM   1987 N  NH1   . ARG A 1 256 ? 49.452 -13.444 15.837  1.00 20.26 ? 253  ARG A NH1   1 
ATOM   1988 N  NH2   . ARG A 1 256 ? 50.633 -11.662 16.660  1.00 22.30 ? 253  ARG A NH2   1 
ATOM   1989 N  N     . LYS A 1 257 ? 51.528 -12.852 9.891   1.00 11.53 ? 254  LYS A N     1 
ATOM   1990 C  CA    . LYS A 1 257 ? 52.482 -11.868 9.396   1.00 12.22 ? 254  LYS A CA    1 
ATOM   1991 C  C     . LYS A 1 257 ? 52.757 -12.020 7.910   1.00 15.67 ? 254  LYS A C     1 
ATOM   1992 O  O     . LYS A 1 257 ? 53.330 -11.121 7.286   1.00 14.71 ? 254  LYS A O     1 
ATOM   1993 C  CB    . LYS A 1 257 ? 53.810 -11.953 10.150  1.00 11.65 ? 254  LYS A CB    1 
ATOM   1994 C  CG    . LYS A 1 257 ? 53.698 -11.765 11.654  1.00 16.46 ? 254  LYS A CG    1 
ATOM   1995 C  CD    . LYS A 1 257 ? 53.113 -10.420 12.035  1.00 21.27 ? 254  LYS A CD    1 
ATOM   1996 C  CE    . LYS A 1 257 ? 53.139 -10.265 13.567  1.00 29.35 ? 254  LYS A CE    1 
ATOM   1997 N  NZ    . LYS A 1 257 ? 52.724 -8.909  14.033  1.00 32.02 ? 254  LYS A NZ    1 
ATOM   1998 N  N     . ILE A 1 258 ? 52.393 -13.174 7.354   1.00 12.22 ? 255  ILE A N     1 
ATOM   1999 C  CA    . ILE A 1 258 ? 52.649 -13.443 5.944   1.00 8.43  ? 255  ILE A CA    1 
ATOM   2000 C  C     . ILE A 1 258 ? 51.514 -12.878 5.097   1.00 13.55 ? 255  ILE A C     1 
ATOM   2001 O  O     . ILE A 1 258 ? 50.333 -13.062 5.419   1.00 13.65 ? 255  ILE A O     1 
ATOM   2002 C  CB    . ILE A 1 258 ? 52.811 -14.953 5.694   1.00 15.77 ? 255  ILE A CB    1 
ATOM   2003 C  CG1   . ILE A 1 258 ? 54.200 -15.426 6.144   1.00 20.34 ? 255  ILE A CG1   1 
ATOM   2004 C  CG2   . ILE A 1 258 ? 52.599 -15.278 4.247   1.00 11.08 ? 255  ILE A CG2   1 
ATOM   2005 C  CD1   . ILE A 1 258 ? 54.348 -15.540 7.628   1.00 23.36 ? 255  ILE A CD1   1 
ATOM   2006 N  N     . ARG A 1 259 ? 51.863 -12.173 4.026   1.00 13.13 ? 256  ARG A N     1 
ATOM   2007 C  CA    . ARG A 1 259 ? 50.850 -11.510 3.210   1.00 13.47 ? 256  ARG A CA    1 
ATOM   2008 C  C     . ARG A 1 259 ? 49.790 -12.496 2.699   1.00 15.02 ? 256  ARG A C     1 
ATOM   2009 O  O     . ARG A 1 259 ? 50.128 -13.530 2.129   1.00 14.71 ? 256  ARG A O     1 
ATOM   2010 C  CB    . ARG A 1 259 ? 51.511 -10.790 2.025   1.00 17.06 ? 256  ARG A CB    1 
ATOM   2011 C  CG    . ARG A 1 259 ? 50.559 -9.921  1.212   1.00 22.36 ? 256  ARG A CG    1 
ATOM   2012 C  CD    . ARG A 1 259 ? 51.135 -9.629  -0.175  1.00 24.78 ? 256  ARG A CD    1 
ATOM   2013 N  NE    . ARG A 1 259 ? 50.765 -10.662 -1.137  1.00 41.36 ? 256  ARG A NE    1 
ATOM   2014 C  CZ    . ARG A 1 259 ? 51.243 -10.756 -2.377  1.00 51.95 ? 256  ARG A CZ    1 
ATOM   2015 N  NH1   . ARG A 1 259 ? 50.823 -11.737 -3.168  1.00 55.20 ? 256  ARG A NH1   1 
ATOM   2016 N  NH2   . ARG A 1 259 ? 52.135 -9.881  -2.834  1.00 30.17 ? 256  ARG A NH2   1 
ATOM   2017 N  N     . SER A 1 260 ? 48.521 -12.148 2.916   1.00 15.98 ? 257  SER A N     1 
ATOM   2018 C  CA    . SER A 1 260 ? 47.343 -12.935 2.512   1.00 17.61 ? 257  SER A CA    1 
ATOM   2019 C  C     . SER A 1 260 ? 46.830 -13.850 3.627   1.00 17.18 ? 257  SER A C     1 
ATOM   2020 O  O     . SER A 1 260 ? 45.741 -14.422 3.518   1.00 12.58 ? 257  SER A O     1 
ATOM   2021 C  CB    . SER A 1 260 ? 47.586 -13.723 1.215   1.00 17.95 ? 257  SER A CB    1 
ATOM   2022 O  OG    . SER A 1 260 ? 48.122 -15.013 1.470   1.00 18.35 ? 257  SER A OG    1 
ATOM   2023 N  N     . LEU A 1 261 ? 47.618 -13.984 4.695   1.00 11.68 ? 258  LEU A N     1 
ATOM   2024 C  CA    . LEU A 1 261 ? 47.216 -14.793 5.842   1.00 11.23 ? 258  LEU A CA    1 
ATOM   2025 C  C     . LEU A 1 261 ? 46.845 -13.961 7.075   1.00 13.52 ? 258  LEU A C     1 
ATOM   2026 O  O     . LEU A 1 261 ? 46.683 -14.496 8.181   1.00 13.43 ? 258  LEU A O     1 
ATOM   2027 C  CB    . LEU A 1 261 ? 48.319 -15.806 6.182   1.00 12.22 ? 258  LEU A CB    1 
ATOM   2028 C  CG    . LEU A 1 261 ? 48.705 -16.787 5.066   1.00 13.35 ? 258  LEU A CG    1 
ATOM   2029 C  CD1   . LEU A 1 261 ? 49.860 -17.660 5.520   1.00 11.32 ? 258  LEU A CD1   1 
ATOM   2030 C  CD2   . LEU A 1 261 ? 47.520 -17.669 4.634   1.00 13.26 ? 258  LEU A CD2   1 
ATOM   2031 N  N     . GLY A 1 262 ? 46.695 -12.651 6.895   1.00 12.93 ? 259  GLY A N     1 
ATOM   2032 C  CA    . GLY A 1 262 ? 46.388 -11.783 8.014   1.00 13.90 ? 259  GLY A CA    1 
ATOM   2033 C  C     . GLY A 1 262 ? 44.917 -11.715 8.389   1.00 18.97 ? 259  GLY A C     1 
ATOM   2034 O  O     . GLY A 1 262 ? 44.549 -11.025 9.343   1.00 16.66 ? 259  GLY A O     1 
ATOM   2035 N  N     . GLY A 1 263 ? 44.082 -12.434 7.641   1.00 15.76 ? 260  GLY A N     1 
ATOM   2036 C  CA    . GLY A 1 263 ? 42.646 -12.408 7.830   1.00 14.62 ? 260  GLY A CA    1 
ATOM   2037 C  C     . GLY A 1 263 ? 42.036 -13.758 8.162   1.00 16.54 ? 260  GLY A C     1 
ATOM   2038 O  O     . GLY A 1 263 ? 42.594 -14.542 8.945   1.00 15.46 ? 260  GLY A O     1 
ATOM   2039 N  N     . LYS A 1 264 ? 40.888 -14.046 7.555   1.00 17.73 ? 261  LYS A N     1 
ATOM   2040 C  CA    . LYS A 1 264 ? 40.125 -15.244 7.904   1.00 17.78 ? 261  LYS A CA    1 
ATOM   2041 C  C     . LYS A 1 264 ? 40.829 -16.565 7.580   1.00 18.56 ? 261  LYS A C     1 
ATOM   2042 O  O     . LYS A 1 264 ? 40.743 -17.501 8.370   1.00 16.07 ? 261  LYS A O     1 
ATOM   2043 C  CB    . LYS A 1 264 ? 38.727 -15.213 7.266   1.00 18.32 ? 261  LYS A CB    1 
ATOM   2044 C  CG    . LYS A 1 264 ? 37.804 -14.177 7.895   1.00 24.79 ? 261  LYS A CG    1 
ATOM   2045 C  CD    . LYS A 1 264 ? 36.398 -14.252 7.285   1.00 26.98 ? 261  LYS A CD    1 
ATOM   2046 C  CE    . LYS A 1 264 ? 35.457 -13.251 7.943   1.00 42.44 ? 261  LYS A CE    1 
ATOM   2047 N  NZ    . LYS A 1 264 ? 34.061 -13.391 7.436   1.00 36.89 ? 261  LYS A NZ    1 
ATOM   2048 N  N     . LEU A 1 265 ? 41.508 -16.652 6.433   1.00 12.53 ? 262  LEU A N     1 
ATOM   2049 C  CA    . LEU A 1 265 ? 42.207 -17.882 6.068   1.00 13.97 ? 262  LEU A CA    1 
ATOM   2050 C  C     . LEU A 1 265 ? 43.305 -18.212 7.082   1.00 15.10 ? 262  LEU A C     1 
ATOM   2051 O  O     . LEU A 1 265 ? 43.401 -19.347 7.561   1.00 14.63 ? 262  LEU A O     1 
ATOM   2052 C  CB    . LEU A 1 265 ? 42.815 -17.793 4.667   1.00 14.08 ? 262  LEU A CB    1 
ATOM   2053 C  CG    . LEU A 1 265 ? 43.656 -18.972 4.156   1.00 15.07 ? 262  LEU A CG    1 
ATOM   2054 C  CD1   . LEU A 1 265 ? 42.803 -20.240 4.054   1.00 19.89 ? 262  LEU A CD1   1 
ATOM   2055 C  CD2   . LEU A 1 265 ? 44.278 -18.641 2.812   1.00 15.13 ? 262  LEU A CD2   1 
ATOM   2056 N  N     . GLY A 1 266 ? 44.129 -17.217 7.405   1.00 11.90 ? 263  GLY A N     1 
ATOM   2057 C  CA    . GLY A 1 266 ? 45.184 -17.394 8.387   1.00 14.24 ? 263  GLY A CA    1 
ATOM   2058 C  C     . GLY A 1 266 ? 44.637 -17.884 9.707   1.00 15.80 ? 263  GLY A C     1 
ATOM   2059 O  O     . GLY A 1 266 ? 45.234 -18.737 10.382  1.00 14.36 ? 263  GLY A O     1 
ATOM   2060 N  N     . ALA A 1 267 ? 43.485 -17.338 10.082  1.00 14.96 ? 264  ALA A N     1 
ATOM   2061 C  CA    . ALA A 1 267 ? 42.837 -17.725 11.321  1.00 13.37 ? 264  ALA A CA    1 
ATOM   2062 C  C     . ALA A 1 267 ? 42.424 -19.191 11.248  1.00 12.67 ? 264  ALA A C     1 
ATOM   2063 O  O     . ALA A 1 267 ? 42.581 -19.938 12.203  1.00 16.52 ? 264  ALA A O     1 
ATOM   2064 C  CB    . ALA A 1 267 ? 41.627 -16.829 11.593  1.00 19.57 ? 264  ALA A CB    1 
ATOM   2065 N  N     . SER A 1 268 ? 41.912 -19.612 10.096  1.00 15.18 ? 265  SER A N     1 
ATOM   2066 C  CA    . SER A 1 268 ? 41.497 -20.998 9.949   1.00 16.78 ? 265  SER A CA    1 
ATOM   2067 C  C     . SER A 1 268 ? 42.692 -21.956 9.900   1.00 13.05 ? 265  SER A C     1 
ATOM   2068 O  O     . SER A 1 268 ? 42.614 -23.059 10.421  1.00 12.79 ? 265  SER A O     1 
ATOM   2069 C  CB    . SER A 1 268 ? 40.577 -21.184 8.738   1.00 17.84 ? 265  SER A CB    1 
ATOM   2070 O  OG    . SER A 1 268 ? 41.302 -21.093 7.536   1.00 24.32 ? 265  SER A OG    1 
ATOM   2071 N  N     . VAL A 1 269 ? 43.796 -21.535 9.291   1.00 12.11 ? 266  VAL A N     1 
ATOM   2072 C  CA    . VAL A 1 269 ? 45.015 -22.354 9.302   1.00 11.82 ? 266  VAL A CA    1 
ATOM   2073 C  C     . VAL A 1 269 ? 45.425 -22.637 10.756  1.00 17.10 ? 266  VAL A C     1 
ATOM   2074 O  O     . VAL A 1 269 ? 45.703 -23.782 11.148  1.00 14.36 ? 266  VAL A O     1 
ATOM   2075 C  CB    . VAL A 1 269 ? 46.172 -21.664 8.544   1.00 13.39 ? 266  VAL A CB    1 
ATOM   2076 C  CG1   . VAL A 1 269 ? 47.486 -22.403 8.780   1.00 13.44 ? 266  VAL A CG1   1 
ATOM   2077 C  CG2   . VAL A 1 269 ? 45.863 -21.580 7.047   1.00 11.62 ? 266  VAL A CG2   1 
ATOM   2078 N  N     . ILE A 1 270 ? 45.436 -21.586 11.563  1.00 12.39 ? 267  ILE A N     1 
ATOM   2079 C  CA    . ILE A 1 270 ? 45.787 -21.713 12.972  1.00 12.78 ? 267  ILE A CA    1 
ATOM   2080 C  C     . ILE A 1 270 ? 44.815 -22.628 13.710  1.00 14.50 ? 267  ILE A C     1 
ATOM   2081 O  O     . ILE A 1 270 ? 45.229 -23.492 14.490  1.00 17.53 ? 267  ILE A O     1 
ATOM   2082 C  CB    . ILE A 1 270 ? 45.830 -20.334 13.649  1.00 17.51 ? 267  ILE A CB    1 
ATOM   2083 C  CG1   . ILE A 1 270 ? 47.097 -19.589 13.223  1.00 15.43 ? 267  ILE A CG1   1 
ATOM   2084 C  CG2   . ILE A 1 270 ? 45.778 -20.475 15.164  1.00 20.58 ? 267  ILE A CG2   1 
ATOM   2085 C  CD1   . ILE A 1 270 ? 47.004 -18.101 13.362  1.00 22.76 ? 267  ILE A CD1   1 
ATOM   2086 N  N     . GLU A 1 271 ? 43.521 -22.434 13.469  1.00 15.39 ? 268  GLU A N     1 
ATOM   2087 C  CA    . GLU A 1 271 ? 42.491 -23.165 14.196  1.00 15.01 ? 268  GLU A CA    1 
ATOM   2088 C  C     . GLU A 1 271 ? 42.418 -24.633 13.795  1.00 20.24 ? 268  GLU A C     1 
ATOM   2089 O  O     . GLU A 1 271 ? 42.431 -25.524 14.650  1.00 21.63 ? 268  GLU A O     1 
ATOM   2090 C  CB    . GLU A 1 271 ? 41.121 -22.506 14.002  1.00 21.62 ? 268  GLU A CB    1 
ATOM   2091 C  CG    . GLU A 1 271 ? 39.951 -23.340 14.526  1.00 37.63 ? 268  GLU A CG    1 
ATOM   2092 C  CD    . GLU A 1 271 ? 39.073 -22.577 15.508  1.00 51.11 ? 268  GLU A CD    1 
ATOM   2093 O  OE1   . GLU A 1 271 ? 37.957 -22.167 15.118  1.00 49.11 ? 268  GLU A OE1   1 
ATOM   2094 O  OE2   . GLU A 1 271 ? 39.498 -22.391 16.671  1.00 53.33 ? 268  GLU A OE2   1 
ATOM   2095 N  N     . ILE A 1 272 ? 42.346 -24.877 12.493  1.00 16.38 ? 269  ILE A N     1 
ATOM   2096 C  CA    . ILE A 1 272 ? 42.156 -26.222 11.983  1.00 14.30 ? 269  ILE A CA    1 
ATOM   2097 C  C     . ILE A 1 272 ? 43.385 -27.096 12.250  1.00 14.59 ? 269  ILE A C     1 
ATOM   2098 O  O     . ILE A 1 272 ? 43.268 -28.269 12.613  1.00 16.32 ? 269  ILE A O     1 
ATOM   2099 C  CB    . ILE A 1 272 ? 41.817 -26.205 10.465  1.00 15.46 ? 269  ILE A CB    1 
ATOM   2100 C  CG1   . ILE A 1 272 ? 40.384 -25.714 10.237  1.00 19.39 ? 269  ILE A CG1   1 
ATOM   2101 C  CG2   . ILE A 1 272 ? 42.017 -27.587 9.847   1.00 19.54 ? 269  ILE A CG2   1 
ATOM   2102 C  CD1   . ILE A 1 272 ? 40.066 -25.399 8.776   1.00 22.30 ? 269  ILE A CD1   1 
ATOM   2103 N  N     . LEU A 1 273 ? 44.573 -26.523 12.086  1.00 15.90 ? 270  LEU A N     1 
ATOM   2104 C  CA    . LEU A 1 273 ? 45.788 -27.324 12.164  1.00 16.12 ? 270  LEU A CA    1 
ATOM   2105 C  C     . LEU A 1 273 ? 46.372 -27.325 13.565  1.00 14.44 ? 270  LEU A C     1 
ATOM   2106 O  O     . LEU A 1 273 ? 47.199 -28.173 13.901  1.00 17.97 ? 270  LEU A O     1 
ATOM   2107 C  CB    . LEU A 1 273 ? 46.822 -26.848 11.148  1.00 13.04 ? 270  LEU A CB    1 
ATOM   2108 C  CG    . LEU A 1 273 ? 46.430 -27.064 9.690   1.00 14.33 ? 270  LEU A CG    1 
ATOM   2109 C  CD1   . LEU A 1 273 ? 47.561 -26.621 8.786   1.00 15.74 ? 270  LEU A CD1   1 
ATOM   2110 C  CD2   . LEU A 1 273 ? 46.102 -28.531 9.453   1.00 17.57 ? 270  LEU A CD2   1 
ATOM   2111 N  N     . GLY A 1 274 ? 45.931 -26.369 14.375  1.00 13.05 ? 271  GLY A N     1 
ATOM   2112 C  CA    . GLY A 1 274 ? 46.392 -26.247 15.744  1.00 12.57 ? 271  GLY A CA    1 
ATOM   2113 C  C     . GLY A 1 274 ? 47.847 -25.830 15.829  1.00 16.38 ? 271  GLY A C     1 
ATOM   2114 O  O     . GLY A 1 274 ? 48.589 -26.344 16.668  1.00 17.51 ? 271  GLY A O     1 
ATOM   2115 N  N     . ILE A 1 275 ? 48.260 -24.908 14.961  1.00 12.80 ? 272  ILE A N     1 
ATOM   2116 C  CA    . ILE A 1 275 ? 49.640 -24.411 14.953  1.00 13.17 ? 272  ILE A CA    1 
ATOM   2117 C  C     . ILE A 1 275 ? 49.667 -22.888 15.125  1.00 15.10 ? 272  ILE A C     1 
ATOM   2118 O  O     . ILE A 1 275 ? 48.626 -22.245 15.061  1.00 16.16 ? 272  ILE A O     1 
ATOM   2119 C  CB    . ILE A 1 275 ? 50.370 -24.770 13.640  1.00 14.00 ? 272  ILE A CB    1 
ATOM   2120 C  CG1   . ILE A 1 275 ? 49.678 -24.118 12.437  1.00 13.10 ? 272  ILE A CG1   1 
ATOM   2121 C  CG2   . ILE A 1 275 ? 50.452 -26.284 13.460  1.00 15.12 ? 272  ILE A CG2   1 
ATOM   2122 C  CD1   . ILE A 1 275 ? 50.346 -24.478 11.091  1.00 14.17 ? 272  ILE A CD1   1 
ATOM   2123 N  N     . GLU A 1 276 ? 50.855 -22.321 15.342  1.00 11.97 ? 273  GLU A N     1 
ATOM   2124 C  CA    . GLU A 1 276 ? 51.015 -20.869 15.490  1.00 16.22 ? 273  GLU A CA    1 
ATOM   2125 C  C     . GLU A 1 276 ? 51.976 -20.218 14.481  1.00 15.20 ? 273  GLU A C     1 
ATOM   2126 O  O     . GLU A 1 276 ? 51.809 -19.051 14.124  1.00 14.12 ? 273  GLU A O     1 
ATOM   2127 C  CB    . GLU A 1 276 ? 51.507 -20.517 16.899  1.00 16.61 ? 273  GLU A CB    1 
ATOM   2128 C  CG    . GLU A 1 276 ? 50.543 -20.881 18.014  1.00 25.25 ? 273  GLU A CG    1 
ATOM   2129 C  CD    . GLU A 1 276 ? 51.171 -20.753 19.399  1.00 40.78 ? 273  GLU A CD    1 
ATOM   2130 O  OE1   . GLU A 1 276 ? 50.968 -21.663 20.234  1.00 49.14 ? 273  GLU A OE1   1 
ATOM   2131 O  OE2   . GLU A 1 276 ? 51.857 -19.740 19.654  1.00 37.37 ? 273  GLU A OE2   1 
ATOM   2132 N  N     . TYR A 1 277 ? 52.991 -20.955 14.045  1.00 12.00 ? 274  TYR A N     1 
ATOM   2133 C  CA    . TYR A 1 277 ? 54.080 -20.344 13.274  1.00 10.35 ? 274  TYR A CA    1 
ATOM   2134 C  C     . TYR A 1 277 ? 54.128 -20.913 11.870  1.00 10.87 ? 274  TYR A C     1 
ATOM   2135 O  O     . TYR A 1 277 ? 53.760 -22.068 11.646  1.00 12.14 ? 274  TYR A O     1 
ATOM   2136 C  CB    . TYR A 1 277 ? 55.438 -20.547 13.964  1.00 11.24 ? 274  TYR A CB    1 
ATOM   2137 C  CG    . TYR A 1 277 ? 55.441 -20.056 15.392  1.00 11.18 ? 274  TYR A CG    1 
ATOM   2138 C  CD1   . TYR A 1 277 ? 55.670 -20.923 16.451  1.00 12.92 ? 274  TYR A CD1   1 
ATOM   2139 C  CD2   . TYR A 1 277 ? 55.170 -18.727 15.678  1.00 12.64 ? 274  TYR A CD2   1 
ATOM   2140 C  CE1   . TYR A 1 277 ? 55.649 -20.477 17.765  1.00 18.64 ? 274  TYR A CE1   1 
ATOM   2141 C  CE2   . TYR A 1 277 ? 55.142 -18.264 16.986  1.00 13.24 ? 274  TYR A CE2   1 
ATOM   2142 C  CZ    . TYR A 1 277 ? 55.385 -19.146 18.029  1.00 20.45 ? 274  TYR A CZ    1 
ATOM   2143 O  OH    . TYR A 1 277 ? 55.353 -18.692 19.334  1.00 18.36 ? 274  TYR A OH    1 
ATOM   2144 N  N     . MET A 1 278 ? 54.598 -20.093 10.942  1.00 8.62  ? 275  MET A N     1 
ATOM   2145 C  CA    . MET A 1 278 ? 54.689 -20.474 9.538   1.00 11.16 ? 275  MET A CA    1 
ATOM   2146 C  C     . MET A 1 278 ? 55.469 -21.779 9.364   1.00 13.14 ? 275  MET A C     1 
ATOM   2147 O  O     . MET A 1 278 ? 55.106 -22.624 8.551   1.00 9.21  ? 275  MET A O     1 
ATOM   2148 C  CB    . MET A 1 278 ? 55.350 -19.353 8.738   1.00 11.36 ? 275  MET A CB    1 
ATOM   2149 C  CG    . MET A 1 278 ? 55.047 -19.396 7.260   1.00 13.85 ? 275  MET A CG    1 
ATOM   2150 S  SD    . MET A 1 278 ? 53.295 -19.106 6.897   1.00 18.98 ? 275  MET A SD    1 
ATOM   2151 C  CE    . MET A 1 278 ? 53.310 -19.563 5.165   1.00 25.22 ? 275  MET A CE    1 
ATOM   2152 N  N     . GLY A 1 279 ? 56.541 -21.937 10.131  1.00 10.10 ? 276  GLY A N     1 
ATOM   2153 C  CA    . GLY A 1 279 ? 57.412 -23.085 9.973   1.00 11.74 ? 276  GLY A CA    1 
ATOM   2154 C  C     . GLY A 1 279 ? 56.733 -24.411 10.276  1.00 15.88 ? 276  GLY A C     1 
ATOM   2155 O  O     . GLY A 1 279 ? 57.098 -25.451 9.724   1.00 13.26 ? 276  GLY A O     1 
ATOM   2156 N  N     . GLU A 1 280 ? 55.737 -24.381 11.157  1.00 8.93  ? 277  GLU A N     1 
ATOM   2157 C  CA    . GLU A 1 280 ? 55.025 -25.593 11.523  1.00 9.62  ? 277  GLU A CA    1 
ATOM   2158 C  C     . GLU A 1 280 ? 54.233 -26.182 10.362  1.00 9.74  ? 277  GLU A C     1 
ATOM   2159 O  O     . GLU A 1 280 ? 53.800 -27.331 10.422  1.00 10.95 ? 277  GLU A O     1 
ATOM   2160 C  CB    . GLU A 1 280 ? 54.061 -25.316 12.680  1.00 10.32 ? 277  GLU A CB    1 
ATOM   2161 C  CG    . GLU A 1 280 ? 54.751 -24.957 13.986  1.00 11.22 ? 277  GLU A CG    1 
ATOM   2162 C  CD    . GLU A 1 280 ? 53.747 -24.711 15.110  1.00 15.93 ? 277  GLU A CD    1 
ATOM   2163 O  OE1   . GLU A 1 280 ? 53.407 -23.540 15.357  1.00 17.04 ? 277  GLU A OE1   1 
ATOM   2164 O  OE2   . GLU A 1 280 ? 53.304 -25.685 15.751  1.00 16.25 ? 277  GLU A OE2   1 
ATOM   2165 N  N     . LEU A 1 281 ? 54.021 -25.399 9.312   1.00 10.84 ? 278  LEU A N     1 
ATOM   2166 C  CA    . LEU A 1 281 ? 53.311 -25.923 8.145   1.00 9.89  ? 278  LEU A CA    1 
ATOM   2167 C  C     . LEU A 1 281 ? 54.076 -27.018 7.409   1.00 9.57  ? 278  LEU A C     1 
ATOM   2168 O  O     . LEU A 1 281 ? 53.470 -27.786 6.659   1.00 11.55 ? 278  LEU A O     1 
ATOM   2169 C  CB    . LEU A 1 281 ? 52.958 -24.785 7.167   1.00 7.44  ? 278  LEU A CB    1 
ATOM   2170 C  CG    . LEU A 1 281 ? 51.773 -23.898 7.560   1.00 14.61 ? 278  LEU A CG    1 
ATOM   2171 C  CD1   . LEU A 1 281 ? 51.761 -22.614 6.728   1.00 17.47 ? 278  LEU A CD1   1 
ATOM   2172 C  CD2   . LEU A 1 281 ? 50.454 -24.673 7.406   1.00 12.42 ? 278  LEU A CD2   1 
ATOM   2173 N  N     . THR A 1 282 ? 55.396 -27.089 7.589   1.00 10.38 ? 279  THR A N     1 
ATOM   2174 C  CA    . THR A 1 282 ? 56.197 -28.033 6.803   1.00 12.68 ? 279  THR A CA    1 
ATOM   2175 C  C     . THR A 1 282 ? 55.826 -29.492 7.092   1.00 12.95 ? 279  THR A C     1 
ATOM   2176 O  O     . THR A 1 282 ? 56.129 -30.378 6.300   1.00 15.63 ? 279  THR A O     1 
ATOM   2177 C  CB    . THR A 1 282 ? 57.712 -27.884 7.041   1.00 13.20 ? 279  THR A CB    1 
ATOM   2178 O  OG1   . THR A 1 282 ? 57.993 -28.121 8.428   1.00 16.05 ? 279  THR A OG1   1 
ATOM   2179 C  CG2   . THR A 1 282 ? 58.207 -26.492 6.620   1.00 13.21 ? 279  THR A CG2   1 
ATOM   2180 N  N     . GLN A 1 283 ? 55.166 -29.734 8.223   1.00 12.03 ? 280  GLN A N     1 
ATOM   2181 C  CA    A GLN A 1 283 ? 54.854 -31.084 8.675   0.52 14.33 ? 280  GLN A CA    1 
ATOM   2182 C  CA    B GLN A 1 283 ? 54.884 -31.108 8.639   0.48 14.34 ? 280  GLN A CA    1 
ATOM   2183 C  C     . GLN A 1 283 ? 53.591 -31.682 8.067   1.00 16.78 ? 280  GLN A C     1 
ATOM   2184 O  O     . GLN A 1 283 ? 53.180 -32.775 8.436   1.00 22.07 ? 280  GLN A O     1 
ATOM   2185 C  CB    A GLN A 1 283 ? 54.761 -31.101 10.202  0.52 15.40 ? 280  GLN A CB    1 
ATOM   2186 C  CB    B GLN A 1 283 ? 54.830 -31.195 10.158  0.48 15.48 ? 280  GLN A CB    1 
ATOM   2187 C  CG    A GLN A 1 283 ? 56.115 -30.884 10.831  0.52 16.36 ? 280  GLN A CG    1 
ATOM   2188 C  CG    B GLN A 1 283 ? 53.718 -30.390 10.745  0.48 14.93 ? 280  GLN A CG    1 
ATOM   2189 C  CD    A GLN A 1 283 ? 57.173 -31.733 10.150  0.52 13.20 ? 280  GLN A CD    1 
ATOM   2190 C  CD    B GLN A 1 283 ? 54.011 -29.981 12.165  0.48 19.70 ? 280  GLN A CD    1 
ATOM   2191 O  OE1   A GLN A 1 283 ? 57.163 -32.957 10.269  0.52 16.17 ? 280  GLN A OE1   1 
ATOM   2192 O  OE1   B GLN A 1 283 ? 54.848 -30.585 12.834  0.48 27.34 ? 280  GLN A OE1   1 
ATOM   2193 N  NE2   A GLN A 1 283 ? 58.082 -31.092 9.418   0.52 15.16 ? 280  GLN A NE2   1 
ATOM   2194 N  NE2   B GLN A 1 283 ? 53.328 -28.953 12.632  0.48 11.41 ? 280  GLN A NE2   1 
ATOM   2195 N  N     . PHE A 1 284 ? 52.957 -30.957 7.159   1.00 12.75 ? 281  PHE A N     1 
ATOM   2196 C  CA    . PHE A 1 284 ? 51.748 -31.460 6.527   1.00 12.05 ? 281  PHE A CA    1 
ATOM   2197 C  C     . PHE A 1 284 ? 52.026 -31.752 5.068   1.00 13.14 ? 281  PHE A C     1 
ATOM   2198 O  O     . PHE A 1 284 ? 52.896 -31.126 4.464   1.00 15.35 ? 281  PHE A O     1 
ATOM   2199 C  CB    . PHE A 1 284 ? 50.636 -30.438 6.646   1.00 9.35  ? 281  PHE A CB    1 
ATOM   2200 C  CG    . PHE A 1 284 ? 50.286 -30.130 8.060   1.00 9.70  ? 281  PHE A CG    1 
ATOM   2201 C  CD1   . PHE A 1 284 ? 49.386 -30.929 8.750   1.00 18.52 ? 281  PHE A CD1   1 
ATOM   2202 C  CD2   . PHE A 1 284 ? 50.893 -29.077 8.723   1.00 13.67 ? 281  PHE A CD2   1 
ATOM   2203 C  CE1   . PHE A 1 284 ? 49.071 -30.659 10.059  1.00 23.82 ? 281  PHE A CE1   1 
ATOM   2204 C  CE2   . PHE A 1 284 ? 50.590 -28.815 10.037  1.00 15.94 ? 281  PHE A CE2   1 
ATOM   2205 C  CZ    . PHE A 1 284 ? 49.680 -29.605 10.707  1.00 18.09 ? 281  PHE A CZ    1 
ATOM   2206 N  N     . THR A 1 285 ? 51.294 -32.698 4.493   1.00 11.94 ? 282  THR A N     1 
ATOM   2207 C  CA    . THR A 1 285 ? 51.536 -33.018 3.096   1.00 14.00 ? 282  THR A CA    1 
ATOM   2208 C  C     . THR A 1 285 ? 50.803 -31.996 2.259   1.00 9.61  ? 282  THR A C     1 
ATOM   2209 O  O     . THR A 1 285 ? 49.907 -31.324 2.743   1.00 11.80 ? 282  THR A O     1 
ATOM   2210 C  CB    . THR A 1 285 ? 51.006 -34.402 2.735   1.00 12.16 ? 282  THR A CB    1 
ATOM   2211 O  OG1   . THR A 1 285 ? 49.583 -34.390 2.812   1.00 11.83 ? 282  THR A OG1   1 
ATOM   2212 C  CG2   . THR A 1 285 ? 51.558 -35.434 3.691   1.00 16.87 ? 282  THR A CG2   1 
ATOM   2213 N  N     . GLU A 1 286 ? 51.170 -31.885 0.996   1.00 10.94 ? 283  GLU A N     1 
ATOM   2214 C  CA    . GLU A 1 286 ? 50.476 -30.949 0.136   1.00 12.42 ? 283  GLU A CA    1 
ATOM   2215 C  C     . GLU A 1 286 ? 48.991 -31.320 0.057   1.00 14.11 ? 283  GLU A C     1 
ATOM   2216 O  O     . GLU A 1 286 ? 48.130 -30.447 0.099   1.00 11.33 ? 283  GLU A O     1 
ATOM   2217 C  CB    . GLU A 1 286 ? 51.133 -30.911 -1.242  1.00 10.93 ? 283  GLU A CB    1 
ATOM   2218 C  CG    . GLU A 1 286 ? 50.524 -29.864 -2.152  1.00 15.86 ? 283  GLU A CG    1 
ATOM   2219 C  CD    . GLU A 1 286 ? 51.287 -29.722 -3.457  1.00 22.97 ? 283  GLU A CD    1 
ATOM   2220 O  OE1   . GLU A 1 286 ? 52.260 -30.477 -3.670  1.00 20.99 ? 283  GLU A OE1   1 
ATOM   2221 O  OE2   . GLU A 1 286 ? 50.915 -28.849 -4.269  1.00 22.11 ? 283  GLU A OE2   1 
ATOM   2222 N  N     . SER A 1 287 ? 48.694 -32.617 -0.033  1.00 13.65 ? 284  SER A N     1 
ATOM   2223 C  CA    . SER A 1 287 ? 47.301 -33.054 -0.101  1.00 13.98 ? 284  SER A CA    1 
ATOM   2224 C  C     . SER A 1 287 ? 46.542 -32.694 1.184   1.00 13.71 ? 284  SER A C     1 
ATOM   2225 O  O     . SER A 1 287 ? 45.370 -32.304 1.141   1.00 12.17 ? 284  SER A O     1 
ATOM   2226 C  CB    . SER A 1 287 ? 47.201 -34.558 -0.387  1.00 14.07 ? 284  SER A CB    1 
ATOM   2227 O  OG    A SER A 1 287 ? 47.770 -34.867 -1.643  0.75 18.96 ? 284  SER A OG    1 
ATOM   2228 O  OG    B SER A 1 287 ? 48.037 -35.304 0.475   0.25 12.92 ? 284  SER A OG    1 
ATOM   2229 N  N     . GLN A 1 288 ? 47.206 -32.808 2.330   1.00 14.49 ? 285  GLN A N     1 
ATOM   2230 C  CA    . GLN A 1 288 ? 46.550 -32.444 3.585   1.00 11.70 ? 285  GLN A CA    1 
ATOM   2231 C  C     . GLN A 1 288 ? 46.148 -30.984 3.557   1.00 12.31 ? 285  GLN A C     1 
ATOM   2232 O  O     . GLN A 1 288 ? 45.028 -30.616 3.917   1.00 10.41 ? 285  GLN A O     1 
ATOM   2233 C  CB    . GLN A 1 288 ? 47.454 -32.710 4.780   1.00 10.99 ? 285  GLN A CB    1 
ATOM   2234 C  CG    . GLN A 1 288 ? 47.491 -34.156 5.216   1.00 17.66 ? 285  GLN A CG    1 
ATOM   2235 C  CD    . GLN A 1 288 ? 48.462 -34.387 6.363   1.00 22.40 ? 285  GLN A CD    1 
ATOM   2236 O  OE1   . GLN A 1 288 ? 49.586 -33.889 6.355   1.00 16.47 ? 285  GLN A OE1   1 
ATOM   2237 N  NE2   . GLN A 1 288 ? 48.026 -35.148 7.360   1.00 27.82 ? 285  GLN A NE2   1 
ATOM   2238 N  N     . LEU A 1 289 ? 47.068 -30.135 3.123   1.00 11.67 ? 286  LEU A N     1 
ATOM   2239 C  CA    . LEU A 1 289 ? 46.775 -28.707 3.106   1.00 12.56 ? 286  LEU A CA    1 
ATOM   2240 C  C     . LEU A 1 289 ? 45.668 -28.372 2.104   1.00 10.37 ? 286  LEU A C     1 
ATOM   2241 O  O     . LEU A 1 289 ? 44.800 -27.544 2.377   1.00 11.63 ? 286  LEU A O     1 
ATOM   2242 C  CB    . LEU A 1 289 ? 48.050 -27.898 2.846   1.00 10.60 ? 286  LEU A CB    1 
ATOM   2243 C  CG    . LEU A 1 289 ? 49.149 -28.050 3.911   1.00 7.05  ? 286  LEU A CG    1 
ATOM   2244 C  CD1   . LEU A 1 289 ? 50.442 -27.304 3.495   1.00 10.77 ? 286  LEU A CD1   1 
ATOM   2245 C  CD2   . LEU A 1 289 ? 48.664 -27.580 5.268   1.00 11.15 ? 286  LEU A CD2   1 
ATOM   2246 N  N     . GLN A 1 290 ? 45.698 -29.016 0.944   1.00 12.34 ? 287  GLN A N     1 
ATOM   2247 C  CA    . GLN A 1 290 ? 44.632 -28.841 -0.039  1.00 14.75 ? 287  GLN A CA    1 
ATOM   2248 C  C     . GLN A 1 290 ? 43.266 -29.303 0.471   1.00 13.46 ? 287  GLN A C     1 
ATOM   2249 O  O     . GLN A 1 290 ? 42.226 -28.714 0.145   1.00 16.73 ? 287  GLN A O     1 
ATOM   2250 C  CB    . GLN A 1 290 ? 44.988 -29.586 -1.320  1.00 14.82 ? 287  GLN A CB    1 
ATOM   2251 C  CG    . GLN A 1 290 ? 46.158 -28.968 -2.087  1.00 16.88 ? 287  GLN A CG    1 
ATOM   2252 C  CD    . GLN A 1 290 ? 46.567 -29.811 -3.274  1.00 20.24 ? 287  GLN A CD    1 
ATOM   2253 O  OE1   . GLN A 1 290 ? 46.613 -31.044 -3.191  1.00 20.09 ? 287  GLN A OE1   1 
ATOM   2254 N  NE2   . GLN A 1 290 ? 46.866 -29.153 -4.392  1.00 17.26 ? 287  GLN A NE2   1 
ATOM   2255 N  N     . SER A 1 291 ? 43.262 -30.359 1.268   1.00 14.16 ? 288  SER A N     1 
ATOM   2256 C  CA    . SER A 1 291 ? 42.004 -30.872 1.792   1.00 12.05 ? 288  SER A CA    1 
ATOM   2257 C  C     . SER A 1 291 ? 41.297 -29.826 2.662   1.00 19.90 ? 288  SER A C     1 
ATOM   2258 O  O     . SER A 1 291 ? 40.080 -29.670 2.587   1.00 22.73 ? 288  SER A O     1 
ATOM   2259 C  CB    . SER A 1 291 ? 42.207 -32.163 2.579   1.00 14.80 ? 288  SER A CB    1 
ATOM   2260 O  OG    A SER A 1 291 ? 42.807 -31.917 3.852   0.60 18.36 ? 288  SER A OG    1 
ATOM   2261 O  OG    B SER A 1 291 ? 40.949 -32.749 2.865   0.40 13.56 ? 288  SER A OG    1 
ATOM   2262 N  N     . HIS A 1 292 ? 42.065 -29.104 3.474   1.00 16.93 ? 289  HIS A N     1 
ATOM   2263 C  CA    . HIS A 1 292 ? 41.499 -28.101 4.374   1.00 14.84 ? 289  HIS A CA    1 
ATOM   2264 C  C     . HIS A 1 292 ? 41.250 -26.732 3.732   1.00 20.82 ? 289  HIS A C     1 
ATOM   2265 O  O     . HIS A 1 292 ? 40.266 -26.063 4.045   1.00 24.83 ? 289  HIS A O     1 
ATOM   2266 C  CB    . HIS A 1 292 ? 42.428 -27.895 5.564   1.00 21.03 ? 289  HIS A CB    1 
ATOM   2267 C  CG    . HIS A 1 292 ? 42.541 -29.084 6.462   1.00 19.68 ? 289  HIS A CG    1 
ATOM   2268 N  ND1   . HIS A 1 292 ? 41.467 -29.597 7.156   1.00 20.88 ? 289  HIS A ND1   1 
ATOM   2269 C  CD2   . HIS A 1 292 ? 43.608 -29.845 6.800   1.00 21.39 ? 289  HIS A CD2   1 
ATOM   2270 C  CE1   . HIS A 1 292 ? 41.867 -30.627 7.880   1.00 19.70 ? 289  HIS A CE1   1 
ATOM   2271 N  NE2   . HIS A 1 292 ? 43.160 -30.801 7.679   1.00 24.77 ? 289  HIS A NE2   1 
ATOM   2272 N  N     . PHE A 1 293 ? 42.152 -26.303 2.857   1.00 15.83 ? 290  PHE A N     1 
ATOM   2273 C  CA    . PHE A 1 293 ? 42.148 -24.912 2.383   1.00 16.11 ? 290  PHE A CA    1 
ATOM   2274 C  C     . PHE A 1 293 ? 41.920 -24.764 0.878   1.00 21.09 ? 290  PHE A C     1 
ATOM   2275 O  O     . PHE A 1 293 ? 41.986 -23.657 0.336   1.00 21.06 ? 290  PHE A O     1 
ATOM   2276 C  CB    . PHE A 1 293 ? 43.449 -24.218 2.820   1.00 15.27 ? 290  PHE A CB    1 
ATOM   2277 C  CG    . PHE A 1 293 ? 43.777 -24.457 4.269   1.00 14.95 ? 290  PHE A CG    1 
ATOM   2278 C  CD1   . PHE A 1 293 ? 42.961 -23.938 5.268   1.00 18.60 ? 290  PHE A CD1   1 
ATOM   2279 C  CD2   . PHE A 1 293 ? 44.865 -25.234 4.631   1.00 12.32 ? 290  PHE A CD2   1 
ATOM   2280 C  CE1   . PHE A 1 293 ? 43.231 -24.175 6.604   1.00 13.14 ? 290  PHE A CE1   1 
ATOM   2281 C  CE2   . PHE A 1 293 ? 45.143 -25.484 5.964   1.00 13.32 ? 290  PHE A CE2   1 
ATOM   2282 C  CZ    . PHE A 1 293 ? 44.323 -24.959 6.952   1.00 16.12 ? 290  PHE A CZ    1 
ATOM   2283 N  N     . GLY A 1 294 ? 41.645 -25.880 0.208   1.00 17.46 ? 291  GLY A N     1 
ATOM   2284 C  CA    . GLY A 1 294 ? 41.390 -25.850 -1.217  1.00 16.48 ? 291  GLY A CA    1 
ATOM   2285 C  C     . GLY A 1 294 ? 42.643 -26.105 -2.016  1.00 17.96 ? 291  GLY A C     1 
ATOM   2286 O  O     . GLY A 1 294 ? 43.743 -25.956 -1.506  1.00 17.23 ? 291  GLY A O     1 
ATOM   2287 N  N     . GLU A 1 295 ? 42.472 -26.482 -3.282  1.00 15.87 ? 292  GLU A N     1 
ATOM   2288 C  CA    . GLU A 1 295 ? 43.591 -26.837 -4.137  1.00 15.82 ? 292  GLU A CA    1 
ATOM   2289 C  C     . GLU A 1 295 ? 44.623 -25.713 -4.243  1.00 17.74 ? 292  GLU A C     1 
ATOM   2290 O  O     . GLU A 1 295 ? 45.809 -25.945 -4.074  1.00 16.03 ? 292  GLU A O     1 
ATOM   2291 C  CB    . GLU A 1 295 ? 43.083 -27.197 -5.534  1.00 20.55 ? 292  GLU A CB    1 
ATOM   2292 C  CG    . GLU A 1 295 ? 44.161 -27.683 -6.472  1.00 27.76 ? 292  GLU A CG    1 
ATOM   2293 C  CD    . GLU A 1 295 ? 43.606 -28.064 -7.839  1.00 46.33 ? 292  GLU A CD    1 
ATOM   2294 O  OE1   . GLU A 1 295 ? 44.374 -28.025 -8.822  1.00 43.66 ? 292  GLU A OE1   1 
ATOM   2295 O  OE2   . GLU A 1 295 ? 42.401 -28.400 -7.927  1.00 33.32 ? 292  GLU A OE2   1 
ATOM   2296 N  N     . LYS A 1 296 ? 44.161 -24.499 -4.526  1.00 13.97 ? 293  LYS A N     1 
ATOM   2297 C  CA    . LYS A 1 296 ? 45.059 -23.368 -4.750  1.00 16.19 ? 293  LYS A CA    1 
ATOM   2298 C  C     . LYS A 1 296 ? 45.794 -22.939 -3.470  1.00 12.00 ? 293  LYS A C     1 
ATOM   2299 O  O     . LYS A 1 296 ? 47.026 -22.817 -3.462  1.00 13.39 ? 293  LYS A O     1 
ATOM   2300 C  CB    . LYS A 1 296 ? 44.286 -22.180 -5.339  1.00 16.81 ? 293  LYS A CB    1 
ATOM   2301 C  CG    . LYS A 1 296 ? 45.169 -21.092 -5.912  1.00 30.88 ? 293  LYS A CG    1 
ATOM   2302 C  CD    . LYS A 1 296 ? 44.343 -20.072 -6.694  1.00 34.57 ? 293  LYS A CD    1 
ATOM   2303 C  CE    . LYS A 1 296 ? 45.162 -18.830 -7.030  1.00 48.04 ? 293  LYS A CE    1 
ATOM   2304 N  NZ    . LYS A 1 296 ? 44.328 -17.758 -7.654  1.00 42.26 ? 293  LYS A NZ    1 
ATOM   2305 N  N     . ASN A 1 297 ? 45.048 -22.721 -2.398  1.00 13.50 ? 294  ASN A N     1 
ATOM   2306 C  CA    . ASN A 1 297 ? 45.660 -22.277 -1.146  1.00 11.75 ? 294  ASN A CA    1 
ATOM   2307 C  C     . ASN A 1 297 ? 46.567 -23.358 -0.559  1.00 14.11 ? 294  ASN A C     1 
ATOM   2308 O  O     . ASN A 1 297 ? 47.599 -23.059 0.034   1.00 13.81 ? 294  ASN A O     1 
ATOM   2309 C  CB    . ASN A 1 297 ? 44.592 -21.936 -0.109  1.00 15.81 ? 294  ASN A CB    1 
ATOM   2310 C  CG    . ASN A 1 297 ? 43.849 -20.670 -0.425  1.00 20.48 ? 294  ASN A CG    1 
ATOM   2311 O  OD1   . ASN A 1 297 ? 44.389 -19.764 -1.059  1.00 25.17 ? 294  ASN A OD1   1 
ATOM   2312 N  ND2   . ASN A 1 297 ? 42.601 -20.585 0.037   1.00 24.59 ? 294  ASN A ND2   1 
ATOM   2313 N  N     . GLY A 1 298 ? 46.165 -24.618 -0.696  1.00 14.16 ? 295  GLY A N     1 
ATOM   2314 C  CA    . GLY A 1 298 ? 46.957 -25.723 -0.171  1.00 12.51 ? 295  GLY A CA    1 
ATOM   2315 C  C     . GLY A 1 298 ? 48.328 -25.834 -0.821  1.00 12.69 ? 295  GLY A C     1 
ATOM   2316 O  O     . GLY A 1 298 ? 49.345 -26.001 -0.138  1.00 12.54 ? 295  GLY A O     1 
ATOM   2317 N  N     . SER A 1 299 ? 48.362 -25.750 -2.151  1.00 11.70 ? 296  SER A N     1 
ATOM   2318 C  CA    . SER A 1 299 ? 49.621 -25.787 -2.880  1.00 11.64 ? 296  SER A CA    1 
ATOM   2319 C  C     . SER A 1 299 ? 50.466 -24.578 -2.512  1.00 10.11 ? 296  SER A C     1 
ATOM   2320 O  O     . SER A 1 299 ? 51.679 -24.684 -2.315  1.00 10.67 ? 296  SER A O     1 
ATOM   2321 C  CB    . SER A 1 299 ? 49.368 -25.783 -4.388  1.00 17.57 ? 296  SER A CB    1 
ATOM   2322 O  OG    . SER A 1 299 ? 48.984 -27.073 -4.837  1.00 21.97 ? 296  SER A OG    1 
ATOM   2323 N  N     . TRP A 1 300 ? 49.811 -23.425 -2.434  1.00 11.13 ? 297  TRP A N     1 
ATOM   2324 C  CA    . TRP A 1 300 ? 50.501 -22.190 -2.100  1.00 14.59 ? 297  TRP A CA    1 
ATOM   2325 C  C     . TRP A 1 300 ? 51.154 -22.295 -0.724  1.00 12.69 ? 297  TRP A C     1 
ATOM   2326 O  O     . TRP A 1 300 ? 52.322 -21.933 -0.562  1.00 11.72 ? 297  TRP A O     1 
ATOM   2327 C  CB    . TRP A 1 300 ? 49.526 -21.011 -2.151  1.00 12.55 ? 297  TRP A CB    1 
