data_4ECY
# 
_entry.id   4ECY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ECY         
NDB   NA1708       
RCSB  RCSB071460   
WWPDB D_1000071460 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ECY 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ECY 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ECY 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ?                                     ? 
4 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
5 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
6 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
7 water       nat water                                                18.015    416 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ECY       4ECY   2 ? ? ? 
3 PDB 4ECY       4ECY   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ECY A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ECY T 1 ? 12  ? 4ECY   1 ? 12  ? 1 12  
3 3 4ECY P 1 ? 8   ? 4ECY   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ECY GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ECY PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ECY HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ECY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ECY 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.943 
_reflns.number_obs                   33395 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.079 
_reflns.pdbx_netI_over_sigmaI        17.1 
_reflns.B_iso_Wilson_estimate        14.970 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.95 
_reflns_shell.d_res_low                   1.98 
_reflns_shell.percent_possible_all        99.8 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.341 
_reflns_shell.meanI_over_sigI_obs         4.4 
_reflns_shell.pdbx_redundancy             3.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ECY 
_refine.ls_number_reflns_obs                     32098 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.11 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.517 
_refine.ls_d_res_high                            1.943 
_refine.ls_percent_reflns_obs                    95.27 
_refine.ls_R_factor_obs                          0.1818 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1792 
_refine.ls_R_factor_R_free                       0.2316 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  1620 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               20.2725 
_refine.aniso_B[1][1]                            -0.3040 
_refine.aniso_B[2][2]                            -0.3040 
_refine.aniso_B[3][3]                            0.6080 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.340 
_refine.solvent_model_param_bsol                 30.875 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.22 
_refine.overall_FOM_work_R_set                   0.8620 
_refine.B_iso_max                                77.880 
_refine.B_iso_min                                4.480 
_refine.pdbx_overall_phase_error                 21.4600 
_refine.occupancy_max                            1.200 
_refine.occupancy_min                            0.400 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             416 
_refine_hist.number_atoms_total               4218 
_refine_hist.d_res_high                       1.943 
_refine_hist.d_res_low                        28.517 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           3990 0.002  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5491 0.741  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     615  0.043  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      630  0.002  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1577 17.574 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.9434 2.0005  12 88.0000 2353 . 0.1940 0.2520 . 117 . 2470 . 'X-RAY DIFFRACTION' . 
2.0005 2.0651  12 91.0000 2408 . 0.1949 0.2841 . 125 . 2533 . 'X-RAY DIFFRACTION' . 
2.0651 2.1389  12 93.0000 2472 . 0.1929 0.2281 . 118 . 2590 . 'X-RAY DIFFRACTION' . 
2.1389 2.2245  12 95.0000 2538 . 0.1763 0.2333 . 126 . 2664 . 'X-RAY DIFFRACTION' . 
2.2245 2.3257  12 91.0000 2395 . 0.2036 0.2513 . 127 . 2522 . 'X-RAY DIFFRACTION' . 
2.3257 2.4482  12 97.0000 2594 . 0.1803 0.2404 . 142 . 2736 . 'X-RAY DIFFRACTION' . 
2.4482 2.6015  12 97.0000 2575 . 0.1949 0.2815 . 140 . 2715 . 'X-RAY DIFFRACTION' . 
2.6015 2.8022  12 97.0000 2605 . 0.1971 0.2345 . 130 . 2735 . 'X-RAY DIFFRACTION' . 
2.8022 3.0839  12 99.0000 2591 . 0.1984 0.2494 . 166 . 2757 . 'X-RAY DIFFRACTION' . 
3.0839 3.5295  12 99.0000 2638 . 0.1660 0.2326 . 148 . 2786 . 'X-RAY DIFFRACTION' . 
3.5295 4.4441  12 98.0000 2626 . 0.1494 0.1830 . 149 . 2775 . 'X-RAY DIFFRACTION' . 
4.4441 28.5201 12 98.0000 2683 . 0.1618 0.2052 . 132 . 2815 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ECY 
_struct.title                     'Human DNA polymerase eta - DNA ternary complex: AT crystal at pH 6.0 (Na+ MES) with 1 Ca2+ ion' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ECY 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? SER A 180 ? GLN A 162 SER A 177 1 ? 16 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 LEU A 232 ? LYS A 234 ? LEU A 229 LYS A 231 5 ? 3  
HELX_P HELX_P12 12 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P13 13 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P14 14 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P15 15 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P16 16 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P17 17 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P18 18 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P19 19 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P20 20 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P21 21 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P22 22 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A MET 17  O   ? ? ? 1_555 D CA  . CA  ? ? A MET 14  A CA  501 1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc2  metalc ? ? D CA  .   CA  ? ? ? 1_555 H DTP . O1B ? ? A CA  501 P DTP 101 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc3  metalc ? ? D CA  .   CA  ? ? ? 1_555 H DTP . O3G ? ? A CA  501 P DTP 101 1_555 ? ? ? ? ? ? ?            2.424 ? 
metalc4  metalc ? ? A ASP 118 OD1 ? ? ? 1_555 D CA  . CA  ? ? A ASP 115 A CA  501 1_555 ? ? ? ? ? ? ?            2.447 ? 
metalc5  metalc ? ? D CA  .   CA  ? ? ? 1_555 H DTP . O2A ? ? A CA  501 P DTP 101 1_555 ? ? ? ? ? ? ?            2.473 ? 
metalc6  metalc ? ? A ASP 16  OD2 ? ? ? 1_555 D CA  . CA  ? ? A ASP 13  A CA  501 1_555 ? ? ? ? ? ? ?            2.489 ? 
hydrog1  hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  8   N1  ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  8   N6  ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  9   N3  ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  9   N4  ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   O2  ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  10  N1  ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  10  N2  ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  O6  ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  11  N3  ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  11  N4  ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  O2  ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  12  N3  ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  12  O4  ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 0.99  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -3.71 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -4.44 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 501'  
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 502' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 503' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 504' 
AC5 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE DTP P 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 4  MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 4  ASP A 118 ? ASP A 115 . ? 1_555 ? 
4  AC1 4  DTP H .   ? DTP P 101 . ? 1_555 ? 
5  AC2 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
6  AC2 9  PHE A 250 ? PHE A 247 . ? 1_555 ? 
7  AC2 9  SER A 251 ? SER A 248 . ? 1_555 ? 
8  AC2 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
9  AC2 9  GLU A 280 ? GLU A 277 . ? 1_555 ? 
10 AC2 9  HOH I .   ? HOH A 602 . ? 1_555 ? 
11 AC2 9  HOH I .   ? HOH A 636 . ? 1_555 ? 
12 AC2 9  HOH I .   ? HOH A 663 . ? 1_555 ? 
13 AC2 9  HOH I .   ? HOH A 806 . ? 1_555 ? 
14 AC3 10 GLU A 97  ? GLU A 94  . ? 1_555 ? 
15 AC3 10 ALA A 98  ? ALA A 95  . ? 1_555 ? 
16 AC3 10 GLU A 101 ? GLU A 98  . ? 1_555 ? 
17 AC3 10 ARG A 306 ? ARG A 303 . ? 5_664 ? 
18 AC3 10 HOH I .   ? HOH A 612 . ? 1_555 ? 
19 AC3 10 HOH I .   ? HOH A 664 . ? 1_555 ? 
20 AC3 10 HOH I .   ? HOH A 737 . ? 1_555 ? 
21 AC3 10 HOH I .   ? HOH A 740 . ? 1_555 ? 
22 AC3 10 HOH I .   ? HOH A 785 . ? 1_555 ? 
23 AC3 10 HOH I .   ? HOH A 962 . ? 5_664 ? 
24 AC4 9  ASN A 29  ? ASN A 26  . ? 1_555 ? 
25 AC4 9  PRO A 30  ? PRO A 27  . ? 1_555 ? 
26 AC4 9  HIS A 31  ? HIS A 28  . ? 1_555 ? 
27 AC4 9  GLY A 274 ? GLY A 271 . ? 5_664 ? 
28 AC4 9  GLU A 276 ? GLU A 273 . ? 5_664 ? 
29 AC4 9  TYR A 277 ? TYR A 274 . ? 5_664 ? 
30 AC4 9  GLU A 280 ? GLU A 277 . ? 5_664 ? 
31 AC4 9  HOH I .   ? HOH A 849 . ? 5_664 ? 
32 AC4 9  HOH I .   ? HOH A 932 . ? 1_555 ? 
33 AC5 24 MET A 17  ? MET A 14  . ? 1_555 ? 
34 AC5 24 ASP A 18  ? ASP A 15  . ? 1_555 ? 
35 AC5 24 CYS A 19  ? CYS A 16  . ? 1_555 ? 
36 AC5 24 PHE A 20  ? PHE A 17  . ? 1_555 ? 
37 AC5 24 PHE A 21  ? PHE A 18  . ? 1_555 ? 
38 AC5 24 ILE A 51  ? ILE A 48  . ? 1_555 ? 
39 AC5 24 ALA A 52  ? ALA A 49  . ? 1_555 ? 
40 AC5 24 TYR A 55  ? TYR A 52  . ? 1_555 ? 
41 AC5 24 ARG A 58  ? ARG A 55  . ? 1_555 ? 
42 AC5 24 ARG A 64  ? ARG A 61  . ? 1_555 ? 
43 AC5 24 ASP A 118 ? ASP A 115 . ? 1_555 ? 
44 AC5 24 LYS A 234 ? LYS A 231 . ? 1_555 ? 
45 AC5 24 CA  D .   ? CA  A 501 . ? 1_555 ? 
46 AC5 24 HOH I .   ? HOH A 608 . ? 1_555 ? 
47 AC5 24 HOH I .   ? HOH A 629 . ? 1_555 ? 
48 AC5 24 HOH I .   ? HOH A 631 . ? 1_555 ? 
49 AC5 24 HOH I .   ? HOH A 704 . ? 1_555 ? 
50 AC5 24 HOH I .   ? HOH A 783 . ? 1_555 ? 
51 AC5 24 HOH I .   ? HOH A 952 . ? 1_555 ? 
52 AC5 24 DT  C 8   ? DT  P 8   . ? 1_555 ? 
53 AC5 24 HOH K .   ? HOH P 205 . ? 1_555 ? 
54 AC5 24 DT  B 3   ? DT  T 3   . ? 1_555 ? 
55 AC5 24 DT  B 4   ? DT  T 4   . ? 1_555 ? 
56 AC5 24 DA  B 5   ? DA  T 5   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ECY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ECY 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.867 -33.924 -3.502  1.00 37.74 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.247 -34.069 -3.929  1.00 35.29 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.619 -33.148 -5.077  1.00 36.72 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.391 -31.940 -5.008  1.00 39.21 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.198 -33.720 -6.145  1.00 33.82 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.656 -32.964 -7.318  1.00 36.34 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.506 -32.453 -8.183  1.00 36.36 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.739 -31.700 -9.129  1.00 42.76 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.480 -33.997 -8.093  1.00 34.92 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.882 -35.308 -7.712  1.00 34.29 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.473 -35.162 -6.274  1.00 34.25 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.282 -32.859 -7.860  1.00 31.62 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.111 -32.438 -8.622  1.00 34.39 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.170 -31.594 -7.768  1.00 36.05 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.111 -31.170 -8.231  1.00 37.92 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.367 -33.657 -9.174  1.00 29.96 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.253 -34.628 -9.891  1.00 25.80 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.853 -34.339 -11.097 1.00 29.45 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.642 -35.884 -9.568  1.00 25.89 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.573 -35.374 -11.488 1.00 26.59 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.463 -36.326 -10.578 1.00 27.52 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.565 -31.353 -6.522  1.00 36.58 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.740 -30.591 -5.591  1.00 38.83 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.933 -29.090 -5.782  1.00 35.09 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.994 -28.546 -5.471  1.00 31.59 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 64.061 -30.981 -4.148  1.00 39.98 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.973 -30.612 -3.154  1.00 45.66 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.452 -31.538 -3.442  1.00 56.01 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 62.012 -33.211 -3.125  1.00 42.69 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.900 -28.427 -6.293  1.00 36.46 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.952 -26.989 -6.536  1.00 33.95 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.159 -26.217 -5.237  1.00 27.03 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.602 -26.571 -4.197  1.00 30.84 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.687 -26.521 -7.238  1.00 37.78 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.963 -25.161 -5.304  1.00 25.21 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.302 -24.385 -4.117  1.00 19.75 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.784 -22.950 -4.190  1.00 19.42 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 64.012 -22.159 -3.276  1.00 16.92 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.823 -24.359 -3.883  1.00 19.85 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.472 -23.761 -5.013  1.00 18.39 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.352 -25.774 -3.686  1.00 20.99 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.090 -22.621 -5.276  1.00 18.31 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.530 -21.292 -5.446  1.00 17.13 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.571 -20.190 -5.374  1.00 16.43 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.365 -19.167 -4.719  1.00 13.92 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.695 -20.401 -6.051  1.00 14.68 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.784 -19.431 -6.056  1.00 12.82 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.051 -18.904 -7.466  1.00 12.35 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.159 -18.469 -7.776  1.00 13.23 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.055 -20.063 -5.483  1.00 13.77 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.998 -20.336 -3.986  1.00 13.97 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.209 -21.101 -3.493  1.00 14.52 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.381 -22.279 -3.806  1.00 18.20 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 69.064 -20.433 -2.726  1.00 12.05 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.022 -18.935 -8.307  1.00 15.59 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.157 -18.604 -9.723  1.00 15.64 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.102 -17.104 -10.020 1.00 18.18 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.613 -16.654 -11.044 1.00 17.54 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.071 -19.325 -10.526 1.00 20.95 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.681 -19.078 -9.970  1.00 22.72 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.365 -19.626 -8.893  1.00 25.48 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.903 -18.335 -10.606 1.00 27.00 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.484 -16.336 -9.129  1.00 15.65 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.309 -14.902 -9.345  1.00 14.46 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.928 -14.067 -8.232  1.00 11.44 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.096 -14.536 -7.109  1.00 10.62 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.821 -14.554 -9.424  1.00 15.64 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.057 -15.192 -10.568 1.00 17.88 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.572 -14.863 -10.448 1.00 14.55 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.975 -15.447 -9.247  1.00 14.36 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.923 -14.940 -8.610  1.00 13.33 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.445 -15.541 -7.529  1.00 11.80 ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.349 -13.829 -9.049  1.00 12.49 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.260 -12.822 -8.553  1.00 12.70 ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.579 -11.835 -7.531  1.00 8.56  ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.465 -10.796 -7.522  1.00 11.95 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.231 -10.117 -8.522  1.00 10.99 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.935 -11.151 -7.781  1.00 11.94 ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.183 -10.081 -6.733  1.00 10.82 ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.058 -12.178 -7.771  1.00 11.18 ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.768 -10.687 -6.394  1.00 8.44  ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.608 -9.810  -6.286  1.00 8.64  ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.760 -8.849  -5.112  1.00 12.12 ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.207 -9.239  -4.035  1.00 9.02  ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.307 -10.622 -6.101  1.00 8.63  ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.126 -9.697  -5.846  1.00 10.85 ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.049 -11.506 -7.312  1.00 11.00 ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.390 -7.591  -5.323  1.00 11.67 ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.450 -6.599  -4.258  1.00 8.65  ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.086 -5.964  -4.019  1.00 9.41  ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.253 -5.894  -4.922  1.00 10.09 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.495 -5.530  -4.575  1.00 9.28  ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.858 -5.521  -2.788  1.00 5.86  ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.668 -4.754  -2.458  1.00 6.34  ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.116 -3.436  -1.835  1.00 12.22 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.775 -3.424  -0.793  1.00 8.48  ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.766 -5.537  -1.499  1.00 7.54  ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.394 -4.968  -1.114  1.00 11.95 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.493 -4.040  0.094   1.00 10.11 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.744 -4.251  -2.296  1.00 8.20  ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.787 -2.331  -2.497  1.00 7.57  ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.105 -1.008  -1.975  1.00 7.62  ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.885 -0.414  -1.286  1.00 10.05 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.789 -0.397  -1.849  1.00 8.47  ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.581 -0.048  -3.080  1.00 12.62 ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 60.832 1.340   -2.503  1.00 10.86 ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.835 -0.591  -3.741  1.00 14.35 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.087 0.078   -0.068  1.00 8.28  ? 13  ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.996 0.569   0.764   1.00 11.06 ? 13  ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 58.374 1.919   1.378   1.00 9.70  ? 13  ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 59.271 1.983   2.215   1.00 9.67  ? 13  ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.729 -0.450  1.871   1.00 9.48  ? 13  ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 56.380 -0.278  2.511   1.00 18.89 ? 13  ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 55.978 -1.168  3.294   1.00 21.28 ? 13  ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 55.711 0.730   2.222   1.00 15.70 ? 13  ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.694 2.990   0.970   1.00 8.18  ? 14  MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 58.011 4.328   1.470   1.00 8.69  ? 14  MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.753 4.415   2.972   1.00 8.62  ? 14  MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.790 3.857   3.468   1.00 8.30  ? 14  MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 57.190 5.399   0.746   1.00 9.58  ? 14  MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 57.220 5.306   -0.776  1.00 9.93  ? 14  MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.883 5.353   -1.466  1.00 13.97 ? 14  MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.446 6.949   -0.900  1.00 9.79  ? 14  MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.613 5.109   3.703   1.00 7.33  ? 15  ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.416 5.233   5.144   1.00 10.29 ? 15  ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.337 6.269   5.445   1.00 9.30  ? 15  ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.314 7.331   4.826   1.00 7.84  ? 15  ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.727 5.609   5.834   1.00 9.62  ? 15  ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.798 4.547   5.667   1.00 10.75 ? 15  ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.446 3.355   5.553   1.00 9.74  ? 15  ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.992 4.903   5.652   1.00 11.33 ? 15  ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.453 5.953   6.391   1.00 7.87  ? 16  CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.338 6.830   6.768   1.00 8.85  ? 16  CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.993 7.814   5.651   1.00 7.50  ? 16  CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 55.150 9.025   5.798   1.00 5.93  ? 16  CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.641 7.570   8.077   1.00 8.13  ? 16  CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 57.196 8.492   8.094   1.00 12.26 ? 16  CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.503 7.277   4.539   1.00 6.46  ? 17  PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.462 8.015   3.277   1.00 6.28  ? 17  PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.763 9.383   3.290   1.00 5.02  ? 17  PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.378 10.387  2.933   1.00 4.48  ? 17  PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.912 7.134   2.152   1.00 6.17  ? 17  PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.980 7.779   0.805   1.00 6.72  ? 17  PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 55.167 8.324   0.348   1.00 6.87  ? 17  PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.858 7.848   -0.003  1.00 9.71  ? 17  PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 55.236 8.931   -0.894  1.00 10.23 ? 17  PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.920 8.449   -1.245  1.00 9.71  ? 17  PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 54.111 8.993   -1.691  1.00 8.75  ? 17  PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.491 9.432   3.677   1.00 5.47  ? 18  PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.764 10.703  3.667   1.00 5.46  ? 18  PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.440 11.738  4.564   1.00 6.12  ? 18  PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.451 12.929  4.255   1.00 6.64  ? 18  PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.303 10.528  4.088   1.00 5.64  ? 18  PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.460 9.798   3.085   1.00 7.66  ? 18  PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 50.042 9.064   2.065   1.00 6.18  ? 18  PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 48.079 9.852   3.161   1.00 6.76  ? 18  PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 49.262 8.396   1.144   1.00 8.30  ? 18  PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 47.291 9.183   2.243   1.00 8.11  ? 18  PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.884 8.456   1.232   1.00 11.26 ? 18  PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.996 11.278  5.681   1.00 6.99  ? 19  VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.738 12.157  6.578   1.00 6.41  ? 19  VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.942 12.778  5.867   1.00 6.38  ? 19  VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 55.176 13.988  5.962   1.00 5.97  ? 19  VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 54.203 11.408  7.847   1.00 6.74  ? 19  VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 55.265 12.206  8.584   1.00 6.41  ? 19  VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 53.018 11.115  8.758   1.00 6.77  ? 19  VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.703 11.950  5.154   1.00 6.08  ? 20  GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.848 12.439  4.391   1.00 7.28  ? 20  GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.440 13.470  3.341   1.00 5.61  ? 20  GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 57.156 14.446  3.110   1.00 6.36  ? 20  GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.589 11.291  3.707   1.00 7.68  ? 20  GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.516 10.498  4.615   1.00 8.87  ? 20  GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.587 9.770   3.829   1.00 10.95 ? 20  GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.675 10.301  3.609   1.00 10.65 ? 20  GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.282 8.552   3.393   1.00 9.82  ? 20  GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.306 13.238  2.689   1.00 4.52  ? 21  VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.807 14.179  1.689   1.00 5.23  ? 21  VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.558 15.544  2.325   1.00 7.50  ? 21  VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.954 16.576  1.781   1.00 5.74  ? 21  VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.510 13.674  1.016   1.00 5.33  ? 21  VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.979 14.710  0.033   1.00 5.88  ? 21  VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.759 12.349  0.308   1.00 6.44  ? 21  VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.910 15.541  3.487   1.00 5.18  ? 22  GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.592 16.783  4.184   1.00 6.49  ? 22  GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.838 17.436  4.778   1.00 6.18  ? 22  GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.925 18.660  4.853   1.00 6.31  ? 22  GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.545 16.538  5.278   1.00 5.67  ? 22  GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 51.203 16.053  4.750   1.00 6.57  ? 22  GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.494 17.100  3.913   1.00 9.21  ? 22  GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.764 18.302  4.109   1.00 12.16 ? 22  GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.669 16.723  3.057   1.00 11.26 ? 22  GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.799 16.617  5.197   1.00 5.88  ? 23  GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 57.038 17.130  5.774   1.00 6.72  ? 23  GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.932 17.779  4.718   1.00 7.19  ? 23  GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.636 18.746  5.005   1.00 6.72  ? 