ATOM   2328 C  CG    . TRP A 1 300 ? 50.184 -19.691 -1.948  1.00 14.23 ? 297  TRP A CG    1 
ATOM   2329 C  CD1   . TRP A 1 300 ? 50.775 -18.912 -2.898  1.00 17.04 ? 297  TRP A CD1   1 
ATOM   2330 C  CD2   . TRP A 1 300 ? 50.322 -18.988 -0.706  1.00 15.50 ? 297  TRP A CD2   1 
ATOM   2331 N  NE1   . TRP A 1 300 ? 51.272 -17.762 -2.322  1.00 17.32 ? 297  TRP A NE1   1 
ATOM   2332 C  CE2   . TRP A 1 300 ? 51.012 -17.790 -0.977  1.00 15.48 ? 297  TRP A CE2   1 
ATOM   2333 C  CE3   . TRP A 1 300 ? 49.933 -19.258 0.605   1.00 16.00 ? 297  TRP A CE3   1 
ATOM   2334 C  CZ2   . TRP A 1 300 ? 51.312 -16.856 0.016   1.00 17.28 ? 297  TRP A CZ2   1 
ATOM   2335 C  CZ3   . TRP A 1 300 ? 50.235 -18.332 1.593   1.00 23.55 ? 297  TRP A CZ3   1 
ATOM   2336 C  CH2   . TRP A 1 300 ? 50.923 -17.144 1.289   1.00 13.49 ? 297  TRP A CH2   1 
ATOM   2337 N  N     . LEU A 1 301 ? 50.397 -22.793 0.257   1.00 10.73 ? 298  LEU A N     1 
ATOM   2338 C  CA    . LEU A 1 301 ? 50.907 -22.954 1.626   1.00 10.72 ? 298  LEU A CA    1 
ATOM   2339 C  C     . LEU A 1 301 ? 52.065 -23.944 1.712   1.00 11.53 ? 298  LEU A C     1 
ATOM   2340 O  O     . LEU A 1 301 ? 53.055 -23.717 2.421   1.00 11.10 ? 298  LEU A O     1 
ATOM   2341 C  CB    . LEU A 1 301 ? 49.780 -23.394 2.559   1.00 6.79  ? 298  LEU A CB    1 
ATOM   2342 C  CG    . LEU A 1 301 ? 48.741 -22.308 2.866   1.00 11.66 ? 298  LEU A CG    1 
ATOM   2343 C  CD1   . LEU A 1 301 ? 47.471 -22.902 3.479   1.00 12.34 ? 298  LEU A CD1   1 
ATOM   2344 C  CD2   . LEU A 1 301 ? 49.345 -21.252 3.795   1.00 14.29 ? 298  LEU A CD2   1 
ATOM   2345 N  N     . TYR A 1 302 ? 51.942 -25.050 0.989   1.00 10.52 ? 299  TYR A N     1 
ATOM   2346 C  CA    . TYR A 1 302 ? 52.974 -26.078 1.006   1.00 9.72  ? 299  TYR A CA    1 
ATOM   2347 C  C     . TYR A 1 302 ? 54.326 -25.519 0.542   1.00 12.73 ? 299  TYR A C     1 
ATOM   2348 O  O     . TYR A 1 302 ? 55.374 -25.729 1.182   1.00 10.07 ? 299  TYR A O     1 
ATOM   2349 C  CB    . TYR A 1 302 ? 52.549 -27.265 0.130   1.00 12.32 ? 299  TYR A CB    1 
ATOM   2350 C  CG    . TYR A 1 302 ? 53.557 -28.398 0.137   1.00 12.39 ? 299  TYR A CG    1 
ATOM   2351 C  CD1   . TYR A 1 302 ? 53.516 -29.382 1.121   1.00 10.80 ? 299  TYR A CD1   1 
ATOM   2352 C  CD2   . TYR A 1 302 ? 54.569 -28.465 -0.814  1.00 13.88 ? 299  TYR A CD2   1 
ATOM   2353 C  CE1   . TYR A 1 302 ? 54.454 -30.416 1.150   1.00 14.03 ? 299  TYR A CE1   1 
ATOM   2354 C  CE2   . TYR A 1 302 ? 55.508 -29.497 -0.790  1.00 18.70 ? 299  TYR A CE2   1 
ATOM   2355 C  CZ    . TYR A 1 302 ? 55.435 -30.470 0.193   1.00 22.37 ? 299  TYR A CZ    1 
ATOM   2356 O  OH    . TYR A 1 302 ? 56.362 -31.494 0.228   1.00 21.04 ? 299  TYR A OH    1 
ATOM   2357 N  N     . ALA A 1 303 ? 54.296 -24.793 -0.572  1.00 11.68 ? 300  ALA A N     1 
ATOM   2358 C  CA    . ALA A 1 303 ? 55.488 -24.134 -1.094  1.00 10.75 ? 300  ALA A CA    1 
ATOM   2359 C  C     . ALA A 1 303 ? 55.922 -22.947 -0.220  1.00 8.76  ? 300  ALA A C     1 
ATOM   2360 O  O     . ALA A 1 303 ? 57.116 -22.767 0.046   1.00 9.13  ? 300  ALA A O     1 
ATOM   2361 C  CB    . ALA A 1 303 ? 55.244 -23.668 -2.553  1.00 11.78 ? 300  ALA A CB    1 
ATOM   2362 N  N     . MET A 1 304 ? 54.965 -22.152 0.244   1.00 7.90  ? 301  MET A N     1 
ATOM   2363 C  CA    . MET A 1 304 ? 55.332 -20.900 0.924   1.00 12.49 ? 301  MET A CA    1 
ATOM   2364 C  C     . MET A 1 304 ? 56.058 -21.131 2.240   1.00 9.39  ? 301  MET A C     1 
ATOM   2365 O  O     . MET A 1 304 ? 56.979 -20.374 2.583   1.00 9.58  ? 301  MET A O     1 
ATOM   2366 C  CB    . MET A 1 304 ? 54.117 -20.011 1.171   1.00 12.84 ? 301  MET A CB    1 
ATOM   2367 C  CG    . MET A 1 304 ? 54.472 -18.588 1.603   1.00 15.27 ? 301  MET A CG    1 
ATOM   2368 S  SD    . MET A 1 304 ? 55.277 -17.637 0.292   1.00 14.99 ? 301  MET A SD    1 
ATOM   2369 C  CE    . MET A 1 304 ? 56.995 -17.623 0.839   1.00 12.81 ? 301  MET A CE    1 
ATOM   2370 N  N     . CYS A 1 305 ? 55.634 -22.147 2.989   1.00 10.98 ? 302  CYS A N     1 
ATOM   2371 C  CA    . CYS A 1 305 ? 56.266 -22.432 4.288   1.00 12.43 ? 302  CYS A CA    1 
ATOM   2372 C  C     . CYS A 1 305 ? 57.708 -22.924 4.129   1.00 9.63  ? 302  CYS A C     1 
ATOM   2373 O  O     . CYS A 1 305 ? 58.467 -22.970 5.104   1.00 12.30 ? 302  CYS A O     1 
ATOM   2374 C  CB    . CYS A 1 305 ? 55.436 -23.428 5.122   1.00 9.08  ? 302  CYS A CB    1 
ATOM   2375 S  SG    . CYS A 1 305 ? 55.406 -25.113 4.468   1.00 11.29 ? 302  CYS A SG    1 
ATOM   2376 N  N     . ARG A 1 306 ? 58.071 -23.279 2.898   1.00 10.01 ? 303  ARG A N     1 
ATOM   2377 C  CA    . ARG A 1 306 ? 59.445 -23.621 2.529   1.00 7.97  ? 303  ARG A CA    1 
ATOM   2378 C  C     . ARG A 1 306 ? 60.201 -22.461 1.866   1.00 10.27 ? 303  ARG A C     1 
ATOM   2379 O  O     . ARG A 1 306 ? 61.338 -22.621 1.423   1.00 13.65 ? 303  ARG A O     1 
ATOM   2380 C  CB    . ARG A 1 306 ? 59.471 -24.874 1.634   1.00 8.00  ? 303  ARG A CB    1 
ATOM   2381 C  CG    . ARG A 1 306 ? 58.994 -26.131 2.349   1.00 11.73 ? 303  ARG A CG    1 
ATOM   2382 C  CD    . ARG A 1 306 ? 58.617 -27.278 1.399   1.00 10.87 ? 303  ARG A CD    1 
ATOM   2383 N  NE    . ARG A 1 306 ? 58.441 -28.503 2.180   1.00 17.98 ? 303  ARG A NE    1 
ATOM   2384 C  CZ    . ARG A 1 306 ? 57.350 -28.790 2.887   1.00 14.12 ? 303  ARG A CZ    1 
ATOM   2385 N  NH1   . ARG A 1 306 ? 57.297 -29.909 3.601   1.00 14.95 ? 303  ARG A NH1   1 
ATOM   2386 N  NH2   . ARG A 1 306 ? 56.315 -27.961 2.882   1.00 10.90 ? 303  ARG A NH2   1 
ATOM   2387 N  N     . GLY A 1 307 ? 59.574 -21.293 1.820   1.00 9.77  ? 304  GLY A N     1 
ATOM   2388 C  CA    . GLY A 1 307 ? 60.203 -20.107 1.275   1.00 8.40  ? 304  GLY A CA    1 
ATOM   2389 C  C     . GLY A 1 307 ? 60.001 -19.961 -0.219  1.00 10.71 ? 304  GLY A C     1 
ATOM   2390 O  O     . GLY A 1 307 ? 60.673 -19.154 -0.862  1.00 11.82 ? 304  GLY A O     1 
ATOM   2391 N  N     . ILE A 1 308 ? 59.068 -20.730 -0.768  1.00 10.40 ? 305  ILE A N     1 
ATOM   2392 C  CA    . ILE A 1 308 ? 58.897 -20.805 -2.224  1.00 9.46  ? 305  ILE A CA    1 
ATOM   2393 C  C     . ILE A 1 308 ? 57.550 -20.249 -2.670  1.00 14.86 ? 305  ILE A C     1 
ATOM   2394 O  O     . ILE A 1 308 ? 56.511 -20.600 -2.123  1.00 11.42 ? 305  ILE A O     1 
ATOM   2395 C  CB    . ILE A 1 308 ? 59.031 -22.263 -2.700  1.00 10.98 ? 305  ILE A CB    1 
ATOM   2396 C  CG1   . ILE A 1 308 ? 60.402 -22.812 -2.284  1.00 17.14 ? 305  ILE A CG1   1 
ATOM   2397 C  CG2   . ILE A 1 308 ? 58.792 -22.371 -4.190  1.00 13.14 ? 305  ILE A CG2   1 
ATOM   2398 C  CD1   . ILE A 1 308 ? 60.507 -24.324 -2.397  1.00 22.06 ? 305  ILE A CD1   1 
ATOM   2399 N  N     . GLU A 1 309 ? 57.569 -19.376 -3.668  1.00 9.32  ? 306  GLU A N     1 
ATOM   2400 C  CA    . GLU A 1 309 ? 56.334 -18.794 -4.177  1.00 12.66 ? 306  GLU A CA    1 
ATOM   2401 C  C     . GLU A 1 309 ? 56.607 -18.276 -5.575  1.00 21.19 ? 306  GLU A C     1 
ATOM   2402 O  O     . GLU A 1 309 ? 57.692 -17.770 -5.847  1.00 17.61 ? 306  GLU A O     1 
ATOM   2403 C  CB    . GLU A 1 309 ? 55.881 -17.638 -3.294  1.00 17.32 ? 306  GLU A CB    1 
ATOM   2404 C  CG    . GLU A 1 309 ? 54.439 -17.311 -3.488  1.00 24.77 ? 306  GLU A CG    1 
ATOM   2405 C  CD    . GLU A 1 309 ? 54.153 -15.834 -3.560  1.00 28.44 ? 306  GLU A CD    1 
ATOM   2406 O  OE1   . GLU A 1 309 ? 55.099 -15.010 -3.687  1.00 22.73 ? 306  GLU A OE1   1 
ATOM   2407 O  OE2   . GLU A 1 309 ? 52.953 -15.507 -3.492  1.00 25.31 ? 306  GLU A OE2   1 
ATOM   2408 N  N     . HIS A 1 310 ? 55.630 -18.388 -6.465  1.00 16.95 ? 307  HIS A N     1 
ATOM   2409 C  CA    . HIS A 1 310 ? 55.920 -18.128 -7.874  1.00 18.02 ? 307  HIS A CA    1 
ATOM   2410 C  C     . HIS A 1 310 ? 55.174 -16.956 -8.512  1.00 16.04 ? 307  HIS A C     1 
ATOM   2411 O  O     . HIS A 1 310 ? 55.361 -16.689 -9.694  1.00 21.56 ? 307  HIS A O     1 
ATOM   2412 C  CB    . HIS A 1 310 ? 55.729 -19.404 -8.695  1.00 25.54 ? 307  HIS A CB    1 
ATOM   2413 C  CG    . HIS A 1 310 ? 56.624 -20.525 -8.264  1.00 37.08 ? 307  HIS A CG    1 
ATOM   2414 N  ND1   . HIS A 1 310 ? 57.999 -20.449 -8.337  1.00 34.42 ? 307  HIS A ND1   1 
ATOM   2415 C  CD2   . HIS A 1 310 ? 56.342 -21.741 -7.739  1.00 34.68 ? 307  HIS A CD2   1 
ATOM   2416 C  CE1   . HIS A 1 310 ? 58.525 -21.574 -7.885  1.00 40.79 ? 307  HIS A CE1   1 
ATOM   2417 N  NE2   . HIS A 1 310 ? 57.540 -22.374 -7.516  1.00 37.36 ? 307  HIS A NE2   1 
ATOM   2418 N  N     . ASP A 1 311 ? 54.342 -16.268 -7.738  1.00 15.60 ? 308  ASP A N     1 
ATOM   2419 C  CA    . ASP A 1 311 ? 53.579 -15.123 -8.247  1.00 16.83 ? 308  ASP A CA    1 
ATOM   2420 C  C     . ASP A 1 311 ? 54.523 -14.134 -8.943  1.00 14.98 ? 308  ASP A C     1 
ATOM   2421 O  O     . ASP A 1 311 ? 55.483 -13.662 -8.345  1.00 12.15 ? 308  ASP A O     1 
ATOM   2422 C  CB    . ASP A 1 311 ? 52.837 -14.443 -7.090  1.00 14.71 ? 308  ASP A CB    1 
ATOM   2423 C  CG    . ASP A 1 311 ? 51.913 -13.326 -7.547  1.00 22.10 ? 308  ASP A CG    1 
ATOM   2424 O  OD1   . ASP A 1 311 ? 51.752 -12.344 -6.796  1.00 34.13 ? 308  ASP A OD1   1 
ATOM   2425 O  OD2   . ASP A 1 311 ? 51.323 -13.428 -8.641  1.00 35.55 ? 308  ASP A OD2   1 
ATOM   2426 N  N     . PRO A 1 312 ? 54.265 -13.826 -10.226 1.00 15.52 ? 309  PRO A N     1 
ATOM   2427 C  CA    . PRO A 1 312 ? 55.190 -12.931 -10.927 1.00 13.08 ? 309  PRO A CA    1 
ATOM   2428 C  C     . PRO A 1 312 ? 55.022 -11.467 -10.524 1.00 10.36 ? 309  PRO A C     1 
ATOM   2429 O  O     . PRO A 1 312 ? 53.956 -11.068 -10.065 1.00 12.82 ? 309  PRO A O     1 
ATOM   2430 C  CB    . PRO A 1 312 ? 54.806 -13.123 -12.409 1.00 13.71 ? 309  PRO A CB    1 
ATOM   2431 C  CG    . PRO A 1 312 ? 53.377 -13.561 -12.373 1.00 13.91 ? 309  PRO A CG    1 
ATOM   2432 C  CD    . PRO A 1 312 ? 53.240 -14.395 -11.128 1.00 15.97 ? 309  PRO A CD    1 
ATOM   2433 N  N     . VAL A 1 313 ? 56.091 -10.689 -10.656 1.00 12.39 ? 310  VAL A N     1 
ATOM   2434 C  CA    . VAL A 1 313 ? 55.995 -9.234  -10.586 1.00 12.25 ? 310  VAL A CA    1 
ATOM   2435 C  C     . VAL A 1 313 ? 55.339 -8.829  -11.895 1.00 11.87 ? 310  VAL A C     1 
ATOM   2436 O  O     . VAL A 1 313 ? 55.913 -9.021  -12.959 1.00 14.78 ? 310  VAL A O     1 
ATOM   2437 C  CB    . VAL A 1 313 ? 57.385 -8.580  -10.450 1.00 14.65 ? 310  VAL A CB    1 
ATOM   2438 C  CG1   . VAL A 1 313 ? 57.284 -7.045  -10.478 1.00 11.61 ? 310  VAL A CG1   1 
ATOM   2439 C  CG2   . VAL A 1 313 ? 58.045 -9.039  -9.143  1.00 13.09 ? 310  VAL A CG2   1 
ATOM   2440 N  N     . LYS A 1 314 ? 54.118 -8.328  -11.809 1.00 11.88 ? 311  LYS A N     1 
ATOM   2441 C  CA    . LYS A 1 314 ? 53.374 -7.957  -13.005 1.00 12.81 ? 311  LYS A CA    1 
ATOM   2442 C  C     . LYS A 1 314 ? 53.813 -6.589  -13.473 1.00 11.25 ? 311  LYS A C     1 
ATOM   2443 O  O     . LYS A 1 314 ? 53.971 -5.664  -12.664 1.00 15.28 ? 311  LYS A O     1 
ATOM   2444 C  CB    . LYS A 1 314 ? 51.871 -8.004  -12.725 1.00 13.86 ? 311  LYS A CB    1 
ATOM   2445 C  CG    . LYS A 1 314 ? 51.417 -9.414  -12.387 1.00 25.11 ? 311  LYS A CG    1 
ATOM   2446 C  CD    . LYS A 1 314 ? 50.078 -9.463  -11.688 1.00 37.04 ? 311  LYS A CD    1 
ATOM   2447 C  CE    . LYS A 1 314 ? 49.757 -10.909 -11.305 1.00 39.40 ? 311  LYS A CE    1 
ATOM   2448 N  NZ    . LYS A 1 314 ? 50.900 -11.565 -10.577 1.00 28.62 ? 311  LYS A NZ    1 
ATOM   2449 N  N     . PRO A 1 315 ? 54.050 -6.462  -14.785 1.00 14.70 ? 312  PRO A N     1 
ATOM   2450 C  CA    . PRO A 1 315 ? 54.429 -5.178  -15.367 1.00 13.44 ? 312  PRO A CA    1 
ATOM   2451 C  C     . PRO A 1 315 ? 53.237 -4.221  -15.372 1.00 18.05 ? 312  PRO A C     1 
ATOM   2452 O  O     . PRO A 1 315 ? 52.510 -4.121  -16.369 1.00 17.72 ? 312  PRO A O     1 
ATOM   2453 C  CB    . PRO A 1 315 ? 54.849 -5.561  -16.792 1.00 19.64 ? 312  PRO A CB    1 
ATOM   2454 C  CG    . PRO A 1 315 ? 54.060 -6.820  -17.093 1.00 19.43 ? 312  PRO A CG    1 
ATOM   2455 C  CD    . PRO A 1 315 ? 54.031 -7.555  -15.779 1.00 15.97 ? 312  PRO A CD    1 
ATOM   2456 N  N     . ARG A 1 316 ? 53.030 -3.523  -14.260 1.00 15.14 ? 313  ARG A N     1 
ATOM   2457 C  CA    . ARG A 1 316 ? 51.880 -2.612  -14.138 1.00 11.71 ? 313  ARG A CA    1 
ATOM   2458 C  C     . ARG A 1 316 ? 52.221 -1.494  -13.154 1.00 19.73 ? 313  ARG A C     1 
ATOM   2459 O  O     . ARG A 1 316 ? 52.323 -1.722  -11.951 1.00 18.06 ? 313  ARG A O     1 
ATOM   2460 C  CB    . ARG A 1 316 ? 50.627 -3.371  -13.681 1.00 22.54 ? 313  ARG A CB    1 
ATOM   2461 C  CG    . ARG A 1 316 ? 49.346 -2.534  -13.659 1.00 24.52 ? 313  ARG A CG    1 
ATOM   2462 C  CD    . ARG A 1 316 ? 48.214 -3.243  -12.900 1.00 25.63 ? 313  ARG A CD    1 
ATOM   2463 N  NE    . ARG A 1 316 ? 48.390 -3.131  -11.453 1.00 27.30 ? 313  ARG A NE    1 
ATOM   2464 C  CZ    . ARG A 1 316 ? 48.663 -4.140  -10.632 1.00 42.38 ? 313  ARG A CZ    1 
ATOM   2465 N  NH1   . ARG A 1 316 ? 48.808 -3.902  -9.331  1.00 27.98 ? 313  ARG A NH1   1 
ATOM   2466 N  NH2   . ARG A 1 316 ? 48.781 -5.381  -11.102 1.00 35.15 ? 313  ARG A NH2   1 
ATOM   2467 N  N     . GLN A 1 317 ? 52.393 -0.287  -13.678 1.00 18.44 ? 314  GLN A N     1 
ATOM   2468 C  CA    . GLN A 1 317 ? 52.805 0.855   -12.876 1.00 22.13 ? 314  GLN A CA    1 
ATOM   2469 C  C     . GLN A 1 317 ? 51.617 1.763   -12.542 1.00 20.63 ? 314  GLN A C     1 
ATOM   2470 O  O     . GLN A 1 317 ? 51.678 2.551   -11.594 1.00 22.74 ? 314  GLN A O     1 
ATOM   2471 C  CB    . GLN A 1 317 ? 53.889 1.636   -13.625 1.00 27.49 ? 314  GLN A CB    1 
ATOM   2472 C  CG    . GLN A 1 317 ? 54.445 2.828   -12.883 1.00 35.58 ? 314  GLN A CG    1 
ATOM   2473 C  CD    . GLN A 1 317 ? 55.438 3.601   -13.717 1.00 31.03 ? 314  GLN A CD    1 
ATOM   2474 O  OE1   . GLN A 1 317 ? 55.760 3.205   -14.837 1.00 39.64 ? 314  GLN A OE1   1 
ATOM   2475 N  NE2   . GLN A 1 317 ? 55.930 4.708   -13.180 1.00 29.26 ? 314  GLN A NE2   1 
ATOM   2476 N  N     . LEU A 1 318 ? 50.543 1.646   -13.320 1.00 17.02 ? 315  LEU A N     1 
ATOM   2477 C  CA    . LEU A 1 318 ? 49.333 2.451   -13.124 1.00 17.53 ? 315  LEU A CA    1 
ATOM   2478 C  C     . LEU A 1 318 ? 48.195 1.665   -12.457 1.00 17.63 ? 315  LEU A C     1 
ATOM   2479 O  O     . LEU A 1 318 ? 48.021 0.473   -12.716 1.00 16.31 ? 315  LEU A O     1 
ATOM   2480 C  CB    . LEU A 1 318 ? 48.822 2.963   -14.481 1.00 17.65 ? 315  LEU A CB    1 
ATOM   2481 C  CG    . LEU A 1 318 ? 49.756 3.806   -15.351 1.00 20.41 ? 315  LEU A CG    1 
ATOM   2482 C  CD1   . LEU A 1 318 ? 49.141 4.038   -16.735 1.00 23.56 ? 315  LEU A CD1   1 
ATOM   2483 C  CD2   . LEU A 1 318 ? 50.103 5.130   -14.674 1.00 21.21 ? 315  LEU A CD2   1 
ATOM   2484 N  N     . PRO A 1 319 ? 47.379 2.348   -11.632 1.00 16.21 ? 316  PRO A N     1 
ATOM   2485 C  CA    . PRO A 1 319 ? 46.206 1.685   -11.033 1.00 17.30 ? 316  PRO A CA    1 
ATOM   2486 C  C     . PRO A 1 319 ? 45.203 1.205   -12.098 1.00 17.60 ? 316  PRO A C     1 
ATOM   2487 O  O     . PRO A 1 319 ? 45.100 1.835   -13.141 1.00 21.57 ? 316  PRO A O     1 
ATOM   2488 C  CB    . PRO A 1 319 ? 45.598 2.768   -10.123 1.00 23.32 ? 316  PRO A CB    1 
ATOM   2489 C  CG    . PRO A 1 319 ? 46.213 4.064   -10.562 1.00 26.75 ? 316  PRO A CG    1 
ATOM   2490 C  CD    . PRO A 1 319 ? 47.527 3.758   -11.221 1.00 13.03 ? 316  PRO A CD    1 
ATOM   2491 N  N     . LYS A 1 320 ? 44.501 0.099   -11.838 1.00 16.69 ? 317  LYS A N     1 
ATOM   2492 C  CA    . LYS A 1 320 ? 43.546 -0.498  -12.787 1.00 14.92 ? 317  LYS A CA    1 
ATOM   2493 C  C     . LYS A 1 320 ? 42.159 0.126   -12.691 1.00 23.27 ? 317  LYS A C     1 
ATOM   2494 O  O     . LYS A 1 320 ? 41.291 -0.130  -13.528 1.00 19.13 ? 317  LYS A O     1 
ATOM   2495 C  CB    . LYS A 1 320 ? 43.351 -1.991  -12.474 1.00 20.30 ? 317  LYS A CB    1 
ATOM   2496 C  CG    . LYS A 1 320 ? 44.528 -2.895  -12.745 1.00 25.50 ? 317  LYS A CG    1 
ATOM   2497 C  CD    . LYS A 1 320 ? 44.084 -4.359  -12.688 1.00 26.33 ? 317  LYS A CD    1 
ATOM   2498 C  CE    . LYS A 1 320 ? 45.221 -5.290  -13.070 1.00 42.71 ? 317  LYS A CE    1 
ATOM   2499 N  NZ    . LYS A 1 320 ? 44.744 -6.667  -13.358 1.00 42.21 ? 317  LYS A NZ    1 
ATOM   2500 N  N     . THR A 1 321 ? 41.932 0.881   -11.626 1.00 20.29 ? 318  THR A N     1 
ATOM   2501 C  CA    . THR A 1 321 ? 40.630 1.493   -11.386 1.00 19.28 ? 318  THR A CA    1 
ATOM   2502 C  C     . THR A 1 321 ? 40.860 2.873   -10.796 1.00 13.81 ? 318  THR A C     1 
ATOM   2503 O  O     . THR A 1 321 ? 41.909 3.143   -10.209 1.00 22.71 ? 318  THR A O     1 
ATOM   2504 C  CB    . THR A 1 321 ? 39.752 0.653   -10.412 1.00 25.74 ? 318  THR A CB    1 
ATOM   2505 O  OG1   . THR A 1 321 ? 40.458 0.459   -9.179  1.00 21.23 ? 318  THR A OG1   1 
ATOM   2506 C  CG2   . THR A 1 321 ? 39.392 -0.709  -11.008 1.00 17.39 ? 318  THR A CG2   1 
ATOM   2507 N  N     . ILE A 1 322 ? 39.889 3.760   -10.991 1.00 15.36 ? 319  ILE A N     1 
ATOM   2508 C  CA    . ILE A 1 322 ? 39.926 5.101   -10.427 1.00 17.50 ? 319  ILE A CA    1 
ATOM   2509 C  C     . ILE A 1 322 ? 38.597 5.309   -9.705  1.00 17.28 ? 319  ILE A C     1 
ATOM   2510 O  O     . ILE A 1 322 ? 37.541 5.315   -10.332 1.00 18.33 ? 319  ILE A O     1 
ATOM   2511 C  CB    . ILE A 1 322 ? 40.121 6.174   -11.514 1.00 12.18 ? 319  ILE A CB    1 
ATOM   2512 C  CG1   . ILE A 1 322 ? 41.488 6.001   -12.187 1.00 21.50 ? 319  ILE A CG1   1 
ATOM   2513 C  CG2   . ILE A 1 322 ? 39.986 7.578   -10.930 1.00 18.05 ? 319  ILE A CG2   1 
ATOM   2514 C  CD1   . ILE A 1 322 ? 41.795 7.081   -13.206 1.00 18.77 ? 319  ILE A CD1   1 
ATOM   2515 N  N     . GLY A 1 323 ? 38.654 5.435   -8.385  1.00 14.87 ? 320  GLY A N     1 
ATOM   2516 C  CA    . GLY A 1 323 ? 37.443 5.495   -7.587  1.00 17.70 ? 320  GLY A CA    1 
ATOM   2517 C  C     . GLY A 1 323 ? 37.335 6.674   -6.642  1.00 14.70 ? 320  GLY A C     1 
ATOM   2518 O  O     . GLY A 1 323 ? 38.331 7.303   -6.280  1.00 16.13 ? 320  GLY A O     1 
ATOM   2519 N  N     . CYS A 1 324 ? 36.102 6.942   -6.227  1.00 13.86 ? 321  CYS A N     1 
ATOM   2520 C  CA    . CYS A 1 324 ? 35.769 8.060   -5.349  1.00 13.37 ? 321  CYS A CA    1 
ATOM   2521 C  C     . CYS A 1 324 ? 34.726 7.540   -4.381  1.00 12.82 ? 321  CYS A C     1 
ATOM   2522 O  O     . CYS A 1 324 ? 33.720 6.976   -4.802  1.00 16.76 ? 321  CYS A O     1 
ATOM   2523 C  CB    . CYS A 1 324 ? 35.162 9.213   -6.169  1.00 14.52 ? 321  CYS A CB    1 
ATOM   2524 S  SG    A CYS A 1 324 ? 35.408 10.815  -5.441  0.31 19.42 ? 321  CYS A SG    1 
ATOM   2525 S  SG    B CYS A 1 324 ? 36.308 10.111  -7.237  0.69 21.86 ? 321  CYS A SG    1 
ATOM   2526 N  N     . SER A 1 325 ? 34.969 7.708   -3.086  1.00 15.28 ? 322  SER A N     1 
ATOM   2527 C  CA    A SER A 1 325 ? 34.033 7.191   -2.104  0.44 17.77 ? 322  SER A CA    1 
ATOM   2528 C  CA    B SER A 1 325 ? 34.135 7.114   -2.050  0.56 17.82 ? 322  SER A CA    1 
ATOM   2529 C  C     . SER A 1 325 ? 33.934 8.077   -0.880  1.00 17.20 ? 322  SER A C     1 
ATOM   2530 O  O     . SER A 1 325 ? 34.867 8.799   -0.519  1.00 15.56 ? 322  SER A O     1 
ATOM   2531 C  CB    A SER A 1 325 ? 34.382 5.755   -1.696  0.44 18.46 ? 322  SER A CB    1 
ATOM   2532 C  CB    B SER A 1 325 ? 34.812 5.831   -1.550  0.56 18.11 ? 322  SER A CB    1 
ATOM   2533 O  OG    A SER A 1 325 ? 35.611 5.702   -1.003  0.44 15.64 ? 322  SER A OG    1 
ATOM   2534 O  OG    B SER A 1 325 ? 34.142 5.265   -0.446  0.56 15.95 ? 322  SER A OG    1 
ATOM   2535 N  N     . LYS A 1 326 ? 32.750 8.055   -0.279  1.00 14.28 ? 323  LYS A N     1 
ATOM   2536 C  CA    . LYS A 1 326 ? 32.509 8.803   0.947   1.00 16.29 ? 323  LYS A CA    1 
ATOM   2537 C  C     . LYS A 1 326 ? 31.561 8.059   1.876   1.00 20.29 ? 323  LYS A C     1 
ATOM   2538 O  O     . LYS A 1 326 ? 30.501 7.601   1.456   1.00 17.74 ? 323  LYS A O     1 
ATOM   2539 C  CB    . LYS A 1 326 ? 31.955 10.204  0.670   1.00 14.07 ? 323  LYS A CB    1 
ATOM   2540 C  CG    . LYS A 1 326 ? 31.859 11.018  1.967   1.00 15.79 ? 323  LYS A CG    1 
ATOM   2541 C  CD    . LYS A 1 326 ? 31.722 12.510  1.720   1.00 17.29 ? 323  LYS A CD    1 
ATOM   2542 C  CE    . LYS A 1 326 ? 31.528 13.238  3.044   1.00 21.98 ? 323  LYS A CE    1 
ATOM   2543 N  NZ    . LYS A 1 326 ? 32.600 12.847  3.993   1.00 26.68 ? 323  LYS A NZ    1 
ATOM   2544 N  N     . ASN A 1 327 ? 31.957 7.938   3.138   1.00 15.20 ? 324  ASN A N     1 
ATOM   2545 C  CA    . ASN A 1 327 ? 31.086 7.391   4.171   1.00 17.22 ? 324  ASN A CA    1 
ATOM   2546 C  C     . ASN A 1 327 ? 30.239 8.497   4.786   1.00 19.59 ? 324  ASN A C     1 
ATOM   2547 O  O     . ASN A 1 327 ? 30.644 9.652   4.815   1.00 15.26 ? 324  ASN A O     1 
ATOM   2548 C  CB    . ASN A 1 327 ? 31.903 6.724   5.277   1.00 21.55 ? 324  ASN A CB    1 
ATOM   2549 C  CG    . ASN A 1 327 ? 32.512 5.412   4.848   1.00 27.41 ? 324  ASN A CG    1 
ATOM   2550 O  OD1   . ASN A 1 327 ? 32.178 4.864   3.795   1.00 26.15 ? 324  ASN A OD1   1 
ATOM   2551 N  ND2   . ASN A 1 327 ? 33.400 4.883   5.677   1.00 27.57 ? 324  ASN A ND2   1 
ATOM   2552 N  N     . PHE A 1 328 ? 29.068 8.132   5.292   1.00 15.63 ? 325  PHE A N     1 
ATOM   2553 C  CA    . PHE A 1 328 ? 28.161 9.088   5.906   1.00 23.39 ? 325  PHE A CA    1 
ATOM   2554 C  C     . PHE A 1 328 ? 27.707 8.444   7.199   1.00 23.01 ? 325  PHE A C     1 
ATOM   2555 O  O     . PHE A 1 328 ? 26.610 7.897   7.275   1.00 26.88 ? 325  PHE A O     1 
ATOM   2556 C  CB    . PHE A 1 328 ? 26.972 9.370   4.983   1.00 21.77 ? 325  PHE A CB    1 
ATOM   2557 C  CG    . PHE A 1 328 ? 27.369 9.939   3.652   1.00 19.58 ? 325  PHE A CG    1 
ATOM   2558 C  CD1   . PHE A 1 328 ? 27.550 9.110   2.556   1.00 18.52 ? 325  PHE A CD1   1 
ATOM   2559 C  CD2   . PHE A 1 328 ? 27.601 11.299  3.504   1.00 15.20 ? 325  PHE A CD2   1 
ATOM   2560 C  CE1   . PHE A 1 328 ? 27.935 9.635   1.334   1.00 17.01 ? 325  PHE A CE1   1 
ATOM   2561 C  CE2   . PHE A 1 328 ? 27.972 11.826  2.290   1.00 21.28 ? 325  PHE A CE2   1 
ATOM   2562 C  CZ    . PHE A 1 328 ? 28.147 10.990  1.198   1.00 15.89 ? 325  PHE A CZ    1 
ATOM   2563 N  N     . PRO A 1 329 ? 28.583 8.475   8.209   1.00 29.38 ? 326  PRO A N     1 
ATOM   2564 C  CA    . PRO A 1 329 ? 28.403 7.714   9.448   1.00 32.68 ? 326  PRO A CA    1 
ATOM   2565 C  C     . PRO A 1 329 ? 27.354 8.287   10.386  1.00 32.84 ? 326  PRO A C     1 
ATOM   2566 O  O     . PRO A 1 329 ? 27.010 9.475   10.326  1.00 28.82 ? 326  PRO A O     1 
ATOM   2567 C  CB    . PRO A 1 329 ? 29.786 7.782   10.100  1.00 31.83 ? 326  PRO A CB    1 
ATOM   2568 C  CG    . PRO A 1 329 ? 30.371 9.058   9.591   1.00 33.44 ? 326  PRO A CG    1 
ATOM   2569 C  CD    . PRO A 1 329 ? 29.882 9.170   8.172   1.00 30.51 ? 326  PRO A CD    1 
ATOM   2570 N  N     . GLY A 1 330 ? 26.853 7.411   11.250  1.00 42.04 ? 327  GLY A N     1 
ATOM   2571 C  CA    . GLY A 1 330 ? 25.903 7.778   12.279  1.00 44.17 ? 327  GLY A CA    1 
ATOM   2572 C  C     . GLY A 1 330 ? 24.780 8.662   11.789  1.00 37.30 ? 327  GLY A C     1 
ATOM   2573 O  O     . GLY A 1 330 ? 24.006 8.288   10.908  1.00 39.61 ? 327  GLY A O     1 
ATOM   2574 N  N     . LYS A 1 331 ? 24.704 9.853   12.367  1.00 31.59 ? 328  LYS A N     1 
ATOM   2575 C  CA    . LYS A 1 331 ? 23.585 10.745  12.138  1.00 34.23 ? 328  LYS A CA    1 
ATOM   2576 C  C     . LYS A 1 331 ? 23.683 11.470  10.799  1.00 33.44 ? 328  LYS A C     1 
ATOM   2577 O  O     . LYS A 1 331 ? 22.726 12.112  10.367  1.00 38.17 ? 328  LYS A O     1 
ATOM   2578 C  CB    . LYS A 1 331 ? 23.476 11.737  13.302  1.00 43.60 ? 328  LYS A CB    1 
ATOM   2579 C  CG    . LYS A 1 331 ? 22.119 12.398  13.451  1.00 56.87 ? 328  LYS A CG    1 
ATOM   2580 C  CD    . LYS A 1 331 ? 22.006 13.121  14.786  1.00 54.16 ? 328  LYS A CD    1 
ATOM   2581 C  CE    . LYS A 1 331 ? 20.897 14.165  14.757  1.00 58.69 ? 328  LYS A CE    1 
ATOM   2582 N  NZ    . LYS A 1 331 ? 21.207 15.265  13.793  1.00 48.48 ? 328  LYS A NZ    1 
ATOM   2583 N  N     . THR A 1 332 ? 24.830 11.367  10.130  1.00 33.81 ? 329  THR A N     1 
ATOM   2584 C  CA    . THR A 1 332 ? 25.004 12.070  8.859   1.00 31.12 ? 329  THR A CA    1 
ATOM   2585 C  C     . THR A 1 332 ? 24.484 11.282  7.655   1.00 28.59 ? 329  THR A C     1 
ATOM   2586 O  O     . THR A 1 332 ? 24.519 11.784  6.537   1.00 26.90 ? 329  THR A O     1 
ATOM   2587 C  CB    . THR A 1 332 ? 26.477 12.499  8.590   1.00 29.86 ? 329  THR A CB    1 
ATOM   2588 O  OG1   . THR A 1 332 ? 27.279 11.354  8.276   1.00 30.58 ? 329  THR A OG1   1 
ATOM   2589 C  CG2   . THR A 1 332 ? 27.064 13.230  9.790   1.00 29.97 ? 329  THR A CG2   1 
ATOM   2590 N  N     . ALA A 1 333 ? 24.005 10.061  7.887   1.00 25.39 ? 330  ALA A N     1 
ATOM   2591 C  CA    . ALA A 1 333 ? 23.453 9.228   6.812   1.00 27.75 ? 330  ALA A CA    1 
ATOM   2592 C  C     . ALA A 1 333 ? 22.437 9.979   5.956   1.00 30.83 ? 330  ALA A C     1 
ATOM   2593 O  O     . ALA A 1 333 ? 21.620 10.734  6.471   1.00 31.23 ? 330  ALA A O     1 
ATOM   2594 C  CB    . ALA A 1 333 ? 22.842 7.951   7.385   1.00 26.11 ? 330  ALA A CB    1 
ATOM   2595 N  N     . LEU A 1 334 ? 22.489 9.765   4.643   1.00 30.40 ? 331  LEU A N     1 
ATOM   2596 C  CA    . LEU A 1 334 ? 21.638 10.500  3.707   1.00 32.67 ? 331  LEU A CA    1 
ATOM   2597 C  C     . LEU A 1 334 ? 20.201 9.964   3.701   1.00 32.06 ? 331  LEU A C     1 
ATOM   2598 O  O     . LEU A 1 334 ? 19.975 8.789   3.446   1.00 28.94 ? 331  LEU A O     1 
ATOM   2599 C  CB    . LEU A 1 334 ? 22.222 10.427  2.294   1.00 27.51 ? 331  LEU A CB    1 
ATOM   2600 C  CG    . LEU A 1 334 ? 23.731 10.646  2.168   1.00 27.19 ? 331  LEU A CG    1 
ATOM   2601 C  CD1   . LEU A 1 334 ? 24.141 10.608  0.695   1.00 24.56 ? 331  LEU A CD1   1 
ATOM   2602 C  CD2   . LEU A 1 334 ? 24.154 11.959  2.825   1.00 23.09 ? 331  LEU A CD2   1 
ATOM   2603 N  N     . ALA A 1 335 ? 19.231 10.832  3.964   1.00 37.36 ? 332  ALA A N     1 
ATOM   2604 C  CA    . ALA A 1 335 ? 17.856 10.375  4.152   1.00 32.51 ? 332  ALA A CA    1 
ATOM   2605 C  C     . ALA A 1 335 ? 16.867 11.024  3.191   1.00 39.01 ? 332  ALA A C     1 
ATOM   2606 O  O     . ALA A 1 335 ? 15.665 10.756  3.251   1.00 40.57 ? 332  ALA A O     1 
ATOM   2607 C  CB    . ALA A 1 335 ? 17.422 10.602  5.590   1.00 35.13 ? 332  ALA A CB    1 
ATOM   2608 N  N     . THR A 1 336 ? 17.372 11.883  2.315   1.00 30.65 ? 333  THR A N     1 
ATOM   2609 C  CA    . THR A 1 336 ? 16.541 12.515  1.308   1.00 32.94 ? 333  THR A CA    1 
ATOM   2610 C  C     . THR A 1 336 ? 17.146 12.315  -0.073  1.00 46.67 ? 333  THR A C     1 
ATOM   2611 O  O     . THR A 1 336 ? 18.355 12.112  -0.210  1.00 34.64 ? 333  THR A O     1 
ATOM   2612 C  CB    . THR A 1 336 ? 16.385 14.020  1.557   1.00 40.27 ? 333  THR A CB    1 
ATOM   2613 O  OG1   . THR A 1 336 ? 17.573 14.700  1.139   1.00 32.98 ? 333  THR A OG1   1 
ATOM   2614 C  CG2   . THR A 1 336 ? 16.116 14.301  3.035   1.00 38.36 ? 333  THR A CG2   1 
ATOM   2615 N  N     . ARG A 1 337 ? 16.295 12.383  -1.091  1.00 42.75 ? 334  ARG A N     1 
ATOM   2616 C  CA    . ARG A 1 337 ? 16.720 12.198  -2.470  1.00 43.47 ? 334  ARG A CA    1 
ATOM   2617 C  C     . ARG A 1 337 ? 17.653 13.323  -2.904  1.00 40.97 ? 334  ARG A C     1 
ATOM   2618 O  O     . ARG A 1 337 ? 18.662 13.085  -3.566  1.00 41.98 ? 334  ARG A O     1 
ATOM   2619 C  CB    . ARG A 1 337 ? 15.497 12.126  -3.387  1.00 46.80 ? 334  ARG A CB    1 
ATOM   2620 C  CG    . ARG A 1 337 ? 15.825 11.961  -4.860  1.00 53.45 ? 334  ARG A CG    1 
ATOM   2621 C  CD    . ARG A 1 337 ? 14.560 11.834  -5.707  1.00 54.76 ? 334  ARG A CD    1 
ATOM   2622 N  NE    . ARG A 1 337 ? 13.559 12.845  -5.371  1.00 72.25 ? 334  ARG A NE    1 
ATOM   2623 C  CZ    . ARG A 1 337 ? 13.699 14.147  -5.606  1.00 67.86 ? 334  ARG A CZ    1 
ATOM   2624 N  NH1   . ARG A 1 337 ? 14.806 14.608  -6.171  1.00 61.43 ? 334  ARG A NH1   1 
ATOM   2625 N  NH2   . ARG A 1 337 ? 12.733 14.990  -5.267  1.00 69.78 ? 334  ARG A NH2   1 
ATOM   2626 N  N     . GLU A 1 338 ? 17.313 14.551  -2.529  1.00 44.44 ? 335  GLU A N     1 
ATOM   2627 C  CA    . GLU A 1 338 ? 18.150 15.701  -2.841  1.00 39.21 ? 335  GLU A CA    1 
ATOM   2628 C  C     . GLU A 1 338 ? 19.562 15.504  -2.291  1.00 30.80 ? 335  GLU A C     1 
ATOM   2629 O  O     . GLU A 1 338 ? 20.551 15.856  -2.938  1.00 30.64 ? 335  GLU A O     1 
ATOM   2630 C  CB    . GLU A 1 338 ? 17.543 16.975  -2.252  1.00 36.80 ? 335  GLU A CB    1 
ATOM   2631 C  CG    . GLU A 1 338 ? 16.199 17.366  -2.851  1.00 59.88 ? 335  GLU A CG    1 
ATOM   2632 C  CD    . GLU A 1 338 ? 16.312 17.889  -4.274  1.00 62.52 ? 335  GLU A CD    1 
ATOM   2633 O  OE1   . GLU A 1 338 ? 17.422 17.844  -4.846  1.00 54.13 ? 335  GLU A OE1   1 
ATOM   2634 O  OE2   . GLU A 1 338 ? 15.287 18.352  -4.819  1.00 68.63 ? 335  GLU A OE2   1 
ATOM   2635 N  N     . GLN A 1 339 ? 19.643 14.949  -1.087  1.00 31.48 ? 336  GLN A N     1 
ATOM   2636 C  CA    . GLN A 1 339 ? 20.924 14.673  -0.453  1.00 30.21 ? 336  GLN A CA    1 
ATOM   2637 C  C     . GLN A 1 339 ? 21.733 13.687  -1.296  1.00 32.34 ? 336  GLN A C     1 
ATOM   2638 O  O     . GLN A 1 339 ? 22.884 13.957  -1.649  1.00 25.68 ? 336  GLN A O     1 
ATOM   2639 C  CB    . GLN A 1 339 ? 20.704 14.092  0.942   1.00 32.16 ? 336  GLN A CB    1 
ATOM   2640 C  CG    . GLN A 1 339 ? 21.078 15.008  2.084   1.00 29.42 ? 336  GLN A CG    1 
ATOM   2641 C  CD    . GLN A 1 339 ? 21.026 14.283  3.410   1.00 31.18 ? 336  GLN A CD    1 
ATOM   2642 O  OE1   . GLN A 1 339 ? 20.098 13.515  3.675   1.00 27.85 ? 336  GLN A OE1   1 
ATOM   2643 N  NE2   . GLN A 1 339 ? 22.034 14.503  4.244   1.00 24.53 ? 336  GLN A NE2   1 
ATOM   2644 N  N     . VAL A 1 340 ? 21.118 12.550  -1.615  1.00 27.77 ? 337  VAL A N     1 
ATOM   2645 C  CA    . VAL A 1 340 ? 21.772 11.493  -2.386  1.00 27.04 ? 337  VAL A CA    1 
ATOM   2646 C  C     . VAL A 1 340 ? 22.259 11.983  -3.749  1.00 28.62 ? 337  VAL A C     1 
ATOM   2647 O  O     . VAL A 1 340 ? 23.357 11.640  -4.191  1.00 26.34 ? 337  VAL A O     1 
ATOM   2648 C  CB    . VAL A 1 340 ? 20.841 10.276  -2.569  1.00 33.05 ? 337  VAL A CB    1 
ATOM   2649 C  CG1   . VAL A 1 340 ? 21.497 9.215   -3.451  1.00 20.59 ? 337  VAL A CG1   1 
ATOM   2650 C  CG2   . VAL A 1 340 ? 20.473 9.694   -1.220  1.00 29.21 ? 337  VAL A CG2   1 
ATOM   2651 N  N     . GLN A 1 341 ? 21.441 12.790  -4.409  1.00 26.28 ? 338  GLN A N     1 
ATOM   2652 C  CA    . GLN A 1 341 ? 21.808 13.339  -5.707  1.00 28.68 ? 338  GLN A CA    1 
ATOM   2653 C  C     . GLN A 1 341 ? 22.939 14.355  -5.599  1.00 26.82 ? 338  GLN A C     1 
ATOM   2654 O  O     . GLN A 1 341 ? 23.847 14.365  -6.421  1.00 28.22 ? 338  GLN A O     1 
ATOM   2655 C  CB    . GLN A 1 341 ? 20.585 13.942  -6.401  1.00 31.06 ? 338  GLN A CB    1 
ATOM   2656 C  CG    . GLN A 1 341 ? 19.511 12.902  -6.666  1.00 33.37 ? 338  GLN A CG    1 
ATOM   2657 C  CD    . GLN A 1 341 ? 18.304 13.457  -7.388  1.00 42.18 ? 338  GLN A CD    1 
ATOM   2658 O  OE1   . GLN A 1 341 ? 18.100 14.670  -7.448  1.00 37.63 ? 338  GLN A OE1   1 
ATOM   2659 N  NE2   . GLN A 1 341 ? 17.494 12.563  -7.952  1.00 37.52 ? 338  GLN A NE2   1 
ATOM   2660 N  N     . TRP A 1 342 ? 22.892 15.207  -4.584  1.00 25.07 ? 339  TRP A N     1 
ATOM   2661 C  CA    . TRP A 1 342 ? 23.958 16.183  -4.394  1.00 23.97 ? 339  TRP A CA    1 
ATOM   2662 C  C     . TRP A 1 342 ? 25.323 15.519  -4.167  1.00 19.19 ? 339  TRP A C     1 
ATOM   2663 O  O     . TRP A 1 342 ? 26.330 15.943  -4.726  1.00 21.28 ? 339  TRP A O     1 
ATOM   2664 C  CB    . TRP A 1 342 ? 23.633 17.142  -3.243  1.00 20.24 ? 339  TRP A CB    1 
ATOM   2665 C  CG    . TRP A 1 342 ? 24.582 18.300  -3.195  1.00 22.22 ? 339  TRP A CG    1 
ATOM   2666 C  CD1   . TRP A 1 342 ? 24.533 19.437  -3.954  1.00 27.56 ? 339  TRP A CD1   1 
ATOM   2667 C  CD2   . TRP A 1 342 ? 25.739 18.423  -2.365  1.00 19.30 ? 339  TRP A CD2   1 
ATOM   2668 N  NE1   . TRP A 1 342 ? 25.583 20.260  -3.640  1.00 28.67 ? 339  TRP A NE1   1 
ATOM   2669 C  CE2   . TRP A 1 342 ? 26.336 19.663  -2.663  1.00 22.76 ? 339  TRP A CE2   1 
ATOM   2670 C  CE3   . TRP A 1 342 ? 26.326 17.606  -1.394  1.00 18.72 ? 339  TRP A CE3   1 
ATOM   2671 C  CZ2   . TRP A 1 342 ? 27.495 20.105  -2.030  1.00 29.78 ? 339  TRP A CZ2   1 
ATOM   2672 C  CZ3   . TRP A 1 342 ? 27.464 18.045  -0.765  1.00 22.24 ? 339  TRP A CZ3   1 
ATOM   2673 C  CH2   . TRP A 1 342 ? 28.046 19.282  -1.088  1.00 26.58 ? 339  TRP A CH2   1 
ATOM   2674 N  N     . TRP A 1 343 ? 25.355 14.482  -3.341  1.00 18.89 ? 340  TRP A N     1 
ATOM   2675 C  CA    . TRP A 1 343 ? 26.612 13.794  -3.075  1.00 16.48 ? 340  TRP A CA    1 
ATOM   2676 C  C     . TRP A 1 343 ? 27.067 12.927  -4.250  1.00 17.84 ? 340  TRP A C     1 
ATOM   2677 O  O     . TRP A 1 343 ? 28.259 12.833  -4.515  1.00 18.43 ? 340  TRP A O     1 
ATOM   2678 C  CB    . TRP A 1 343 ? 26.533 12.983  -1.780  1.00 18.92 ? 340  TRP A CB    1 
ATOM   2679 C  CG    . TRP A 1 343 ? 26.685 13.844  -0.549  1.00 18.74 ? 340  TRP A CG    1 
ATOM   2680 C  CD1   . TRP A 1 343 ? 25.706 14.210  0.326   1.00 25.22 ? 340  TRP A CD1   1 
ATOM   2681 C  CD2   . TRP A 1 343 ? 27.891 14.462  -0.085  1.00 13.96 ? 340  TRP A CD2   1 
ATOM   2682 N  NE1   . TRP A 1 343 ? 26.229 15.016  1.314   1.00 20.89 ? 340  TRP A NE1   1 
ATOM   2683 C  CE2   . TRP A 1 343 ? 27.570 15.182  1.084   1.00 19.02 ? 340  TRP A CE2   1 
ATOM   2684 C  CE3   . TRP A 1 343 ? 29.213 14.473  -0.544  1.00 15.04 ? 340  TRP A CE3   1 
ATOM   2685 C  CZ2   . TRP A 1 343 ? 28.524 15.895  1.810   1.00 17.73 ? 340  TRP A CZ2   1 
ATOM   2686 C  CZ3   . TRP A 1 343 ? 30.159 15.185  0.172   1.00 17.31 ? 340  TRP A CZ3   1 
ATOM   2687 C  CH2   . TRP A 1 343 ? 29.810 15.890  1.338   1.00 21.97 ? 340  TRP A CH2   1 
ATOM   2688 N  N     . LEU A 1 344 ? 26.131 12.300  -4.962  1.00 15.52 ? 341  LEU A N     1 
ATOM   2689 C  CA    . LEU A 1 344 ? 26.522 11.551  -6.153  1.00 20.84 ? 341  LEU A CA    1 
ATOM   2690 C  C     . LEU A 1 344 ? 27.193 12.504  -7.119  1.00 18.43 ? 341  LEU A C     1 
ATOM   2691 O  O     . LEU A 1 344 ? 28.160 12.137  -7.795  1.00 19.80 ? 341  LEU A O     1 
ATOM   2692 C  CB    . LEU A 1 344 ? 25.329 10.863  -6.835  1.00 16.29 ? 341  LEU A CB    1 
ATOM   2693 C  CG    . LEU A 1 344 ? 24.813 9.584   -6.171  1.00 19.34 ? 341  LEU A CG    1 
ATOM   2694 C  CD1   . LEU A 1 344 ? 23.519 9.115   -6.822  1.00 23.21 ? 341  LEU A CD1   1 
ATOM   2695 C  CD2   . LEU A 1 344 ? 25.872 8.495   -6.223  1.00 19.46 ? 341  LEU A CD2   1 
ATOM   2696 N  N     . LEU A 1 345 ? 26.677 13.728  -7.187  1.00 16.84 ? 342  LEU A N     1 
ATOM   2697 C  CA    . LEU A 1 345 ? 27.262 14.751  -8.034  1.00 17.52 ? 342  LEU A CA    1 
ATOM   2698 C  C     . LEU A 1 345 ? 28.664 15.164  -7.585  1.00 20.06 ? 342  LEU A C     1 
ATOM   2699 O  O     . LEU A 1 345 ? 29.548 15.351  -8.413  1.00 17.30 ? 342  LEU A O     1 
ATOM   2700 C  CB    . LEU A 1 345 ? 26.354 15.987  -8.115  1.00 21.04 ? 342  LEU A CB    1 
ATOM   2701 C  CG    . LEU A 1 345 ? 26.913 17.119  -8.978  1.00 20.68 ? 342  LEU A CG    1 
ATOM   2702 C  CD1   . LEU A 1 345 ? 27.228 16.621  -10.401 1.00 25.86 ? 342  LEU A CD1   1 
ATOM   2703 C  CD2   . LEU A 1 345 ? 25.957 18.306  -9.023  1.00 26.55 ? 342  LEU A CD2   1 
ATOM   2704 N  N     . GLN A 1 346 ? 28.871 15.313  -6.280  1.00 16.78 ? 343  GLN A N     1 
ATOM   2705 C  CA    . GLN A 1 346 ? 30.183 15.739  -5.793  1.00 16.35 ? 343  GLN A CA    1 
ATOM   2706 C  C     . GLN A 1 346 ? 31.225 14.690  -6.171  1.00 13.71 ? 343  GLN A C     1 
ATOM   2707 O  O     . GLN A 1 346 ? 32.324 15.023  -6.618  1.00 13.96 ? 343  GLN A O     1 
ATOM   2708 C  CB    . GLN A 1 346 ? 30.189 15.918  -4.271  1.00 18.14 ? 343  GLN A CB    1 
ATOM   2709 C  CG    . GLN A 1 346 ? 29.235 16.981  -3.758  1.00 16.82 ? 343  GLN A CG    1 
ATOM   2710 C  CD    . GLN A 1 346 ? 29.201 18.206  -4.639  1.00 23.24 ? 343  GLN A CD    1 
ATOM   2711 O  OE1   . GLN A 1 346 ? 30.151 18.994  -4.677  1.00 24.59 ? 343  GLN A OE1   1 
ATOM   2712 N  NE2   . GLN A 1 346 ? 28.098 18.377  -5.360  1.00 19.21 ? 343  GLN A NE2   1 
ATOM   2713 N  N     . LEU A 1 347 ? 30.856 13.431  -5.976  1.00 17.61 ? 344  LEU A N     1 
ATOM   2714 C  CA    . LEU A 1 347 ? 31.733 12.298  -6.258  1.00 17.72 ? 344  LEU A CA    1 
ATOM   2715 C  C     . LEU A 1 347 ? 32.034 12.215  -7.744  1.00 17.80 ? 344  LEU A C     1 
ATOM   2716 O  O     . LEU A 1 347 ? 33.174 11.987  -8.155  1.00 15.11 ? 344  LEU A O     1 
ATOM   2717 C  CB    . LEU A 1 347 ? 31.082 10.997  -5.796  1.00 14.60 ? 344  LEU A CB    1 
ATOM   2718 C  CG    . LEU A 1 347 ? 31.128 10.735  -4.286  1.00 22.04 ? 344  LEU A CG    1 
ATOM   2719 C  CD1   . LEU A 1 347 ? 30.510 9.384   -3.945  1.00 22.29 ? 344  LEU A CD1   1 
ATOM   2720 C  CD2   . LEU A 1 347 ? 32.550 10.771  -3.833  1.00 19.67 ? 344  LEU A CD2   1 
ATOM   2721 N  N     . ALA A 1 348 ? 30.990 12.384  -8.542  1.00 15.89 ? 345  ALA A N     1 
ATOM   2722 C  CA    . ALA A 1 348 ? 31.112 12.289  -9.983  1.00 15.11 ? 345  ALA A CA    1 
ATOM   2723 C  C     . ALA A 1 348 ? 32.014 13.392  -10.518 1.00 15.20 ? 345  ALA A C     1 
ATOM   2724 O  O     . ALA A 1 348 ? 32.725 13.209  -11.510 1.00 13.36 ? 345  ALA A O     1 
ATOM   2725 C  CB    . ALA A 1 348 ? 29.728 12.379  -10.635 1.00 12.63 ? 345  ALA A CB    1 
ATOM   2726 N  N     . GLN A 1 349 ? 31.959 14.550  -9.872  1.00 17.52 ? 346  GLN A N     1 
ATOM   2727 C  CA    . GLN A 1 349 ? 32.776 15.681  -10.269 1.00 14.54 ? 346  GLN A CA    1 
ATOM   2728 C  C     . GLN A 1 349 ? 34.259 15.443  -9.972  1.00 17.19 ? 346  GLN A C     1 
ATOM   2729 O  O     . GLN A 1 349 ? 35.117 15.807  -10.769 1.00 15.03 ? 346  GLN A O     1 
ATOM   2730 C  CB    . GLN A 1 349 ? 32.288 16.962  -9.601  1.00 19.96 ? 346  GLN A CB    1 
ATOM   2731 C  CG    . GLN A 1 349 ? 30.996 17.492  -10.225 1.00 22.77 ? 346  GLN A CG    1 
ATOM   2732 C  CD    . GLN A 1 349 ? 30.528 18.798  -9.604  1.00 26.37 ? 346  GLN A CD    1 
ATOM   2733 O  OE1   . GLN A 1 349 ? 31.099 19.275  -8.626  1.00 32.55 ? 346  GLN A OE1   1 
ATOM   2734 N  NE2   . GLN A 1 349 ? 29.478 19.378  -10.173 1.00 33.67 ? 346  GLN A NE2   1 
ATOM   2735 N  N     . GLU A 1 350 ? 34.567 14.825  -8.840  1.00 14.47 ? 347  GLU A N     1 
ATOM   2736 C  CA    . GLU A 1 350 ? 35.966 14.508  -8.570  1.00 17.23 ? 347  GLU A CA    1 
ATOM   2737 C  C     . GLU A 1 350 ? 36.412 13.392  -9.515  1.00 12.89 ? 347  GLU A C     1 
ATOM   2738 O  O     . GLU A 1 350 ? 37.532 13.416  -10.015 1.00 16.52 ? 347  GLU A O     1 
ATOM   2739 C  CB    . GLU A 1 350 ? 36.208 14.095  -7.112  1.00 17.27 ? 347  GLU A CB    1 
ATOM   2740 C  CG    . GLU A 1 350 ? 37.672 13.697  -6.853  1.00 21.10 ? 347  GLU A CG    1 
ATOM   2741 C  CD    . GLU A 1 350 ? 37.908 13.066  -5.483  1.00 25.89 ? 347  GLU A CD    1 
ATOM   2742 O  OE1   . GLU A 1 350 ? 37.213 13.432  -4.513  1.00 20.80 ? 347  GLU A OE1   1 
ATOM   2743 O  OE2   . GLU A 1 350 ? 38.793 12.195  -5.380  1.00 19.23 ? 347  GLU A OE2   1 
ATOM   2744 N  N     . LEU A 1 351 ? 35.532 12.423  -9.749  1.00 14.68 ? 348  LEU A N     1 
ATOM   2745 C  CA    . LEU A 1 351 ? 35.837 11.307  -10.646 1.00 11.88 ? 348  LEU A CA    1 
ATOM   2746 C  C     . LEU A 1 351 ? 36.107 11.828  -12.054 1.00 20.17 ? 348  LEU A C     1 
ATOM   2747 O  O     . LEU A 1 351 ? 37.085 11.430  -12.692 1.00 15.69 ? 348  LEU A O     1 
ATOM   2748 C  CB    . LEU A 1 351 ? 34.704 10.275  -10.664 1.00 17.36 ? 348  LEU A CB    1 
ATOM   2749 C  CG    . LEU A 1 351 ? 34.976 8.977   -11.441 1.00 19.50 ? 348  LEU A CG    1 
ATOM   2750 C  CD1   . LEU A 1 351 ? 36.265 8.298   -10.936 1.00 20.45 ? 348  LEU A CD1   1 
ATOM   2751 C  CD2   . LEU A 1 351 ? 33.803 8.010   -11.362 1.00 19.71 ? 348  LEU A CD2   1 
ATOM   2752 N  N     . GLU A 1 352 ? 35.250 12.727  -12.539 1.00 15.92 ? 349  GLU A N     1 
ATOM   2753 C  CA    . GLU A 1 352 ? 35.483 13.337  -13.849 1.00 16.97 ? 349  GLU A CA    1 
ATOM   2754 C  C     . GLU A 1 352 ? 36.841 14.024  -13.949 1.00 14.36 ? 349  GLU A C     1 
ATOM   2755 O  O     . GLU A 1 352 ? 37.551 13.896  -14.951 1.00 16.54 ? 349  GLU A O     1 
ATOM   2756 C  CB    . GLU A 1 352 ? 34.377 14.330  -14.230 1.00 16.69 ? 349  GLU A CB    1 
ATOM   2757 C  CG    . GLU A 1 352 ? 34.688 15.013  -15.559 1.00 21.64 ? 349  GLU A CG    1 
ATOM   2758 C  CD    . GLU A 1 352 ? 33.619 15.989  -16.017 1.00 41.31 ? 349  GLU A CD    1 
ATOM   2759 O  OE1   . GLU A 1 352 ? 33.895 16.740  -16.982 1.00 36.41 ? 349  GLU A OE1   1 
ATOM   2760 O  OE2   . GLU A 1 352 ? 32.511 16.002  -15.432 1.00 33.18 ? 349  GLU A OE2   1 
ATOM   2761 N  N     . GLU A 1 353 ? 37.211 14.764  -12.914 1.00 16.13 ? 350  GLU A N     1 
ATOM   2762 C  CA    . GLU A 1 353 ? 38.489 15.457  -12.930 1.00 16.54 ? 350  GLU A CA    1 
ATOM   2763 C  C     . GLU A 1 353 ? 39.651 14.455  -13.023 1.00 16.32 ? 350  GLU A C     1 
ATOM   2764 O  O     . GLU A 1 353 ? 40.573 14.615  -13.830 1.00 15.67 ? 350  GLU A O     1 
ATOM   2765 C  CB    . GLU A 1 353 ? 38.618 16.317  -11.677 1.00 21.35 ? 350  GLU A CB    1 
ATOM   2766 C  CG    . GLU A 1 353 ? 39.837 17.215  -11.653 1.00 31.95 ? 350  GLU A CG    1 
ATOM   2767 C  CD    . GLU A 1 353 ? 39.761 18.218  -10.525 1.00 40.54 ? 350  GLU A CD    1 
ATOM   2768 O  OE1   . GLU A 1 353 ? 39.181 17.873  -9.474  1.00 44.55 ? 350  GLU A OE1   1 
ATOM   2769 O  OE2   . GLU A 1 353 ? 40.256 19.352  -10.695 1.00 52.94 ? 350  GLU A OE2   1 
ATOM   2770 N  N     . ARG A 1 354 ? 39.597 13.408  -12.209 1.00 13.34 ? 351  ARG A N     1 
ATOM   2771 C  CA    . ARG A 1 354 ? 40.675 12.416  -12.208 1.00 18.63 ? 351  ARG A CA    1 
ATOM   2772 C  C     . ARG A 1 354 ? 40.720 11.608  -13.501 1.00 17.40 ? 351  ARG A C     1 
ATOM   2773 O  O     . ARG A 1 354 ? 41.795 11.263  -13.989 1.00 15.38 ? 351  ARG A O     1 
ATOM   2774 C  CB    . ARG A 1 354 ? 40.578 11.505  -11.001 1.00 15.73 ? 351  ARG A CB    1 
ATOM   2775 C  CG    A ARG A 1 354 ? 41.077 12.206  -9.749  0.72 14.56 ? 351  ARG A CG    1 
ATOM   2776 C  CG    B ARG A 1 354 ? 40.706 12.166  -9.649  0.28 15.67 ? 351  ARG A CG    1 
ATOM   2777 C  CD    A ARG A 1 354 ? 40.562 11.541  -8.505  0.72 18.40 ? 351  ARG A CD    1 
ATOM   2778 C  CD    B ARG A 1 354 ? 40.615 11.104  -8.562  0.28 17.76 ? 351  ARG A CD    1 
ATOM   2779 N  NE    A ARG A 1 354 ? 41.039 10.173  -8.394  0.72 16.03 ? 351  ARG A NE    1 
ATOM   2780 N  NE    B ARG A 1 354 ? 41.609 10.053  -8.764  0.28 15.58 ? 351  ARG A NE    1 
ATOM   2781 C  CZ    A ARG A 1 354 ? 40.585 9.305   -7.501  0.72 18.11 ? 351  ARG A CZ    1 
ATOM   2782 C  CZ    B ARG A 1 354 ? 41.517 8.820   -8.273  0.28 17.47 ? 351  ARG A CZ    1 
ATOM   2783 N  NH1   A ARG A 1 354 ? 39.640 9.676   -6.638  0.72 15.88 ? 351  ARG A NH1   1 
ATOM   2784 N  NH1   B ARG A 1 354 ? 40.464 8.464   -7.553  0.28 15.63 ? 351  ARG A NH1   1 
ATOM   2785 N  NH2   A ARG A 1 354 ? 41.079 8.071   -7.472  0.72 12.08 ? 351  ARG A NH2   1 
ATOM   2786 N  NH2   B ARG A 1 354 ? 42.475 7.936   -8.512  0.28 14.38 ? 351  ARG A NH2   1 
ATOM   2787 N  N     . LEU A 1 355 ? 39.549 11.317  -14.055 1.00 12.03 ? 352  LEU A N     1 
ATOM   2788 C  CA    . LEU A 1 355 ? 39.464 10.543  -15.285 1.00 14.32 ? 352  LEU A CA    1 
ATOM   2789 C  C     . LEU A 1 355 ? 40.018 11.319  -16.473 1.00 16.92 ? 352  LEU A C     1 
ATOM   2790 O  O     . LEU A 1 355 ? 40.734 10.766  -17.314 1.00 15.81 ? 352  LEU A O     1 
ATOM   2791 C  CB    . LEU A 1 355 ? 38.020 10.133  -15.565 1.00 13.73 ? 352  LEU A CB    1 
ATOM   2792 C  CG    . LEU A 1 355 ? 37.454 8.946   -14.785 1.00 14.48 ? 352  LEU A CG    1 
ATOM   2793 C  CD1   . LEU A 1 355 ? 35.975 8.798   -15.071 1.00 14.50 ? 352  LEU A CD1   1 
ATOM   2794 C  CD2   . LEU A 1 355 ? 38.207 7.678   -15.156 1.00 17.82 ? 352  LEU A CD2   1 
ATOM   2795 N  N     . THR A 1 356 ? 39.680 12.604  -16.549 1.00 14.81 ? 353  THR A N     1 
ATOM   2796 C  CA    . THR A 1 356 ? 40.131 13.414  -17.670 1.00 16.93 ? 353  THR A CA    1 
ATOM   2797 C  C     . THR A 1 356 ? 41.656 13.534  -17.651 1.00 18.39 ? 353  THR A C     1 
ATOM   2798 O  O     . THR A 1 356 ? 42.317 13.374  -18.682 1.00 18.77 ? 353  THR A O     1 
ATOM   2799 C  CB    . THR A 1 356 ? 39.446 14.794  -17.662 1.00 18.63 ? 353  THR A CB    1 
ATOM   2800 O  OG1   . THR A 1 356 ? 38.040 14.607  -17.857 1.00 19.56 ? 353  THR A OG1   1 
ATOM   2801 C  CG2   . THR A 1 356 ? 39.980 15.669  -18.769 1.00 20.08 ? 353  THR A CG2   1 
ATOM   2802 N  N     . LYS A 1 357 ? 42.210 13.785  -16.469 1.00 17.65 ? 354  LYS A N     1 
ATOM   2803 C  CA    . LYS A 1 357 ? 43.658 13.833  -16.305 1.00 17.52 ? 354  LYS A CA    1 
ATOM   2804 C  C     . LYS A 1 357 ? 44.272 12.486  -16.673 1.00 18.81 ? 354  LYS A C     1 
ATOM   2805 O  O     . LYS A 1 357 ? 45.316 12.431  -17.334 1.00 19.51 ? 354  LYS A O     1 
ATOM   2806 C  CB    . LYS A 1 357 ? 44.027 14.214  -14.871 1.00 18.42 ? 354  LYS A CB    1 
ATOM   2807 C  CG    . LYS A 1 357 ? 45.513 14.192  -14.580 1.00 27.65 ? 354  LYS A CG    1 
ATOM   2808 C  CD    . LYS A 1 357 ? 46.227 15.314  -15.308 1.00 38.01 ? 354  LYS A CD    1 
ATOM   2809 C  CE    . LYS A 1 357 ? 47.351 15.906  -14.460 1.00 47.42 ? 354  LYS A CE    1 
ATOM   2810 N  NZ    . LYS A 1 357 ? 48.364 14.897  -14.060 1.00 38.57 ? 354  LYS A NZ    1 
ATOM   2811 N  N     . ASP A 1 358 ? 43.621 11.399  -16.263 1.00 18.38 ? 355  ASP A N     1 
ATOM   2812 C  CA    . ASP A 1 358 ? 44.151 10.063  -16.554 1.00 17.79 ? 355  ASP A CA    1 
ATOM   2813 C  C     . ASP A 1 358 ? 44.206 9.809   -18.052 1.00 20.19 ? 355  ASP A C     1 
ATOM   2814 O  O     . ASP A 1 358 ? 45.167 9.222   -18.545 1.00 24.19 ? 355  ASP A O     1 
ATOM   2815 C  CB    . ASP A 1 358 ? 43.342 8.951   -15.869 1.00 14.62 ? 355  ASP A CB    1 
ATOM   2816 C  CG    . ASP A 1 358 ? 43.914 7.567   -16.141 1.00 19.36 ? 355  ASP A CG    1 
ATOM   2817 O  OD1   . ASP A 1 358 ? 44.923 7.202   -15.496 1.00 21.74 ? 355  ASP A OD1   1 
ATOM   2818 O  OD2   . ASP A 1 358 ? 43.363 6.839   -16.994 1.00 24.04 ? 355  ASP A OD2   1 
ATOM   2819 N  N     . ARG A 1 359 ? 43.173 10.237  -18.773 1.00 15.60 ? 356  ARG A N     1 
ATOM   2820 C  CA    . ARG A 1 359 ? 43.126 10.055  -20.227 1.00 19.56 ? 356  ARG A CA    1 
ATOM   2821 C  C     . ARG A 1 359 ? 44.258 10.805  -20.937 1.00 19.46 ? 356  ARG A C     1 
ATOM   2822 O  O     . ARG A 1 359 ? 44.878 10.284  -21.862 1.00 17.14 ? 356  ARG A O     1 
ATOM   2823 C  CB    . ARG A 1 359 ? 41.765 10.502  -20.779 1.00 20.67 ? 356  ARG A CB    1 
ATOM   2824 C  CG    . ARG A 1 359 ? 41.466 10.021  -22.204 1.00 20.35 ? 356  ARG A CG    1 
ATOM   2825 C  CD    . ARG A 1 359 ? 40.102 10.539  -22.691 1.00 20.42 ? 356  ARG A CD    1 
ATOM   2826 N  NE    . ARG A 1 359 ? 40.020 12.003  -22.636 1.00 26.90 ? 356  ARG A NE    1 
ATOM   2827 C  CZ    . ARG A 1 359 ? 38.908 12.684  -22.361 1.00 29.47 ? 356  ARG A CZ    1 
ATOM   2828 N  NH1   . ARG A 1 359 ? 37.775 12.039  -22.117 1.00 31.73 ? 356  ARG A NH1   1 
ATOM   2829 N  NH2   . ARG A 1 359 ? 38.928 14.012  -22.335 1.00 30.95 ? 356  ARG A NH2   1 
ATOM   2830 N  N     . ASN A 1 360 ? 44.518 12.033  -20.504 1.00 21.38 ? 357  ASN A N     1 
ATOM   2831 C  CA    . ASN A 1 360 ? 45.587 12.842  -21.083 1.00 18.87 ? 357  ASN A CA    1 
ATOM   2832 C  C     . ASN A 1 360 ? 46.982 12.296  -20.785 1.00 26.49 ? 357  ASN A C     1 
ATOM   2833 O  O     . ASN A 1 360 ? 47.848 12.285  -21.654 1.00 26.16 ? 357  ASN A O     1 
ATOM   2834 C  CB    . ASN A 1 360 ? 45.498 14.276  -20.573 1.00 20.61 ? 357  ASN A CB    1 
ATOM   2835 C  CG    . ASN A 1 360 ? 44.374 15.051  -21.214 1.00 24.79 ? 357  ASN A CG    1 
ATOM   2836 O  OD1   . ASN A 1 360 ? 43.941 14.741  -22.326 1.00 23.34 ? 357  ASN A OD1   1 
ATOM   2837 N  ND2   . ASN A 1 360 ? 43.905 16.082  -20.524 1.00 26.17 ? 357  ASN A ND2   1 
ATOM   2838 N  N     . ASP A 1 361 ? 47.203 11.868  -19.544 1.00 21.41 ? 358  ASP A N     1 
ATOM   2839 C  CA    . ASP A 1 361 ? 48.517 11.372  -19.136 1.00 20.86 ? 358  ASP A CA    1 
ATOM   2840 C  C     . ASP A 1 361 ? 48.844 9.990   -19.683 1.00 17.41 ? 358  ASP A C     1 
ATOM   2841 O  O     . ASP A 1 361 ? 49.983 9.721   -20.045 1.00 19.96 ? 358  ASP A O     1 
ATOM   2842 C  CB    . ASP A 1 361 ? 48.628 11.301  -17.605 1.00 22.82 ? 358  ASP A CB    1 
ATOM   2843 C  CG    . ASP A 1 361 ? 48.720 12.667  -16.957 1.00 33.57 ? 358  ASP A CG    1 
ATOM   2844 O  OD1   . ASP A 1 361 ? 48.964 13.666  -17.676 1.00 27.84 ? 358  ASP A OD1   1 
ATOM   2845 O  OD2   . ASP A 1 361 ? 48.557 12.731  -15.719 1.00 32.29 ? 358  ASP A OD2   1 
ATOM   2846 N  N     . ASN A 1 362 ? 47.849 9.113   -19.721 1.00 16.28 ? 359  ASN A N     1 
ATOM   2847 C  CA    . ASN A 1 362 ? 48.108 7.682   -19.847 1.00 20.18 ? 359  ASN A CA    1 
ATOM   2848 C  C     . ASN A 1 362 ? 47.500 7.023   -21.076 1.00 19.97 ? 359  ASN A C     1 
ATOM   2849 O  O     . ASN A 1 362 ? 47.657 5.823   -21.273 1.00 22.41 ? 359  ASN A O     1 
ATOM   2850 C  CB    . ASN A 1 362 ? 47.670 6.950   -18.562 1.00 15.06 ? 359  ASN A CB    1 
ATOM   2851 C  CG    . ASN A 1 362 ? 48.426 7.442   -17.330 1.00 22.50 ? 359  ASN A CG    1 
ATOM   2852 O  OD1   . ASN A 1 362 ? 49.630 7.665   -17.381 1.00 20.29 ? 359  ASN A OD1   1 
ATOM   2853 N  ND2   . ASN A 1 362 ? 47.716 7.609   -16.222 1.00 18.29 ? 359  ASN A ND2   1 
ATOM   2854 N  N     . ASP A 1 363 ? 46.816 7.809   -21.902 1.00 22.44 ? 360  ASP A N     1 
ATOM   2855 C  CA    . ASP A 1 363 ? 46.301 7.308   -23.174 1.00 16.40 ? 360  ASP A CA    1 
ATOM   2856 C  C     . ASP A 1 363 ? 45.396 6.119   -22.999 1.00 23.50 ? 360  ASP A C     1 
ATOM   2857 O  O     . ASP A 1 363 ? 45.605 5.079   -23.620 1.00 26.08 ? 360  ASP A O     1 
ATOM   2858 C  CB    . ASP A 1 363 ? 47.449 6.903   -24.096 1.00 27.38 ? 360  ASP A CB    1 
ATOM   2859 C  CG    . ASP A 1 363 ? 48.299 8.076   -24.498 1.00 33.50 ? 360  ASP A CG    1 
ATOM   2860 O  OD1   . ASP A 1 363 ? 47.717 9.129   -24.839 1.00 32.30 ? 360  ASP A OD1   1 
ATOM   2861 O  OD2   . ASP A 1 363 ? 49.541 7.945   -24.456 1.00 35.98 ? 360  ASP A OD2   1 
ATOM   2862 N  N     . ARG A 1 364 ? 44.384 6.269   -22.156 1.00 21.42 ? 361  ARG A N     1 
ATOM   2863 C  CA    . ARG A 1 364 ? 43.411 5.207   -21.947 1.00 23.17 ? 361  ARG A CA    1 
ATOM   2864 C  C     . ARG A 1 364 ? 42.095 5.824   -21.495 1.00 20.00 ? 361  ARG A C     1 
ATOM   2865 O  O     . ARG A 1 364 ? 42.059 6.988   -21.085 1.00 23.54 ? 361  ARG A O     1 
ATOM   2866 C  CB    . ARG A 1 364 ? 43.930 4.222   -20.901 1.00 20.78 ? 361  ARG A CB    1 
ATOM   2867 C  CG    . ARG A 1 364 ? 44.190 4.861   -19.543 1.00 24.77 ? 361  ARG A CG    1 
ATOM   2868 C  CD    . ARG A 1 364 ? 44.784 3.872   -18.560 1.00 18.35 ? 361  ARG A CD    1 
ATOM   2869 N  NE    . ARG A 1 364 ? 44.838 4.431   -17.210 1.00 21.68 ? 361  ARG A NE    1 
ATOM   2870 C  CZ    . ARG A 1 364 ? 45.006 3.704   -16.111 1.00 21.02 ? 361  ARG A CZ    1 
ATOM   2871 N  NH1   . ARG A 1 364 ? 45.043 4.292   -14.916 1.00 21.49 ? 361  ARG A NH1   1 
ATOM   2872 N  NH2   . ARG A 1 364 ? 45.142 2.397   -16.207 1.00 22.72 ? 361  ARG A NH2   1 
ATOM   2873 N  N     . VAL A 1 365 ? 41.026 5.045   -21.581 1.00 22.15 ? 362  VAL A N     1 
ATOM   2874 C  CA    . VAL A 1 365 ? 39.693 5.489   -21.198 1.00 26.02 ? 362  VAL A CA    1 
ATOM   2875 C  C     . VAL A 1 365 ? 38.941 4.380   -20.484 1.00 24.14 ? 362  VAL A C     1 
ATOM   2876 O  O     . VAL A 1 365 ? 38.890 3.243   -20.957 1.00 24.73 ? 362  VAL A O     1 
ATOM   2877 C  CB    . VAL A 1 365 ? 38.865 5.901   -22.423 1.00 24.60 ? 362  VAL A CB    1 
ATOM   2878 C  CG1   . VAL A 1 365 ? 39.341 7.246   -22.957 1.00 37.25 ? 362  VAL A CG1   1 
ATOM   2879 C  CG2   . VAL A 1 365 ? 38.943 4.824   -23.502 1.00 34.27 ? 362  VAL A CG2   1 
ATOM   2880 N  N     . ALA A 1 366 ? 38.348 4.712   -19.344 1.00 19.89 ? 363  ALA A N     1 
ATOM   2881 C  CA    . ALA A 1 366 ? 37.500 3.769   -18.638 1.00 17.33 ? 363  ALA A CA    1 
ATOM   2882 C  C     . ALA A 1 366 ? 36.204 3.533   -19.411 1.00 20.03 ? 363  ALA A C     1 
ATOM   2883 O  O     . ALA A 1 366 ? 35.714 4.425   -20.117 1.00 26.02 ? 363  ALA A O     1 
ATOM   2884 C  CB    . ALA A 1 366 ? 37.193 4.294   -17.250 1.00 16.16 ? 363  ALA A CB    1 
ATOM   2885 N  N     . THR A 1 367 ? 35.633 2.341   -19.273 1.00 18.53 ? 364  THR A N     1 
ATOM   2886 C  CA    . THR A 1 367 ? 34.424 2.020   -20.020 1.00 20.93 ? 364  THR A CA    1 
ATOM   2887 C  C     . THR A 1 367 ? 33.271 1.520   -19.162 1.00 22.71 ? 364  THR A C     1 
ATOM   2888 O  O     . THR A 1 367 ? 32.157 1.338   -19.658 1.00 21.54 ? 364  THR A O     1 
ATOM   2889 C  CB    . THR A 1 367 ? 34.712 0.974   -21.118 1.00 25.24 ? 364  THR A CB    1 
ATOM   2890 O  OG1   . THR A 1 367 ? 35.033 -0.279  -20.505 1.00 23.59 ? 364  THR A OG1   1 
ATOM   2891 C  CG2   . THR A 1 367 ? 35.885 1.421   -21.978 1.00 23.41 ? 364  THR A CG2   1 
ATOM   2892 N  N     . GLN A 1 368 ? 33.536 1.294   -17.878 1.00 22.57 ? 365  GLN A N     1 
ATOM   2893 C  CA    . GLN A 1 368 ? 32.509 0.817   -16.966 1.00 24.11 ? 365  GLN A CA    1 
ATOM   2894 C  C     . GLN A 1 368 ? 32.477 1.687   -15.719 1.00 18.05 ? 365  GLN A C     1 
ATOM   2895 O  O     . GLN A 1 368 ? 33.520 2.061   -15.197 1.00 22.75 ? 365  GLN A O     1 
ATOM   2896 C  CB    . GLN A 1 368 ? 32.766 -0.635  -16.561 1.00 23.65 ? 365  GLN A CB    1 
ATOM   2897 C  CG    . GLN A 1 368 ? 31.592 -1.277  -15.833 1.00 29.72 ? 365  GLN A CG    1 
ATOM   2898 C  CD    . GLN A 1 368 ? 31.793 -2.764  -15.583 1.00 38.48 ? 365  GLN A CD    1 
ATOM   2899 O  OE1   . GLN A 1 368 ? 32.623 -3.164  -14.765 1.00 50.64 ? 365  GLN A OE1   1 
ATOM   2900 N  NE2   . GLN A 1 368 ? 31.031 -3.590  -16.287 1.00 37.98 ? 365  GLN A NE2   1 
ATOM   2901 N  N     . LEU A 1 369 ? 31.272 2.021   -15.271 1.00 22.67 ? 366  LEU A N     1 
ATOM   2902 C  CA    . LEU A 1 369 ? 31.085 2.747   -14.019 1.00 24.13 ? 366  LEU A CA    1 
ATOM   2903 C  C     . LEU A 1 369 ? 30.415 1.813   -13.024 1.00 23.05 ? 366  LEU A C     1 
ATOM   2904 O  O     . LEU A 1 369 ? 29.322 1.306   -13.273 1.00 23.85 ? 366  LEU A O     1 
ATOM   2905 C  CB    . LEU A 1 369 ? 30.214 3.992   -14.236 1.00 24.52 ? 366  LEU A CB    1 
ATOM   2906 C  CG    . LEU A 1 369 ? 29.951 4.886   -13.014 1.00 26.61 ? 366  LEU A CG    1 
ATOM   2907 C  CD1   . LEU A 1 369 ? 31.200 5.681   -12.652 1.00 25.55 ? 366  LEU A CD1   1 
ATOM   2908 C  CD2   . LEU A 1 369 ? 28.770 5.835   -13.259 1.00 23.94 ? 366  LEU A CD2   1 
ATOM   2909 N  N     . VAL A 1 370 ? 31.081 1.565   -11.903 1.00 18.81 ? 367  VAL A N     1 
ATOM   2910 C  CA    . VAL A 1 370 ? 30.530 0.707   -10.869 1.00 18.15 ? 367  VAL A CA    1 
ATOM   2911 C  C     . VAL A 1 370 ? 30.009 1.600   -9.746  1.00 23.05 ? 367  VAL A C     1 
ATOM   2912 O  O     . VAL A 1 370 ? 30.706 2.506   -9.307  1.00 20.67 ? 367  VAL A O     1 
ATOM   2913 C  CB    . VAL A 1 370 ? 31.611 -0.237  -10.315 1.00 20.12 ? 367  VAL A CB    1 
ATOM   2914 C  CG1   . VAL A 1 370 ? 31.055 -1.067  -9.158  1.00 27.83 ? 367  VAL A CG1   1 
ATOM   2915 C  CG2   . VAL A 1 370 ? 32.156 -1.131  -11.438 1.00 21.16 ? 367  VAL A CG2   1 
ATOM   2916 N  N     . VAL A 1 371 ? 28.783 1.355   -9.296  1.00 20.94 ? 368  VAL A N     1 
ATOM   2917 C  CA    . VAL A 1 371 ? 28.173 2.190   -8.271  1.00 20.02 ? 368  VAL A CA    1 
ATOM   2918 C  C     . VAL A 1 371 ? 27.870 1.329   -7.071  1.00 24.11 ? 368  VAL A C     1 
ATOM   2919 O  O     . VAL A 1 371 ? 27.216 0.297   -7.190  1.00 24.62 ? 368  VAL A O     1 
ATOM   2920 C  CB    . VAL A 1 371 ? 26.859 2.835   -8.761  1.00 24.73 ? 368  VAL A CB    1 
ATOM   2921 C  CG1   . VAL A 1 371 ? 26.299 3.773   -7.694  1.00 22.36 ? 368  VAL A CG1   1 
ATOM   2922 C  CG2   . VAL A 1 371 ? 27.084 3.581   -10.073 1.00 20.61 ? 368  VAL A CG2   1 
ATOM   2923 N  N     . SER A 1 372 ? 28.362 1.733   -5.909  1.00 20.70 ? 369  SER A N     1 
ATOM   2924 C  CA    . SER A 1 372 ? 28.166 0.932   -4.717  1.00 23.19 ? 369  SER A CA    1 
ATOM   2925 C  C     . SER A 1 372 ? 27.615 1.796   -3.592  1.00 20.10 ? 369  SER A C     1 
ATOM   2926 O  O     . SER A 1 372 ? 27.953 2.976   -3.479  1.00 21.88 ? 369  SER A O     1 
ATOM   2927 C  CB    . SER A 1 372 ? 29.480 0.268   -4.300  1.00 21.85 ? 369  SER A CB    1 
ATOM   2928 O  OG    . SER A 1 372 ? 29.313 -0.497  -3.118  1.00 32.16 ? 369  SER A OG    1 
ATOM   2929 N  N     . ILE A 1 373 ? 26.742 1.210   -2.782  1.00 22.38 ? 370  ILE A N     1 
ATOM   2930 C  CA    . ILE A 1 373 ? 26.196 1.914   -1.632  1.00 25.32 ? 370  ILE A CA    1 
ATOM   2931 C  C     . ILE A 1 373 ? 26.158 1.025   -0.400  1.00 27.21 ? 370  ILE A C     1 
ATOM   2932 O  O     . ILE A 1 373 ? 26.291 -0.196  -0.480  1.00 24.18 ? 370  ILE A O     1 
ATOM   2933 C  CB    . ILE A 1 373 ? 24.784 2.508   -1.907  1.00 28.77 ? 370  ILE A CB    1 
ATOM   2934 C  CG1   . ILE A 1 373 ? 23.731 1.402   -2.008  1.00 27.03 ? 370  ILE A CG1   1 
ATOM   2935 C  CG2   . ILE A 1 373 ? 24.792 3.422   -3.153  1.00 16.70 ? 370  ILE A CG2   1 
ATOM   2936 C  CD1   . ILE A 1 373 ? 22.367 1.910   -2.442  1.00 32.40 ? 370  ILE A CD1   1 
ATOM   2937 N  N     . ARG A 1 374 ? 26.006 1.660   0.753   1.00 24.74 ? 371  ARG A N     1 
ATOM   2938 C  CA    . ARG A 1 374 ? 25.776 0.931   1.981   1.00 26.78 ? 371  ARG A CA    1 
ATOM   2939 C  C     . ARG A 1 374 ? 24.533 1.532   2.608   1.00 30.18 ? 371  ARG A C     1 
ATOM   2940 O  O     . ARG A 1 374 ? 24.314 2.741   2.525   1.00 27.15 ? 371  ARG A O     1 
ATOM   2941 C  CB    . ARG A 1 374 ? 26.973 1.038   2.920   1.00 28.79 ? 371  ARG A CB    1 
ATOM   2942 C  CG    . ARG A 1 374 ? 26.914 0.074   4.088   1.00 36.34 ? 371  ARG A CG    1 
ATOM   2943 C  CD    . ARG A 1 374 ? 28.106 0.245   5.001   1.00 42.67 ? 371  ARG A CD    1 
ATOM   2944 N  NE    . ARG A 1 374 ? 28.078 -0.701  6.111   1.00 51.52 ? 371  ARG A NE    1 
ATOM   2945 C  CZ    . ARG A 1 374 ? 28.965 -0.714  7.099   1.00 56.17 ? 371  ARG A CZ    1 
ATOM   2946 N  NH1   . ARG A 1 374 ? 29.950 0.173   7.118   1.00 58.99 ? 371  ARG A NH1   1 
ATOM   2947 N  NH2   . ARG A 1 374 ? 28.866 -1.610  8.069   1.00 62.18 ? 371  ARG A NH2   1 
ATOM   2948 N  N     . VAL A 1 375 ? 23.700 0.677   3.191   1.00 35.09 ? 372  VAL A N     1 
ATOM   2949 C  CA    . VAL A 1 375 ? 22.498 1.127   3.877   1.00 38.73 ? 372  VAL A CA    1 
ATOM   2950 C  C     . VAL A 1 375 ? 22.683 0.977   5.376   1.00 30.17 ? 372  VAL A C     1 
ATOM   2951 O  O     . VAL A 1 375 ? 23.369 0.064   5.841   1.00 28.74 ? 372  VAL A O     1 
ATOM   2952 C  CB    . VAL A 1 375 ? 21.258 0.331   3.441   1.00 47.93 ? 372  VAL A CB    1 
ATOM   2953 C  CG1   . VAL A 1 375 ? 20.961 0.574   1.968   1.00 40.78 ? 372  VAL A CG1   1 
ATOM   2954 C  CG2   . VAL A 1 375 ? 21.457 -1.149  3.725   1.00 44.48 ? 372  VAL A CG2   1 
ATOM   2955 N  N     . GLN A 1 376 ? 22.082 1.885   6.132   1.00 35.60 ? 373  GLN A N     1 
ATOM   2956 C  CA    . GLN A 1 376 ? 22.215 1.853   7.580   1.00 41.47 ? 373  GLN A CA    1 
ATOM   2957 C  C     . GLN A 1 376 ? 21.721 0.518   8.120   1.00 40.42 ? 373  GLN A C     1 
ATOM   2958 O  O     . GLN A 1 376 ? 20.630 0.070   7.778   1.00 44.99 ? 373  GLN A O     1 
ATOM   2959 C  CB    . GLN A 1 376 ? 21.437 3.004   8.212   1.00 39.29 ? 373  GLN A CB    1 
ATOM   2960 C  CG    . GLN A 1 376 ? 21.971 3.428   9.576   1.00 45.02 ? 373  GLN A CG    1 
ATOM   2961 C  CD    . GLN A 1 376 ? 21.653 4.874   9.890   1.00 45.48 ? 373  GLN A CD    1 
ATOM   2962 O  OE1   . GLN A 1 376 ? 20.515 5.316   9.727   1.00 44.82 ? 373  GLN A OE1   1 
ATOM   2963 N  NE2   . GLN A 1 376 ? 22.663 5.628   10.323  1.00 46.79 ? 373  GLN A NE2   1 
ATOM   2964 N  N     . GLY A 1 377 ? 22.536 -0.122  8.949   1.00 40.60 ? 374  GLY A N     1 
ATOM   2965 C  CA    . GLY A 1 377 ? 22.165 -1.394  9.540   1.00 55.96 ? 374  GLY A CA    1 
ATOM   2966 C  C     . GLY A 1 377 ? 23.020 -2.560  9.078   1.00 57.67 ? 374  GLY A C     1 
ATOM   2967 O  O     . GLY A 1 377 ? 23.314 -3.467  9.857   1.00 54.89 ? 374  GLY A O     1 
ATOM   2968 N  N     . ASP A 1 378 ? 23.419 -2.537  7.809   1.00 51.01 ? 375  ASP A N     1 
ATOM   2969 C  CA    . ASP A 1 378 ? 24.217 -3.614  7.232   1.00 44.10 ? 375  ASP A CA    1 
ATOM   2970 C  C     . ASP A 1 378 ? 25.630 -3.626  7.813   1.00 56.12 ? 375  ASP A C     1 
ATOM   2971 O  O     . ASP A 1 378 ? 26.280 -2.585  7.903   1.00 56.84 ? 375  ASP A O     1 
ATOM   2972 C  CB    . ASP A 1 378 ? 24.269 -3.466  5.710   1.00 46.90 ? 375  ASP A CB    1 
ATOM   2973 C  CG    . ASP A 1 378 ? 24.817 -4.702  5.019   1.00 52.08 ? 375  ASP A CG    1 
ATOM   2974 O  OD1   . ASP A 1 378 ? 25.654 -5.412  5.614   1.00 50.12 ? 375  ASP A OD1   1 
ATOM   2975 O  OD2   . ASP A 1 378 ? 24.405 -4.963  3.872   1.00 45.84 ? 375  ASP A OD2   1 
ATOM   2976 N  N     . LYS A 1 379 ? 26.106 -4.805  8.205   1.00 58.80 ? 376  LYS A N     1 
ATOM   2977 C  CA    . LYS A 1 379 ? 27.440 -4.923  8.790   1.00 68.17 ? 376  LYS A CA    1 
ATOM   2978 C  C     . LYS A 1 379 ? 28.546 -4.952  7.735   1.00 67.22 ? 376  LYS A C     1 
ATOM   2979 O  O     . LYS A 1 379 ? 29.689 -4.582  8.012   1.00 65.56 ? 376  LYS A O     1 
ATOM   2980 C  CB    . LYS A 1 379 ? 27.538 -6.161  9.687   1.00 73.72 ? 376  LYS A CB    1 
ATOM   2981 C  CG    . LYS A 1 379 ? 28.909 -6.337  10.327  1.00 77.48 ? 376  LYS A CG    1 
ATOM   2982 C  CD    . LYS A 1 379 ? 28.979 -7.584  11.191  1.00 86.49 ? 376  LYS A CD    1 
ATOM   2983 C  CE    . LYS A 1 379 ? 30.384 -7.788  11.743  1.00 86.89 ? 376  LYS A CE    1 
ATOM   2984 N  NZ    . LYS A 1 379 ? 31.403 -7.892  10.658  1.00 82.64 ? 376  LYS A NZ    1 
ATOM   2985 N  N     . ARG A 1 380 ? 28.203 -5.397  6.530   1.00 59.86 ? 377  ARG A N     1 
ATOM   2986 C  CA    . ARG A 1 380 ? 29.163 -5.451  5.431   1.00 61.34 ? 377  ARG A CA    1 
ATOM   2987 C  C     . ARG A 1 380 ? 29.562 -4.049  4.990   1.00 62.61 ? 377  ARG A C     1 
ATOM   2988 O  O     . ARG A 1 380 ? 28.773 -3.109  5.106   1.00 60.10 ? 377  ARG A O     1 
ATOM   2989 C  CB    . ARG A 1 380 ? 28.566 -6.199  4.239   1.00 54.91 ? 377  ARG A CB    1 
ATOM   2990 C  CG    . ARG A 1 380 ? 28.145 -7.621  4.539   1.00 56.27 ? 377  ARG A CG    1 
ATOM   2991 C  CD    . ARG A 1 380 ? 27.323 -8.179  3.398   1.00 46.25 ? 377  ARG A CD    1 
ATOM   2992 N  NE    . ARG A 1 380 ? 26.101 -7.410  3.175   1.00 45.63 ? 377  ARG A NE    1 
ATOM   2993 C  CZ    . ARG A 1 380 ? 25.300 -7.580  2.129   1.00 37.70 ? 377  ARG A CZ    1 
ATOM   2994 N  NH1   . ARG A 1 380 ? 25.597 -8.489  1.212   1.00 36.54 ? 377  ARG A NH1   1 
ATOM   2995 N  NH2   . ARG A 1 380 ? 24.204 -6.847  1.995   1.00 45.81 ? 377  ARG A NH2   1 
ATOM   2996 N  N     . LEU A 1 381 ? 30.782 -3.912  4.478   1.00 55.34 ? 378  LEU A N     1 
ATOM   2997 C  CA    . LEU A 1 381 ? 31.245 -2.629  3.967   1.00 53.44 ? 378  LEU A CA    1 
ATOM   2998 C  C     . LEU A 1 381 ? 30.400 -2.174  2.777   1.00 53.02 ? 378  LEU A C     1 
ATOM   2999 O  O     . LEU A 1 381 ? 30.010 -1.010  2.694   1.00 55.63 ? 378  LEU A O     1 
ATOM   3000 C  CB    . LEU A 1 381 ? 32.728 -2.685  3.593   1.00 60.20 ? 378  LEU A CB    1 
ATOM   3001 C  CG    . LEU A 1 381 ? 33.742 -2.420  4.715   1.00 66.08 ? 378  LEU A CG    1 
ATOM   3002 C  CD1   . LEU A 1 381 ? 33.662 -3.479  5.808   1.00 62.90 ? 378  LEU A CD1   1 
ATOM   3003 C  CD2   . LEU A 1 381 ? 35.159 -2.338  4.153   1.00 68.53 ? 378  LEU A CD2   1 
ATOM   3004 N  N     . SER A 1 382 ? 30.114 -3.094  1.861   1.00 52.39 ? 379  SER A N     1 
ATOM   3005 C  CA    . SER A 1 382 ? 29.241 -2.788  0.729   1.00 45.76 ? 379  SER A CA    1 
ATOM   3006 C  C     . SER A 1 382 ? 27.949 -3.583  0.792   1.00 41.98 ? 379  SER A C     1 
ATOM   3007 O  O     . SER A 1 382 ? 27.964 -4.783  1.056   1.00 43.43 ? 379  SER A O     1 
ATOM   3008 C  CB    . SER A 1 382 ? 29.936 -3.067  -0.603  1.00 46.89 ? 379  SER A CB    1 
ATOM   3009 O  OG    . SER A 1 382 ? 28.992 -3.066  -1.667  1.00 40.57 ? 379  SER A OG    1 