23  GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.807 16.021  6.494   1.00 8.37  ? 23  GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 57.226 15.616  7.841   1.00 8.96  ? 23  GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.990 14.468  8.474   1.00 9.90  ? 23  GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.443 13.556  7.782   1.00 9.73  ? 23  GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 58.143 14.511  9.793   1.00 9.66  ? 23  GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.915 17.242  3.503   1.00 5.49  ? 24  ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.675 17.848  2.415   1.00 7.31  ? 24  ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 58.115 19.232  2.110   1.00 9.04  ? 24  ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.863 20.185  1.893   1.00 8.10  ? 24  ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.639 16.979  1.153   1.00 6.86  ? 24  ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 59.444 17.568  -0.003  1.00 11.78 ? 24  ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.460 16.665  -1.232  1.00 8.21  ? 24  ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 58.174 16.635  -1.922  1.00 10.33 ? 24  ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.974 16.050  -3.099  1.00 8.69  ? 24  ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.978 15.446  -3.725  1.00 6.41  ? 24  ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.770 16.072  -3.651  1.00 7.58  ? 24  ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.790 19.332  2.115   1.00 7.08  ? 25  GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 56.103 20.580  1.801   1.00 10.63 ? 25  GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 56.226 21.615  2.919   1.00 9.39  ? 25  GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 56.306 22.814  2.656   1.00 8.41  ? 25  GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.628 20.305  1.505   1.00 9.10  ? 25  GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.787 21.556  1.302   1.00 12.78 ? 25  GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 52.321 21.236  1.087   1.00 15.17 ? 25  GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.981 20.224  0.478   1.00 14.29 ? 25  GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.444 22.095  1.597   1.00 17.11 ? 25  GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 56.239 21.143  4.162   1.00 8.94  ? 26  ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 56.316 22.024  5.325   1.00 9.59  ? 26  ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.468 21.637  6.250   1.00 9.20  ? 26  ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 57.320 20.752  7.092   1.00 7.02  ? 26  ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.996 21.997  6.100   1.00 12.18 ? 26  ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.984 22.965  7.274   1.00 15.60 ? 26  ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 56.011 23.545  7.630   1.00 11.03 ? 26  ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.818 23.134  7.887   1.00 17.32 ? 26  ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.621 22.304  6.094   1.00 7.04  ? 27  PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.831 21.976  6.860   1.00 9.53  ? 27  PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.618 22.005  8.375   1.00 10.52 ? 27  PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 60.356 21.341  9.102   1.00 8.46  ? 27  PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.818 23.070  6.436   1.00 10.56 ? 27  PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 60.358 23.477  5.069   1.00 11.45 ? 27  PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.859 23.377  5.112   1.00 7.41  ? 27  PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.626 22.759  8.842   1.00 10.94 ? 28  HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.322 22.827  10.272  1.00 14.20 ? 28  HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.940 21.468  10.861  1.00 15.19 ? 28  HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 58.040 21.260  12.071  1.00 14.54 ? 28  HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 57.198 23.833  10.537  1.00 17.84 ? 28  HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.638 25.262  10.472  1.00 19.75 ? 28  HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 56.864 26.254  9.909   1.00 22.36 ? 28  HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.768 25.868  10.909  1.00 17.63 ? 28  HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.500 27.409  9.997   1.00 21.57 ? 28  HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.657 27.202  10.601  1.00 21.51 ? 28  HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.500 20.549  10.006  1.00 12.17 ? 29  LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 57.059 19.233  10.459  1.00 11.38 ? 29  LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 58.191 18.205  10.480  1.00 10.79 ? 29  LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 58.046 17.124  11.054  1.00 9.78  ? 29  LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.912 18.721  9.584   1.00 10.19 ? 29  LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.647 19.581  9.542   1.00 15.08 ? 29  LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.632 18.991  8.572   1.00 11.68 ? 29  LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 54.044 19.726  10.929  1.00 13.33 ? 29  LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 59.316 18.541  9.858   1.00 9.58  ? 30  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.429 17.601  9.741   1.00 10.49 ? 30  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 61.055 17.289  11.095  1.00 11.73 ? 30  ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 61.212 18.176  11.931  1.00 10.87 ? 30  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.489 18.138  8.777   1.00 9.88  ? 30  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.967 18.368  7.369   1.00 10.38 ? 30  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 62.009 19.034  6.489   1.00 9.92  ? 30  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.488 19.331  5.156   1.00 11.68 ? 30  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 62.207 19.881  4.182   1.00 15.64 ? 30  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.479 20.193  4.392   1.00 12.48 ? 30  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.656 20.119  3.000   1.00 11.19 ? 30  ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.403 16.022  11.300  1.00 11.77 ? 31  ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 62.040 15.577  12.537  1.00 15.60 ? 31  ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 61.204 15.883  13.777  1.00 15.37 ? 31  ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.739 16.231  14.831  1.00 15.91 ? 31  ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.435 16.194  12.672  1.00 15.61 ? 31  ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 64.341 15.839  11.510  1.00 18.36 ? 31  ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.520 14.665  11.184  1.00 28.03 ? 31  ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.903 16.854  10.866  1.00 22.31 ? 31  ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.890 15.751  13.639  1.00 10.72 ? 32  LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.966 16.012  14.734  1.00 11.78 ? 32  LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.965 14.874  14.849  1.00 13.06 ? 32  LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.686 14.194  13.865  1.00 11.27 ? 32  LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 58.196 17.311  14.482  1.00 13.10 ? 32  LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 59.048 18.573  14.468  1.00 14.34 ? 32  LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 59.196 19.156  15.861  1.00 22.77 ? 32  LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 59.920 20.494  15.816  1.00 27.28 ? 32  LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 59.896 21.184  17.136  1.00 33.20 ? 32  LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 57.416 14.668  16.056  1.00 12.60 ? 33  PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 56.256 13.785  16.178  1.00 11.41 ? 33  PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 55.107 14.429  15.416  1.00 11.16 ? 33  PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 54.627 15.496  15.798  1.00 9.62  ? 33  PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 55.973 13.781  17.683  1.00 12.61 ? 33  PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 56.572 15.051  18.187  1.00 15.80 ? 33  PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 57.790 15.277  17.343  1.00 16.14 ? 33  PRO A CD    1 
ATOM   289  N  N     . CYS A 1 37  ? 54.691 13.799  14.327  1.00 8.42  ? 34  CYS A N     1 
ATOM   290  C  CA    A CYS A 1 37  ? 53.613 14.359  13.536  0.50 9.22  ? 34  CYS A CA    1 
ATOM   291  C  CA    B CYS A 1 37  ? 53.699 14.365  13.422  0.50 9.23  ? 34  CYS A CA    1 
ATOM   292  C  C     . CYS A 1 37  ? 52.773 13.268  12.899  1.00 8.40  ? 34  CYS A C     1 
ATOM   293  O  O     . CYS A 1 37  ? 53.172 12.104  12.836  1.00 10.15 ? 34  CYS A O     1 
ATOM   294  C  CB    A CYS A 1 37  ? 54.147 15.336  12.485  0.50 9.79  ? 34  CYS A CB    1 
ATOM   295  C  CB    B CYS A 1 37  ? 54.418 15.057  12.256  0.50 9.41  ? 34  CYS A CB    1 
ATOM   296  S  SG    A CYS A 1 37  ? 55.200 14.591  11.238  0.50 5.89  ? 34  CYS A SG    1 
ATOM   297  S  SG    B CYS A 1 37  ? 53.373 15.634  10.894  0.50 13.82 ? 34  CYS A SG    1 
ATOM   298  N  N     . ALA A 1 38  ? 51.569 13.643  12.492  1.00 7.00  ? 35  ALA A N     1 
ATOM   299  C  CA    . ALA A 1 38  ? 50.632 12.698  11.909  1.00 7.03  ? 35  ALA A CA    1 
ATOM   300  C  C     . ALA A 1 38  ? 49.796 13.392  10.847  1.00 7.74  ? 35  ALA A C     1 
ATOM   301  O  O     . ALA A 1 38  ? 49.643 14.612  10.869  1.00 8.09  ? 35  ALA A O     1 
ATOM   302  C  CB    . ALA A 1 38  ? 49.737 12.106  12.982  1.00 9.57  ? 35  ALA A CB    1 
ATOM   303  N  N     . VAL A 1 39  ? 49.265 12.610  9.915   1.00 8.00  ? 36  VAL A N     1 
ATOM   304  C  CA    . VAL A 1 39  ? 48.349 13.132  8.914   1.00 6.55  ? 36  VAL A CA    1 
ATOM   305  C  C     . VAL A 1 39  ? 46.936 12.724  9.302   1.00 12.25 ? 36  VAL A C     1 
ATOM   306  O  O     . VAL A 1 39  ? 46.687 11.562  9.632   1.00 8.79  ? 36  VAL A O     1 
ATOM   307  C  CB    . VAL A 1 39  ? 48.682 12.601  7.505   1.00 7.77  ? 36  VAL A CB    1 
ATOM   308  C  CG1   . VAL A 1 39  ? 47.576 12.969  6.516   1.00 8.22  ? 36  VAL A CG1   1 
ATOM   309  C  CG2   . VAL A 1 39  ? 50.028 13.140  7.041   1.00 6.73  ? 36  VAL A CG2   1 
ATOM   310  N  N     . VAL A 1 40  ? 46.020 13.688  9.282   1.00 9.70  ? 37  VAL A N     1 
ATOM   311  C  CA    . VAL A 1 40  ? 44.644 13.448  9.697   1.00 10.45 ? 37  VAL A CA    1 
ATOM   312  C  C     . VAL A 1 40  ? 43.673 13.866  8.603   1.00 10.58 ? 37  VAL A C     1 
ATOM   313  O  O     . VAL A 1 40  ? 43.961 14.767  7.814   1.00 12.09 ? 37  VAL A O     1 
ATOM   314  C  CB    . VAL A 1 40  ? 44.294 14.235  10.983  1.00 12.70 ? 37  VAL A CB    1 
ATOM   315  C  CG1   . VAL A 1 40  ? 45.220 13.842  12.120  1.00 14.52 ? 37  VAL A CG1   1 
ATOM   316  C  CG2   . VAL A 1 40  ? 44.364 15.738  10.727  1.00 11.36 ? 37  VAL A CG2   1 
ATOM   317  N  N     . GLN A 1 41  ? 42.522 13.208  8.550   1.00 10.67 ? 38  GLN A N     1 
ATOM   318  C  CA    . GLN A 1 41  ? 41.466 13.636  7.644   1.00 11.39 ? 38  GLN A CA    1 
ATOM   319  C  C     . GLN A 1 41  ? 40.221 14.044  8.424   1.00 14.13 ? 38  GLN A C     1 
ATOM   320  O  O     . GLN A 1 41  ? 39.819 13.370  9.377   1.00 11.38 ? 38  GLN A O     1 
ATOM   321  C  CB    . GLN A 1 41  ? 41.157 12.574  6.582   1.00 14.23 ? 38  GLN A CB    1 
ATOM   322  C  CG    . GLN A 1 41  ? 40.834 11.194  7.118   1.00 16.49 ? 38  GLN A CG    1 
ATOM   323  C  CD    . GLN A 1 41  ? 40.790 10.148  6.015   1.00 17.84 ? 38  GLN A CD    1 
ATOM   324  O  OE1   . GLN A 1 41  ? 41.086 10.438  4.854   1.00 20.33 ? 38  GLN A OE1   1 
ATOM   325  N  NE2   . GLN A 1 41  ? 40.423 8.927   6.375   1.00 17.66 ? 38  GLN A NE2   1 
ATOM   326  N  N     . TYR A 1 42  ? 39.633 15.165  8.017   1.00 11.04 ? 39  TYR A N     1 
ATOM   327  C  CA    . TYR A 1 42  ? 38.532 15.780  8.745   1.00 15.69 ? 39  TYR A CA    1 
ATOM   328  C  C     . TYR A 1 42  ? 39.052 16.249  10.105  1.00 16.17 ? 39  TYR A C     1 
ATOM   329  O  O     . TYR A 1 42  ? 40.144 15.863  10.516  1.00 20.76 ? 39  TYR A O     1 
ATOM   330  C  CB    . TYR A 1 42  ? 37.351 14.812  8.860   1.00 12.50 ? 39  TYR A CB    1 
ATOM   331  C  CG    . TYR A 1 42  ? 36.920 14.258  7.514   1.00 13.03 ? 39  TYR A CG    1 
ATOM   332  C  CD1   . TYR A 1 42  ? 36.416 15.097  6.527   1.00 16.15 ? 39  TYR A CD1   1 
ATOM   333  C  CD2   . TYR A 1 42  ? 37.029 12.902  7.225   1.00 14.58 ? 39  TYR A CD2   1 
ATOM   334  C  CE1   . TYR A 1 42  ? 36.027 14.604  5.295   1.00 15.35 ? 39  TYR A CE1   1 
ATOM   335  C  CE2   . TYR A 1 42  ? 36.640 12.397  5.990   1.00 13.94 ? 39  TYR A CE2   1 
ATOM   336  C  CZ    . TYR A 1 42  ? 36.141 13.255  5.031   1.00 16.20 ? 39  TYR A CZ    1 
ATOM   337  O  OH    . TYR A 1 42  ? 35.751 12.770  3.803   1.00 14.93 ? 39  TYR A OH    1 
ATOM   338  N  N     . LYS A 1 43  ? 38.299 17.102  10.789  1.00 22.30 ? 40  LYS A N     1 
ATOM   339  C  CA    . LYS A 1 43  ? 38.800 17.704  12.024  1.00 21.56 ? 40  LYS A CA    1 
ATOM   340  C  C     . LYS A 1 43  ? 37.701 17.858  13.067  1.00 22.81 ? 40  LYS A C     1 
ATOM   341  O  O     . LYS A 1 43  ? 37.974 17.914  14.267  1.00 22.14 ? 40  LYS A O     1 
ATOM   342  C  CB    . LYS A 1 43  ? 39.436 19.068  11.730  1.00 25.60 ? 40  LYS A CB    1 
ATOM   343  C  CG    . LYS A 1 43  ? 40.495 19.512  12.737  1.00 29.10 ? 40  LYS A CG    1 
ATOM   344  C  CD    . LYS A 1 43  ? 41.841 18.847  12.457  1.00 29.35 ? 40  LYS A CD    1 
ATOM   345  C  CE    . LYS A 1 43  ? 42.924 19.333  13.415  1.00 26.84 ? 40  LYS A CE    1 
ATOM   346  N  NZ    . LYS A 1 43  ? 42.683 18.890  14.818  1.00 27.44 ? 40  LYS A NZ    1 
ATOM   347  N  N     . SER A 1 44  ? 36.458 17.919  12.601  1.00 22.17 ? 41  SER A N     1 
ATOM   348  C  CA    . SER A 1 44  ? 35.312 18.150  13.475  1.00 24.18 ? 41  SER A CA    1 
ATOM   349  C  C     . SER A 1 44  ? 35.115 17.034  14.495  1.00 24.45 ? 41  SER A C     1 
ATOM   350  O  O     . SER A 1 44  ? 34.946 17.296  15.687  1.00 26.00 ? 41  SER A O     1 
ATOM   351  C  CB    . SER A 1 44  ? 34.038 18.324  12.647  1.00 25.75 ? 41  SER A CB    1 
ATOM   352  O  OG    . SER A 1 44  ? 34.170 19.404  11.741  1.00 31.52 ? 41  SER A OG    1 
ATOM   353  N  N     . TRP A 1 45  ? 35.127 15.792  14.024  1.00 23.95 ? 42  TRP A N     1 
ATOM   354  C  CA    . TRP A 1 45  ? 34.880 14.653  14.900  1.00 21.66 ? 42  TRP A CA    1 
ATOM   355  C  C     . TRP A 1 45  ? 36.146 14.206  15.622  1.00 21.29 ? 42  TRP A C     1 
ATOM   356  O  O     . TRP A 1 45  ? 36.987 13.507  15.053  1.00 19.03 ? 42  TRP A O     1 
ATOM   357  C  CB    . TRP A 1 45  ? 34.274 13.485  14.120  1.00 24.22 ? 42  TRP A CB    1 
ATOM   358  C  CG    . TRP A 1 45  ? 33.793 12.368  15.001  1.00 25.30 ? 42  TRP A CG    1 
ATOM   359  C  CD1   . TRP A 1 45  ? 34.479 11.237  15.340  1.00 26.85 ? 42  TRP A CD1   1 
ATOM   360  C  CD2   . TRP A 1 45  ? 32.524 12.279  15.657  1.00 26.45 ? 42  TRP A CD2   1 
ATOM   361  N  NE1   . TRP A 1 45  ? 33.714 10.449  16.165  1.00 28.76 ? 42  TRP A NE1   1 
ATOM   362  C  CE2   . TRP A 1 45  ? 32.507 11.066  16.375  1.00 27.97 ? 42  TRP A CE2   1 
ATOM   363  C  CE3   . TRP A 1 45  ? 31.396 13.105  15.706  1.00 29.00 ? 42  TRP A CE3   1 
ATOM   364  C  CZ2   . TRP A 1 45  ? 31.412 10.660  17.132  1.00 30.48 ? 42  TRP A CZ2   1 
ATOM   365  C  CZ3   . TRP A 1 45  ? 30.308 12.700  16.459  1.00 27.05 ? 42  TRP A CZ3   1 
ATOM   366  C  CH2   . TRP A 1 45  ? 30.324 11.489  17.161  1.00 29.50 ? 42  TRP A CH2   1 
ATOM   367  N  N     . LYS A 1 46  ? 36.271 14.621  16.879  1.00 22.99 ? 43  LYS A N     1 
ATOM   368  C  CA    . LYS A 1 46  ? 37.371 14.198  17.740  1.00 17.24 ? 43  LYS A CA    1 
ATOM   369  C  C     . LYS A 1 46  ? 38.746 14.559  17.181  1.00 18.62 ? 43  LYS A C     1 
ATOM   370  O  O     . LYS A 1 46  ? 39.719 13.829  17.381  1.00 18.07 ? 43  LYS A O     1 
ATOM   371  C  CB    . LYS A 1 46  ? 37.280 12.697  18.022  1.00 18.49 ? 43  LYS A CB    1 
ATOM   372  C  CG    . LYS A 1 46  ? 35.957 12.278  18.643  1.00 24.26 ? 43  LYS A CG    1 
ATOM   373  C  CD    . LYS A 1 46  ? 35.934 10.796  18.972  1.00 24.85 ? 43  LYS A CD    1 
ATOM   374  C  CE    . LYS A 1 46  ? 34.623 10.409  19.638  1.00 34.15 ? 43  LYS A CE    1 
ATOM   375  N  NZ    . LYS A 1 46  ? 34.595 8.969   20.013  1.00 32.29 ? 43  LYS A NZ    1 
ATOM   376  N  N     . GLY A 1 47  ? 38.819 15.691  16.489  1.00 15.01 ? 44  GLY A N     1 
ATOM   377  C  CA    . GLY A 1 47  ? 40.080 16.201  15.983  1.00 19.33 ? 44  GLY A CA    1 
ATOM   378  C  C     . GLY A 1 47  ? 40.497 15.604  14.653  1.00 15.36 ? 44  GLY A C     1 
ATOM   379  O  O     . GLY A 1 47  ? 41.508 16.001  14.078  1.00 15.84 ? 44  GLY A O     1 
ATOM   380  N  N     . GLY A 1 48  ? 39.717 14.648  14.164  1.00 16.48 ? 45  GLY A N     1 
ATOM   381  C  CA    . GLY A 1 48  ? 40.006 14.008  12.894  1.00 15.86 ? 45  GLY A CA    1 
ATOM   382  C  C     . GLY A 1 48  ? 40.647 12.647  13.075  1.00 14.78 ? 45  GLY A C     1 
ATOM   383  O  O     . GLY A 1 48  ? 41.222 12.357  14.122  1.00 14.48 ? 45  GLY A O     1 
ATOM   384  N  N     . GLY A 1 49  ? 40.545 11.808  12.050  1.00 11.44 ? 46  GLY A N     1 
ATOM   385  C  CA    . GLY A 1 49  ? 41.112 10.474  12.099  1.00 11.63 ? 46  GLY A CA    1 
ATOM   386  C  C     . GLY A 1 49  ? 42.520 10.433  11.537  1.00 11.89 ? 46  GLY A C     1 
ATOM   387  O  O     . GLY A 1 49  ? 42.782 10.962  10.457  1.00 10.55 ? 46  GLY A O     1 
ATOM   388  N  N     . ILE A 1 50  ? 43.428 9.803   12.275  1.00 9.64  ? 47  ILE A N     1 
ATOM   389  C  CA    . ILE A 1 50  ? 44.821 9.702   11.858  1.00 9.80  ? 47  ILE A CA    1 
ATOM   390  C  C     . ILE A 1 50  ? 45.007 8.593   10.822  1.00 9.22  ? 47  ILE A C     1 
ATOM   391  O  O     . ILE A 1 50  ? 44.561 7.465   11.027  1.00 8.49  ? 47  ILE A O     1 
ATOM   392  C  CB    . ILE A 1 50  ? 45.741 9.446   13.071  1.00 11.65 ? 47  ILE A CB    1 
ATOM   393  C  CG1   . ILE A 1 50  ? 45.788 10.683  13.972  1.00 12.59 ? 47  ILE A CG1   1 
ATOM   394  C  CG2   . ILE A 1 50  ? 47.140 9.063   12.616  1.00 10.44 ? 47  ILE A CG2   1 
ATOM   395  C  CD1   . ILE A 1 50  ? 46.640 10.502  15.210  1.00 15.32 ? 47  ILE A CD1   1 
ATOM   396  N  N     . ILE A 1 51  ? 45.658 8.916   9.706   1.00 7.26  ? 48  ILE A N     1 
ATOM   397  C  CA    . ILE A 1 51  ? 45.906 7.916   8.668   1.00 7.29  ? 48  ILE A CA    1 
ATOM   398  C  C     . ILE A 1 51  ? 47.392 7.626   8.440   1.00 10.87 ? 48  ILE A C     1 
ATOM   399  O  O     . ILE A 1 51  ? 47.740 6.659   7.764   1.00 9.88  ? 48  ILE A O     1 
ATOM   400  C  CB    . ILE A 1 51  ? 45.231 8.284   7.325   1.00 10.21 ? 48  ILE A CB    1 
ATOM   401  C  CG1   . ILE A 1 51  ? 45.777 9.605   6.781   1.00 8.16  ? 48  ILE A CG1   1 
ATOM   402  C  CG2   . ILE A 1 51  ? 43.716 8.355   7.488   1.00 12.28 ? 48  ILE A CG2   1 
ATOM   403  C  CD1   . ILE A 1 51  ? 45.172 9.997   5.444   1.00 11.47 ? 48  ILE A CD1   1 
ATOM   404  N  N     . ALA A 1 52  ? 48.261 8.460   9.005   1.00 8.79  ? 49  ALA A N     1 
ATOM   405  C  CA    . ALA A 1 52  ? 49.704 8.250   8.900   1.00 6.30  ? 49  ALA A CA    1 
ATOM   406  C  C     . ALA A 1 52  ? 50.432 8.873   10.088  1.00 7.02  ? 49  ALA A C     1 
ATOM   407  O  O     . ALA A 1 52  ? 50.036 9.928   10.579  1.00 6.49  ? 49  ALA A O     1 
ATOM   408  C  CB    . ALA A 1 52  ? 50.234 8.819   7.591   1.00 5.30  ? 49  ALA A CB    1 
ATOM   409  N  N     . VAL A 1 53  ? 51.504 8.224   10.534  1.00 6.82  ? 50  VAL A N     1 
ATOM   410  C  CA    . VAL A 1 53  ? 52.190 8.624   11.760  1.00 7.02  ? 50  VAL A CA    1 
ATOM   411  C  C     . VAL A 1 53  ? 53.711 8.583   11.603  1.00 7.19  ? 50  VAL A C     1 
ATOM   412  O  O     . VAL A 1 53  ? 54.269 7.584   11.151  1.00 7.58  ? 50  VAL A O     1 
ATOM   413  C  CB    . VAL A 1 53  ? 51.792 7.704   12.936  1.00 7.04  ? 50  VAL A CB    1 
ATOM   414  C  CG1   . VAL A 1 53  ? 52.409 8.197   14.231  1.00 8.92  ? 50  VAL A CG1   1 
ATOM   415  C  CG2   . VAL A 1 53  ? 50.276 7.622   13.065  1.00 8.46  ? 50  VAL A CG2   1 
ATOM   416  N  N     . SER A 1 54  ? 54.379 9.669   11.981  1.00 6.76  ? 51  SER A N     1 
ATOM   417  C  CA    . SER A 1 54  ? 55.834 9.719   11.916  1.00 7.30  ? 51  SER A CA    1 
ATOM   418  C  C     . SER A 1 54  ? 56.422 8.806   12.981  1.00 9.18  ? 51  SER A C     1 
ATOM   419  O  O     . SER A 1 54  ? 55.785 8.533   13.998  1.00 7.90  ? 51  SER A O     1 
ATOM   420  C  CB    . SER A 1 54  ? 56.347 11.145  12.117  1.00 8.29  ? 51  SER A CB    1 
ATOM   421  O  OG    . SER A 1 54  ? 56.421 11.466  13.496  1.00 10.15 ? 51  SER A OG    1 
ATOM   422  N  N     . TYR A 1 55  ? 57.643 8.340   12.753  1.00 8.41  ? 52  TYR A N     1 
ATOM   423  C  CA    . TYR A 1 55  ? 58.270 7.419   13.691  1.00 10.64 ? 52  TYR A CA    1 
ATOM   424  C  C     . TYR A 1 55  ? 58.516 8.061   15.058  1.00 13.29 ? 52  TYR A C     1 
ATOM   425  O  O     . TYR A 1 55  ? 58.497 7.380   16.081  1.00 12.12 ? 52  TYR A O     1 
ATOM   426  C  CB    . TYR A 1 55  ? 59.540 6.812   13.089  1.00 10.34 ? 52  TYR A CB    1 
ATOM   427  C  CG    . TYR A 1 55  ? 59.216 5.727   12.085  1.00 11.59 ? 52  TYR A CG    1 
ATOM   428  C  CD1   . TYR A 1 55  ? 58.848 6.043   10.783  1.00 9.37  ? 52  TYR A CD1   1 
ATOM   429  C  CD2   . TYR A 1 55  ? 59.240 4.389   12.452  1.00 13.23 ? 52  TYR A CD2   1 
ATOM   430  C  CE1   . TYR A 1 55  ? 58.530 5.050   9.868   1.00 11.70 ? 52  TYR A CE1   1 
ATOM   431  C  CE2   . TYR A 1 55  ? 58.928 3.394   11.550  1.00 12.61 ? 52  TYR A CE2   1 
ATOM   432  C  CZ    . TYR A 1 55  ? 58.572 3.726   10.260  1.00 11.13 ? 52  TYR A CZ    1 
ATOM   433  O  OH    . TYR A 1 55  ? 58.263 2.728   9.366   1.00 13.35 ? 52  TYR A OH    1 
ATOM   434  N  N     . GLU A 1 56  ? 58.711 9.375   15.074  1.00 12.75 ? 53  GLU A N     1 
ATOM   435  C  CA    . GLU A 1 56  ? 58.852 10.105  16.330  1.00 13.36 ? 53  GLU A CA    1 
ATOM   436  C  C     . GLU A 1 56  ? 57.569 10.040  17.157  1.00 12.24 ? 53  GLU A C     1 
ATOM   437  O  O     . GLU A 1 56  ? 57.617 9.916   18.381  1.00 12.95 ? 53  GLU A O     1 
ATOM   438  C  CB    . GLU A 1 56  ? 59.239 11.564  16.073  1.00 13.57 ? 53  GLU A CB    1 
ATOM   439  C  CG    . GLU A 1 56  ? 60.640 11.758  15.505  1.00 17.26 ? 53  GLU A CG    1 
ATOM   440  C  CD    . GLU A 1 56  ? 60.703 11.604  13.994  1.00 21.81 ? 53  GLU A CD    1 
ATOM   441  O  OE1   . GLU A 1 56  ? 59.743 11.069  13.397  1.00 18.85 ? 53  GLU A OE1   1 
ATOM   442  O  OE2   . GLU A 1 56  ? 61.718 12.027  13.401  1.00 22.05 ? 53  GLU A OE2   1 
ATOM   443  N  N     . ALA A 1 57  ? 56.424 10.121  16.485  1.00 11.31 ? 54  ALA A N     1 
ATOM   444  C  CA    . ALA A 1 57  ? 55.133 10.053  17.165  1.00 9.37  ? 54  ALA A CA    1 
ATOM   445  C  C     . ALA A 1 57  ? 54.773 8.623   17.571  1.00 9.86  ? 54  ALA A C     1 
ATOM   446  O  O     . ALA A 1 57  ? 54.127 8.404   18.597  1.00 9.68  ? 54  ALA A O     1 
ATOM   447  C  CB    . ALA A 1 57  ? 54.034 10.660  16.293  1.00 10.79 ? 54  ALA A CB    1 
ATOM   448  N  N     . ARG A 1 58  ? 55.191 7.649   16.767  1.00 10.23 ? 55  ARG A N     1 
ATOM   449  C  CA    . ARG A 1 58  ? 54.929 6.246   17.083  1.00 10.75 ? 55  ARG A CA    1 
ATOM   450  C  C     . ARG A 1 58  ? 55.544 5.868   18.429  1.00 13.25 ? 55  ARG A C     1 
ATOM   451  O  O     . ARG A 1 58  ? 55.009 5.028   19.154  1.00 12.95 ? 55  ARG A O     1 
ATOM   452  C  CB    . ARG A 1 58  ? 55.462 5.328   15.983  1.00 11.75 ? 55  ARG A CB    1 
ATOM   453  C  CG    . ARG A 1 58  ? 54.850 5.589   14.618  1.00 10.17 ? 55  ARG A CG    1 
ATOM   454  C  CD    . ARG A 1 58  ? 55.358 4.610   13.577  1.00 12.44 ? 55  ARG A CD    1 
ATOM   455  N  NE    . ARG A 1 58  ? 54.947 5.010   12.236  1.00 10.85 ? 55  ARG A NE    1 
ATOM   456  C  CZ    . ARG A 1 58  ? 55.081 4.254   11.152  1.00 11.71 ? 55  ARG A CZ    1 
ATOM   457  N  NH1   . ARG A 1 58  ? 55.611 3.042   11.245  1.00 10.69 ? 55  ARG A NH1   1 
ATOM   458  N  NH2   . ARG A 1 58  ? 54.679 4.712   9.975   1.00 12.40 ? 55  ARG A NH2   1 
ATOM   459  N  N     . ALA A 1 59  ? 56.666 6.498   18.759  1.00 11.78 ? 56  ALA A N     1 
ATOM   460  C  CA    . ALA A 1 59  ? 57.334 6.247   20.032  1.00 15.09 ? 56  ALA A CA    1 
ATOM   461  C  C     . ALA A 1 59  ? 56.436 6.590   21.223  1.00 15.44 ? 56  ALA A C     1 
ATOM   462  O  O     . ALA A 1 59  ? 56.563 5.996   22.294  1.00 19.15 ? 56  ALA A O     1 
ATOM   463  C  CB    . ALA A 1 59  ? 58.643 7.018   20.106  1.00 12.49 ? 56  ALA A CB    1 
ATOM   464  N  N     . PHE A 1 60  ? 55.532 7.548   21.034  1.00 11.40 ? 57  PHE A N     1 
ATOM   465  C  CA    . PHE A 1 60  ? 54.587 7.924   22.086  1.00 14.12 ? 57  PHE A CA    1 
ATOM   466  C  C     . PHE A 1 60  ? 53.364 7.010   22.122  1.00 15.17 ? 57  PHE A C     1 
ATOM   467  O  O     . PHE A 1 60  ? 52.553 7.085   23.047  1.00 15.57 ? 57  PHE A O     1 
ATOM   468  C  CB    . PHE A 1 60  ? 54.139 9.379   21.926  1.00 12.19 ? 57  PHE A CB    1 
ATOM   469  C  CG    . PHE A 1 60  ? 55.207 10.384  22.251  1.00 14.89 ? 57  PHE A CG    1 
ATOM   470  C  CD1   . PHE A 1 60  ? 55.313 10.911  23.529  1.00 18.79 ? 57  PHE A CD1   1 
ATOM   471  C  CD2   . PHE A 1 60  ? 56.100 10.806  21.282  1.00 11.53 ? 57  PHE A CD2   1 
ATOM   472  C  CE1   . PHE A 1 60  ? 56.291 11.840  23.833  1.00 18.43 ? 57  PHE A CE1   1 
ATOM   473  C  CE2   . PHE A 1 60  ? 57.080 11.735  21.578  1.00 16.49 ? 57  PHE A CE2   1 
ATOM   474  C  CZ    . PHE A 1 60  ? 57.176 12.253  22.856  1.00 22.30 ? 57  PHE A CZ    1 
ATOM   475  N  N     . GLY A 1 61  ? 53.228 6.155   21.113  1.00 12.38 ? 58  GLY A N     1 
ATOM   476  C  CA    . GLY A 1 61  ? 52.114 5.222   21.052  1.00 13.32 ? 58  GLY A CA    1 
ATOM   477  C  C     . GLY A 1 61  ? 51.017 5.652   20.094  1.00 14.01 ? 58  GLY A C     1 
ATOM   478  O  O     . GLY A 1 61  ? 49.939 5.055   20.056  1.00 9.76  ? 58  GLY A O     1 
ATOM   479  N  N     . VAL A 1 62  ? 51.287 6.697   19.319  1.00 11.33 ? 59  VAL A N     1 
ATOM   480  C  CA    . VAL A 1 62  ? 50.325 7.178   18.332  1.00 11.55 ? 59  VAL A CA    1 
ATOM   481  C  C     . VAL A 1 62  ? 50.212 6.188   17.181  1.00 10.92 ? 59  VAL A C     1 
ATOM   482  O  O     . VAL A 1 62  ? 51.221 5.722   16.654  1.00 10.26 ? 59  VAL A O     1 
ATOM   483  C  CB    . VAL A 1 62  ? 50.727 8.557   17.773  1.00 8.07  ? 59  VAL A CB    1 
ATOM   484  C  CG1   . VAL A 1 62  ? 49.742 9.000   16.701  1.00 11.88 ? 59  VAL A CG1   1 
ATOM   485  C  CG2   . VAL A 1 62  ? 50.794 9.580   18.891  1.00 8.72  ? 59  VAL A CG2   1 
ATOM   486  N  N     . THR A 1 63  ? 48.982 5.866   16.792  1.00 11.62 ? 60  THR A N     1 
ATOM   487  C  CA    . THR A 1 63  ? 48.757 4.911   15.714  1.00 13.43 ? 60  THR A CA    1 
ATOM   488  C  C     . THR A 1 63  ? 47.691 5.379   14.733  1.00 13.79 ? 60  THR A C     1 
ATOM   489  O  O     . THR A 1 63  ? 46.896 6.272   15.033  1.00 13.51 ? 60  THR A O     1 
ATOM   490  C  CB    . THR A 1 63  ? 48.334 3.529   16.255  1.00 14.84 ? 60  THR A CB    1 
ATOM   491  O  OG1   . THR A 1 63  ? 47.071 3.641   16.922  1.00 15.68 ? 60  THR A OG1   1 
ATOM   492  C  CG2   . THR A 1 63  ? 49.372 2.990   17.223  1.00 15.62 ? 60  THR A CG2   1 
ATOM   493  N  N     . ARG A 1 64  ? 47.689 4.761   13.558  1.00 12.92 ? 61  ARG A N     1 
ATOM   494  C  CA    . ARG A 1 64  ? 46.648 4.973   12.562  1.00 13.82 ? 61  ARG A CA    1 
ATOM   495  C  C     . ARG A 1 64  ? 45.290 4.566   13.130  1.00 17.96 ? 61  ARG A C     1 
ATOM   496  O  O     . ARG A 1 64  ? 45.216 3.699   14.001  1.00 18.27 ? 61  ARG A O     1 
ATOM   497  C  CB    . ARG A 1 64  ? 46.975 4.164   11.304  1.00 15.44 ? 61  ARG A CB    1 
ATOM   498  C  CG    . ARG A 1 64  ? 45.834 4.010   10.314  1.00 17.64 ? 61  ARG A CG    1 
ATOM   499  C  CD    . ARG A 1 64  ? 46.300 3.260   9.070   1.00 19.14 ? 61  ARG A CD    1 
ATOM   500  N  NE    . ARG A 1 64  ? 47.372 3.979   8.386   1.00 18.66 ? 61  ARG A NE    1 
ATOM   501  C  CZ    . ARG A 1 64  ? 48.608 3.516   8.226   1.00 17.26 ? 61  ARG A CZ    1 
ATOM   502  N  NH1   . ARG A 1 64  ? 48.937 2.317   8.688   1.00 21.10 ? 61  ARG A NH1   1 
ATOM   503  N  NH2   . ARG A 1 64  ? 49.514 4.252   7.596   1.00 11.90 ? 61  ARG A NH2   1 
ATOM   504  N  N     . SER A 1 65  ? 44.230 5.207   12.637  1.00 17.12 ? 62  SER A N     1 
ATOM   505  C  CA    . SER A 1 65  ? 42.850 4.945   13.059  1.00 22.58 ? 62  SER A CA    1 
ATOM   506  C  C     . SER A 1 65  ? 42.502 5.674   14.354  1.00 24.18 ? 62  SER A C     1 
ATOM   507  O  O     . SER A 1 65  ? 41.332 5.837   14.698  1.00 29.63 ? 62  SER A O     1 
ATOM   508  C  CB    . SER A 1 65  ? 42.577 3.446   13.206  1.00 24.91 ? 62  SER A CB    1 
ATOM   509  O  OG    . SER A 1 65  ? 42.809 3.010   14.534  1.00 29.90 ? 62  SER A OG    1 
ATOM   510  N  N     . MET A 1 66  ? 43.532 6.110   15.065  1.00 19.57 ? 63  MET A N     1 
ATOM   511  C  CA    . MET A 1 66  ? 43.372 6.833   16.316  1.00 15.84 ? 63  MET A CA    1 
ATOM   512  C  C     . MET A 1 66  ? 42.796 8.224   16.047  1.00 16.50 ? 63  MET A C     1 
ATOM   513  O  O     . MET A 1 66  ? 43.168 8.876   15.071  1.00 15.52 ? 63  MET A O     1 
ATOM   514  C  CB    . MET A 1 66  ? 44.740 6.938   16.989  1.00 17.37 ? 63  MET A CB    1 
ATOM   515  C  CG    . MET A 1 66  ? 44.744 7.390   18.427  1.00 18.30 ? 63  MET A CG    1 
ATOM   516  S  SD    . MET A 1 66  ? 46.394 7.171   19.129  1.00 17.66 ? 63  MET A SD    1 
ATOM   517  C  CE    . MET A 1 66  ? 46.382 5.422   19.513  1.00 17.50 ? 63  MET A CE    1 
ATOM   518  N  N     . TRP A 1 67  ? 41.875 8.672   16.897  1.00 16.96 ? 64  TRP A N     1 
ATOM   519  C  CA    . TRP A 1 67  ? 41.358 10.035  16.791  1.00 16.25 ? 64  TRP A CA    1 
ATOM   520  C  C     . TRP A 1 67  ? 42.422 11.012  17.270  1.00 12.54 ? 64  TRP A C     1 
ATOM   521  O  O     . TRP A 1 67  ? 43.093 10.760  18.269  1.00 12.88 ? 64  TRP A O     1 
ATOM   522  C  CB    . TRP A 1 67  ? 40.080 10.213  17.615  1.00 17.31 ? 64  TRP A CB    1 
ATOM   523  C  CG    . TRP A 1 67  ? 38.929 9.395   17.130  1.00 18.82 ? 64  TRP A CG    1 
ATOM   524  C  CD1   . TRP A 1 67  ? 38.274 8.416   17.817  1.00 20.20 ? 64  TRP A CD1   1 
ATOM   525  C  CD2   . TRP A 1 67  ? 38.300 9.477   15.846  1.00 20.32 ? 64  TRP A CD2   1 
ATOM   526  N  NE1   . TRP A 1 67  ? 37.272 7.885   17.041  1.00 23.60 ? 64  TRP A NE1   1 
ATOM   527  C  CE2   . TRP A 1 67  ? 37.267 8.518   15.826  1.00 22.30 ? 64  TRP A CE2   1 
ATOM   528  C  CE3   . TRP A 1 67  ? 38.508 10.267  14.711  1.00 17.77 ? 64  TRP A CE3   1 
ATOM   529  C  CZ2   . TRP A 1 67  ? 36.446 8.328   14.716  1.00 26.80 ? 64  TRP A CZ2   1 
ATOM   530  C  CZ3   . TRP A 1 67  ? 37.691 10.077  13.610  1.00 18.13 ? 64  TRP A CZ3   1 
ATOM   531  C  CH2   . TRP A 1 67  ? 36.673 9.115   13.621  1.00 21.32 ? 64  TRP A CH2   1 
ATOM   532  N  N     . ALA A 1 68  ? 42.576 12.124  16.556  1.00 12.36 ? 65  ALA A N     1 
ATOM   533  C  CA    . ALA A 1 68  ? 43.604 13.107  16.887  1.00 13.24 ? 65  ALA A CA    1 
ATOM   534  C  C     . ALA A 1 68  ? 43.499 13.598  18.330  1.00 12.72 ? 65  ALA A C     1 
ATOM   535  O  O     . ALA A 1 68  ? 44.513 13.852  18.978  1.00 11.24 ? 65  ALA A O     1 
ATOM   536  C  CB    . ALA A 1 68  ? 43.555 14.280  15.917  1.00 14.81 ? 65  ALA A CB    1 
ATOM   537  N  N     . ASP A 1 69  ? 42.275 13.739  18.831  1.00 13.11 ? 66  ASP A N     1 
ATOM   538  C  CA    . ASP A 1 69  ? 42.079 14.171  20.212  1.00 15.59 ? 66  ASP A CA    1 
ATOM   539  C  C     . ASP A 1 69  ? 42.671 13.162  21.192  1.00 13.37 ? 66  ASP A C     1 
ATOM   540  O  O     . ASP A 1 69  ? 43.206 13.535  22.234  1.00 14.63 ? 66  ASP A O     1 
ATOM   541  C  CB    . ASP A 1 69  ? 40.596 14.393  20.517  1.00 13.16 ? 66  ASP A CB    1 
ATOM   542  C  CG    . ASP A 1 69  ? 40.055 15.669  19.902  1.00 21.98 ? 66  ASP A CG    1 
ATOM   543  O  OD1   . ASP A 1 69  ? 40.861 16.490  19.410  1.00 20.41 ? 66  ASP A OD1   1 
ATOM   544  O  OD2   . ASP A 1 69  ? 38.822 15.859  19.923  1.00 20.51 ? 66  ASP A OD2   1 
ATOM   545  N  N     . ASP A 1 70  ? 42.573 11.882  20.850  1.00 12.17 ? 67  ASP A N     1 
ATOM   546  C  CA    . ASP A 1 70  ? 43.093 10.825  21.708  1.00 14.21 ? 67  ASP A CA    1 
ATOM   547  C  C     . ASP A 1 70  ? 44.607 10.710  21.575  1.00 12.02 ? 67  ASP A C     1 
ATOM   548  O  O     . ASP A 1 70  ? 45.308 10.439  22.548  1.00 10.88 ? 67  ASP A O     1 
ATOM   549  C  CB    . ASP A 1 70  ? 42.418 9.491   21.381  1.00 14.05 ? 67  ASP A CB    1 
ATOM   550  C  CG    . ASP A 1 70  ? 40.927 9.507   21.672  1.00 21.83 ? 67  ASP A CG    1 
ATOM   551  O  OD1   . ASP A 1 70  ? 40.505 10.264  22.573  1.00 20.15 ? 67  ASP A OD1   1 
ATOM   552  O  OD2   . ASP A 1 70  ? 40.178 8.762   21.003  1.00 18.41 ? 67  ASP A OD2   1 
ATOM   553  N  N     . ALA A 1 71  ? 45.106 10.923  20.362  1.00 13.26 ? 68  ALA A N     1 
ATOM   554  C  CA    . ALA A 1 71  ? 46.540 10.894  20.107  1.00 13.20 ? 68  ALA A CA    1 
ATOM   555  C  C     . ALA A 1 71  ? 47.247 11.991  20.896  1.00 11.59 ? 68  ALA A C     1 
ATOM   556  O  O     . ALA A 1 71  ? 48.359 11.799  21.383  1.00 11.45 ? 68  ALA A O     1 
ATOM   557  C  CB    . ALA A 1 71  ? 46.816 11.049  18.616  1.00 10.25 ? 68  ALA A CB    1 
ATOM   558  N  N     . LYS A 1 72  ? 46.593 13.143  21.009  1.00 10.74 ? 69  LYS A N     1 
ATOM   559  C  CA    . LYS A 1 72  ? 47.130 14.269  21.765  1.00 13.43 ? 69  LYS A CA    1 
ATOM   560  C  C     . LYS A 1 72  ? 47.299 13.933  23.246  1.00 13.12 ? 69  LYS A C     1 
ATOM   561  O  O     . LYS A 1 72  ? 48.148 14.504  23.930  1.00 14.06 ? 69  LYS A O     1 
ATOM   562  C  CB    . LYS A 1 72  ? 46.233 15.498  21.597  1.00 14.66 ? 69  LYS A CB    1 
ATOM   563  C  CG    . LYS A 1 72  ? 46.576 16.362  20.389  1.00 15.87 ? 69  LYS A CG    1 
ATOM   564  C  CD    . LYS A 1 72  ? 47.892 17.099  20.601  1.00 16.47 ? 69  LYS A CD    1 
ATOM   565  C  CE    . LYS A 1 72  ? 48.142 18.120  19.500  1.00 18.75 ? 69  LYS A CE    1 
ATOM   566  N  NZ    . LYS A 1 72  ? 49.383 18.915  19.739  1.00 17.04 ? 69  LYS A NZ    1 
ATOM   567  N  N     . LYS A 1 73  ? 46.489 13.002  23.738  1.00 13.47 ? 70  LYS A N     1 
ATOM   568  C  CA    . LYS A 1 73  ? 46.585 12.574  25.129  1.00 14.49 ? 70  LYS A CA    1 
ATOM   569  C  C     . LYS A 1 73  ? 47.887 11.813  25.372  1.00 15.10 ? 70  LYS A C     1 
ATOM   570  O  O     . LYS A 1 73  ? 48.490 11.920  26.439  1.00 16.55 ? 70  LYS A O     1 
ATOM   571  C  CB    . LYS A 1 73  ? 45.377 11.712  25.506  1.00 13.26 ? 70  LYS A CB    1 
ATOM   572  C  CG    . LYS A 1 73  ? 44.043 12.404  25.280  1.00 12.60 ? 70  LYS A CG    1 
ATOM   573  C  CD    . LYS A 1 73  ? 42.873 11.459  25.506  1.00 15.76 ? 70  LYS A CD    1 
ATOM   574  C  CE    . LYS A 1 73  ? 41.551 12.142  25.194  1.00 15.01 ? 70  LYS A CE    1 
ATOM   575  N  NZ    . LYS A 1 73  ? 40.400 11.202  25.312  1.00 24.37 ? 70  LYS A NZ    1 
ATOM   576  N  N     . LEU A 1 74  ? 48.320 11.052  24.371  1.00 11.47 ? 71  LEU A N     1 
ATOM   577  C  CA    . LEU A 1 74  ? 49.567 10.298  24.457  1.00 14.45 ? 71  LEU A CA    1 
ATOM   578  C  C     . LEU A 1 74  ? 50.764 11.170  24.096  1.00 13.51 ? 71  LEU A C     1 
ATOM   579  O  O     . LEU A 1 74  ? 51.868 10.974  24.607  1.00 11.86 ? 71  LEU A O     1 
ATOM   580  C  CB    . LEU A 1 74  ? 49.527 9.093   23.514  1.00 12.05 ? 71  LEU A CB    1 
ATOM   581  C  CG    . LEU A 1 74  ? 48.438 8.046   23.744  1.00 14.79 ? 71  LEU A CG    1 
ATOM   582  C  CD1   . LEU A 1 74  ? 48.568 6.928   22.722  1.00 14.95 ? 71  LEU A CD1   1 
ATOM   583  C  CD2   . LEU A 1 74  ? 48.522 7.494   25.155  1.00 12.36 ? 71  LEU A CD2   1 
ATOM   584  N  N     . CYS A 1 75  ? 50.534 12.127  23.203  1.00 12.46 ? 72  CYS A N     1 
ATOM   585  C  CA    . CYS A 1 75  ? 51.600 12.955  22.658  1.00 11.83 ? 72  CYS A CA    1 
ATOM   586  C  C     . CYS A 1 75  ? 51.108 14.391  22.517  1.00 16.35 ? 72  CYS A C     1 
ATOM   587  O  O     . CYS A 1 75  ? 50.649 14.797  21.449  1.00 14.15 ? 72  CYS A O     1 
ATOM   588  C  CB    . CYS A 1 75  ? 52.036 12.403  21.300  1.00 14.03 ? 72  CYS A CB    1 
ATOM   589  S  SG    . CYS A 1 75  ? 53.422 13.260  20.534  1.00 16.71 ? 72  CYS A SG    1 
ATOM   590  N  N     . PRO A 1 76  ? 51.194 15.164  23.608  1.00 15.22 ? 73  PRO A N     1 
ATOM   591  C  CA    . PRO A 1 76  ? 50.665 16.532  23.680  1.00 15.57 ? 73  PRO A CA    1 
ATOM   592  C  C     . PRO A 1 76  ? 51.276 17.478  22.645  1.00 14.09 ? 73  PRO A C     1 
ATOM   593  O  O     . PRO A 1 76  ? 50.606 18.418  22.219  1.00 14.82 ? 73  PRO A O     1 
ATOM   594  C  CB    . PRO A 1 76  ? 51.049 16.981  25.094  1.00 16.82 ? 73  PRO A CB    1 
ATOM   595  C  CG    . PRO A 1 76  ? 51.210 15.716  25.863  1.00 19.72 ? 73  PRO A CG    1 
ATOM   596  C  CD    . PRO A 1 76  ? 51.772 14.728  24.890  1.00 15.35 ? 73  PRO A CD    1 
ATOM   597  N  N     . ASP A 1 77  ? 52.521 17.235  22.249  1.00 14.89 ? 74  ASP A N     1 
ATOM   598  C  CA    . ASP A 1 77  ? 53.196 18.103  21.286  1.00 17.52 ? 74  ASP A CA    1 
ATOM   599  C  C     . ASP A 1 77  ? 53.071 17.599  19.849  1.00 18.16 ? 74  ASP A C     1 
ATOM   600  O  O     . ASP A 1 77  ? 53.718 18.123  18.942  1.00 13.99 ? 74  ASP A O     1 
ATOM   601  C  CB    . ASP A 1 77  ? 54.672 18.267  21.651  1.00 15.91 ? 74  ASP A CB    1 
ATOM   602  C  CG    . ASP A 1 77  ? 54.869 18.988  22.968  1.00 27.58 ? 74  ASP A CG    1 
ATOM   603  O  OD1   . ASP A 1 77  ? 55.726 18.549  23.763  1.00 31.71 ? 74  ASP A OD1   1 
ATOM   604  O  OD2   . ASP A 1 77  ? 54.165 19.994  23.209  1.00 28.42 ? 74  ASP A OD2   1 
ATOM   605  N  N     . LEU A 1 78  ? 52.239 16.582  19.648  1.00 14.72 ? 75  LEU A N     1 
ATOM   606  C  CA    . LEU A 1 78  ? 52.011 16.023  18.318  1.00 12.35 ? 75  LEU A CA    1 
ATOM   607  C  C     . LEU A 1 78  ? 51.623 17.108  17.318  1.00 11.21 ? 75  LEU A C     1 
ATOM   608  O  O     . LEU A 1 78  ? 50.722 17.897  17.575  1.00 10.23 ? 75  LEU A O     1 
ATOM   609  C  CB    . LEU A 1 78  ? 50.906 14.968  18.375  1.00 12.58 ? 75  LEU A CB    1 
ATOM   610  C  CG    . LEU A 1 78  ? 50.511 14.312  17.053  1.00 8.69  ? 75  LEU A CG    1 
ATOM   611  C  CD1   . LEU A 1 78  ? 51.651 13.461  16.520  1.00 9.38  ? 75  LEU A CD1   1 
ATOM   612  C  CD2   . LEU A 1 78  ? 49.262 13.469  17.243  1.00 10.81 ? 75  LEU A CD2   1 
ATOM   613  N  N     . LEU A 1 79  ? 52.306 17.144  16.178  1.00 8.08  ? 76  LEU A N     1 
ATOM   614  C  CA    . LEU A 1 79  ? 51.952 18.080  15.116  1.00 9.26  ? 76  LEU A CA    1 
ATOM   615  C  C     . LEU A 1 79  ? 51.068 17.385  14.084  1.00 10.32 ? 76  LEU A C     1 
ATOM   616  O  O     . LEU A 1 79  ? 51.174 16.179  13.880  1.00 8.73  ? 76  LEU A O     1 
ATOM   617  C  CB    . LEU A 1 79  ? 53.206 18.652  14.454  1.00 8.65  ? 76  LEU A CB    1 
ATOM   618  C  CG    . LEU A 1 79  ? 54.139 19.444  15.374  1.00 9.61  ? 76  LEU A CG    1 
ATOM   619  C  CD1   . LEU A 1 79  ? 55.349 19.961  14.608  1.00 10.15 ? 76  LEU A CD1   1 
ATOM   620  C  CD2   . LEU A 1 79  ? 53.392 20.589  16.043  1.00 11.20 ? 76  LEU A CD2   1 
ATOM   621  N  N     . LEU A 1 80  ? 50.195 18.147  13.436  1.00 11.78 ? 77  LEU A N     1 
ATOM   622  C  CA    . LEU A 1 80  ? 49.238 17.560  12.506  1.00 9.54  ? 77  LEU A CA    1 
ATOM   623  C  C     . LEU A 1 80  ? 49.203 18.260  11.151  1.00 13.62 ? 77  LEU A C     1 
ATOM   624  O  O     . LEU A 1 80  ? 49.318 19.485  11.062  1.00 15.12 ? 77  LEU A O     1 
ATOM   625  C  CB    . LEU A 1 80  ? 47.837 17.560  13.121  1.00 8.07  ? 77  LEU A CB    1 
ATOM   626  C  CG    . LEU A 1 80  ? 47.691 16.800  14.440  1.00 11.73 ? 77  LEU A CG    1 
ATOM   627  C  CD1   . LEU A 1 80  ? 46.323 17.047  15.058  1.00 13.67 ? 77  LEU A CD1   1 
ATOM   628  C  CD2   . LEU A 1 80  ? 47.933 15.313  14.224  1.00 9.99  ? 77  LEU A CD2   1 
ATOM   629  N  N     . ALA A 1 81  ? 49.053 17.466  10.097  1.00 11.51 ? 78  ALA A N     1 
ATOM   630  C  CA    . ALA A 1 81  ? 48.760 17.993  8.773   1.00 10.05 ? 78  ALA A CA    1 
ATOM   631  C  C     . ALA A 1 81  ? 47.441 17.395  8.294   1.00 10.28 ? 78  ALA A C     1 
ATOM   632  O  O     . ALA A 1 81  ? 47.201 16.197  8.448   1.00 10.96 ? 78  ALA A O     1 
ATOM   633  C  CB    . ALA A 1 81  ? 49.890 17.679  7.805   1.00 10.13 ? 78  ALA A CB    1 
ATOM   634  N  N     . GLN A 1 82  ? 46.576 18.233  7.736   1.00 10.87 ? 79  GLN A N     1 
ATOM   635  C  CA    . GLN A 1 82  ? 45.257 17.786  7.304   1.00 12.83 ? 79  GLN A CA    1 
ATOM   636  C  C     . GLN A 1 82  ? 45.229 17.442  5.825   1.00 9.64  ? 79  GLN A C     1 
ATOM   637  O  O     . GLN A 1 82  ? 45.791 18.161  4.996   1.00 10.23 ? 79  GLN A O     1 
ATOM   638  C  CB    . GLN A 1 82  ? 44.200 18.857  7.573   1.00 17.33 ? 79  GLN A CB    1 
ATOM   639  C  CG    . GLN A 1 82  ? 43.928 19.144  9.033   1.00 24.54 ? 79  GLN A CG    1 
ATOM   640  C  CD    . GLN A 1 82  ? 42.732 20.059  9.211   1.00 28.36 ? 79  GLN A CD    1 
ATOM   641  O  OE1   . GLN A 1 82  ? 42.850 21.157  9.752   1.00 28.91 ? 79  GLN A OE1   1 
ATOM   642  N  NE2   . GLN A 1 82  ? 41.569 19.609  8.748   1.00 28.42 ? 79  GLN A NE2   1 
ATOM   643  N  N     . VAL A 1 83  ? 44.556 16.345  5.499   1.00 9.23  ? 80  VAL A N     1 
ATOM   644  C  CA    . VAL A 1 83  ? 44.310 15.991  4.112   1.00 10.21 ? 80  VAL A CA    1 
ATOM   645  C  C     . VAL A 1 83  ? 43.444 17.071  3.477   1.00 13.65 ? 80  VAL A C     1 
ATOM   646  O  O     . VAL A 1 83  ? 42.502 17.569  4.094   1.00 9.25  ? 80  VAL A O     1 
ATOM   647  C  CB    . VAL A 1 83  ? 43.590 14.636  3.997   1.00 9.47  ? 80  VAL A CB    1 
ATOM   648  C  CG1   . VAL A 1 83  ? 43.276 14.317  2.541   1.00 9.64  ? 80  VAL A CG1   1 
ATOM   649  C  CG2   . VAL A 1 83  ? 44.435 13.533  4.625   1.00 12.08 ? 80  VAL A CG2   1 
ATOM   650  N  N     . ARG A 1 84  ? 43.777 17.437  2.246   1.00 11.16 ? 81  ARG A N     1 
ATOM   651  C  CA    . ARG A 1 84  ? 43.002 18.421  1.504   1.00 13.09 ? 81  ARG A CA    1 
ATOM   652  C  C     . ARG A 1 84  ? 41.548 17.972  1.392   1.00 12.79 ? 81  ARG A C     1 
ATOM   653  O  O     . ARG A 1 84  ? 41.267 16.792  1.183   1.00 12.66 ? 81  ARG A O     1 
ATOM   654  C  CB    . ARG A 1 84  ? 43.606 18.609  0.112   1.00 14.91 ? 81  ARG A CB    1 
ATOM   655  C  CG    . ARG A 1 84  ? 42.812 19.512  -0.818  1.00 20.77 ? 81  ARG A CG    1 
ATOM   656  C  CD    . ARG A 1 84  ? 43.296 19.345  -2.250  1.00 25.46 ? 81  ARG A CD    1 
ATOM   657  N  NE    . ARG A 1 84  ? 42.567 20.188  -3.193  1.00 37.96 ? 81  ARG A NE    1 
ATOM   658  C  CZ    . ARG A 1 84  ? 42.743 20.156  -4.511  1.00 44.18 ? 81  ARG A CZ    1 
ATOM   659  N  NH1   . ARG A 1 84  ? 43.623 19.317  -5.045  1.00 36.40 ? 81  ARG A NH1   1 
ATOM   660  N  NH2   . ARG A 1 84  ? 42.038 20.959  -5.298  1.00 39.14 ? 81  ARG A NH2   1 
ATOM   661  N  N     . GLU A 1 85  ? 40.624 18.914  1.547   1.00 11.88 ? 82  GLU A N     1 
ATOM   662  C  CA    . GLU A 1 85  ? 39.205 18.624  1.372   1.00 15.08 ? 82  GLU A CA    1 
ATOM   663  C  C     . GLU A 1 85  ? 38.651 19.396  0.184   1.00 13.12 ? 82  GLU A C     1 
ATOM   664  O  O     . GLU A 1 85  ? 38.838 20.605  0.081   1.00 13.06 ? 82  GLU A O     1 
ATOM   665  C  CB    . GLU A 1 85  ? 38.409 18.965  2.633   1.00 15.26 ? 82  GLU A CB    1 
ATOM   666  C  CG    . GLU A 1 85  ? 38.501 17.924  3.730   1.00 19.45 ? 82  GLU A CG    1 
ATOM   667  C  CD    . GLU A 1 85  ? 37.648 18.272  4.937   1.00 19.32 ? 82  GLU A CD    1 
ATOM   668  O  OE1   . GLU A 1 85  ? 36.447 18.571  4.763   1.00 19.94 ? 82  GLU A OE1   1 
ATOM   669  O  OE2   . GLU A 1 85  ? 38.187 18.252  6.062   1.00 29.50 ? 82  GLU A OE2   1 
ATOM   670  N  N     . SER A 1 86  ? 37.978 18.686  -0.712  1.00 14.59 ? 83  SER A N     1 
ATOM   671  C  CA    . SER A 1 86  ? 37.373 19.301  -1.884  1.00 13.76 ? 83  SER A CA    1 
ATOM   672  C  C     . SER A 1 86  ? 35.987 18.723  -2.116  1.00 14.54 ? 83  SER A C     1 
ATOM   673  O  O     . SER A 1 86  ? 35.785 17.515  -2.005  1.00 15.53 ? 83  SER A O     1 
ATOM   674  C  CB    . SER A 1 86  ? 38.244 19.077  -3.121  1.00 17.25 ? 83  SER A CB    1 
ATOM   675  O  OG    . SER A 1 86  ? 39.543 19.606  -2.931  1.00 27.67 ? 83  SER A OG    1 
ATOM   676  N  N     . ARG A 1 87  ? 35.035 19.592  -2.437  1.00 17.41 ? 84  ARG A N     1 
ATOM   677  C  CA    . ARG A 1 87  ? 33.662 19.172  -2.699  1.00 19.38 ? 84  ARG A CA    1 
ATOM   678  C  C     . ARG A 1 87  ? 33.091 18.394  -1.519  1.00 19.36 ? 84  ARG A C     1 
ATOM   679  O  O     . ARG A 1 87  ? 32.292 17.473  -1.693  1.00 27.07 ? 84  ARG A O     1 
ATOM   680  C  CB    . ARG A 1 87  ? 33.585 18.336  -3.978  1.00 20.82 ? 84  ARG A CB    1 
ATOM   681  C  CG    . ARG A 1 87  ? 34.233 18.990  -5.190  1.00 21.56 ? 84  ARG A CG    1 
ATOM   682  C  CD    . ARG A 1 87  ? 34.006 18.166  -6.452  1.00 25.87 ? 84  ARG A CD    1 
ATOM   683  N  NE    . ARG A 1 87  ? 35.173 18.181  -7.332  1.00 28.09 ? 84  ARG A NE    1 
ATOM   684  C  CZ    . ARG A 1 87  ? 35.351 19.037  -8.333  1.00 31.30 ? 84  ARG A CZ    1 
ATOM   685  N  NH1   . ARG A 1 87  ? 34.435 19.960  -8.595  1.00 35.13 ? 84  ARG A NH1   1 
ATOM   686  N  NH2   . ARG A 1 87  ? 36.449 18.969  -9.075  1.00 34.57 ? 84  ARG A NH2   1 
ATOM   687  N  N     . GLY A 1 88  ? 33.514 18.767  -0.317  1.00 16.97 ? 85  GLY A N     1 
ATOM   688  C  CA    . GLY A 1 88  ? 32.990 18.172  0.897   1.00 19.72 ? 85  GLY A CA    1 
ATOM   689  C  C     . GLY A 1 88  ? 33.617 16.849  1.296   1.00 18.39 ? 85  GLY A C     1 
ATOM   690  O  O     . GLY A 1 88  ? 33.163 16.214  2.247   1.00 17.50 ? 85  GLY A O     1 
ATOM   691  N  N     . LYS A 1 89  ? 34.661 16.427  0.587   1.00 12.58 ? 86  LYS A N     1 
ATOM   692  C  CA    . LYS A 1 89  ? 35.295 15.147  0.890   1.00 12.56 ? 86  LYS A CA    1 
ATOM   693  C  C     . LYS A 1 89  ? 36.817 15.203  0.868   1.00 12.99 ? 86  LYS A C     1 
ATOM   694  O  O     . LYS A 1 89  ? 37.417 16.086  0.251   1.00 10.05 ? 86  LYS A O     1 
ATOM   695  C  CB    . LYS A 1 89  ? 34.813 14.060  -0.074  1.00 14.02 ? 86  LYS A CB    1 
ATOM   696  C  CG    . LYS A 1 89  ? 35.339 14.211  -1.491  1.00 13.39 ? 86  LYS A CG    1 
ATOM   697  C  CD    . LYS A 1 89  ? 34.872 13.071  -2.383  1.00 17.89 ? 86  LYS A CD    1 
ATOM   698  C  CE    . LYS A 1 89  ? 35.511 11.749  -1.983  1.00 13.88 ? 86  LYS A CE    1 
ATOM   699  N  NZ    . LYS A 1 89  ? 36.975 11.726  -2.271  1.00 13.57 ? 86  LYS A NZ    1 
ATOM   700  N  N     . ALA A 1 90  ? 37.436 14.243  1.547   1.00 12.44 ? 87  ALA A N     1 
ATOM   701  C  CA    . ALA A 1 90  ? 38.884 14.113  1.523   1.00 13.76 ? 87  ALA A CA    1 
ATOM   702  C  C     . ALA A 1 90  ? 39.345 13.908  0.089   1.00 11.86 ? 87  ALA A C     1 
ATOM   703  O  O     . ALA A 1 90  ? 38.717 13.178  -0.677  1.00 15.13 ? 87  ALA A O     1 
ATOM   704  C  CB    . ALA A 1 90  ? 39.327 12.952  2.396   1.00 14.42 ? 87  ALA A CB    1 
ATOM   705  N  N     . ASN A 1 91  ? 40.436 14.569  -0.275  1.00 12.52 ? 88  ASN A N     1 
ATOM   706  C  CA    . ASN A 1 91  ? 41.001 14.433  -1.608  1.00 13.70 ? 88  ASN A CA    1 
ATOM   707  C  C     . ASN A 1 91  ? 42.468 14.039  -1.520  1.00 11.29 ? 88  ASN A C     1 
ATOM   708  O  O     . ASN A 1 91  ? 43.273 14.756  -0.930  1.00 11.53 ? 88  ASN A O     1 
ATOM   709  C  CB    . ASN A 1 91  ? 40.849 15.738  -2.386  1.00 13.14 ? 88  ASN A CB    1 
ATOM   710  C  CG    . ASN A 1 91  ? 41.207 15.584  -3.847  1.00 18.22 ? 88  ASN A CG    1 
ATOM   711  O  OD1   . ASN A 1 91  ? 42.375 15.429  -4.194  1.00 11.58 ? 88  ASN A OD1   1 
ATOM   712  N  ND2   . ASN A 1 91  ? 40.199 15.622  -4.713  1.00 20.69 ? 88  ASN A ND2   1 
ATOM   713  N  N     . LEU A 1 92  ? 42.814 12.901  -2.112  1.00 10.20 ? 89  LEU A N     1 
ATOM   714  C  CA    . LEU A 1 92  ? 44.146 12.323  -1.933  1.00 9.61  ? 89  LEU A CA    1 
ATOM   715  C  C     . LEU A 1 92  ? 45.113 12.622  -3.082  1.00 11.06 ? 89  LEU A C     1 
ATOM   716  O  O     . LEU A 1 92  ? 46.162 11.986  -3.193  1.00 8.07  ? 89  LEU A O     1 
ATOM   717  C  CB    . LEU A 1 92  ? 44.036 10.808  -1.727  1.00 9.81  ? 89  LEU A CB    1 
ATOM   718  C  CG    . LEU A 1 92  ? 43.148 10.351  -0.567  1.00 9.96  ? 89  LEU A CG    1 
ATOM   719  C  CD1   . LEU A 1 92  ? 43.025 8.833   -0.532  1.00 12.42 ? 89  LEU A CD1   1 
ATOM   720  C  CD2   . LEU A 1 92  ? 43.684 10.883  0.757   1.00 11.61 ? 89  LEU A CD2   1 
ATOM   721  N  N     . THR A 1 93  ? 44.769 13.594  -3.920  1.00 7.54  ? 90  THR A N     1 
ATOM   722  C  CA    . THR A 1 93  ? 45.558 13.898  -5.118  1.00 10.85 ? 90  THR A CA    1 
ATOM   723  C  C     . THR A 1 93  ? 47.052 14.128  -4.862  1.00 11.90 ? 90  THR A C     1 
ATOM   724  O  O     . THR A 1 93  ? 47.900 13.643  -5.618  1.00 9.50  ? 90  THR A O     1 
ATOM   725  C  CB    . THR A 1 93  ? 44.983 15.109  -5.881  1.00 13.54 ? 90  THR A CB    1 
ATOM   726  O  OG1   . THR A 1 93  ? 43.668 14.790  -6.353  1.00 16.47 ? 90  THR A OG1   1 
ATOM   727  C  CG2   . THR A 1 93  ? 45.867 15.464  -7.069  1.00 12.10 ? 90  THR A CG2   1 
ATOM   728  N  N     . LYS A 1 94  ? 47.370 14.870  -3.806  1.00 7.92  ? 91  LYS A N     1 
ATOM   729  C  CA    . LYS A 1 94  ? 48.761 15.183  -3.487  1.00 9.31  ? 91  LYS A CA    1 
ATOM   730  C  C     . LYS A 1 94  ? 49.593 13.916  -3.288  1.00 9.06  ? 91  LYS A C     1 
ATOM   731  O  O     . LYS A 1 94  ? 50.755 13.852  -3.689  1.00 9.97  ? 91  LYS A O     1 
ATOM   732  C  CB    . LYS A 1 94  ? 48.842 16.060  -2.235  1.00 10.54 ? 91  LYS A CB    1 
ATOM   733  C  CG    . LYS A 1 94  ? 50.242 16.576  -1.933  1.00 10.17 ? 91  LYS A CG    1 
ATOM   734  C  CD    . LYS A 1 94  ? 50.356 17.096  -0.504  1.00 10.54 ? 91  LYS A CD    1 
ATOM   735  C  CE    . LYS A 1 94  ? 49.412 18.261  -0.256  1.00 13.92 ? 91  LYS A CE    1 
ATOM   736  N  NZ    . LYS A 1 94  ? 49.579 18.823  1.113   1.00 8.94  ? 91  LYS A NZ    1 
ATOM   737  N  N     . TYR A 1 95  ? 48.989 12.908  -2.669  1.00 7.63  ? 92  TYR A N     1 
ATOM   738  C  CA    . TYR A 1 95  ? 49.697 11.670  -2.359  1.00 7.58  ? 92  TYR A CA    1 
ATOM   739  C  C     . TYR A 1 95  ? 49.796 10.757  -3.577  1.00 8.38  ? 92  TYR A C     1 
ATOM   740  O  O     . TYR A 1 95  ? 50.795 10.061  -3.759  1.00 7.13  ? 92  TYR A O     1 
ATOM   741  C  CB    . TYR A 1 95  ? 49.030 10.976  -1.171  1.00 6.03  ? 92  TYR A CB    1 
ATOM   742  C  CG    . TYR A 1 95  ? 48.699 11.968  -0.078  1.00 8.21  ? 92  TYR A CG    1 
ATOM   743  C  CD1   . TYR A 1 95  ? 47.392 12.380  0.143   1.00 8.84  ? 92  TYR A CD1   1 
ATOM   744  C  CD2   . TYR A 1 95  ? 49.703 12.533  0.696   1.00 6.44  ? 92  TYR A CD2   1 
ATOM   745  C  CE1   . TYR A 1 95  ? 47.092 13.308  1.126   1.00 9.16  ? 92  TYR A CE1   1 
ATOM   746  C  CE2   . TYR A 1 95  ? 49.416 13.457  1.678   1.00 8.18  ? 92  TYR A CE2   1 
ATOM   747  C  CZ    . TYR A 1 95  ? 48.108 13.842  1.889   1.00 8.71  ? 92  TYR A CZ    1 
ATOM   748  O  OH    . TYR A 1 95  ? 47.819 14.765  2.866   1.00 8.70  ? 92  TYR A OH    1 
ATOM   749  N  N     . ARG A 1 96  ? 48.768 10.777  -4.421  1.00 10.07 ? 93  ARG A N     1 
ATOM   750  C  CA    . ARG A 1 96  ? 48.810 10.035  -5.678  1.00 11.30 ? 93  ARG A CA    1 
ATOM   751  C  C     . ARG A 1 96  ? 49.892 10.588  -6.602  1.00 10.48 ? 93  ARG A C     1 
ATOM   752  O  O     . ARG A 1 96  ? 50.609 9.831   -7.254  1.00 8.58  ? 93  ARG A O     1 
ATOM   753  C  CB    . ARG A 1 96  ? 47.453 10.065  -6.382  1.00 9.53  ? 93  ARG A CB    1 
ATOM   754  C  CG    . ARG A 1 96  ? 46.362 9.319   -5.638  1.00 11.81 ? 93  ARG A CG    1 
ATOM   755  C  CD    . ARG A 1 96  ? 45.135 9.089   -6.505  1.00 13.10 ? 93  ARG A CD    1 
ATOM   756  N  NE    . ARG A 1 96  ? 44.107 8.364   -5.766  1.00 14.47 ? 93  ARG A NE    1 
ATOM   757  C  CZ    . ARG A 1 96  ? 43.073 8.939   -5.160  1.00 15.11 ? 93  ARG A CZ    1 
ATOM   758  N  NH1   . ARG A 1 96  ? 42.197 8.195   -4.501  1.00 13.82 ? 93  ARG A NH1   1 
ATOM   759  N  NH2   . ARG A 1 96  ? 42.912 10.256  -5.216  1.00 12.20 ? 93  ARG A NH2   1 
ATOM   760  N  N     . GLU A 1 97  ? 50.006 11.911  -6.654  1.00 10.41 ? 94  GLU A N     1 
ATOM   761  C  CA    . GLU A 1 97  ? 51.016 12.548  -7.493  1.00 9.38  ? 94  GLU A CA    1 
ATOM   762  C  C     . GLU A 1 97  ? 52.422 12.294  -6.954  1.00 10.50 ? 94  GLU A C     1 
ATOM   763  O  O     . GLU A 1 97  ? 53.358 12.060  -7.721  1.00 10.01 ? 94  GLU A O     1 
ATOM   764  C  CB    . GLU A 1 97  ? 50.737 14.047  -7.640  1.00 10.89 ? 94  GLU A CB    1 
ATOM   765  C  CG    . GLU A 1 97  ? 49.442 14.355  -8.388  1.00 13.35 ? 94  GLU A CG    1 
ATOM   766  C  CD    . GLU A 1 97  ? 49.201 15.843  -8.579  1.00 21.06 ? 94  GLU A CD    1 
ATOM   767  O  OE1   . GLU A 1 97  ? 49.985 16.651  -8.043  1.00 29.06 ? 94  GLU A OE1   1 
ATOM   768  O  OE2   . GLU A 1 97  ? 48.225 16.206  -9.270  1.00 25.02 ? 94  GLU A OE2   1 
ATOM   769  N  N     . ALA A 1 98  ? 52.566 12.335  -5.632  1.00 9.08  ? 95  ALA A N     1 
ATOM   770  C  CA    . ALA A 1 98  ? 53.839 12.017  -4.997  1.00 10.20 ? 95  ALA A CA    1 
ATOM   771  C  C     . ALA A 1 98  ? 54.226 10.569  -5.287  1.00 9.25  ? 95  ALA A C     1 
ATOM   772  O  O     . ALA A 1 98  ? 55.402 10.253  -5.471  1.00 8.36  ? 95  ALA A O     1 
ATOM   773  C  CB    . ALA A 1 98  ? 53.761 12.257  -3.500  1.00 8.28  ? 95  ALA A CB    1 
ATOM   774  N  N     . SER A 1 99  ? 53.226 9.695   -5.328  1.00 8.21  ? 96  SER A N     1 
ATOM   775  C  CA    . SER A 1 99  ? 53.443 8.290   -5.654  1.00 9.18  ? 96  SER A CA    1 
ATOM   776  C  C     . SER A 1 99  ? 54.000 8.143   -7.066  1.00 10.28 ? 96  SER A C     1 
ATOM   777  O  O     . SER A 1 99  ? 54.957 7.399   -7.294  1.00 7.69  ? 96  SER A O     1 
ATOM   778  C  CB    . SER A 1 99  ? 52.137 7.507   -5.524  1.00 10.36 ? 96  SER A CB    1 
ATOM   779  O  OG    . SER A 1 99  ? 52.304 6.164   -5.941  1.00 12.50 ? 96  SER A OG    1 
ATOM   780  N  N     . VAL A 1 100 ? 53.393 8.851   -8.013  1.00 9.17  ? 97  VAL A N     1 
ATOM   781  C  CA    . VAL A 1 100 ? 53.881 8.847   -9.391  1.00 9.53  ? 97  VAL A CA    1 
ATOM   782  C  C     . VAL A 1 100 ? 55.364 9.215   -9.456  1.00 11.18 ? 97  VAL A C     1 
ATOM   783  O  O     . VAL A 1 100 ? 56.136 8.580   -10.179 1.00 13.19 ? 97  VAL A O     1 
ATOM   784  C  CB    . VAL A 1 100 ? 53.062 9.799   -10.287 1.00 11.10 ? 97  VAL A CB    1 
ATOM   785  C  CG1   . VAL A 1 100 ? 53.725 9.961   -11.648 1.00 13.91 ? 97  VAL A CG1   1 
ATOM   786  C  CG2   . VAL A 1 100 ? 51.640 9.282   -10.440 1.00 13.64 ? 97  VAL A CG2   1 
ATOM   787  N  N     . GLU A 1 101 ? 55.761 10.234  -8.695  1.00 7.47  ? 98  GLU A N     1 
ATOM   788  C  CA    . GLU A 1 101 ? 57.162 10.648  -8.634  1.00 10.17 ? 98  GLU A CA    1 
ATOM   789  C  C     . GLU A 1 101 ? 58.077 9.459   -8.364  1.00 10.21 ? 98  GLU A C     1 
ATOM   790  O  O     . GLU A 1 101 ? 59.066 9.241   -9.067  1.00 9.59  ? 98  GLU A O     1 
ATOM   791  C  CB    . GLU A 1 101 ? 57.382 11.686  -7.528  1.00 10.95 ? 98  GLU A CB    1 
ATOM   792  C  CG    . GLU A 1 101 ? 56.906 13.095  -7.835  1.00 14.07 ? 98  GLU A CG    1 
ATOM   793  C  CD    . GLU A 1 101 ? 57.304 14.081  -6.745  1.00 14.28 ? 98  GLU A CD    1 
ATOM   794  O  OE1   . GLU A 1 101 ? 58.511 14.384  -6.620  1.00 11.71 ? 98  GLU A OE1   1 
ATOM   795  O  OE2   . GLU A 1 101 ? 56.411 14.544  -6.003  1.00 15.22 ? 98  GLU A OE2   1 
ATOM   796  N  N     . VAL A 1 102 ? 57.743 8.700   -7.326  1.00 7.74  ? 99  VAL A N     1 
ATOM   797  C  CA    . VAL A 1 102 ? 58.571 7.583   -6.896  1.00 10.08 ? 99  VAL A CA    1 
ATOM   798  C  C     . VAL A 1 102 ? 58.523 6.435   -7.897  1.00 10.91 ? 99  VAL A C     1 