ATOM   3010 N  N     . SER A 1 383 ? 26.833 -2.910  0.530   1.00 37.90 ? 380  SER A N     1 
ATOM   3011 C  CA    . SER A 1 383 ? 25.527 -3.556  0.543   1.00 41.08 ? 380  SER A CA    1 
ATOM   3012 C  C     . SER A 1 383 ? 25.104 -3.959  -0.862  1.00 49.85 ? 380  SER A C     1 
ATOM   3013 O  O     . SER A 1 383 ? 24.617 -5.068  -1.077  1.00 47.85 ? 380  SER A O     1 
ATOM   3014 C  CB    . SER A 1 383 ? 24.467 -2.626  1.146   1.00 40.66 ? 380  SER A CB    1 
ATOM   3015 O  OG    . SER A 1 383 ? 24.759 -2.314  2.498   1.00 38.16 ? 380  SER A OG    1 
ATOM   3016 N  N     . LEU A 1 384 ? 25.282 -3.047  -1.812  1.00 47.39 ? 381  LEU A N     1 
ATOM   3017 C  CA    . LEU A 1 384 ? 24.876 -3.284  -3.191  1.00 35.50 ? 381  LEU A CA    1 
ATOM   3018 C  C     . LEU A 1 384 ? 25.863 -2.694  -4.191  1.00 39.64 ? 381  LEU A C     1 
ATOM   3019 O  O     . LEU A 1 384 ? 26.303 -1.547  -4.055  1.00 26.68 ? 381  LEU A O     1 
ATOM   3020 C  CB    . LEU A 1 384 ? 23.477 -2.718  -3.447  1.00 33.80 ? 381  LEU A CB    1 
ATOM   3021 C  CG    . LEU A 1 384 ? 23.070 -2.536  -4.915  1.00 36.98 ? 381  LEU A CG    1 
ATOM   3022 C  CD1   . LEU A 1 384 ? 21.574 -2.720  -5.103  1.00 44.01 ? 381  LEU A CD1   1 
ATOM   3023 C  CD2   . LEU A 1 384 ? 23.512 -1.184  -5.450  1.00 38.66 ? 381  LEU A CD2   1 
ATOM   3024 N  N     . ARG A 1 385 ? 26.194 -3.483  -5.207  1.00 28.70 ? 382  ARG A N     1 
ATOM   3025 C  CA    . ARG A 1 385 ? 27.097 -3.042  -6.254  1.00 26.58 ? 382  ARG A CA    1 
ATOM   3026 C  C     . ARG A 1 385 ? 26.407 -3.262  -7.593  1.00 32.87 ? 382  ARG A C     1 
ATOM   3027 O  O     . ARG A 1 385 ? 25.936 -4.361  -7.881  1.00 32.18 ? 382  ARG A O     1 
ATOM   3028 C  CB    . ARG A 1 385 ? 28.390 -3.851  -6.201  1.00 34.58 ? 382  ARG A CB    1 
ATOM   3029 C  CG    . ARG A 1 385 ? 29.650 -3.036  -6.383  1.00 36.50 ? 382  ARG A CG    1 
ATOM   3030 C  CD    . ARG A 1 385 ? 30.754 -3.882  -6.999  1.00 56.48 ? 382  ARG A CD    1 
ATOM   3031 N  NE    . ARG A 1 385 ? 30.473 -4.201  -8.400  1.00 48.62 ? 382  ARG A NE    1 
ATOM   3032 C  CZ    . ARG A 1 385 ? 31.282 -4.902  -9.191  1.00 47.02 ? 382  ARG A CZ    1 
ATOM   3033 N  NH1   . ARG A 1 385 ? 30.941 -5.133  -10.448 1.00 41.03 ? 382  ARG A NH1   1 
ATOM   3034 N  NH2   . ARG A 1 385 ? 32.435 -5.370  -8.728  1.00 55.15 ? 382  ARG A NH2   1 
ATOM   3035 N  N     . ARG A 1 386 ? 26.323 -2.210  -8.396  1.00 20.15 ? 383  ARG A N     1 
ATOM   3036 C  CA    . ARG A 1 386 ? 25.699 -2.287  -9.710  1.00 26.36 ? 383  ARG A CA    1 
ATOM   3037 C  C     . ARG A 1 386 ? 26.581 -1.569  -10.714 1.00 27.56 ? 383  ARG A C     1 
ATOM   3038 O  O     . ARG A 1 386 ? 27.185 -0.552  -10.394 1.00 21.66 ? 383  ARG A O     1 
ATOM   3039 C  CB    . ARG A 1 386 ? 24.334 -1.614  -9.689  1.00 28.98 ? 383  ARG A CB    1 
ATOM   3040 C  CG    . ARG A 1 386 ? 23.296 -2.339  -8.874  1.00 31.15 ? 383  ARG A CG    1 
ATOM   3041 C  CD    . ARG A 1 386 ? 22.764 -3.538  -9.629  1.00 29.07 ? 383  ARG A CD    1 
ATOM   3042 N  NE    . ARG A 1 386 ? 21.583 -4.089  -8.980  1.00 28.68 ? 383  ARG A NE    1 
ATOM   3043 C  CZ    . ARG A 1 386 ? 21.627 -4.956  -7.978  1.00 35.18 ? 383  ARG A CZ    1 
ATOM   3044 N  NH1   . ARG A 1 386 ? 22.800 -5.369  -7.513  1.00 33.04 ? 383  ARG A NH1   1 
ATOM   3045 N  NH2   . ARG A 1 386 ? 20.499 -5.412  -7.444  1.00 40.82 ? 383  ARG A NH2   1 
ATOM   3046 N  N     A CYS A 1 387 ? 26.651 -2.097  -11.929 0.67 28.40 ? 384  CYS A N     1 
ATOM   3047 N  N     B CYS A 1 387 ? 26.651 -2.096  -11.930 0.33 28.41 ? 384  CYS A N     1 
ATOM   3048 C  CA    . CYS A 1 387 ? 27.446 -1.466  -12.976 1.00 26.84 ? 384  CYS A CA    1 
ATOM   3049 C  C     . CYS A 1 387 ? 26.557 -0.893  -14.080 1.00 28.14 ? 384  CYS A C     1 
ATOM   3050 O  O     . CYS A 1 387 ? 25.451 -1.373  -14.309 1.00 34.05 ? 384  CYS A O     1 
ATOM   3051 C  CB    . CYS A 1 387 ? 28.448 -2.462  -13.569 1.00 27.92 ? 384  CYS A CB    1 
ATOM   3052 S  SG    A CYS A 1 387 ? 27.714 -3.824  -14.522 0.67 35.63 ? 384  CYS A SG    1 
ATOM   3053 S  SG    B CYS A 1 387 ? 29.585 -3.169  -12.377 0.33 39.44 ? 384  CYS A SG    1 
ATOM   3054 N  N     . CYS A 1 388 ? 27.040 0.147   -14.749 1.00 29.70 ? 385  CYS A N     1 
ATOM   3055 C  CA    . CYS A 1 388 ? 26.412 0.625   -15.978 1.00 37.60 ? 385  CYS A CA    1 
ATOM   3056 C  C     . CYS A 1 388 ? 27.508 1.066   -16.932 1.00 30.59 ? 385  CYS A C     1 
ATOM   3057 O  O     . CYS A 1 388 ? 28.684 1.066   -16.570 1.00 29.29 ? 385  CYS A O     1 
ATOM   3058 C  CB    . CYS A 1 388 ? 25.424 1.764   -15.702 1.00 32.39 ? 385  CYS A CB    1 
ATOM   3059 S  SG    . CYS A 1 388 ? 26.145 3.265   -15.012 1.00 36.55 ? 385  CYS A SG    1 
ATOM   3060 N  N     . ALA A 1 389 ? 27.131 1.432   -18.154 1.00 32.10 ? 386  ALA A N     1 
ATOM   3061 C  CA    . ALA A 1 389 ? 28.116 1.873   -19.133 1.00 29.19 ? 386  ALA A CA    1 
ATOM   3062 C  C     . ALA A 1 389 ? 28.670 3.250   -18.797 1.00 25.79 ? 386  ALA A C     1 
ATOM   3063 O  O     . ALA A 1 389 ? 27.937 4.146   -18.387 1.00 31.50 ? 386  ALA A O     1 
ATOM   3064 C  CB    . ALA A 1 389 ? 27.524 1.861   -20.533 1.00 31.95 ? 386  ALA A CB    1 
ATOM   3065 N  N     . LEU A 1 390 ? 29.977 3.408   -18.968 1.00 22.93 ? 387  LEU A N     1 
ATOM   3066 C  CA    . LEU A 1 390 ? 30.620 4.702   -18.828 1.00 24.74 ? 387  LEU A CA    1 
ATOM   3067 C  C     . LEU A 1 390 ? 31.055 5.139   -20.216 1.00 29.03 ? 387  LEU A C     1 
ATOM   3068 O  O     . LEU A 1 390 ? 32.111 4.738   -20.690 1.00 28.02 ? 387  LEU A O     1 
ATOM   3069 C  CB    . LEU A 1 390 ? 31.843 4.579   -17.921 1.00 28.65 ? 387  LEU A CB    1 
ATOM   3070 C  CG    . LEU A 1 390 ? 32.273 5.806   -17.120 1.00 26.13 ? 387  LEU A CG    1 
ATOM   3071 C  CD1   . LEU A 1 390 ? 33.573 5.508   -16.393 1.00 25.64 ? 387  LEU A CD1   1 
ATOM   3072 C  CD2   . LEU A 1 390 ? 32.427 7.015   -18.006 1.00 24.50 ? 387  LEU A CD2   1 
ATOM   3073 N  N     . THR A 1 391 ? 30.243 5.969   -20.859 1.00 30.50 ? 388  THR A N     1 
ATOM   3074 C  CA    . THR A 1 391 ? 30.446 6.307   -22.263 1.00 32.78 ? 388  THR A CA    1 
ATOM   3075 C  C     . THR A 1 391 ? 30.970 7.724   -22.472 1.00 34.41 ? 388  THR A C     1 
ATOM   3076 O  O     . THR A 1 391 ? 31.460 8.054   -23.549 1.00 28.58 ? 388  THR A O     1 
ATOM   3077 C  CB    . THR A 1 391 ? 29.140 6.139   -23.065 1.00 40.34 ? 388  THR A CB    1 
ATOM   3078 O  OG1   . THR A 1 391 ? 28.198 7.136   -22.651 1.00 40.88 ? 388  THR A OG1   1 
ATOM   3079 C  CG2   . THR A 1 391 ? 28.545 4.756   -22.829 1.00 29.19 ? 388  THR A CG2   1 
ATOM   3080 N  N     . ARG A 1 392 ? 30.863 8.559   -21.443 1.00 33.00 ? 389  ARG A N     1 
ATOM   3081 C  CA    . ARG A 1 392 ? 31.355 9.929   -21.516 1.00 31.17 ? 389  ARG A CA    1 
ATOM   3082 C  C     . ARG A 1 392 ? 31.838 10.430  -20.155 1.00 24.33 ? 389  ARG A C     1 
ATOM   3083 O  O     . ARG A 1 392 ? 31.212 10.172  -19.129 1.00 30.48 ? 389  ARG A O     1 
ATOM   3084 C  CB    . ARG A 1 392 ? 30.278 10.870  -22.070 1.00 36.52 ? 389  ARG A CB    1 
ATOM   3085 C  CG    . ARG A 1 392 ? 30.045 10.736  -23.574 1.00 44.19 ? 389  ARG A CG    1 
ATOM   3086 C  CD    . ARG A 1 392 ? 29.020 11.738  -24.083 1.00 52.25 ? 389  ARG A CD    1 
ATOM   3087 N  NE    . ARG A 1 392 ? 29.371 13.106  -23.706 1.00 49.60 ? 389  ARG A NE    1 
ATOM   3088 C  CZ    . ARG A 1 392 ? 28.802 13.775  -22.706 1.00 60.40 ? 389  ARG A CZ    1 
ATOM   3089 N  NH1   . ARG A 1 392 ? 29.188 15.015  -22.430 1.00 53.19 ? 389  ARG A NH1   1 
ATOM   3090 N  NH2   . ARG A 1 392 ? 27.845 13.205  -21.985 1.00 52.24 ? 389  ARG A NH2   1 
ATOM   3091 N  N     . TYR A 1 393 ? 32.959 11.139  -20.162 1.00 21.91 ? 390  TYR A N     1 
ATOM   3092 C  CA    . TYR A 1 393 ? 33.506 11.733  -18.948 1.00 23.66 ? 390  TYR A CA    1 
ATOM   3093 C  C     . TYR A 1 393 ? 32.745 13.014  -18.627 1.00 31.19 ? 390  TYR A C     1 
ATOM   3094 O  O     . TYR A 1 393 ? 33.237 14.121  -18.864 1.00 27.97 ? 390  TYR A O     1 
ATOM   3095 C  CB    . TYR A 1 393 ? 34.997 12.033  -19.116 1.00 26.33 ? 390  TYR A CB    1 
ATOM   3096 C  CG    . TYR A 1 393 ? 35.901 10.812  -19.075 1.00 22.36 ? 390  TYR A CG    1 
ATOM   3097 C  CD1   . TYR A 1 393 ? 37.282 10.944  -19.155 1.00 17.54 ? 390  TYR A CD1   1 
ATOM   3098 C  CD2   . TYR A 1 393 ? 35.372 9.529   -18.949 1.00 27.03 ? 390  TYR A CD2   1 
ATOM   3099 C  CE1   . TYR A 1 393 ? 38.113 9.824   -19.110 1.00 14.30 ? 390  TYR A CE1   1 
ATOM   3100 C  CE2   . TYR A 1 393 ? 36.193 8.415   -18.898 1.00 22.52 ? 390  TYR A CE2   1 
ATOM   3101 C  CZ    . TYR A 1 393 ? 37.562 8.569   -18.983 1.00 20.66 ? 390  TYR A CZ    1 
ATOM   3102 O  OH    . TYR A 1 393 ? 38.384 7.460   -18.934 1.00 21.82 ? 390  TYR A OH    1 
ATOM   3103 N  N     . ASP A 1 394 ? 31.535 12.853  -18.105 1.00 24.33 ? 391  ASP A N     1 
ATOM   3104 C  CA    . ASP A 1 394 ? 30.688 13.988  -17.766 1.00 25.51 ? 391  ASP A CA    1 
ATOM   3105 C  C     . ASP A 1 394 ? 30.066 13.724  -16.413 1.00 18.47 ? 391  ASP A C     1 
ATOM   3106 O  O     . ASP A 1 394 ? 29.360 12.734  -16.242 1.00 22.11 ? 391  ASP A O     1 
ATOM   3107 C  CB    . ASP A 1 394 ? 29.591 14.176  -18.819 1.00 29.08 ? 391  ASP A CB    1 
ATOM   3108 C  CG    . ASP A 1 394 ? 28.726 15.395  -18.547 1.00 34.98 ? 391  ASP A CG    1 
ATOM   3109 O  OD1   . ASP A 1 394 ? 27.754 15.273  -17.775 1.00 31.12 ? 391  ASP A OD1   1 
ATOM   3110 O  OD2   . ASP A 1 394 ? 29.021 16.476  -19.100 1.00 50.37 ? 391  ASP A OD2   1 
ATOM   3111 N  N     . ALA A 1 395 ? 30.332 14.605  -15.455 1.00 20.25 ? 392  ALA A N     1 
ATOM   3112 C  CA    . ALA A 1 395 ? 29.899 14.386  -14.075 1.00 19.36 ? 392  ALA A CA    1 
ATOM   3113 C  C     . ALA A 1 395 ? 28.382 14.338  -13.891 1.00 16.26 ? 392  ALA A C     1 
ATOM   3114 O  O     . ALA A 1 395 ? 27.880 13.518  -13.130 1.00 16.87 ? 392  ALA A O     1 
ATOM   3115 C  CB    . ALA A 1 395 ? 30.533 15.430  -13.132 1.00 17.60 ? 392  ALA A CB    1 
ATOM   3116 N  N     . HIS A 1 396 ? 27.653 15.214  -14.579 1.00 22.98 ? 393  HIS A N     1 
ATOM   3117 C  CA    . HIS A 1 396 ? 26.193 15.217  -14.475 1.00 28.81 ? 393  HIS A CA    1 
ATOM   3118 C  C     . HIS A 1 396 ? 25.581 13.933  -15.012 1.00 20.19 ? 393  HIS A C     1 
ATOM   3119 O  O     . HIS A 1 396 ? 24.644 13.386  -14.420 1.00 24.96 ? 393  HIS A O     1 
ATOM   3120 C  CB    . HIS A 1 396 ? 25.593 16.447  -15.159 1.00 29.08 ? 393  HIS A CB    1 
ATOM   3121 C  CG    . HIS A 1 396 ? 25.761 17.708  -14.370 1.00 34.08 ? 393  HIS A CG    1 
ATOM   3122 N  ND1   . HIS A 1 396 ? 26.805 18.583  -14.579 1.00 40.50 ? 393  HIS A ND1   1 
ATOM   3123 C  CD2   . HIS A 1 396 ? 25.034 18.226  -13.351 1.00 39.83 ? 393  HIS A CD2   1 
ATOM   3124 C  CE1   . HIS A 1 396 ? 26.705 19.595  -13.733 1.00 41.15 ? 393  HIS A CE1   1 
ATOM   3125 N  NE2   . HIS A 1 396 ? 25.641 19.401  -12.976 1.00 38.23 ? 393  HIS A NE2   1 
ATOM   3126 N  N     . LYS A 1 397 ? 26.111 13.446  -16.133 1.00 21.29 ? 394  LYS A N     1 
ATOM   3127 C  CA    . LYS A 1 397 ? 25.675 12.157  -16.671 1.00 21.65 ? 394  LYS A CA    1 
ATOM   3128 C  C     . LYS A 1 397 ? 26.002 10.983  -15.759 1.00 21.87 ? 394  LYS A C     1 
ATOM   3129 O  O     . LYS A 1 397 ? 25.163 10.112  -15.523 1.00 25.81 ? 394  LYS A O     1 
ATOM   3130 C  CB    . LYS A 1 397 ? 26.273 11.889  -18.056 1.00 26.46 ? 394  LYS A CB    1 
ATOM   3131 C  CG    . LYS A 1 397 ? 25.914 10.494  -18.591 1.00 35.90 ? 394  LYS A CG    1 
ATOM   3132 C  CD    . LYS A 1 397 ? 26.288 10.317  -20.065 1.00 37.07 ? 394  LYS A CD    1 
ATOM   3133 C  CE    . LYS A 1 397 ? 26.225 8.847   -20.494 1.00 38.16 ? 394  LYS A CE    1 
ATOM   3134 N  NZ    . LYS A 1 397 ? 24.893 8.208   -20.264 1.00 41.57 ? 394  LYS A NZ    1 
ATOM   3135 N  N     . MET A 1 398 ? 27.231 10.939  -15.267 1.00 20.06 ? 395  MET A N     1 
ATOM   3136 C  CA    . MET A 1 398 ? 27.636 9.827   -14.421 1.00 23.35 ? 395  MET A CA    1 
ATOM   3137 C  C     . MET A 1 398 ? 26.782 9.763   -13.157 1.00 20.90 ? 395  MET A C     1 
ATOM   3138 O  O     . MET A 1 398 ? 26.373 8.681   -12.731 1.00 21.66 ? 395  MET A O     1 
ATOM   3139 C  CB    . MET A 1 398 ? 29.128 9.917   -14.078 1.00 18.48 ? 395  MET A CB    1 
ATOM   3140 C  CG    . MET A 1 398 ? 30.031 9.558   -15.255 1.00 16.41 ? 395  MET A CG    1 
ATOM   3141 S  SD    . MET A 1 398 ? 31.742 9.299   -14.767 1.00 30.55 ? 395  MET A SD    1 
ATOM   3142 C  CE    . MET A 1 398 ? 32.250 10.993  -14.491 1.00 23.61 ? 395  MET A CE    1 
ATOM   3143 N  N     . SER A 1 399 ? 26.499 10.922  -12.569 1.00 22.08 ? 396  SER A N     1 
ATOM   3144 C  CA    . SER A 1 399 ? 25.728 10.953  -11.333 1.00 24.49 ? 396  SER A CA    1 
ATOM   3145 C  C     . SER A 1 399 ? 24.266 10.580  -11.586 1.00 21.21 ? 396  SER A C     1 
ATOM   3146 O  O     . SER A 1 399 ? 23.652 9.894   -10.777 1.00 19.77 ? 396  SER A O     1 
ATOM   3147 C  CB    . SER A 1 399 ? 25.854 12.307  -10.622 1.00 27.19 ? 396  SER A CB    1 
ATOM   3148 O  OG    . SER A 1 399 ? 25.447 13.384  -11.445 1.00 29.38 ? 396  SER A OG    1 
ATOM   3149 N  N     . HIS A 1 400 ? 23.727 11.008  -12.721 1.00 26.23 ? 397  HIS A N     1 
ATOM   3150 C  CA    . HIS A 1 400 ? 22.364 10.632  -13.094 1.00 28.38 ? 397  HIS A CA    1 
ATOM   3151 C  C     . HIS A 1 400 ? 22.275 9.122   -13.313 1.00 27.17 ? 397  HIS A C     1 
ATOM   3152 O  O     . HIS A 1 400 ? 21.350 8.460   -12.836 1.00 25.49 ? 397  HIS A O     1 
ATOM   3153 C  CB    . HIS A 1 400 ? 21.927 11.397  -14.348 1.00 34.62 ? 397  HIS A CB    1 
ATOM   3154 C  CG    . HIS A 1 400 ? 20.517 11.115  -14.766 1.00 40.53 ? 397  HIS A CG    1 
ATOM   3155 N  ND1   . HIS A 1 400 ? 20.153 9.963   -15.431 1.00 45.23 ? 397  HIS A ND1   1 
ATOM   3156 C  CD2   . HIS A 1 400 ? 19.381 11.835  -14.612 1.00 47.40 ? 397  HIS A CD2   1 
ATOM   3157 C  CE1   . HIS A 1 400 ? 18.854 9.986   -15.670 1.00 40.36 ? 397  HIS A CE1   1 
ATOM   3158 N  NE2   . HIS A 1 400 ? 18.362 11.111  -15.183 1.00 46.05 ? 397  HIS A NE2   1 
ATOM   3159 N  N     . ASP A 1 401 ? 23.262 8.577   -14.021 1.00 27.00 ? 398  ASP A N     1 
ATOM   3160 C  CA    . ASP A 1 401 ? 23.329 7.143   -14.261 1.00 23.15 ? 398  ASP A CA    1 
ATOM   3161 C  C     . ASP A 1 401 ? 23.471 6.359   -12.966 1.00 26.58 ? 398  ASP A C     1 
ATOM   3162 O  O     . ASP A 1 401 ? 22.889 5.289   -12.813 1.00 29.15 ? 398  ASP A O     1 
ATOM   3163 C  CB    . ASP A 1 401 ? 24.487 6.812   -15.200 1.00 25.64 ? 398  ASP A CB    1 
ATOM   3164 C  CG    . ASP A 1 401 ? 24.255 7.328   -16.603 1.00 34.06 ? 398  ASP A CG    1 
ATOM   3165 O  OD1   . ASP A 1 401 ? 23.111 7.733   -16.905 1.00 35.02 ? 398  ASP A OD1   1 
ATOM   3166 O  OD2   . ASP A 1 401 ? 25.208 7.320   -17.406 1.00 28.26 ? 398  ASP A OD2   1 
ATOM   3167 N  N     . ALA A 1 402 ? 24.250 6.896   -12.033 1.00 22.85 ? 399  ALA A N     1 
ATOM   3168 C  CA    . ALA A 1 402 ? 24.458 6.236   -10.753 1.00 24.00 ? 399  ALA A CA    1 
ATOM   3169 C  C     . ALA A 1 402 ? 23.160 6.202   -9.967  1.00 20.46 ? 399  ALA A C     1 
ATOM   3170 O  O     . ALA A 1 402 ? 22.828 5.199   -9.333  1.00 20.95 ? 399  ALA A O     1 
ATOM   3171 C  CB    . ALA A 1 402 ? 25.550 6.949   -9.957  1.00 23.83 ? 399  ALA A CB    1 
ATOM   3172 N  N     . PHE A 1 403 ? 22.424 7.305   -10.007 1.00 26.24 ? 400  PHE A N     1 
ATOM   3173 C  CA    . PHE A 1 403 ? 21.156 7.375   -9.297  1.00 26.56 ? 400  PHE A CA    1 
ATOM   3174 C  C     . PHE A 1 403 ? 20.180 6.384   -9.914  1.00 31.62 ? 400  PHE A C     1 
ATOM   3175 O  O     . PHE A 1 403 ? 19.452 5.688   -9.208  1.00 33.55 ? 400  PHE A O     1 
ATOM   3176 C  CB    . PHE A 1 403 ? 20.573 8.783   -9.362  1.00 28.15 ? 400  PHE A CB    1 
ATOM   3177 C  CG    . PHE A 1 403 ? 19.315 8.951   -8.558  1.00 39.45 ? 400  PHE A CG    1 
ATOM   3178 C  CD1   . PHE A 1 403 ? 18.072 8.753   -9.139  1.00 45.84 ? 400  PHE A CD1   1 
ATOM   3179 C  CD2   . PHE A 1 403 ? 19.376 9.299   -7.218  1.00 35.02 ? 400  PHE A CD2   1 
ATOM   3180 C  CE1   . PHE A 1 403 ? 16.914 8.903   -8.400  1.00 41.25 ? 400  PHE A CE1   1 
ATOM   3181 C  CE2   . PHE A 1 403 ? 18.223 9.453   -6.474  1.00 47.29 ? 400  PHE A CE2   1 
ATOM   3182 C  CZ    . PHE A 1 403 ? 16.989 9.255   -7.067  1.00 47.09 ? 400  PHE A CZ    1 
ATOM   3183 N  N     . THR A 1 404 ? 20.172 6.325   -11.239 1.00 33.48 ? 401  THR A N     1 
ATOM   3184 C  CA    . THR A 1 404 ? 19.309 5.384   -11.935 1.00 32.25 ? 401  THR A CA    1 
ATOM   3185 C  C     . THR A 1 404 ? 19.544 3.941   -11.482 1.00 29.69 ? 401  THR A C     1 
ATOM   3186 O  O     . THR A 1 404 ? 18.587 3.219   -11.196 1.00 40.17 ? 401  THR A O     1 
ATOM   3187 C  CB    . THR A 1 404 ? 19.445 5.504   -13.470 1.00 31.11 ? 401  THR A CB    1 
ATOM   3188 O  OG1   . THR A 1 404 ? 18.989 6.796   -13.889 1.00 28.22 ? 401  THR A OG1   1 
ATOM   3189 C  CG2   . THR A 1 404 ? 18.614 4.437   -14.170 1.00 33.66 ? 401  THR A CG2   1 
ATOM   3190 N  N     . VAL A 1 405 ? 20.804 3.517   -11.396 1.00 28.86 ? 402  VAL A N     1 
ATOM   3191 C  CA    . VAL A 1 405 ? 21.080 2.127   -11.041 1.00 28.52 ? 402  VAL A CA    1 
ATOM   3192 C  C     . VAL A 1 405 ? 20.786 1.799   -9.575  1.00 36.85 ? 402  VAL A C     1 
ATOM   3193 O  O     . VAL A 1 405 ? 20.656 0.628   -9.227  1.00 38.37 ? 402  VAL A O     1 
ATOM   3194 C  CB    . VAL A 1 405 ? 22.519 1.671   -11.414 1.00 33.80 ? 402  VAL A CB    1 
ATOM   3195 C  CG1   . VAL A 1 405 ? 22.722 1.715   -12.928 1.00 38.69 ? 402  VAL A CG1   1 
ATOM   3196 C  CG2   . VAL A 1 405 ? 23.558 2.516   -10.709 1.00 39.22 ? 402  VAL A CG2   1 
ATOM   3197 N  N     . ILE A 1 406 ? 20.669 2.821   -8.724  1.00 33.99 ? 403  ILE A N     1 
ATOM   3198 C  CA    . ILE A 1 406 ? 20.448 2.592   -7.293  1.00 35.15 ? 403  ILE A CA    1 
ATOM   3199 C  C     . ILE A 1 406 ? 19.067 3.008   -6.777  1.00 37.58 ? 403  ILE A C     1 
ATOM   3200 O  O     . ILE A 1 406 ? 18.683 2.632   -5.670  1.00 41.03 ? 403  ILE A O     1 
ATOM   3201 C  CB    . ILE A 1 406 ? 21.492 3.326   -6.417  1.00 37.76 ? 403  ILE A CB    1 
ATOM   3202 C  CG1   . ILE A 1 406 ? 21.167 4.821   -6.346  1.00 32.07 ? 403  ILE A CG1   1 
ATOM   3203 C  CG2   . ILE A 1 406 ? 22.898 3.068   -6.922  1.00 30.81 ? 403  ILE A CG2   1 
ATOM   3204 C  CD1   . ILE A 1 406 ? 21.905 5.559   -5.250  1.00 34.17 ? 403  ILE A CD1   1 
ATOM   3205 N  N     . LYS A 1 407 ? 18.331 3.786   -7.563  1.00 31.75 ? 404  LYS A N     1 
ATOM   3206 C  CA    . LYS A 1 407 ? 17.080 4.375   -7.083  1.00 40.16 ? 404  LYS A CA    1 
ATOM   3207 C  C     . LYS A 1 407 ? 16.048 3.340   -6.616  1.00 50.50 ? 404  LYS A C     1 
ATOM   3208 O  O     . LYS A 1 407 ? 15.213 3.633   -5.759  1.00 49.92 ? 404  LYS A O     1 
ATOM   3209 C  CB    . LYS A 1 407 ? 16.479 5.322   -8.129  1.00 41.88 ? 404  LYS A CB    1 
ATOM   3210 C  CG    . LYS A 1 407 ? 15.892 4.641   -9.356  1.00 40.68 ? 404  LYS A CG    1 
ATOM   3211 C  CD    . LYS A 1 407 ? 15.454 5.679   -10.387 1.00 49.34 ? 404  LYS A CD    1 
ATOM   3212 C  CE    . LYS A 1 407 ? 14.736 5.039   -11.570 1.00 50.08 ? 404  LYS A CE    1 
ATOM   3213 N  NZ    . LYS A 1 407 ? 15.594 4.061   -12.293 1.00 63.15 ? 404  LYS A NZ    1 
ATOM   3214 N  N     . ASN A 1 408 ? 16.115 2.131   -7.166  1.00 48.30 ? 405  ASN A N     1 
ATOM   3215 C  CA    . ASN A 1 408 ? 15.205 1.059   -6.765  1.00 51.71 ? 405  ASN A CA    1 
ATOM   3216 C  C     . ASN A 1 408 ? 15.497 0.520   -5.366  1.00 50.06 ? 405  ASN A C     1 
ATOM   3217 O  O     . ASN A 1 408 ? 14.754 -0.308  -4.843  1.00 44.87 ? 405  ASN A O     1 
ATOM   3218 C  CB    . ASN A 1 408 ? 15.233 -0.089  -7.780  1.00 51.97 ? 405  ASN A CB    1 
ATOM   3219 C  CG    . ASN A 1 408 ? 16.616 -0.702  -7.929  1.00 62.87 ? 405  ASN A CG    1 
ATOM   3220 O  OD1   . ASN A 1 408 ? 17.593 -0.003  -8.212  1.00 46.95 ? 405  ASN A OD1   1 
ATOM   3221 N  ND2   . ASN A 1 408 ? 16.708 -2.013  -7.722  1.00 64.94 ? 405  ASN A ND2   1 
ATOM   3222 N  N     . CYS A 1 409 ? 16.586 0.983   -4.763  1.00 48.62 ? 406  CYS A N     1 
ATOM   3223 C  CA    . CYS A 1 409 ? 16.936 0.557   -3.415  1.00 47.34 ? 406  CYS A CA    1 
ATOM   3224 C  C     . CYS A 1 409 ? 16.084 1.285   -2.396  1.00 44.46 ? 406  CYS A C     1 
ATOM   3225 O  O     . CYS A 1 409 ? 15.938 0.841   -1.259  1.00 58.68 ? 406  CYS A O     1 
ATOM   3226 C  CB    . CYS A 1 409 ? 18.409 0.829   -3.125  1.00 54.77 ? 406  CYS A CB    1 
ATOM   3227 S  SG    . CYS A 1 409 ? 19.527 -0.282  -3.966  1.00 56.31 ? 406  CYS A SG    1 
ATOM   3228 N  N     . ASN A 1 410 ? 15.524 2.412   -2.812  1.00 46.01 ? 407  ASN A N     1 
ATOM   3229 C  CA    . ASN A 1 410 ? 14.739 3.242   -1.916  1.00 43.07 ? 407  ASN A CA    1 
ATOM   3230 C  C     . ASN A 1 410 ? 13.450 2.552   -1.454  1.00 55.33 ? 407  ASN A C     1 
ATOM   3231 O  O     . ASN A 1 410 ? 12.496 2.414   -2.220  1.00 51.51 ? 407  ASN A O     1 
ATOM   3232 C  CB    . ASN A 1 410 ? 14.435 4.582   -2.582  1.00 42.15 ? 407  ASN A CB    1 
ATOM   3233 C  CG    . ASN A 1 410 ? 13.877 5.589   -1.615  1.00 38.65 ? 407  ASN A CG    1 
ATOM   3234 O  OD1   . ASN A 1 410 ? 13.685 5.287   -0.438  1.00 40.22 ? 407  ASN A OD1   1 
ATOM   3235 N  ND2   . ASN A 1 410 ? 13.623 6.803   -2.099  1.00 40.75 ? 407  ASN A ND2   1 
ATOM   3236 N  N     . THR A 1 411 ? 13.443 2.119   -0.196  1.00 56.73 ? 408  THR A N     1 
ATOM   3237 C  CA    . THR A 1 411 ? 12.291 1.453   0.410   1.00 57.25 ? 408  THR A CA    1 
ATOM   3238 C  C     . THR A 1 411 ? 11.148 2.431   0.658   1.00 58.16 ? 408  THR A C     1 
ATOM   3239 O  O     . THR A 1 411 ? 9.976  2.053   0.631   1.00 63.31 ? 408  THR A O     1 
ATOM   3240 C  CB    . THR A 1 411 ? 12.679 0.779   1.745   1.00 51.87 ? 408  THR A CB    1 
ATOM   3241 O  OG1   . THR A 1 411 ? 13.253 -0.508  1.483   1.00 62.73 ? 408  THR A OG1   1 
ATOM   3242 C  CG2   . THR A 1 411 ? 11.464 0.608   2.643   1.00 68.13 ? 408  THR A CG2   1 
ATOM   3243 N  N     . SER A 1 412 ? 11.501 3.691   0.895   1.00 58.23 ? 409  SER A N     1 
ATOM   3244 C  CA    . SER A 1 412 ? 10.524 4.736   1.184   1.00 62.10 ? 409  SER A CA    1 
ATOM   3245 C  C     . SER A 1 412 ? 9.301  4.671   0.274   1.00 66.07 ? 409  SER A C     1 
ATOM   3246 O  O     . SER A 1 412 ? 9.420  4.425   -0.926  1.00 64.29 ? 409  SER A O     1 
ATOM   3247 C  CB    . SER A 1 412 ? 11.175 6.116   1.067   1.00 54.06 ? 409  SER A CB    1 
ATOM   3248 O  OG    . SER A 1 412 ? 10.225 7.149   1.260   1.00 59.34 ? 409  SER A OG    1 
ATOM   3249 N  N     . GLY A 1 413 ? 8.127  4.888   0.859   1.00 66.45 ? 410  GLY A N     1 
ATOM   3250 C  CA    . GLY A 1 413 ? 6.906  5.016   0.086   1.00 69.40 ? 410  GLY A CA    1 
ATOM   3251 C  C     . GLY A 1 413 ? 6.825  6.420   -0.477  1.00 67.48 ? 410  GLY A C     1 
ATOM   3252 O  O     . GLY A 1 413 ? 6.147  6.675   -1.471  1.00 64.16 ? 410  GLY A O     1 
ATOM   3253 N  N     . ILE A 1 414 ? 7.534  7.336   0.173   1.00 64.78 ? 411  ILE A N     1 
ATOM   3254 C  CA    . ILE A 1 414 ? 7.617  8.717   -0.274  1.00 66.02 ? 411  ILE A CA    1 
ATOM   3255 C  C     . ILE A 1 414 ? 8.794  8.874   -1.230  1.00 67.49 ? 411  ILE A C     1 
ATOM   3256 O  O     . ILE A 1 414 ? 9.929  8.544   -0.888  1.00 65.96 ? 411  ILE A O     1 
ATOM   3257 C  CB    . ILE A 1 414 ? 7.812  9.669   0.920   1.00 64.39 ? 411  ILE A CB    1 
ATOM   3258 C  CG1   . ILE A 1 414 ? 6.976  9.198   2.115   1.00 62.63 ? 411  ILE A CG1   1 
ATOM   3259 C  CG2   . ILE A 1 414 ? 7.480  11.102  0.523   1.00 57.58 ? 411  ILE A CG2   1 
ATOM   3260 C  CD1   . ILE A 1 414 ? 7.220  9.986   3.381   1.00 63.75 ? 411  ILE A CD1   1 
ATOM   3261 N  N     . GLN A 1 415 ? 8.518  9.379   -2.427  1.00 73.37 ? 412  GLN A N     1 
ATOM   3262 C  CA    . GLN A 1 415 ? 9.546  9.555   -3.450  1.00 72.15 ? 412  GLN A CA    1 
ATOM   3263 C  C     . GLN A 1 415 ? 10.710 10.409  -2.944  1.00 70.32 ? 412  GLN A C     1 
ATOM   3264 O  O     . GLN A 1 415 ? 11.877 10.096  -3.188  1.00 69.37 ? 412  GLN A O     1 
ATOM   3265 C  CB    . GLN A 1 415 ? 8.935  10.200  -4.698  1.00 76.59 ? 412  GLN A CB    1 
ATOM   3266 C  CG    . GLN A 1 415 ? 9.755  10.032  -5.971  1.00 82.11 ? 412  GLN A CG    1 
ATOM   3267 C  CD    . GLN A 1 415 ? 9.621  8.644   -6.580  1.00 84.01 ? 412  GLN A CD    1 
ATOM   3268 O  OE1   . GLN A 1 415 ? 9.759  7.631   -5.891  1.00 80.33 ? 412  GLN A OE1   1 
ATOM   3269 N  NE2   . GLN A 1 415 ? 9.345  8.594   -7.880  1.00 73.62 ? 412  GLN A NE2   1 
ATOM   3270 N  N     . THR A 1 416 ? 10.376 11.481  -2.231  1.00 62.82 ? 413  THR A N     1 
ATOM   3271 C  CA    . THR A 1 416 ? 11.354 12.462  -1.771  1.00 57.28 ? 413  THR A CA    1 
ATOM   3272 C  C     . THR A 1 416 ? 12.263 11.951  -0.651  1.00 55.27 ? 413  THR A C     1 
ATOM   3273 O  O     . THR A 1 416 ? 13.385 12.429  -0.487  1.00 52.00 ? 413  THR A O     1 
ATOM   3274 C  CB    . THR A 1 416 ? 10.649 13.745  -1.290  1.00 58.94 ? 413  THR A CB    1 
ATOM   3275 O  OG1   . THR A 1 416 ? 9.807  14.245  -2.335  1.00 64.89 ? 413  THR A OG1   1 
ATOM   3276 C  CG2   . THR A 1 416 ? 11.666 14.810  -0.909  1.00 62.88 ? 413  THR A CG2   1 
ATOM   3277 N  N     . GLU A 1 417 ? 11.776 10.986  0.122   1.00 52.68 ? 414  GLU A N     1 
ATOM   3278 C  CA    . GLU A 1 417 ? 12.543 10.450  1.239   1.00 49.29 ? 414  GLU A CA    1 
ATOM   3279 C  C     . GLU A 1 417 ? 13.354 9.232   0.827   1.00 53.42 ? 414  GLU A C     1 
ATOM   3280 O  O     . GLU A 1 417 ? 12.968 8.491   -0.080  1.00 46.28 ? 414  GLU A O     1 
ATOM   3281 C  CB    . GLU A 1 417 ? 11.618 10.086  2.400   1.00 54.46 ? 414  GLU A CB    1 
ATOM   3282 C  CG    . GLU A 1 417 ? 10.699 11.217  2.822   1.00 58.73 ? 414  GLU A CG    1 
ATOM   3283 C  CD    . GLU A 1 417 ? 11.453 12.506  3.071   1.00 53.75 ? 414  GLU A CD    1 
ATOM   3284 O  OE1   . GLU A 1 417 ? 12.207 12.571  4.065   1.00 46.17 ? 414  GLU A OE1   1 
ATOM   3285 O  OE2   . GLU A 1 417 ? 11.298 13.448  2.264   1.00 54.83 ? 414  GLU A OE2   1 
ATOM   3286 N  N     . TRP A 1 418 ? 14.479 9.027   1.502   1.00 36.21 ? 415  TRP A N     1 
ATOM   3287 C  CA    . TRP A 1 418 ? 15.315 7.873   1.227   1.00 41.24 ? 415  TRP A CA    1 
ATOM   3288 C  C     . TRP A 1 418 ? 15.489 6.998   2.462   1.00 42.82 ? 415  TRP A C     1 
ATOM   3289 O  O     . TRP A 1 418 ? 16.081 7.418   3.455   1.00 43.92 ? 415  TRP A O     1 
ATOM   3290 C  CB    . TRP A 1 418 ? 16.688 8.296   0.696   1.00 37.57 ? 415  TRP A CB    1 
ATOM   3291 C  CG    . TRP A 1 418 ? 17.331 7.181   -0.044  1.00 31.92 ? 415  TRP A CG    1 
ATOM   3292 C  CD1   . TRP A 1 418 ? 17.832 6.030   0.483   1.00 31.66 ? 415  TRP A CD1   1 
ATOM   3293 C  CD2   . TRP A 1 418 ? 17.497 7.084   -1.459  1.00 33.47 ? 415  TRP A CD2   1 
ATOM   3294 N  NE1   . TRP A 1 418 ? 18.315 5.222   -0.518  1.00 35.60 ? 415  TRP A NE1   1 
ATOM   3295 C  CE2   . TRP A 1 418 ? 18.122 5.849   -1.721  1.00 33.36 ? 415  TRP A CE2   1 
ATOM   3296 C  CE3   . TRP A 1 418 ? 17.188 7.926   -2.530  1.00 37.88 ? 415  TRP A CE3   1 
ATOM   3297 C  CZ2   . TRP A 1 418 ? 18.445 5.437   -3.012  1.00 38.03 ? 415  TRP A CZ2   1 
ATOM   3298 C  CZ3   . TRP A 1 418 ? 17.508 7.517   -3.810  1.00 40.51 ? 415  TRP A CZ3   1 
ATOM   3299 C  CH2   . TRP A 1 418 ? 18.131 6.283   -4.040  1.00 30.53 ? 415  TRP A CH2   1 
ATOM   3300 N  N     . SER A 1 419 ? 14.979 5.774   2.393   1.00 44.80 ? 416  SER A N     1 
ATOM   3301 C  CA    . SER A 1 419 ? 15.120 4.837   3.499   1.00 41.39 ? 416  SER A CA    1 
ATOM   3302 C  C     . SER A 1 419 ? 15.361 3.423   2.989   1.00 46.77 ? 416  SER A C     1 
ATOM   3303 O  O     . SER A 1 419 ? 14.873 3.056   1.922   1.00 48.18 ? 416  SER A O     1 
ATOM   3304 C  CB    . SER A 1 419 ? 13.885 4.877   4.402   1.00 51.49 ? 416  SER A CB    1 
ATOM   3305 O  OG    . SER A 1 419 ? 12.696 4.724   3.646   1.00 63.70 ? 416  SER A OG    1 
ATOM   3306 N  N     . PRO A 1 420 ? 16.153 2.637   3.736   1.00 43.51 ? 417  PRO A N     1 
ATOM   3307 C  CA    . PRO A 1 420 ? 16.881 3.138   4.908   1.00 47.53 ? 417  PRO A CA    1 
ATOM   3308 C  C     . PRO A 1 420 ? 18.014 4.057   4.463   1.00 40.05 ? 417  PRO A C     1 
ATOM   3309 O  O     . PRO A 1 420 ? 18.531 3.876   3.360   1.00 45.97 ? 417  PRO A O     1 
ATOM   3310 C  CB    . PRO A 1 420 ? 17.446 1.862   5.542   1.00 47.55 ? 417  PRO A CB    1 
ATOM   3311 C  CG    . PRO A 1 420 ? 17.542 0.891   4.416   1.00 45.96 ? 417  PRO A CG    1 
ATOM   3312 C  CD    . PRO A 1 420 ? 16.383 1.199   3.510   1.00 44.94 ? 417  PRO A CD    1 
ATOM   3313 N  N     . PRO A 1 421 ? 18.389 5.033   5.306   1.00 41.88 ? 418  PRO A N     1 
ATOM   3314 C  CA    . PRO A 1 421 ? 19.397 6.035   4.933   1.00 35.46 ? 418  PRO A CA    1 
ATOM   3315 C  C     . PRO A 1 421 ? 20.679 5.394   4.401   1.00 25.16 ? 418  PRO A C     1 
ATOM   3316 O  O     . PRO A 1 421 ? 21.003 4.263   4.769   1.00 27.42 ? 418  PRO A O     1 
ATOM   3317 C  CB    . PRO A 1 421 ? 19.673 6.763   6.252   1.00 34.68 ? 418  PRO A CB    1 
ATOM   3318 C  CG    . PRO A 1 421 ? 18.422 6.573   7.057   1.00 41.19 ? 418  PRO A CG    1 
ATOM   3319 C  CD    . PRO A 1 421 ? 17.913 5.209   6.690   1.00 40.77 ? 418  PRO A CD    1 
ATOM   3320 N  N     . LEU A 1 422 ? 21.385 6.115   3.536   1.00 30.24 ? 419  LEU A N     1 
ATOM   3321 C  CA    . LEU A 1 422 ? 22.613 5.611   2.928   1.00 26.74 ? 419  LEU A CA    1 
ATOM   3322 C  C     . LEU A 1 422 ? 23.826 6.030   3.754   1.00 23.09 ? 419  LEU A C     1 
ATOM   3323 O  O     . LEU A 1 422 ? 23.986 7.202   4.080   1.00 28.50 ? 419  LEU A O     1 
ATOM   3324 C  CB    . LEU A 1 422 ? 22.752 6.116   1.483   1.00 26.33 ? 419  LEU A CB    1 
ATOM   3325 C  CG    . LEU A 1 422 ? 21.657 5.702   0.494   1.00 27.75 ? 419  LEU A CG    1 
ATOM   3326 C  CD1   . LEU A 1 422 ? 22.029 6.081   -0.942  1.00 24.38 ? 419  LEU A CD1   1 
ATOM   3327 C  CD2   . LEU A 1 422 ? 21.382 4.213   0.596   1.00 32.45 ? 419  LEU A CD2   1 
ATOM   3328 N  N     . THR A 1 423 ? 24.678 5.069   4.084   1.00 23.58 ? 420  THR A N     1 
ATOM   3329 C  CA    . THR A 1 423 ? 25.850 5.344   4.905   1.00 24.88 ? 420  THR A CA    1 
ATOM   3330 C  C     . THR A 1 423 ? 27.156 5.360   4.102   1.00 22.55 ? 420  THR A C     1 
ATOM   3331 O  O     . THR A 1 423 ? 28.231 5.620   4.649   1.00 23.05 ? 420  THR A O     1 
ATOM   3332 C  CB    . THR A 1 423 ? 25.960 4.329   6.043   1.00 30.19 ? 420  THR A CB    1 
ATOM   3333 O  OG1   . THR A 1 423 ? 25.821 3.007   5.507   1.00 29.37 ? 420  THR A OG1   1 
ATOM   3334 C  CG2   . THR A 1 423 ? 24.854 4.572   7.070   1.00 30.55 ? 420  THR A CG2   1 
ATOM   3335 N  N     . MET A 1 424 ? 27.057 5.089   2.806   1.00 18.12 ? 421  MET A N     1 
ATOM   3336 C  CA    . MET A 1 424 ? 28.237 5.076   1.945   1.00 19.73 ? 421  MET A CA    1 
ATOM   3337 C  C     . MET A 1 424 ? 27.820 5.204   0.493   1.00 22.67 ? 421  MET A C     1 
ATOM   3338 O  O     . MET A 1 424 ? 26.815 4.618   0.080   1.00 19.74 ? 421  MET A O     1 
ATOM   3339 C  CB    . MET A 1 424 ? 29.037 3.784   2.154   1.00 22.64 ? 421  MET A CB    1 
ATOM   3340 C  CG    . MET A 1 424 ? 30.365 3.712   1.385   1.00 22.28 ? 421  MET A CG    1 
ATOM   3341 S  SD    . MET A 1 424 ? 30.178 3.131   -0.319  1.00 26.34 ? 421  MET A SD    1 
ATOM   3342 C  CE    . MET A 1 424 ? 29.730 1.419   -0.028  1.00 21.73 ? 421  MET A CE    1 
ATOM   3343 N  N     . LEU A 1 425 ? 28.576 5.997   -0.266  1.00 15.01 ? 422  LEU A N     1 
ATOM   3344 C  CA    . LEU A 1 425 ? 28.425 6.091   -1.711  1.00 17.75 ? 422  LEU A CA    1 
ATOM   3345 C  C     . LEU A 1 425 ? 29.809 5.891   -2.318  1.00 18.23 ? 422  LEU A C     1 
ATOM   3346 O  O     . LEU A 1 425 ? 30.805 6.347   -1.758  1.00 18.70 ? 422  LEU A O     1 
ATOM   3347 C  CB    . LEU A 1 425 ? 27.886 7.462   -2.136  1.00 17.42 ? 422  LEU A CB    1 
ATOM   3348 C  CG    . LEU A 1 425 ? 26.491 7.920   -1.713  1.00 26.00 ? 422  LEU A CG    1 
ATOM   3349 C  CD1   . LEU A 1 425 ? 26.228 9.335   -2.238  1.00 21.69 ? 422  LEU A CD1   1 
ATOM   3350 C  CD2   . LEU A 1 425 ? 25.411 6.949   -2.197  1.00 17.24 ? 422  LEU A CD2   1 