ATOM   799  O  O     . VAL A 1 102 ? 59.555 5.860   -8.242  1.00 11.56 ? 99  VAL A O     1 
ATOM   800  C  CB    . VAL A 1 102 ? 58.142 7.074   -5.507  1.00 8.74  ? 99  VAL A CB    1 
ATOM   801  C  CG1   . VAL A 1 102 ? 58.952 5.848   -5.117  1.00 11.06 ? 99  VAL A CG1   1 
ATOM   802  C  CG2   . VAL A 1 102 ? 58.299 8.183   -4.468  1.00 10.14 ? 99  VAL A CG2   1 
ATOM   803  N  N     . MET A 1 103 ? 57.321 6.114   -8.365  1.00 8.52  ? 100 MET A N     1 
ATOM   804  C  CA    . MET A 1 103 ? 57.125 5.008   -9.296  1.00 9.54  ? 100 MET A CA    1 
ATOM   805  C  C     . MET A 1 103 ? 57.904 5.206   -10.596 1.00 13.83 ? 100 MET A C     1 
ATOM   806  O  O     . MET A 1 103 ? 58.465 4.256   -11.144 1.00 11.08 ? 100 MET A O     1 
ATOM   807  C  CB    . MET A 1 103 ? 55.637 4.823   -9.600  1.00 13.90 ? 100 MET A CB    1 
ATOM   808  C  CG    . MET A 1 103 ? 54.777 4.563   -8.373  1.00 16.06 ? 100 MET A CG    1 
ATOM   809  S  SD    . MET A 1 103 ? 54.993 2.908   -7.690  1.00 17.63 ? 100 MET A SD    1 
ATOM   810  C  CE    . MET A 1 103 ? 54.209 3.094   -6.085  1.00 9.37  ? 100 MET A CE    1 
ATOM   811  N  N     . GLU A 1 104 ? 57.936 6.440   -11.090 1.00 10.35 ? 101 GLU A N     1 
ATOM   812  C  CA    . GLU A 1 104 ? 58.628 6.730   -12.342 1.00 14.44 ? 101 GLU A CA    1 
ATOM   813  C  C     . GLU A 1 104 ? 60.142 6.609   -12.192 1.00 12.83 ? 101 GLU A C     1 
ATOM   814  O  O     . GLU A 1 104 ? 60.838 6.230   -13.132 1.00 14.61 ? 101 GLU A O     1 
ATOM   815  C  CB    . GLU A 1 104 ? 58.222 8.103   -12.889 1.00 14.51 ? 101 GLU A CB    1 
ATOM   816  C  CG    . GLU A 1 104 ? 56.794 8.138   -13.428 1.00 17.67 ? 101 GLU A CG    1 
ATOM   817  C  CD    . GLU A 1 104 ? 56.433 9.462   -14.081 1.00 25.91 ? 101 GLU A CD    1 
ATOM   818  O  OE1   . GLU A 1 104 ? 57.169 10.451  -13.883 1.00 29.17 ? 101 GLU A OE1   1 
ATOM   819  O  OE2   . GLU A 1 104 ? 55.408 9.510   -14.795 1.00 28.61 ? 101 GLU A OE2   1 
ATOM   820  N  N     . ILE A 1 105 ? 60.648 6.918   -11.003 1.00 12.73 ? 102 ILE A N     1 
ATOM   821  C  CA    . ILE A 1 105 ? 62.061 6.711   -10.707 1.00 11.92 ? 102 ILE A CA    1 
ATOM   822  C  C     . ILE A 1 105 ? 62.391 5.219   -10.664 1.00 12.95 ? 102 ILE A C     1 
ATOM   823  O  O     . ILE A 1 105 ? 63.331 4.761   -11.317 1.00 12.21 ? 102 ILE A O     1 
ATOM   824  C  CB    . ILE A 1 105 ? 62.468 7.376   -9.380  1.00 10.92 ? 102 ILE A CB    1 
ATOM   825  C  CG1   . ILE A 1 105 ? 62.260 8.889   -9.464  1.00 12.06 ? 102 ILE A CG1   1 
ATOM   826  C  CG2   . ILE A 1 105 ? 63.916 7.056   -9.041  1.00 13.71 ? 102 ILE A CG2   1 
ATOM   827  C  CD1   . ILE A 1 105 ? 62.514 9.610   -8.163  1.00 14.25 ? 102 ILE A CD1   1 
ATOM   828  N  N     . MET A 1 106 ? 61.615 4.458   -9.899  1.00 11.46 ? 103 MET A N     1 
ATOM   829  C  CA    . MET A 1 106 ? 61.832 3.017   -9.818  1.00 14.56 ? 103 MET A CA    1 
ATOM   830  C  C     . MET A 1 106 ? 61.794 2.362   -11.196 1.00 11.63 ? 103 MET A C     1 
ATOM   831  O  O     . MET A 1 106 ? 62.545 1.428   -11.469 1.00 10.72 ? 103 MET A O     1 
ATOM   832  C  CB    . MET A 1 106 ? 60.809 2.363   -8.887  1.00 11.44 ? 103 MET A CB    1 
ATOM   833  C  CG    . MET A 1 106 ? 61.048 2.659   -7.415  1.00 13.51 ? 103 MET A CG    1 
ATOM   834  S  SD    . MET A 1 106 ? 59.846 1.847   -6.348  1.00 16.83 ? 103 MET A SD    1 
ATOM   835  C  CE    . MET A 1 106 ? 58.337 2.640   -6.889  1.00 17.73 ? 103 MET A CE    1 
ATOM   836  N  N     . SER A 1 107 ? 60.923 2.864   -12.064 1.00 11.08 ? 104 SER A N     1 
ATOM   837  C  CA    . SER A 1 107 ? 60.764 2.300   -13.402 1.00 14.03 ? 104 SER A CA    1 
ATOM   838  C  C     . SER A 1 107 ? 62.032 2.389   -14.253 1.00 16.12 ? 104 SER A C     1 
ATOM   839  O  O     . SER A 1 107 ? 62.177 1.651   -15.229 1.00 17.46 ? 104 SER A O     1 
ATOM   840  C  CB    . SER A 1 107 ? 59.594 2.966   -14.133 1.00 15.91 ? 104 SER A CB    1 
ATOM   841  O  OG    . SER A 1 107 ? 58.354 2.562   -13.582 1.00 21.51 ? 104 SER A OG    1 
ATOM   842  N  N     . ARG A 1 108 ? 62.945 3.288   -13.893 1.00 12.96 ? 105 ARG A N     1 
ATOM   843  C  CA    . ARG A 1 108 ? 64.190 3.429   -14.643 1.00 14.62 ? 105 ARG A CA    1 
ATOM   844  C  C     . ARG A 1 108 ? 65.098 2.221   -14.437 1.00 18.42 ? 105 ARG A C     1 
ATOM   845  O  O     . ARG A 1 108 ? 65.895 1.875   -15.310 1.00 14.58 ? 105 ARG A O     1 
ATOM   846  C  CB    . ARG A 1 108 ? 64.939 4.705   -14.248 1.00 16.74 ? 105 ARG A CB    1 
ATOM   847  C  CG    . ARG A 1 108 ? 64.150 5.988   -14.425 1.00 17.28 ? 105 ARG A CG    1 
ATOM   848  C  CD    . ARG A 1 108 ? 65.083 7.176   -14.604 1.00 20.98 ? 105 ARG A CD    1 
ATOM   849  N  NE    . ARG A 1 108 ? 66.123 7.225   -13.580 1.00 21.15 ? 105 ARG A NE    1 
ATOM   850  C  CZ    . ARG A 1 108 ? 66.140 8.090   -12.570 1.00 19.44 ? 105 ARG A CZ    1 
ATOM   851  N  NH1   . ARG A 1 108 ? 67.129 8.060   -11.687 1.00 18.29 ? 105 ARG A NH1   1 
ATOM   852  N  NH2   . ARG A 1 108 ? 65.172 8.986   -12.444 1.00 17.54 ? 105 ARG A NH2   1 
ATOM   853  N  N     . PHE A 1 109 ? 64.969 1.582   -13.278 1.00 16.35 ? 106 PHE A N     1 
ATOM   854  C  CA    . PHE A 1 109 ? 65.835 0.464   -12.918 1.00 17.38 ? 106 PHE A CA    1 
ATOM   855  C  C     . PHE A 1 109 ? 65.284 -0.874  -13.398 1.00 18.69 ? 106 PHE A C     1 
ATOM   856  O  O     . PHE A 1 109 ? 66.044 -1.766  -13.781 1.00 24.20 ? 106 PHE A O     1 
ATOM   857  C  CB    . PHE A 1 109 ? 66.061 0.433   -11.405 1.00 15.19 ? 106 PHE A CB    1 
ATOM   858  C  CG    . PHE A 1 109 ? 66.793 1.634   -10.878 1.00 15.78 ? 106 PHE A CG    1 
ATOM   859  C  CD1   . PHE A 1 109 ? 66.135 2.839   -10.694 1.00 13.13 ? 106 PHE A CD1   1 
ATOM   860  C  CD2   . PHE A 1 109 ? 68.140 1.557   -10.564 1.00 14.78 ? 106 PHE A CD2   1 
ATOM   861  C  CE1   . PHE A 1 109 ? 66.810 3.947   -10.210 1.00 13.35 ? 106 PHE A CE1   1 
ATOM   862  C  CE2   . PHE A 1 109 ? 68.818 2.659   -10.080 1.00 15.85 ? 106 PHE A CE2   1 
ATOM   863  C  CZ    . PHE A 1 109 ? 68.154 3.855   -9.903  1.00 13.76 ? 106 PHE A CZ    1 
ATOM   864  N  N     . ALA A 1 110 ? 63.962 -1.012  -13.379 1.00 19.28 ? 107 ALA A N     1 
ATOM   865  C  CA    . ALA A 1 110 ? 63.322 -2.250  -13.808 1.00 16.44 ? 107 ALA A CA    1 
ATOM   866  C  C     . ALA A 1 110 ? 61.813 -2.100  -13.928 1.00 24.15 ? 107 ALA A C     1 
ATOM   867  O  O     . ALA A 1 110 ? 61.237 -1.101  -13.495 1.00 20.57 ? 107 ALA A O     1 
ATOM   868  C  CB    . ALA A 1 110 ? 63.661 -3.381  -12.849 1.00 22.22 ? 107 ALA A CB    1 
ATOM   869  N  N     . VAL A 1 111 ? 61.178 -3.102  -14.525 1.00 22.36 ? 108 VAL A N     1 
ATOM   870  C  CA    . VAL A 1 111 ? 59.729 -3.147  -14.608 1.00 27.54 ? 108 VAL A CA    1 
ATOM   871  C  C     . VAL A 1 111 ? 59.173 -3.314  -13.202 1.00 23.00 ? 108 VAL A C     1 
ATOM   872  O  O     . VAL A 1 111 ? 59.640 -4.159  -12.439 1.00 23.89 ? 108 VAL A O     1 
ATOM   873  C  CB    . VAL A 1 111 ? 59.254 -4.318  -15.484 1.00 31.31 ? 108 VAL A CB    1 
ATOM   874  C  CG1   . VAL A 1 111 ? 57.735 -4.341  -15.561 1.00 27.42 ? 108 VAL A CG1   1 
ATOM   875  C  CG2   . VAL A 1 111 ? 59.863 -4.218  -16.873 1.00 37.18 ? 108 VAL A CG2   1 
ATOM   876  N  N     . ILE A 1 112 ? 58.187 -2.498  -12.851 1.00 20.52 ? 109 ILE A N     1 
ATOM   877  C  CA    . ILE A 1 112 ? 57.631 -2.552  -11.506 1.00 18.45 ? 109 ILE A CA    1 
ATOM   878  C  C     . ILE A 1 112 ? 56.168 -2.960  -11.515 1.00 11.91 ? 109 ILE A C     1 
ATOM   879  O  O     . ILE A 1 112 ? 55.468 -2.789  -12.514 1.00 12.35 ? 109 ILE A O     1 
ATOM   880  C  CB    . ILE A 1 112 ? 57.771 -1.199  -10.774 1.00 15.29 ? 109 ILE A CB    1 
ATOM   881  C  CG1   . ILE A 1 112 ? 56.850 -0.152  -11.401 1.00 17.39 ? 109 ILE A CG1   1 
ATOM   882  C  CG2   . ILE A 1 112 ? 59.224 -0.732  -10.785 1.00 18.08 ? 109 ILE A CG2   1 
ATOM   883  C  CD1   . ILE A 1 112 ? 56.896 1.197   -10.707 1.00 19.18 ? 109 ILE A CD1   1 
ATOM   884  N  N     . GLU A 1 113 ? 55.725 -3.523  -10.397 1.00 9.36  ? 110 GLU A N     1 
ATOM   885  C  CA    . GLU A 1 113 ? 54.313 -3.766  -10.159 1.00 11.75 ? 110 GLU A CA    1 
ATOM   886  C  C     . GLU A 1 113 ? 53.854 -2.852  -9.034  1.00 11.80 ? 110 GLU A C     1 
ATOM   887  O  O     . GLU A 1 113 ? 54.289 -3.002  -7.894  1.00 8.78  ? 110 GLU A O     1 
ATOM   888  C  CB    . GLU A 1 113 ? 54.063 -5.225  -9.772  1.00 10.99 ? 110 GLU A CB    1 
ATOM   889  C  CG    . GLU A 1 113 ? 52.611 -5.516  -9.419  1.00 11.16 ? 110 GLU A CG    1 
ATOM   890  C  CD    . GLU A 1 113 ? 52.379 -6.949  -8.976  1.00 17.11 ? 110 GLU A CD    1 
ATOM   891  O  OE1   . GLU A 1 113 ? 51.295 -7.226  -8.422  1.00 21.17 ? 110 GLU A OE1   1 
ATOM   892  O  OE2   . GLU A 1 113 ? 53.272 -7.799  -9.182  1.00 14.63 ? 110 GLU A OE2   1 
ATOM   893  N  N     . ARG A 1 114 ? 52.989 -1.896  -9.361  1.00 12.76 ? 111 ARG A N     1 
ATOM   894  C  CA    . ARG A 1 114 ? 52.438 -0.995  -8.356  1.00 11.95 ? 111 ARG A CA    1 
ATOM   895  C  C     . ARG A 1 114 ? 51.535 -1.783  -7.418  1.00 12.18 ? 111 ARG A C     1 
ATOM   896  O  O     . ARG A 1 114 ? 50.452 -2.216  -7.812  1.00 13.72 ? 111 ARG A O     1 
ATOM   897  C  CB    . ARG A 1 114 ? 51.640 0.128   -9.025  1.00 12.66 ? 111 ARG A CB    1 
ATOM   898  C  CG    . ARG A 1 114 ? 51.122 1.190   -8.061  1.00 12.01 ? 111 ARG A CG    1 
ATOM   899  C  CD    . ARG A 1 114 ? 50.040 2.042   -8.709  1.00 15.33 ? 111 ARG A CD    1 
ATOM   900  N  NE    . ARG A 1 114 ? 49.697 3.216   -7.909  1.00 17.91 ? 111 ARG A NE    1 
ATOM   901  C  CZ    . ARG A 1 114 ? 48.748 3.240   -6.978  1.00 16.87 ? 111 ARG A CZ    1 
ATOM   902  N  NH1   . ARG A 1 114 ? 48.039 2.150   -6.718  1.00 16.84 ? 111 ARG A NH1   1 
ATOM   903  N  NH2   . ARG A 1 114 ? 48.507 4.358   -6.304  1.00 16.39 ? 111 ARG A NH2   1 
ATOM   904  N  N     . ALA A 1 115 ? 51.981 -1.975  -6.181  1.00 12.13 ? 112 ALA A N     1 
ATOM   905  C  CA    . ALA A 1 115 ? 51.229 -2.768  -5.214  1.00 12.85 ? 112 ALA A CA    1 
ATOM   906  C  C     . ALA A 1 115 ? 50.209 -1.914  -4.467  1.00 14.50 ? 112 ALA A C     1 
ATOM   907  O  O     . ALA A 1 115 ? 49.103 -2.365  -4.162  1.00 15.20 ? 112 ALA A O     1 
ATOM   908  C  CB    . ALA A 1 115 ? 52.177 -3.450  -4.232  1.00 13.57 ? 112 ALA A CB    1 
ATOM   909  N  N     . SER A 1 116 ? 50.594 -0.678  -4.177  1.00 11.27 ? 113 SER A N     1 
ATOM   910  C  CA    . SER A 1 116 ? 49.726 0.262   -3.486  1.00 12.45 ? 113 SER A CA    1 
ATOM   911  C  C     . SER A 1 116 ? 50.221 1.670   -3.771  1.00 10.46 ? 113 SER A C     1 
ATOM   912  O  O     . SER A 1 116 ? 51.137 1.859   -4.566  1.00 12.13 ? 113 SER A O     1 
ATOM   913  C  CB    . SER A 1 116 ? 49.749 0.002   -1.979  1.00 15.91 ? 113 SER A CB    1 
ATOM   914  O  OG    . SER A 1 116 ? 51.049 0.215   -1.453  1.00 14.47 ? 113 SER A OG    1 
ATOM   915  N  N     . ILE A 1 117 ? 49.625 2.658   -3.113  1.00 10.08 ? 114 ILE A N     1 
ATOM   916  C  CA    . ILE A 1 117 ? 50.015 4.042   -3.338  1.00 11.15 ? 114 ILE A CA    1 
ATOM   917  C  C     . ILE A 1 117 ? 51.500 4.283   -3.048  1.00 9.37  ? 114 ILE A C     1 
ATOM   918  O  O     . ILE A 1 117 ? 52.099 5.208   -3.590  1.00 11.02 ? 114 ILE A O     1 
ATOM   919  C  CB    . ILE A 1 117 ? 49.150 5.019   -2.513  1.00 12.99 ? 114 ILE A CB    1 
ATOM   920  C  CG1   . ILE A 1 117 ? 49.307 6.448   -3.042  1.00 13.63 ? 114 ILE A CG1   1 
ATOM   921  C  CG2   . ILE A 1 117 ? 49.500 4.928   -1.035  1.00 13.37 ? 114 ILE A CG2   1 
ATOM   922  C  CD1   . ILE A 1 117 ? 48.185 7.377   -2.624  1.00 12.14 ? 114 ILE A CD1   1 
ATOM   923  N  N     . ASP A 1 118 ? 52.105 3.448   -2.208  1.00 10.18 ? 115 ASP A N     1 
ATOM   924  C  CA    . ASP A 1 118 ? 53.500 3.684   -1.846  1.00 9.73  ? 115 ASP A CA    1 
ATOM   925  C  C     . ASP A 1 118 ? 54.368 2.428   -1.794  1.00 10.98 ? 115 ASP A C     1 
ATOM   926  O  O     . ASP A 1 118 ? 55.445 2.438   -1.195  1.00 10.03 ? 115 ASP A O     1 
ATOM   927  C  CB    . ASP A 1 118 ? 53.577 4.428   -0.518  1.00 9.63  ? 115 ASP A CB    1 
ATOM   928  C  CG    . ASP A 1 118 ? 53.478 3.502   0.669   1.00 10.03 ? 115 ASP A CG    1 
ATOM   929  O  OD1   . ASP A 1 118 ? 54.170 3.777   1.662   1.00 11.16 ? 115 ASP A OD1   1 
ATOM   930  O  OD2   . ASP A 1 118 ? 52.725 2.504   0.611   1.00 12.97 ? 115 ASP A OD2   1 
ATOM   931  N  N     . GLU A 1 119 ? 53.903 1.355   -2.425  1.00 9.90  ? 116 GLU A N     1 
ATOM   932  C  CA    . GLU A 1 119 ? 54.678 0.121   -2.500  1.00 10.15 ? 116 GLU A CA    1 
ATOM   933  C  C     . GLU A 1 119 ? 54.786 -0.355  -3.941  1.00 10.45 ? 116 GLU A C     1 
ATOM   934  O  O     . GLU A 1 119 ? 53.830 -0.256  -4.708  1.00 8.41  ? 116 GLU A O     1 
ATOM   935  C  CB    . GLU A 1 119 ? 54.038 -0.979  -1.650  1.00 11.34 ? 116 GLU A CB    1 
ATOM   936  C  CG    . GLU A 1 119 ? 54.040 -0.704  -0.157  1.00 14.07 ? 116 GLU A CG    1 
ATOM   937  C  CD    . GLU A 1 119 ? 53.533 -1.885  0.652   1.00 21.95 ? 116 GLU A CD    1 
ATOM   938  O  OE1   . GLU A 1 119 ? 52.807 -2.730  0.088   1.00 20.92 ? 116 GLU A OE1   1 
ATOM   939  O  OE2   . GLU A 1 119 ? 53.867 -1.973  1.852   1.00 28.65 ? 116 GLU A OE2   1 
ATOM   940  N  N     . ALA A 1 120 ? 55.950 -0.879  -4.304  1.00 8.02  ? 117 ALA A N     1 
ATOM   941  C  CA    . ALA A 1 120 ? 56.136 -1.454  -5.626  1.00 9.90  ? 117 ALA A CA    1 
ATOM   942  C  C     . ALA A 1 120 ? 57.079 -2.647  -5.574  1.00 10.66 ? 117 ALA A C     1 
ATOM   943  O  O     . ALA A 1 120 ? 58.121 -2.599  -4.916  1.00 10.42 ? 117 ALA A O     1 
ATOM   944  C  CB    . ALA A 1 120 ? 56.660 -0.402  -6.596  1.00 10.04 ? 117 ALA A CB    1 
ATOM   945  N  N     . TYR A 1 121 ? 56.704 -3.718  -6.266  1.00 8.86  ? 118 TYR A N     1 
ATOM   946  C  CA    . TYR A 1 121 ? 57.579 -4.872  -6.412  1.00 10.19 ? 118 TYR A CA    1 
ATOM   947  C  C     . TYR A 1 121 ? 58.436 -4.711  -7.654  1.00 12.31 ? 118 TYR A C     1 
ATOM   948  O  O     . TYR A 1 121 ? 58.004 -4.122  -8.646  1.00 12.83 ? 118 TYR A O     1 
ATOM   949  C  CB    . TYR A 1 121 ? 56.770 -6.167  -6.506  1.00 9.42  ? 118 TYR A CB    1 
ATOM   950  C  CG    . TYR A 1 121 ? 56.086 -6.566  -5.219  1.00 9.81  ? 118 TYR A CG    1 
ATOM   951  C  CD1   . TYR A 1 121 ? 54.773 -6.194  -4.962  1.00 10.35 ? 118 TYR A CD1   1 
ATOM   952  C  CD2   . TYR A 1 121 ? 56.753 -7.320  -4.262  1.00 11.72 ? 118 TYR A CD2   1 
ATOM   953  C  CE1   . TYR A 1 121 ? 54.140 -6.563  -3.786  1.00 12.62 ? 118 TYR A CE1   1 
ATOM   954  C  CE2   . TYR A 1 121 ? 56.129 -7.693  -3.080  1.00 11.78 ? 118 TYR A CE2   1 
ATOM   955  C  CZ    . TYR A 1 121 ? 54.825 -7.310  -2.848  1.00 11.92 ? 118 TYR A CZ    1 
ATOM   956  O  OH    . TYR A 1 121 ? 54.203 -7.681  -1.677  1.00 14.83 ? 118 TYR A OH    1 
ATOM   957  N  N     . VAL A 1 122 ? 59.651 -5.245  -7.593  1.00 9.45  ? 119 VAL A N     1 
ATOM   958  C  CA    . VAL A 1 122 ? 60.598 -5.136  -8.689  1.00 13.55 ? 119 VAL A CA    1 
ATOM   959  C  C     . VAL A 1 122 ? 61.200 -6.499  -8.991  1.00 12.51 ? 119 VAL A C     1 
ATOM   960  O  O     . VAL A 1 122 ? 61.697 -7.168  -8.089  1.00 10.08 ? 119 VAL A O     1 
ATOM   961  C  CB    . VAL A 1 122 ? 61.749 -4.175  -8.323  1.00 13.91 ? 119 VAL A CB    1 
ATOM   962  C  CG1   . VAL A 1 122 ? 62.575 -3.847  -9.552  1.00 19.64 ? 119 VAL A CG1   1 
ATOM   963  C  CG2   . VAL A 1 122 ? 61.202 -2.905  -7.688  1.00 22.03 ? 119 VAL A CG2   1 
ATOM   964  N  N     . ASP A 1 123 ? 61.151 -6.918  -10.252 1.00 12.31 ? 120 ASP A N     1 
ATOM   965  C  CA    . ASP A 1 123 ? 61.869 -8.118  -10.667 1.00 12.84 ? 120 ASP A CA    1 
ATOM   966  C  C     . ASP A 1 123 ? 63.253 -7.722  -11.166 1.00 15.55 ? 120 ASP A C     1 
ATOM   967  O  O     . ASP A 1 123 ? 63.394 -7.143  -12.243 1.00 15.70 ? 120 ASP A O     1 
ATOM   968  C  CB    . ASP A 1 123 ? 61.102 -8.891  -11.743 1.00 16.52 ? 120 ASP A CB    1 
ATOM   969  C  CG    . ASP A 1 123 ? 61.698 -10.264 -12.011 1.00 18.64 ? 120 ASP A CG    1 
ATOM   970  O  OD1   . ASP A 1 123 ? 62.936 -10.367 -12.134 1.00 16.45 ? 120 ASP A OD1   1 
ATOM   971  O  OD2   . ASP A 1 123 ? 60.931 -11.247 -12.084 1.00 29.41 ? 120 ASP A OD2   1 
ATOM   972  N  N     . LEU A 1 124 ? 64.271 -8.030  -10.370 1.00 11.53 ? 121 LEU A N     1 
ATOM   973  C  CA    . LEU A 1 124 ? 65.637 -7.601  -10.658 1.00 13.17 ? 121 LEU A CA    1 
ATOM   974  C  C     . LEU A 1 124 ? 66.479 -8.693  -11.300 1.00 11.46 ? 121 LEU A C     1 
ATOM   975  O  O     . LEU A 1 124 ? 67.684 -8.522  -11.486 1.00 12.71 ? 121 LEU A O     1 
ATOM   976  C  CB    . LEU A 1 124 ? 66.321 -7.137  -9.371  1.00 10.22 ? 121 LEU A CB    1 
ATOM   977  C  CG    . LEU A 1 124 ? 65.752 -5.887  -8.699  1.00 17.04 ? 121 LEU A CG    1 
ATOM   978  C  CD1   . LEU A 1 124 ? 66.359 -5.705  -7.317  1.00 11.79 ? 121 LEU A CD1   1 
ATOM   979  C  CD2   . LEU A 1 124 ? 65.989 -4.660  -9.567  1.00 14.69 ? 121 LEU A CD2   1 
ATOM   980  N  N     . THR A 1 125 ? 65.849 -9.816  -11.627 1.00 12.53 ? 122 THR A N     1 
ATOM   981  C  CA    . THR A 1 125 ? 66.577 -10.964 -12.152 1.00 13.33 ? 122 THR A CA    1 
ATOM   982  C  C     . THR A 1 125 ? 67.504 -10.577 -13.303 1.00 14.93 ? 122 THR A C     1 
ATOM   983  O  O     . THR A 1 125 ? 68.699 -10.865 -13.264 1.00 15.13 ? 122 THR A O     1 
ATOM   984  C  CB    . THR A 1 125 ? 65.623 -12.086 -12.604 1.00 16.21 ? 122 THR A CB    1 
ATOM   985  O  OG1   . THR A 1 125 ? 64.739 -12.428 -11.528 1.00 13.25 ? 122 THR A OG1   1 
ATOM   986  C  CG2   . THR A 1 125 ? 66.413 -13.318 -13.018 1.00 18.26 ? 122 THR A CG2   1 
ATOM   987  N  N     . SER A 1 126 ? 66.955 -9.912  -14.316 1.00 15.28 ? 123 SER A N     1 
ATOM   988  C  CA    . SER A 1 126 ? 67.735 -9.545  -15.497 1.00 18.32 ? 123 SER A CA    1 
ATOM   989  C  C     . SER A 1 126 ? 68.817 -8.513  -15.183 1.00 20.94 ? 123 SER A C     1 
ATOM   990  O  O     . SER A 1 126 ? 69.959 -8.650  -15.621 1.00 21.91 ? 123 SER A O     1 
ATOM   991  C  CB    . SER A 1 126 ? 66.826 -9.038  -16.619 1.00 19.83 ? 123 SER A CB    1 
ATOM   992  O  OG    A SER A 1 126 ? 65.944 -10.054 -17.059 0.50 20.68 ? 123 SER A OG    1 
ATOM   993  O  OG    B SER A 1 126 ? 66.177 -7.834  -16.251 0.50 20.08 ? 123 SER A OG    1 
ATOM   994  N  N     . ALA A 1 127 ? 68.453 -7.482  -14.425 1.00 16.15 ? 124 ALA A N     1 
ATOM   995  C  CA    . ALA A 1 127 ? 69.401 -6.442  -14.038 1.00 17.93 ? 124 ALA A CA    1 
ATOM   996  C  C     . ALA A 1 127 ? 70.587 -7.019  -13.266 1.00 17.37 ? 124 ALA A C     1 
ATOM   997  O  O     . ALA A 1 127 ? 71.727 -6.597  -13.459 1.00 17.54 ? 124 ALA A O     1 
ATOM   998  C  CB    . ALA A 1 127 ? 68.705 -5.363  -13.221 1.00 16.75 ? 124 ALA A CB    1 
ATOM   999  N  N     . VAL A 1 128 ? 70.315 -7.985  -12.393 1.00 15.62 ? 125 VAL A N     1 
ATOM   1000 C  CA    . VAL A 1 128 ? 71.372 -8.642  -11.629 1.00 15.30 ? 125 VAL A CA    1 
ATOM   1001 C  C     . VAL A 1 128 ? 72.363 -9.358  -12.547 1.00 17.50 ? 125 VAL A C     1 
ATOM   1002 O  O     . VAL A 1 128 ? 73.576 -9.252  -12.364 1.00 18.37 ? 125 VAL A O     1 
ATOM   1003 C  CB    . VAL A 1 128 ? 70.797 -9.642  -10.598 1.00 14.15 ? 125 VAL A CB    1 
ATOM   1004 C  CG1   . VAL A 1 128 ? 71.874 -10.608 -10.130 1.00 14.24 ? 125 VAL A CG1   1 
ATOM   1005 C  CG2   . VAL A 1 128 ? 70.192 -8.892  -9.418  1.00 12.03 ? 125 VAL A CG2   1 
ATOM   1006 N  N     . GLN A 1 129 ? 71.841 -10.082 -13.532 1.00 19.05 ? 126 GLN A N     1 
ATOM   1007 C  CA    . GLN A 1 129 ? 72.682 -10.770 -14.506 1.00 26.24 ? 126 GLN A CA    1 
ATOM   1008 C  C     . GLN A 1 129 ? 73.613 -9.790  -15.214 1.00 27.29 ? 126 GLN A C     1 
ATOM   1009 O  O     . GLN A 1 129 ? 74.817 -10.029 -15.320 1.00 27.78 ? 126 GLN A O     1 
ATOM   1010 C  CB    . GLN A 1 129 ? 71.822 -11.511 -15.531 1.00 28.69 ? 126 GLN A CB    1 
ATOM   1011 C  CG    . GLN A 1 129 ? 70.973 -12.626 -14.939 1.00 33.27 ? 126 GLN A CG    1 
ATOM   1012 C  CD    . GLN A 1 129 ? 71.811 -13.754 -14.363 1.00 41.49 ? 126 GLN A CD    1 
ATOM   1013 O  OE1   . GLN A 1 129 ? 71.686 -14.099 -13.188 1.00 38.04 ? 126 GLN A OE1   1 
ATOM   1014 N  NE2   . GLN A 1 129 ? 72.668 -14.338 -15.194 1.00 45.36 ? 126 GLN A NE2   1 
ATOM   1015 N  N     . GLU A 1 130 ? 73.048 -8.687  -15.696 1.00 23.15 ? 127 GLU A N     1 
ATOM   1016 C  CA    . GLU A 1 130 ? 73.832 -7.657  -16.367 1.00 29.02 ? 127 GLU A CA    1 
ATOM   1017 C  C     . GLU A 1 130 ? 74.940 -7.136  -15.459 1.00 30.02 ? 127 GLU A C     1 
ATOM   1018 O  O     . GLU A 1 130 ? 76.104 -7.074  -15.856 1.00 29.48 ? 127 GLU A O     1 
ATOM   1019 C  CB    . GLU A 1 130 ? 72.934 -6.499  -16.805 1.00 28.00 ? 127 GLU A CB    1 
ATOM   1020 C  CG    . GLU A 1 130 ? 71.788 -6.907  -17.714 1.00 32.43 ? 127 GLU A CG    1 
ATOM   1021 C  CD    . GLU A 1 130 ? 70.908 -5.734  -18.102 1.00 47.52 ? 127 GLU A CD    1 
ATOM   1022 O  OE1   . GLU A 1 130 ? 71.391 -4.582  -18.052 1.00 47.44 ? 127 GLU A OE1   1 
ATOM   1023 O  OE2   . GLU A 1 130 ? 69.730 -5.963  -18.452 1.00 47.49 ? 127 GLU A OE2   1 
ATOM   1024 N  N     . ARG A 1 131 ? 74.569 -6.762  -14.237 1.00 22.40 ? 128 ARG A N     1 
ATOM   1025 C  CA    . ARG A 1 131 ? 75.520 -6.212  -13.278 1.00 24.99 ? 128 ARG A CA    1 
ATOM   1026 C  C     . ARG A 1 131 ? 76.625 -7.216  -12.956 1.00 25.28 ? 128 ARG A C     1 
ATOM   1027 O  O     . ARG A 1 131 ? 77.786 -6.841  -12.792 1.00 27.56 ? 128 ARG A O     1 
ATOM   1028 C  CB    . ARG A 1 131 ? 74.798 -5.781  -11.998 1.00 21.62 ? 128 ARG A CB    1 
ATOM   1029 C  CG    A ARG A 1 131 ? 75.682 -5.079  -10.977 0.50 22.95 ? 128 ARG A CG    1 
ATOM   1030 C  CG    B ARG A 1 131 ? 75.718 -5.209  -10.929 0.50 22.94 ? 128 ARG A CG    1 
ATOM   1031 C  CD    A ARG A 1 131 ? 76.242 -3.777  -11.528 0.50 24.04 ? 128 ARG A CD    1 
ATOM   1032 C  CD    B ARG A 1 131 ? 76.386 -3.926  -11.399 0.50 24.05 ? 128 ARG A CD    1 
ATOM   1033 N  NE    A ARG A 1 131 ? 76.911 -2.990  -10.496 0.50 23.33 ? 128 ARG A NE    1 
ATOM   1034 N  NE    B ARG A 1 131 ? 75.406 -2.885  -11.690 0.50 22.30 ? 128 ARG A NE    1 
ATOM   1035 C  CZ    A ARG A 1 131 ? 76.296 -2.096  -9.728  0.50 21.66 ? 128 ARG A CZ    1 
ATOM   1036 C  CZ    B ARG A 1 131 ? 74.936 -2.031  -10.787 0.50 21.03 ? 128 ARG A CZ    1 
ATOM   1037 N  NH1   A ARG A 1 131 ? 76.980 -1.422  -8.813  0.50 22.93 ? 128 ARG A NH1   1 
ATOM   1038 N  NH1   B ARG A 1 131 ? 74.042 -1.117  -11.138 0.50 22.73 ? 128 ARG A NH1   1 
ATOM   1039 N  NH2   A ARG A 1 131 ? 74.997 -1.877  -9.876  0.50 19.82 ? 128 ARG A NH2   1 
ATOM   1040 N  NH2   B ARG A 1 131 ? 75.359 -2.091  -9.532  0.50 19.68 ? 128 ARG A NH2   1 
ATOM   1041 N  N     . LEU A 1 132 ? 76.258 -8.491  -12.870 1.00 23.50 ? 129 LEU A N     1 
ATOM   1042 C  CA    . LEU A 1 132 ? 77.224 -9.554  -12.606 1.00 27.41 ? 129 LEU A CA    1 
ATOM   1043 C  C     . LEU A 1 132 ? 78.269 -9.654  -13.713 1.00 35.96 ? 129 LEU A C     1 
ATOM   1044 O  O     . LEU A 1 132 ? 79.400 -10.080 -13.473 1.00 36.57 ? 129 LEU A O     1 
ATOM   1045 C  CB    . LEU A 1 132 ? 76.515 -10.901 -12.434 1.00 28.67 ? 129 LEU A CB    1 
ATOM   1046 C  CG    . LEU A 1 132 ? 75.912 -11.193 -11.057 1.00 23.00 ? 129 LEU A CG    1 
ATOM   1047 C  CD1   . LEU A 1 132 ? 75.028 -12.431 -11.104 1.00 27.03 ? 129 LEU A CD1   1 
ATOM   1048 C  CD2   . LEU A 1 132 ? 77.009 -11.352 -10.015 1.00 26.69 ? 129 LEU A CD2   1 
ATOM   1049 N  N     . GLN A 1 133 ? 77.884 -9.260  -14.923 1.00 35.83 ? 130 GLN A N     1 
ATOM   1050 C  CA    . GLN A 1 133 ? 78.786 -9.308  -16.068 1.00 38.31 ? 130 GLN A CA    1 
ATOM   1051 C  C     . GLN A 1 133 ? 79.811 -8.178  -16.035 1.00 41.06 ? 130 GLN A C     1 
ATOM   1052 O  O     . GLN A 1 133 ? 80.902 -8.307  -16.587 1.00 48.76 ? 130 GLN A O     1 
ATOM   1053 C  CB    . GLN A 1 133 ? 77.998 -9.272  -17.379 1.00 38.76 ? 130 GLN A CB    1 
ATOM   1054 C  CG    . GLN A 1 133 ? 77.078 -10.467 -17.581 1.00 40.78 ? 130 GLN A CG    1 
ATOM   1055 C  CD    . GLN A 1 133 ? 77.832 -11.779 -17.672 1.00 48.76 ? 130 GLN A CD    1 
ATOM   1056 O  OE1   . GLN A 1 133 ? 79.062 -11.800 -17.733 1.00 54.36 ? 130 GLN A OE1   1 
ATOM   1057 N  NE2   . GLN A 1 133 ? 77.096 -12.885 -17.682 1.00 53.84 ? 130 GLN A NE2   1 
ATOM   1058 N  N     . LYS A 1 134 ? 79.457 -7.071  -15.389 1.00 40.99 ? 131 LYS A N     1 
ATOM   1059 C  CA    . LYS A 1 134 ? 80.387 -5.959  -15.233 1.00 43.70 ? 131 LYS A CA    1 
ATOM   1060 C  C     . LYS A 1 134 ? 81.402 -6.247  -14.132 1.00 46.00 ? 131 LYS A C     1 
ATOM   1061 O  O     . LYS A 1 134 ? 82.583 -5.929  -14.266 1.00 47.75 ? 131 LYS A O     1 
ATOM   1062 C  CB    . LYS A 1 134 ? 79.644 -4.657  -14.923 1.00 44.49 ? 131 LYS A CB    1 
ATOM   1063 C  CG    . LYS A 1 134 ? 78.770 -4.140  -16.053 1.00 44.79 ? 131 LYS A CG    1 
ATOM   1064 C  CD    . LYS A 1 134 ? 78.387 -2.685  -15.822 1.00 44.34 ? 131 LYS A CD    1 
ATOM   1065 C  CE    . LYS A 1 134 ? 77.785 -2.485  -14.440 1.00 41.17 ? 131 LYS A CE    1 
ATOM   1066 N  NZ    . LYS A 1 134 ? 77.448 -1.058  -14.173 1.00 41.06 ? 131 LYS A NZ    1 
ATOM   1067 N  N     . LEU A 1 135 ? 80.933 -6.849  -13.043 1.00 42.54 ? 132 LEU A N     1 
ATOM   1068 C  CA    . LEU A 1 135 ? 81.793 -7.156  -11.905 1.00 49.06 ? 132 LEU A CA    1 
ATOM   1069 C  C     . LEU A 1 135 ? 82.936 -8.090  -12.289 1.00 49.30 ? 132 LEU A C     1 
ATOM   1070 O  O     . LEU A 1 135 ? 84.094 -7.834  -11.956 1.00 53.04 ? 132 LEU A O     1 
ATOM   1071 C  CB    . LEU A 1 135 ? 80.977 -7.754  -10.755 1.00 46.04 ? 132 LEU A CB    1 
ATOM   1072 C  CG    . LEU A 1 135 ? 80.367 -6.758  -9.763  1.00 43.41 ? 132 LEU A CG    1 
ATOM   1073 C  CD1   . LEU A 1 135 ? 79.693 -5.598  -10.482 1.00 41.29 ? 132 LEU A CD1   1 
ATOM   1074 C  CD2   . LEU A 1 135 ? 79.392 -7.458  -8.825  1.00 38.49 ? 132 LEU A CD2   1 
ATOM   1075 N  N     . GLN A 1 136 ? 82.604 -9.169  -12.991 1.00 48.68 ? 133 GLN A N     1 
ATOM   1076 C  CA    . GLN A 1 136 ? 83.603 -10.133 -13.443 1.00 51.64 ? 133 GLN A CA    1 
ATOM   1077 C  C     . GLN A 1 136 ? 84.388 -10.743 -12.285 1.00 52.54 ? 133 GLN A C     1 
ATOM   1078 O  O     . GLN A 1 136 ? 85.602 -10.566 -12.185 1.00 52.65 ? 133 GLN A O     1 
ATOM   1079 C  CB    . GLN A 1 136 ? 84.567 -9.484  -14.442 1.00 51.33 ? 133 GLN A CB    1 
ATOM   1080 C  CG    . GLN A 1 136 ? 83.914 -9.001  -15.729 1.00 52.44 ? 133 GLN A CG    1 
ATOM   1081 C  CD    . GLN A 1 136 ? 83.341 -10.134 -16.562 1.00 57.95 ? 133 GLN A CD    1 
ATOM   1082 O  OE1   . GLN A 1 136 ? 82.510 -10.912 -16.091 1.00 59.44 ? 133 GLN A OE1   1 
ATOM   1083 N  NE2   . GLN A 1 136 ? 83.787 -10.233 -17.810 1.00 55.04 ? 133 GLN A NE2   1 
ATOM   1084 N  N     . GLY A 1 137 ? 83.688 -11.462 -11.412 1.00 49.78 ? 134 GLY A N     1 
ATOM   1085 C  CA    . GLY A 1 137 ? 84.325 -12.151 -10.304 1.00 48.96 ? 134 GLY A CA    1 
ATOM   1086 C  C     . GLY A 1 137 ? 84.840 -11.226 -9.218  1.00 46.19 ? 134 GLY A C     1 
ATOM   1087 O  O     . GLY A 1 137 ? 85.353 -11.682 -8.196  1.00 48.87 ? 134 GLY A O     1 
ATOM   1088 N  N     . GLN A 1 138 ? 84.707 -9.922  -9.439  1.00 44.22 ? 135 GLN A N     1 
ATOM   1089 C  CA    . GLN A 1 138 ? 85.140 -8.937  -8.456  1.00 45.28 ? 135 GLN A CA    1 
ATOM   1090 C  C     . GLN A 1 138 ? 84.261 -8.996  -7.212  1.00 44.28 ? 135 GLN A C     1 
ATOM   1091 O  O     . GLN A 1 138 ? 83.034 -8.984  -7.313  1.00 40.06 ? 135 GLN A O     1 
ATOM   1092 C  CB    . GLN A 1 138 ? 85.106 -7.531  -9.057  1.00 45.84 ? 135 GLN A CB    1 
ATOM   1093 C  CG    . GLN A 1 138 ? 85.509 -6.432  -8.088  1.00 52.63 ? 135 GLN A CG    1 
ATOM   1094 C  CD    . GLN A 1 138 ? 85.480 -5.056  -8.723  1.00 54.64 ? 135 GLN A CD    1 
ATOM   1095 O  OE1   . GLN A 1 138 ? 85.295 -4.922  -9.933  1.00 54.62 ? 135 GLN A OE1   1 
ATOM   1096 N  NE2   . GLN A 1 138 ? 85.661 -4.024  -7.907  1.00 53.28 ? 135 GLN A NE2   1 
ATOM   1097 N  N     . PRO A 1 139 ? 84.891 -9.061  -6.031  1.00 42.34 ? 136 PRO A N     1 
ATOM   1098 C  CA    . PRO A 1 139 ? 84.155 -9.131  -4.765  1.00 40.60 ? 136 PRO A CA    1 
ATOM   1099 C  C     . PRO A 1 139 ? 83.263 -7.912  -4.566  1.00 36.08 ? 136 PRO A C     1 
ATOM   1100 O  O     . PRO A 1 139 ? 83.478 -6.875  -5.194  1.00 37.96 ? 136 PRO A O     1 
ATOM   1101 C  CB    . PRO A 1 139 ? 85.269 -9.148  -3.713  1.00 41.25 ? 136 PRO A CB    1 
ATOM   1102 C  CG    . PRO A 1 139 ? 86.451 -8.546  -4.395  1.00 42.12 ? 136 PRO A CG    1 
ATOM   1103 C  CD    . PRO A 1 139 ? 86.346 -8.995  -5.818  1.00 41.67 ? 136 PRO A CD    1 
ATOM   1104 N  N     . ILE A 1 140 ? 82.267 -8.044  -3.699  1.00 35.76 ? 137 ILE A N     1 
ATOM   1105 C  CA    . ILE A 1 140 ? 81.359 -6.944  -3.411  1.00 27.14 ? 137 ILE A CA    1 
ATOM   1106 C  C     . ILE A 1 140 ? 81.722 -6.280  -2.090  1.00 26.25 ? 137 ILE A C     1 
ATOM   1107 O  O     . ILE A 1 140 ? 81.695 -6.913  -1.035  1.00 25.68 ? 137 ILE A O     1 
ATOM   1108 C  CB    . ILE A 1 140 ? 79.896 -7.420  -3.371  1.00 27.19 ? 137 ILE A CB    1 
ATOM   1109 C  CG1   . ILE A 1 140 ? 79.482 -7.961  -4.741  1.00 29.76 ? 137 ILE A CG1   1 
ATOM   1110 C  CG2   . ILE A 1 140 ? 78.978 -6.289  -2.940  1.00 21.34 ? 137 ILE A CG2   1 
ATOM   1111 C  CD1   . ILE A 1 140 ? 78.062 -8.480  -4.794  1.00 29.77 ? 137 ILE A CD1   1 
ATOM   1112 N  N     . SER A 1 141 ? 82.070 -5.000  -2.157  1.00 25.23 ? 138 SER A N     1 
ATOM   1113 C  CA    . SER A 1 141 ? 82.432 -4.244  -0.967  1.00 22.43 ? 138 SER A CA    1 
ATOM   1114 C  C     . SER A 1 141 ? 81.213 -4.002  -0.085  1.00 23.04 ? 138 SER A C     1 
ATOM   1115 O  O     . SER A 1 141 ? 80.110 -3.780  -0.585  1.00 19.50 ? 138 SER A O     1 
ATOM   1116 C  CB    . SER A 1 141 ? 83.063 -2.907  -1.360  1.00 22.25 ? 138 SER A CB    1 
ATOM   1117 O  OG    . SER A 1 141 ? 83.326 -2.116  -0.215  1.00 25.80 ? 138 SER A OG    1 
ATOM   1118 N  N     . ALA A 1 142 ? 81.418 -4.045  1.227   1.00 15.74 ? 139 ALA A N     1 
ATOM   1119 C  CA    . ALA A 1 142 ? 80.357 -3.715  2.169   1.00 21.46 ? 139 ALA A CA    1 
ATOM   1120 C  C     . ALA A 1 142 ? 79.945 -2.252  2.009   1.00 22.83 ? 139 ALA A C     1 
ATOM   1121 O  O     . ALA A 1 142 ? 78.864 -1.848  2.441   1.00 16.60 ? 139 ALA A O     1 
ATOM   1122 C  CB    . ALA A 1 142 ? 80.808 -3.988  3.594   1.00 19.17 ? 139 ALA A CB    1 
ATOM   1123 N  N     . ASP A 1 143 ? 80.816 -1.464  1.385   1.00 22.90 ? 140 ASP A N     1 
ATOM   1124 C  CA    . ASP A 1 143 ? 80.542 -0.050  1.158   1.00 24.81 ? 140 ASP A CA    1 
ATOM   1125 C  C     . ASP A 1 143 ? 79.412 0.144   0.153   1.00 23.48 ? 140 ASP A C     1 
ATOM   1126 O  O     . ASP A 1 143 ? 78.805 1.215   0.088   1.00 22.53 ? 140 ASP A O     1 
ATOM   1127 C  CB    . ASP A 1 143 ? 81.802 0.677   0.680   1.00 24.62 ? 140 ASP A CB    1 
ATOM   1128 C  CG    . ASP A 1 143 ? 82.888 0.719   1.738   1.00 34.49 ? 140 ASP A CG    1 
ATOM   1129 O  OD1   . ASP A 1 143 ? 82.555 0.652   2.940   1.00 31.79 ? 140 ASP A OD1   1 
ATOM   1130 O  OD2   . ASP A 1 143 ? 84.077 0.822   1.366   1.00 41.63 ? 140 ASP A OD2   1 
ATOM   1131 N  N     . LEU A 1 144 ? 79.132 -0.894  -0.628  1.00 18.52 ? 141 LEU A N     1 
ATOM   1132 C  CA    . LEU A 1 144 ? 78.050 -0.841  -1.603  1.00 19.33 ? 141 LEU A CA    1 
ATOM   1133 C  C     . LEU A 1 144 ? 76.712 -1.226  -0.973  1.00 17.99 ? 141 LEU A C     1 
ATOM   1134 O  O     . LEU A 1 144 ? 75.671 -1.180  -1.628  1.00 15.32 ? 141 LEU A O     1 
ATOM   1135 C  CB    . LEU A 1 144 ? 78.353 -1.753  -2.791  1.00 18.20 ? 141 LEU A CB    1 
ATOM   1136 C  CG    . LEU A 1 144 ? 79.648 -1.449  -3.547  1.00 22.84 ? 141 LEU A CG    1 
ATOM   1137 C  CD1   . LEU A 1 144 ? 79.820 -2.401  -4.720  1.00 25.01 ? 141 LEU A CD1   1 
ATOM   1138 C  CD2   . LEU A 1 144 ? 79.660 -0.004  -4.019  1.00 24.29 ? 141 LEU A CD2   1 
ATOM   1139 N  N     . LEU A 1 145 ? 76.750 -1.604  0.301   1.00 17.67 ? 142 LEU A N     1 
ATOM   1140 C  CA    . LEU A 1 145 ? 75.544 -2.000  1.027   1.00 14.63 ? 142 LEU A CA    1 
ATOM   1141 C  C     . LEU A 1 145 ? 75.443 -1.267  2.364   1.00 16.88 ? 142 LEU A C     1 
ATOM   1142 O  O     . LEU A 1 145 ? 75.360 -1.895  3.420   1.00 14.57 ? 142 LEU A O     1 
ATOM   1143 C  CB    . LEU A 1 145 ? 75.545 -3.514  1.253   1.00 15.35 ? 142 LEU A CB    1 
ATOM   1144 C  CG    . LEU A 1 145 ? 75.572 -4.371  -0.015  1.00 13.75 ? 142 LEU A CG    1 
ATOM   1145 C  CD1   . LEU A 1 145 ? 76.035 -5.792  0.282   1.00 13.87 ? 142 LEU A CD1   1 
ATOM   1146 C  CD2   . LEU A 1 145 ? 74.208 -4.375  -0.692  1.00 14.00 ? 142 LEU A CD2   1 
ATOM   1147 N  N     . PRO A 1 146 ? 75.429 0.074   2.318   1.00 18.43 ? 143 PRO A N     1 
ATOM   1148 C  CA    . PRO A 1 146 ? 75.516 0.905   3.525   1.00 16.94 ? 143 PRO A CA    1 
ATOM   1149 C  C     . PRO A 1 146 ? 74.290 0.850   4.437   1.00 14.40 ? 143 PRO A C     1 
ATOM   1150 O  O     . PRO A 1 146 ? 74.396 1.237   5.598   1.00 15.46 ? 143 PRO A O     1 
ATOM   1151 C  CB    . PRO A 1 146 ? 75.682 2.319   2.958   1.00 20.42 ? 143 PRO A CB    1 
ATOM   1152 C  CG    . PRO A 1 146 ? 75.028 2.263   1.623   1.00 18.41 ? 143 PRO A CG    1 
ATOM   1153 C  CD    . PRO A 1 146 ? 75.317 0.887   1.094   1.00 15.21 ? 143 PRO A CD    1 
ATOM   1154 N  N     . SER A 1 147 ? 73.151 0.386   3.932   1.00 16.27 ? 144 SER A N     1 
ATOM   1155 C  CA    . SER A 1 147 ? 71.938 0.345   4.749   1.00 14.60 ? 144 SER A CA    1 
ATOM   1156 C  C     . SER A 1 147 ? 71.277 -1.029  4.730   1.00 12.65 ? 144 SER A C     1 
ATOM   1157 O  O     . SER A 1 147 ? 70.085 -1.160  5.004   1.00 10.20 ? 144 SER A O     1 
ATOM   1158 C  CB    . SER A 1 147 ? 70.944 1.417   4.291   1.00 12.99 ? 144 SER A CB    1 
ATOM   1159 O  OG    . SER A 1 147 ? 70.585 1.233   2.934   1.00 14.86 ? 144 SER A OG    1 
ATOM   1160 N  N     . THR A 1 148 ? 72.067 -2.053  4.430   1.00 12.37 ? 145 THR A N     1 
ATOM   1161 C  CA    . THR A 1 148 ? 71.542 -3.401  4.246   1.00 12.01 ? 145 THR A CA    1 
ATOM   1162 C  C     . THR A 1 148 ? 71.714 -4.288  5.478   1.00 9.84  ? 145 THR A C     1 
ATOM   1163 O  O     . THR A 1 148 ? 72.779 -4.318  6.094   1.00 14.76 ? 145 THR A O     1 
ATOM   1164 C  CB    . THR A 1 148 ? 72.200 -4.084  3.030   1.00 9.42  ? 145 THR A CB    1 
ATOM   1165 O  OG1   . THR A 1 148 ? 71.806 -3.401  1.836   1.00 10.79 ? 145 THR A OG1   1 
ATOM   1166 C  CG2   . THR A 1 148 ? 71.777 -5.545  2.931   1.00 10.96 ? 145 THR A CG2   1 
ATOM   1167 N  N     . TYR A 1 149 ? 70.647 -4.998  5.830   1.00 9.02  ? 146 TYR A N     1 
ATOM   1168 C  CA    . TYR A 1 149 ? 70.680 -6.002  6.884   1.00 11.85 ? 146 TYR A CA    1 
ATOM   1169 C  C     . TYR A 1 149 ? 70.597 -7.378  6.246   1.00 13.09 ? 146 TYR A C     1 
ATOM   1170 O  O     . TYR A 1 149 ? 69.827 -7.585  5.308   1.00 10.75 ? 146 TYR A O     1 
ATOM   1171 C  CB    . TYR A 1 149 ? 69.495 -5.828  7.835   1.00 9.49  ? 146 TYR A CB    1 
ATOM   1172 C  CG    . TYR A 1 149 ? 69.686 -4.775  8.904   1.00 11.98 ? 146 TYR A CG    1 
ATOM   1173 C  CD1   . TYR A 1 149 ? 70.123 -5.125  10.175  1.00 16.09 ? 146 TYR A CD1   1 
ATOM   1174 C  CD2   . TYR A 1 149 ? 69.419 -3.434  8.648   1.00 12.23 ? 146 TYR A CD2   1 
ATOM   1175 C  CE1   . TYR A 1 149 ? 70.296 -4.172  11.161  1.00 17.96 ? 146 TYR A CE1   1 
ATOM   1176 C  CE2   . TYR A 1 149 ? 69.589 -2.471  9.629   1.00 16.25 ? 146 TYR A CE2   1 
ATOM   1177 C  CZ    . TYR A 1 149 ? 70.028 -2.848  10.883  1.00 18.57 ? 146 TYR A CZ    1 
ATOM   1178 O  OH    . TYR A 1 149 ? 70.200 -1.902  11.867  1.00 24.15 ? 146 TYR A OH    1 
ATOM   1179 N  N     . ILE A 1 150 ? 71.392 -8.316  6.747   1.00 11.42 ? 147 ILE A N     1 
ATOM   1180 C  CA    . ILE A 1 150 ? 71.286 -9.704  6.315   1.00 12.29 ? 147 ILE A CA    1 
ATOM   1181 C  C     . ILE A 1 150 ? 70.579 -10.500 7.405   1.00 12.11 ? 147 ILE A C     1 
ATOM   1182 O  O     . ILE A 1 150 ? 71.146 -10.746 8.470   1.00 12.55 ? 147 ILE A O     1 
ATOM   1183 C  CB    . ILE A 1 150 ? 72.663 -10.331 6.040   1.00 11.81 ? 147 ILE A CB    1 
ATOM   1184 C  CG1   . ILE A 1 150 ? 73.485 -9.444  5.099   1.00 10.44 ? 147 ILE A CG1   1 
ATOM   1185 C  CG2   . ILE A 1 150 ? 72.500 -11.733 5.463   1.00 12.13 ? 147 ILE A CG2   1 
ATOM   1186 C  CD1   . ILE A 1 150 ? 72.897 -9.292  3.706   1.00 10.94 ? 147 ILE A CD1   1 
ATOM   1187 N  N     . GLU A 1 151 ? 69.336 -10.889 7.139   1.00 10.35 ? 148 GLU A N     1 
ATOM   1188 C  CA    . GLU A 1 151 ? 68.517 -11.553 8.145   1.00 11.56 ? 148 GLU A CA    1 
ATOM   1189 C  C     . GLU A 1 151 ? 69.153 -12.858 8.617   1.00 13.75 ? 148 GLU A C     1 
ATOM   1190 O  O     . GLU A 1 151 ? 69.565 -13.686 7.805   1.00 12.58 ? 148 GLU A O     1 
ATOM   1191 C  CB    . GLU A 1 151 ? 67.102 -11.803 7.612   1.00 13.59 ? 148 GLU A CB    1 
ATOM   1192 C  CG    . GLU A 1 151 ? 66.193 -12.564 8.574   1.00 11.40 ? 148 GLU A CG    1 
ATOM   1193 C  CD    . GLU A 1 151 ? 66.024 -11.864 9.908   1.00 16.07 ? 148 GLU A CD    1 
ATOM   1194 O  OE1   . GLU A 1 151 ? 65.804 -12.559 10.922  1.00 14.16 ? 148 GLU A OE1   1 
ATOM   1195 O  OE2   . GLU A 1 151 ? 66.100 -10.618 9.943   1.00 18.15 ? 148 GLU A OE2   1 
ATOM   1196 N  N     . GLY A 1 152 ? 69.232 -13.027 9.933   1.00 13.13 ? 149 GLY A N     1 
ATOM   1197 C  CA    . GLY A 1 152 ? 69.805 -14.224 10.522  1.00 15.68 ? 149 GLY A CA    1 
ATOM   1198 C  C     . GLY A 1 152 ? 71.248 -14.039 10.953  1.00 19.15 ? 149 GLY A C     1 
ATOM   1199 O  O     . GLY A 1 152 ? 71.820 -14.896 11.627  1.00 19.74 ? 149 GLY A O     1 
ATOM   1200 N  N     . LEU A 1 153 ? 71.842 -12.918 10.559  1.00 16.01 ? 150 LEU A N     1 
ATOM   1201 C  CA    . LEU A 1 153 ? 73.223 -12.622 10.916  1.00 15.16 ? 150 LEU A CA    1 
ATOM   1202 C  C     . LEU A 1 153 ? 73.300 -11.331 11.729  1.00 18.67 ? 150 LEU A C     1 
ATOM   1203 O  O     . LEU A 1 153 ? 72.434 -10.466 11.603  1.00 16.68 ? 150 LEU A O     1 
ATOM   1204 C  CB    . LEU A 1 153 ? 74.087 -12.521 9.657   1.00 13.26 ? 150 LEU A CB    1 
ATOM   1205 C  CG    . LEU A 1 153 ? 74.139 -13.777 8.782   1.00 16.88 ? 150 LEU A CG    1 
ATOM   1206 C  CD1   . LEU A 1 153 ? 75.005 -13.545 7.553   1.00 15.46 ? 150 LEU A CD1   1 
ATOM   1207 C  CD2   . LEU A 1 153 ? 74.645 -14.971 9.579   1.00 17.69 ? 150 LEU A CD2   1 
ATOM   1208 N  N     . PRO A 1 154 ? 74.339 -11.197 12.571  1.00 17.81 ? 151 PRO A N     1 
ATOM   1209 C  CA    . PRO A 1 154 ? 75.405 -12.190 12.744  1.00 21.32 ? 151 PRO A CA    1 
ATOM   1210 C  C     . PRO A 1 154 ? 74.982 -13.366 13.622  1.00 20.61 ? 151 PRO A C     1 
ATOM   1211 O  O     . PRO A 1 154 ? 73.950 -13.311 14.290  1.00 17.14 ? 151 PRO A O     1 
ATOM   1212 C  CB    . PRO A 1 154 ? 76.512 -11.388 13.433  1.00 21.03 ? 151 PRO A CB    1 
ATOM   1213 C  CG    . PRO A 1 154 ? 75.779 -10.359 14.218  1.00 23.55 ? 151 PRO A CG    1 
ATOM   1214 C  CD    . PRO A 1 154 ? 74.563 -9.999  13.398  1.00 19.37 ? 151 PRO A CD    1 
ATOM   1215 N  N     . GLN A 1 155 ? 75.788 -14.422 13.610  1.00 22.53 ? 152 GLN A N     1 
ATOM   1216 C  CA    . GLN A 1 155 ? 75.504 -15.623 14.383  1.00 25.26 ? 152 GLN A CA    1 
ATOM   1217 C  C     . GLN A 1 155 ? 76.777 -16.431 14.612  1.00 32.39 ? 152 GLN A C     1 
ATOM   1218 O  O     . GLN A 1 155 ? 77.707 -16.380 13.807  1.00 28.43 ? 152 GLN A O     1 
ATOM   1219 C  CB    . GLN A 1 155 ? 74.464 -16.484 13.665  1.00 26.80 ? 152 GLN A CB    1 
ATOM   1220 C  CG    . GLN A 1 155 ? 74.676 -17.979 13.837  1.00 30.66 ? 152 GLN A CG    1 
ATOM   1221 C  CD    . GLN A 1 155 ? 74.880 -18.690 12.515  1.00 33.45 ? 152 GLN A CD    1 
ATOM   1222 O  OE1   . GLN A 1 155 ? 73.996 -18.692 11.659  1.00 32.70 ? 152 GLN A OE1   1 
ATOM   1223 N  NE2   . GLN A 1 155 ? 76.053 -19.292 12.337  1.00 24.34 ? 152 GLN A NE2   1 
ATOM   1224 N  N     . GLY A 1 156 ? 76.815 -17.169 15.717  1.00 34.09 ? 153 GLY A N     1 
ATOM   1225 C  CA    . GLY A 1 156 ? 77.927 -18.058 15.999  1.00 36.83 ? 153 GLY A CA    1 
ATOM   1226 C  C     . GLY A 1 156 ? 78.878 -17.527 17.054  1.00 39.82 ? 153 GLY A C     1 
ATOM   1227 O  O     . GLY A 1 156 ? 78.584 -16.534 17.720  1.00 41.14 ? 153 GLY A O     1 
ATOM   1228 N  N     . PRO A 1 157 ? 80.028 -18.199 17.217  1.00 43.96 ? 154 PRO A N     1 
ATOM   1229 C  CA    . PRO A 1 157 ? 81.065 -17.805 18.175  1.00 40.03 ? 154 PRO A CA    1 
ATOM   1230 C  C     . PRO A 1 157 ? 81.925 -16.662 17.643  1.00 36.44 ? 154 PRO A C     1 
ATOM   1231 O  O     . PRO A 1 157 ? 81.924 -16.423 16.434  1.00 37.76 ? 154 PRO A O     1 
ATOM   1232 C  CB    . PRO A 1 157 ? 81.903 -19.076 18.311  1.00 34.06 ? 154 PRO A CB    1 
ATOM   1233 C  CG    . PRO A 1 157 ? 81.764 -19.745 16.988  1.00 29.18 ? 154 PRO A CG    1 
ATOM   1234 C  CD    . PRO A 1 157 ? 80.365 -19.455 16.522  1.00 33.49 ? 154 PRO A CD    1 
ATOM   1235 N  N     . THR A 1 163 ? 79.929 -6.023  20.411  1.00 58.81 ? 160 THR A N     1 
ATOM   1236 C  CA    . THR A 1 163 ? 79.184 -4.812  20.083  1.00 57.83 ? 160 THR A CA    1 
ATOM   1237 C  C     . THR A 1 163 ? 77.778 -4.845  20.673  1.00 51.16 ? 160 THR A C     1 
ATOM   1238 O  O     . THR A 1 163 ? 77.068 -5.845  20.564  1.00 50.23 ? 160 THR A O     1 
ATOM   1239 C  CB    . THR A 1 163 ? 79.090 -4.597  18.558  1.00 51.31 ? 160 THR A CB    1 
ATOM   1240 O  OG1   . THR A 1 163 ? 78.243 -3.474  18.283  1.00 49.84 ? 160 THR A OG1   1 
ATOM   1241 C  CG2   . THR A 1 163 ? 78.520 -5.832  17.879  1.00 47.52 ? 160 THR A CG2   1 
ATOM   1242 N  N     . VAL A 1 164 ? 77.383 -3.743  21.300  1.00 48.71 ? 161 VAL A N     1 
ATOM   1243 C  CA    . VAL A 1 164 ? 76.060 -3.640  21.901  1.00 48.34 ? 161 VAL A CA    1 
ATOM   1244 C  C     . VAL A 1 164 ? 75.232 -2.562  21.210  1.00 46.25 ? 161 VAL A C     1 
ATOM   1245 O  O     . VAL A 1 164 ? 74.195 -2.141  21.723  1.00 46.93 ? 161 VAL A O     1 
ATOM   1246 C  CB    . VAL A 1 164 ? 76.146 -3.327  23.408  1.00 44.39 ? 161 VAL A CB    1 
ATOM   1247 C  CG1   . VAL A 1 164 ? 76.927 -4.415  24.132  1.00 39.28 ? 161 VAL A CG1   1 
ATOM   1248 C  CG2   . VAL A 1 164 ? 76.786 -1.964  23.633  1.00 43.86 ? 161 VAL A CG2   1 
ATOM   1249 N  N     . GLN A 1 165 ? 75.696 -2.121  20.044  1.00 45.90 ? 162 GLN A N     1 
ATOM   1250 C  CA    . GLN A 1 165 ? 75.008 -1.075  19.293  1.00 44.86 ? 162 GLN A CA    1 
ATOM   1251 C  C     . GLN A 1 165 ? 74.377 -1.616  18.012  1.00 41.02 ? 162 GLN A C     1 
ATOM   1252 O  O     . GLN A 1 165 ? 74.834 -2.612  17.451  1.00 38.44 ? 162 GLN A O     1 
ATOM   1253 C  CB    . GLN A 1 165 ? 75.962 0.077   18.970  1.00 46.57 ? 162 GLN A CB    1 
ATOM   1254 C  CG    . GLN A 1 165 ? 77.104 -0.299  18.043  1.00 51.03 ? 162 GLN A CG    1 
ATOM   1255 C  CD    . GLN A 1 165 ? 78.030 0.867   17.760  1.00 59.13 ? 162 GLN A CD    1 
ATOM   1256 O  OE1   . GLN A 1 165 ? 78.004 1.879   18.462  1.00 66.76 ? 162 GLN A OE1   1 
ATOM   1257 N  NE2   . GLN A 1 165 ? 78.852 0.733   16.726  1.00 56.71 ? 162 GLN A NE2   1 
ATOM   1258 N  N     . LYS A 1 166 ? 73.328 -0.941  17.554  1.00 38.88 ? 163 LYS A N     1 
ATOM   1259 C  CA    . LYS A 1 166 ? 72.547 -1.394  16.409  1.00 36.93 ? 163 LYS A CA    1 
ATOM   1260 C  C     . LYS A 1 166 ? 73.355 -1.432  15.112  1.00 30.80 ? 163 LYS A C     1 
ATOM   1261 O  O     . LYS A 1 166 ? 73.389 -2.453  14.424  1.00 30.92 ? 163 LYS A O     1 
ATOM   1262 C  CB    . LYS A 1 166 ? 71.306 -0.513  16.241  1.00 36.78 ? 163 LYS A CB    1 
ATOM   1263 C  CG    . LYS A 1 166 ? 70.383 -0.926  15.109  1.00 36.50 ? 163 LYS A CG    1 
ATOM   1264 C  CD    . LYS A 1 166 ? 69.134 -0.058  15.095  1.00 35.99 ? 163 LYS A CD    1 
ATOM   1265 C  CE    . LYS A 1 166 ? 69.494 1.421   15.099  1.00 41.48 ? 163 LYS A CE    1 
ATOM   1266 N  NZ    . LYS A 1 166 ? 68.288 2.294   15.162  1.00 48.08 ? 163 LYS A NZ    1 
ATOM   1267 N  N     . GLU A 1 167 ? 74.000 -0.320  14.776  1.00 29.09 ? 164 GLU A N     1 
ATOM   1268 C  CA    . GLU A 1 167 ? 74.779 -0.246  13.546  1.00 31.15 ? 164 GLU A CA    1 
ATOM   1269 C  C     . GLU A 1 167 ? 75.936 -1.240  13.556  1.00 29.16 ? 164 GLU A C     1 
ATOM   1270 O  O     . GLU A 1 167 ? 76.288 -1.806  12.521  1.00 26.32 ? 164 GLU A O     1 
ATOM   1271 C  CB    . GLU A 1 167 ? 75.295 1.176   13.309  1.00 31.82 ? 164 GLU A CB    1 
ATOM   1272 C  CG    . GLU A 1 167 ? 76.215 1.312   12.102  1.00 28.10 ? 164 GLU A CG    1 
ATOM   1273 C  CD    . GLU A 1 167 ? 75.557 0.880   10.800  1.00 31.60 ? 164 GLU A CD    1 
ATOM   1274 O  OE1   . GLU A 1 167 ? 76.291 0.634   9.818   1.00 24.48 ? 164 GLU A OE1   1 
ATOM   1275 O  OE2   . GLU A 1 167 ? 74.311 0.791   10.753  1.00 28.67 ? 164 GLU A OE2   1 
ATOM   1276 N  N     . GLY A 1 168 ? 76.526 -1.449  14.728  1.00 33.67 ? 165 GLY A N     1 
ATOM   1277 C  CA    . GLY A 1 168 ? 77.609 -2.402  14.868  1.00 33.51 ? 165 GLY A CA    1 
ATOM   1278 C  C     . GLY A 1 168 ? 77.159 -3.797  14.485  1.00 26.65 ? 165 GLY A C     1 
ATOM   1279 O  O     . GLY A 1 168 ? 77.844 -4.503  13.746  1.00 25.67 ? 165 GLY A O     1 
ATOM   1280 N  N     . MET A 1 169 ? 75.995 -4.191  14.990  1.00 31.28 ? 166 MET A N     1 
ATOM   1281 C  CA    . MET A 1 169 ? 75.424 -5.495  14.681  1.00 26.46 ? 166 MET A CA    1 
ATOM   1282 C  C     . MET A 1 169 ? 75.185 -5.631  13.179  1.00 24.73 ? 166 MET A C     1 
ATOM   1283 O  O     . MET A 1 169 ? 75.509 -6.657  12.580  1.00 23.58 ? 166 MET A O     1 
ATOM   1284 C  CB    . MET A 1 169 ? 74.114 -5.698  15.445  1.00 31.48 ? 166 MET A CB    1 
ATOM   1285 C  CG    . MET A 1 169 ? 73.617 -7.135  15.453  1.00 36.18 ? 166 MET A CG    1 
ATOM   1286 S  SD    . MET A 1 169 ? 73.718 -7.897  17.085  1.00 52.32 ? 166 MET A SD    1 
ATOM   1287 C  CE    . MET A 1 169 ? 75.404 -7.503  17.548  1.00 39.11 ? 166 MET A CE    1 
ATOM   1288 N  N     . ARG A 1 170 ? 74.620 -4.590  12.574  1.00 23.02 ? 167 ARG A N     1 
ATOM   1289 C  CA    . ARG A 1 170 ? 74.360 -4.596  11.140  1.00 18.91 ? 167 ARG A CA    1 
ATOM   1290 C  C     . ARG A 1 170 ? 75.623 -4.954  10.369  1.00 20.26 ? 167 ARG A C     1 
ATOM   1291 O  O     . ARG A 1 170 ? 75.614 -5.859  9.534   1.00 14.93 ? 167 ARG A O     1 
ATOM   1292 C  CB    . ARG A 1 170 ? 73.840 -3.235  10.668  1.00 19.41 ? 167 ARG A CB    1 
ATOM   1293 C  CG    . ARG A 1 170 ? 73.392 -3.223  9.213   1.00 15.28 ? 167 ARG A CG    1 
ATOM   1294 C  CD    . ARG A 1 170 ? 73.273 -1.807  8.663   1.00 19.07 ? 167 ARG A CD    1 
ATOM   1295 N  NE    . ARG A 1 170 ? 74.580 -1.213  8.391   1.00 15.56 ? 167 ARG A NE    1 
ATOM   1296 C  CZ    . ARG A 1 170 ? 75.274 -1.416  7.275   1.00 18.92 ? 167 ARG A CZ    1 
ATOM   1297 N  NH1   . ARG A 1 170 ? 74.792 -2.207  6.326   1.00 13.70 ? 167 ARG A NH1   1 
ATOM   1298 N  NH2   . ARG A 1 170 ? 76.454 -0.834  7.107   1.00 19.99 ? 167 ARG A NH2   1 
ATOM   1299 N  N     . LYS A 1 171 ? 76.708 -4.240  10.657  1.00 19.02 ? 168 LYS A N     1 
ATOM   1300 C  CA    . LYS A 1 171 ? 77.973 -4.446  9.960   1.00 20.92 ? 168 LYS A CA    1 
ATOM   1301 C  C     . LYS A 1 171 ? 78.546 -5.844  10.175  1.00 19.30 ? 168 LYS A C     1 
ATOM   1302 O  O     . LYS A 1 171 ? 79.064 -6.456  9.241   1.00 16.51 ? 168 LYS A O     1 
ATOM   1303 C  CB    . LYS A 1 171 ? 79.003 -3.388  10.367  1.00 23.19 ? 168 LYS A CB    1 
ATOM   1304 C  CG    . LYS A 1 171 ? 78.739 -2.003  9.794   1.00 29.11 ? 168 LYS A CG    1 
ATOM   1305 C  CD    . LYS A 1 171 ? 79.992 -1.140  9.874   1.00 32.58 ? 168 LYS A CD    1 
ATOM   1306 C  CE    . LYS A 1 171 ? 79.768 0.239   9.273   1.00 38.78 ? 168 LYS A CE    1 
ATOM   1307 N  NZ    . LYS A 1 171 ? 78.884 1.085   10.120  1.00 36.45 ? 168 LYS A NZ    1 
ATOM   1308 N  N     . GLN A 1 172 ? 78.461 -6.346  11.403  1.00 18.98 ? 169 GLN A N     1 
ATOM   1309 C  CA    . GLN A 1 172 ? 78.962 -7.684  11.701  1.00 21.96 ? 169 GLN A CA    1 
ATOM   1310 C  C     . GLN A 1 172 ? 78.245 -8.738  10.861  1.00 19.83 ? 169 GLN A C     1 
ATOM   1311 O  O     . GLN A 1 172 ? 78.874 -9.651  10.327  1.00 16.51 ? 169 GLN A O     1 
ATOM   1312 C  CB    . GLN A 1 172 ? 78.824 -8.013  13.189  1.00 22.03 ? 169 GLN A CB    1 
ATOM   1313 C  CG    . GLN A 1 172 ? 79.817 -7.292  14.083  1.00 35.57 ? 169 GLN A CG    1 
ATOM   1314 C  CD    . GLN A 1 172 ? 79.990 -7.974  15.427  1.00 46.67 ? 169 GLN A CD    1 
ATOM   1315 O  OE1   . GLN A 1 172 ? 79.415 -9.035  15.677  1.00 48.96 ? 169 GLN A OE1   1 
ATOM   1316 N  NE2   . GLN A 1 172 ? 80.789 -7.371  16.300  1.00 48.84 ? 169 GLN A NE2   1 
ATOM   1317 N  N     . GLY A 1 173 ? 76.927 -8.604  10.749  1.00 19.41 ? 170 GLY A N     1 
ATOM   1318 C  CA    . GLY A 1 173 ? 76.138 -9.525  9.953   1.00 16.77 ? 170 GLY A CA    1 
ATOM   1319 C  C     . GLY A 1 173 ? 76.505 -9.453  8.485   1.00 13.97 ? 170 GLY A C     1 
ATOM   1320 O  O     . GLY A 1 173 ? 76.683 -10.476 7.823   1.00 15.17 ? 170 GLY A O     1 
ATOM   1321 N  N     . LEU A 1 174 ? 76.615 -8.231  7.975   1.00 15.41 ? 171 LEU A N     1 
ATOM   1322 C  CA    . LEU A 1 174 ? 76.980 -8.010  6.584   1.00 16.39 ? 171 LEU A CA    1 
ATOM   1323 C  C     . LEU A 1 174 ? 78.345 -8.618  6.289   1.00 18.06 ? 171 LEU A C     1 
ATOM   1324 O  O     . LEU A 1 174 ? 78.538 -9.256  5.255   1.00 15.98 ? 171 LEU A O     1 
ATOM   1325 C  CB    . LEU A 1 174 ? 76.990 -6.513  6.267   1.00 15.25 ? 171 LEU A CB    1 
ATOM   1326 C  CG    . LEU A 1 174 ? 77.367 -6.111  4.841   1.00 15.36 ? 171 LEU A CG    1 
ATOM   1327 C  CD1   . LEU A 1 174 ? 76.492 -6.837  3.831   1.00 15.85 ? 171 LEU A CD1   1 
ATOM   1328 C  CD2   . LEU A 1 174 ? 77.262 -4.600  4.662   1.00 17.12 ? 171 LEU A CD2   1 
ATOM   1329 N  N     . PHE A 1 175 ? 79.287 -8.416  7.205   1.00 18.67 ? 172 PHE A N     1 
ATOM   1330 C  CA    . PHE A 1 175 ? 80.634 -8.960  7.058   1.00 23.63 ? 172 PHE A CA    1 
ATOM   1331 C  C     . PHE A 1 175 ? 80.620 -10.483 6.945   1.00 19.74 ? 172 PHE A C     1 
ATOM   1332 O  O     . PHE A 1 175 ? 81.227 -11.048 6.038   1.00 21.51 ? 172 PHE A O     1 
ATOM   1333 C  CB    . PHE A 1 175 ? 81.522 -8.522  8.224   1.00 21.00 ? 172 PHE A CB    1 
ATOM   1334 C  CG    . PHE A 1 175 ? 81.992 -7.097  8.129   1.00 27.42 ? 172 PHE A CG    1 
ATOM   1335 C  CD1   . PHE A 1 175 ? 82.140 -6.482  6.896   1.00 30.90 ? 172 PHE A CD1   1 
ATOM   1336 C  CD2   . PHE A 1 175 ? 82.289 -6.373  9.273   1.00 30.97 ? 172 PHE A CD2   1 
ATOM   1337 C  CE1   . PHE A 1 175 ? 82.573 -5.171  6.805   1.00 30.83 ? 172 PHE A CE1   1 
ATOM   1338 C  CE2   . PHE A 1 175 ? 82.724 -5.061  9.189   1.00 35.37 ? 172 PHE A CE2   1 
ATOM   1339 C  CZ    . PHE A 1 175 ? 82.865 -4.460  7.953   1.00 33.66 ? 172 PHE A CZ    1 
ATOM   1340 N  N     . GLN A 1 176 ? 79.930 -11.143 7.872   1.00 20.36 ? 173 GLN A N     1 
ATOM   1341 C  CA    . GLN A 1 176 ? 79.815 -12.599 7.840   1.00 20.24 ? 173 GLN A CA    1 
ATOM   1342 C  C     . GLN A 1 176 ? 79.228 -13.068 6.514   1.00 20.49 ? 173 GLN A C     1 
ATOM   1343 O  O     . GLN A 1 176 ? 79.686 -14.050 5.932   1.00 17.32 ? 173 GLN A O     1 
ATOM   1344 C  CB    . GLN A 1 176 ? 78.954 -13.107 9.001   1.00 20.65 ? 173 GLN A CB    1 
ATOM   1345 C  CG    . GLN A 1 176 ? 79.528 -12.823 10.381  1.00 22.43 ? 173 GLN A CG    1 
ATOM   1346 C  CD    . GLN A 1 176 ? 78.722 -13.466 11.495  1.00 22.36 ? 173 GLN A CD    1 
ATOM   1347 O  OE1   . GLN A 1 176 ? 77.645 -14.013 11.262  1.00 23.73 ? 173 GLN A OE1   1 
ATOM   1348 N  NE2   . GLN A 1 176 ? 79.246 -13.409 12.713  1.00 25.54 ? 173 GLN A NE2   1 
ATOM   1349 N  N     . TRP A 1 177 ? 78.212 -12.354 6.041   1.00 18.26 ? 174 TRP A N     1 
ATOM   1350 C  CA    . TRP A 1 177 ? 77.546 -12.693 4.788   1.00 16.11 ? 174 TRP A CA    1 
ATOM   1351 C  C     . TRP A 1 177 ? 78.509 -12.616 3.610   1.00 18.54 ? 174 TRP A C     1 
ATOM   1352 O  O     . TRP A 1 177 ? 78.651 -13.573 2.846   1.00 17.55 ? 174 TRP A O     1 
ATOM   1353 C  CB    . TRP A 1 177 ? 76.354 -11.761 4.558   1.00 12.79 ? 174 TRP A CB    1 
ATOM   1354 C  CG    . TRP A 1 177 ? 75.700 -11.916 3.217   1.00 15.76 ? 174 TRP A CG    1 
ATOM   1355 C  CD1   . TRP A 1 177 ? 75.834 -11.088 2.141   1.00 13.92 ? 174 TRP A CD1   1 
ATOM   1356 C  CD2   . TRP A 1 177 ? 74.804 -12.959 2.812   1.00 15.06 ? 174 TRP A CD2   1 
ATOM   1357 N  NE1   . TRP A 1 177 ? 75.078 -11.549 1.091   1.00 15.29 ? 174 TRP A NE1   1 
ATOM   1358 C  CE2   . TRP A 1 177 ? 74.437 -12.696 1.475   1.00 15.44 ? 174 TRP A CE2   1 
ATOM   1359 C  CE3   . TRP A 1 177 ? 74.279 -14.089 3.446   1.00 14.47 ? 174 TRP A CE3   1 
ATOM   1360 C  CZ2   . TRP A 1 177 ? 73.569 -13.523 0.764   1.00 13.16 ? 174 TRP A CZ2   1 
ATOM   1361 C  CZ3   . TRP A 1 177 ? 73.416 -14.908 2.738   1.00 15.97 ? 174 TRP A CZ3   1 
ATOM   1362 C  CH2   . TRP A 1 177 ? 73.069 -14.620 1.410   1.00 12.21 ? 174 TRP A CH2   1 
ATOM   1363 N  N     . LEU A 1 178 ? 79.170 -11.473 3.468   1.00 18.59 ? 175 LEU A N     1 
ATOM   1364 C  CA    . LEU A 1 178 ? 80.106 -11.265 2.368   1.00 19.61 ? 175 LEU A CA    1 
ATOM   1365 C  C     . LEU A 1 178 ? 81.290 -12.224 2.451   1.00 23.67 ? 175 LEU A C     1 
ATOM   1366 O  O     . LEU A 1 178 ? 81.765 -12.722 1.430   1.00 25.63 ? 175 LEU A O     1 
ATOM   1367 C  CB    . LEU A 1 178 ? 80.595 -9.815  2.346   1.00 17.39 ? 175 LEU A CB    1 
ATOM   1368 C  CG    . LEU A 1 178 ? 79.505 -8.762  2.127   1.00 17.99 ? 175 LEU A CG    1 
ATOM   1369 C  CD1   . LEU A 1 178 ? 80.066 -7.357  2.284   1.00 20.36 ? 175 LEU A CD1   1 
ATOM   1370 C  CD2   . LEU A 1 178 ? 78.857 -8.939  0.761   1.00 17.47 ? 175 LEU A CD2   1 
ATOM   1371 N  N     . ASP A 1 179 ? 81.759 -12.480 3.669   1.00 21.10 ? 176 ASP A N     1 
ATOM   1372 C  CA    . ASP A 1 179 ? 82.896 -13.371 3.883   1.00 27.99 ? 176 ASP A CA    1 
ATOM   1373 C  C     . ASP A 1 179 ? 82.615 -14.792 3.404   1.00 30.42 ? 176 ASP A C     1 
ATOM   1374 O  O     . ASP A 1 179 ? 83.540 -15.543 3.097   1.00 33.96 ? 176 ASP A O     1 
ATOM   1375 C  CB    . ASP A 1 179 ? 83.305 -13.391 5.360   1.00 27.67 ? 176 ASP A CB    1 
ATOM   1376 C  CG    . ASP A 1 179 ? 84.024 -12.125 5.785   1.00 36.18 ? 176 ASP A CG    1 
ATOM   1377 O  OD1   . ASP A 1 179 ? 84.560 -11.421 4.903   1.00 38.15 ? 176 ASP A OD1   1 
ATOM   1378 O  OD2   . ASP A 1 179 ? 84.059 -11.837 7.001   1.00 40.56 ? 176 ASP A OD2   1 
ATOM   1379 N  N     . SER A 1 180 ? 81.337 -15.154 3.341   1.00 26.88 ? 177 SER A N     1 
ATOM   1380 C  CA    . SER A 1 180 ? 80.944 -16.503 2.945   1.00 29.82 ? 177 SER A CA    1 
ATOM   1381 C  C     . SER A 1 180 ? 80.496 -16.583 1.489   1.00 31.97 ? 177 SER A C     1 
ATOM   1382 O  O     . SER A 1 180 ? 80.209 -17.668 0.980   1.00 31.49 ? 177 SER A O     1 
ATOM   1383 C  CB    . SER A 1 180 ? 79.831 -17.025 3.858   1.00 27.27 ? 177 SER A CB    1 
ATOM   1384 O  OG    . SER A 1 180 ? 80.270 -17.102 5.203   1.00 38.52 ? 177 SER A OG    1 
ATOM   1385 N  N     . LEU A 1 181 ? 80.433 -15.436 0.821   1.00 24.27 ? 178 LEU A N     1 
ATOM   1386 C  CA    . LEU A 1 181 ? 79.977 -15.393 -0.565  1.00 24.80 ? 178 LEU A CA    1 
ATOM   1387 C  C     . LEU A 1 181 ? 80.970 -16.026 -1.533  1.00 33.41 ? 178 LEU A C     1 
ATOM   1388 O  O     . LEU A 1 181 ? 82.180 -16.012 -1.302  1.00 30.17 ? 178 LEU A O     1 
ATOM   1389 C  CB    . LEU A 1 181 ? 79.685 -13.954 -0.998  1.00 27.63 ? 178 LEU A CB    1 
ATOM   1390 C  CG    . LEU A 1 181 ? 78.274 -13.430 -0.733  1.00 20.75 ? 178 LEU A CG    1 
ATOM   1391 C  CD1   . LEU A 1 181 ? 78.086 -12.059 -1.372  1.00 17.85 ? 178 LEU A CD1   1 
ATOM   1392 C  CD2   . LEU A 1 181 ? 77.243 -14.414 -1.267  1.00 18.39 ? 178 LEU A CD2   1 
ATOM   1393 N  N     . GLN A 1 182 ? 80.447 -16.582 -2.620  1.00 35.47 ? 179 GLN A N     1 
ATOM   1394 C  CA    . GLN A 1 182 ? 81.289 -17.112 -3.683  1.00 41.70 ? 179 GLN A CA    1 
ATOM   1395 C  C     . GLN A 1 182 ? 81.082 -16.307 -4.960  1.00 43.85 ? 179 GLN A C     1 
ATOM   1396 O  O     . GLN A 1 182 ? 80.288 -16.684 -5.822  1.00 45.37 ? 179 GLN A O     1 
ATOM   1397 C  CB    . GLN A 1 182 ? 80.991 -18.592 -3.932  1.00 41.94 ? 179 GLN A CB    1 
ATOM   1398 C  CG    . GLN A 1 182 ? 81.949 -19.254 -4.912  1.00 47.70 ? 179 GLN A CG    1 
ATOM   1399 C  CD    . GLN A 1 182 ? 83.404 -19.076 -4.514  1.00 52.91 ? 179 GLN A CD    1 
ATOM   1400 O  OE1   . GLN A 1 182 ? 84.034 -18.072 -4.853  1.00 51.69 ? 179 GLN A OE1   1 
ATOM   1401 N  NE2   . GLN A 1 182 ? 83.944 -20.049 -3.790  1.00 54.70 ? 179 GLN A NE2   1 
ATOM   1402 N  N     . ILE A 1 183 ? 81.801 -15.194 -5.070  1.00 41.52 ? 180 ILE A N     1 
ATOM   1403 C  CA    . ILE A 1 183 ? 81.684 -14.311 -6.226  1.00 46.41 ? 180 ILE A CA    1 