ATOM   3351 N  N     . PHE A 1 426 ? 29.867 5.211   -3.459  1.00 14.50 ? 423  PHE A N     1 
ATOM   3352 C  CA    . PHE A 1 426 ? 31.134 4.860   -4.089  1.00 16.54 ? 423  PHE A CA    1 
ATOM   3353 C  C     . PHE A 1 426 ? 30.901 4.806   -5.591  1.00 18.72 ? 423  PHE A C     1 
ATOM   3354 O  O     . PHE A 1 426 ? 29.972 4.136   -6.054  1.00 21.65 ? 423  PHE A O     1 
ATOM   3355 C  CB    . PHE A 1 426 ? 31.603 3.490   -3.571  1.00 19.63 ? 423  PHE A CB    1 
ATOM   3356 C  CG    . PHE A 1 426 ? 32.961 3.065   -4.067  1.00 23.01 ? 423  PHE A CG    1 
ATOM   3357 C  CD1   . PHE A 1 426 ? 33.333 1.733   -4.025  1.00 44.32 ? 423  PHE A CD1   1 
ATOM   3358 C  CD2   . PHE A 1 426 ? 33.877 3.989   -4.549  1.00 22.59 ? 423  PHE A CD2   1 
ATOM   3359 C  CE1   . PHE A 1 426 ? 34.577 1.328   -4.472  1.00 41.98 ? 423  PHE A CE1   1 
ATOM   3360 C  CE2   . PHE A 1 426 ? 35.127 3.589   -4.995  1.00 27.59 ? 423  PHE A CE2   1 
ATOM   3361 C  CZ    . PHE A 1 426 ? 35.475 2.258   -4.956  1.00 33.09 ? 423  PHE A CZ    1 
ATOM   3362 N  N     . LEU A 1 427 ? 31.709 5.552   -6.339  1.00 13.08 ? 424  LEU A N     1 
ATOM   3363 C  CA    . LEU A 1 427 ? 31.712 5.488   -7.792  1.00 16.51 ? 424  LEU A CA    1 
ATOM   3364 C  C     . LEU A 1 427 ? 33.087 5.048   -8.238  1.00 18.97 ? 424  LEU A C     1 
ATOM   3365 O  O     . LEU A 1 427 ? 34.079 5.626   -7.817  1.00 15.14 ? 424  LEU A O     1 
ATOM   3366 C  CB    . LEU A 1 427 ? 31.437 6.856   -8.412  1.00 18.82 ? 424  LEU A CB    1 
ATOM   3367 C  CG    . LEU A 1 427 ? 30.093 7.520   -8.168  1.00 21.61 ? 424  LEU A CG    1 
ATOM   3368 C  CD1   . LEU A 1 427 ? 30.044 8.832   -8.947  1.00 24.43 ? 424  LEU A CD1   1 
ATOM   3369 C  CD2   . LEU A 1 427 ? 28.958 6.599   -8.584  1.00 18.85 ? 424  LEU A CD2   1 
ATOM   3370 N  N     . CYS A 1 428 ? 33.150 4.036   -9.100  1.00 17.71 ? 425  CYS A N     1 
ATOM   3371 C  CA    . CYS A 1 428 ? 34.438 3.525   -9.558  1.00 16.94 ? 425  CYS A CA    1 
ATOM   3372 C  C     . CYS A 1 428 ? 34.459 3.336   -11.077 1.00 24.20 ? 425  CYS A C     1 
ATOM   3373 O  O     . CYS A 1 428 ? 33.573 2.688   -11.645 1.00 19.73 ? 425  CYS A O     1 
ATOM   3374 C  CB    . CYS A 1 428 ? 34.778 2.204   -8.870  1.00 26.77 ? 425  CYS A CB    1 
ATOM   3375 S  SG    . CYS A 1 428 ? 36.473 1.621   -9.193  1.00 25.65 ? 425  CYS A SG    1 
ATOM   3376 N  N     . ALA A 1 429 ? 35.474 3.906   -11.718 1.00 19.58 ? 426  ALA A N     1 
ATOM   3377 C  CA    . ALA A 1 429 ? 35.672 3.743   -13.152 1.00 16.48 ? 426  ALA A CA    1 
ATOM   3378 C  C     . ALA A 1 429 ? 36.613 2.567   -13.391 1.00 20.47 ? 426  ALA A C     1 
ATOM   3379 O  O     . ALA A 1 429 ? 37.704 2.499   -12.813 1.00 18.08 ? 426  ALA A O     1 
ATOM   3380 C  CB    . ALA A 1 429 ? 36.244 5.007   -13.751 1.00 16.44 ? 426  ALA A CB    1 
ATOM   3381 N  N     . THR A 1 430 ? 36.196 1.649   -14.256 1.00 23.63 ? 427  THR A N     1 
ATOM   3382 C  CA    . THR A 1 430 ? 36.934 0.410   -14.454 1.00 23.57 ? 427  THR A CA    1 
ATOM   3383 C  C     . THR A 1 430 ? 36.954 0.026   -15.926 1.00 22.96 ? 427  THR A C     1 
ATOM   3384 O  O     . THR A 1 430 ? 36.327 0.686   -16.751 1.00 18.26 ? 427  THR A O     1 
ATOM   3385 C  CB    . THR A 1 430 ? 36.286 -0.750  -13.665 1.00 21.17 ? 427  THR A CB    1 
ATOM   3386 O  OG1   . THR A 1 430 ? 35.006 -1.054  -14.227 1.00 30.72 ? 427  THR A OG1   1 
ATOM   3387 C  CG2   . THR A 1 430 ? 36.100 -0.375  -12.197 1.00 25.20 ? 427  THR A CG2   1 
ATOM   3388 N  N     . LYS A 1 431 ? 37.654 -1.063  -16.237 1.00 23.32 ? 428  LYS A N     1 
ATOM   3389 C  CA    . LYS A 1 431 ? 37.678 -1.614  -17.592 1.00 27.85 ? 428  LYS A CA    1 
ATOM   3390 C  C     . LYS A 1 431 ? 38.228 -0.619  -18.615 1.00 19.79 ? 428  LYS A C     1 
ATOM   3391 O  O     . LYS A 1 431 ? 37.520 -0.178  -19.525 1.00 22.19 ? 428  LYS A O     1 
ATOM   3392 C  CB    . LYS A 1 431 ? 36.292 -2.101  -18.002 1.00 21.16 ? 428  LYS A CB    1 
ATOM   3393 C  CG    . LYS A 1 431 ? 35.778 -3.250  -17.145 1.00 36.96 ? 428  LYS A CG    1 
ATOM   3394 C  CD    . LYS A 1 431 ? 34.500 -3.846  -17.723 1.00 41.14 ? 428  LYS A CD    1 
ATOM   3395 C  CE    . LYS A 1 431 ? 33.990 -5.001  -16.871 1.00 48.97 ? 428  LYS A CE    1 
ATOM   3396 N  NZ    . LYS A 1 431 ? 35.066 -5.976  -16.549 1.00 41.89 ? 428  LYS A NZ    1 
ATOM   3397 N  N     . PHE A 1 432 ? 39.498 -0.273  -18.449 1.00 25.15 ? 429  PHE A N     1 
ATOM   3398 C  CA    . PHE A 1 432 ? 40.146 0.710   -19.304 1.00 19.64 ? 429  PHE A CA    1 
ATOM   3399 C  C     . PHE A 1 432 ? 40.480 0.109   -20.663 1.00 26.41 ? 429  PHE A C     1 
ATOM   3400 O  O     . PHE A 1 432 ? 40.774 -1.083  -20.769 1.00 25.45 ? 429  PHE A O     1 
ATOM   3401 C  CB    . PHE A 1 432 ? 41.419 1.244   -18.633 1.00 19.48 ? 429  PHE A CB    1 
ATOM   3402 C  CG    . PHE A 1 432 ? 41.150 2.242   -17.538 1.00 23.66 ? 429  PHE A CG    1 
ATOM   3403 C  CD1   . PHE A 1 432 ? 41.135 3.599   -17.807 1.00 19.81 ? 429  PHE A CD1   1 
ATOM   3404 C  CD2   . PHE A 1 432 ? 40.888 1.819   -16.244 1.00 29.61 ? 429  PHE A CD2   1 
ATOM   3405 C  CE1   . PHE A 1 432 ? 40.874 4.523   -16.806 1.00 19.77 ? 429  PHE A CE1   1 
ATOM   3406 C  CE2   . PHE A 1 432 ? 40.629 2.735   -15.236 1.00 29.40 ? 429  PHE A CE2   1 
ATOM   3407 C  CZ    . PHE A 1 432 ? 40.621 4.091   -15.518 1.00 25.67 ? 429  PHE A CZ    1 
ATOM   3408 N  N     . SER A 1 433 ? 40.409 0.946   -21.695 1.00 28.85 ? 430  SER A N     1 
ATOM   3409 C  CA    . SER A 1 433 ? 40.833 0.584   -23.044 1.00 29.55 ? 430  SER A CA    1 
ATOM   3410 C  C     . SER A 1 433 ? 41.786 1.656   -23.554 1.00 31.04 ? 430  SER A C     1 
ATOM   3411 O  O     . SER A 1 433 ? 41.712 2.811   -23.134 1.00 26.13 ? 430  SER A O     1 
ATOM   3412 C  CB    . SER A 1 433 ? 39.629 0.494   -23.986 1.00 31.18 ? 430  SER A CB    1 
ATOM   3413 O  OG    . SER A 1 433 ? 38.674 -0.442  -23.524 1.00 42.16 ? 430  SER A OG    1 
ATOM   3414 N  N     . ALA A 1 434 ? 42.684 1.278   -24.457 1.00 29.81 ? 431  ALA A N     1 
ATOM   3415 C  CA    . ALA A 1 434 ? 43.641 2.226   -25.006 1.00 26.19 ? 431  ALA A CA    1 
ATOM   3416 C  C     . ALA A 1 434 ? 42.903 3.302   -25.778 1.00 31.38 ? 431  ALA A C     1 
ATOM   3417 O  O     . ALA A 1 434 ? 41.833 3.050   -26.336 1.00 37.93 ? 431  ALA A O     1 
ATOM   3418 C  CB    . ALA A 1 434 ? 44.646 1.520   -25.903 1.00 33.36 ? 431  ALA A CB    1 
ATOM   3419 N  N     . SER A 1 435 ? 43.469 4.505   -25.792 1.00 28.13 ? 432  SER A N     1 
ATOM   3420 C  CA    . SER A 1 435 ? 42.894 5.615   -26.544 1.00 39.28 ? 432  SER A CA    1 
ATOM   3421 C  C     . SER A 1 435 ? 43.997 6.475   -27.151 1.00 39.33 ? 432  SER A C     1 
ATOM   3422 O  O     . SER A 1 435 ? 43.770 7.621   -27.533 1.00 50.93 ? 432  SER A O     1 
ATOM   3423 C  CB    . SER A 1 435 ? 41.992 6.464   -25.648 1.00 37.09 ? 432  SER A CB    1 
ATOM   3424 O  OG    . SER A 1 435 ? 42.722 6.985   -24.551 1.00 45.78 ? 432  SER A OG    1 
ATOM   3425 O  OXT   . SER A 1 435 ? 45.147 6.047   -27.267 1.00 45.94 ? 432  SER A OXT   1 
ATOM   3426 O  "O3'" . DC  B 2 1   ? 28.042 4.742   11.713  1.00 45.99 ? 1    DC  T "O3'" 1 
ATOM   3427 P  P     . DA  B 2 2   ? 28.377 4.401   13.249  1.00 74.18 ? 2    DA  T P     1 
ATOM   3428 O  OP1   . DA  B 2 2   ? 28.348 2.926   13.408  1.00 62.96 ? 2    DA  T OP1   1 
ATOM   3429 O  OP2   . DA  B 2 2   ? 27.520 5.257   14.104  1.00 57.54 ? 2    DA  T OP2   1 
ATOM   3430 O  "O5'" . DA  B 2 2   ? 29.880 4.922   13.432  1.00 53.27 ? 2    DA  T "O5'" 1 
ATOM   3431 C  "C5'" . DA  B 2 2   ? 30.918 4.519   12.551  1.00 47.09 ? 2    DA  T "C5'" 1 
ATOM   3432 C  "C4'" . DA  B 2 2   ? 32.176 5.295   12.886  1.00 45.92 ? 2    DA  T "C4'" 1 
ATOM   3433 O  "O4'" . DA  B 2 2   ? 31.970 6.692   12.570  1.00 44.97 ? 2    DA  T "O4'" 1 
ATOM   3434 C  "C3'" . DA  B 2 2   ? 32.562 5.258   14.361  1.00 49.26 ? 2    DA  T "C3'" 1 
ATOM   3435 O  "O3'" . DA  B 2 2   ? 33.976 5.220   14.480  1.00 49.61 ? 2    DA  T "O3'" 1 
ATOM   3436 C  "C2'" . DA  B 2 2   ? 31.984 6.555   14.922  1.00 42.01 ? 2    DA  T "C2'" 1 
ATOM   3437 C  "C1'" . DA  B 2 2   ? 32.120 7.490   13.729  1.00 38.70 ? 2    DA  T "C1'" 1 
ATOM   3438 N  N9    . DA  B 2 2   ? 31.088 8.522   13.687  1.00 34.65 ? 2    DA  T N9    1 
ATOM   3439 C  C8    . DA  B 2 2   ? 29.828 8.458   14.215  1.00 36.65 ? 2    DA  T C8    1 
ATOM   3440 N  N7    . DA  B 2 2   ? 29.115 9.541   14.015  1.00 37.77 ? 2    DA  T N7    1 
ATOM   3441 C  C5    . DA  B 2 2   ? 29.968 10.368  13.304  1.00 30.82 ? 2    DA  T C5    1 
ATOM   3442 C  C6    . DA  B 2 2   ? 29.820 11.669  12.782  1.00 37.08 ? 2    DA  T C6    1 
ATOM   3443 N  N6    . DA  B 2 2   ? 28.699 12.391  12.905  1.00 35.20 ? 2    DA  T N6    1 
ATOM   3444 N  N1    . DA  B 2 2   ? 30.872 12.198  12.123  1.00 36.78 ? 2    DA  T N1    1 
ATOM   3445 C  C2    . DA  B 2 2   ? 31.993 11.480  11.998  1.00 27.51 ? 2    DA  T C2    1 
ATOM   3446 N  N3    . DA  B 2 2   ? 32.249 10.252  12.446  1.00 36.90 ? 2    DA  T N3    1 
ATOM   3447 C  C4    . DA  B 2 2   ? 31.188 9.753   13.096  1.00 33.32 ? 2    DA  T C4    1 
ATOM   3448 P  P     . DT  B 2 3   ? 34.705 3.872   14.958  1.00 50.56 ? 3    DT  T P     1 
ATOM   3449 O  OP1   . DT  B 2 3   ? 33.658 2.883   15.293  1.00 53.20 ? 3    DT  T OP1   1 
ATOM   3450 O  OP2   . DT  B 2 3   ? 35.749 4.243   15.939  1.00 51.84 ? 3    DT  T OP2   1 
ATOM   3451 O  "O5'" . DT  B 2 3   ? 35.450 3.358   13.643  1.00 51.32 ? 3    DT  T "O5'" 1 
ATOM   3452 C  "C5'" . DT  B 2 3   ? 36.798 3.715   13.406  1.00 51.17 ? 3    DT  T "C5'" 1 
ATOM   3453 C  "C4'" . DT  B 2 3   ? 36.841 4.839   12.396  1.00 46.47 ? 3    DT  T "C4'" 1 
ATOM   3454 O  "O4'" . DT  B 2 3   ? 38.219 5.121   12.057  1.00 54.81 ? 3    DT  T "O4'" 1 
ATOM   3455 C  "C3'" . DT  B 2 3   ? 36.110 4.529   11.094  1.00 53.84 ? 3    DT  T "C3'" 1 
ATOM   3456 O  "O3'" . DT  B 2 3   ? 35.237 5.605   10.788  1.00 39.61 ? 3    DT  T "O3'" 1 
ATOM   3457 C  "C2'" . DT  B 2 3   ? 37.214 4.368   10.052  1.00 43.43 ? 3    DT  T "C2'" 1 
ATOM   3458 C  "C1'" . DT  B 2 3   ? 38.396 5.119   10.653  1.00 51.16 ? 3    DT  T "C1'" 1 
ATOM   3459 N  N1    . DT  B 2 3   ? 39.708 4.459   10.407  1.00 51.19 ? 3    DT  T N1    1 
ATOM   3460 C  C2    . DT  B 2 3   ? 40.737 5.162   9.811   1.00 44.60 ? 3    DT  T C2    1 
ATOM   3461 O  O2    . DT  B 2 3   ? 40.639 6.322   9.450   1.00 47.90 ? 3    DT  T O2    1 
ATOM   3462 N  N3    . DT  B 2 3   ? 41.898 4.448   9.648   1.00 38.96 ? 3    DT  T N3    1 
ATOM   3463 C  C4    . DT  B 2 3   ? 42.121 3.131   10.014  1.00 42.70 ? 3    DT  T C4    1 
ATOM   3464 O  O4    . DT  B 2 3   ? 43.200 2.576   9.827   1.00 48.40 ? 3    DT  T O4    1 
ATOM   3465 C  C5    . DT  B 2 3   ? 41.002 2.455   10.632  1.00 47.07 ? 3    DT  T C5    1 
ATOM   3466 C  C7    . DT  B 2 3   ? 41.120 1.024   11.077  1.00 52.05 ? 3    DT  T C7    1 
ATOM   3467 C  C6    . DT  B 2 3   ? 39.866 3.145   10.801  1.00 46.03 ? 3    DT  T C6    1 
ATOM   3468 P  P     . DT  B 2 4   ? 34.491 5.657   9.369   1.00 53.20 ? 4    DT  T P     1 
ATOM   3469 O  OP1   . DT  B 2 4   ? 33.374 6.620   9.479   1.00 44.25 ? 4    DT  T OP1   1 
ATOM   3470 O  OP2   . DT  B 2 4   ? 34.265 4.266   8.923   1.00 49.24 ? 4    DT  T OP2   1 
ATOM   3471 O  "O5'" . DT  B 2 4   ? 35.590 6.289   8.390   1.00 42.00 ? 4    DT  T "O5'" 1 
ATOM   3472 C  "C5'" . DT  B 2 4   ? 36.007 7.639   8.545   1.00 31.54 ? 4    DT  T "C5'" 1 
ATOM   3473 C  "C4'" . DT  B 2 4   ? 36.741 8.065   7.291   1.00 24.00 ? 4    DT  T "C4'" 1 
ATOM   3474 O  "O4'" . DT  B 2 4   ? 37.996 7.360   7.163   1.00 23.64 ? 4    DT  T "O4'" 1 
ATOM   3475 C  "C3'" . DT  B 2 4   ? 36.000 7.764   5.997   1.00 20.55 ? 4    DT  T "C3'" 1 
ATOM   3476 O  "O3'" . DT  B 2 4   ? 36.333 8.809   5.135   1.00 21.32 ? 4    DT  T "O3'" 1 
ATOM   3477 C  "C2'" . DT  B 2 4   ? 36.584 6.436   5.522   1.00 24.69 ? 4    DT  T "C2'" 1 
ATOM   3478 C  "C1'" . DT  B 2 4   ? 38.027 6.629   5.950   1.00 27.15 ? 4    DT  T "C1'" 1 
ATOM   3479 N  N1    . DT  B 2 4   ? 38.767 5.383   6.250   1.00 24.48 ? 4    DT  T N1    1 
ATOM   3480 C  C2    . DT  B 2 4   ? 40.082 5.350   5.882   1.00 23.26 ? 4    DT  T C2    1 
ATOM   3481 O  O2    . DT  B 2 4   ? 40.632 6.282   5.323   1.00 19.84 ? 4    DT  T O2    1 
ATOM   3482 N  N3    . DT  B 2 4   ? 40.719 4.183   6.198   1.00 26.28 ? 4    DT  T N3    1 
ATOM   3483 C  C4    . DT  B 2 4   ? 40.181 3.089   6.839   1.00 23.25 ? 4    DT  T C4    1 
ATOM   3484 O  O4    . DT  B 2 4   ? 40.845 2.098   7.079   1.00 23.35 ? 4    DT  T O4    1 
ATOM   3485 C  C5    . DT  B 2 4   ? 38.794 3.193   7.206   1.00 30.85 ? 4    DT  T C5    1 
ATOM   3486 C  C7    . DT  B 2 4   ? 38.115 2.049   7.905   1.00 29.14 ? 4    DT  T C7    1 
ATOM   3487 C  C6    . DT  B 2 4   ? 38.155 4.329   6.901   1.00 26.10 ? 4    DT  T C6    1 
ATOM   3488 P  P     . DA  B 2 5   ? 35.669 8.896   3.690   1.00 17.54 ? 5    DA  T P     1 
ATOM   3489 O  OP1   . DA  B 2 5   ? 35.358 10.304  3.427   1.00 18.08 ? 5    DA  T OP1   1 
ATOM   3490 O  OP2   . DA  B 2 5   ? 34.607 7.874   3.608   1.00 19.25 ? 5    DA  T OP2   1 
ATOM   3491 O  "O5'" . DA  B 2 5   ? 36.855 8.423   2.722   1.00 16.44 ? 5    DA  T "O5'" 1 
ATOM   3492 C  "C5'" . DA  B 2 5   ? 38.018 9.247   2.600   1.00 14.48 ? 5    DA  T "C5'" 1 
ATOM   3493 C  "C4'" . DA  B 2 5   ? 38.955 8.617   1.595   1.00 14.52 ? 5    DA  T "C4'" 1 
ATOM   3494 O  "O4'" . DA  B 2 5   ? 39.517 7.387   2.127   1.00 17.37 ? 5    DA  T "O4'" 1 
ATOM   3495 C  "C3'" . DA  B 2 5   ? 38.268 8.236   0.285   1.00 15.33 ? 5    DA  T "C3'" 1 
ATOM   3496 O  "O3'" . DA  B 2 5   ? 39.192 8.460   -0.760  1.00 14.86 ? 5    DA  T "O3'" 1 
ATOM   3497 C  "C2'" . DA  B 2 5   ? 38.006 6.751   0.476   1.00 18.69 ? 5    DA  T "C2'" 1 
ATOM   3498 C  "C1'" . DA  B 2 5   ? 39.296 6.351   1.199   1.00 21.04 ? 5    DA  T "C1'" 1 
ATOM   3499 N  N9    . DA  B 2 5   ? 39.207 5.103   1.947   1.00 15.61 ? 5    DA  T N9    1 
ATOM   3500 C  C8    . DA  B 2 5   ? 38.097 4.570   2.529   1.00 18.91 ? 5    DA  T C8    1 
ATOM   3501 N  N7    . DA  B 2 5   ? 38.316 3.432   3.143   1.00 20.66 ? 5    DA  T N7    1 
ATOM   3502 C  C5    . DA  B 2 5   ? 39.669 3.208   2.949   1.00 17.23 ? 5    DA  T C5    1 
ATOM   3503 C  C6    . DA  B 2 5   ? 40.513 2.159   3.350   1.00 20.27 ? 5    DA  T C6    1 
ATOM   3504 N  N6    . DA  B 2 5   ? 40.078 1.115   4.064   1.00 18.04 ? 5    DA  T N6    1 
ATOM   3505 N  N1    . DA  B 2 5   ? 41.810 2.230   2.987   1.00 20.04 ? 5    DA  T N1    1 
ATOM   3506 C  C2    . DA  B 2 5   ? 42.237 3.282   2.272   1.00 19.18 ? 5    DA  T C2    1 
ATOM   3507 N  N3    . DA  B 2 5   ? 41.530 4.323   1.839   1.00 14.71 ? 5    DA  T N3    1 
ATOM   3508 C  C4    . DA  B 2 5   ? 40.240 4.223   2.215   1.00 17.67 ? 5    DA  T C4    1 
ATOM   3509 P  P     . DT  B 2 6   ? 38.703 8.501   -2.288  1.00 15.48 ? 6    DT  T P     1 
ATOM   3510 O  OP1   . DT  B 2 6   ? 39.843 8.943   -3.104  1.00 18.22 ? 6    DT  T OP1   1 
ATOM   3511 O  OP2   . DT  B 2 6   ? 37.402 9.202   -2.342  1.00 15.13 ? 6    DT  T OP2   1 
ATOM   3512 O  "O5'" . DT  B 2 6   ? 38.337 6.974   -2.609  1.00 18.68 ? 6    DT  T "O5'" 1 
ATOM   3513 C  "C5'" . DT  B 2 6   ? 39.089 6.162   -3.493  1.00 23.58 ? 6    DT  T "C5'" 1 
ATOM   3514 C  "C4'" . DT  B 2 6   ? 40.334 5.545   -2.878  1.00 20.90 ? 6    DT  T "C4'" 1 
ATOM   3515 O  "O4'" . DT  B 2 6   ? 40.049 4.826   -1.653  1.00 20.37 ? 6    DT  T "O4'" 1 
ATOM   3516 C  "C3'" . DT  B 2 6   ? 40.869 4.479   -3.818  1.00 22.25 ? 6    DT  T "C3'" 1 
ATOM   3517 O  "O3'" . DT  B 2 6   ? 41.895 5.056   -4.555  1.00 22.37 ? 6    DT  T "O3'" 1 
ATOM   3518 C  "C2'" . DT  B 2 6   ? 41.397 3.336   -2.952  1.00 28.49 ? 6    DT  T "C2'" 1 
ATOM   3519 C  "C1'" . DT  B 2 6   ? 40.921 3.719   -1.561  1.00 21.97 ? 6    DT  T "C1'" 1 
ATOM   3520 N  N1    . DT  B 2 6   ? 40.204 2.659   -0.849  1.00 20.18 ? 6    DT  T N1    1 
ATOM   3521 C  C2    . DT  B 2 6   ? 40.926 1.588   -0.379  1.00 15.16 ? 6    DT  T C2    1 
ATOM   3522 O  O2    . DT  B 2 6   ? 42.122 1.467   -0.553  1.00 20.81 ? 6    DT  T O2    1 
ATOM   3523 N  N3    . DT  B 2 6   ? 40.182 0.672   0.312   1.00 15.52 ? 6    DT  T N3    1 
ATOM   3524 C  C4    . DT  B 2 6   ? 38.838 0.719   0.585   1.00 18.72 ? 6    DT  T C4    1 
ATOM   3525 O  O4    . DT  B 2 6   ? 38.278 -0.162  1.228   1.00 17.68 ? 6    DT  T O4    1 
ATOM   3526 C  C5    . DT  B 2 6   ? 38.143 1.871   0.073   1.00 26.37 ? 6    DT  T C5    1 
ATOM   3527 C  C7    . DT  B 2 6   ? 36.667 2.012   0.310   1.00 26.22 ? 6    DT  T C7    1 
ATOM   3528 C  C6    . DT  B 2 6   ? 38.853 2.781   -0.612  1.00 20.40 ? 6    DT  T C6    1 
ATOM   3529 P  P     . DG  B 2 7   ? 42.105 4.650   -6.085  1.00 18.73 ? 7    DG  T P     1 
ATOM   3530 O  OP1   . DG  B 2 7   ? 43.261 5.407   -6.588  1.00 22.92 ? 7    DG  T OP1   1 
ATOM   3531 O  OP2   . DG  B 2 7   ? 40.786 4.660   -6.751  1.00 17.39 ? 7    DG  T OP2   1 
ATOM   3532 O  "O5'" . DG  B 2 7   ? 42.483 3.089   -6.017  1.00 28.63 ? 7    DG  T "O5'" 1 
ATOM   3533 C  "C5'" . DG  B 2 7   ? 43.821 2.661   -5.825  1.00 27.85 ? 7    DG  T "C5'" 1 
ATOM   3534 C  "C4'" . DG  B 2 7   ? 43.835 1.152   -5.666  1.00 16.82 ? 7    DG  T "C4'" 1 
ATOM   3535 O  "O4'" . DG  B 2 7   ? 43.050 0.785   -4.516  1.00 23.36 ? 7    DG  T "O4'" 1 
ATOM   3536 C  "C3'" . DG  B 2 7   ? 43.211 0.372   -6.825  1.00 30.05 ? 7    DG  T "C3'" 1 
ATOM   3537 O  "O3'" . DG  B 2 7   ? 44.246 -0.306  -7.500  1.00 24.07 ? 7    DG  T "O3'" 1 
ATOM   3538 C  "C2'" . DG  B 2 7   ? 42.240 -0.606  -6.164  1.00 26.21 ? 7    DG  T "C2'" 1 
ATOM   3539 C  "C1'" . DG  B 2 7   ? 42.683 -0.557  -4.709  1.00 25.70 ? 7    DG  T "C1'" 1 
ATOM   3540 N  N9    . DG  B 2 7   ? 41.608 -0.926  -3.796  1.00 23.75 ? 7    DG  T N9    1 
ATOM   3541 C  C8    . DG  B 2 7   ? 40.401 -0.297  -3.623  1.00 16.30 ? 7    DG  T C8    1 
ATOM   3542 N  N7    . DG  B 2 7   ? 39.640 -0.879  -2.734  1.00 20.26 ? 7    DG  T N7    1 
ATOM   3543 C  C5    . DG  B 2 7   ? 40.394 -1.961  -2.303  1.00 21.74 ? 7    DG  T C5    1 
ATOM   3544 C  C6    . DG  B 2 7   ? 40.093 -2.956  -1.352  1.00 16.09 ? 7    DG  T C6    1 
ATOM   3545 O  O6    . DG  B 2 7   ? 39.072 -3.084  -0.668  1.00 17.45 ? 7    DG  T O6    1 
ATOM   3546 N  N1    . DG  B 2 7   ? 41.139 -3.866  -1.221  1.00 17.87 ? 7    DG  T N1    1 
ATOM   3547 C  C2    . DG  B 2 7   ? 42.321 -3.826  -1.912  1.00 18.12 ? 7    DG  T C2    1 
ATOM   3548 N  N2    . DG  B 2 7   ? 43.205 -4.803  -1.641  1.00 21.53 ? 7    DG  T N2    1 
ATOM   3549 N  N3    . DG  B 2 7   ? 42.617 -2.894  -2.811  1.00 22.44 ? 7    DG  T N3    1 
ATOM   3550 C  C4    . DG  B 2 7   ? 41.607 -2.003  -2.944  1.00 19.98 ? 7    DG  T C4    1 
ATOM   3551 P  P     . DA  B 2 8   ? 43.918 -1.302  -8.717  1.00 23.57 ? 8    DA  T P     1 
ATOM   3552 O  OP1   . DA  B 2 8   ? 44.910 -1.059  -9.774  1.00 25.86 ? 8    DA  T OP1   1 
ATOM   3553 O  OP2   . DA  B 2 8   ? 42.463 -1.247  -8.994  1.00 26.97 ? 8    DA  T OP2   1 
ATOM   3554 O  "O5'" . DA  B 2 8   ? 44.244 -2.749  -8.111  1.00 25.31 ? 8    DA  T "O5'" 1 
ATOM   3555 C  "C5'" . DA  B 2 8   ? 45.523 -3.021  -7.533  1.00 20.77 ? 8    DA  T "C5'" 1 
ATOM   3556 C  "C4'" . DA  B 2 8   ? 45.608 -4.488  -7.175  1.00 25.26 ? 8    DA  T "C4'" 1 
ATOM   3557 O  "O4'" . DA  B 2 8   ? 44.711 -4.706  -6.061  1.00 31.67 ? 8    DA  T "O4'" 1 
ATOM   3558 C  "C3'" . DA  B 2 8   ? 45.140 -5.404  -8.303  1.00 27.00 ? 8    DA  T "C3'" 1 
ATOM   3559 O  "O3'" . DA  B 2 8   ? 45.888 -6.601  -8.360  1.00 23.81 ? 8    DA  T "O3'" 1 
ATOM   3560 C  "C2'" . DA  B 2 8   ? 43.703 -5.703  -7.919  1.00 25.36 ? 8    DA  T "C2'" 1 
ATOM   3561 C  "C1'" . DA  B 2 8   ? 43.781 -5.702  -6.398  1.00 33.41 ? 8    DA  T "C1'" 1 
ATOM   3562 N  N9    . DA  B 2 8   ? 42.483 -5.363  -5.841  1.00 28.63 ? 8    DA  T N9    1 
ATOM   3563 C  C8    . DA  B 2 8   ? 41.684 -4.338  -6.265  1.00 27.94 ? 8    DA  T C8    1 
ATOM   3564 N  N7    . DA  B 2 8   ? 40.560 -4.256  -5.610  1.00 18.76 ? 8    DA  T N7    1 
ATOM   3565 C  C5    . DA  B 2 8   ? 40.620 -5.294  -4.703  1.00 22.46 ? 8    DA  T C5    1 
ATOM   3566 C  C6    . DA  B 2 8   ? 39.714 -5.732  -3.722  1.00 17.57 ? 8    DA  T C6    1 
ATOM   3567 N  N6    . DA  B 2 8   ? 38.526 -5.142  -3.505  1.00 17.00 ? 8    DA  T N6    1 
ATOM   3568 N  N1    . DA  B 2 8   ? 40.075 -6.813  -2.987  1.00 18.08 ? 8    DA  T N1    1 
ATOM   3569 C  C2    . DA  B 2 8   ? 41.258 -7.393  -3.221  1.00 18.10 ? 8    DA  T C2    1 
ATOM   3570 N  N3    . DA  B 2 8   ? 42.196 -7.071  -4.115  1.00 18.61 ? 8    DA  T N3    1 
ATOM   3571 C  C4    . DA  B 2 8   ? 41.803 -5.999  -4.832  1.00 23.54 ? 8    DA  T C4    1 
ATOM   3572 P  P     . DC  B 2 9   ? 45.661 -7.638  -9.568  1.00 31.93 ? 9    DC  T P     1 
ATOM   3573 O  OP1   . DC  B 2 9   ? 46.985 -8.118  -10.002 1.00 29.72 ? 9    DC  T OP1   1 
ATOM   3574 O  OP2   . DC  B 2 9   ? 44.746 -7.015  -10.551 1.00 38.06 ? 9    DC  T OP2   1 
ATOM   3575 O  "O5'" . DC  B 2 9   ? 44.846 -8.837  -8.886  1.00 23.93 ? 9    DC  T "O5'" 1 
ATOM   3576 C  "C5'" . DC  B 2 9   ? 45.432 -9.491  -7.779  1.00 31.63 ? 9    DC  T "C5'" 1 
ATOM   3577 C  "C4'" . DC  B 2 9   ? 44.392 -10.365 -7.127  1.00 23.44 ? 9    DC  T "C4'" 1 
ATOM   3578 O  "O4'" . DC  B 2 9   ? 43.312 -9.546  -6.614  1.00 27.75 ? 9    DC  T "O4'" 1 
ATOM   3579 C  "C3'" . DC  B 2 9   ? 43.742 -11.354 -8.085  1.00 31.86 ? 9    DC  T "C3'" 1 
ATOM   3580 O  "O3'" . DC  B 2 9   ? 43.784 -12.609 -7.465  1.00 32.10 ? 9    DC  T "O3'" 1 
ATOM   3581 C  "C2'" . DC  B 2 9   ? 42.306 -10.860 -8.208  1.00 25.10 ? 9    DC  T "C2'" 1 
ATOM   3582 C  "C1'" . DC  B 2 9   ? 42.106 -10.232 -6.838  1.00 29.57 ? 9    DC  T "C1'" 1 
ATOM   3583 N  N1    . DC  B 2 9   ? 40.969 -9.277  -6.795  1.00 24.44 ? 9    DC  T N1    1 
ATOM   3584 C  C2    . DC  B 2 9   ? 40.036 -9.398  -5.773  1.00 21.05 ? 9    DC  T C2    1 
ATOM   3585 O  O2    . DC  B 2 9   ? 40.197 -10.294 -4.932  1.00 24.41 ? 9    DC  T O2    1 
ATOM   3586 N  N3    . DC  B 2 9   ? 38.981 -8.543  -5.741  1.00 21.10 ? 9    DC  T N3    1 
ATOM   3587 C  C4    . DC  B 2 9   ? 38.853 -7.592  -6.672  1.00 21.76 ? 9    DC  T C4    1 
ATOM   3588 N  N4    . DC  B 2 9   ? 37.801 -6.773  -6.587  1.00 20.14 ? 9    DC  T N4    1 
ATOM   3589 C  C5    . DC  B 2 9   ? 39.795 -7.456  -7.731  1.00 24.92 ? 9    DC  T C5    1 
ATOM   3590 C  C6    . DC  B 2 9   ? 40.829 -8.313  -7.754  1.00 27.70 ? 9    DC  T C6    1 
ATOM   3591 P  P     . DG  B 2 10  ? 43.415 -13.937 -8.289  1.00 31.15 ? 10   DG  T P     1 
ATOM   3592 O  OP1   . DG  B 2 10  ? 44.623 -14.781 -8.347  1.00 39.43 ? 10   DG  T OP1   1 
ATOM   3593 O  OP2   . DG  B 2 10  ? 42.726 -13.538 -9.538  1.00 27.87 ? 10   DG  T OP2   1 
ATOM   3594 O  "O5'" . DG  B 2 10  ? 42.337 -14.645 -7.362  1.00 27.01 ? 10   DG  T "O5'" 1 
ATOM   3595 C  "C5'" . DG  B 2 10  ? 42.531 -14.632 -5.962  1.00 28.13 ? 10   DG  T "C5'" 1 
ATOM   3596 C  "C4'" . DG  B 2 10  ? 41.340 -15.291 -5.307  1.00 22.81 ? 10   DG  T "C4'" 1 
ATOM   3597 O  "O4'" . DG  B 2 10  ? 40.297 -14.309 -5.112  1.00 28.71 ? 10   DG  T "O4'" 1 
ATOM   3598 C  "C3'" . DG  B 2 10  ? 40.716 -16.413 -6.131  1.00 29.70 ? 10   DG  T "C3'" 1 
ATOM   3599 O  "O3'" . DG  B 2 10  ? 40.221 -17.380 -5.222  1.00 37.63 ? 10   DG  T "O3'" 1 
ATOM   3600 C  "C2'" . DG  B 2 10  ? 39.606 -15.692 -6.891  1.00 29.57 ? 10   DG  T "C2'" 1 
ATOM   3601 C  "C1'" . DG  B 2 10  ? 39.155 -14.663 -5.863  1.00 29.64 ? 10   DG  T "C1'" 1 
ATOM   3602 N  N9    . DG  B 2 10  ? 38.584 -13.458 -6.461  1.00 22.41 ? 10   DG  T N9    1 
ATOM   3603 C  C8    . DG  B 2 10  ? 39.158 -12.642 -7.408  1.00 25.47 ? 10   DG  T C8    1 
ATOM   3604 N  N7    . DG  B 2 10  ? 38.403 -11.637 -7.750  1.00 24.32 ? 10   DG  T N7    1 
ATOM   3605 C  C5    . DG  B 2 10  ? 37.258 -11.794 -6.982  1.00 23.42 ? 10   DG  T C5    1 
ATOM   3606 C  C6    . DG  B 2 10  ? 36.086 -11.004 -6.924  1.00 20.04 ? 10   DG  T C6    1 
ATOM   3607 O  O6    . DG  B 2 10  ? 35.828 -9.974  -7.562  1.00 24.76 ? 10   DG  T O6    1 
ATOM   3608 N  N1    . DG  B 2 10  ? 35.165 -11.516 -6.003  1.00 27.45 ? 10   DG  T N1    1 
ATOM   3609 C  C2    . DG  B 2 10  ? 35.353 -12.653 -5.245  1.00 23.87 ? 10   DG  T C2    1 
ATOM   3610 N  N2    . DG  B 2 10  ? 34.355 -12.990 -4.412  1.00 26.70 ? 10   DG  T N2    1 
ATOM   3611 N  N3    . DG  B 2 10  ? 36.446 -13.405 -5.287  1.00 21.25 ? 10   DG  T N3    1 
ATOM   3612 C  C4    . DG  B 2 10  ? 37.356 -12.909 -6.173  1.00 23.20 ? 10   DG  T C4    1 
ATOM   3613 P  P     . DC  B 2 11  ? 39.564 -18.744 -5.760  1.00 36.90 ? 11   DC  T P     1 
ATOM   3614 O  OP1   . DC  B 2 11  ? 40.032 -19.845 -4.896  1.00 39.46 ? 11   DC  T OP1   1 
ATOM   3615 O  OP2   . DC  B 2 11  ? 39.794 -18.824 -7.214  1.00 28.85 ? 11   DC  T OP2   1 
ATOM   3616 O  "O5'" . DC  B 2 11  ? 38.001 -18.502 -5.554  1.00 29.20 ? 11   DC  T "O5'" 1 
ATOM   3617 C  "C5'" . DC  B 2 11  ? 37.433 -18.355 -4.271  1.00 31.05 ? 11   DC  T "C5'" 1 
ATOM   3618 C  "C4'" . DC  B 2 11  ? 35.921 -18.265 -4.413  1.00 28.87 ? 11   DC  T "C4'" 1 
ATOM   3619 O  "O4'" . DC  B 2 11  ? 35.552 -17.000 -5.023  1.00 23.09 ? 11   DC  T "O4'" 1 
ATOM   3620 C  "C3'" . DC  B 2 11  ? 35.277 -19.362 -5.266  1.00 21.06 ? 11   DC  T "C3'" 1 
ATOM   3621 O  "O3'" . DC  B 2 11  ? 34.202 -19.901 -4.503  1.00 19.99 ? 11   DC  T "O3'" 1 
ATOM   3622 C  "C2'" . DC  B 2 11  ? 34.792 -18.636 -6.524  1.00 18.29 ? 11   DC  T "C2'" 1 
ATOM   3623 C  "C1'" . DC  B 2 11  ? 34.567 -17.214 -6.021  1.00 22.60 ? 11   DC  T "C1'" 1 
ATOM   3624 N  N1    . DC  B 2 11  ? 34.757 -16.121 -7.028  1.00 16.92 ? 11   DC  T N1    1 
ATOM   3625 C  C2    . DC  B 2 11  ? 33.736 -15.185 -7.243  1.00 19.66 ? 11   DC  T C2    1 
ATOM   3626 O  O2    . DC  B 2 11  ? 32.672 -15.287 -6.623  1.00 19.64 ? 11   DC  T O2    1 
ATOM   3627 N  N3    . DC  B 2 11  ? 33.930 -14.177 -8.144  1.00 18.59 ? 11   DC  T N3    1 
ATOM   3628 C  C4    . DC  B 2 11  ? 35.080 -14.105 -8.812  1.00 18.52 ? 11   DC  T C4    1 
ATOM   3629 N  N4    . DC  B 2 11  ? 35.212 -13.097 -9.684  1.00 19.15 ? 11   DC  T N4    1 
ATOM   3630 C  C5    . DC  B 2 11  ? 36.136 -15.042 -8.604  1.00 16.94 ? 11   DC  T C5    1 
ATOM   3631 C  C6    . DC  B 2 11  ? 35.938 -16.028 -7.707  1.00 15.58 ? 11   DC  T C6    1 
ATOM   3632 P  P     . DT  B 2 12  ? 33.500 -21.275 -4.943  1.00 20.35 ? 12   DT  T P     1 
ATOM   3633 O  OP1   . DT  B 2 12  ? 32.974 -21.927 -3.721  1.00 21.40 ? 12   DT  T OP1   1 
ATOM   3634 O  OP2   . DT  B 2 12  ? 34.426 -22.000 -5.830  1.00 18.68 ? 12   DT  T OP2   1 
ATOM   3635 O  "O5'" . DT  B 2 12  ? 32.254 -20.786 -5.811  1.00 22.45 ? 12   DT  T "O5'" 1 
ATOM   3636 C  "C5'" . DT  B 2 12  ? 31.140 -20.191 -5.158  1.00 18.91 ? 12   DT  T "C5'" 1 
ATOM   3637 C  "C4'" . DT  B 2 12  ? 30.186 -19.692 -6.214  1.00 22.93 ? 12   DT  T "C4'" 1 
ATOM   3638 O  "O4'" . DT  B 2 12  ? 30.832 -18.590 -6.893  1.00 19.88 ? 12   DT  T "O4'" 1 
ATOM   3639 C  "C3'" . DT  B 2 12  ? 29.878 -20.745 -7.283  1.00 20.84 ? 12   DT  T "C3'" 1 
ATOM   3640 O  "O3'" . DT  B 2 12  ? 28.476 -20.852 -7.492  1.00 22.20 ? 12   DT  T "O3'" 1 
ATOM   3641 C  "C2'" . DT  B 2 12  ? 30.608 -20.228 -8.519  1.00 22.74 ? 12   DT  T "C2'" 1 
ATOM   3642 C  "C1'" . DT  B 2 12  ? 30.536 -18.728 -8.263  1.00 21.38 ? 12   DT  T "C1'" 1 
ATOM   3643 N  N1    . DT  B 2 12  ? 31.479 -17.913 -9.062  1.00 25.96 ? 12   DT  T N1    1 
ATOM   3644 C  C2    . DT  B 2 12  ? 31.078 -16.662 -9.456  1.00 18.40 ? 12   DT  T C2    1 
ATOM   3645 O  O2    . DT  B 2 12  ? 29.995 -16.201 -9.169  1.00 31.69 ? 12   DT  T O2    1 
ATOM   3646 N  N3    . DT  B 2 12  ? 31.989 -15.971 -10.201 1.00 21.73 ? 12   DT  T N3    1 
ATOM   3647 C  C4    . DT  B 2 12  ? 33.242 -16.407 -10.590 1.00 18.99 ? 12   DT  T C4    1 
ATOM   3648 O  O4    . DT  B 2 12  ? 33.983 -15.705 -11.274 1.00 25.12 ? 12   DT  T O4    1 
ATOM   3649 C  C5    . DT  B 2 12  ? 33.600 -17.730 -10.141 1.00 22.82 ? 12   DT  T C5    1 
ATOM   3650 C  C7    . DT  B 2 12  ? 34.930 -18.318 -10.487 1.00 20.79 ? 12   DT  T C7    1 
ATOM   3651 C  C6    . DT  B 2 12  ? 32.712 -18.414 -9.411  1.00 24.40 ? 12   DT  T C6    1 
ATOM   3652 O  "O5'" . DA  C 3 1   ? 29.267 -7.812  -15.230 1.00 44.95 ? 1    DA  P "O5'" 1 
ATOM   3653 C  "C5'" . DA  C 3 1   ? 27.923 -8.000  -15.661 1.00 32.08 ? 1    DA  P "C5'" 1 
ATOM   3654 C  "C4'" . DA  C 3 1   ? 27.047 -8.559  -14.548 1.00 30.11 ? 1    DA  P "C4'" 1 
ATOM   3655 O  "O4'" . DA  C 3 1   ? 27.412 -9.940  -14.280 1.00 36.90 ? 1    DA  P "O4'" 1 
ATOM   3656 C  "C3'" . DA  C 3 1   ? 27.074 -7.822  -13.209 1.00 22.42 ? 1    DA  P "C3'" 1 
ATOM   3657 O  "O3'" . DA  C 3 1   ? 25.744 -7.697  -12.726 1.00 27.04 ? 1    DA  P "O3'" 1 
ATOM   3658 C  "C2'" . DA  C 3 1   ? 27.876 -8.724  -12.271 1.00 26.26 ? 1    DA  P "C2'" 1 
ATOM   3659 C  "C1'" . DA  C 3 1   ? 27.894 -10.086 -12.960 1.00 33.18 ? 1    DA  P "C1'" 1 
ATOM   3660 N  N9    . DA  C 3 1   ? 29.239 -10.634 -13.057 1.00 26.42 ? 1    DA  P N9    1 
ATOM   3661 C  C8    . DA  C 3 1   ? 30.253 -10.210 -13.866 1.00 28.86 ? 1    DA  P C8    1 
ATOM   3662 N  N7    . DA  C 3 1   ? 31.356 -10.910 -13.729 1.00 28.34 ? 1    DA  P N7    1 
ATOM   3663 C  C5    . DA  C 3 1   ? 31.032 -11.849 -12.766 1.00 23.06 ? 1    DA  P C5    1 
ATOM   3664 C  C6    . DA  C 3 1   ? 31.762 -12.897 -12.176 1.00 24.39 ? 1    DA  P C6    1 
ATOM   3665 N  N6    . DA  C 3 1   ? 33.029 -13.170 -12.483 1.00 23.54 ? 1    DA  P N6    1 
ATOM   3666 N  N1    . DA  C 3 1   ? 31.136 -13.647 -11.249 1.00 25.84 ? 1    DA  P N1    1 
ATOM   3667 C  C2    . DA  C 3 1   ? 29.866 -13.375 -10.938 1.00 21.93 ? 1    DA  P C2    1 
ATOM   3668 N  N3    . DA  C 3 1   ? 29.074 -12.425 -11.427 1.00 24.44 ? 1    DA  P N3    1 
ATOM   3669 C  C4    . DA  C 3 1   ? 29.732 -11.693 -12.341 1.00 23.97 ? 1    DA  P C4    1 
ATOM   3670 P  P     . DG  C 3 2   ? 25.366 -6.536  -11.675 1.00 35.29 ? 2    DG  P P     1 
ATOM   3671 O  OP1   . DG  C 3 2   ? 23.907 -6.316  -11.751 1.00 28.24 ? 2    DG  P OP1   1 
ATOM   3672 O  OP2   . DG  C 3 2   ? 26.337 -5.431  -11.851 1.00 28.09 ? 2    DG  P OP2   1 
ATOM   3673 O  "O5'" . DG  C 3 2   ? 25.710 -7.184  -10.253 1.00 30.64 ? 2    DG  P "O5'" 1 
ATOM   3674 C  "C5'" . DG  C 3 2   ? 24.855 -8.146  -9.675  1.00 31.63 ? 2    DG  P "C5'" 1 
ATOM   3675 C  "C4'" . DG  C 3 2   ? 25.568 -8.757  -8.491  1.00 25.96 ? 2    DG  P "C4'" 1 
ATOM   3676 O  "O4'" . DG  C 3 2   ? 26.788 -9.395  -8.945  1.00 22.47 ? 2    DG  P "O4'" 1 
ATOM   3677 C  "C3'" . DG  C 3 2   ? 25.976 -7.777  -7.388  1.00 27.29 ? 2    DG  P "C3'" 1 
ATOM   3678 O  "O3'" . DG  C 3 2   ? 25.483 -8.365  -6.206  1.00 33.79 ? 2    DG  P "O3'" 1 
ATOM   3679 C  "C2'" . DG  C 3 2   ? 27.506 -7.762  -7.460  1.00 23.51 ? 2    DG  P "C2'" 1 
ATOM   3680 C  "C1'" . DG  C 3 2   ? 27.799 -9.159  -7.995  1.00 21.30 ? 2    DG  P "C1'" 1 
ATOM   3681 N  N9    . DG  C 3 2   ? 29.116 -9.318  -8.609  1.00 21.55 ? 2    DG  P N9    1 
ATOM   3682 C  C8    . DG  C 3 2   ? 29.785 -8.450  -9.446  1.00 23.41 ? 2    DG  P C8    1 
ATOM   3683 N  N7    . DG  C 3 2   ? 30.958 -8.881  -9.818  1.00 21.66 ? 2    DG  P N7    1 
ATOM   3684 C  C5    . DG  C 3 2   ? 31.079 -10.117 -9.184  1.00 22.19 ? 2    DG  P C5    1 
ATOM   3685 C  C6    . DG  C 3 2   ? 32.130 -11.063 -9.196  1.00 18.48 ? 2    DG  P C6    1 
ATOM   3686 O  O6    . DG  C 3 2   ? 33.208 -11.005 -9.798  1.00 19.02 ? 2    DG  P O6    1 
ATOM   3687 N  N1    . DG  C 3 2   ? 31.836 -12.181 -8.411  1.00 21.15 ? 2    DG  P N1    1 
ATOM   3688 C  C2    . DG  C 3 2   ? 30.672 -12.365 -7.708  1.00 19.45 ? 2    DG  P C2    1 
ATOM   3689 N  N2    . DG  C 3 2   ? 30.547 -13.504 -7.007  1.00 24.39 ? 2    DG  P N2    1 
ATOM   3690 N  N3    . DG  C 3 2   ? 29.683 -11.487 -7.691  1.00 24.06 ? 2    DG  P N3    1 
ATOM   3691 C  C4    . DG  C 3 2   ? 29.955 -10.394 -8.443  1.00 23.80 ? 2    DG  P C4    1 