ATOM   1404 C  C     . ILE A 1 183 ? 82.193 -14.974 -7.503  1.00 46.46 ? 180 ILE A C     1 
ATOM   1405 O  O     . ILE A 1 183 ? 82.194 -14.368 -8.576  1.00 43.89 ? 180 ILE A O     1 
ATOM   1406 C  CB    . ILE A 1 183 ? 82.421 -12.973 -5.995  1.00 44.91 ? 180 ILE A CB    1 
ATOM   1407 C  CG1   . ILE A 1 183 ? 83.753 -13.206 -5.275  1.00 45.53 ? 180 ILE A CG1   1 
ATOM   1408 C  CG2   . ILE A 1 183 ? 81.556 -12.026 -5.179  1.00 43.67 ? 180 ILE A CG2   1 
ATOM   1409 C  CD1   . ILE A 1 183 ? 84.793 -13.938 -6.098  1.00 48.02 ? 180 ILE A CD1   1 
ATOM   1410 N  N     . ASP A 1 184 ? 82.622 -16.225 -7.375  1.00 50.22 ? 181 ASP A N     1 
ATOM   1411 C  CA    . ASP A 1 184 ? 83.145 -16.988 -8.500  1.00 51.25 ? 181 ASP A CA    1 
ATOM   1412 C  C     . ASP A 1 184 ? 82.017 -17.604 -9.325  1.00 48.58 ? 181 ASP A C     1 
ATOM   1413 O  O     . ASP A 1 184 ? 82.171 -17.845 -10.522 1.00 39.43 ? 181 ASP A O     1 
ATOM   1414 C  CB    . ASP A 1 184 ? 84.088 -18.083 -7.996  1.00 52.30 ? 181 ASP A CB    1 
ATOM   1415 C  CG    . ASP A 1 184 ? 84.691 -18.898 -9.121  1.00 62.90 ? 181 ASP A CG    1 
ATOM   1416 O  OD1   . ASP A 1 184 ? 84.874 -18.347 -10.227 1.00 64.51 ? 181 ASP A OD1   1 
ATOM   1417 O  OD2   . ASP A 1 184 ? 84.984 -20.092 -8.896  1.00 69.56 ? 181 ASP A OD2   1 
ATOM   1418 N  N     . ASN A 1 185 ? 80.883 -17.853 -8.678  1.00 44.65 ? 182 ASN A N     1 
ATOM   1419 C  CA    . ASN A 1 185 ? 79.742 -18.473 -9.342  1.00 41.96 ? 182 ASN A CA    1 
ATOM   1420 C  C     . ASN A 1 185 ? 78.663 -17.460 -9.717  1.00 41.34 ? 182 ASN A C     1 
ATOM   1421 O  O     . ASN A 1 185 ? 78.015 -16.879 -8.846  1.00 36.95 ? 182 ASN A O     1 
ATOM   1422 C  CB    . ASN A 1 185 ? 79.149 -19.576 -8.460  1.00 36.94 ? 182 ASN A CB    1 
ATOM   1423 C  CG    . ASN A 1 185 ? 78.009 -20.312 -9.135  1.00 40.25 ? 182 ASN A CG    1 
ATOM   1424 O  OD1   . ASN A 1 185 ? 77.855 -20.258 -10.356 1.00 37.74 ? 182 ASN A OD1   1 
ATOM   1425 N  ND2   . ASN A 1 185 ? 77.203 -21.009 -8.341  1.00 37.08 ? 182 ASN A ND2   1 
ATOM   1426 N  N     . LEU A 1 186 ? 78.472 -17.258 -11.017 1.00 38.86 ? 183 LEU A N     1 
ATOM   1427 C  CA    . LEU A 1 186 ? 77.497 -16.286 -11.507 1.00 37.01 ? 183 LEU A CA    1 
ATOM   1428 C  C     . LEU A 1 186 ? 76.054 -16.777 -11.393 1.00 36.26 ? 183 LEU A C     1 
ATOM   1429 O  O     . LEU A 1 186 ? 75.114 -16.017 -11.629 1.00 34.28 ? 183 LEU A O     1 
ATOM   1430 C  CB    . LEU A 1 186 ? 77.806 -15.887 -12.953 1.00 36.77 ? 183 LEU A CB    1 
ATOM   1431 C  CG    . LEU A 1 186 ? 78.814 -14.753 -13.162 1.00 45.16 ? 183 LEU A CG    1 
ATOM   1432 C  CD1   . LEU A 1 186 ? 80.181 -15.116 -12.597 1.00 50.15 ? 183 LEU A CD1   1 
ATOM   1433 C  CD2   . LEU A 1 186 ? 78.918 -14.394 -14.636 1.00 44.81 ? 183 LEU A CD2   1 
ATOM   1434 N  N     . THR A 1 187 ? 75.880 -18.045 -11.034 1.00 36.63 ? 184 THR A N     1 
ATOM   1435 C  CA    . THR A 1 187 ? 74.543 -18.605 -10.866 1.00 33.75 ? 184 THR A CA    1 
ATOM   1436 C  C     . THR A 1 187 ? 74.199 -18.828 -9.395  1.00 29.16 ? 184 THR A C     1 
ATOM   1437 O  O     . THR A 1 187 ? 73.140 -19.367 -9.076  1.00 29.11 ? 184 THR A O     1 
ATOM   1438 C  CB    . THR A 1 187 ? 74.371 -19.933 -11.638 1.00 36.47 ? 184 THR A CB    1 
ATOM   1439 O  OG1   . THR A 1 187 ? 75.315 -20.899 -11.158 1.00 38.28 ? 184 THR A OG1   1 
ATOM   1440 C  CG2   . THR A 1 187 ? 74.582 -19.717 -13.129 1.00 39.13 ? 184 THR A CG2   1 
ATOM   1441 N  N     . SER A 1 188 ? 75.095 -18.415 -8.504  1.00 26.90 ? 185 SER A N     1 
ATOM   1442 C  CA    . SER A 1 188 ? 74.848 -18.533 -7.069  1.00 25.19 ? 185 SER A CA    1 
ATOM   1443 C  C     . SER A 1 188 ? 73.708 -17.620 -6.632  1.00 19.96 ? 185 SER A C     1 
ATOM   1444 O  O     . SER A 1 188 ? 73.809 -16.398 -6.744  1.00 17.01 ? 185 SER A O     1 
ATOM   1445 C  CB    . SER A 1 188 ? 76.108 -18.202 -6.270  1.00 26.15 ? 185 SER A CB    1 
ATOM   1446 O  OG    . SER A 1 188 ? 75.829 -18.173 -4.879  1.00 23.16 ? 185 SER A OG    1 
ATOM   1447 N  N     . PRO A 1 189 ? 72.617 -18.215 -6.132  1.00 19.48 ? 186 PRO A N     1 
ATOM   1448 C  CA    . PRO A 1 189 ? 71.452 -17.462 -5.656  1.00 14.41 ? 186 PRO A CA    1 
ATOM   1449 C  C     . PRO A 1 189 ? 71.820 -16.424 -4.600  1.00 13.08 ? 186 PRO A C     1 
ATOM   1450 O  O     . PRO A 1 189 ? 71.309 -15.307 -4.651  1.00 11.94 ? 186 PRO A O     1 
ATOM   1451 C  CB    . PRO A 1 189 ? 70.565 -18.549 -5.045  1.00 17.52 ? 186 PRO A CB    1 
ATOM   1452 C  CG    . PRO A 1 189 ? 70.925 -19.783 -5.805  1.00 17.01 ? 186 PRO A CG    1 
ATOM   1453 C  CD    . PRO A 1 189 ? 72.402 -19.671 -6.059  1.00 18.91 ? 186 PRO A CD    1 
ATOM   1454 N  N     . ASP A 1 190 ? 72.690 -16.784 -3.660  1.00 12.53 ? 187 ASP A N     1 
ATOM   1455 C  CA    . ASP A 1 190 ? 73.094 -15.855 -2.609  1.00 12.36 ? 187 ASP A CA    1 
ATOM   1456 C  C     . ASP A 1 190 ? 73.831 -14.655 -3.189  1.00 11.86 ? 187 ASP A C     1 
ATOM   1457 O  O     . ASP A 1 190 ? 73.652 -13.523 -2.735  1.00 11.45 ? 187 ASP A O     1 
ATOM   1458 C  CB    . ASP A 1 190 ? 73.970 -16.551 -1.567  1.00 15.59 ? 187 ASP A CB    1 
ATOM   1459 C  CG    . ASP A 1 190 ? 73.183 -17.494 -0.681  1.00 17.06 ? 187 ASP A CG    1 
ATOM   1460 O  OD1   . ASP A 1 190 ? 71.936 -17.459 -0.733  1.00 11.76 ? 187 ASP A OD1   1 
ATOM   1461 O  OD2   . ASP A 1 190 ? 73.813 -18.262 0.075   1.00 16.60 ? 187 ASP A OD2   1 
ATOM   1462 N  N     . LEU A 1 191 ? 74.667 -14.912 -4.189  1.00 13.51 ? 188 LEU A N     1 
ATOM   1463 C  CA    . LEU A 1 191 ? 75.372 -13.844 -4.879  1.00 15.69 ? 188 LEU A CA    1 
ATOM   1464 C  C     . LEU A 1 191 ? 74.381 -12.960 -5.627  1.00 10.58 ? 188 LEU A C     1 
ATOM   1465 O  O     . LEU A 1 191 ? 74.473 -11.736 -5.585  1.00 10.90 ? 188 LEU A O     1 
ATOM   1466 C  CB    . LEU A 1 191 ? 76.401 -14.421 -5.853  1.00 15.91 ? 188 LEU A CB    1 
ATOM   1467 C  CG    . LEU A 1 191 ? 77.225 -13.390 -6.627  1.00 20.39 ? 188 LEU A CG    1 
ATOM   1468 C  CD1   . LEU A 1 191 ? 77.944 -12.458 -5.668  1.00 18.70 ? 188 LEU A CD1   1 
ATOM   1469 C  CD2   . LEU A 1 191 ? 78.215 -14.078 -7.557  1.00 24.07 ? 188 LEU A CD2   1 
ATOM   1470 N  N     . GLN A 1 192 ? 73.436 -13.591 -6.316  1.00 10.47 ? 189 GLN A N     1 
ATOM   1471 C  CA    . GLN A 1 192 ? 72.413 -12.861 -7.056  1.00 13.02 ? 189 GLN A CA    1 
ATOM   1472 C  C     . GLN A 1 192 ? 71.600 -11.947 -6.138  1.00 11.95 ? 189 GLN A C     1 
ATOM   1473 O  O     . GLN A 1 192 ? 71.328 -10.798 -6.485  1.00 10.27 ? 189 GLN A O     1 
ATOM   1474 C  CB    . GLN A 1 192 ? 71.502 -13.832 -7.813  1.00 13.11 ? 189 GLN A CB    1 
ATOM   1475 C  CG    . GLN A 1 192 ? 72.206 -14.570 -8.947  1.00 19.40 ? 189 GLN A CG    1 
ATOM   1476 C  CD    . GLN A 1 192 ? 71.361 -15.677 -9.546  1.00 23.75 ? 189 GLN A CD    1 
ATOM   1477 O  OE1   . GLN A 1 192 ? 70.346 -16.077 -8.975  1.00 24.43 ? 189 GLN A OE1   1 
ATOM   1478 N  NE2   . GLN A 1 192 ? 71.777 -16.180 -10.703 1.00 29.37 ? 189 GLN A NE2   1 
ATOM   1479 N  N     . LEU A 1 193 ? 71.224 -12.457 -4.968  1.00 10.14 ? 190 LEU A N     1 
ATOM   1480 C  CA    . LEU A 1 193 ? 70.501 -11.653 -3.982  1.00 10.24 ? 190 LEU A CA    1 
ATOM   1481 C  C     . LEU A 1 193 ? 71.327 -10.449 -3.540  1.00 11.11 ? 190 LEU A C     1 
ATOM   1482 O  O     . LEU A 1 193 ? 70.799 -9.350  -3.365  1.00 9.31  ? 190 LEU A O     1 
ATOM   1483 C  CB    . LEU A 1 193 ? 70.118 -12.496 -2.760  1.00 11.28 ? 190 LEU A CB    1 
ATOM   1484 C  CG    . LEU A 1 193 ? 69.000 -13.524 -2.944  1.00 9.79  ? 190 LEU A CG    1 
ATOM   1485 C  CD1   . LEU A 1 193 ? 68.681 -14.205 -1.624  1.00 10.66 ? 190 LEU A CD1   1 
ATOM   1486 C  CD2   . LEU A 1 193 ? 67.759 -12.852 -3.510  1.00 9.40  ? 190 LEU A CD2   1 
ATOM   1487 N  N     . THR A 1 194 ? 72.625 -10.666 -3.363  1.00 12.02 ? 191 THR A N     1 
ATOM   1488 C  CA    . THR A 1 194 ? 73.530 -9.620  -2.906  1.00 10.23 ? 191 THR A CA    1 
ATOM   1489 C  C     . THR A 1 194 ? 73.629 -8.492  -3.931  1.00 11.12 ? 191 THR A C     1 
ATOM   1490 O  O     . THR A 1 194 ? 73.571 -7.313  -3.579  1.00 11.81 ? 191 THR A O     1 
ATOM   1491 C  CB    . THR A 1 194 ? 74.936 -10.187 -2.618  1.00 12.35 ? 191 THR A CB    1 
ATOM   1492 O  OG1   . THR A 1 194 ? 74.837 -11.246 -1.657  1.00 13.72 ? 191 THR A OG1   1 
ATOM   1493 C  CG2   . THR A 1 194 ? 75.852 -9.102  -2.076  1.00 11.02 ? 191 THR A CG2   1 
ATOM   1494 N  N     . VAL A 1 195 ? 73.778 -8.858  -5.199  1.00 12.27 ? 192 VAL A N     1 
ATOM   1495 C  CA    . VAL A 1 195 ? 73.839 -7.871  -6.269  1.00 14.51 ? 192 VAL A CA    1 
ATOM   1496 C  C     . VAL A 1 195 ? 72.497 -7.159  -6.385  1.00 11.48 ? 192 VAL A C     1 
ATOM   1497 O  O     . VAL A 1 195 ? 72.438 -5.959  -6.662  1.00 11.38 ? 192 VAL A O     1 
ATOM   1498 C  CB    . VAL A 1 195 ? 74.220 -8.518  -7.616  1.00 14.40 ? 192 VAL A CB    1 
ATOM   1499 C  CG1   . VAL A 1 195 ? 74.036 -7.529  -8.760  1.00 14.40 ? 192 VAL A CG1   1 
ATOM   1500 C  CG2   . VAL A 1 195 ? 75.653 -9.025  -7.566  1.00 11.45 ? 192 VAL A CG2   1 
ATOM   1501 N  N     . GLY A 1 196 ? 71.419 -7.904  -6.161  1.00 10.53 ? 193 GLY A N     1 
ATOM   1502 C  CA    . GLY A 1 196 ? 70.094 -7.317  -6.119  1.00 9.54  ? 193 GLY A CA    1 
ATOM   1503 C  C     . GLY A 1 196 ? 70.036 -6.199  -5.096  1.00 9.93  ? 193 GLY A C     1 
ATOM   1504 O  O     . GLY A 1 196 ? 69.502 -5.123  -5.368  1.00 10.48 ? 193 GLY A O     1 
ATOM   1505 N  N     . ALA A 1 197 ? 70.600 -6.449  -3.916  1.00 8.87  ? 194 ALA A N     1 
ATOM   1506 C  CA    . ALA A 1 197 ? 70.603 -5.457  -2.844  1.00 9.32  ? 194 ALA A CA    1 
ATOM   1507 C  C     . ALA A 1 197 ? 71.455 -4.238  -3.201  1.00 10.60 ? 194 ALA A C     1 
ATOM   1508 O  O     . ALA A 1 197 ? 71.132 -3.113  -2.820  1.00 10.01 ? 194 ALA A O     1 
ATOM   1509 C  CB    . ALA A 1 197 ? 71.076 -6.080  -1.535  1.00 12.17 ? 194 ALA A CB    1 
ATOM   1510 N  N     . VAL A 1 198 ? 72.545 -4.465  -3.927  1.00 9.29  ? 195 VAL A N     1 
ATOM   1511 C  CA    . VAL A 1 198 ? 73.382 -3.366  -4.394  1.00 9.20  ? 195 VAL A CA    1 
ATOM   1512 C  C     . VAL A 1 198 ? 72.550 -2.431  -5.270  1.00 10.94 ? 195 VAL A C     1 
ATOM   1513 O  O     . VAL A 1 198 ? 72.585 -1.211  -5.110  1.00 11.72 ? 195 VAL A O     1 
ATOM   1514 C  CB    . VAL A 1 198 ? 74.592 -3.878  -5.201  1.00 14.07 ? 195 VAL A CB    1 
ATOM   1515 C  CG1   . VAL A 1 198 ? 75.355 -2.713  -5.818  1.00 16.12 ? 195 VAL A CG1   1 
ATOM   1516 C  CG2   . VAL A 1 198 ? 75.506 -4.719  -4.317  1.00 11.97 ? 195 VAL A CG2   1 
ATOM   1517 N  N     . ILE A 1 199 ? 71.791 -3.018  -6.189  1.00 7.66  ? 196 ILE A N     1 
ATOM   1518 C  CA    . ILE A 1 199 ? 70.947 -2.245  -7.092  1.00 12.68 ? 196 ILE A CA    1 
ATOM   1519 C  C     . ILE A 1 199 ? 69.842 -1.507  -6.336  1.00 11.92 ? 196 ILE A C     1 
ATOM   1520 O  O     . ILE A 1 199 ? 69.510 -0.369  -6.663  1.00 11.18 ? 196 ILE A O     1 
ATOM   1521 C  CB    . ILE A 1 199 ? 70.339 -3.135  -8.191  1.00 10.48 ? 196 ILE A CB    1 
ATOM   1522 C  CG1   . ILE A 1 199 ? 71.450 -3.700  -9.082  1.00 12.99 ? 196 ILE A CG1   1 
ATOM   1523 C  CG2   . ILE A 1 199 ? 69.337 -2.353  -9.026  1.00 11.49 ? 196 ILE A CG2   1 
ATOM   1524 C  CD1   . ILE A 1 199 ? 70.968 -4.692  -10.117 1.00 13.74 ? 196 ILE A CD1   1 
ATOM   1525 N  N     . VAL A 1 200 ? 69.286 -2.152  -5.316  1.00 10.14 ? 197 VAL A N     1 
ATOM   1526 C  CA    . VAL A 1 200 ? 68.230 -1.539  -4.516  1.00 10.10 ? 197 VAL A CA    1 
ATOM   1527 C  C     . VAL A 1 200 ? 68.757 -0.354  -3.703  1.00 11.90 ? 197 VAL A C     1 
ATOM   1528 O  O     . VAL A 1 200 ? 68.064 0.653   -3.544  1.00 10.56 ? 197 VAL A O     1 
ATOM   1529 C  CB    . VAL A 1 200 ? 67.533 -2.567  -3.603  1.00 8.38  ? 197 VAL A CB    1 
ATOM   1530 C  CG1   . VAL A 1 200 ? 66.523 -1.878  -2.699  1.00 6.19  ? 197 VAL A CG1   1 
ATOM   1531 C  CG2   . VAL A 1 200 ? 66.851 -3.636  -4.448  1.00 7.98  ? 197 VAL A CG2   1 
ATOM   1532 N  N     . GLU A 1 201 ? 69.985 -0.470  -3.202  1.00 9.61  ? 198 GLU A N     1 
ATOM   1533 C  CA    . GLU A 1 201 ? 70.645 0.664   -2.560  1.00 12.46 ? 198 GLU A CA    1 
ATOM   1534 C  C     . GLU A 1 201 ? 70.671 1.847   -3.526  1.00 12.16 ? 198 GLU A C     1 
ATOM   1535 O  O     . GLU A 1 201 ? 70.333 2.971   -3.158  1.00 12.03 ? 198 GLU A O     1 
ATOM   1536 C  CB    . GLU A 1 201 ? 72.077 0.306   -2.146  1.00 13.58 ? 198 GLU A CB    1 
ATOM   1537 C  CG    . GLU A 1 201 ? 72.195 -0.716  -1.017  1.00 13.81 ? 198 GLU A CG    1 
ATOM   1538 C  CD    . GLU A 1 201 ? 72.113 -0.093  0.365   1.00 14.93 ? 198 GLU A CD    1 
ATOM   1539 O  OE1   . GLU A 1 201 ? 71.817 1.117   0.465   1.00 15.38 ? 198 GLU A OE1   1 
ATOM   1540 O  OE2   . GLU A 1 201 ? 72.350 -0.814  1.356   1.00 13.77 ? 198 GLU A OE2   1 
ATOM   1541 N  N     . GLU A 1 202 ? 71.071 1.577   -4.764  1.00 11.35 ? 199 GLU A N     1 
ATOM   1542 C  CA    . GLU A 1 202 ? 71.136 2.602   -5.799  1.00 11.68 ? 199 GLU A CA    1 
ATOM   1543 C  C     . GLU A 1 202 ? 69.751 3.182   -6.084  1.00 13.12 ? 199 GLU A C     1 
ATOM   1544 O  O     . GLU A 1 202 ? 69.591 4.397   -6.187  1.00 11.03 ? 199 GLU A O     1 
ATOM   1545 C  CB    . GLU A 1 202 ? 71.754 2.030   -7.077  1.00 15.32 ? 199 GLU A CB    1 
ATOM   1546 C  CG    . GLU A 1 202 ? 73.189 1.556   -6.898  1.00 16.30 ? 199 GLU A CG    1 
ATOM   1547 C  CD    . GLU A 1 202 ? 73.730 0.819   -8.112  1.00 22.00 ? 199 GLU A CD    1 
ATOM   1548 O  OE1   . GLU A 1 202 ? 74.942 0.517   -8.128  1.00 22.76 ? 199 GLU A OE1   1 
ATOM   1549 O  OE2   . GLU A 1 202 ? 72.947 0.539   -9.045  1.00 25.06 ? 199 GLU A OE2   1 
ATOM   1550 N  N     . MET A 1 203 ? 68.757 2.307   -6.208  1.00 9.74  ? 200 MET A N     1 
ATOM   1551 C  CA    A MET A 1 203 ? 67.385 2.742   -6.437  0.50 12.36 ? 200 MET A CA    1 
ATOM   1552 C  CA    B MET A 1 203 ? 67.376 2.731   -6.426  0.50 12.38 ? 200 MET A CA    1 
ATOM   1553 C  C     . MET A 1 203 ? 66.899 3.636   -5.298  1.00 10.17 ? 200 MET A C     1 
ATOM   1554 O  O     . MET A 1 203 ? 66.344 4.708   -5.536  1.00 11.25 ? 200 MET A O     1 
ATOM   1555 C  CB    A MET A 1 203 ? 66.458 1.535   -6.602  0.50 11.39 ? 200 MET A CB    1 
ATOM   1556 C  CB    B MET A 1 203 ? 66.447 1.519   -6.519  0.50 11.28 ? 200 MET A CB    1 
ATOM   1557 C  CG    A MET A 1 203 ? 65.018 1.898   -6.929  0.50 12.86 ? 200 MET A CG    1 
ATOM   1558 C  CG    B MET A 1 203 ? 66.761 0.559   -7.647  0.50 12.33 ? 200 MET A CG    1 
ATOM   1559 S  SD    A MET A 1 203 ? 63.941 0.457   -7.077  0.50 17.41 ? 200 MET A SD    1 
ATOM   1560 S  SD    B MET A 1 203 ? 65.584 -0.808  -7.702  0.50 18.01 ? 200 MET A SD    1 
ATOM   1561 C  CE    A MET A 1 203 ? 64.681 -0.394  -8.465  0.50 15.43 ? 200 MET A CE    1 
ATOM   1562 C  CE    B MET A 1 203 ? 64.058 0.081   -8.010  0.50 13.26 ? 200 MET A CE    1 
ATOM   1563 N  N     . ARG A 1 204 ? 67.112 3.189   -4.065  1.00 9.07  ? 201 ARG A N     1 
ATOM   1564 C  CA    . ARG A 1 204 ? 66.684 3.942   -2.891  1.00 10.61 ? 201 ARG A CA    1 
ATOM   1565 C  C     . ARG A 1 204 ? 67.421 5.273   -2.755  1.00 10.96 ? 201 ARG A C     1 
ATOM   1566 O  O     . ARG A 1 204 ? 66.849 6.260   -2.298  1.00 9.80  ? 201 ARG A O     1 
ATOM   1567 C  CB    . ARG A 1 204 ? 66.826 3.094   -1.620  1.00 11.97 ? 201 ARG A CB    1 
ATOM   1568 C  CG    . ARG A 1 204 ? 65.854 1.917   -1.569  1.00 8.37  ? 201 ARG A CG    1 
ATOM   1569 C  CD    . ARG A 1 204 ? 66.016 1.088   -0.300  1.00 9.89  ? 201 ARG A CD    1 
ATOM   1570 N  NE    . ARG A 1 204 ? 66.044 1.921   0.899   1.00 10.45 ? 201 ARG A NE    1 
ATOM   1571 C  CZ    . ARG A 1 204 ? 67.103 2.056   1.690   1.00 11.24 ? 201 ARG A CZ    1 
ATOM   1572 N  NH1   . ARG A 1 204 ? 67.042 2.840   2.759   1.00 9.17  ? 201 ARG A NH1   1 
ATOM   1573 N  NH2   . ARG A 1 204 ? 68.223 1.401   1.417   1.00 11.69 ? 201 ARG A NH2   1 
ATOM   1574 N  N     . ALA A 1 205 ? 68.685 5.304   -3.166  1.00 9.97  ? 202 ALA A N     1 
ATOM   1575 C  CA    . ALA A 1 205 ? 69.452 6.545   -3.145  1.00 11.60 ? 202 ALA A CA    1 
ATOM   1576 C  C     . ALA A 1 205 ? 68.885 7.549   -4.149  1.00 9.90  ? 202 ALA A C     1 
ATOM   1577 O  O     . ALA A 1 205 ? 68.759 8.737   -3.851  1.00 9.91  ? 202 ALA A O     1 
ATOM   1578 C  CB    . ALA A 1 205 ? 70.923 6.273   -3.428  1.00 12.75 ? 202 ALA A CB    1 
ATOM   1579 N  N     . ALA A 1 206 ? 68.538 7.063   -5.337  1.00 9.29  ? 203 ALA A N     1 
ATOM   1580 C  CA    . ALA A 1 206 ? 67.982 7.921   -6.376  1.00 11.47 ? 203 ALA A CA    1 
ATOM   1581 C  C     . ALA A 1 206 ? 66.623 8.479   -5.961  1.00 11.09 ? 203 ALA A C     1 
ATOM   1582 O  O     . ALA A 1 206 ? 66.307 9.642   -6.226  1.00 9.93  ? 203 ALA A O     1 
ATOM   1583 C  CB    . ALA A 1 206 ? 67.867 7.159   -7.687  1.00 12.79 ? 203 ALA A CB    1 
ATOM   1584 N  N     . ILE A 1 207 ? 65.817 7.645   -5.313  1.00 7.96  ? 204 ILE A N     1 
ATOM   1585 C  CA    . ILE A 1 207 ? 64.516 8.087   -4.829  1.00 9.69  ? 204 ILE A CA    1 
ATOM   1586 C  C     . ILE A 1 207 ? 64.677 9.237   -3.841  1.00 8.77  ? 204 ILE A C     1 
ATOM   1587 O  O     . ILE A 1 207 ? 63.998 10.255  -3.956  1.00 6.45  ? 204 ILE A O     1 
ATOM   1588 C  CB    . ILE A 1 207 ? 63.717 6.943   -4.171  1.00 9.18  ? 204 ILE A CB    1 
ATOM   1589 C  CG1   . ILE A 1 207 ? 63.338 5.893   -5.217  1.00 7.25  ? 204 ILE A CG1   1 
ATOM   1590 C  CG2   . ILE A 1 207 ? 62.460 7.491   -3.498  1.00 7.41  ? 204 ILE A CG2   1 
ATOM   1591 C  CD1   . ILE A 1 207 ? 62.615 4.688   -4.649  1.00 8.36  ? 204 ILE A CD1   1 
ATOM   1592 N  N     . GLU A 1 208 ? 65.585 9.083   -2.881  1.00 9.18  ? 205 GLU A N     1 
ATOM   1593 C  CA    . GLU A 1 208 ? 65.785 10.125  -1.878  1.00 10.61 ? 205 GLU A CA    1 
ATOM   1594 C  C     . GLU A 1 208 ? 66.375 11.396  -2.483  1.00 10.25 ? 205 GLU A C     1 
ATOM   1595 O  O     . GLU A 1 208 ? 65.942 12.501  -2.159  1.00 9.70  ? 205 GLU A O     1 
ATOM   1596 C  CB    . GLU A 1 208 ? 66.660 9.636   -0.719  1.00 13.64 ? 205 GLU A CB    1 
ATOM   1597 C  CG    . GLU A 1 208 ? 66.680 10.613  0.456   1.00 12.41 ? 205 GLU A CG    1 
ATOM   1598 C  CD    . GLU A 1 208 ? 67.449 10.094  1.657   1.00 16.04 ? 205 GLU A CD    1 
ATOM   1599 O  OE1   . GLU A 1 208 ? 67.433 10.771  2.706   1.00 21.80 ? 205 GLU A OE1   1 
ATOM   1600 O  OE2   . GLU A 1 208 ? 68.066 9.016   1.556   1.00 16.89 ? 205 GLU A OE2   1 
ATOM   1601 N  N     . ARG A 1 209 ? 67.356 11.239  -3.367  1.00 10.61 ? 206 ARG A N     1 
ATOM   1602 C  CA    . ARG A 1 209 ? 67.988 12.390  -4.010  1.00 11.45 ? 206 ARG A CA    1 
ATOM   1603 C  C     . ARG A 1 209 ? 66.981 13.210  -4.808  1.00 10.07 ? 206 ARG A C     1 
ATOM   1604 O  O     . ARG A 1 209 ? 66.973 14.439  -4.743  1.00 11.82 ? 206 ARG A O     1 
ATOM   1605 C  CB    . ARG A 1 209 ? 69.131 11.951  -4.934  1.00 13.01 ? 206 ARG A CB    1 
ATOM   1606 C  CG    . ARG A 1 209 ? 69.928 13.124  -5.511  1.00 16.08 ? 206 ARG A CG    1 
ATOM   1607 C  CD    . ARG A 1 209 ? 70.948 12.693  -6.560  1.00 22.21 ? 206 ARG A CD    1 
ATOM   1608 N  NE    . ARG A 1 209 ? 70.352 12.498  -7.882  1.00 23.56 ? 206 ARG A NE    1 
ATOM   1609 C  CZ    . ARG A 1 209 ? 70.098 13.481  -8.742  1.00 24.56 ? 206 ARG A CZ    1 
ATOM   1610 N  NH1   . ARG A 1 209 ? 69.558 13.212  -9.924  1.00 18.96 ? 206 ARG A NH1   1 
ATOM   1611 N  NH2   . ARG A 1 209 ? 70.378 14.738  -8.420  1.00 17.64 ? 206 ARG A NH2   1 
ATOM   1612 N  N     . GLU A 1 210 ? 66.127 12.518  -5.554  1.00 8.55  ? 207 GLU A N     1 
ATOM   1613 C  CA    . GLU A 1 210 ? 65.247 13.167  -6.519  1.00 10.34 ? 207 GLU A CA    1 
ATOM   1614 C  C     . GLU A 1 210 ? 63.860 13.518  -5.979  1.00 8.57  ? 207 GLU A C     1 
ATOM   1615 O  O     . GLU A 1 210 ? 63.112 14.250  -6.626  1.00 8.04  ? 207 GLU A O     1 
ATOM   1616 C  CB    . GLU A 1 210 ? 65.128 12.307  -7.779  1.00 10.68 ? 207 GLU A CB    1 
ATOM   1617 C  CG    . GLU A 1 210 ? 66.459 12.082  -8.476  1.00 11.46 ? 207 GLU A CG    1 
ATOM   1618 C  CD    . GLU A 1 210 ? 66.351 11.168  -9.680  1.00 16.38 ? 207 GLU A CD    1 
ATOM   1619 O  OE1   . GLU A 1 210 ? 65.276 11.134  -10.313 1.00 19.99 ? 207 GLU A OE1   1 
ATOM   1620 O  OE2   . GLU A 1 210 ? 67.345 10.479  -9.991  1.00 19.82 ? 207 GLU A OE2   1 
ATOM   1621 N  N     . THR A 1 211 ? 63.514 13.009  -4.800  1.00 7.31  ? 208 THR A N     1 
ATOM   1622 C  CA    . THR A 1 211 ? 62.206 13.311  -4.224  1.00 8.19  ? 208 THR A CA    1 
ATOM   1623 C  C     . THR A 1 211 ? 62.292 13.811  -2.791  1.00 9.59  ? 208 THR A C     1 
ATOM   1624 O  O     . THR A 1 211 ? 61.408 14.524  -2.326  1.00 9.72  ? 208 THR A O     1 
ATOM   1625 C  CB    . THR A 1 211 ? 61.262 12.093  -4.260  1.00 10.75 ? 208 THR A CB    1 
ATOM   1626 O  OG1   . THR A 1 211 ? 61.735 11.085  -3.355  1.00 8.38  ? 208 THR A OG1   1 
ATOM   1627 C  CG2   . THR A 1 211 ? 61.177 11.523  -5.667  1.00 8.94  ? 208 THR A CG2   1 
ATOM   1628 N  N     . GLY A 1 212 ? 63.354 13.426  -2.093  1.00 8.34  ? 209 GLY A N     1 
ATOM   1629 C  CA    . GLY A 1 212 ? 63.496 13.751  -0.687  1.00 12.06 ? 209 GLY A CA    1 
ATOM   1630 C  C     . GLY A 1 212 ? 62.895 12.685  0.213   1.00 11.95 ? 209 GLY A C     1 
ATOM   1631 O  O     . GLY A 1 212 ? 63.035 12.745  1.430   1.00 12.64 ? 209 GLY A O     1 
ATOM   1632 N  N     . PHE A 1 213 ? 62.235 11.700  -0.390  1.00 10.77 ? 210 PHE A N     1 
ATOM   1633 C  CA    . PHE A 1 213 ? 61.545 10.658  0.369   1.00 9.50  ? 210 PHE A CA    1 
ATOM   1634 C  C     . PHE A 1 213 ? 62.451 9.475   0.696   1.00 10.77 ? 210 PHE A C     1 
ATOM   1635 O  O     . PHE A 1 213 ? 63.225 9.018   -0.147  1.00 10.91 ? 210 PHE A O     1 
ATOM   1636 C  CB    . PHE A 1 213 ? 60.318 10.158  -0.396  1.00 8.51  ? 210 PHE A CB    1 
ATOM   1637 C  CG    . PHE A 1 213 ? 59.328 11.236  -0.737  1.00 9.42  ? 210 PHE A CG    1 
ATOM   1638 C  CD1   . PHE A 1 213 ? 58.641 11.204  -1.939  1.00 7.99  ? 210 PHE A CD1   1 
ATOM   1639 C  CD2   . PHE A 1 213 ? 59.075 12.272  0.146   1.00 9.20  ? 210 PHE A CD2   1 
ATOM   1640 C  CE1   . PHE A 1 213 ? 57.727 12.196  -2.259  1.00 10.21 ? 210 PHE A CE1   1 
ATOM   1641 C  CE2   . PHE A 1 213 ? 58.161 13.262  -0.167  1.00 7.03  ? 210 PHE A CE2   1 
ATOM   1642 C  CZ    . PHE A 1 213 ? 57.487 13.223  -1.372  1.00 7.25  ? 210 PHE A CZ    1 
ATOM   1643 N  N     . GLN A 1 214 ? 62.339 8.979   1.925   1.00 8.24  ? 211 GLN A N     1 
ATOM   1644 C  CA    . GLN A 1 214 ? 63.067 7.793   2.354   1.00 9.13  ? 211 GLN A CA    1 
ATOM   1645 C  C     . GLN A 1 214 ? 62.163 6.564   2.331   1.00 9.67  ? 211 GLN A C     1 
ATOM   1646 O  O     . GLN A 1 214 ? 60.943 6.671   2.450   1.00 8.84  ? 211 GLN A O     1 
ATOM   1647 C  CB    . GLN A 1 214 ? 63.636 7.995   3.760   1.00 11.12 ? 211 GLN A CB    1 
ATOM   1648 C  CG    . GLN A 1 214 ? 64.741 9.035   3.836   1.00 13.98 ? 211 GLN A CG    1 
ATOM   1649 C  CD    . GLN A 1 214 ? 65.345 9.141   5.222   1.00 14.21 ? 211 GLN A CD    1 
ATOM   1650 O  OE1   . GLN A 1 214 ? 64.808 8.601   6.189   1.00 10.25 ? 211 GLN A OE1   1 
ATOM   1651 N  NE2   . GLN A 1 214 ? 66.472 9.836   5.324   1.00 16.05 ? 211 GLN A NE2   1 
ATOM   1652 N  N     . CYS A 1 215 ? 62.765 5.392   2.186   1.00 9.45  ? 212 CYS A N     1 
ATOM   1653 C  CA    . CYS A 1 215 ? 61.989 4.167   2.112   1.00 9.23  ? 212 CYS A CA    1 
ATOM   1654 C  C     . CYS A 1 215 ? 62.754 2.983   2.668   1.00 8.67  ? 212 CYS A C     1 
ATOM   1655 O  O     . CYS A 1 215 ? 63.956 3.058   2.917   1.00 10.51 ? 212 CYS A O     1 
ATOM   1656 C  CB    . CYS A 1 215 ? 61.608 3.872   0.660   1.00 8.49  ? 212 CYS A CB    1 
ATOM   1657 S  SG    . CYS A 1 215 ? 63.029 3.576   -0.425  1.00 13.23 ? 212 CYS A SG    1 
ATOM   1658 N  N     . SER A 1 216 ? 62.034 1.890   2.871   1.00 8.77  ? 213 SER A N     1 
ATOM   1659 C  CA    A SER A 1 216 ? 62.652 0.625   3.228   0.50 9.83  ? 213 SER A CA    1 
ATOM   1660 C  CA    B SER A 1 216 ? 62.654 0.624   3.226   0.50 9.84  ? 213 SER A CA    1 
ATOM   1661 C  C     . SER A 1 216 ? 62.456 -0.346  2.072   1.00 10.81 ? 213 SER A C     1 
ATOM   1662 O  O     . SER A 1 216 ? 61.640 -0.103  1.184   1.00 8.32  ? 213 SER A O     1 
ATOM   1663 C  CB    A SER A 1 216 ? 62.033 0.069   4.508   0.50 9.99  ? 213 SER A CB    1 
ATOM   1664 C  CB    B SER A 1 216 ? 62.044 0.059   4.508   0.50 9.94  ? 213 SER A CB    1 
ATOM   1665 O  OG    A SER A 1 216 ? 62.124 1.012   5.563   0.50 8.05  ? 213 SER A OG    1 
ATOM   1666 O  OG    B SER A 1 216 ? 60.656 -0.177  4.351   0.50 13.02 ? 213 SER A OG    1 
ATOM   1667 N  N     . ALA A 1 217 ? 63.206 -1.440  2.076   1.00 7.87  ? 214 ALA A N     1 
ATOM   1668 C  CA    . ALA A 1 217 ? 63.076 -2.418  1.009   1.00 6.78  ? 214 ALA A CA    1 
ATOM   1669 C  C     . ALA A 1 217 ? 63.436 -3.815  1.486   1.00 6.32  ? 214 ALA A C     1 
ATOM   1670 O  O     . ALA A 1 217 ? 64.242 -3.984  2.400   1.00 6.78  ? 214 ALA A O     1 
ATOM   1671 C  CB    . ALA A 1 217 ? 63.937 -2.023  -0.184  1.00 7.28  ? 214 ALA A CB    1 
ATOM   1672 N  N     . GLY A 1 218 ? 62.813 -4.812  0.871   1.00 7.47  ? 215 GLY A N     1 
ATOM   1673 C  CA    . GLY A 1 218 ? 63.176 -6.194  1.105   1.00 6.71  ? 215 GLY A CA    1 
ATOM   1674 C  C     . GLY A 1 218 ? 63.700 -6.782  -0.187  1.00 6.83  ? 215 GLY A C     1 
ATOM   1675 O  O     . GLY A 1 218 ? 63.181 -6.478  -1.261  1.00 6.74  ? 215 GLY A O     1 
ATOM   1676 N  N     . ILE A 1 219 ? 64.743 -7.600  -0.087  1.00 5.11  ? 216 ILE A N     1 
ATOM   1677 C  CA    . ILE A 1 219 ? 65.281 -8.304  -1.244  1.00 5.24  ? 216 ILE A CA    1 
ATOM   1678 C  C     . ILE A 1 219 ? 65.303 -9.804  -0.969  1.00 7.43  ? 216 ILE A C     1 
ATOM   1679 O  O     . ILE A 1 219 ? 65.922 -10.259 -0.004  1.00 8.80  ? 216 ILE A O     1 
ATOM   1680 C  CB    . ILE A 1 219 ? 66.712 -7.839  -1.596  1.00 8.36  ? 216 ILE A CB    1 
ATOM   1681 C  CG1   . ILE A 1 219 ? 66.766 -6.321  -1.805  1.00 7.05  ? 216 ILE A CG1   1 
ATOM   1682 C  CG2   . ILE A 1 219 ? 67.220 -8.567  -2.831  1.00 10.74 ? 216 ILE A CG2   1 
ATOM   1683 C  CD1   . ILE A 1 219 ? 67.081 -5.529  -0.550  1.00 8.99  ? 216 ILE A CD1   1 
ATOM   1684 N  N     . SER A 1 220 ? 64.619 -10.570 -1.811  1.00 6.10  ? 217 SER A N     1 
ATOM   1685 C  CA    . SER A 1 220 ? 64.612 -12.021 -1.682  1.00 7.16  ? 217 SER A CA    1 
ATOM   1686 C  C     . SER A 1 220 ? 64.309 -12.672 -3.031  1.00 10.99 ? 217 SER A C     1 
ATOM   1687 O  O     . SER A 1 220 ? 64.527 -12.062 -4.078  1.00 7.87  ? 217 SER A O     1 
ATOM   1688 C  CB    . SER A 1 220 ? 63.607 -12.465 -0.614  1.00 7.50  ? 217 SER A CB    1 
ATOM   1689 O  OG    . SER A 1 220 ? 63.808 -13.823 -0.258  1.00 6.56  ? 217 SER A OG    1 
ATOM   1690 N  N     . HIS A 1 221 ? 63.812 -13.905 -3.007  1.00 7.66  ? 218 HIS A N     1 
ATOM   1691 C  CA    . HIS A 1 221 ? 63.595 -14.655 -4.241  1.00 9.86  ? 218 HIS A CA    1 
ATOM   1692 C  C     . HIS A 1 221 ? 62.148 -14.623 -4.724  1.00 9.21  ? 218 HIS A C     1 
ATOM   1693 O  O     . HIS A 1 221 ? 61.838 -15.140 -5.792  1.00 9.47  ? 218 HIS A O     1 
ATOM   1694 C  CB    . HIS A 1 221 ? 64.060 -16.106 -4.086  1.00 10.23 ? 218 HIS A CB    1 
ATOM   1695 C  CG    . HIS A 1 221 ? 65.547 -16.259 -4.009  1.00 10.96 ? 218 HIS A CG    1 
ATOM   1696 N  ND1   . HIS A 1 221 ? 66.380 -15.972 -5.068  1.00 10.09 ? 218 HIS A ND1   1 
ATOM   1697 C  CD2   . HIS A 1 221 ? 66.349 -16.673 -3.000  1.00 10.11 ? 218 HIS A CD2   1 
ATOM   1698 C  CE1   . HIS A 1 221 ? 67.632 -16.200 -4.715  1.00 11.91 ? 218 HIS A CE1   1 
ATOM   1699 N  NE2   . HIS A 1 221 ? 67.641 -16.627 -3.465  1.00 10.51 ? 218 HIS A NE2   1 
ATOM   1700 N  N     . ASN A 1 222 ? 61.267 -14.023 -3.933  1.00 6.04  ? 219 ASN A N     1 
ATOM   1701 C  CA    . ASN A 1 222 ? 59.868 -13.885 -4.319  1.00 8.20  ? 219 ASN A CA    1 
ATOM   1702 C  C     . ASN A 1 222 ? 59.198 -12.722 -3.600  1.00 8.24  ? 219 ASN A C     1 
ATOM   1703 O  O     . ASN A 1 222 ? 59.788 -12.106 -2.714  1.00 8.20  ? 219 ASN A O     1 
ATOM   1704 C  CB    . ASN A 1 222 ? 59.097 -15.185 -4.071  1.00 9.84  ? 219 ASN A CB    1 
ATOM   1705 C  CG    . ASN A 1 222 ? 59.236 -15.682 -2.647  1.00 9.28  ? 219 ASN A CG    1 
ATOM   1706 O  OD1   . ASN A 1 222 ? 58.718 -15.071 -1.710  1.00 5.97  ? 219 ASN A OD1   1 
ATOM   1707 N  ND2   . ASN A 1 222 ? 59.928 -16.803 -2.477  1.00 9.06  ? 219 ASN A ND2   1 
ATOM   1708 N  N     . LYS A 1 223 ? 57.963 -12.427 -3.987  1.00 7.54  ? 220 LYS A N     1 
ATOM   1709 C  CA    . LYS A 1 223 ? 57.249 -11.266 -3.464  1.00 9.35  ? 220 LYS A CA    1 
ATOM   1710 C  C     . LYS A 1 223 ? 56.932 -11.373 -1.970  1.00 7.72  ? 220 LYS A C     1 
ATOM   1711 O  O     . LYS A 1 223 ? 57.069 -10.398 -1.232  1.00 7.74  ? 220 LYS A O     1 
ATOM   1712 C  CB    . LYS A 1 223 ? 55.970 -11.030 -4.273  1.00 8.77  ? 220 LYS A CB    1 
ATOM   1713 C  CG    . LYS A 1 223 ? 56.243 -10.749 -5.746  1.00 9.77  ? 220 LYS A CG    1 
ATOM   1714 C  CD    . LYS A 1 223 ? 54.988 -10.881 -6.601  1.00 16.83 ? 220 LYS A CD    1 
ATOM   1715 C  CE    . LYS A 1 223 ? 54.013 -9.749  -6.354  1.00 16.46 ? 220 LYS A CE    1 
ATOM   1716 N  NZ    . LYS A 1 223 ? 52.828 -9.848  -7.251  1.00 18.68 ? 220 LYS A NZ    1 
ATOM   1717 N  N     . VAL A 1 224 ? 56.508 -12.550 -1.526  1.00 8.13  ? 221 VAL A N     1 
ATOM   1718 C  CA    . VAL A 1 224 ? 56.157 -12.736 -0.119  1.00 7.61  ? 221 VAL A CA    1 
ATOM   1719 C  C     . VAL A 1 224 ? 57.361 -12.552 0.807   1.00 7.07  ? 221 VAL A C     1 
ATOM   1720 O  O     . VAL A 1 224 ? 57.267 -11.862 1.825   1.00 8.81  ? 221 VAL A O     1 
ATOM   1721 C  CB    . VAL A 1 224 ? 55.489 -14.104 0.138   1.00 9.77  ? 221 VAL A CB    1 
ATOM   1722 C  CG1   . VAL A 1 224 ? 55.485 -14.423 1.627   1.00 10.27 ? 221 VAL A CG1   1 
ATOM   1723 C  CG2   . VAL A 1 224 ? 54.072 -14.111 -0.413  1.00 12.49 ? 221 VAL A CG2   1 
ATOM   1724 N  N     . LEU A 1 225 ? 58.492 -13.159 0.455   1.00 7.24  ? 222 LEU A N     1 
ATOM   1725 C  CA    . LEU A 1 225 ? 59.707 -13.003 1.253   1.00 5.99  ? 222 LEU A CA    1 
ATOM   1726 C  C     . LEU A 1 225 ? 60.248 -11.576 1.173   1.00 7.45  ? 222 LEU A C     1 
ATOM   1727 O  O     . LEU A 1 225 ? 60.710 -11.024 2.171   1.00 7.07  ? 222 LEU A O     1 
ATOM   1728 C  CB    . LEU A 1 225 ? 60.784 -14.013 0.839   1.00 5.28  ? 222 LEU A CB    1 
ATOM   1729 C  CG    . LEU A 1 225 ? 60.515 -15.474 1.212   1.00 7.02  ? 222 LEU A CG    1 
ATOM   1730 C  CD1   . LEU A 1 225 ? 61.726 -16.345 0.894   1.00 8.63  ? 222 LEU A CD1   1 
ATOM   1731 C  CD2   . LEU A 1 225 ? 60.149 -15.590 2.681   1.00 10.59 ? 222 LEU A CD2   1 
ATOM   1732 N  N     . ALA A 1 226 ? 60.183 -10.982 -0.016  1.00 6.77  ? 223 ALA A N     1 
ATOM   1733 C  CA    . ALA A 1 226 ? 60.602 -9.593  -0.197  1.00 7.65  ? 223 ALA A CA    1 
ATOM   1734 C  C     . ALA A 1 226 ? 59.798 -8.666  0.711   1.00 8.17  ? 223 ALA A C     1 
ATOM   1735 O  O     . ALA A 1 226 ? 60.352 -7.776  1.355   1.00 7.56  ? 223 ALA A O     1 
ATOM   1736 C  CB    . ALA A 1 226 ? 60.445 -9.176  -1.655  1.00 8.53  ? 223 ALA A CB    1 
ATOM   1737 N  N     . LYS A 1 227 ? 58.487 -8.881  0.748   1.00 8.41  ? 224 LYS A N     1 
ATOM   1738 C  CA    . LYS A 1 227 ? 57.586 -8.091  1.581   1.00 8.73  ? 224 LYS A CA    1 
ATOM   1739 C  C     . LYS A 1 227 ? 57.885 -8.279  3.066   1.00 9.87  ? 224 LYS A C     1 
ATOM   1740 O  O     . LYS A 1 227 ? 57.976 -7.311  3.821   1.00 7.94  ? 224 LYS A O     1 
ATOM   1741 C  CB    . LYS A 1 227 ? 56.132 -8.470  1.295   1.00 9.40  ? 224 LYS A CB    1 
ATOM   1742 C  CG    A LYS A 1 227 ? 55.120 -7.835  2.243   0.50 13.38 ? 224 LYS A CG    1 
ATOM   1743 C  CG    B LYS A 1 227 ? 55.130 -7.787  2.203   0.50 13.37 ? 224 LYS A CG    1 
ATOM   1744 C  CD    A LYS A 1 227 ? 55.242 -6.317  2.256   0.50 14.89 ? 224 LYS A CD    1 
ATOM   1745 C  CD    B LYS A 1 227 ? 55.224 -6.276  2.094   0.50 14.92 ? 224 LYS A CD    1 
ATOM   1746 C  CE    A LYS A 1 227 ? 54.236 -5.683  3.210   0.50 19.63 ? 224 LYS A CE    1 
ATOM   1747 C  CE    B LYS A 1 227 ? 54.201 -5.613  2.991   0.50 19.63 ? 224 LYS A CE    1 
ATOM   1748 N  NZ    A LYS A 1 227 ? 54.379 -4.200  3.292   0.50 17.79 ? 224 LYS A NZ    1 
ATOM   1749 N  NZ    B LYS A 1 227 ? 52.856 -6.217  2.786   0.50 17.37 ? 224 LYS A NZ    1 
ATOM   1750 N  N     . LEU A 1 228 ? 58.031 -9.531  3.482   1.00 8.88  ? 225 LEU A N     1 
ATOM   1751 C  CA    . LEU A 1 228 ? 58.350 -9.833  4.869   1.00 8.34  ? 225 LEU A CA    1 
ATOM   1752 C  C     . LEU A 1 228 ? 59.675 -9.182  5.254   1.00 8.75  ? 225 LEU A C     1 
ATOM   1753 O  O     . LEU A 1 228 ? 59.787 -8.563  6.312   1.00 11.79 ? 225 LEU A O     1 
ATOM   1754 C  CB    . LEU A 1 228 ? 58.408 -11.347 5.087   1.00 10.15 ? 225 LEU A CB    1 
ATOM   1755 C  CG    . LEU A 1 228 ? 58.526 -11.800 6.544   1.00 15.72 ? 225 LEU A CG    1 
ATOM   1756 C  CD1   . LEU A 1 228 ? 57.304 -11.353 7.336   1.00 13.33 ? 225 LEU A CD1   1 
ATOM   1757 C  CD2   . LEU A 1 228 ? 58.707 -13.309 6.633   1.00 14.44 ? 225 LEU A CD2   1 
ATOM   1758 N  N     . ALA A 1 229 ? 60.671 -9.318  4.384   1.00 7.60  ? 226 ALA A N     1 
ATOM   1759 C  CA    . ALA A 1 229 ? 61.999 -8.765  4.629   1.00 10.77 ? 226 ALA A CA    1 
ATOM   1760 C  C     . ALA A 1 229 ? 61.951 -7.254  4.816   1.00 10.00 ? 226 ALA A C     1 
ATOM   1761 O  O     . ALA A 1 229 ? 62.596 -6.707  5.709   1.00 9.01  ? 226 ALA A O     1 
ATOM   1762 C  CB    . ALA A 1 229 ? 62.938 -9.117  3.482   1.00 6.00  ? 226 ALA A CB    1 
ATOM   1763 N  N     . CYS A 1 230 ? 61.188 -6.585  3.961   1.00 7.15  ? 227 CYS A N     1 
ATOM   1764 C  CA    . CYS A 1 230 ? 61.086 -5.132  4.006   1.00 6.70  ? 227 CYS A CA    1 
ATOM   1765 C  C     . CYS A 1 230 ? 60.717 -4.621  5.401   1.00 8.21  ? 227 CYS A C     1 
ATOM   1766 O  O     . CYS A 1 230 ? 61.266 -3.624  5.873   1.00 11.80 ? 227 CYS A O     1 
ATOM   1767 C  CB    . CYS A 1 230 ? 60.064 -4.647  2.977   1.00 8.20  ? 227 CYS A CB    1 
ATOM   1768 S  SG    . CYS A 1 230 ? 59.954 -2.857  2.838   1.00 10.75 ? 227 CYS A SG    1 
ATOM   1769 N  N     . GLY A 1 231 ? 59.797 -5.312  6.065   1.00 7.64  ? 228 GLY A N     1 
ATOM   1770 C  CA    . GLY A 1 231 ? 59.305 -4.864  7.356   1.00 9.26  ? 228 GLY A CA    1 
ATOM   1771 C  C     . GLY A 1 231 ? 60.206 -5.185  8.536   1.00 12.38 ? 228 GLY A C     1 
ATOM   1772 O  O     . GLY A 1 231 ? 59.934 -4.763  9.659   1.00 13.19 ? 228 GLY A O     1 
ATOM   1773 N  N     . LEU A 1 232 ? 61.284 -5.922  8.292   1.00 9.33  ? 229 LEU A N     1 
ATOM   1774 C  CA    . LEU A 1 232 ? 62.138 -6.379  9.387   1.00 10.65 ? 229 LEU A CA    1 
ATOM   1775 C  C     . LEU A 1 232 ? 63.029 -5.278  9.962   1.00 13.17 ? 229 LEU A C     1 
ATOM   1776 O  O     . LEU A 1 232 ? 63.389 -5.314  11.139  1.00 11.52 ? 229 LEU A O     1 
ATOM   1777 C  CB    . LEU A 1 232 ? 62.980 -7.581  8.954   1.00 11.12 ? 229 LEU A CB    1 
ATOM   1778 C  CG    . LEU A 1 232 ? 62.186 -8.845  8.611   1.00 11.12 ? 229 LEU A CG    1 
ATOM   1779 C  CD1   . LEU A 1 232 ? 63.116 -9.976  8.195   1.00 10.11 ? 229 LEU A CD1   1 
ATOM   1780 C  CD2   . LEU A 1 232 ? 61.312 -9.267  9.785   1.00 14.90 ? 229 LEU A CD2   1 
ATOM   1781 N  N     . ASN A 1 233 ? 63.381 -4.300  9.134   1.00 10.34 ? 230 ASN A N     1 
ATOM   1782 C  CA    . ASN A 1 233 ? 64.244 -3.212  9.575   1.00 17.19 ? 230 ASN A CA    1 
ATOM   1783 C  C     . ASN A 1 233 ? 63.795 -1.846  9.046   1.00 15.37 ? 230 ASN A C     1 
ATOM   1784 O  O     . ASN A 1 233 ? 64.467 -1.241  8.217   1.00 24.13 ? 230 ASN A O     1 
ATOM   1785 C  CB    . ASN A 1 233 ? 65.703 -3.486  9.185   1.00 12.38 ? 230 ASN A CB    1 
ATOM   1786 C  CG    . ASN A 1 233 ? 66.296 -4.679  9.924   1.00 14.53 ? 230 ASN A CG    1 
ATOM   1787 O  OD1   . ASN A 1 233 ? 66.729 -4.559  11.069  1.00 14.06 ? 230 ASN A OD1   1 
ATOM   1788 N  ND2   . ASN A 1 233 ? 66.330 -5.831  9.264   1.00 12.43 ? 230 ASN A ND2   1 
ATOM   1789 N  N     . LYS A 1 234 ? 62.650 -1.375  9.529   1.00 18.94 ? 231 LYS A N     1 
ATOM   1790 C  CA    . LYS A 1 234 ? 62.138 -0.056  9.168   1.00 15.52 ? 231 LYS A CA    1 
ATOM   1791 C  C     . LYS A 1 234 ? 62.490 0.947   10.260  1.00 17.22 ? 231 LYS A C     1 
ATOM   1792 O  O     . LYS A 1 234 ? 62.625 0.574   11.426  1.00 25.83 ? 231 LYS A O     1 
ATOM   1793 C  CB    . LYS A 1 234 ? 60.616 -0.100  8.984   1.00 18.97 ? 231 LYS A CB    1 
ATOM   1794 C  CG    . LYS A 1 234 ? 60.134 -0.147  7.539   1.00 19.61 ? 231 LYS A CG    1 
ATOM   1795 C  CD    . LYS A 1 234 ? 58.614 0.027   7.462   1.00 16.98 ? 231 LYS A CD    1 
ATOM   1796 C  CE    . LYS A 1 234 ? 58.109 0.112   6.025   1.00 17.82 ? 231 LYS A CE    1 
ATOM   1797 N  NZ    . LYS A 1 234 ? 58.471 1.401   5.349   1.00 12.46 ? 231 LYS A NZ    1 
ATOM   1798 N  N     . PRO A 1 235 ? 62.638 2.228   9.891   1.00 12.74 ? 232 PRO A N     1 
ATOM   1799 C  CA    . PRO A 1 235 ? 62.567 2.740   8.520   1.00 12.55 ? 232 PRO A CA    1 
ATOM   1800 C  C     . PRO A 1 235 ? 63.952 2.983   7.930   1.00 13.67 ? 232 PRO A C     1 
ATOM   1801 O  O     . PRO A 1 235 ? 64.960 2.785   8.606   1.00 10.79 ? 232 PRO A O     1 
ATOM   1802 C  CB    . PRO A 1 235 ? 61.872 4.083   8.713   1.00 12.89 ? 232 PRO A CB    1 
ATOM   1803 C  CG    . PRO A 1 235 ? 62.415 4.563   10.027  1.00 17.69 ? 232 PRO A CG    1 
ATOM   1804 C  CD    . PRO A 1 235 ? 62.634 3.325   10.876  1.00 17.20 ? 232 PRO A CD    1 
ATOM   1805 N  N     . ASN A 1 236 ? 63.989 3.412   6.672   1.00 11.31 ? 233 ASN A N     1 
ATOM   1806 C  CA    . ASN A 1 236 ? 65.225 3.856   6.035   1.00 11.99 ? 233 ASN A CA    1 
ATOM   1807 C  C     . ASN A 1 236 ? 66.316 2.787   5.967   1.00 10.58 ? 233 ASN A C     1 
ATOM   1808 O  O     . ASN A 1 236 ? 67.502 3.107   5.972   1.00 11.46 ? 233 ASN A O     1 
ATOM   1809 C  CB    . ASN A 1 236 ? 65.759 5.112   6.736   1.00 12.88 ? 233 ASN A CB    1 
ATOM   1810 C  CG    . ASN A 1 236 ? 66.788 5.853   5.903   1.00 12.36 ? 233 ASN A CG    1 
ATOM   1811 O  OD1   . ASN A 1 236 ? 66.726 5.849   4.675   1.00 12.47 ? 233 ASN A OD1   1 
ATOM   1812 N  ND2   . ASN A 1 236 ? 67.744 6.488   6.568   1.00 14.88 ? 233 ASN A ND2   1 
ATOM   1813 N  N     . ARG A 1 237 ? 65.910 1.521   5.902   1.00 10.73 ? 234 ARG A N     1 
ATOM   1814 C  CA    . ARG A 1 237 ? 66.854 0.411   5.795   1.00 9.95  ? 234 ARG A CA    1 
ATOM   1815 C  C     . ARG A 1 237 ? 66.327 -0.642  4.829   1.00 9.36  ? 234 ARG A C     1 
ATOM   1816 O  O     . ARG A 1 237 ? 65.138 -0.677  4.523   1.00 8.52  ? 234 ARG A O     1 
ATOM   1817 C  CB    . ARG A 1 237 ? 67.094 -0.236  7.163   1.00 12.09 ? 234 ARG A CB    1 
ATOM   1818 C  CG    . ARG A 1 237 ? 67.747 0.670   8.194   1.00 16.19 ? 234 ARG A CG    1 
ATOM   1819 C  CD    . ARG A 1 237 ? 69.183 1.004   7.816   1.00 18.36 ? 234 ARG A CD    1 
ATOM   1820 N  NE    . ARG A 1 237 ? 69.863 1.750   8.872   1.00 23.05 ? 234 ARG A NE    1 
ATOM   1821 C  CZ    . ARG A 1 237 ? 69.927 3.077   8.930   1.00 26.99 ? 234 ARG A CZ    1 
ATOM   1822 N  NH1   . ARG A 1 237 ? 69.357 3.815   7.988   1.00 20.78 ? 234 ARG A NH1   1 
ATOM   1823 N  NH2   . ARG A 1 237 ? 70.566 3.668   9.931   1.00 32.37 ? 234 ARG A NH2   1 
ATOM   1824 N  N     . GLN A 1 238 ? 67.213 -1.505  4.348   1.00 10.18 ? 235 GLN A N     1 
ATOM   1825 C  CA    . GLN A 1 238 ? 66.784 -2.614  3.511   1.00 7.31  ? 235 GLN A CA    1 
ATOM   1826 C  C     . GLN A 1 238 ? 67.305 -3.938  4.053   1.00 9.16  ? 235 GLN A C     1 
ATOM   1827 O  O     . GLN A 1 238 ? 68.372 -3.999  4.667   1.00 8.90  ? 235 GLN A O     1 
ATOM   1828 C  CB    . GLN A 1 238 ? 67.207 -2.412  2.055   1.00 8.10  ? 235 GLN A CB    1 
ATOM   1829 C  CG    . GLN A 1 238 ? 68.706 -2.387  1.828   1.00 9.79  ? 235 GLN A CG    1 
ATOM   1830 C  CD    . GLN A 1 238 ? 69.056 -2.115  0.380   1.00 10.38 ? 235 GLN A CD    1 
ATOM   1831 O  OE1   . GLN A 1 238 ? 68.680 -1.083  -0.177  1.00 13.77 ? 235 GLN A OE1   1 
ATOM   1832 N  NE2   . GLN A 1 238 ? 69.767 -3.046  -0.243  1.00 10.24 ? 235 GLN A NE2   1 
ATOM   1833 N  N     . THR A 1 239 ? 66.540 -4.998  3.826   1.00 7.18  ? 236 THR A N     1 
ATOM   1834 C  CA    . THR A 1 239 ? 66.861 -6.295  4.396   1.00 9.81  ? 236 THR A CA    1 
ATOM   1835 C  C     . THR A 1 239 ? 66.899 -7.374  3.323   1.00 9.70  ? 236 THR A C     1 
ATOM   1836 O  O     . THR A 1 239 ? 66.017 -7.447  2.468   1.00 7.96  ? 236 THR A O     1 
ATOM   1837 C  CB    . THR A 1 239 ? 65.846 -6.686  5.487   1.00 10.67 ? 236 THR A CB    1 
ATOM   1838 O  OG1   . THR A 1 239 ? 65.808 -5.665  6.490   1.00 12.77 ? 236 THR A OG1   1 
ATOM   1839 C  CG2   . THR A 1 239 ? 66.228 -8.014  6.138   1.00 11.48 ? 236 THR A CG2   1 
ATOM   1840 N  N     . LEU A 1 240 ? 67.937 -8.201  3.372   1.00 8.47  ? 237 LEU A N     1 
ATOM   1841 C  CA    . LEU A 1 240 ? 68.072 -9.322  2.458   1.00 8.02  ? 237 LEU A CA    1 
ATOM   1842 C  C     . LEU A 1 240 ? 67.693 -10.604 3.193   1.00 10.46 ? 237 LEU A C     1 
ATOM   1843 O  O     . LEU A 1 240 ? 68.249 -10.914 4.248   1.00 7.84  ? 237 LEU A O     1 
ATOM   1844 C  CB    . LEU A 1 240 ? 69.506 -9.399  1.919   1.00 8.41  ? 237 LEU A CB    1 
ATOM   1845 C  CG    . LEU A 1 240 ? 69.836 -10.420 0.824   1.00 10.19 ? 237 LEU A CG    1 
ATOM   1846 C  CD1   . LEU A 1 240 ? 71.128 -10.042 0.107   1.00 9.86  ? 237 LEU A CD1   1 
ATOM   1847 C  CD2   . LEU A 1 240 ? 69.924 -11.838 1.377   1.00 10.42 ? 237 LEU A CD2   1 
ATOM   1848 N  N     . VAL A 1 241 ? 66.726 -11.332 2.644   1.00 9.77  ? 238 VAL A N     1 
ATOM   1849 C  CA    . VAL A 1 241 ? 66.316 -12.609 3.211   1.00 8.80  ? 238 VAL A CA    1 
ATOM   1850 C  C     . VAL A 1 241 ? 66.651 -13.729 2.240   1.00 9.59  ? 238 VAL A C     1 
ATOM   1851 O  O     . VAL A 1 241 ? 66.000 -13.887 1.207   1.00 7.80  ? 238 VAL A O     1 
ATOM   1852 C  CB    . VAL A 1 241 ? 64.812 -12.630 3.538   1.00 11.31 ? 238 VAL A CB    1 
ATOM   1853 C  CG1   . VAL A 1 241 ? 64.326 -14.064 3.749   1.00 9.16  ? 238 VAL A CG1   1 
ATOM   1854 C  CG2   . VAL A 1 241 ? 64.529 -11.774 4.764   1.00 8.70  ? 238 VAL A CG2   1 
ATOM   1855 N  N     . SER A 1 242 ? 67.683 -14.497 2.571   1.00 7.09  ? 239 SER A N     1 
ATOM   1856 C  CA    . SER A 1 242 ? 68.137 -15.575 1.706   1.00 9.98  ? 239 SER A CA    1 
ATOM   1857 C  C     . SER A 1 242 ? 67.261 -16.809 1.872   1.00 8.23  ? 239 SER A C     1 
ATOM   1858 O  O     . SER A 1 242 ? 66.508 -16.929 2.841   1.00 5.99  ? 239 SER A O     1 
ATOM   1859 C  CB    . SER A 1 242 ? 69.591 -15.931 2.020   1.00 11.74 ? 239 SER A CB    1 
ATOM   1860 O  OG    . SER A 1 242 ? 69.691 -16.509 3.311   1.00 12.00 ? 239 SER A OG    1 
ATOM   1861 N  N     . HIS A 1 243 ? 67.365 -17.731 0.923   1.00 9.03  ? 240 HIS A N     1 
ATOM   1862 C  CA    . HIS A 1 243 ? 66.641 -18.987 1.019   1.00 9.56  ? 240 HIS A CA    1 
ATOM   1863 C  C     . HIS A 1 243 ? 67.064 -19.733 2.284   1.00 9.19  ? 240 HIS A C     1 
ATOM   1864 O  O     . HIS A 1 243 ? 66.239 -20.338 2.970   1.00 7.37  ? 240 HIS A O     1 
ATOM   1865 C  CB    . HIS A 1 243 ? 66.898 -19.849 -0.218  1.00 10.88 ? 240 HIS A CB    1 
ATOM   1866 C  CG    . HIS A 1 243 ? 66.186 -21.165 -0.190  1.00 11.43 ? 240 HIS A CG    1 
ATOM   1867 N  ND1   . HIS A 1 243 ? 64.840 -21.288 -0.454  1.00 11.32 ? 240 HIS A ND1   1 
ATOM   1868 C  CD2   . HIS A 1 243 ? 66.635 -22.415 0.076   1.00 11.12 ? 240 HIS A CD2   1 
ATOM   1869 C  CE1   . HIS A 1 243 ? 64.488 -22.559 -0.352  1.00 12.81 ? 240 HIS A CE1   1 
ATOM   1870 N  NE2   . HIS A 1 243 ? 65.559 -23.262 -0.032  1.00 11.65 ? 240 HIS A NE2   1 
ATOM   1871 N  N     . GLY A 1 244 ? 68.355 -19.672 2.593   1.00 9.85  ? 241 GLY A N     1 
ATOM   1872 C  CA    . GLY A 1 244 ? 68.898 -20.364 3.748   1.00 9.63  ? 241 GLY A CA    1 
ATOM   1873 C  C     . GLY A 1 244 ? 68.382 -19.842 5.076   1.00 8.82  ? 241 GLY A C     1 
ATOM   1874 O  O     . GLY A 1 244 ? 68.336 -20.578 6.059   1.00 7.80  ? 241 GLY A O     1 
ATOM   1875 N  N     . SER A 1 245 ? 67.989 -18.572 5.110   1.00 8.23  ? 242 SER A N     1 
ATOM   1876 C  CA    . SER A 1 245 ? 67.520 -17.957 6.351   1.00 9.55  ? 242 SER A CA    1 
ATOM   1877 C  C     . SER A 1 245 ? 66.092 -18.366 6.706   1.00 8.68  ? 242 SER A C     1 
ATOM   1878 O  O     . SER A 1 245 ? 65.638 -18.142 7.826   1.00 7.83  ? 242 SER A O     1 
ATOM   1879 C  CB    . SER A 1 245 ? 67.610 -16.431 6.266   1.00 9.51  ? 242 SER A CB    1 
ATOM   1880 O  OG    . SER A 1 245 ? 66.637 -15.910 5.375   1.00 10.06 ? 242 SER A OG    1 
ATOM   1881 N  N     . VAL A 1 246 ? 65.392 -18.974 5.754   1.00 7.23  ? 243 VAL A N     1 
ATOM   1882 C  CA    . VAL A 1 246 ? 63.963 -19.252 5.916   1.00 7.71  ? 243 VAL A CA    1 
ATOM   1883 C  C     . VAL A 1 246 ? 63.587 -20.137 7.120   1.00 8.22  ? 243 VAL A C     1 
ATOM   1884 O  O     . VAL A 1 246 ? 62.707 -19.773 7.899   1.00 7.70  ? 243 VAL A O     1 
ATOM   1885 C  CB    . VAL A 1 246 ? 63.344 -19.809 4.614   1.00 9.40  ? 243 VAL A CB    1 
ATOM   1886 C  CG1   . VAL A 1 246 ? 61.898 -20.233 4.843   1.00 8.50  ? 243 VAL A CG1   1 
ATOM   1887 C  CG2   . VAL A 1 246 ? 63.428 -18.764 3.510   1.00 9.48  ? 243 VAL A CG2   1 
ATOM   1888 N  N     . PRO A 1 247 ? 64.246 -21.299 7.278   1.00 9.90  ? 244 PRO A N     1 
ATOM   1889 C  CA    . PRO A 1 247 ? 63.875 -22.181 8.393   1.00 8.90  ? 244 PRO A CA    1 
ATOM   1890 C  C     . PRO A 1 247 ? 63.877 -21.484 9.756   1.00 8.33  ? 244 PRO A C     1 
ATOM   1891 O  O     . PRO A 1 247 ? 62.899 -21.598 10.493  1.00 7.19  ? 244 PRO A O     1 
ATOM   1892 C  CB    . PRO A 1 247 ? 64.953 -23.266 8.350   1.00 9.01  ? 244 PRO A CB    1 
ATOM   1893 C  CG    . PRO A 1 247 ? 65.344 -23.331 6.908   1.00 11.86 ? 244 PRO A CG    1 
ATOM   1894 C  CD    . PRO A 1 247 ? 65.277 -21.905 6.416   1.00 8.51  ? 244 PRO A CD    1 
ATOM   1895 N  N     . GLN A 1 248 ? 64.954 -20.778 10.088  1.00 7.33  ? 245 GLN A N     1 
ATOM   1896 C  CA    . GLN A 1 248 ? 65.029 -20.099 11.379  1.00 9.56  ? 245 GLN A CA    1 
ATOM   1897 C  C     . GLN A 1 248 ? 64.062 -18.920 11.458  1.00 8.88  ? 245 GLN A C     1 
ATOM   1898 O  O     . GLN A 1 248 ? 63.431 -18.690 12.492  1.00 8.36  ? 245 GLN A O     1 
ATOM   1899 C  CB    . GLN A 1 248 ? 66.460 -19.643 11.682  1.00 9.36  ? 245 GLN A CB    1 
ATOM   1900 C  CG    . GLN A 1 248 ? 67.427 -20.784 11.969  1.00 15.94 ? 245 GLN A CG    1 
ATOM   1901 C  CD    . GLN A 1 248 ? 68.565 -20.368 12.884  1.00 22.35 ? 245 GLN A CD    1 
ATOM   1902 O  OE1   . GLN A 1 248 ? 68.379 -20.218 14.092  1.00 26.39 ? 245 GLN A OE1   1 
ATOM   1903 N  NE2   . GLN A 1 248 ? 69.750 -20.176 12.311  1.00 17.72 ? 245 GLN A NE2   1 
ATOM   1904 N  N     . LEU A 1 249 ? 63.947 -18.177 10.361  1.00 8.31  ? 246 LEU A N     1 
ATOM   1905 C  CA    . LEU A 1 249 ? 63.032 -17.040 10.303  1.00 9.86  ? 246 LEU A CA    1 
ATOM   1906 C  C     . LEU A 1 249 ? 61.588 -17.475 10.535  1.00 8.11  ? 246 LEU A C     1 
ATOM   1907 O  O     . LEU A 1 249 ? 60.858 -16.855 11.308  1.00 7.38  ? 246 LEU A O     1 
ATOM   1908 C  CB    . LEU A 1 249 ? 63.145 -16.327 8.952   1.00 7.83  ? 246 LEU A CB    1 
ATOM   1909 C  CG    . LEU A 1 249 ? 62.236 -15.109 8.762   1.00 10.06 ? 246 LEU A CG    1 
ATOM   1910 C  CD1   . LEU A 1 249 ? 62.555 -14.042 9.795   1.00 11.02 ? 246 LEU A CD1   1 
ATOM   1911 C  CD2   . LEU A 1 249 ? 62.351 -14.546 7.347   1.00 11.54 ? 246 LEU A CD2   1 
ATOM   1912 N  N     . PHE A 1 250 ? 61.183 -18.548 9.863   1.00 8.86  ? 247 PHE A N     1 
ATOM   1913 C  CA    . PHE A 1 250 ? 59.803 -19.021 9.928   1.00 8.26  ? 247 PHE A CA    1 
ATOM   1914 C  C     . PHE A 1 250 ? 59.484 -19.795 11.206  1.00 8.49  ? 247 PHE A C     1 
ATOM   1915 O  O     . PHE A 1 250 ? 58.312 -19.980 11.542  1.00 9.00  ? 247 PHE A O     1 
ATOM   1916 C  CB    . PHE A 1 250 ? 59.468 -19.887 8.707   1.00 6.86  ? 247 PHE A CB    1 
ATOM   1917 C  CG    . PHE A 1 250 ? 59.083 -19.097 7.484   1.00 9.27  ? 247 PHE A CG    1 
ATOM   1918 C  CD1   . PHE A 1 250 ? 58.587 -19.738 6.360   1.00 8.60  ? 247 PHE A CD1   1 
ATOM   1919 C  CD2   . PHE A 1 250 ? 59.216 -17.717 7.459   1.00 10.38 ? 247 PHE A CD2   1 
ATOM   1920 C  CE1   . PHE A 1 250 ? 58.226 -19.020 5.232   1.00 8.72  ? 247 PHE A CE1   1 
ATOM   1921 C  CE2   . PHE A 1 250 ? 58.859 -16.990 6.332   1.00 11.44 ? 247 PHE A CE2   1 
ATOM   1922 C  CZ    . PHE A 1 250 ? 58.363 -17.644 5.218   1.00 8.78  ? 247 PHE A CZ    1 
ATOM   1923 N  N     . SER A 1 251 ? 60.517 -20.246 11.913  1.00 8.47  ? 248 SER A N     1 
ATOM   1924 C  CA    . SER A 1 251 ? 60.324 -21.099 13.086  1.00 7.95  ? 248 SER A CA    1 
ATOM   1925 C  C     . SER A 1 251 ? 59.599 -20.382 14.226  1.00 7.85  ? 248 SER A C     1 
ATOM   1926 O  O     . SER A 1 251 ? 58.968 -21.022 15.065  1.00 7.75  ? 248 SER A O     1 
ATOM   1927 C  CB    . SER A 1 251 ? 61.660 -21.665 13.584  1.00 8.32  ? 248 SER A CB    1 
ATOM   1928 O  OG    . SER A 1 251 ? 62.400 -20.692 14.302  1.00 7.85  ? 248 SER A OG    1 
ATOM   1929 N  N     . GLN A 1 252 ? 59.695 -19.057 14.262  1.00 7.83  ? 249 GLN A N     1 
ATOM   1930 C  CA    . GLN A 1 252 ? 59.008 -18.282 15.290  1.00 8.45  ? 249 GLN A CA    1 
ATOM   1931 C  C     . GLN A 1 252 ? 58.135 -17.193 14.683  1.00 10.71 ? 249 GLN A C     1 
ATOM   1932 O  O     . GLN A 1 252 ? 57.706 -16.270 15.375  1.00 9.76  ? 249 GLN A O     1 
ATOM   1933 C  CB    . GLN A 1 252 ? 60.011 -17.645 16.248  1.00 11.37 ? 249 GLN A CB    1 
ATOM   1934 C  CG    . GLN A 1 252 ? 60.780 -18.629 17.101  1.00 13.92 ? 249 GLN A CG    1 
ATOM   1935 C  CD    . GLN A 1 252 ? 61.658 -17.926 18.113  1.00 17.80 ? 249 GLN A CD    1 
ATOM   1936 O  OE1   . GLN A 1 252 ? 61.319 -17.839 19.293  1.00 19.62 ? 249 GLN A OE1   1 
ATOM   1937 N  NE2   . GLN A 1 252 ? 62.789 -17.406 17.653  1.00 15.88 ? 249 GLN A NE2   1 
ATOM   1938 N  N     . MET A 1 253 ? 57.881 -17.305 13.385  1.00 8.58  ? 250 MET A N     1 
ATOM   1939 C  CA    . MET A 1 253 ? 57.122 -16.296 12.662  1.00 10.42 ? 250 MET A CA    1 
ATOM   1940 C  C     . MET A 1 253 ? 55.632 -16.604 12.731  1.00 8.09  ? 250 MET A C     1 
ATOM   1941 O  O     . MET A 1 253 ? 55.174 -17.598 12.169  1.00 7.04  ? 250 MET A O     1 
ATOM   1942 C  CB    . MET A 1 253 ? 57.587 -16.231 11.202  1.00 9.31  ? 250 MET A CB    1 
ATOM   1943 C  CG    . MET A 1 253 ? 56.895 -15.164 10.358  1.00 10.36 ? 250 MET A CG    1 
ATOM   1944 S  SD    . MET A 1 253 ? 57.252 -13.481 10.897  1.00 16.02 ? 250 MET A SD    1 
ATOM   1945 C  CE    . MET A 1 253 ? 59.027 -13.402 10.660  1.00 11.04 ? 250 MET A CE    1 
ATOM   1946 N  N     . PRO A 1 254 ? 54.867 -15.755 13.432  1.00 8.63  ? 251 PRO A N     1 
ATOM   1947 C  CA    . PRO A 1 254 ? 53.416 -15.960 13.476  1.00 8.75  ? 251 PRO A CA    1 
ATOM   1948 C  C     . PRO A 1 254 ? 52.846 -16.012 12.063  1.00 8.06  ? 251 PRO A C     1 
ATOM   1949 O  O     . PRO A 1 254 ? 53.239 -15.223 11.207  1.00 7.73  ? 251 PRO A O     1 
ATOM   1950 C  CB    . PRO A 1 254 ? 52.911 -14.718 14.216  1.00 9.24  ? 251 PRO A CB    1 
ATOM   1951 C  CG    . PRO A 1 254 ? 54.069 -14.285 15.051  1.00 13.10 ? 251 PRO A CG    1 
ATOM   1952 C  CD    . PRO A 1 254 ? 55.286 -14.580 14.214  1.00 10.91 ? 251 PRO A CD    1 
ATOM   1953 N  N     . ILE A 1 255 ? 51.929 -16.940 11.828  1.00 7.45  ? 252 ILE A N     1 
ATOM   1954 C  CA    . ILE A 1 255 ? 51.379 -17.153 10.495  1.00 10.14 ? 252 ILE A CA    1 
ATOM   1955 C  C     . ILE A 1 255 ? 50.764 -15.882 9.900   1.00 10.00 ? 252 ILE A C     1 
ATOM   1956 O  O     . ILE A 1 255 ? 50.875 -15.636 8.699   1.00 7.53  ? 252 ILE A O     1 
ATOM   1957 C  CB    . ILE A 1 255 ? 50.366 -18.315 10.504  1.00 10.64 ? 252 ILE A CB    1 
ATOM   1958 C  CG1   . ILE A 1 255 ? 51.105 -19.638 10.730  1.00 10.18 ? 252 ILE A CG1   1 
ATOM   1959 C  CG2   . ILE A 1 255 ? 49.575 -18.360 9.206   1.00 11.50 ? 252 ILE A CG2   1 
ATOM   1960 C  CD1   . ILE A 1 255 ? 50.206 -20.807 11.030  1.00 10.83 ? 252 ILE A CD1   1 
ATOM   1961 N  N     . ARG A 1 256 ? 50.149 -15.064 10.751  1.00 7.94  ? 253 ARG A N     1 
ATOM   1962 C  CA    . ARG A 1 256 ? 49.462 -13.855 10.297  1.00 10.41 ? 253 ARG A CA    1 
ATOM   1963 C  C     . ARG A 1 256 ? 50.390 -12.812 9.671   1.00 10.23 ? 253 ARG A C     1 
ATOM   1964 O  O     . ARG A 1 256 ? 49.921 -11.876 9.024   1.00 9.58  ? 253 ARG A O     1 
ATOM   1965 C  CB    . ARG A 1 256 ? 48.682 -13.213 11.447  1.00 9.55  ? 253 ARG A CB    1 
ATOM   1966 C  CG    . ARG A 1 256 ? 49.568 -12.648 12.544  1.00 12.06 ? 253 ARG A CG    1 
ATOM   1967 C  CD    . ARG A 1 256 ? 48.754 -11.926 13.610  1.00 18.36 ? 253 ARG A CD    1 
ATOM   1968 N  NE    . ARG A 1 256 ? 49.606 -11.456 14.699  1.00 14.86 ? 253 ARG A NE    1 
ATOM   1969 C  CZ    . ARG A 1 256 ? 49.959 -12.198 15.744  1.00 21.23 ? 253 ARG A CZ    1 
ATOM   1970 N  NH1   . ARG A 1 256 ? 49.526 -13.449 15.849  1.00 16.80 ? 253 ARG A NH1   1 
ATOM   1971 N  NH2   . ARG A 1 256 ? 50.744 -11.692 16.686  1.00 20.89 ? 253 ARG A NH2   1 
ATOM   1972 N  N     . LYS A 1 257 ? 51.697 -12.968 9.867   1.00 9.58  ? 254 LYS A N     1 
ATOM   1973 C  CA    . LYS A 1 257 ? 52.661 -11.992 9.364   1.00 7.71  ? 254 LYS A CA    1 
ATOM   1974 C  C     . LYS A 1 257 ? 52.902 -12.128 7.862   1.00 10.94 ? 254 LYS A C     1 
ATOM   1975 O  O     . LYS A 1 257 ? 53.398 -11.201 7.222   1.00 7.70  ? 254 LYS A O     1 
ATOM   1976 C  CB    . LYS A 1 257 ? 53.991 -12.106 10.115  1.00 8.83  ? 254 LYS A CB    1 
ATOM   1977 C  CG    . LYS A 1 257 ? 53.881 -11.896 11.616  1.00 11.59 ? 254 LYS A CG    1 
ATOM   1978 C  CD    . LYS A 1 257 ? 53.354 -10.509 11.948  1.00 17.57 ? 254 LYS A CD    1 
ATOM   1979 C  CE    . LYS A 1 257 ? 53.227 -10.319 13.454  1.00 25.36 ? 254 LYS A CE    1 
ATOM   1980 N  NZ    . LYS A 1 257 ? 52.774 -8.946  13.811  1.00 27.30 ? 254 LYS A NZ    1 
ATOM   1981 N  N     . ILE A 1 258 ? 52.553 -13.284 7.305   1.00 7.86  ? 255 ILE A N     1 
ATOM   1982 C  CA    . ILE A 1 258 ? 52.770 -13.544 5.885   1.00 8.59  ? 255 ILE A CA    1 
ATOM   1983 C  C     . ILE A 1 258 ? 51.622 -12.985 5.046   1.00 12.33 ? 255 ILE A C     1 
ATOM   1984 O  O     . ILE A 1 258 ? 50.454 -13.157 5.388   1.00 10.74 ? 255 ILE A O     1 
ATOM   1985 C  CB    . ILE A 1 258 ? 52.946 -15.052 5.605   1.00 11.98 ? 255 ILE A CB    1 
ATOM   1986 C  CG1   . ILE A 1 258 ? 54.360 -15.508 5.982   1.00 12.33 ? 255 ILE A CG1   1 
ATOM   1987 C  CG2   . ILE A 1 258 ? 52.689 -15.360 4.137   1.00 11.56 ? 255 ILE A CG2   1 
ATOM   1988 C  CD1   . ILE A 1 258 ? 54.768 -15.178 7.402   1.00 16.00 ? 255 ILE A CD1   1 
ATOM   1989 N  N     . ARG A 1 259 ? 51.963 -12.314 3.951   1.00 11.53 ? 256 ARG A N     1 
ATOM   1990 C  CA    . ARG A 1 259 ? 50.968 -11.665 3.103   1.00 11.15 ? 256 ARG A CA    1 
ATOM   1991 C  C     . ARG A 1 259 ? 49.907 -12.650 2.619   1.00 9.06  ? 256 ARG A C     1 
ATOM   1992 O  O     . ARG A 1 259 ? 50.233 -13.680 2.031   1.00 9.96  ? 256 ARG A O     1 
ATOM   1993 C  CB    . ARG A 1 259 ? 51.639 -10.993 1.903   1.00 12.26 ? 256 ARG A CB    1 
ATOM   1994 C  CG    . ARG A 1 259 ? 50.774 -9.947  1.211   1.00 14.41 ? 256 ARG A CG    1 
ATOM   1995 C  CD    . ARG A 1 259 ? 51.324 -9.600  -0.164  1.00 19.91 ? 256 ARG A CD    1 
ATOM   1996 N  NE    . ARG A 1 259 ? 50.888 -10.562 -1.171  1.00 27.61 ? 256 ARG A NE    1 
ATOM   1997 C  CZ    . ARG A 1 259 ? 51.367 -10.628 -2.409  1.00 35.15 ? 256 ARG A CZ    1 
ATOM   1998 N  NH1   . ARG A 1 259 ? 50.896 -11.537 -3.252  1.00 38.45 ? 256 ARG A NH1   1 
ATOM   1999 N  NH2   . ARG A 1 259 ? 52.319 -9.791  -2.806  1.00 29.96 ? 256 ARG A NH2   1 
ATOM   2000 N  N     . SER A 1 260 ? 48.648 -12.306 2.880   1.00 11.51 ? 257 SER A N     1 
ATOM   2001 C  CA    . SER A 1 260 ? 47.465 -13.090 2.505   1.00 12.15 ? 257 SER A CA    1 
ATOM   2002 C  C     . SER A 1 260 ? 46.964 -13.972 3.650   1.00 12.66 ? 257 SER A C     1 
ATOM   2003 O  O     . SER A 1 260 ? 45.855 -14.502 3.593   1.00 11.10 ? 257 SER A O     1 
ATOM   2004 C  CB    . SER A 1 260 ? 47.689 -13.917 1.229   1.00 13.92 ? 257 SER A CB    1 
ATOM   2005 O  OG    . SER A 1 260 ? 48.282 -15.174 1.512   1.00 12.08 ? 257 SER A OG    1 
ATOM   2006 N  N     . LEU A 1 261 ? 47.776 -14.112 4.694   1.00 9.19  ? 258 LEU A N     1 
ATOM   2007 C  CA    . LEU A 1 261 ? 47.415 -14.949 5.835   1.00 9.82  ? 258 LEU A CA    1 