ATOM   3692 P  P     . DC  C 3 3   ? 25.509 -7.570  -4.808  1.00 30.06 ? 3    DC  P P     1 
ATOM   3693 O  OP1   . DC  C 3 3   ? 24.146 -7.596  -4.251  1.00 34.21 ? 3    DC  P OP1   1 
ATOM   3694 O  OP2   . DC  C 3 3   ? 26.258 -6.307  -4.997  1.00 31.69 ? 3    DC  P OP2   1 
ATOM   3695 O  "O5'" . DC  C 3 3   ? 26.419 -8.498  -3.880  1.00 38.27 ? 3    DC  P "O5'" 1 
ATOM   3696 C  "C5'" . DC  C 3 3   ? 26.242 -9.905  -3.923  1.00 40.91 ? 3    DC  P "C5'" 1 
ATOM   3697 C  "C4'" . DC  C 3 3   ? 27.467 -10.612 -3.379  1.00 41.86 ? 3    DC  P "C4'" 1 
ATOM   3698 O  "O4'" . DC  C 3 3   ? 28.493 -10.617 -4.400  1.00 32.75 ? 3    DC  P "O4'" 1 
ATOM   3699 C  "C3'" . DC  C 3 3   ? 28.083 -9.970  -2.133  1.00 37.16 ? 3    DC  P "C3'" 1 
ATOM   3700 O  "O3'" . DC  C 3 3   ? 27.996 -10.861 -1.022  1.00 41.84 ? 3    DC  P "O3'" 1 
ATOM   3701 C  "C2'" . DC  C 3 3   ? 29.538 -9.700  -2.516  1.00 38.88 ? 3    DC  P "C2'" 1 
ATOM   3702 C  "C1'" . DC  C 3 3   ? 29.742 -10.567 -3.754  1.00 35.61 ? 3    DC  P "C1'" 1 
ATOM   3703 N  N1    . DC  C 3 3   ? 30.714 -9.952  -4.679  1.00 32.37 ? 3    DC  P N1    1 
ATOM   3704 C  C2    . DC  C 3 3   ? 31.895 -10.628 -4.968  1.00 17.04 ? 3    DC  P C2    1 
ATOM   3705 O  O2    . DC  C 3 3   ? 32.084 -11.730 -4.444  1.00 32.40 ? 3    DC  P O2    1 
ATOM   3706 N  N3    . DC  C 3 3   ? 32.788 -10.053 -5.808  1.00 28.39 ? 3    DC  P N3    1 
ATOM   3707 C  C4    . DC  C 3 3   ? 32.525 -8.857  -6.338  1.00 23.25 ? 3    DC  P C4    1 
ATOM   3708 N  N4    . DC  C 3 3   ? 33.429 -8.320  -7.167  1.00 26.64 ? 3    DC  P N4    1 
ATOM   3709 C  C5    . DC  C 3 3   ? 31.319 -8.159  -6.051  1.00 27.80 ? 3    DC  P C5    1 
ATOM   3710 C  C6    . DC  C 3 3   ? 30.450 -8.731  -5.217  1.00 26.56 ? 3    DC  P C6    1 
ATOM   3711 P  P     . DG  C 3 4   ? 28.551 -10.416 0.421   1.00 40.48 ? 4    DG  P P     1 
ATOM   3712 O  OP1   . DG  C 3 4   ? 27.786 -11.158 1.450   1.00 47.18 ? 4    DG  P OP1   1 
ATOM   3713 O  OP2   . DG  C 3 4   ? 28.606 -8.941  0.459   1.00 32.67 ? 4    DG  P OP2   1 
ATOM   3714 O  "O5'" . DG  C 3 4   ? 30.068 -10.936 0.418   1.00 37.29 ? 4    DG  P "O5'" 1 
ATOM   3715 C  "C5'" . DG  C 3 4   ? 30.336 -12.313 0.194   1.00 38.46 ? 4    DG  P "C5'" 1 
ATOM   3716 C  "C4'" . DG  C 3 4   ? 31.833 -12.574 0.211   1.00 40.74 ? 4    DG  P "C4'" 1 
ATOM   3717 O  "O4'" . DG  C 3 4   ? 32.455 -11.998 -0.965  1.00 34.25 ? 4    DG  P "O4'" 1 
ATOM   3718 C  "C3'" . DG  C 3 4   ? 32.557 -12.001 1.429   1.00 31.70 ? 4    DG  P "C3'" 1 
ATOM   3719 O  "O3'" . DG  C 3 4   ? 33.220 -13.068 2.084   1.00 34.82 ? 4    DG  P "O3'" 1 
ATOM   3720 C  "C2'" . DG  C 3 4   ? 33.526 -10.971 0.860   1.00 28.20 ? 4    DG  P "C2'" 1 
ATOM   3721 C  "C1'" . DG  C 3 4   ? 33.680 -11.400 -0.593  1.00 29.68 ? 4    DG  P "C1'" 1 
ATOM   3722 N  N9    . DG  C 3 4   ? 33.907 -10.285 -1.503  1.00 27.24 ? 4    DG  P N9    1 
ATOM   3723 C  C8    . DG  C 3 4   ? 33.064 -9.228  -1.773  1.00 30.81 ? 4    DG  P C8    1 
ATOM   3724 N  N7    . DG  C 3 4   ? 33.545 -8.385  -2.646  1.00 28.18 ? 4    DG  P N7    1 
ATOM   3725 C  C5    . DG  C 3 4   ? 34.786 -8.922  -2.973  1.00 25.89 ? 4    DG  P C5    1 
ATOM   3726 C  C6    . DG  C 3 4   ? 35.771 -8.458  -3.863  1.00 22.32 ? 4    DG  P C6    1 
ATOM   3727 O  O6    . DG  C 3 4   ? 35.746 -7.434  -4.561  1.00 29.07 ? 4    DG  P O6    1 
ATOM   3728 N  N1    . DG  C 3 4   ? 36.880 -9.308  -3.894  1.00 21.11 ? 4    DG  P N1    1 
ATOM   3729 C  C2    . DG  C 3 4   ? 37.012 -10.460 -3.151  1.00 20.31 ? 4    DG  P C2    1 
ATOM   3730 N  N2    . DG  C 3 4   ? 38.142 -11.176 -3.296  1.00 19.22 ? 4    DG  P N2    1 
ATOM   3731 N  N3    . DG  C 3 4   ? 36.091 -10.901 -2.313  1.00 21.41 ? 4    DG  P N3    1 
ATOM   3732 C  C4    . DG  C 3 4   ? 35.015 -10.087 -2.282  1.00 23.74 ? 4    DG  P C4    1 
ATOM   3733 P  P     . DT  C 3 5   ? 34.023 -12.806 3.451   1.00 43.77 ? 5    DT  P P     1 
ATOM   3734 O  OP1   . DT  C 3 5   ? 34.002 -14.058 4.233   1.00 38.59 ? 5    DT  P OP1   1 
ATOM   3735 O  OP2   . DT  C 3 5   ? 33.552 -11.530 4.025   1.00 30.89 ? 5    DT  P OP2   1 
ATOM   3736 O  "O5'" . DT  C 3 5   ? 35.515 -12.532 2.956   1.00 36.34 ? 5    DT  P "O5'" 1 
ATOM   3737 C  "C5'" . DT  C 3 5   ? 36.170 -13.546 2.235   1.00 28.88 ? 5    DT  P "C5'" 1 
ATOM   3738 C  "C4'" . DT  C 3 5   ? 37.581 -13.107 1.896   1.00 27.47 ? 5    DT  P "C4'" 1 
ATOM   3739 O  "O4'" . DT  C 3 5   ? 37.578 -12.113 0.843   1.00 21.30 ? 5    DT  P "O4'" 1 
ATOM   3740 C  "C3'" . DT  C 3 5   ? 38.373 -12.524 3.060   1.00 23.19 ? 5    DT  P "C3'" 1 
ATOM   3741 O  "O3'" . DT  C 3 5   ? 39.540 -13.311 3.115   1.00 23.14 ? 5    DT  P "O3'" 1 
ATOM   3742 C  "C2'" . DT  C 3 5   ? 38.685 -11.087 2.643   1.00 17.87 ? 5    DT  P "C2'" 1 
ATOM   3743 C  "C1'" . DT  C 3 5   ? 38.586 -11.158 1.127   1.00 18.69 ? 5    DT  P "C1'" 1 
ATOM   3744 N  N1    . DT  C 3 5   ? 38.167 -9.897  0.479   1.00 16.19 ? 5    DT  P N1    1 
ATOM   3745 C  C2    . DT  C 3 5   ? 38.997 -9.301  -0.438  1.00 16.78 ? 5    DT  P C2    1 
ATOM   3746 O  O2    . DT  C 3 5   ? 40.086 -9.746  -0.766  1.00 20.94 ? 5    DT  P O2    1 
ATOM   3747 N  N3    . DT  C 3 5   ? 38.501 -8.148  -0.979  1.00 18.04 ? 5    DT  P N3    1 
ATOM   3748 C  C4    . DT  C 3 5   ? 37.295 -7.545  -0.710  1.00 18.01 ? 5    DT  P C4    1 
ATOM   3749 O  O4    . DT  C 3 5   ? 36.959 -6.497  -1.264  1.00 20.13 ? 5    DT  P O4    1 
ATOM   3750 C  C5    . DT  C 3 5   ? 36.473 -8.216  0.268   1.00 23.32 ? 5    DT  P C5    1 
ATOM   3751 C  C7    . DT  C 3 5   ? 35.143 -7.640  0.650   1.00 23.39 ? 5    DT  P C7    1 
ATOM   3752 C  C6    . DT  C 3 5   ? 36.939 -9.350  0.818   1.00 20.82 ? 5    DT  P C6    1 
ATOM   3753 P  P     . DC  C 3 6   ? 40.569 -13.173 4.338   1.00 16.99 ? 6    DC  P P     1 
ATOM   3754 O  OP1   . DC  C 3 6   ? 41.318 -14.452 4.431   1.00 20.90 ? 6    DC  P OP1   1 
ATOM   3755 O  OP2   . DC  C 3 6   ? 39.858 -12.610 5.488   1.00 16.40 ? 6    DC  P OP2   1 
ATOM   3756 O  "O5'" . DC  C 3 6   ? 41.590 -12.057 3.835   1.00 18.95 ? 6    DC  P "O5'" 1 
ATOM   3757 C  "C5'" . DC  C 3 6   ? 42.542 -12.349 2.824   1.00 13.47 ? 6    DC  P "C5'" 1 
ATOM   3758 C  "C4'" . DC  C 3 6   ? 43.254 -11.062 2.488   1.00 15.97 ? 6    DC  P "C4'" 1 
ATOM   3759 O  "O4'" . DC  C 3 6   ? 42.303 -10.165 1.873   1.00 18.72 ? 6    DC  P "O4'" 1 
ATOM   3760 C  "C3'" . DC  C 3 6   ? 43.826 -10.297 3.686   1.00 15.28 ? 6    DC  P "C3'" 1 
ATOM   3761 O  "O3'" . DC  C 3 6   ? 45.245 -10.414 3.618   1.00 16.02 ? 6    DC  P "O3'" 1 
ATOM   3762 C  "C2'" . DC  C 3 6   ? 43.357 -8.855  3.477   1.00 13.34 ? 6    DC  P "C2'" 1 
ATOM   3763 C  "C1'" . DC  C 3 6   ? 42.786 -8.859  2.061   1.00 13.16 ? 6    DC  P "C1'" 1 
ATOM   3764 N  N1    . DC  C 3 6   ? 41.673 -7.892  1.863   1.00 17.35 ? 6    DC  P N1    1 
ATOM   3765 C  C2    . DC  C 3 6   ? 41.767 -6.945  0.836   1.00 18.18 ? 6    DC  P C2    1 
ATOM   3766 O  O2    . DC  C 3 6   ? 42.762 -6.950  0.101   1.00 16.15 ? 6    DC  P O2    1 
ATOM   3767 N  N3    . DC  C 3 6   ? 40.756 -6.058  0.661   1.00 17.79 ? 6    DC  P N3    1 
ATOM   3768 C  C4    . DC  C 3 6   ? 39.695 -6.089  1.462   1.00 17.37 ? 6    DC  P C4    1 
ATOM   3769 N  N4    . DC  C 3 6   ? 38.728 -5.186  1.236   1.00 17.73 ? 6    DC  P N4    1 
ATOM   3770 C  C5    . DC  C 3 6   ? 39.574 -7.037  2.525   1.00 16.81 ? 6    DC  P C5    1 
ATOM   3771 C  C6    . DC  C 3 6   ? 40.574 -7.921  2.687   1.00 19.46 ? 6    DC  P C6    1 
ATOM   3772 P  P     . DA  C 3 7   ? 46.179 -9.709  4.721   1.00 17.36 ? 7    DA  P P     1 
ATOM   3773 O  OP1   . DA  C 3 7   ? 47.374 -10.554 4.900   1.00 16.97 ? 7    DA  P OP1   1 
ATOM   3774 O  OP2   . DA  C 3 7   ? 45.356 -9.411  5.901   1.00 16.78 ? 7    DA  P OP2   1 
ATOM   3775 O  "O5'" . DA  C 3 7   ? 46.527 -8.278  4.073   1.00 20.19 ? 7    DA  P "O5'" 1 
ATOM   3776 C  "C5'" . DA  C 3 7   ? 47.220 -8.121  2.856   1.00 23.91 ? 7    DA  P "C5'" 1 
ATOM   3777 C  "C4'" . DA  C 3 7   ? 47.011 -6.707  2.309   1.00 27.88 ? 7    DA  P "C4'" 1 
ATOM   3778 O  "O4'" . DA  C 3 7   ? 45.613 -6.460  2.009   1.00 24.14 ? 7    DA  P "O4'" 1 
ATOM   3779 C  "C3'" . DA  C 3 7   ? 47.333 -5.543  3.237   1.00 26.46 ? 7    DA  P "C3'" 1 
ATOM   3780 O  "O3'" . DA  C 3 7   ? 48.722 -5.233  3.267   1.00 29.46 ? 7    DA  P "O3'" 1 
ATOM   3781 C  "C2'" . DA  C 3 7   ? 46.581 -4.378  2.605   1.00 23.55 ? 7    DA  P "C2'" 1 
ATOM   3782 C  "C1'" . DA  C 3 7   ? 45.445 -5.061  1.859   1.00 30.30 ? 7    DA  P "C1'" 1 
ATOM   3783 N  N9    . DA  C 3 7   ? 44.118 -4.629  2.298   1.00 21.82 ? 7    DA  P N9    1 
ATOM   3784 C  C8    . DA  C 3 7   ? 43.286 -5.189  3.235   1.00 20.02 ? 7    DA  P C8    1 
ATOM   3785 N  N7    . DA  C 3 7   ? 42.150 -4.540  3.382   1.00 19.35 ? 7    DA  P N7    1 
ATOM   3786 C  C5    . DA  C 3 7   ? 42.251 -3.481  2.493   1.00 16.78 ? 7    DA  P C5    1 
ATOM   3787 C  C6    . DA  C 3 7   ? 41.378 -2.420  2.164   1.00 18.55 ? 7    DA  P C6    1 
ATOM   3788 N  N6    . DA  C 3 7   ? 40.175 -2.255  2.724   1.00 18.35 ? 7    DA  P N6    1 
ATOM   3789 N  N1    . DA  C 3 7   ? 41.791 -1.537  1.237   1.00 17.17 ? 7    DA  P N1    1 
ATOM   3790 C  C2    . DA  C 3 7   ? 42.995 -1.704  0.675   1.00 20.72 ? 7    DA  P C2    1 
ATOM   3791 N  N3    . DA  C 3 7   ? 43.903 -2.654  0.902   1.00 17.99 ? 7    DA  P N3    1 
ATOM   3792 C  C4    . DA  C 3 7   ? 43.457 -3.518  1.826   1.00 18.91 ? 7    DA  P C4    1 
ATOM   3793 P  P     A DT  C 3 8   ? 49.299 -4.254  4.399   0.30 28.25 ? 8    DT  P P     1 
ATOM   3794 P  P     B DT  C 3 8   ? 49.260 -3.993  4.143   0.70 28.13 ? 8    DT  P P     1 
ATOM   3795 O  OP1   A DT  C 3 8   ? 50.683 -4.679  4.712   0.30 26.70 ? 8    DT  P OP1   1 
ATOM   3796 O  OP1   B DT  C 3 8   ? 50.738 -4.120  4.253   0.70 25.64 ? 8    DT  P OP1   1 
ATOM   3797 O  OP2   A DT  C 3 8   ? 48.285 -4.155  5.474   0.30 27.16 ? 8    DT  P OP2   1 
ATOM   3798 O  OP2   B DT  C 3 8   ? 48.410 -3.880  5.350   0.70 26.55 ? 8    DT  P OP2   1 
ATOM   3799 O  "O5'" A DT  C 3 8   ? 49.337 -2.834  3.675   0.30 25.05 ? 8    DT  P "O5'" 1 
ATOM   3800 O  "O5'" B DT  C 3 8   ? 48.916 -2.707  3.249   0.70 25.94 ? 8    DT  P "O5'" 1 
ATOM   3801 C  "C5'" A DT  C 3 8   ? 49.674 -2.759  2.299   0.30 24.24 ? 8    DT  P "C5'" 1 
ATOM   3802 C  "C5'" B DT  C 3 8   ? 49.776 -2.259  2.204   0.70 23.94 ? 8    DT  P "C5'" 1 
ATOM   3803 C  "C4'" A DT  C 3 8   ? 49.379 -1.352  1.835   0.30 21.32 ? 8    DT  P "C4'" 1 
ATOM   3804 C  "C4'" B DT  C 3 8   ? 49.240 -0.965  1.615   0.70 21.41 ? 8    DT  P "C4'" 1 
ATOM   3805 O  "O4'" A DT  C 3 8   ? 47.943 -1.158  1.810   0.30 19.88 ? 8    DT  P "O4'" 1 
ATOM   3806 O  "O4'" B DT  C 3 8   ? 47.817 -1.105  1.375   0.70 19.87 ? 8    DT  P "O4'" 1 
ATOM   3807 C  "C3'" A DT  C 3 8   ? 49.958 -0.301  2.774   0.30 20.25 ? 8    DT  P "C3'" 1 
ATOM   3808 C  "C3'" B DT  C 3 8   ? 49.313 0.247   2.537   0.70 22.43 ? 8    DT  P "C3'" 1 
ATOM   3809 O  "O3'" A DT  C 3 8   ? 50.707 0.654   2.023   0.30 16.99 ? 8    DT  P "O3'" 1 
ATOM   3810 O  "O3'" B DT  C 3 8   ? 50.599 0.870   2.527   0.70 19.36 ? 8    DT  P "O3'" 1 
ATOM   3811 C  "C2'" A DT  C 3 8   ? 48.737 0.290   3.491   0.30 19.25 ? 8    DT  P "C2'" 1 
ATOM   3812 C  "C2'" B DT  C 3 8   ? 48.222 1.160   1.972   0.70 19.14 ? 8    DT  P "C2'" 1 
ATOM   3813 C  "C1'" A DT  C 3 8   ? 47.593 0.012   2.519   0.30 20.51 ? 8    DT  P "C1'" 1 
ATOM   3814 C  "C1'" B DT  C 3 8   ? 47.170 0.154   1.518   0.70 19.57 ? 8    DT  P "C1'" 1 
ATOM   3815 N  N1    A DT  C 3 8   ? 46.252 -0.213  3.152   0.30 19.99 ? 8    DT  P N1    1 
ATOM   3816 N  N1    B DT  C 3 8   ? 45.969 -0.013  2.421   0.70 19.96 ? 8    DT  P N1    1 
ATOM   3817 C  C2    A DT  C 3 8   ? 45.224 0.659   2.863   0.30 19.23 ? 8    DT  P C2    1 
ATOM   3818 C  C2    B DT  C 3 8   ? 44.923 0.878   2.312   0.70 21.04 ? 8    DT  P C2    1 
ATOM   3819 O  O2    A DT  C 3 8   ? 45.350 1.611   2.116   0.30 19.36 ? 8    DT  P O2    1 
ATOM   3820 O  O2    B DT  C 3 8   ? 44.915 1.812   1.530   0.70 19.99 ? 8    DT  P O2    1 
ATOM   3821 N  N3    A DT  C 3 8   ? 44.031 0.374   3.479   0.30 18.59 ? 8    DT  P N3    1 
ATOM   3822 N  N3    B DT  C 3 8   ? 43.864 0.639   3.152   0.70 19.66 ? 8    DT  P N3    1 
ATOM   3823 C  C4    A DT  C 3 8   ? 43.765 -0.672  4.339   0.30 19.62 ? 8    DT  P C4    1 
ATOM   3824 C  C4    B DT  C 3 8   ? 43.737 -0.370  4.075   0.70 18.64 ? 8    DT  P C4    1 
ATOM   3825 O  O4    A DT  C 3 8   ? 42.658 -0.843  4.845   0.30 19.82 ? 8    DT  P O4    1 
ATOM   3826 O  O4    B DT  C 3 8   ? 42.739 -0.492  4.782   0.70 20.39 ? 8    DT  P O4    1 
ATOM   3827 C  C5    A DT  C 3 8   ? 44.882 -1.545  4.603   0.30 19.38 ? 8    DT  P C5    1 
ATOM   3828 C  C5    B DT  C 3 8   ? 44.860 -1.271  4.144   0.70 19.56 ? 8    DT  P C5    1 
ATOM   3829 C  C7    A DT  C 3 8   ? 44.709 -2.716  5.523   0.30 21.78 ? 8    DT  P C7    1 
ATOM   3830 C  C7    B DT  C 3 8   ? 44.826 -2.405  5.121   0.70 20.85 ? 8    DT  P C7    1 
ATOM   3831 C  C6    A DT  C 3 8   ? 46.054 -1.280  4.005   0.30 21.25 ? 8    DT  P C6    1 
ATOM   3832 C  C6    B DT  C 3 8   ? 45.904 -1.057  3.325   0.70 20.11 ? 8    DT  P C6    1 
ATOM   3833 P  P     B DA  C 3 9   ? 51.137 1.614   3.854   0.70 20.59 ? 9    DA  P P     1 
ATOM   3834 O  OP1   B DA  C 3 9   ? 52.600 1.780   3.738   0.70 20.21 ? 9    DA  P OP1   1 
ATOM   3835 O  OP2   B DA  C 3 9   ? 50.598 0.884   5.031   0.70 20.11 ? 9    DA  P OP2   1 
ATOM   3836 O  "O5'" B DA  C 3 9   ? 50.458 3.053   3.778   0.70 16.25 ? 9    DA  P "O5'" 1 
ATOM   3837 C  "C5'" B DA  C 3 9   ? 50.925 4.028   2.850   0.70 13.65 ? 9    DA  P "C5'" 1 
ATOM   3838 C  "C4'" B DA  C 3 9   ? 50.087 5.284   2.984   0.70 12.55 ? 9    DA  P "C4'" 1 
ATOM   3839 O  "O4'" B DA  C 3 9   ? 48.719 4.958   2.626   0.70 15.10 ? 9    DA  P "O4'" 1 
ATOM   3840 C  "C3'" B DA  C 3 9   ? 50.006 5.847   4.398   0.70 15.27 ? 9    DA  P "C3'" 1 
ATOM   3841 O  "O3'" B DA  C 3 9   ? 51.081 6.752   4.632   0.70 10.94 ? 9    DA  P "O3'" 1 
ATOM   3842 C  "C2'" B DA  C 3 9   ? 48.649 6.552   4.372   0.70 13.18 ? 9    DA  P "C2'" 1 
ATOM   3843 C  "C1'" B DA  C 3 9   ? 47.813 5.618   3.490   0.70 16.03 ? 9    DA  P "C1'" 1 
ATOM   3844 N  N9    B DA  C 3 9   ? 47.056 4.604   4.223   0.70 18.62 ? 9    DA  P N9    1 
ATOM   3845 C  C8    B DA  C 3 9   ? 47.521 3.423   4.739   0.70 18.00 ? 9    DA  P C8    1 
ATOM   3846 N  N7    B DA  C 3 9   ? 46.594 2.718   5.352   0.70 17.80 ? 9    DA  P N7    1 
ATOM   3847 C  C5    B DA  C 3 9   ? 45.443 3.487   5.217   0.70 17.97 ? 9    DA  P C5    1 
ATOM   3848 C  C6    B DA  C 3 9   ? 44.111 3.302   5.649   0.70 20.69 ? 9    DA  P C6    1 
ATOM   3849 N  N6    B DA  C 3 9   ? 43.706 2.225   6.330   0.70 18.90 ? 9    DA  P N6    1 
ATOM   3850 N  N1    B DA  C 3 9   ? 43.214 4.269   5.358   0.70 19.80 ? 9    DA  P N1    1 
ATOM   3851 C  C2    B DA  C 3 9   ? 43.622 5.346   4.669   0.70 21.07 ? 9    DA  P C2    1 
ATOM   3852 N  N3    B DA  C 3 9   ? 44.848 5.630   4.209   0.70 18.63 ? 9    DA  P N3    1 
ATOM   3853 C  C4    B DA  C 3 9   ? 45.713 4.652   4.527   0.70 17.25 ? 9    DA  P C4    1 
HETATM 3854 MG MG    . MG  D 4 .   ? 52.950 0.528   2.166   0.30 13.51 ? 501  MG  A MG    1 
HETATM 3855 CA CA    A CA  E 5 .   ? 54.845 2.754   3.788   0.15 11.70 ? 502  CA  A CA    1 
HETATM 3856 MG MG    B MG  F 4 .   ? 54.845 2.754   3.800   0.85 11.32 ? 503  MG  A MG    1 
HETATM 3857 C  C1    . GOL G 6 .   ? 60.479 -24.954 12.136  1.00 15.02 ? 506  GOL A C1    1 
HETATM 3858 O  O1    . GOL G 6 .   ? 59.122 -24.984 12.458  1.00 18.84 ? 506  GOL A O1    1 
HETATM 3859 C  C2    . GOL G 6 .   ? 60.509 -24.520 10.674  1.00 21.32 ? 506  GOL A C2    1 
HETATM 3860 O  O2    . GOL G 6 .   ? 60.810 -23.153 10.577  1.00 14.65 ? 506  GOL A O2    1 
HETATM 3861 C  C3    . GOL G 6 .   ? 61.274 -25.466 9.750   1.00 24.59 ? 506  GOL A C3    1 
HETATM 3862 O  O3    . GOL G 6 .   ? 61.503 -24.880 8.485   1.00 17.75 ? 506  GOL A O3    1 
HETATM 3863 C  C1    . GOL H 6 .   ? 54.667 28.254  4.497   1.00 26.82 ? 507  GOL A C1    1 
HETATM 3864 O  O1    . GOL H 6 .   ? 53.339 27.990  4.079   1.00 32.34 ? 507  GOL A O1    1 
HETATM 3865 C  C2    . GOL H 6 .   ? 55.065 27.286  5.610   1.00 38.20 ? 507  GOL A C2    1 
HETATM 3866 O  O2    . GOL H 6 .   ? 54.478 26.019  5.397   1.00 35.54 ? 507  GOL A O2    1 
HETATM 3867 C  C3    . GOL H 6 .   ? 56.580 27.129  5.648   1.00 35.70 ? 507  GOL A C3    1 
HETATM 3868 O  O3    . GOL H 6 .   ? 56.951 26.087  6.533   1.00 22.44 ? 507  GOL A O3    1 
HETATM 3869 P  PG    A DTP I 7 .   ? 55.423 2.795   7.154   0.30 15.13 ? 504  DTP P PG    1 
HETATM 3870 O  O1G   A DTP I 7 .   ? 55.152 1.899   8.341   0.30 16.74 ? 504  DTP P O1G   1 
HETATM 3871 O  O2G   A DTP I 7 .   ? 56.734 3.535   7.248   0.30 15.52 ? 504  DTP P O2G   1 
HETATM 3872 O  O3G   A DTP I 7 .   ? 55.164 2.137   5.816   0.30 15.45 ? 504  DTP P O3G   1 
HETATM 3873 P  PB    A DTP I 7 .   ? 53.241 4.225   6.102   0.30 15.02 ? 504  DTP P PB    1 
HETATM 3874 O  O1B   A DTP I 7 .   ? 53.959 4.345   4.776   0.30 12.85 ? 504  DTP P O1B   1 
HETATM 3875 O  O2B   A DTP I 7 .   ? 52.305 5.322   6.562   0.30 15.44 ? 504  DTP P O2B   1 
HETATM 3876 O  O3B   A DTP I 7 .   ? 54.296 3.945   7.287   0.30 16.03 ? 504  DTP P O3B   1 
HETATM 3877 P  PA    A DTP I 7 .   ? 51.829 2.116   4.864   0.30 14.58 ? 504  DTP P PA    1 
HETATM 3878 O  O1A   A DTP I 7 .   ? 51.012 0.958   5.384   0.30 18.98 ? 504  DTP P O1A   1 
HETATM 3879 O  O2A   A DTP I 7 .   ? 52.939 1.820   3.876   0.30 18.94 ? 504  DTP P O2A   1 
HETATM 3880 O  O3A   A DTP I 7 .   ? 52.455 2.823   6.164   0.30 17.24 ? 504  DTP P O3A   1 
HETATM 3881 O  "O5'" A DTP I 7 .   ? 50.816 3.223   4.279   0.30 15.02 ? 504  DTP P "O5'" 1 
HETATM 3882 C  "C5'" A DTP I 7 .   ? 51.126 4.017   3.133   0.30 14.25 ? 504  DTP P "C5'" 1 
HETATM 3883 C  "C4'" A DTP I 7 .   ? 50.243 5.261   3.113   0.30 12.95 ? 504  DTP P "C4'" 1 
HETATM 3884 O  "O4'" A DTP I 7 .   ? 48.889 4.950   2.760   0.30 15.14 ? 504  DTP P "O4'" 1 
HETATM 3885 C  "C3'" A DTP I 7 .   ? 50.197 5.934   4.476   0.30 14.82 ? 504  DTP P "C3'" 1 
HETATM 3886 O  "O3'" A DTP I 7 .   ? 51.098 7.044   4.526   0.30 11.36 ? 504  DTP P "O3'" 1 
HETATM 3887 C  "C2'" A DTP I 7 .   ? 48.766 6.414   4.628   0.30 13.67 ? 504  DTP P "C2'" 1 
HETATM 3888 C  "C1'" A DTP I 7 .   ? 47.954 5.574   3.649   0.30 16.03 ? 504  DTP P "C1'" 1 
HETATM 3889 N  N9    A DTP I 7 .   ? 47.185 4.541   4.389   0.30 18.31 ? 504  DTP P N9    1 
HETATM 3890 C  C8    A DTP I 7 .   ? 47.680 3.405   4.904   0.30 17.95 ? 504  DTP P C8    1 
HETATM 3891 N  N7    A DTP I 7 .   ? 46.674 2.719   5.496   0.30 17.89 ? 504  DTP P N7    1 
HETATM 3892 C  C5    A DTP I 7 .   ? 45.541 3.435   5.338   0.30 18.24 ? 504  DTP P C5    1 
HETATM 3893 C  C6    A DTP I 7 .   ? 44.224 3.236   5.726   0.30 20.65 ? 504  DTP P C6    1 
HETATM 3894 N  N6    A DTP I 7 .   ? 43.876 2.122   6.416   0.30 19.13 ? 504  DTP P N6    1 
HETATM 3895 N  N1    A DTP I 7 .   ? 43.295 4.166   5.411   0.30 19.82 ? 504  DTP P N1    1 
HETATM 3896 C  C2    A DTP I 7 .   ? 43.636 5.269   4.727   0.30 21.01 ? 504  DTP P C2    1 
HETATM 3897 N  N3    A DTP I 7 .   ? 44.904 5.484   4.340   0.30 18.78 ? 504  DTP P N3    1 
HETATM 3898 C  C4    A DTP I 7 .   ? 45.870 4.579   4.634   0.30 17.44 ? 504  DTP P C4    1 
HETATM 3899 P  P1    B DPO J 8 .   ? 53.157 4.202   6.081   0.70 14.97 ? 505  DPO P P1    1 
HETATM 3900 O  O1    B DPO J 8 .   ? 52.322 2.947   6.164   0.70 17.07 ? 505  DPO P O1    1 
HETATM 3901 O  O2    B DPO J 8 .   ? 53.914 4.371   4.777   0.70 12.76 ? 505  DPO P O2    1 
HETATM 3902 O  O3    B DPO J 8 .   ? 52.399 5.419   6.571   0.70 15.43 ? 505  DPO P O3    1 
HETATM 3903 O  O4    B DPO J 8 .   ? 54.293 3.961   7.202   0.70 16.05 ? 505  DPO P O4    1 
HETATM 3904 P  P2    B DPO J 8 .   ? 55.393 2.769   7.142   0.70 15.08 ? 505  DPO P P2    1 
HETATM 3905 O  O5    B DPO J 8 .   ? 56.715 3.461   7.332   0.70 15.52 ? 505  DPO P O5    1 
HETATM 3906 O  O6    B DPO J 8 .   ? 55.001 1.859   8.285   0.70 16.50 ? 505  DPO P O6    1 
HETATM 3907 O  O7    B DPO J 8 .   ? 55.218 2.085   5.802   0.70 15.36 ? 505  DPO P O7    1 
HETATM 3908 MG MG    B MG  K 4 .   ? 51.443 1.078   6.876   0.70 30.19 ? 506  MG  P MG    1 
HETATM 3909 O  O     B HOH L 9 .   ? 49.603 4.482   7.372   0.70 17.74 ? 601  HOH A O     1 
HETATM 3910 O  O     B HOH L 9 .   ? 49.593 1.908   7.469   0.70 19.36 ? 602  HOH A O     1 
HETATM 3911 O  O     . HOH L 9 .   ? 53.037 -1.160  3.671   1.00 20.69 ? 603  HOH A O     1 
HETATM 3912 O  O     . HOH L 9 .   ? 56.502 -13.975 -5.877  1.00 11.93 ? 604  HOH A O     1 
HETATM 3913 O  O     . HOH L 9 .   ? 64.067 -3.460  6.063   1.00 11.37 ? 605  HOH A O     1 
HETATM 3914 O  O     . HOH L 9 .   ? 67.526 -20.732 8.756   1.00 11.65 ? 606  HOH A O     1 
HETATM 3915 O  O     . HOH L 9 .   ? 59.482 9.541   10.629  1.00 11.96 ? 607  HOH A O     1 
HETATM 3916 O  O     . HOH L 9 .   ? 43.905 -14.486 5.596   1.00 13.43 ? 608  HOH A O     1 
HETATM 3917 O  O     . HOH L 9 .   ? 69.275 -17.553 -1.230  1.00 11.29 ? 609  HOH A O     1 
HETATM 3918 O  O     . HOH L 9 .   ? 57.915 -23.531 14.232  1.00 10.70 ? 610  HOH A O     1 
HETATM 3919 O  O     . HOH L 9 .   ? 73.180 -7.390  9.091   1.00 14.29 ? 611  HOH A O     1 
HETATM 3920 O  O     . HOH L 9 .   ? 67.173 -16.579 9.628   1.00 14.23 ? 612  HOH A O     1 
HETATM 3921 O  O     . HOH L 9 .   ? 68.901 16.381  -4.069  1.00 13.23 ? 613  HOH A O     1 
HETATM 3922 O  O     . HOH L 9 .   ? 55.586 17.440  -0.578  1.00 9.68  ? 614  HOH A O     1 
HETATM 3923 O  O     . HOH L 9 .   ? 60.500 -18.563 -4.645  1.00 11.73 ? 615  HOH A O     1 
HETATM 3924 O  O     . HOH L 9 .   ? 62.402 7.518   7.133   1.00 13.75 ? 616  HOH A O     1 
HETATM 3925 O  O     . HOH L 9 .   ? 45.598 16.144  -1.593  1.00 13.52 ? 617  HOH A O     1 
HETATM 3926 O  O     . HOH L 9 .   ? 69.218 -13.449 5.089   1.00 11.66 ? 618  HOH A O     1 
HETATM 3927 O  O     . HOH L 9 .   ? 53.917 -28.528 4.122   1.00 13.67 ? 619  HOH A O     1 
HETATM 3928 O  O     . HOH L 9 .   ? 53.776 -20.539 -2.579  1.00 17.84 ? 620  HOH A O     1 
HETATM 3929 O  O     . HOH L 9 .   ? 54.716 -11.459 3.418   1.00 14.65 ? 621  HOH A O     1 
HETATM 3930 O  O     . HOH L 9 .   ? 70.656 -16.028 7.757   1.00 17.39 ? 622  HOH A O     1 
HETATM 3931 O  O     . HOH L 9 .   ? 46.213 16.835  1.147   1.00 13.25 ? 623  HOH A O     1 
HETATM 3932 O  O     . HOH L 9 .   ? 54.316 -9.523  5.349   1.00 15.29 ? 624  HOH A O     1 
HETATM 3933 O  O     . HOH L 9 .   ? 52.383 15.978  -4.616  1.00 15.16 ? 625  HOH A O     1 
HETATM 3934 O  O     . HOH L 9 .   ? 43.608 12.305  -7.246  1.00 19.10 ? 626  HOH A O     1 
HETATM 3935 O  O     . HOH L 9 .   ? 42.227 -22.603 -2.536  1.00 20.12 ? 627  HOH A O     1 
HETATM 3936 O  O     . HOH L 9 .   ? 49.091 -15.606 13.674  1.00 16.38 ? 628  HOH A O     1 
HETATM 3937 O  O     . HOH L 9 .   ? 62.623 14.813  -9.200  1.00 13.22 ? 629  HOH A O     1 
HETATM 3938 O  O     . HOH L 9 .   ? 61.315 -30.163 10.602  1.00 17.08 ? 630  HOH A O     1 
HETATM 3939 O  O     . HOH L 9 .   ? 60.042 11.598  -10.334 1.00 14.86 ? 631  HOH A O     1 
HETATM 3940 O  O     . HOH L 9 .   ? 43.424 -33.172 -0.598  1.00 17.75 ? 632  HOH A O     1 
HETATM 3941 O  O     . HOH L 9 .   ? 53.421 -28.289 15.165  1.00 17.25 ? 633  HOH A O     1 
HETATM 3942 O  O     . HOH L 9 .   ? 60.743 -23.514 6.350   1.00 19.47 ? 634  HOH A O     1 
HETATM 3943 O  O     . HOH L 9 .   ? 34.971 5.606   1.947   1.00 19.25 ? 635  HOH A O     1 
HETATM 3944 O  O     . HOH L 9 .   ? 58.570 -12.100 -11.433 1.00 13.22 ? 636  HOH A O     1 
HETATM 3945 O  O     . HOH L 9 .   ? 51.411 5.611   -8.309  1.00 17.81 ? 637  HOH A O     1 
HETATM 3946 O  O     . HOH L 9 .   ? 52.060 5.808   9.154   1.00 15.47 ? 638  HOH A O     1 
HETATM 3947 O  O     . HOH L 9 .   ? 60.048 14.088  -8.625  1.00 18.77 ? 639  HOH A O     1 
HETATM 3948 O  O     . HOH L 9 .   ? 71.075 3.560   -0.227  1.00 18.07 ? 640  HOH A O     1 
HETATM 3949 O  O     . HOH L 9 .   ? 33.148 10.729  5.443   1.00 25.11 ? 641  HOH A O     1 
HETATM 3950 O  O     . HOH L 9 .   ? 49.093 6.841   -11.806 1.00 19.04 ? 642  HOH A O     1 
HETATM 3951 O  O     . HOH L 9 .   ? 48.709 -22.287 -5.670  1.00 20.12 ? 643  HOH A O     1 
HETATM 3952 O  O     . HOH L 9 .   ? 40.531 16.702  6.055   1.00 20.45 ? 644  HOH A O     1 
HETATM 3953 O  O     . HOH L 9 .   ? 50.223 -17.266 15.465  1.00 17.66 ? 645  HOH A O     1 
HETATM 3954 O  O     . HOH L 9 .   ? 44.955 -14.270 10.455  1.00 15.66 ? 646  HOH A O     1 
HETATM 3955 O  O     . HOH L 9 .   ? 65.816 -15.246 11.729  1.00 18.18 ? 647  HOH A O     1 
HETATM 3956 O  O     . HOH L 9 .   ? 41.173 6.771   19.084  1.00 15.42 ? 648  HOH A O     1 
HETATM 3957 O  O     . HOH L 9 .   ? 65.735 -6.490  -13.744 1.00 16.58 ? 649  HOH A O     1 
HETATM 3958 O  O     . HOH L 9 .   ? 59.367 11.123  8.508   1.00 18.54 ? 650  HOH A O     1 
HETATM 3959 O  O     . HOH L 9 .   ? 64.143 -9.262  -14.333 1.00 16.48 ? 651  HOH A O     1 
HETATM 3960 O  O     . HOH L 9 .   ? 60.453 -17.802 -7.374  1.00 24.32 ? 652  HOH A O     1 
HETATM 3961 O  O     . HOH L 9 .   ? 53.663 13.567  -9.951  1.00 16.35 ? 653  HOH A O     1 
HETATM 3962 O  O     . HOH L 9 .   ? 45.056 7.620   -10.403 1.00 21.33 ? 654  HOH A O     1 
HETATM 3963 O  O     . HOH L 9 .   ? 68.485 -15.814 -7.563  1.00 22.73 ? 655  HOH A O     1 
HETATM 3964 O  O     . HOH L 9 .   ? 58.492 -9.072  -14.142 1.00 23.26 ? 656  HOH A O     1 
HETATM 3965 O  O     . HOH L 9 .   ? 43.711 9.842   -10.083 1.00 18.30 ? 657  HOH A O     1 
HETATM 3966 O  O     . HOH L 9 .   ? 53.144 -33.461 -0.275  1.00 19.61 ? 658  HOH A O     1 
HETATM 3967 O  O     . HOH L 9 .   ? 41.307 16.986  -14.942 1.00 22.54 ? 659  HOH A O     1 
HETATM 3968 O  O     . HOH L 9 .   ? 48.883 -9.459  10.494  1.00 23.15 ? 660  HOH A O     1 
HETATM 3969 O  O     . HOH L 9 .   ? 49.213 7.503   -7.680  1.00 21.27 ? 661  HOH A O     1 
HETATM 3970 O  O     . HOH L 9 .   ? 48.917 2.845   21.297  1.00 21.79 ? 662  HOH A O     1 
HETATM 3971 O  O     . HOH L 9 .   ? 59.566 4.932   16.650  1.00 24.94 ? 663  HOH A O     1 
HETATM 3972 O  O     . HOH L 9 .   ? 48.522 -36.885 2.536   1.00 24.89 ? 664  HOH A O     1 
HETATM 3973 O  O     . HOH L 9 .   ? 52.726 1.338   9.233   1.00 20.81 ? 665  HOH A O     1 
HETATM 3974 O  O     . HOH L 9 .   ? 52.381 20.252  4.903   1.00 19.43 ? 666  HOH A O     1 
HETATM 3975 O  O     . HOH L 9 .   ? 50.522 -34.791 -0.901  1.00 22.33 ? 667  HOH A O     1 
HETATM 3976 O  O     . HOH L 9 .   ? 23.215 14.176  -9.093  1.00 29.03 ? 668  HOH A O     1 
HETATM 3977 O  O     . HOH L 9 .   ? 65.742 -22.974 3.290   1.00 14.15 ? 669  HOH A O     1 
HETATM 3978 O  O     . HOH L 9 .   ? 51.178 3.413   10.258  1.00 20.83 ? 670  HOH A O     1 
HETATM 3979 O  O     . HOH L 9 .   ? 58.166 -14.281 -12.997 1.00 23.41 ? 671  HOH A O     1 
HETATM 3980 O  O     . HOH L 9 .   ? 46.792 -0.317  -15.074 1.00 21.16 ? 672  HOH A O     1 
HETATM 3981 O  O     . HOH L 9 .   ? 58.349 -17.918 19.824  1.00 25.26 ? 673  HOH A O     1 
HETATM 3982 O  O     . HOH L 9 .   ? 54.015 15.404  -6.823  1.00 19.40 ? 674  HOH A O     1 
HETATM 3983 O  O     . HOH L 9 .   ? 42.802 15.512  23.601  1.00 20.97 ? 675  HOH A O     1 
HETATM 3984 O  O     . HOH L 9 .   ? 70.858 -19.093 1.390   1.00 17.07 ? 676  HOH A O     1 
HETATM 3985 O  O     . HOH L 9 .   ? 78.194 -0.866  5.455   1.00 18.49 ? 677  HOH A O     1 
HETATM 3986 O  O     . HOH L 9 .   ? 53.188 -20.348 -5.097  1.00 27.85 ? 678  HOH A O     1 
HETATM 3987 O  O     . HOH L 9 .   ? 44.072 -15.179 1.381   1.00 17.34 ? 679  HOH A O     1 
HETATM 3988 O  O     . HOH L 9 .   ? 51.075 0.479   -15.956 1.00 25.40 ? 680  HOH A O     1 
HETATM 3989 O  O     . HOH L 9 .   ? 41.141 7.646   -18.519 1.00 19.12 ? 681  HOH A O     1 
HETATM 3990 O  O     . HOH L 9 .   ? 57.928 -7.694  8.091   1.00 23.84 ? 682  HOH A O     1 
HETATM 3991 O  O     . HOH L 9 .   ? 61.521 14.592  8.569   1.00 24.04 ? 683  HOH A O     1 
HETATM 3992 O  O     . HOH L 9 .   ? 71.626 6.049   -7.158  1.00 21.57 ? 684  HOH A O     1 
HETATM 3993 O  O     . HOH L 9 .   ? 69.423 4.585   3.810   1.00 25.71 ? 685  HOH A O     1 
HETATM 3994 O  O     . HOH L 9 .   ? 61.620 8.122   9.721   1.00 20.57 ? 686  HOH A O     1 
HETATM 3995 O  O     . HOH L 9 .   ? 44.057 11.051  -12.560 1.00 21.34 ? 687  HOH A O     1 
HETATM 3996 O  O     . HOH L 9 .   ? 51.667 -8.614  4.954   1.00 25.38 ? 688  HOH A O     1 
HETATM 3997 O  O     . HOH L 9 .   ? 65.813 -22.307 -7.811  1.00 29.43 ? 689  HOH A O     1 
HETATM 3998 O  O     . HOH L 9 .   ? 51.612 5.238   -10.854 1.00 23.04 ? 690  HOH A O     1 
HETATM 3999 O  O     . HOH L 9 .   ? 63.102 -26.716 7.058   1.00 21.26 ? 691  HOH A O     1 
HETATM 4000 O  O     . HOH L 9 .   ? 59.854 13.020  11.276  1.00 20.86 ? 692  HOH A O     1 
HETATM 4001 O  O     . HOH L 9 .   ? 42.166 -18.924 14.793  1.00 22.57 ? 693  HOH A O     1 
HETATM 4002 O  O     . HOH L 9 .   ? 64.629 6.654   -0.417  1.00 19.51 ? 694  HOH A O     1 
HETATM 4003 O  O     . HOH L 9 .   ? 75.242 0.332   -3.666  1.00 27.44 ? 695  HOH A O     1 
HETATM 4004 O  O     . HOH L 9 .   ? 29.528 3.790   6.445   1.00 33.80 ? 696  HOH A O     1 
HETATM 4005 O  O     . HOH L 9 .   ? 56.631 21.649  18.140  1.00 23.50 ? 697  HOH A O     1 
HETATM 4006 O  O     . HOH L 9 .   ? 36.771 13.006  12.029  1.00 23.05 ? 698  HOH A O     1 
HETATM 4007 O  O     . HOH L 9 .   ? 34.637 14.991  11.404  1.00 22.94 ? 699  HOH A O     1 
HETATM 4008 O  O     . HOH L 9 .   ? 41.651 15.419  -23.224 1.00 26.75 ? 700  HOH A O     1 
HETATM 4009 O  O     . HOH L 9 .   ? 63.438 12.918  -10.817 1.00 23.21 ? 701  HOH A O     1 
HETATM 4010 O  O     . HOH L 9 .   ? 41.557 20.327  4.833   1.00 23.76 ? 702  HOH A O     1 
HETATM 4011 O  O     . HOH L 9 .   ? 70.620 -17.226 12.462  1.00 26.41 ? 703  HOH A O     1 
HETATM 4012 O  O     . HOH L 9 .   ? 54.494 15.443  23.231  1.00 30.55 ? 704  HOH A O     1 
HETATM 4013 O  O     . HOH L 9 .   ? 41.694 -30.484 -6.560  1.00 24.36 ? 705  HOH A O     1 
HETATM 4014 O  O     . HOH L 9 .   ? 56.294 18.703  18.137  1.00 22.26 ? 706  HOH A O     1 
HETATM 4015 O  O     . HOH L 9 .   ? 70.751 0.535   11.413  1.00 32.77 ? 707  HOH A O     1 
HETATM 4016 O  O     . HOH L 9 .   ? 63.376 -18.973 -1.466  1.00 25.05 ? 708  HOH A O     1 
HETATM 4017 O  O     . HOH L 9 .   ? 47.197 2.407   -1.260  1.00 22.26 ? 709  HOH A O     1 
HETATM 4018 O  O     . HOH L 9 .   ? 67.497 -6.357  12.918  1.00 23.17 ? 710  HOH A O     1 
HETATM 4019 O  O     . HOH L 9 .   ? 62.796 -17.061 -7.245  1.00 25.08 ? 711  HOH A O     1 
HETATM 4020 O  O     . HOH L 9 .   ? 47.488 -16.464 -1.194  1.00 30.55 ? 712  HOH A O     1 
HETATM 4021 O  O     . HOH L 9 .   ? 61.199 21.012  11.789  1.00 29.97 ? 713  HOH A O     1 
HETATM 4022 O  O     . HOH L 9 .   ? 41.394 -23.848 -4.988  1.00 26.37 ? 714  HOH A O     1 
HETATM 4023 O  O     . HOH L 9 .   ? 51.499 8.882   -15.516 1.00 29.10 ? 715  HOH A O     1 
HETATM 4024 O  O     . HOH L 9 .   ? 58.186 -27.606 11.292  1.00 19.22 ? 716  HOH A O     1 
HETATM 4025 O  O     . HOH L 9 .   ? 63.198 -7.336  12.862  1.00 25.64 ? 717  HOH A O     1 
HETATM 4026 O  O     . HOH L 9 .   ? 57.449 -16.537 -11.410 1.00 25.88 ? 718  HOH A O     1 
HETATM 4027 O  O     . HOH L 9 .   ? 47.018 16.147  -23.775 1.00 24.79 ? 719  HOH A O     1 
HETATM 4028 O  O     . HOH L 9 .   ? 48.227 -17.957 17.155  1.00 29.14 ? 720  HOH A O     1 
HETATM 4029 O  O     . HOH L 9 .   ? 59.898 10.371  19.719  1.00 22.56 ? 721  HOH A O     1 
HETATM 4030 O  O     . HOH L 9 .   ? 46.837 19.508  1.321   1.00 24.51 ? 722  HOH A O     1 
HETATM 4031 O  O     . HOH L 9 .   ? 49.957 -3.289  -17.325 1.00 19.08 ? 723  HOH A O     1 
HETATM 4032 O  O     . HOH L 9 .   ? 46.866 -14.653 14.842  1.00 30.48 ? 724  HOH A O     1 
HETATM 4033 O  O     . HOH L 9 .   ? 49.516 8.478   -13.572 1.00 26.02 ? 725  HOH A O     1 
HETATM 4034 O  O     . HOH L 9 .   ? 55.669 -32.941 5.024   1.00 30.23 ? 726  HOH A O     1 
HETATM 4035 O  O     . HOH L 9 .   ? 68.184 -14.550 -9.994  1.00 23.51 ? 727  HOH A O     1 
HETATM 4036 O  O     . HOH L 9 .   ? 50.179 2.926   12.603  1.00 28.15 ? 728  HOH A O     1 
HETATM 4037 O  O     . HOH L 9 .   ? 63.101 9.510   -13.419 1.00 28.36 ? 729  HOH A O     1 
HETATM 4038 O  O     . HOH L 9 .   ? 47.827 15.979  -17.570 1.00 36.89 ? 730  HOH A O     1 
HETATM 4039 O  O     . HOH L 9 .   ? 48.348 -33.334 -3.753  1.00 26.01 ? 731  HOH A O     1 
HETATM 4040 O  O     . HOH L 9 .   ? 34.635 17.794  -12.680 1.00 24.83 ? 732  HOH A O     1 
HETATM 4041 O  O     . HOH L 9 .   ? 47.388 0.347   6.515   1.00 26.39 ? 733  HOH A O     1 
HETATM 4042 O  O     . HOH L 9 .   ? 72.246 -3.737  -13.723 1.00 20.61 ? 734  HOH A O     1 
HETATM 4043 O  O     . HOH L 9 .   ? 45.018 16.901  -18.181 1.00 31.85 ? 735  HOH A O     1 
HETATM 4044 O  O     . HOH L 9 .   ? 58.714 15.328  -10.675 1.00 26.46 ? 736  HOH A O     1 
HETATM 4045 O  O     . HOH L 9 .   ? 65.206 12.918  3.253   1.00 31.46 ? 737  HOH A O     1 
HETATM 4046 O  O     . HOH L 9 .   ? 76.552 2.807   6.908   1.00 27.95 ? 738  HOH A O     1 
HETATM 4047 O  O     . HOH L 9 .   ? 65.713 5.788   2.054   1.00 25.64 ? 739  HOH A O     1 
HETATM 4048 O  O     . HOH L 9 .   ? 48.464 19.903  4.804   1.00 31.59 ? 740  HOH A O     1 
HETATM 4049 O  O     . HOH L 9 .   ? 61.999 -18.751 21.835  1.00 35.27 ? 741  HOH A O     1 
HETATM 4050 O  O     . HOH L 9 .   ? 45.798 7.836   -13.132 1.00 31.38 ? 742  HOH A O     1 
HETATM 4051 O  O     . HOH L 9 .   ? 42.870 17.393  -17.055 1.00 30.04 ? 743  HOH A O     1 
HETATM 4052 O  O     . HOH L 9 .   ? 48.118 10.927  -9.695  1.00 27.48 ? 744  HOH A O     1 
HETATM 4053 O  O     . HOH L 9 .   ? 60.180 14.459  3.466   1.00 26.39 ? 745  HOH A O     1 
HETATM 4054 O  O     . HOH L 9 .   ? 62.123 -25.570 4.987   1.00 24.20 ? 746  HOH A O     1 
HETATM 4055 O  O     . HOH L 9 .   ? 72.228 -7.733  11.683  1.00 17.69 ? 747  HOH A O     1 
HETATM 4056 O  O     . HOH L 9 .   ? 49.656 -9.227  -8.647  1.00 27.47 ? 748  HOH A O     1 
HETATM 4057 O  O     . HOH L 9 .   ? 46.194 -9.584  10.871  1.00 31.26 ? 749  HOH A O     1 
HETATM 4058 O  O     . HOH L 9 .   ? 45.857 18.357  -3.381  1.00 29.73 ? 750  HOH A O     1 
HETATM 4059 O  O     . HOH L 9 .   ? 53.904 16.267  -9.283  1.00 30.45 ? 751  HOH A O     1 
HETATM 4060 O  O     . HOH L 9 .   ? 53.367 19.403  -1.545  1.00 23.31 ? 752  HOH A O     1 
HETATM 4061 O  O     . HOH L 9 .   ? 47.162 16.377  25.575  1.00 25.85 ? 753  HOH A O     1 
HETATM 4062 O  O     . HOH L 9 .   ? 45.974 1.922   18.483  1.00 33.03 ? 754  HOH A O     1 
HETATM 4063 O  O     . HOH L 9 .   ? 69.808 5.528   1.209   1.00 31.82 ? 755  HOH A O     1 
HETATM 4064 O  O     . HOH L 9 .   ? 47.953 -27.133 -7.217  1.00 24.51 ? 756  HOH A O     1 
HETATM 4065 O  O     . HOH L 9 .   ? 68.765 -10.835 12.125  1.00 25.12 ? 757  HOH A O     1 
HETATM 4066 O  O     . HOH L 9 .   ? 65.174 19.565  1.871   1.00 26.18 ? 758  HOH A O     1 
HETATM 4067 O  O     . HOH L 9 .   ? 34.304 5.886   -21.919 1.00 28.88 ? 759  HOH A O     1 
HETATM 4068 O  O     . HOH L 9 .   ? 63.028 -23.643 3.475   1.00 27.42 ? 760  HOH A O     1 
HETATM 4069 O  O     . HOH L 9 .   ? 53.742 6.020   -12.388 1.00 25.89 ? 761  HOH A O     1 
HETATM 4070 O  O     . HOH L 9 .   ? 33.513 2.539   -0.464  1.00 30.05 ? 762  HOH A O     1 
HETATM 4071 O  O     . HOH L 9 .   ? 37.084 16.098  -4.235  1.00 23.98 ? 763  HOH A O     1 
HETATM 4072 O  O     . HOH L 9 .   ? 53.766 7.764   -14.589 1.00 30.97 ? 764  HOH A O     1 
HETATM 4073 O  O     . HOH L 9 .   ? 67.861 1.950   12.192  1.00 44.65 ? 765  HOH A O     1 
HETATM 4074 O  O     . HOH L 9 .   ? 52.849 -19.755 22.119  1.00 28.71 ? 766  HOH A O     1 
HETATM 4075 O  O     . HOH L 9 .   ? 55.459 -7.358  6.392   1.00 25.92 ? 767  HOH A O     1 
HETATM 4076 O  O     . HOH L 9 .   ? 60.524 9.796   22.373  1.00 36.37 ? 768  HOH A O     1 
HETATM 4077 O  O     . HOH L 9 .   ? 68.481 -26.325 -0.718  1.00 27.51 ? 769  HOH A O     1 
HETATM 4078 O  O     . HOH L 9 .   ? 42.381 -8.907  9.574   1.00 31.74 ? 770  HOH A O     1 
HETATM 4079 O  O     . HOH L 9 .   ? 69.758 -12.993 -11.402 1.00 30.20 ? 771  HOH A O     1 
HETATM 4080 O  O     . HOH L 9 .   ? 43.749 -33.603 5.635   1.00 33.74 ? 772  HOH A O     1 
HETATM 4081 O  O     . HOH L 9 .   ? 52.752 8.289   25.368  1.00 29.16 ? 773  HOH A O     1 
HETATM 4082 O  O     . HOH L 9 .   ? 53.980 -32.458 -2.842  1.00 31.75 ? 774  HOH A O     1 
HETATM 4083 O  O     . HOH L 9 .   ? 56.395 -3.180  4.284   1.00 34.47 ? 775  HOH A O     1 
HETATM 4084 O  O     . HOH L 9 .   ? 21.673 13.803  6.848   1.00 33.79 ? 776  HOH A O     1 
HETATM 4085 O  O     . HOH L 9 .   ? 34.497 19.893  -16.222 1.00 28.54 ? 777  HOH A O     1 
HETATM 4086 O  O     . HOH L 9 .   ? 48.967 13.587  28.187  1.00 30.05 ? 778  HOH A O     1 
HETATM 4087 O  O     . HOH L 9 .   ? 55.852 13.771  -11.489 1.00 29.64 ? 779  HOH A O     1 
HETATM 4088 O  O     . HOH L 9 .   ? 65.641 8.442   8.888   1.00 28.42 ? 780  HOH A O     1 
HETATM 4089 O  O     . HOH L 9 .   ? 66.306 -26.222 0.621   1.00 31.87 ? 781  HOH A O     1 
HETATM 4090 O  O     . HOH L 9 .   ? 39.756 7.059   13.641  1.00 27.78 ? 782  HOH A O     1 
HETATM 4091 O  O     . HOH L 9 .   ? 51.492 6.190   -18.959 1.00 33.37 ? 783  HOH A O     1 
HETATM 4092 O  O     . HOH L 9 .   ? 55.858 -1.416  -14.777 1.00 26.91 ? 784  HOH A O     1 
HETATM 4093 O  O     . HOH L 9 .   ? 45.010 20.643  3.727   1.00 30.97 ? 785  HOH A O     1 
HETATM 4094 O  O     . HOH L 9 .   ? 47.217 -20.152 18.389  1.00 30.28 ? 786  HOH A O     1 
HETATM 4095 O  O     . HOH L 9 .   ? 57.808 23.544  14.085  1.00 29.74 ? 787  HOH A O     1 
HETATM 4096 O  O     . HOH L 9 .   ? 76.662 1.311   -5.649  1.00 31.01 ? 788  HOH A O     1 
HETATM 4097 O  O     . HOH L 9 .   ? 52.942 -26.526 -3.945  1.00 23.39 ? 789  HOH A O     1 
HETATM 4098 O  O     . HOH L 9 .   ? 29.462 18.026  -16.244 1.00 38.88 ? 790  HOH A O     1 
HETATM 4099 O  O     . HOH L 9 .   ? 65.020 -8.967  12.218  1.00 37.13 ? 791  HOH A O     1 
HETATM 4100 O  O     . HOH L 9 .   ? 62.134 -12.947 -12.858 1.00 35.99 ? 792  HOH A O     1 
HETATM 4101 O  O     . HOH L 9 .   ? 60.937 -15.743 13.625  1.00 30.21 ? 793  HOH A O     1 
HETATM 4102 O  O     . HOH L 9 .   ? 51.473 13.535  -11.442 1.00 28.31 ? 794  HOH A O     1 
HETATM 4103 O  O     . HOH L 9 .   ? 69.224 1.725   -15.786 1.00 34.66 ? 795  HOH A O     1 
HETATM 4104 O  O     . HOH L 9 .   ? 52.623 3.531   17.627  1.00 25.43 ? 796  HOH A O     1 
HETATM 4105 O  O     . HOH L 9 .   ? 61.640 -28.083 4.126   1.00 35.52 ? 797  HOH A O     1 
HETATM 4106 O  O     . HOH L 9 .   ? 56.352 1.218   13.134  1.00 30.51 ? 798  HOH A O     1 
HETATM 4107 O  O     . HOH L 9 .   ? 51.228 -8.842  -5.388  1.00 28.13 ? 799  HOH A O     1 
HETATM 4108 O  O     . HOH L 9 .   ? 51.409 -29.257 16.660  1.00 34.18 ? 800  HOH A O     1 
HETATM 4109 O  O     . HOH L 9 .   ? 47.027 -22.597 17.275  1.00 25.09 ? 801  HOH A O     1 
HETATM 4110 O  O     . HOH L 9 .   ? 58.986 4.666   23.047  1.00 26.96 ? 802  HOH A O     1 
HETATM 4111 O  O     . HOH L 9 .   ? 50.774 17.646  -6.009  1.00 30.65 ? 803  HOH A O     1 
HETATM 4112 O  O     . HOH L 9 .   ? 71.394 9.065   -6.611  1.00 27.68 ? 804  HOH A O     1 
HETATM 4113 O  O     . HOH L 9 .   ? 44.513 10.495  -24.640 1.00 29.60 ? 805  HOH A O     1 
HETATM 4114 O  O     . HOH L 9 .   ? 55.541 -20.657 21.242  1.00 25.94 ? 806  HOH A O     1 
HETATM 4115 O  O     . HOH L 9 .   ? 59.299 -18.503 -9.828  1.00 36.31 ? 807  HOH A O     1 
HETATM 4116 O  O     . HOH L 9 .   ? 80.924 -15.789 7.667   1.00 30.95 ? 808  HOH A O     1 
HETATM 4117 O  O     . HOH L 9 .   ? 43.028 -1.429  -24.836 1.00 32.15 ? 809  HOH A O     1 
HETATM 4118 O  O     . HOH L 9 .   ? 41.227 18.819  -18.972 1.00 27.09 ? 810  HOH A O     1 
HETATM 4119 O  O     . HOH L 9 .   ? 61.622 -31.548 -10.575 1.00 31.55 ? 811  HOH A O     1 
HETATM 4120 O  O     . HOH L 9 .   ? 73.564 4.460   -1.070  1.00 36.01 ? 812  HOH A O     1 
HETATM 4121 O  O     . HOH L 9 .   ? 61.826 1.812   14.065  1.00 31.34 ? 813  HOH A O     1 
HETATM 4122 O  O     . HOH L 9 .   ? 69.720 10.043  -8.346  1.00 28.16 ? 814  HOH A O     1 
HETATM 4123 O  O     . HOH L 9 .   ? 66.090 -4.107  -15.137 1.00 28.02 ? 815  HOH A O     1 
HETATM 4124 O  O     . HOH L 9 .   ? 50.831 5.738   -23.368 1.00 34.60 ? 816  HOH A O     1 
HETATM 4125 O  O     . HOH L 9 .   ? 57.972 12.327  -11.942 1.00 40.77 ? 817  HOH A O     1 
HETATM 4126 O  O     . HOH L 9 .   ? 45.160 0.579   -18.447 1.00 29.22 ? 818  HOH A O     1 
HETATM 4127 O  O     . HOH L 9 .   ? 53.172 30.790  5.207   1.00 37.60 ? 819  HOH A O     1 
HETATM 4128 O  O     . HOH L 9 .   ? 65.112 -34.539 -5.923  1.00 28.96 ? 820  HOH A O     1 
HETATM 4129 O  O     . HOH L 9 .   ? 60.636 -28.435 8.307   1.00 23.66 ? 821  HOH A O     1 
HETATM 4130 O  O     . HOH L 9 .   ? 48.188 -19.131 -5.529  1.00 30.43 ? 822  HOH A O     1 
HETATM 4131 O  O     . HOH L 9 .   ? 38.522 -22.981 11.391  1.00 36.85 ? 823  HOH A O     1 
HETATM 4132 O  O     . HOH L 9 .   ? 72.960 2.173   8.049   1.00 31.83 ? 824  HOH A O     1 
HETATM 4133 O  O     . HOH L 9 .   ? 24.207 16.247  3.281   1.00 28.36 ? 825  HOH A O     1 
HETATM 4134 O  O     . HOH L 9 .   ? 43.595 -28.832 15.706  1.00 32.95 ? 826  HOH A O     1 
HETATM 4135 O  O     . HOH L 9 .   ? 52.980 -12.589 -4.083  1.00 25.97 ? 827  HOH A O     1 
HETATM 4136 O  O     . HOH L 9 .   ? 62.030 11.937  9.453   1.00 33.97 ? 828  HOH A O     1 
HETATM 4137 O  O     . HOH L 9 .   ? 83.805 -7.979  0.789   1.00 35.99 ? 829  HOH A O     1 
HETATM 4138 O  O     . HOH L 9 .   ? 60.366 6.165   -15.554 1.00 27.90 ? 830  HOH A O     1 
HETATM 4139 O  O     . HOH L 9 .   ? 79.073 3.750   2.352   1.00 36.90 ? 831  HOH A O     1 
HETATM 4140 O  O     . HOH L 9 .   ? 50.617 14.090  -20.313 1.00 41.30 ? 832  HOH A O     1 
HETATM 4141 O  O     . HOH L 9 .   ? 53.628 -8.468  8.778   1.00 24.98 ? 833  HOH A O     1 
HETATM 4142 O  O     . HOH L 9 .   ? 54.901 -34.117 12.192  1.00 34.76 ? 834  HOH A O     1 
HETATM 4143 O  O     . HOH L 9 .   ? 40.898 14.026  -6.589  1.00 28.43 ? 835  HOH A O     1 
HETATM 4144 O  O     . HOH L 9 .   ? 20.187 10.244  8.810   1.00 36.79 ? 836  HOH A O     1 
HETATM 4145 O  O     . HOH L 9 .   ? 39.587 4.595   18.366  1.00 37.00 ? 837  HOH A O     1 
HETATM 4146 O  O     . HOH L 9 .   ? 32.241 -1.480  -2.854  1.00 41.86 ? 838  HOH A O     1 
HETATM 4147 O  O     . HOH L 9 .   ? 52.360 -5.703  -0.891  1.00 29.40 ? 839  HOH A O     1 
HETATM 4148 O  O     . HOH L 9 .   ? 57.427 -34.837 8.432   1.00 32.24 ? 840  HOH A O     1 
HETATM 4149 O  O     . HOH L 9 .   ? 68.887 -1.446  -12.981 1.00 38.47 ? 841  HOH A O     1 
HETATM 4150 O  O     . HOH L 9 .   ? 57.783 3.144   18.062  1.00 22.57 ? 842  HOH A O     1 
HETATM 4151 O  O     . HOH L 9 .   ? 42.560 13.068  -23.742 1.00 34.41 ? 843  HOH A O     1 
HETATM 4152 O  O     . HOH L 9 .   ? 85.558 -9.230  8.283   1.00 44.48 ? 844  HOH A O     1 
HETATM 4153 O  O     . HOH L 9 .   ? 34.065 15.509  18.454  1.00 30.23 ? 845  HOH A O     1 
HETATM 4154 O  O     . HOH L 9 .   ? 38.461 -18.031 10.066  1.00 28.07 ? 846  HOH A O     1 
HETATM 4155 O  O     . HOH L 9 .   ? 65.342 19.894  6.622   1.00 34.98 ? 847  HOH A O     1 
HETATM 4156 O  O     . HOH L 9 .   ? 60.909 9.842   6.912   1.00 33.83 ? 848  HOH A O     1 
HETATM 4157 O  O     . HOH L 9 .   ? 38.827 -19.793 12.371  1.00 38.58 ? 849  HOH A O     1 
HETATM 4158 O  O     . HOH L 9 .   ? 48.541 22.138  3.086   1.00 41.30 ? 850  HOH A O     1 
HETATM 4159 O  O     . HOH L 9 .   ? 70.778 -6.899  13.867  1.00 31.92 ? 851  HOH A O     1 
HETATM 4160 O  O     . HOH L 9 .   ? 44.430 15.719  26.073  1.00 29.02 ? 852  HOH A O     1 
HETATM 4161 O  O     . HOH L 9 .   ? 69.879 -18.632 -9.606  1.00 38.91 ? 853  HOH A O     1 
HETATM 4162 O  O     . HOH L 9 .   ? 46.501 -18.664 -2.516  1.00 31.81 ? 854  HOH A O     1 
HETATM 4163 O  O     . HOH L 9 .   ? 63.588 -4.590  -15.486 1.00 32.35 ? 855  HOH A O     1 
HETATM 4164 O  O     . HOH L 9 .   ? 49.300 15.054  -22.600 1.00 32.58 ? 856  HOH A O     1 
HETATM 4165 O  O     . HOH L 9 .   ? 67.629 6.533   1.073   1.00 30.20 ? 857  HOH A O     1 
HETATM 4166 O  O     . HOH L 9 .   ? 59.827 -31.518 3.645   1.00 31.33 ? 858  HOH A O     1 
HETATM 4167 O  O     . HOH L 9 .   ? 44.056 0.586   -21.026 1.00 34.44 ? 859  HOH A O     1 
HETATM 4168 O  O     . HOH L 9 .   ? 41.085 -1.819  -16.603 1.00 33.30 ? 860  HOH A O     1 
HETATM 4169 O  O     . HOH L 9 .   ? 58.261 -0.158  -14.498 1.00 29.84 ? 861  HOH A O     1 
HETATM 4170 O  O     . HOH L 9 .   ? 37.120 18.734  16.926  1.00 29.85 ? 862  HOH A O     1 
HETATM 4171 O  O     . HOH L 9 .   ? 51.640 -35.102 7.792   1.00 30.31 ? 863  HOH A O     1 
HETATM 4172 O  O     . HOH L 9 .   ? 46.561 18.606  -14.426 1.00 42.91 ? 864  HOH A O     1 
HETATM 4173 O  O     . HOH L 9 .   ? 50.552 -13.232 -0.804  1.00 30.04 ? 865  HOH A O     1 
HETATM 4174 O  O     . HOH L 9 .   ? 39.583 18.660  18.250  1.00 32.92 ? 866  HOH A O     1 
HETATM 4175 O  O     . HOH L 9 .   ? 38.265 10.355  9.510   1.00 27.20 ? 867  HOH A O     1 
HETATM 4176 O  O     . HOH L 9 .   ? 68.083 10.425  7.648   1.00 34.01 ? 868  HOH A O     1 
HETATM 4177 O  O     . HOH L 9 .   ? 71.757 -19.114 14.123  1.00 34.59 ? 869  HOH A O     1 
HETATM 4178 O  O     . HOH L 9 .   ? 66.552 3.812   10.776  1.00 31.53 ? 870  HOH A O     1 
HETATM 4179 O  O     . HOH L 9 .   ? 50.081 -8.749  13.216  1.00 30.44 ? 871  HOH A O     1 
HETATM 4180 O  O     . HOH L 9 .   ? 69.731 -8.941  10.721  1.00 24.44 ? 872  HOH A O     1 
HETATM 4181 O  O     . HOH L 9 .   ? 40.273 -18.172 -1.662  1.00 34.00 ? 873  HOH A O     1 
HETATM 4182 O  O     . HOH L 9 .   ? 46.415 2.502   -3.979  1.00 35.98 ? 874  HOH A O     1 
HETATM 4183 O  O     . HOH L 9 .   ? 35.493 22.487  -3.273  1.00 40.03 ? 875  HOH A O     1 
HETATM 4184 O  O     . HOH L 9 .   ? 46.373 -31.038 12.889  1.00 41.36 ? 876  HOH A O     1 
HETATM 4185 O  O     . HOH L 9 .   ? 49.034 -0.437  -16.841 1.00 29.00 ? 877  HOH A O     1 
HETATM 4186 O  O     . HOH L 9 .   ? 63.579 -17.337 15.305  1.00 30.31 ? 878  HOH A O     1 
HETATM 4187 O  O     . HOH L 9 .   ? 43.344 -15.898 -2.746  1.00 38.94 ? 879  HOH A O     1 
HETATM 4188 O  O     . HOH L 9 .   ? 40.583 15.698  -8.724  1.00 36.61 ? 880  HOH A O     1 
HETATM 4189 O  O     . HOH L 9 .   ? 80.796 -18.219 -12.600 1.00 48.17 ? 881  HOH A O     1 
HETATM 4190 O  O     . HOH L 9 .   ? 41.219 21.628  2.281   1.00 26.46 ? 882  HOH A O     1 
HETATM 4191 O  O     . HOH L 9 .   ? 29.004 8.194   -18.976 1.00 26.46 ? 883  HOH A O     1 
HETATM 4192 O  O     . HOH L 9 .   ? 67.406 -8.282  10.075  1.00 24.28 ? 884  HOH A O     1 
HETATM 4193 O  O     . HOH L 9 .   ? 39.281 19.775  -17.567 1.00 31.59 ? 885  HOH A O     1 
HETATM 4194 O  O     . HOH L 9 .   ? 51.363 21.953  6.888   1.00 29.63 ? 886  HOH A O     1 
HETATM 4195 O  O     . HOH L 9 .   ? 40.811 -29.581 -2.386  1.00 24.41 ? 887  HOH A O     1 
HETATM 4196 O  O     . HOH L 9 .   ? 53.307 -0.106  6.291   1.00 27.94 ? 888  HOH A O     1 
HETATM 4197 O  O     . HOH L 9 .   ? 61.776 11.519  -12.355 1.00 30.08 ? 889  HOH A O     1 
HETATM 4198 O  O     . HOH L 9 .   ? 77.199 -17.322 10.561  1.00 33.73 ? 890  HOH A O     1 
HETATM 4199 O  O     . HOH L 9 .   ? 35.484 20.920  0.463   1.00 28.05 ? 891  HOH A O     1 
HETATM 4200 O  O     . HOH L 9 .   ? 49.352 12.198  -11.513 1.00 31.41 ? 892  HOH A O     1 
HETATM 4201 O  O     . HOH L 9 .   ? 63.498 17.829  0.810   1.00 30.47 ? 893  HOH A O     1 
HETATM 4202 O  O     . HOH L 9 .   ? 64.380 -24.764 -8.039  1.00 37.55 ? 894  HOH A O     1 
HETATM 4203 O  O     . HOH L 9 .   ? 27.583 6.613   -16.866 1.00 30.66 ? 895  HOH A O     1 
HETATM 4204 O  O     . HOH L 9 .   ? 21.775 11.772  -9.260  1.00 34.07 ? 896  HOH A O     1 
HETATM 4205 O  O     . HOH L 9 .   ? 55.349 2.671   21.130  1.00 29.28 ? 897  HOH A O     1 
HETATM 4206 O  O     . HOH L 9 .   ? 53.256 24.387  4.062   1.00 28.40 ? 898  HOH A O     1 
HETATM 4207 O  O     . HOH L 9 .   ? 25.802 14.453  5.273   1.00 29.48 ? 899  HOH A O     1 
HETATM 4208 O  O     . HOH L 9 .   ? 70.434 -21.710 0.798   1.00 27.97 ? 900  HOH A O     1 
HETATM 4209 O  O     . HOH L 9 .   ? 33.680 7.701   17.367  1.00 32.18 ? 901  HOH A O     1 
HETATM 4210 O  O     . HOH L 9 .   ? 39.950 -22.389 2.933   1.00 33.61 ? 902  HOH A O     1 
HETATM 4211 O  O     . HOH L 9 .   ? 44.765 -16.932 -0.462  1.00 34.36 ? 903  HOH A O     1 
HETATM 4212 O  O     . HOH L 9 .   ? 44.928 20.480  -7.400  1.00 38.63 ? 904  HOH A O     1 
HETATM 4213 O  O     . HOH L 9 .   ? 63.633 -11.577 12.652  1.00 38.71 ? 905  HOH A O     1 
HETATM 4214 O  O     . HOH L 9 .   ? 29.837 12.531  6.873   1.00 30.89 ? 906  HOH A O     1 
HETATM 4215 O  O     . HOH L 9 .   ? 42.790 -30.220 -4.068  1.00 31.06 ? 907  HOH A O     1 
HETATM 4216 O  O     . HOH L 9 .   ? 38.539 13.802  24.427  1.00 32.17 ? 908  HOH A O     1 
HETATM 4217 O  O     . HOH L 9 .   ? 49.681 0.666   20.221  1.00 35.92 ? 909  HOH A O     1 
HETATM 4218 O  O     . HOH L 9 .   ? 62.560 11.862  5.644   1.00 32.99 ? 910  HOH A O     1 
HETATM 4219 O  O     . HOH L 9 .   ? 62.096 -23.428 -7.833  1.00 40.23 ? 911  HOH A O     1 
HETATM 4220 O  O     . HOH L 9 .   ? 33.468 11.214  8.714   1.00 38.78 ? 912  HOH A O     1 
HETATM 4221 O  O     . HOH L 9 .   ? 60.647 13.827  6.095   1.00 35.71 ? 913  HOH A O     1 
HETATM 4222 O  O     . HOH L 9 .   ? 44.764 -33.071 -3.021  1.00 29.66 ? 914  HOH A O     1 
HETATM 4223 O  O     . HOH L 9 .   ? 37.439 15.224  -20.449 1.00 33.86 ? 915  HOH A O     1 
HETATM 4224 O  O     . HOH L 9 .   ? 36.023 10.954  10.453  1.00 31.06 ? 916  HOH A O     1 
HETATM 4225 O  O     . HOH L 9 .   ? 50.579 -6.380  -5.630  1.00 34.50 ? 917  HOH A O     1 
HETATM 4226 O  O     . HOH L 9 .   ? 59.896 3.561   20.887  1.00 34.81 ? 918  HOH A O     1 
HETATM 4227 O  O     . HOH L 9 .   ? 39.044 4.847   15.757  1.00 38.41 ? 919  HOH A O     1 
HETATM 4228 O  O     . HOH L 9 .   ? 44.780 -19.131 19.171  1.00 46.46 ? 920  HOH A O     1 
HETATM 4229 O  O     . HOH L 9 .   ? 51.858 -18.076 -6.359  1.00 35.65 ? 921  HOH A O     1 
HETATM 4230 O  O     . HOH L 9 .   ? 64.283 -15.414 13.834  1.00 32.89 ? 922  HOH A O     1 
HETATM 4231 O  O     . HOH L 9 .   ? 73.972 5.152   -8.180  1.00 30.67 ? 923  HOH A O     1 
HETATM 4232 O  O     . HOH L 9 .   ? 63.521 4.753   14.105  1.00 41.93 ? 924  HOH A O     1 
HETATM 4233 O  O     . HOH L 9 .   ? 62.147 7.721   16.147  1.00 38.53 ? 925  HOH A O     1 
HETATM 4234 O  O     . HOH L 9 .   ? 39.822 -13.239 11.032  1.00 34.80 ? 926  HOH A O     1 
HETATM 4235 O  O     . HOH L 9 .   ? 51.129 -22.811 -5.591  1.00 31.86 ? 927  HOH A O     1 
HETATM 4236 O  O     . HOH L 9 .   ? 45.886 12.115  -8.771  1.00 31.65 ? 928  HOH A O     1 
HETATM 4237 O  O     . HOH L 9 .   ? 79.408 -20.868 -4.263  1.00 39.44 ? 929  HOH A O     1 
HETATM 4238 O  O     . HOH L 9 .   ? 55.725 5.673   24.946  1.00 33.31 ? 930  HOH A O     1 
HETATM 4239 O  O     . HOH L 9 .   ? 47.543 -4.561  -16.400 1.00 29.94 ? 931  HOH A O     1 
HETATM 4240 O  O     . HOH L 9 .   ? 82.411 -10.247 -0.755  1.00 36.25 ? 932  HOH A O     1 
HETATM 4241 O  O     . HOH L 9 .   ? 42.509 -20.599 16.950  1.00 36.74 ? 933  HOH A O     1 
HETATM 4242 O  O     . HOH L 9 .   ? 48.517 -29.669 16.204  1.00 39.37 ? 934  HOH A O     1 
HETATM 4243 O  O     . HOH L 9 .   ? 61.891 4.627   -17.087 1.00 31.10 ? 935  HOH A O     1 
HETATM 4244 O  O     . HOH L 9 .   ? 42.441 5.486   21.109  1.00 33.66 ? 936  HOH A O     1 
HETATM 4245 O  O     . HOH L 9 .   ? 37.458 13.492  21.697  1.00 32.37 ? 937  HOH A O     1 
HETATM 4246 O  O     . HOH L 9 .   ? 34.771 13.982  21.809  1.00 31.85 ? 938  HOH A O     1 
HETATM 4247 O  O     . HOH L 9 .   ? 21.996 -4.203  3.343   1.00 48.83 ? 939  HOH A O     1 
HETATM 4248 O  O     . HOH L 9 .   ? 69.508 8.512   4.013   1.00 30.91 ? 940  HOH A O     1 
HETATM 4249 O  O     . HOH L 9 .   ? 75.405 -22.404 -6.249  1.00 37.95 ? 941  HOH A O     1 
HETATM 4250 O  O     . HOH L 9 .   ? 54.287 -1.176  -17.271 1.00 37.49 ? 942  HOH A O     1 
HETATM 4251 O  O     . HOH L 9 .   ? 50.783 -0.905  7.377   0.50 25.68 ? 943  HOH A O     1 
HETATM 4252 O  O     . HOH L 9 .   ? 58.293 18.040  19.660  1.00 30.89 ? 944  HOH A O     1 
HETATM 4253 O  O     . HOH L 9 .   ? 50.178 -15.823 -9.177  1.00 31.75 ? 945  HOH A O     1 
HETATM 4254 O  O     . HOH L 9 .   ? 75.577 -12.797 -15.132 1.00 35.50 ? 946  HOH A O     1 
HETATM 4255 O  O     . HOH L 9 .   ? 43.461 -32.739 -5.021  1.00 34.94 ? 947  HOH A O     1 
HETATM 4256 O  O     . HOH L 9 .   ? 40.882 -29.700 12.941  1.00 27.62 ? 948  HOH A O     1 
HETATM 4257 O  O     . HOH L 9 .   ? 40.059 -27.558 15.485  1.00 31.65 ? 949  HOH A O     1 
HETATM 4258 O  O     . HOH L 9 .   ? 43.107 -25.376 17.371  1.00 34.79 ? 950  HOH A O     1 
HETATM 4259 O  O     . HOH L 9 .   ? 76.899 -5.884  -17.916 1.00 43.22 ? 951  HOH A O     1 
HETATM 4260 O  O     . HOH L 9 .   ? 55.325 -17.477 -13.254 1.00 35.45 ? 952  HOH A O     1 
HETATM 4261 O  O     . HOH L 9 .   ? 43.391 17.544  17.805  1.00 31.49 ? 953  HOH A O     1 
HETATM 4262 O  O     . HOH L 9 .   ? 57.314 0.112   10.626  1.00 35.19 ? 954  HOH A O     1 
HETATM 4263 O  O     . HOH L 9 .   ? 61.522 7.164   22.697  1.00 43.29 ? 955  HOH A O     1 
HETATM 4264 O  O     . HOH L 9 .   ? 33.862 3.101   2.809   1.00 37.67 ? 956  HOH A O     1 
HETATM 4265 O  O     . HOH L 9 .   ? 54.535 -34.942 1.272   1.00 32.95 ? 957  HOH A O     1 
HETATM 4266 O  O     . HOH L 9 .   ? 50.725 -14.749 -3.126  1.00 37.63 ? 958  HOH A O     1 
HETATM 4267 O  O     . HOH L 9 .   ? 67.427 5.574   -16.907 1.00 35.25 ? 959  HOH A O     1 
HETATM 4268 O  O     . HOH L 9 .   ? 46.051 -10.788 0.029   1.00 29.20 ? 960  HOH A O     1 
HETATM 4269 O  O     . HOH L 9 .   ? 48.213 -11.458 -1.522  1.00 36.99 ? 961  HOH A O     1 
HETATM 4270 O  O     . HOH L 9 .   ? 63.442 7.897   11.653  1.00 40.43 ? 962  HOH A O     1 
HETATM 4271 O  O     . HOH L 9 .   ? 60.800 -0.067  -16.362 1.00 34.38 ? 963  HOH A O     1 
HETATM 4272 O  O     . HOH L 9 .   ? 49.950 -27.366 18.749  1.00 38.45 ? 964  HOH A O     1 
HETATM 4273 O  O     . HOH L 9 .   ? 52.137 1.686   13.987  1.00 36.86 ? 965  HOH A O     1 
HETATM 4274 O  O     . HOH L 9 .   ? 80.594 -4.127  13.994  1.00 38.83 ? 966  HOH A O     1 
HETATM 4275 O  O     . HOH L 9 .   ? 66.142 3.454   -17.815 1.00 39.28 ? 967  HOH A O     1 
HETATM 4276 O  O     . HOH L 9 .   ? 43.895 -1.285  -16.726 1.00 41.18 ? 968  HOH A O     1 
HETATM 4277 O  O     . HOH L 9 .   ? 20.192 7.402   -16.610 1.00 42.23 ? 969  HOH A O     1 
HETATM 4278 O  O     . HOH L 9 .   ? 33.892 22.676  -0.692  1.00 34.36 ? 970  HOH A O     1 
HETATM 4279 O  O     . HOH L 9 .   ? 55.892 -27.454 -3.984  1.00 33.86 ? 971  HOH A O     1 
HETATM 4280 O  O     . HOH L 9 .   ? 61.915 9.038   18.674  1.00 39.27 ? 972  HOH A O     1 
HETATM 4281 O  O     . HOH L 9 .   ? 49.147 -34.614 10.189  1.00 33.21 ? 973  HOH A O     1 
HETATM 4282 O  O     . HOH L 9 .   ? 64.062 -7.846  -18.243 1.00 40.75 ? 974  HOH A O     1 
HETATM 4283 O  O     . HOH L 9 .   ? 77.852 3.161   -1.574  1.00 41.49 ? 975  HOH A O     1 
HETATM 4284 O  O     . HOH L 9 .   ? 68.633 5.588   -14.518 1.00 35.16 ? 976  HOH A O     1 
HETATM 4285 O  O     . HOH L 9 .   ? 41.976 -11.644 11.810  1.00 43.13 ? 977  HOH A O     1 
HETATM 4286 O  O     . HOH L 9 .   ? 37.908 7.632   21.887  1.00 36.66 ? 978  HOH A O     1 
HETATM 4287 O  O     . HOH L 9 .   ? 44.545 13.418  -10.490 1.00 36.04 ? 979  HOH A O     1 
HETATM 4288 O  O     . HOH L 9 .   ? 63.087 15.586  6.197   1.00 41.49 ? 980  HOH A O     1 
HETATM 4289 O  O     . HOH L 9 .   ? 59.153 -33.557 2.137   1.00 36.55 ? 981  HOH A O     1 
HETATM 4290 O  O     . HOH L 9 .   ? 39.277 -22.633 5.877   1.00 38.67 ? 982  HOH A O     1 
HETATM 4291 O  O     . HOH L 9 .   ? 35.213 24.196  1.183   1.00 36.11 ? 983  HOH A O     1 
HETATM 4292 O  O     . HOH L 9 .   ? 47.530 13.950  -11.586 1.00 40.83 ? 984  HOH A O     1 
HETATM 4293 O  O     . HOH L 9 .   ? 62.356 -2.265  12.508  1.00 30.30 ? 985  HOH A O     1 
HETATM 4294 O  O     . HOH L 9 .   ? 71.391 0.120   -11.206 1.00 34.77 ? 986  HOH A O     1 
HETATM 4295 O  O     . HOH L 9 .   ? 65.645 5.836   12.626  1.00 37.97 ? 987  HOH A O     1 
HETATM 4296 O  O     . HOH L 9 .   ? 68.387 -16.741 -12.177 1.00 37.71 ? 988  HOH A O     1 
HETATM 4297 O  O     . HOH L 9 .   ? 43.882 18.299  23.319  1.00 33.79 ? 989  HOH A O     1 
HETATM 4298 O  O     . HOH L 9 .   ? 65.479 -32.299 -12.809 1.00 40.12 ? 990  HOH A O     1 
HETATM 4299 O  O     . HOH L 9 .   ? 43.318 16.056  -10.788 1.00 41.20 ? 991  HOH A O     1 
HETATM 4300 O  O     . HOH L 9 .   ? 41.015 -18.200 0.729   1.00 35.12 ? 992  HOH A O     1 
HETATM 4301 O  O     . HOH L 9 .   ? 52.955 2.473   -17.536 1.00 36.30 ? 993  HOH A O     1 
HETATM 4302 O  O     . HOH L 9 .   ? 55.749 -0.573  8.614   1.00 32.95 ? 994  HOH A O     1 
HETATM 4303 O  O     . HOH L 9 .   ? 53.122 -0.344  12.137  1.00 41.26 ? 995  HOH A O     1 
HETATM 4304 O  O     . HOH L 9 .   ? 61.781 16.122  2.348   1.00 29.05 ? 996  HOH A O     1 
HETATM 4305 O  O     . HOH L 9 .   ? 47.735 8.087   -9.773  1.00 23.56 ? 997  HOH A O     1 
HETATM 4306 O  O     . HOH L 9 .   ? 83.921 -5.146  2.590   1.00 31.23 ? 998  HOH A O     1 
HETATM 4307 O  O     . HOH L 9 .   ? 59.572 -13.237 14.979  1.00 38.36 ? 999  HOH A O     1 
HETATM 4308 O  O     . HOH L 9 .   ? 59.195 -30.517 -0.839  1.00 40.46 ? 1000 HOH A O     1 
HETATM 4309 O  O     . HOH L 9 .   ? 37.483 17.467  -6.695  1.00 38.89 ? 1001 HOH A O     1 
HETATM 4310 O  O     . HOH L 9 .   ? 70.205 6.958   -11.616 1.00 33.29 ? 1002 HOH A O     1 
HETATM 4311 O  O     . HOH L 9 .   ? 79.889 -2.350  -10.901 1.00 37.92 ? 1003 HOH A O     1 
HETATM 4312 O  O     . HOH L 9 .   ? 83.072 -3.275  -4.136  1.00 33.76 ? 1004 HOH A O     1 
HETATM 4313 O  O     . HOH L 9 .   ? 66.216 -2.602  12.772  1.00 25.53 ? 1005 HOH A O     1 
HETATM 4314 O  O     . HOH L 9 .   ? 42.435 11.209  -25.977 1.00 43.46 ? 1006 HOH A O     1 
HETATM 4315 O  O     . HOH L 9 .   ? 35.113 8.936   -21.959 1.00 35.27 ? 1007 HOH A O     1 
HETATM 4316 O  O     . HOH L 9 .   ? 81.545 -10.532 -8.489  1.00 47.32 ? 1008 HOH A O     1 
HETATM 4317 O  O     . HOH L 9 .   ? 41.524 7.324   11.388  1.00 34.77 ? 1009 HOH A O     1 
HETATM 4318 O  O     . HOH M 9 .   ? 40.677 11.496  -3.502  1.00 16.46 ? 101  HOH T O     1 
HETATM 4319 O  O     . HOH M 9 .   ? 35.966 10.973  0.876   1.00 22.73 ? 102  HOH T O     1 
HETATM 4320 O  O     . HOH M 9 .   ? 41.968 -7.326  -10.601 1.00 30.51 ? 103  HOH T O     1 
HETATM 4321 O  O     . HOH M 9 .   ? 47.434 -0.394  -8.475  1.00 30.98 ? 104  HOH T O     1 
HETATM 4322 O  O     . HOH M 9 .   ? 36.987 -23.142 -5.394  1.00 26.92 ? 105  HOH T O     1 
HETATM 4323 O  O     . HOH M 9 .   ? 31.015 -16.261 -4.479  1.00 28.26 ? 106  HOH T O     1 
HETATM 4324 O  O     . HOH M 9 .   ? 43.409 5.532   -8.997  1.00 22.58 ? 107  HOH T O     1 
HETATM 4325 O  O     . HOH M 9 .   ? 38.936 2.484   -6.677  1.00 34.79 ? 108  HOH T O     1 
HETATM 4326 O  O     . HOH M 9 .   ? 35.040 5.804   17.998  1.00 35.45 ? 109  HOH T O     1 
HETATM 4327 O  O     . HOH M 9 .   ? 42.064 8.118   3.249   1.00 29.19 ? 110  HOH T O     1 
HETATM 4328 O  O     . HOH M 9 .   ? 45.461 -5.094  -3.281  1.00 34.97 ? 111  HOH T O     1 
HETATM 4329 O  O     . HOH M 9 .   ? 40.927 -3.482  -9.346  1.00 27.61 ? 112  HOH T O     1 
HETATM 4330 O  O     . HOH M 9 .   ? 36.269 2.448   4.515   1.00 32.55 ? 113  HOH T O     1 
HETATM 4331 O  O     . HOH M 9 .   ? 40.503 8.834   8.818   1.00 32.78 ? 114  HOH T O     1 
HETATM 4332 O  O     . HOH M 9 .   ? 38.883 -2.271  -6.674  1.00 32.80 ? 115  HOH T O     1 
HETATM 4333 O  O     . HOH M 9 .   ? 36.733 -2.978  -4.399  1.00 32.02 ? 116  HOH T O     1 
HETATM 4334 O  O     . HOH M 9 .   ? 36.681 -1.879  -1.037  1.00 38.46 ? 117  HOH T O     1 
HETATM 4335 O  O     . HOH M 9 .   ? 37.941 -4.196  -8.317  1.00 34.42 ? 118  HOH T O     1 
HETATM 4336 O  O     . HOH M 9 .   ? 41.953 -20.015 -3.461  1.00 35.92 ? 119  HOH T O     1 
HETATM 4337 O  O     . HOH M 9 .   ? 40.440 -21.988 -6.726  1.00 35.42 ? 120  HOH T O     1 
HETATM 4338 O  O     . HOH M 9 .   ? 44.524 -8.374  -3.692  1.00 31.91 ? 121  HOH T O     1 
HETATM 4339 O  O     . HOH M 9 .   ? 38.980 -10.169 -10.088 1.00 28.72 ? 122  HOH T O     1 
HETATM 4340 O  O     . HOH M 9 .   ? 47.148 -8.811  -4.754  1.00 35.76 ? 123  HOH T O     1 
HETATM 4341 O  O     . HOH M 9 .   ? 34.079 8.911   11.355  1.00 34.25 ? 124  HOH T O     1 
HETATM 4342 O  O     . HOH M 9 .   ? 37.614 -12.726 -11.152 1.00 27.62 ? 125  HOH T O     1 
HETATM 4343 O  O     . HOH M 9 .   ? 30.361 15.365  11.093  1.00 42.48 ? 126  HOH T O     1 
HETATM 4344 O  O     . HOH M 9 .   ? 40.324 -0.604  7.915   1.00 36.84 ? 127  HOH T O     1 
HETATM 4345 O  O     . HOH M 9 .   ? 38.179 -21.704 -3.038  1.00 34.04 ? 128  HOH T O     1 
HETATM 4346 O  O     . HOH M 9 .   ? 42.734 -11.545 -11.689 1.00 47.72 ? 129  HOH T O     1 
HETATM 4347 O  O     . HOH M 9 .   ? 37.470 -0.043  4.676   1.00 36.60 ? 130  HOH T O     1 
HETATM 4348 O  O     . HOH M 9 .   ? 30.826 4.808   8.451   1.00 37.18 ? 131  HOH T O     1 
HETATM 4349 O  O     . HOH M 9 .   ? 46.670 -12.373 -10.435 1.00 40.01 ? 132  HOH T O     1 
HETATM 4350 O  O     . HOH M 9 .   ? 37.876 -22.967 -7.726  1.00 33.39 ? 133  HOH T O     1 
HETATM 4351 O  O     . HOH M 9 .   ? 44.310 0.815   -2.120  1.00 40.25 ? 134  HOH T O     1 
HETATM 4352 O  O     . HOH M 9 .   ? 43.650 5.806   0.379   1.00 32.14 ? 135  HOH T O     1 
HETATM 4353 O  O     . HOH N 9 .   ? 41.887 -11.558 -0.929  1.00 23.60 ? 201  HOH P O     1 
HETATM 4354 O  O     . HOH N 9 .   ? 49.462 -10.053 6.543   1.00 17.33 ? 202  HOH P O     1 
HETATM 4355 O  O     . HOH N 9 .   ? 42.930 -8.956  6.983   1.00 21.45 ? 203  HOH P O     1 
HETATM 4356 O  O     . HOH N 9 .   ? 41.627 -15.694 1.728   1.00 21.32 ? 204  HOH P O     1 
HETATM 4357 O  O     . HOH N 9 .   ? 45.001 -8.354  -1.048  1.00 31.22 ? 205  HOH P O     1 
HETATM 4358 O  O     . HOH N 9 .   ? 44.160 -12.882 -0.288  1.00 24.68 ? 206  HOH P O     1 
HETATM 4359 O  O     . HOH N 9 .   ? 44.370 7.425   2.331   1.00 23.99 ? 207  HOH P O     1 
HETATM 4360 O  O     . HOH N 9 .   ? 40.476 -9.393  6.049   1.00 27.09 ? 208  HOH P O     1 
HETATM 4361 O  O     . HOH N 9 .   ? 46.250 -2.538  -0.814  1.00 27.88 ? 209  HOH P O     1 
HETATM 4362 O  O     . HOH N 9 .   ? 40.179 -14.085 -0.086  1.00 29.87 ? 210  HOH P O     1 
HETATM 4363 O  O     . HOH N 9 .   ? 27.767 -5.125  -9.715  1.00 36.41 ? 211  HOH P O     1 
HETATM 4364 O  O     . HOH N 9 .   ? 38.253 -10.797 6.365   1.00 36.37 ? 212  HOH P O     1 
HETATM 4365 O  O     . HOH N 9 .   ? 48.073 -1.983  7.063   1.00 32.06 ? 213  HOH P O     1 
HETATM 4366 O  O     . HOH N 9 .   ? 46.352 4.220   0.819   1.00 32.55 ? 214  HOH P O     1 
HETATM 4367 O  O     . HOH N 9 .   ? 46.698 -7.854  7.961   1.00 25.98 ? 215  HOH P O     1 
HETATM 4368 O  O     . HOH N 9 .   ? 40.485 -5.391  5.532   1.00 29.38 ? 216  HOH P O     1 
HETATM 4369 O  O     . HOH N 9 .   ? 28.759 -5.900  -11.905 1.00 47.14 ? 217  HOH P O     1 
HETATM 4370 O  O     . HOH N 9 .   ? 32.474 -7.335  -11.606 1.00 34.68 ? 218  HOH P O     1 
HETATM 4371 O  O     . HOH N 9 .   ? 34.463 -9.352  -11.373 1.00 41.45 ? 219  HOH P O     1 
HETATM 4372 O  O     . HOH N 9 .   ? 38.609 -1.993  5.718   1.00 41.63 ? 220  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   501  501 MG  MG  A . 
E 5 CA  1   502  502 CA  CA  A . 
F 4 MG  1   503  502 MG  MG  A . 
G 6 GOL 1   506  436 GOL GOL A . 
H 6 GOL 1   507  439 GOL GOL A . 
I 7 DTP 1   504  9   DTP DTP P . 
J 8 DPO 1   505  9   DPO DPO P . 
K 4 MG  1   506  9   MG  MG  P . 
L 9 HOH 1   601  61  HOH HOH A . 
L 9 HOH 2   602  61  HOH HOH A . 
L 9 HOH 3   603  1   HOH HOH A . 
L 9 HOH 4   604  2   HOH HOH A . 
L 9 HOH 5   605  3   HOH HOH A . 
L 9 HOH 6   606  4   HOH HOH A . 
L 9 HOH 7   607  5   HOH HOH A . 
L 9 HOH 8   608  6   HOH HOH A . 
L 9 HOH 9   609  7   HOH HOH A . 
L 9 HOH 10  610  8   HOH HOH A . 
L 9 HOH 11  611  9   HOH HOH A . 
L 9 HOH 12  612  10  HOH HOH A . 
L 9 HOH 13  613  11  HOH HOH A . 
L 9 HOH 14  614  12  HOH HOH A . 
L 9 HOH 15  615  13  HOH HOH A . 
L 9 HOH 16  616  14  HOH HOH A . 
L 9 HOH 17  617  15  HOH HOH A . 
L 9 HOH 18  618  16  HOH HOH A . 
L 9 HOH 19  619  17  HOH HOH A . 
L 9 HOH 20  620  18  HOH HOH A . 
L 9 HOH 21  621  20  HOH HOH A . 
L 9 HOH 22  622  21  HOH HOH A . 
L 9 HOH 23  623  22  HOH HOH A . 
L 9 HOH 24  624  23  HOH HOH A . 
L 9 HOH 25  625  24  HOH HOH A . 
L 9 HOH 26  626  25  HOH HOH A . 
L 9 HOH 27  627  26  HOH HOH A . 
L 9 HOH 28  628  27  HOH HOH A . 
L 9 HOH 29  629  28  HOH HOH A . 
L 9 HOH 30  630  29  HOH HOH A . 
L 9 HOH 31  631  30  HOH HOH A . 
L 9 HOH 32  632  31  HOH HOH A . 
L 9 HOH 33  633  32  HOH HOH A . 
L 9 HOH 34  634  33  HOH HOH A . 
L 9 HOH 35  635  34  HOH HOH A . 
L 9 HOH 36  636  35  HOH HOH A . 
L 9 HOH 37  637  36  HOH HOH A . 
L 9 HOH 38  638  37  HOH HOH A . 
L 9 HOH 39  639  38  HOH HOH A . 
L 9 HOH 40  640  40  HOH HOH A . 
L 9 HOH 41  641  41  HOH HOH A . 
L 9 HOH 42  642  42  HOH HOH A . 
L 9 HOH 43  643  43  HOH HOH A . 
L 9 HOH 44  644  44  HOH HOH A . 
L 9 HOH 45  645  45  HOH HOH A . 
L 9 HOH 46  646  46  HOH HOH A . 
L 9 HOH 47  647  47  HOH HOH A . 
L 9 HOH 48  648  48  HOH HOH A . 
L 9 HOH 49  649  49  HOH HOH A . 
L 9 HOH 50  650  50  HOH HOH A . 
L 9 HOH 51  651  51  HOH HOH A . 
L 9 HOH 52  652  52  HOH HOH A . 
L 9 HOH 53  653  53  HOH HOH A . 
L 9 HOH 54  654  56  HOH HOH A . 
L 9 HOH 55  655  57  HOH HOH A . 
L 9 HOH 56  656  58  HOH HOH A . 
L 9 HOH 57  657  59  HOH HOH A . 
L 9 HOH 58  658  60  HOH HOH A . 
L 9 HOH 59  659  61  HOH HOH A . 
L 9 HOH 60  660  62  HOH HOH A . 
L 9 HOH 61  661  63  HOH HOH A . 
L 9 HOH 62  662  64  HOH HOH A . 
L 9 HOH 63  663  65  HOH HOH A . 
L 9 HOH 64  664  66  HOH HOH A . 
L 9 HOH 65  665  67  HOH HOH A . 
L 9 HOH 66  666  68  HOH HOH A . 
L 9 HOH 67  667  69  HOH HOH A . 
L 9 HOH 68  668  70  HOH HOH A . 
L 9 HOH 69  669  71  HOH HOH A . 
L 9 HOH 70  670  72  HOH HOH A . 
L 9 HOH 71  671  73  HOH HOH A . 
L 9 HOH 72  672  75  HOH HOH A . 
L 9 HOH 73  673  76  HOH HOH A . 
L 9 HOH 74  674  77  HOH HOH A . 
L 9 HOH 75  675  78  HOH HOH A . 
L 9 HOH 76  676  79  HOH HOH A . 
L 9 HOH 77  677  80  HOH HOH A . 
L 9 HOH 78  678  81  HOH HOH A . 
L 9 HOH 79  679  82  HOH HOH A . 
L 9 HOH 80  680  83  HOH HOH A . 
L 9 HOH 81  681  84  HOH HOH A . 
L 9 HOH 82  682  85  HOH HOH A . 
L 9 HOH 83  683  86  HOH HOH A . 
L 9 HOH 84  684  87  HOH HOH A . 
L 9 HOH 85  685  88  HOH HOH A . 
L 9 HOH 86  686  89  HOH HOH A . 
L 9 HOH 87  687  90  HOH HOH A . 
L 9 HOH 88  688  93  HOH HOH A . 
L 9 HOH 89  689  94  HOH HOH A . 
L 9 HOH 90  690  95  HOH HOH A . 
L 9 HOH 91  691  96  HOH HOH A . 
L 9 HOH 92  692  97  HOH HOH A . 
L 9 HOH 93  693  98  HOH HOH A . 
L 9 HOH 94  694  99  HOH HOH A . 
L 9 HOH 95  695  100 HOH HOH A . 
L 9 HOH 96  696  101 HOH HOH A . 
L 9 HOH 97  697  102 HOH HOH A . 
L 9 HOH 98  698  103 HOH HOH A . 
L 9 HOH 99  699  104 HOH HOH A . 
L 9 HOH 100 700  105 HOH HOH A . 
L 9 HOH 101 701  107 HOH HOH A . 
L 9 HOH 102 702  108 HOH HOH A . 
L 9 HOH 103 703  109 HOH HOH A . 
L 9 HOH 104 704  112 HOH HOH A . 
L 9 HOH 105 705  113 HOH HOH A . 
L 9 HOH 106 706  114 HOH HOH A . 
L 9 HOH 107 707  115 HOH HOH A . 
L 9 HOH 108 708  116 HOH HOH A . 
L 9 HOH 109 709  117 HOH HOH A . 
L 9 HOH 110 710  118 HOH HOH A . 
L 9 HOH 111 711  120 HOH HOH A . 
L 9 HOH 112 712  121 HOH HOH A . 
L 9 HOH 113 713  122 HOH HOH A . 
L 9 HOH 114 714  123 HOH HOH A . 
L 9 HOH 115 715  124 HOH HOH A . 
L 9 HOH 116 716  125 HOH HOH A . 
L 9 HOH 117 717  126 HOH HOH A . 
L 9 HOH 118 718  127 HOH HOH A . 
L 9 HOH 119 719  128 HOH HOH A . 
L 9 HOH 120 720  129 HOH HOH A . 
L 9 HOH 121 721  130 HOH HOH A . 
L 9 HOH 122 722  131 HOH HOH A . 
L 9 HOH 123 723  132 HOH HOH A . 
L 9 HOH 124 724  134 HOH HOH A . 
L 9 HOH 125 725  135 HOH HOH A . 
L 9 HOH 126 726  136 HOH HOH A . 
L 9 HOH 127 727  138 HOH HOH A . 
L 9 HOH 128 728  140 HOH HOH A . 
L 9 HOH 129 729  141 HOH HOH A . 
L 9 HOH 130 730  143 HOH HOH A . 
L 9 HOH 131 731  144 HOH HOH A . 
L 9 HOH 132 732  146 HOH HOH A . 
L 9 HOH 133 733  147 HOH HOH A . 
L 9 HOH 134 734  149 HOH HOH A . 
L 9 HOH 135 735  150 HOH HOH A . 
L 9 HOH 136 736  151 HOH HOH A . 
L 9 HOH 137 737  155 HOH HOH A . 
L 9 HOH 138 738  156 HOH HOH A . 
L 9 HOH 139 739  157 HOH HOH A . 
L 9 HOH 140 740  158 HOH HOH A . 
L 9 HOH 141 741  160 HOH HOH A . 
L 9 HOH 142 742  161 HOH HOH A . 
L 9 HOH 143 743  162 HOH HOH A . 
L 9 HOH 144 744  163 HOH HOH A . 
L 9 HOH 145 745  164 HOH HOH A . 
L 9 HOH 146 746  165 HOH HOH A . 
L 9 HOH 147 747  166 HOH HOH A . 
L 9 HOH 148 748  167 HOH HOH A . 
L 9 HOH 149 749  168 HOH HOH A . 
L 9 HOH 150 750  169 HOH HOH A . 
L 9 HOH 151 751  170 HOH HOH A . 
L 9 HOH 152 752  171 HOH HOH A . 
L 9 HOH 153 753  172 HOH HOH A . 
L 9 HOH 154 754  173 HOH HOH A . 
L 9 HOH 155 755  174 HOH HOH A . 
L 9 HOH 156 756  176 HOH HOH A . 
L 9 HOH 157 757  177 HOH HOH A . 
L 9 HOH 158 758  178 HOH HOH A . 
L 9 HOH 159 759  179 HOH HOH A . 
L 9 HOH 160 760  180 HOH HOH A . 
L 9 HOH 161 761  181 HOH HOH A . 
L 9 HOH 162 762  182 HOH HOH A . 
L 9 HOH 163 763  183 HOH HOH A . 
L 9 HOH 164 764  185 HOH HOH A . 
L 9 HOH 165 765  186 HOH HOH A . 
L 9 HOH 166 766  188 HOH HOH A . 
L 9 HOH 167 767  189 HOH HOH A . 
L 9 HOH 168 768  190 HOH HOH A . 
L 9 HOH 169 769  191 HOH HOH A . 
L 9 HOH 170 770  192 HOH HOH A . 
L 9 HOH 171 771  193 HOH HOH A . 
L 9 HOH 172 772  194 HOH HOH A . 
L 9 HOH 173 773  195 HOH HOH A . 
L 9 HOH 174 774  196 HOH HOH A . 
L 9 HOH 175 775  197 HOH HOH A . 
L 9 HOH 176 776  198 HOH HOH A . 
L 9 HOH 177 777  199 HOH HOH A . 
L 9 HOH 178 778  200 HOH HOH A . 
L 9 HOH 179 779  202 HOH HOH A . 
L 9 HOH 180 780  203 HOH HOH A . 
L 9 HOH 181 781  204 HOH HOH A . 
L 9 HOH 182 782  205 HOH HOH A . 
L 9 HOH 183 783  206 HOH HOH A . 
L 9 HOH 184 784  207 HOH HOH A . 
L 9 HOH 185 785  208 HOH HOH A . 
L 9 HOH 186 786  211 HOH HOH A . 
L 9 HOH 187 787  212 HOH HOH A . 
L 9 HOH 188 788  213 HOH HOH A . 
L 9 HOH 189 789  214 HOH HOH A . 
L 9 HOH 190 790  215 HOH HOH A . 
L 9 HOH 191 791  216 HOH HOH A . 
L 9 HOH 192 792  218 HOH HOH A . 
L 9 HOH 193 793  219 HOH HOH A . 
L 9 HOH 194 794  221 HOH HOH A . 
L 9 HOH 195 795  222 HOH HOH A . 
L 9 HOH 196 796  225 HOH HOH A . 
L 9 HOH 197 797  226 HOH HOH A . 
L 9 HOH 198 798  228 HOH HOH A . 
L 9 HOH 199 799  229 HOH HOH A . 
L 9 HOH 200 800  230 HOH HOH A . 
L 9 HOH 201 801  231 HOH HOH A . 
L 9 HOH 202 802  232 HOH HOH A . 
L 9 HOH 203 803  233 HOH HOH A . 
L 9 HOH 204 804  234 HOH HOH A . 
L 9 HOH 205 805  235 HOH HOH A . 
L 9 HOH 206 806  236 HOH HOH A . 
L 9 HOH 207 807  237 HOH HOH A . 
L 9 HOH 208 808  238 HOH HOH A . 
L 9 HOH 209 809  239 HOH HOH A . 
L 9 HOH 210 810  240 HOH HOH A . 
L 9 HOH 211 811  241 HOH HOH A . 
L 9 HOH 212 812  242 HOH HOH A . 
L 9 HOH 213 813  243 HOH HOH A . 
L 9 HOH 214 814  244 HOH HOH A . 
L 9 HOH 215 815  245 HOH HOH A . 
L 9 HOH 216 816  246 HOH HOH A . 
L 9 HOH 217 817  247 HOH HOH A . 
L 9 HOH 218 818  248 HOH HOH A . 
L 9 HOH 219 819  249 HOH HOH A . 
L 9 HOH 220 820  250 HOH HOH A . 
L 9 HOH 221 821  251 HOH HOH A . 
L 9 HOH 222 822  252 HOH HOH A . 
L 9 HOH 223 823  253 HOH HOH A . 
L 9 HOH 224 824  254 HOH HOH A . 
L 9 HOH 225 825  255 HOH HOH A . 
L 9 HOH 226 826  256 HOH HOH A . 
L 9 HOH 227 827  257 HOH HOH A . 
L 9 HOH 228 828  258 HOH HOH A . 
L 9 HOH 229 829  259 HOH HOH A . 
L 9 HOH 230 830  260 HOH HOH A . 
L 9 HOH 231 831  262 HOH HOH A . 
L 9 HOH 232 832  263 HOH HOH A . 
L 9 HOH 233 833  264 HOH HOH A . 
L 9 HOH 234 834  267 HOH HOH A . 
L 9 HOH 235 835  268 HOH HOH A . 
L 9 HOH 236 836  269 HOH HOH A . 
L 9 HOH 237 837  270 HOH HOH A . 
L 9 HOH 238 838  271 HOH HOH A . 
L 9 HOH 239 839  272 HOH HOH A . 
L 9 HOH 240 840  273 HOH HOH A . 
L 9 HOH 241 841  275 HOH HOH A . 
L 9 HOH 242 842  277 HOH HOH A . 
L 9 HOH 243 843  278 HOH HOH A . 
L 9 HOH 244 844  279 HOH HOH A . 
L 9 HOH 245 845  280 HOH HOH A . 
L 9 HOH 246 846  281 HOH HOH A . 
L 9 HOH 247 847  282 HOH HOH A . 
L 9 HOH 248 848  283 HOH HOH A . 
L 9 HOH 249 849  286 HOH HOH A . 
L 9 HOH 250 850  287 HOH HOH A . 
L 9 HOH 251 851  288 HOH HOH A . 
L 9 HOH 252 852  290 HOH HOH A . 
L 9 HOH 253 853  292 HOH HOH A . 
L 9 HOH 254 854  293 HOH HOH A . 
L 9 HOH 255 855  294 HOH HOH A . 
L 9 HOH 256 856  295 HOH HOH A . 
L 9 HOH 257 857  296 HOH HOH A . 
L 9 HOH 258 858  297 HOH HOH A . 
L 9 HOH 259 859  298 HOH HOH A . 
L 9 HOH 260 860  299 HOH HOH A . 
L 9 HOH 261 861  300 HOH HOH A . 
L 9 HOH 262 862  301 HOH HOH A . 
L 9 HOH 263 863  302 HOH HOH A . 
L 9 HOH 264 864  303 HOH HOH A . 
L 9 HOH 265 865  305 HOH HOH A . 
L 9 HOH 266 866  306 HOH HOH A . 
L 9 HOH 267 867  308 HOH HOH A . 
L 9 HOH 268 868  310 HOH HOH A . 
L 9 HOH 269 869  311 HOH HOH A . 
L 9 HOH 270 870  312 HOH HOH A . 
L 9 HOH 271 871  316 HOH HOH A . 
L 9 HOH 272 872  317 HOH HOH A . 
L 9 HOH 273 873  319 HOH HOH A . 
L 9 HOH 274 874  321 HOH HOH A . 
L 9 HOH 275 875  322 HOH HOH A . 
L 9 HOH 276 876  323 HOH HOH A . 
L 9 HOH 277 877  325 HOH HOH A . 
L 9 HOH 278 878  326 HOH HOH A . 
L 9 HOH 279 879  327 HOH HOH A . 
L 9 HOH 280 880  328 HOH HOH A . 
L 9 HOH 281 881  329 HOH HOH A . 
L 9 HOH 282 882  330 HOH HOH A . 
L 9 HOH 283 883  331 HOH HOH A . 
L 9 HOH 284 884  333 HOH HOH A . 
L 9 HOH 285 885  334 HOH HOH A . 
L 9 HOH 286 886  335 HOH HOH A . 
L 9 HOH 287 887  336 HOH HOH A . 
L 9 HOH 288 888  337 HOH HOH A . 
L 9 HOH 289 889  338 HOH HOH A . 
L 9 HOH 290 890  339 HOH HOH A . 
L 9 HOH 291 891  340 HOH HOH A . 
L 9 HOH 292 892  341 HOH HOH A . 
L 9 HOH 293 893  343 HOH HOH A . 
L 9 HOH 294 894  344 HOH HOH A . 
L 9 HOH 295 895  345 HOH HOH A . 
L 9 HOH 296 896  346 HOH HOH A . 
L 9 HOH 297 897  347 HOH HOH A . 
L 9 HOH 298 898  349 HOH HOH A . 
L 9 HOH 299 899  350 HOH HOH A . 
L 9 HOH 300 900  351 HOH HOH A . 
L 9 HOH 301 901  352 HOH HOH A . 
L 9 HOH 302 902  353 HOH HOH A . 
L 9 HOH 303 903  355 HOH HOH A . 
L 9 HOH 304 904  356 HOH HOH A . 
L 9 HOH 305 905  357 HOH HOH A . 
L 9 HOH 306 906  358 HOH HOH A . 
L 9 HOH 307 907  359 HOH HOH A . 
L 9 HOH 308 908  360 HOH HOH A . 
L 9 HOH 309 909  362 HOH HOH A . 
L 9 HOH 310 910  363 HOH HOH A . 
L 9 HOH 311 911  364 HOH HOH A . 
L 9 HOH 312 912  365 HOH HOH A . 
L 9 HOH 313 913  366 HOH HOH A . 
L 9 HOH 314 914  367 HOH HOH A . 
L 9 HOH 315 915  368 HOH HOH A . 
L 9 HOH 316 916  370 HOH HOH A . 
L 9 HOH 317 917  371 HOH HOH A . 
L 9 HOH 318 918  372 HOH HOH A . 
L 9 HOH 319 919  373 HOH HOH A . 
L 9 HOH 320 920  374 HOH HOH A . 
L 9 HOH 321 921  375 HOH HOH A . 
L 9 HOH 322 922  376 HOH HOH A . 
L 9 HOH 323 923  380 HOH HOH A . 
L 9 HOH 324 924  381 HOH HOH A . 
L 9 HOH 325 925  382 HOH HOH A . 
L 9 HOH 326 926  383 HOH HOH A . 
L 9 HOH 327 927  384 HOH HOH A . 
L 9 HOH 328 928  385 HOH HOH A . 
L 9 HOH 329 929  386 HOH HOH A . 
L 9 HOH 330 930  387 HOH HOH A . 
L 9 HOH 331 931  388 HOH HOH A . 
L 9 HOH 332 932  390 HOH HOH A . 
L 9 HOH 333 933  391 HOH HOH A . 
L 9 HOH 334 934  392 HOH HOH A . 
L 9 HOH 335 935  393 HOH HOH A . 
L 9 HOH 336 936  394 HOH HOH A . 
L 9 HOH 337 937  398 HOH HOH A . 
L 9 HOH 338 938  399 HOH HOH A . 
L 9 HOH 339 939  400 HOH HOH A . 
L 9 HOH 340 940  402 HOH HOH A . 
L 9 HOH 341 941  403 HOH HOH A . 
L 9 HOH 342 942  404 HOH HOH A . 
L 9 HOH 343 943  405 HOH HOH A . 
L 9 HOH 344 944  407 HOH HOH A . 
L 9 HOH 345 945  408 HOH HOH A . 
L 9 HOH 346 946  409 HOH HOH A . 
L 9 HOH 347 947  410 HOH HOH A . 
L 9 HOH 348 948  411 HOH HOH A . 
L 9 HOH 349 949  414 HOH HOH A . 
L 9 HOH 350 950  415 HOH HOH A . 
L 9 HOH 351 951  416 HOH HOH A . 
L 9 HOH 352 952  417 HOH HOH A . 
L 9 HOH 353 953  419 HOH HOH A . 
L 9 HOH 354 954  420 HOH HOH A . 
L 9 HOH 355 955  421 HOH HOH A . 
L 9 HOH 356 956  423 HOH HOH A . 
L 9 HOH 357 957  426 HOH HOH A . 
L 9 HOH 358 958  427 HOH HOH A . 
L 9 HOH 359 959  428 HOH HOH A . 
L 9 HOH 360 960  429 HOH HOH A . 
L 9 HOH 361 961  430 HOH HOH A . 
L 9 HOH 362 962  431 HOH HOH A . 
L 9 HOH 363 963  432 HOH HOH A . 
L 9 HOH 364 964  433 HOH HOH A . 
L 9 HOH 365 965  434 HOH HOH A . 
L 9 HOH 366 966  435 HOH HOH A . 
L 9 HOH 367 967  437 HOH HOH A . 
L 9 HOH 368 968  438 HOH HOH A . 
L 9 HOH 369 969  439 HOH HOH A . 
L 9 HOH 370 970  441 HOH HOH A . 
L 9 HOH 371 971  442 HOH HOH A . 
L 9 HOH 372 972  443 HOH HOH A . 
L 9 HOH 373 973  444 HOH HOH A . 
L 9 HOH 374 974  445 HOH HOH A . 
L 9 HOH 375 975  447 HOH HOH A . 
L 9 HOH 376 976  449 HOH HOH A . 
L 9 HOH 377 977  450 HOH HOH A . 
L 9 HOH 378 978  451 HOH HOH A . 
L 9 HOH 379 979  452 HOH HOH A . 
L 9 HOH 380 980  453 HOH HOH A . 
L 9 HOH 381 981  454 HOH HOH A . 
L 9 HOH 382 982  455 HOH HOH A . 
L 9 HOH 383 983  456 HOH HOH A . 
L 9 HOH 384 984  457 HOH HOH A . 
L 9 HOH 385 985  459 HOH HOH A . 
L 9 HOH 386 986  460 HOH HOH A . 
L 9 HOH 387 987  461 HOH HOH A . 
L 9 HOH 388 988  462 HOH HOH A . 
L 9 HOH 389 989  463 HOH HOH A . 
L 9 HOH 390 990  464 HOH HOH A . 
L 9 HOH 391 991  465 HOH HOH A . 
L 9 HOH 392 992  466 HOH HOH A . 
L 9 HOH 393 993  467 HOH HOH A . 
L 9 HOH 394 994  468 HOH HOH A . 
L 9 HOH 395 995  470 HOH HOH A . 
L 9 HOH 396 996  473 HOH HOH A . 
L 9 HOH 397 997  474 HOH HOH A . 
L 9 HOH 398 998  475 HOH HOH A . 
L 9 HOH 399 999  476 HOH HOH A . 
L 9 HOH 400 1000 477 HOH HOH A . 
L 9 HOH 401 1001 478 HOH HOH A . 
L 9 HOH 402 1002 479 HOH HOH A . 
L 9 HOH 403 1003 480 HOH HOH A . 
L 9 HOH 404 1004 481 HOH HOH A . 
L 9 HOH 405 1005 482 HOH HOH A . 
L 9 HOH 406 1006 483 HOH HOH A . 
L 9 HOH 407 1007 484 HOH HOH A . 
L 9 HOH 408 1008 486 HOH HOH A . 
L 9 HOH 409 1009 111 HOH HOH A . 
M 9 HOH 1   101  39  HOH HOH T . 
M 9 HOH 2   102  106 HOH HOH T . 
M 9 HOH 3   103  119 HOH HOH T . 
M 9 HOH 4   104  133 HOH HOH T . 
M 9 HOH 5   105  137 HOH HOH T . 
M 9 HOH 6   106  142 HOH HOH T . 
M 9 HOH 7   107  145 HOH HOH T . 
M 9 HOH 8   108  148 HOH HOH T . 
M 9 HOH 9   109  152 HOH HOH T . 
M 9 HOH 10  110  159 HOH HOH T . 
M 9 HOH 11  111  184 HOH HOH T . 
M 9 HOH 12  112  187 HOH HOH T . 
M 9 HOH 13  113  201 HOH HOH T . 
M 9 HOH 14  114  210 HOH HOH T . 
M 9 HOH 15  115  223 HOH HOH T . 
M 9 HOH 16  116  224 HOH HOH T . 
M 9 HOH 17  117  261 HOH HOH T . 
M 9 HOH 18  118  266 HOH HOH T . 
M 9 HOH 19  119  274 HOH HOH T . 
M 9 HOH 20  120  314 HOH HOH T . 
M 9 HOH 21  121  318 HOH HOH T . 
M 9 HOH 22  122  320 HOH HOH T . 
M 9 HOH 23  123  324 HOH HOH T . 
M 9 HOH 24  124  332 HOH HOH T . 
M 9 HOH 25  125  342 HOH HOH T . 
M 9 HOH 26  126  377 HOH HOH T . 
M 9 HOH 27  127  389 HOH HOH T . 
M 9 HOH 28  128  396 HOH HOH T . 
M 9 HOH 29  129  401 HOH HOH T . 
M 9 HOH 30  130  424 HOH HOH T . 
M 9 HOH 31  131  425 HOH HOH T . 
M 9 HOH 32  132  436 HOH HOH T . 
M 9 HOH 33  133  440 HOH HOH T . 
M 9 HOH 34  134  448 HOH HOH T . 
M 9 HOH 35  135  485 HOH HOH T . 
N 9 HOH 1   201  54  HOH HOH P . 
N 9 HOH 2   202  55  HOH HOH P . 
N 9 HOH 3   203  74  HOH HOH P . 
N 9 HOH 4   204  91  HOH HOH P . 
N 9 HOH 5   205  92  HOH HOH P . 
N 9 HOH 6   206  110 HOH HOH P . 
N 9 HOH 7   207  139 HOH HOH P . 
N 9 HOH 8   208  153 HOH HOH P . 
N 9 HOH 9   209  175 HOH HOH P . 
N 9 HOH 10  210  209 HOH HOH P . 
N 9 HOH 11  211  227 HOH HOH P . 
N 9 HOH 12  212  284 HOH HOH P . 
N 9 HOH 13  213  313 HOH HOH P . 
N 9 HOH 14  214  315 HOH HOH P . 
N 9 HOH 15  215  348 HOH HOH P . 
N 9 HOH 16  216  361 HOH HOH P . 
N 9 HOH 17  217  369 HOH HOH P . 
N 9 HOH 18  218  413 HOH HOH P . 
N 9 HOH 19  219  446 HOH HOH P . 
N 9 HOH 20  220  458 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6400  ? 
1 MORE         -77   ? 
1 'SSA (A^2)'  21850 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OP2   B C DA  9   ? P DA  9   ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     B L HOH .   ? A HOH 602 ? 1_555 85.9  ? 
2  OP2   B C DA  9   ? P DA  9   ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 943 ? 1_555 89.8  ? 
3  O     B L HOH .   ? A HOH 602 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 943 ? 1_555 91.6  ? 
4  OP2   B C DA  9   ? P DA  9   ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O1    B J DPO .   ? P DPO 505 ? 1_555 87.3  ? 
5  O     B L HOH .   ? A HOH 602 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O1    B J DPO .   ? P DPO 505 ? 1_555 96.2  ? 
6  O     ? L HOH .   ? A HOH 943 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O1    B J DPO .   ? P DPO 505 ? 1_555 171.5 ? 
7  OP2   B C DA  9   ? P DA  9   ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 888 ? 1_555 93.3  ? 
8  O     B L HOH .   ? A HOH 602 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 888 ? 1_555 171.9 ? 
9  O     ? L HOH .   ? A HOH 943 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 888 ? 1_555 80.3  ? 
10 O1    B J DPO .   ? P DPO 505 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 888 ? 1_555 91.8  ? 
11 OP2   B C DA  9   ? P DA  9   ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 665 ? 1_555 176.1 ? 
12 O     B L HOH .   ? A HOH 602 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 665 ? 1_555 97.7  ? 
13 O     ? L HOH .   ? A HOH 943 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 665 ? 1_555 91.8  ? 
14 O1    B J DPO .   ? P DPO 505 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 665 ? 1_555 90.6  ? 
15 O     ? L HOH .   ? A HOH 888 ? 1_555 MG B K MG . ? P MG 506 ? 1_555 O     ? L HOH .   ? A HOH 665 ? 1_555 83.4  ? 
16 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 108.7 ? 
17 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   A I DTP .   ? P DTP 504 ? 1_555 9.7   ? 
18 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O2A   A I DTP .   ? P DTP 504 ? 1_555 99.1  ? 
19 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 155.9 ? 
20 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 94.8  ? 
21 O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 164.6 ? 
22 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 81.0  ? 
23 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 169.7 ? 
24 O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 90.7  ? 
25 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 75.9  ? 
26 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 88.1  ? 
27 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 93.6  ? 
28 O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 89.9  ? 
29 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 95.8  ? 
30 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 83.3  ? 
31 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 603 ? 1_555 87.2  ? 
32 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 603 ? 1_555 86.9  ? 
33 O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 603 ? 1_555 85.4  ? 
34 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 603 ? 1_555 88.9  ? 
35 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 603 ? 1_555 97.0  ? 
36 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 O     ? L HOH .   ? A HOH 603 ? 1_555 175.2 ? 
37 OP1   B C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 68.2  ? 
38 OD2   B A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 176.9 ? 
39 O2A   A I DTP .   ? P DTP 504 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 77.8  ? 
40 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 88.2  ? 
41 "O3'" A C DT  8   ? P DT  8   ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 13.3  ? 
42 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 86.7  ? 
43 O     ? L HOH .   ? A HOH 603 ? 1_555 MG ? D MG . ? A MG 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 92.5  ? 
44 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O2A   A I DTP .   ? P DTP 504 ? 1_555 86.2  ? 
45 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   A I DTP .   ? P DTP 504 ? 1_555 80.4  ? 
46 O2A   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O3G   A I DTP .   ? P DTP 504 ? 1_555 88.2  ? 
47 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 179.0 ? 
48 O2A   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 93.0  ? 
49 O3G   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 98.8  ? 
50 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 91.8  ? 
51 O2A   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 91.1  ? 
52 O3G   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 172.2 ? 
53 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 88.9  ? 
54 O1B   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 90.5  ? 
55 O2A   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 171.4 ? 
56 O3G   A I DTP .   ? P DTP 504 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 99.2  ? 
57 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 90.3  ? 
58 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 81.1  ? 
59 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O7    B J DPO .   ? P DPO 505 ? 1_555 83.3  ? 
60 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 158.2 ? 
61 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 78.3  ? 
62 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 91.3  ? 
63 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 98.9  ? 
64 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 80.3  ? 
65 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 91.1  ? 
66 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 174.4 ? 
67 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 107.1 ? 
68 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 80.8  ? 
69 O2    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 84.9  ? 
70 O7    B J DPO .   ? P DPO 505 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 93.4  ? 
71 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 107.5 ? 
72 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 166.7 ? 
73 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 86.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ECX 
_pdbx_entry_details.nonpolymer_details   'CA A 502 AND MG A 503 ARE IN ALTERNATE CONFORMATIONS OF EACH OTHER.' 
_pdbx_entry_details.sequence_details     
;ARG A 61 HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS ARG 61 (OCCUPANCY 0.30), 
ALTERNATE B HAS ARG 61 (OCCUPANCY 0.70) + HOH A 601 + HOH A 602. 
CHAIN P HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS DT 8 + DTP 504, 
ALTERNATE B HAS DT 8 + DA 9 + DPO 505 + MG 506.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 7 ? ? "C1'" T DG 7 ? ? N9    T DG 7 ? ? 110.39 108.30 2.09  0.30 N 
2 1 "O4'" P DG 2 ? ? "C1'" P DG 2 ? ? N9    P DG 2 ? ? 110.21 108.30 1.91  0.30 N 
3 1 "O4'" P DA 7 ? ? "C4'" P DA 7 ? ? "C3'" P DA 7 ? ? 101.51 104.50 -2.99 0.40 N 
4 1 "O4'" P DA 7 ? ? "C1'" P DA 7 ? ? N9    P DA 7 ? ? 111.55 108.30 3.25  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 22.01   65.58   
2 1 TYR A 39  ? ? 64.99   -178.00 
3 1 LYS A 40  ? ? -158.27 -38.33  
4 1 SER A 62  ? ? 82.59   -3.80   
5 1 SER A 217 ? ? -153.13 -157.66 
6 1 SER A 257 ? ? 94.41   -10.83  
7 1 LYS A 428 ? ? 60.14   64.30   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ECX 'double helix'        
4ECX 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.152  0.042  -0.014 -0.665 -6.816  5.982  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.092  -0.059 0.195  -0.357 -15.473 3.556  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.109 -0.123 -0.279 -6.450 -3.561  -0.818 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.190  -0.064 0.065  4.612  -3.143  1.048  4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.301  -0.130 -0.358 11.734 -6.811  1.655  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.381 -0.233 -0.125 -3.447 -6.506  2.936  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.142  -0.100 0.153  -7.869 -4.120  0.004  7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.112 -0.201 -0.190 15.963 -0.580  4.203  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.819  -0.968 3.341 -2.199 3.458 26.708 -2.946 -2.308 3.117 7.431  4.724   
27.015 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.461 -1.179 3.423 5.159  9.262 28.164 -4.135 1.927  2.778 18.236 -10.158 
30.056 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.562 -0.448 3.174 -2.340 0.904 34.718 -0.883 0.592  3.191 1.512  3.914   
34.806 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.457  -0.796 3.264 3.895  0.410 30.517 -1.581 -0.096 3.285 0.775  -7.362  
30.761 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.423 -0.737 3.761 -4.374 6.540 33.475 -2.411 -0.062 3.583 11.164 7.466   
34.362 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.446 -0.601 3.498 -2.047 0.686 37.632 -1.026 0.406  3.505 1.063  3.170   
37.692 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.278  0.102  2.901 -0.486 2.663 25.633 -0.434 -0.744 2.891 5.982  1.092   
25.773 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 DIPHOSPHATE                         DPO 
9 water                               HOH 
#