ATOM   2008 C  C     . LEU A 1 261 ? 47.046 -14.128 7.072   1.00 10.61 ? 258 LEU A C     1 
ATOM   2009 O  O     . LEU A 1 261 ? 46.954 -14.665 8.179   1.00 9.79  ? 258 LEU A O     1 
ATOM   2010 C  CB    . LEU A 1 261 ? 48.555 -15.918 6.171   1.00 11.04 ? 258 LEU A CB    1 
ATOM   2011 C  CG    . LEU A 1 261 ? 48.955 -16.898 5.064   1.00 10.80 ? 258 LEU A CG    1 
ATOM   2012 C  CD1   . LEU A 1 261 ? 50.055 -17.837 5.538   1.00 9.96  ? 258 LEU A CD1   1 
ATOM   2013 C  CD2   . LEU A 1 261 ? 47.747 -17.691 4.582   1.00 11.90 ? 258 LEU A CD2   1 
ATOM   2014 N  N     . GLY A 1 262 ? 46.832 -12.830 6.881   1.00 9.46  ? 259 GLY A N     1 
ATOM   2015 C  CA    . GLY A 1 262 ? 46.545 -11.938 7.991   1.00 11.28 ? 259 GLY A CA    1 
ATOM   2016 C  C     . GLY A 1 262 ? 45.084 -11.891 8.403   1.00 12.97 ? 259 GLY A C     1 
ATOM   2017 O  O     . GLY A 1 262 ? 44.730 -11.223 9.374   1.00 13.39 ? 259 GLY A O     1 
ATOM   2018 N  N     . GLY A 1 263 ? 44.234 -12.604 7.671   1.00 10.19 ? 260 GLY A N     1 
ATOM   2019 C  CA    . GLY A 1 263 ? 42.805 -12.573 7.924   1.00 11.20 ? 260 GLY A CA    1 
ATOM   2020 C  C     . GLY A 1 263 ? 42.212 -13.918 8.300   1.00 13.33 ? 260 GLY A C     1 
ATOM   2021 O  O     . GLY A 1 263 ? 42.801 -14.673 9.075   1.00 13.31 ? 260 GLY A O     1 
ATOM   2022 N  N     . LYS A 1 264 ? 41.042 -14.219 7.741   1.00 12.68 ? 261 LYS A N     1 
ATOM   2023 C  CA    . LYS A 1 264 ? 40.296 -15.424 8.099   1.00 14.02 ? 261 LYS A CA    1 
ATOM   2024 C  C     . LYS A 1 264 ? 41.009 -16.727 7.725   1.00 11.39 ? 261 LYS A C     1 
ATOM   2025 O  O     . LYS A 1 264 ? 40.994 -17.688 8.496   1.00 13.29 ? 261 LYS A O     1 
ATOM   2026 C  CB    . LYS A 1 264 ? 38.890 -15.385 7.488   1.00 16.86 ? 261 LYS A CB    1 
ATOM   2027 C  CG    . LYS A 1 264 ? 38.017 -14.261 8.032   1.00 18.79 ? 261 LYS A CG    1 
ATOM   2028 C  CD    . LYS A 1 264 ? 36.628 -14.270 7.407   1.00 25.74 ? 261 LYS A CD    1 
ATOM   2029 C  CE    . LYS A 1 264 ? 35.747 -13.182 8.009   1.00 34.17 ? 261 LYS A CE    1 
ATOM   2030 N  NZ    . LYS A 1 264 ? 34.369 -13.194 7.441   1.00 30.69 ? 261 LYS A NZ    1 
ATOM   2031 N  N     . LEU A 1 265 ? 41.624 -16.766 6.546   1.00 9.35  ? 262 LEU A N     1 
ATOM   2032 C  CA    . LEU A 1 265 ? 42.365 -17.954 6.124   1.00 11.29 ? 262 LEU A CA    1 
ATOM   2033 C  C     . LEU A 1 265 ? 43.480 -18.283 7.115   1.00 13.35 ? 262 LEU A C     1 
ATOM   2034 O  O     . LEU A 1 265 ? 43.608 -19.424 7.566   1.00 12.61 ? 262 LEU A O     1 
ATOM   2035 C  CB    . LEU A 1 265 ? 42.950 -17.769 4.723   1.00 13.21 ? 262 LEU A CB    1 
ATOM   2036 C  CG    . LEU A 1 265 ? 43.790 -18.932 4.185   1.00 11.33 ? 262 LEU A CG    1 
ATOM   2037 C  CD1   . LEU A 1 265 ? 42.968 -20.211 4.132   1.00 15.01 ? 262 LEU A CD1   1 
ATOM   2038 C  CD2   . LEU A 1 265 ? 44.352 -18.598 2.809   1.00 14.98 ? 262 LEU A CD2   1 
ATOM   2039 N  N     . GLY A 1 266 ? 44.285 -17.280 7.450   1.00 10.20 ? 263 GLY A N     1 
ATOM   2040 C  CA    . GLY A 1 266 ? 45.354 -17.459 8.416   1.00 10.34 ? 263 GLY A CA    1 
ATOM   2041 C  C     . GLY A 1 266 ? 44.830 -17.950 9.751   1.00 12.27 ? 263 GLY A C     1 
ATOM   2042 O  O     . GLY A 1 266 ? 45.441 -18.804 10.396  1.00 11.77 ? 263 GLY A O     1 
ATOM   2043 N  N     . ALA A 1 267 ? 43.689 -17.411 10.168  1.00 11.48 ? 264 ALA A N     1 
ATOM   2044 C  CA    . ALA A 1 267 ? 43.075 -17.815 11.424  1.00 12.88 ? 264 ALA A CA    1 
ATOM   2045 C  C     . ALA A 1 267 ? 42.639 -19.277 11.374  1.00 11.74 ? 264 ALA A C     1 
ATOM   2046 O  O     . ALA A 1 267 ? 42.746 -20.000 12.366  1.00 12.65 ? 264 ALA A O     1 
ATOM   2047 C  CB    . ALA A 1 267 ? 41.893 -16.914 11.756  1.00 16.84 ? 264 ALA A CB    1 
ATOM   2048 N  N     . SER A 1 268 ? 42.150 -19.713 10.218  1.00 10.14 ? 265 SER A N     1 
ATOM   2049 C  CA    . SER A 1 268 ? 41.699 -21.092 10.074  1.00 13.63 ? 265 SER A CA    1 
ATOM   2050 C  C     . SER A 1 268 ? 42.887 -22.046 10.028  1.00 10.63 ? 265 SER A C     1 
ATOM   2051 O  O     . SER A 1 268 ? 42.831 -23.137 10.584  1.00 10.27 ? 265 SER A O     1 
ATOM   2052 C  CB    . SER A 1 268 ? 40.805 -21.265 8.841   1.00 13.18 ? 265 SER A CB    1 
ATOM   2053 O  OG    . SER A 1 268 ? 41.542 -21.126 7.641   1.00 18.99 ? 265 SER A OG    1 
ATOM   2054 N  N     . VAL A 1 269 ? 43.964 -21.632 9.367   1.00 11.18 ? 266 VAL A N     1 
ATOM   2055 C  CA    . VAL A 1 269 ? 45.190 -22.421 9.368   1.00 9.28  ? 266 VAL A CA    1 
ATOM   2056 C  C     . VAL A 1 269 ? 45.604 -22.705 10.812  1.00 12.44 ? 266 VAL A C     1 
ATOM   2057 O  O     . VAL A 1 269 ? 45.871 -23.848 11.186  1.00 11.02 ? 266 VAL A O     1 
ATOM   2058 C  CB    . VAL A 1 269 ? 46.333 -21.700 8.630   1.00 10.72 ? 266 VAL A CB    1 
ATOM   2059 C  CG1   . VAL A 1 269 ? 47.657 -22.418 8.870   1.00 9.46  ? 266 VAL A CG1   1 
ATOM   2060 C  CG2   . VAL A 1 269 ? 46.029 -21.606 7.140   1.00 9.38  ? 266 VAL A CG2   1 
ATOM   2061 N  N     . ILE A 1 270 ? 45.633 -21.653 11.622  1.00 10.06 ? 267 ILE A N     1 
ATOM   2062 C  CA    . ILE A 1 270 ? 45.976 -21.768 13.035  1.00 10.93 ? 267 ILE A CA    1 
ATOM   2063 C  C     . ILE A 1 270 ? 45.020 -22.687 13.793  1.00 13.10 ? 267 ILE A C     1 
ATOM   2064 O  O     . ILE A 1 270 ? 45.454 -23.564 14.541  1.00 13.97 ? 267 ILE A O     1 
ATOM   2065 C  CB    . ILE A 1 270 ? 45.990 -20.385 13.712  1.00 11.35 ? 267 ILE A CB    1 
ATOM   2066 C  CG1   . ILE A 1 270 ? 47.185 -19.567 13.216  1.00 10.18 ? 267 ILE A CG1   1 
ATOM   2067 C  CG2   . ILE A 1 270 ? 46.023 -20.529 15.224  1.00 16.62 ? 267 ILE A CG2   1 
ATOM   2068 C  CD1   . ILE A 1 270 ? 47.191 -18.133 13.700  1.00 16.74 ? 267 ILE A CD1   1 
ATOM   2069 N  N     . GLU A 1 271 ? 43.720 -22.486 13.594  1.00 10.81 ? 268 GLU A N     1 
ATOM   2070 C  CA    . GLU A 1 271 ? 42.707 -23.228 14.341  1.00 14.08 ? 268 GLU A CA    1 
ATOM   2071 C  C     . GLU A 1 271 ? 42.593 -24.692 13.925  1.00 14.50 ? 268 GLU A C     1 
ATOM   2072 O  O     . GLU A 1 271 ? 42.573 -25.584 14.773  1.00 13.24 ? 268 GLU A O     1 
ATOM   2073 C  CB    . GLU A 1 271 ? 41.343 -22.546 14.231  1.00 18.98 ? 268 GLU A CB    1 
ATOM   2074 C  CG    . GLU A 1 271 ? 40.188 -23.411 14.712  1.00 26.26 ? 268 GLU A CG    1 
ATOM   2075 C  CD    . GLU A 1 271 ? 39.075 -22.600 15.343  1.00 38.50 ? 268 GLU A CD    1 
ATOM   2076 O  OE1   . GLU A 1 271 ? 37.956 -22.586 14.787  1.00 43.73 ? 268 GLU A OE1   1 
ATOM   2077 O  OE2   . GLU A 1 271 ? 39.320 -21.981 16.401  1.00 38.02 ? 268 GLU A OE2   1 
ATOM   2078 N  N     . ILE A 1 272 ? 42.515 -24.934 12.621  1.00 11.41 ? 269 ILE A N     1 
ATOM   2079 C  CA    . ILE A 1 272 ? 42.354 -26.289 12.105  1.00 12.74 ? 269 ILE A CA    1 
ATOM   2080 C  C     . ILE A 1 272 ? 43.585 -27.155 12.365  1.00 12.42 ? 269 ILE A C     1 
ATOM   2081 O  O     . ILE A 1 272 ? 43.468 -28.318 12.750  1.00 13.30 ? 269 ILE A O     1 
ATOM   2082 C  CB    . ILE A 1 272 ? 42.044 -26.280 10.593  1.00 14.06 ? 269 ILE A CB    1 
ATOM   2083 C  CG1   . ILE A 1 272 ? 40.660 -25.678 10.338  1.00 18.51 ? 269 ILE A CG1   1 
ATOM   2084 C  CG2   . ILE A 1 272 ? 42.122 -27.688 10.020  1.00 13.95 ? 269 ILE A CG2   1 
ATOM   2085 C  CD1   . ILE A 1 272 ? 40.283 -25.603 8.869   1.00 20.40 ? 269 ILE A CD1   1 
ATOM   2086 N  N     . LEU A 1 273 ? 44.767 -26.587 12.157  1.00 12.43 ? 270 LEU A N     1 
ATOM   2087 C  CA    . LEU A 1 273 ? 45.999 -27.359 12.281  1.00 10.71 ? 270 LEU A CA    1 
ATOM   2088 C  C     . LEU A 1 273 ? 46.575 -27.334 13.695  1.00 11.62 ? 270 LEU A C     1 
ATOM   2089 O  O     . LEU A 1 273 ? 47.424 -28.154 14.039  1.00 15.11 ? 270 LEU A O     1 
ATOM   2090 C  CB    . LEU A 1 273 ? 47.040 -26.880 11.269  1.00 10.89 ? 270 LEU A CB    1 
ATOM   2091 C  CG    . LEU A 1 273 ? 46.662 -27.037 9.793   1.00 11.73 ? 270 LEU A CG    1 
ATOM   2092 C  CD1   . LEU A 1 273 ? 47.773 -26.511 8.894   1.00 11.53 ? 270 LEU A CD1   1 
ATOM   2093 C  CD2   . LEU A 1 273 ? 46.347 -28.488 9.466   1.00 12.72 ? 270 LEU A CD2   1 
ATOM   2094 N  N     . GLY A 1 274 ? 46.112 -26.393 14.510  1.00 11.71 ? 271 GLY A N     1 
ATOM   2095 C  CA    . GLY A 1 274 ? 46.592 -26.265 15.874  1.00 13.45 ? 271 GLY A CA    1 
ATOM   2096 C  C     . GLY A 1 274 ? 48.051 -25.856 15.951  1.00 13.68 ? 271 GLY A C     1 
ATOM   2097 O  O     . GLY A 1 274 ? 48.804 -26.370 16.777  1.00 14.01 ? 271 GLY A O     1 
ATOM   2098 N  N     . ILE A 1 275 ? 48.448 -24.927 15.086  1.00 10.18 ? 272 ILE A N     1 
ATOM   2099 C  CA    . ILE A 1 275 ? 49.819 -24.430 15.059  1.00 10.80 ? 272 ILE A CA    1 
ATOM   2100 C  C     . ILE A 1 275 ? 49.850 -22.909 15.198  1.00 11.49 ? 272 ILE A C     1 
ATOM   2101 O  O     . ILE A 1 275 ? 48.809 -22.254 15.152  1.00 11.45 ? 272 ILE A O     1 
ATOM   2102 C  CB    . ILE A 1 275 ? 50.543 -24.839 13.758  1.00 11.28 ? 272 ILE A CB    1 
ATOM   2103 C  CG1   . ILE A 1 275 ? 49.876 -24.196 12.538  1.00 13.43 ? 272 ILE A CG1   1 
ATOM   2104 C  CG2   . ILE A 1 275 ? 50.565 -26.353 13.614  1.00 10.61 ? 272 ILE A CG2   1 
ATOM   2105 C  CD1   . ILE A 1 275 ? 50.573 -24.520 11.219  1.00 8.99  ? 272 ILE A CD1   1 
ATOM   2106 N  N     . GLU A 1 276 ? 51.047 -22.351 15.367  1.00 10.02 ? 273 GLU A N     1 
ATOM   2107 C  CA    . GLU A 1 276 ? 51.202 -20.908 15.543  1.00 10.37 ? 273 GLU A CA    1 
ATOM   2108 C  C     . GLU A 1 276 ? 52.142 -20.270 14.519  1.00 10.35 ? 273 GLU A C     1 
ATOM   2109 O  O     . GLU A 1 276 ? 51.924 -19.136 14.091  1.00 8.99  ? 273 GLU A O     1 
ATOM   2110 C  CB    . GLU A 1 276 ? 51.691 -20.589 16.961  1.00 13.82 ? 273 GLU A CB    1 
ATOM   2111 C  CG    . GLU A 1 276 ? 50.735 -21.030 18.057  1.00 16.65 ? 273 GLU A CG    1 
ATOM   2112 C  CD    . GLU A 1 276 ? 51.239 -20.703 19.451  1.00 26.02 ? 273 GLU A CD    1 
ATOM   2113 O  OE1   . GLU A 1 276 ? 50.691 -21.263 20.424  1.00 31.55 ? 273 GLU A OE1   1 
ATOM   2114 O  OE2   . GLU A 1 276 ? 52.176 -19.887 19.577  1.00 25.50 ? 273 GLU A OE2   1 
ATOM   2115 N  N     . TYR A 1 277 ? 53.183 -20.996 14.126  1.00 9.66  ? 274 TYR A N     1 
ATOM   2116 C  CA    . TYR A 1 277 ? 54.233 -20.419 13.290  1.00 6.27  ? 274 TYR A CA    1 
ATOM   2117 C  C     . TYR A 1 277 ? 54.274 -20.999 11.872  1.00 7.08  ? 274 TYR A C     1 
ATOM   2118 O  O     . TYR A 1 277 ? 53.897 -22.150 11.646  1.00 6.61  ? 274 TYR A O     1 
ATOM   2119 C  CB    . TYR A 1 277 ? 55.595 -20.569 13.977  1.00 9.06  ? 274 TYR A CB    1 
ATOM   2120 C  CG    . TYR A 1 277 ? 55.599 -20.075 15.408  1.00 7.37  ? 274 TYR A CG    1 
ATOM   2121 C  CD1   . TYR A 1 277 ? 55.862 -20.938 16.466  1.00 9.09  ? 274 TYR A CD1   1 
ATOM   2122 C  CD2   . TYR A 1 277 ? 55.314 -18.749 15.701  1.00 9.82  ? 274 TYR A CD2   1 
ATOM   2123 C  CE1   . TYR A 1 277 ? 55.857 -20.486 17.777  1.00 12.21 ? 274 TYR A CE1   1 
ATOM   2124 C  CE2   . TYR A 1 277 ? 55.304 -18.288 17.002  1.00 11.34 ? 274 TYR A CE2   1 
ATOM   2125 C  CZ    . TYR A 1 277 ? 55.574 -19.161 18.038  1.00 15.65 ? 274 TYR A CZ    1 
ATOM   2126 O  OH    . TYR A 1 277 ? 55.563 -18.699 19.335  1.00 14.94 ? 274 TYR A OH    1 
ATOM   2127 N  N     . MET A 1 278 ? 54.741 -20.188 10.926  1.00 7.24  ? 275 MET A N     1 
ATOM   2128 C  CA    . MET A 1 278 ? 54.825 -20.594 9.522   1.00 7.69  ? 275 MET A CA    1 
ATOM   2129 C  C     . MET A 1 278 ? 55.609 -21.885 9.324   1.00 9.47  ? 275 MET A C     1 
ATOM   2130 O  O     . MET A 1 278 ? 55.231 -22.732 8.512   1.00 8.04  ? 275 MET A O     1 
ATOM   2131 C  CB    . MET A 1 278 ? 55.453 -19.481 8.677   1.00 8.97  ? 275 MET A CB    1 
ATOM   2132 C  CG    . MET A 1 278 ? 54.460 -18.472 8.140   1.00 16.48 ? 275 MET A CG    1 
ATOM   2133 S  SD    . MET A 1 278 ? 53.332 -19.173 6.916   1.00 14.73 ? 275 MET A SD    1 
ATOM   2134 C  CE    . MET A 1 278 ? 54.477 -19.694 5.647   1.00 18.70 ? 275 MET A CE    1 
ATOM   2135 N  N     . GLY A 1 279 ? 56.706 -22.026 10.062  1.00 7.78  ? 276 GLY A N     1 
ATOM   2136 C  CA    . GLY A 1 279 ? 57.568 -23.185 9.930   1.00 10.12 ? 276 GLY A CA    1 
ATOM   2137 C  C     . GLY A 1 279 ? 56.862 -24.495 10.224  1.00 10.64 ? 276 GLY A C     1 
ATOM   2138 O  O     . GLY A 1 279 ? 57.162 -25.523 9.612   1.00 10.05 ? 276 GLY A O     1 
ATOM   2139 N  N     . GLU A 1 280 ? 55.920 -24.458 11.163  1.00 7.27  ? 277 GLU A N     1 
ATOM   2140 C  CA    . GLU A 1 280 ? 55.176 -25.650 11.555  1.00 9.19  ? 277 GLU A CA    1 
ATOM   2141 C  C     . GLU A 1 280 ? 54.382 -26.244 10.394  1.00 8.39  ? 277 GLU A C     1 
ATOM   2142 O  O     . GLU A 1 280 ? 53.950 -27.392 10.453  1.00 10.55 ? 277 GLU A O     1 
ATOM   2143 C  CB    . GLU A 1 280 ? 54.232 -25.342 12.720  1.00 9.45  ? 277 GLU A CB    1 
ATOM   2144 C  CG    . GLU A 1 280 ? 54.927 -24.944 14.009  1.00 10.47 ? 277 GLU A CG    1 
ATOM   2145 C  CD    . GLU A 1 280 ? 53.944 -24.688 15.134  1.00 12.49 ? 277 GLU A CD    1 
ATOM   2146 O  OE1   . GLU A 1 280 ? 53.649 -23.506 15.406  1.00 10.21 ? 277 GLU A OE1   1 
ATOM   2147 O  OE2   . GLU A 1 280 ? 53.460 -25.667 15.742  1.00 11.89 ? 277 GLU A OE2   1 
ATOM   2148 N  N     . LEU A 1 281 ? 54.185 -25.460 9.341   1.00 10.18 ? 278 LEU A N     1 
ATOM   2149 C  CA    . LEU A 1 281 ? 53.441 -25.933 8.177   1.00 8.50  ? 278 LEU A CA    1 
ATOM   2150 C  C     . LEU A 1 281 ? 54.174 -27.028 7.405   1.00 8.74  ? 278 LEU A C     1 
ATOM   2151 O  O     . LEU A 1 281 ? 53.550 -27.797 6.678   1.00 8.04  ? 278 LEU A O     1 
ATOM   2152 C  CB    . LEU A 1 281 ? 53.100 -24.766 7.245   1.00 8.28  ? 278 LEU A CB    1 
ATOM   2153 C  CG    . LEU A 1 281 ? 51.887 -23.928 7.656   1.00 8.39  ? 278 LEU A CG    1 
ATOM   2154 C  CD1   . LEU A 1 281 ? 51.839 -22.617 6.883   1.00 12.01 ? 278 LEU A CD1   1 
ATOM   2155 C  CD2   . LEU A 1 281 ? 50.605 -24.732 7.453   1.00 7.25  ? 278 LEU A CD2   1 
ATOM   2156 N  N     . THR A 1 282 ? 55.494 -27.102 7.559   1.00 9.25  ? 279 THR A N     1 
ATOM   2157 C  CA    . THR A 1 282 ? 56.288 -28.060 6.785   1.00 10.01 ? 279 THR A CA    1 
ATOM   2158 C  C     . THR A 1 282 ? 55.944 -29.514 7.109   1.00 9.99  ? 279 THR A C     1 
ATOM   2159 O  O     . THR A 1 282 ? 56.295 -30.421 6.359   1.00 10.31 ? 279 THR A O     1 
ATOM   2160 C  CB    . THR A 1 282 ? 57.805 -27.861 6.986   1.00 10.11 ? 279 THR A CB    1 
ATOM   2161 O  OG1   . THR A 1 282 ? 58.149 -28.125 8.351   1.00 10.99 ? 279 THR A OG1   1 
ATOM   2162 C  CG2   . THR A 1 282 ? 58.218 -26.445 6.619   1.00 9.82  ? 279 THR A CG2   1 
ATOM   2163 N  N     . GLN A 1 283 ? 55.256 -29.735 8.224   1.00 10.00 ? 280 GLN A N     1 
ATOM   2164 C  CA    . GLN A 1 283 ? 54.974 -31.093 8.676   1.00 10.96 ? 280 GLN A CA    1 
ATOM   2165 C  C     . GLN A 1 283 ? 53.677 -31.658 8.104   1.00 13.23 ? 280 GLN A C     1 
ATOM   2166 O  O     . GLN A 1 283 ? 53.219 -32.723 8.516   1.00 16.21 ? 280 GLN A O     1 
ATOM   2167 C  CB    . GLN A 1 283 ? 54.948 -31.147 10.203  1.00 11.07 ? 280 GLN A CB    1 
ATOM   2168 C  CG    A GLN A 1 283 ? 56.281 -30.798 10.831  0.50 12.19 ? 280 GLN A CG    1 
ATOM   2169 C  CG    B GLN A 1 283 ? 53.807 -30.370 10.821  0.50 11.73 ? 280 GLN A CG    1 
ATOM   2170 C  CD    A GLN A 1 283 ? 57.423 -31.562 10.193  0.50 14.11 ? 280 GLN A CD    1 
ATOM   2171 C  CD    B GLN A 1 283 ? 54.147 -29.850 12.199  0.50 13.09 ? 280 GLN A CD    1 
ATOM   2172 O  OE1   A GLN A 1 283 ? 57.463 -32.792 10.240  0.50 13.89 ? 280 GLN A OE1   1 
ATOM   2173 O  OE1   B GLN A 1 283 ? 55.145 -30.249 12.794  0.50 17.94 ? 280 GLN A OE1   1 
ATOM   2174 N  NE2   A GLN A 1 283 ? 58.350 -30.838 9.579   0.50 13.26 ? 280 GLN A NE2   1 
ATOM   2175 N  NE2   B GLN A 1 283 ? 53.323 -28.946 12.711  0.50 9.71  ? 280 GLN A NE2   1 
ATOM   2176 N  N     . PHE A 1 284 ? 53.085 -30.944 7.156   1.00 8.76  ? 281 PHE A N     1 
ATOM   2177 C  CA    . PHE A 1 284 ? 51.880 -31.431 6.501   1.00 8.90  ? 281 PHE A CA    1 
ATOM   2178 C  C     . PHE A 1 284 ? 52.155 -31.681 5.024   1.00 11.30 ? 281 PHE A C     1 
ATOM   2179 O  O     . PHE A 1 284 ? 52.890 -30.929 4.388   1.00 11.77 ? 281 PHE A O     1 
ATOM   2180 C  CB    . PHE A 1 284 ? 50.737 -30.433 6.685   1.00 9.20  ? 281 PHE A CB    1 
ATOM   2181 C  CG    . PHE A 1 284 ? 50.416 -30.150 8.124   1.00 10.32 ? 281 PHE A CG    1 
ATOM   2182 C  CD1   . PHE A 1 284 ? 49.476 -30.912 8.801   1.00 14.00 ? 281 PHE A CD1   1 
ATOM   2183 C  CD2   . PHE A 1 284 ? 51.069 -29.138 8.808   1.00 10.00 ? 281 PHE A CD2   1 
ATOM   2184 C  CE1   . PHE A 1 284 ? 49.183 -30.660 10.130  1.00 17.11 ? 281 PHE A CE1   1 
ATOM   2185 C  CE2   . PHE A 1 284 ? 50.781 -28.881 10.136  1.00 10.83 ? 281 PHE A CE2   1 
ATOM   2186 C  CZ    . PHE A 1 284 ? 49.838 -29.643 10.799  1.00 11.90 ? 281 PHE A CZ    1 
ATOM   2187 N  N     . THR A 1 285 ? 51.581 -32.750 4.485   1.00 10.19 ? 282 THR A N     1 
ATOM   2188 C  CA    . THR A 1 285 ? 51.739 -33.049 3.068   1.00 13.77 ? 282 THR A CA    1 
ATOM   2189 C  C     . THR A 1 285 ? 50.961 -32.023 2.253   1.00 9.26  ? 282 THR A C     1 
ATOM   2190 O  O     . THR A 1 285 ? 50.093 -31.331 2.781   1.00 10.27 ? 282 THR A O     1 
ATOM   2191 C  CB    . THR A 1 285 ? 51.229 -34.461 2.717   1.00 10.90 ? 282 THR A CB    1 
ATOM   2192 O  OG1   . THR A 1 285 ? 49.807 -34.506 2.875   1.00 11.68 ? 282 THR A OG1   1 
ATOM   2193 C  CG2   . THR A 1 285 ? 51.872 -35.505 3.619   1.00 16.67 ? 282 THR A CG2   1 
ATOM   2194 N  N     . GLU A 1 286 ? 51.274 -31.921 0.968   1.00 10.53 ? 283 GLU A N     1 
ATOM   2195 C  CA    . GLU A 1 286 ? 50.562 -30.993 0.103   1.00 11.32 ? 283 GLU A CA    1 
ATOM   2196 C  C     . GLU A 1 286 ? 49.080 -31.366 0.021   1.00 11.81 ? 283 GLU A C     1 
ATOM   2197 O  O     . GLU A 1 286 ? 48.217 -30.491 0.025   1.00 10.29 ? 283 GLU A O     1 
ATOM   2198 C  CB    . GLU A 1 286 ? 51.196 -30.941 -1.291  1.00 11.38 ? 283 GLU A CB    1 
ATOM   2199 C  CG    . GLU A 1 286 ? 50.626 -29.845 -2.181  1.00 14.37 ? 283 GLU A CG    1 
ATOM   2200 C  CD    . GLU A 1 286 ? 51.322 -29.762 -3.528  1.00 21.02 ? 283 GLU A CD    1 
ATOM   2201 O  OE1   . GLU A 1 286 ? 52.262 -30.548 -3.764  1.00 19.99 ? 283 GLU A OE1   1 
ATOM   2202 O  OE2   . GLU A 1 286 ? 50.931 -28.907 -4.350  1.00 19.94 ? 283 GLU A OE2   1 
ATOM   2203 N  N     . SER A 1 287 ? 48.790 -32.663 -0.038  1.00 11.20 ? 284 SER A N     1 
ATOM   2204 C  CA    . SER A 1 287 ? 47.405 -33.128 -0.092  1.00 11.32 ? 284 SER A CA    1 
ATOM   2205 C  C     . SER A 1 287 ? 46.643 -32.779 1.187   1.00 9.91  ? 284 SER A C     1 
ATOM   2206 O  O     . SER A 1 287 ? 45.483 -32.377 1.131   1.00 11.59 ? 284 SER A O     1 
ATOM   2207 C  CB    . SER A 1 287 ? 47.337 -34.636 -0.353  1.00 13.74 ? 284 SER A CB    1 
ATOM   2208 O  OG    A SER A 1 287 ? 47.903 -34.967 -1.609  0.50 12.94 ? 284 SER A OG    1 
ATOM   2209 O  OG    B SER A 1 287 ? 47.977 -35.361 0.681   0.50 15.89 ? 284 SER A OG    1 
ATOM   2210 N  N     . GLN A 1 288 ? 47.297 -32.932 2.336   1.00 10.09 ? 285 GLN A N     1 
ATOM   2211 C  CA    . GLN A 1 288 ? 46.682 -32.563 3.609   1.00 9.45  ? 285 GLN A CA    1 
ATOM   2212 C  C     . GLN A 1 288 ? 46.272 -31.093 3.610   1.00 11.42 ? 285 GLN A C     1 
ATOM   2213 O  O     . GLN A 1 288 ? 45.159 -30.744 4.007   1.00 11.10 ? 285 GLN A O     1 
ATOM   2214 C  CB    . GLN A 1 288 ? 47.635 -32.828 4.777   1.00 9.60  ? 285 GLN A CB    1 
ATOM   2215 C  CG    . GLN A 1 288 ? 47.718 -34.276 5.218   1.00 17.29 ? 285 GLN A CG    1 
ATOM   2216 C  CD    . GLN A 1 288 ? 48.610 -34.460 6.431   1.00 17.39 ? 285 GLN A CD    1 
ATOM   2217 O  OE1   . GLN A 1 288 ? 49.723 -33.942 6.479   1.00 13.13 ? 285 GLN A OE1   1 
ATOM   2218 N  NE2   . GLN A 1 288 ? 48.116 -35.188 7.426   1.00 21.90 ? 285 GLN A NE2   1 
ATOM   2219 N  N     . LEU A 1 289 ? 47.180 -30.231 3.167   1.00 10.43 ? 286 LEU A N     1 
ATOM   2220 C  CA    . LEU A 1 289 ? 46.919 -28.798 3.148   1.00 10.20 ? 286 LEU A CA    1 
ATOM   2221 C  C     . LEU A 1 289 ? 45.797 -28.458 2.171   1.00 10.34 ? 286 LEU A C     1 
ATOM   2222 O  O     . LEU A 1 289 ? 44.909 -27.662 2.479   1.00 11.38 ? 286 LEU A O     1 
ATOM   2223 C  CB    . LEU A 1 289 ? 48.193 -28.024 2.801   1.00 10.77 ? 286 LEU A CB    1 
ATOM   2224 C  CG    . LEU A 1 289 ? 49.334 -28.121 3.819   1.00 9.75  ? 286 LEU A CG    1 
ATOM   2225 C  CD1   . LEU A 1 289 ? 50.561 -27.367 3.327   1.00 8.53  ? 286 LEU A CD1   1 
ATOM   2226 C  CD2   . LEU A 1 289 ? 48.889 -27.594 5.175   1.00 9.73  ? 286 LEU A CD2   1 
ATOM   2227 N  N     . GLN A 1 290 ? 45.838 -29.072 0.993   1.00 12.18 ? 287 GLN A N     1 
ATOM   2228 C  CA    . GLN A 1 290 ? 44.790 -28.880 -0.002  1.00 12.46 ? 287 GLN A CA    1 
ATOM   2229 C  C     . GLN A 1 290 ? 43.422 -29.310 0.529   1.00 12.39 ? 287 GLN A C     1 
ATOM   2230 O  O     . GLN A 1 290 ? 42.401 -28.704 0.203   1.00 14.32 ? 287 GLN A O     1 
ATOM   2231 C  CB    . GLN A 1 290 ? 45.116 -29.653 -1.280  1.00 14.14 ? 287 GLN A CB    1 
ATOM   2232 C  CG    . GLN A 1 290 ? 46.327 -29.130 -2.041  1.00 14.08 ? 287 GLN A CG    1 
ATOM   2233 C  CD    . GLN A 1 290 ? 46.660 -29.985 -3.248  1.00 15.60 ? 287 GLN A CD    1 
ATOM   2234 O  OE1   . GLN A 1 290 ? 46.587 -31.212 -3.189  1.00 15.79 ? 287 GLN A OE1   1 
ATOM   2235 N  NE2   . GLN A 1 290 ? 47.020 -29.340 -4.353  1.00 18.13 ? 287 GLN A NE2   1 
ATOM   2236 N  N     . SER A 1 291 ? 43.403 -30.359 1.343   1.00 13.17 ? 288 SER A N     1 
ATOM   2237 C  CA    . SER A 1 291 ? 42.143 -30.873 1.869   1.00 12.57 ? 288 SER A CA    1 
ATOM   2238 C  C     . SER A 1 291 ? 41.472 -29.877 2.811   1.00 14.83 ? 288 SER A C     1 
ATOM   2239 O  O     . SER A 1 291 ? 40.247 -29.765 2.835   1.00 19.69 ? 288 SER A O     1 
ATOM   2240 C  CB    . SER A 1 291 ? 42.348 -32.208 2.582   1.00 11.38 ? 288 SER A CB    1 
ATOM   2241 O  OG    A SER A 1 291 ? 42.867 -32.019 3.886   0.50 10.58 ? 288 SER A OG    1 
ATOM   2242 O  OG    B SER A 1 291 ? 41.109 -32.720 3.032   0.50 14.13 ? 288 SER A OG    1 
ATOM   2243 N  N     . HIS A 1 292 ? 42.277 -29.154 3.583   1.00 11.58 ? 289 HIS A N     1 
ATOM   2244 C  CA    . HIS A 1 292 ? 41.747 -28.191 4.541   1.00 14.33 ? 289 HIS A CA    1 
ATOM   2245 C  C     . HIS A 1 292 ? 41.424 -26.842 3.905   1.00 17.18 ? 289 HIS A C     1 
ATOM   2246 O  O     . HIS A 1 292 ? 40.429 -26.206 4.250   1.00 19.30 ? 289 HIS A O     1 
ATOM   2247 C  CB    . HIS A 1 292 ? 42.735 -27.974 5.689   1.00 15.77 ? 289 HIS A CB    1 
ATOM   2248 C  CG    . HIS A 1 292 ? 42.922 -29.172 6.568   1.00 16.05 ? 289 HIS A CG    1 
ATOM   2249 N  ND1   . HIS A 1 292 ? 41.902 -29.704 7.326   1.00 18.39 ? 289 HIS A ND1   1 
ATOM   2250 C  CD2   . HIS A 1 292 ? 44.015 -29.929 6.822   1.00 17.65 ? 289 HIS A CD2   1 
ATOM   2251 C  CE1   . HIS A 1 292 ? 42.356 -30.745 8.003   1.00 16.66 ? 289 HIS A CE1   1 
ATOM   2252 N  NE2   . HIS A 1 292 ? 43.636 -30.901 7.715   1.00 19.84 ? 289 HIS A NE2   1 
ATOM   2253 N  N     . PHE A 1 293 ? 42.271 -26.406 2.978   1.00 14.34 ? 290 PHE A N     1 
ATOM   2254 C  CA    . PHE A 1 293 ? 42.238 -25.019 2.527   1.00 16.22 ? 290 PHE A CA    1 
ATOM   2255 C  C     . PHE A 1 293 ? 42.018 -24.860 1.024   1.00 19.65 ? 290 PHE A C     1 
ATOM   2256 O  O     . PHE A 1 293 ? 42.058 -23.746 0.499   1.00 16.18 ? 290 PHE A O     1 
ATOM   2257 C  CB    . PHE A 1 293 ? 43.525 -24.306 2.960   1.00 13.24 ? 290 PHE A CB    1 
ATOM   2258 C  CG    . PHE A 1 293 ? 43.930 -24.605 4.380   1.00 14.31 ? 290 PHE A CG    1 
ATOM   2259 C  CD1   . PHE A 1 293 ? 43.177 -24.130 5.444   1.00 13.75 ? 290 PHE A CD1   1 
ATOM   2260 C  CD2   . PHE A 1 293 ? 45.058 -25.363 4.651   1.00 12.62 ? 290 PHE A CD2   1 
ATOM   2261 C  CE1   . PHE A 1 293 ? 43.540 -24.408 6.751   1.00 12.22 ? 290 PHE A CE1   1 
ATOM   2262 C  CE2   . PHE A 1 293 ? 45.428 -25.644 5.957   1.00 11.29 ? 290 PHE A CE2   1 
ATOM   2263 C  CZ    . PHE A 1 293 ? 44.669 -25.165 7.006   1.00 11.36 ? 290 PHE A CZ    1 
ATOM   2264 N  N     . GLY A 1 294 ? 41.781 -25.972 0.335   1.00 15.43 ? 291 GLY A N     1 
ATOM   2265 C  CA    . GLY A 1 294 ? 41.529 -25.933 -1.094  1.00 17.18 ? 291 GLY A CA    1 
ATOM   2266 C  C     . GLY A 1 294 ? 42.766 -26.233 -1.917  1.00 16.91 ? 291 GLY A C     1 
ATOM   2267 O  O     . GLY A 1 294 ? 43.889 -26.143 -1.420  1.00 15.33 ? 291 GLY A O     1 
ATOM   2268 N  N     . GLU A 1 295 ? 42.556 -26.581 -3.183  1.00 16.97 ? 292 GLU A N     1 
ATOM   2269 C  CA    . GLU A 1 295 ? 43.646 -26.956 -4.078  1.00 14.66 ? 292 GLU A CA    1 
ATOM   2270 C  C     . GLU A 1 295 ? 44.685 -25.846 -4.238  1.00 13.62 ? 292 GLU A C     1 
ATOM   2271 O  O     . GLU A 1 295 ? 45.886 -26.088 -4.138  1.00 14.44 ? 292 GLU A O     1 
ATOM   2272 C  CB    . GLU A 1 295 ? 43.088 -27.359 -5.448  1.00 19.13 ? 292 GLU A CB    1 
ATOM   2273 C  CG    . GLU A 1 295 ? 44.150 -27.708 -6.478  1.00 21.87 ? 292 GLU A CG    1 
ATOM   2274 C  CD    . GLU A 1 295 ? 43.561 -28.042 -7.837  1.00 31.60 ? 292 GLU A CD    1 
ATOM   2275 O  OE1   . GLU A 1 295 ? 44.276 -27.884 -8.850  1.00 34.68 ? 292 GLU A OE1   1 
ATOM   2276 O  OE2   . GLU A 1 295 ? 42.385 -28.464 -7.895  1.00 26.33 ? 292 GLU A OE2   1 
ATOM   2277 N  N     . LYS A 1 296 ? 44.218 -24.627 -4.485  1.00 16.06 ? 293 LYS A N     1 
ATOM   2278 C  CA    . LYS A 1 296 ? 45.114 -23.500 -4.719  1.00 14.46 ? 293 LYS A CA    1 
ATOM   2279 C  C     . LYS A 1 296 ? 45.857 -23.098 -3.443  1.00 14.15 ? 293 LYS A C     1 
ATOM   2280 O  O     . LYS A 1 296 ? 47.086 -23.020 -3.429  1.00 10.04 ? 293 LYS A O     1 
ATOM   2281 C  CB    . LYS A 1 296 ? 44.339 -22.310 -5.293  1.00 17.07 ? 293 LYS A CB    1 
ATOM   2282 C  CG    . LYS A 1 296 ? 45.213 -21.236 -5.926  1.00 26.32 ? 293 LYS A CG    1 
ATOM   2283 C  CD    . LYS A 1 296 ? 44.364 -20.149 -6.576  1.00 29.21 ? 293 LYS A CD    1 
ATOM   2284 C  CE    . LYS A 1 296 ? 45.229 -19.071 -7.213  1.00 34.68 ? 293 LYS A CE    1 
ATOM   2285 N  NZ    . LYS A 1 296 ? 44.408 -17.987 -7.827  1.00 34.86 ? 293 LYS A NZ    1 
ATOM   2286 N  N     . ASN A 1 297 ? 45.107 -22.849 -2.373  1.00 13.92 ? 294 ASN A N     1 
ATOM   2287 C  CA    . ASN A 1 297 ? 45.701 -22.473 -1.093  1.00 14.84 ? 294 ASN A CA    1 
ATOM   2288 C  C     . ASN A 1 297 ? 46.645 -23.537 -0.540  1.00 12.16 ? 294 ASN A C     1 
ATOM   2289 O  O     . ASN A 1 297 ? 47.702 -23.216 -0.003  1.00 11.71 ? 294 ASN A O     1 
ATOM   2290 C  CB    . ASN A 1 297 ? 44.616 -22.158 -0.061  1.00 16.28 ? 294 ASN A CB    1 
ATOM   2291 C  CG    . ASN A 1 297 ? 43.897 -20.856 -0.349  1.00 18.84 ? 294 ASN A CG    1 
ATOM   2292 O  OD1   . ASN A 1 297 ? 44.465 -19.941 -0.944  1.00 22.55 ? 294 ASN A OD1   1 
ATOM   2293 N  ND2   . ASN A 1 297 ? 42.641 -20.763 0.077   1.00 20.79 ? 294 ASN A ND2   1 
ATOM   2294 N  N     . GLY A 1 298 ? 46.252 -24.801 -0.667  1.00 12.41 ? 295 GLY A N     1 
ATOM   2295 C  CA    . GLY A 1 298 ? 47.053 -25.907 -0.171  1.00 10.39 ? 295 GLY A CA    1 
ATOM   2296 C  C     . GLY A 1 298 ? 48.411 -25.991 -0.841  1.00 13.25 ? 295 GLY A C     1 
ATOM   2297 O  O     . GLY A 1 298 ? 49.436 -26.163 -0.174  1.00 11.75 ? 295 GLY A O     1 
ATOM   2298 N  N     . SER A 1 299 ? 48.420 -25.875 -2.166  1.00 9.24  ? 296 SER A N     1 
ATOM   2299 C  CA    . SER A 1 299 ? 49.668 -25.877 -2.917  1.00 11.05 ? 296 SER A CA    1 
ATOM   2300 C  C     . SER A 1 299 ? 50.522 -24.670 -2.548  1.00 10.79 ? 296 SER A C     1 
ATOM   2301 O  O     . SER A 1 299 ? 51.726 -24.793 -2.338  1.00 9.28  ? 296 SER A O     1 
ATOM   2302 C  CB    . SER A 1 299 ? 49.394 -25.891 -4.422  1.00 14.33 ? 296 SER A CB    1 
ATOM   2303 O  OG    . SER A 1 299 ? 48.880 -27.145 -4.829  1.00 20.22 ? 296 SER A OG    1 
ATOM   2304 N  N     . TRP A 1 300 ? 49.887 -23.505 -2.462  1.00 11.28 ? 297 TRP A N     1 
ATOM   2305 C  CA    . TRP A 1 300 ? 50.590 -22.272 -2.132  1.00 11.04 ? 297 TRP A CA    1 
ATOM   2306 C  C     . TRP A 1 300 ? 51.255 -22.374 -0.760  1.00 10.49 ? 297 TRP A C     1 
ATOM   2307 O  O     . TRP A 1 300 ? 52.432 -22.046 -0.609  1.00 9.64  ? 297 TRP A O     1 
ATOM   2308 C  CB    . TRP A 1 300 ? 49.627 -21.083 -2.177  1.00 12.31 ? 297 TRP A CB    1 
ATOM   2309 C  CG    . TRP A 1 300 ? 50.286 -19.753 -1.977  1.00 12.72 ? 297 TRP A CG    1 
ATOM   2310 C  CD1   . TRP A 1 300 ? 50.842 -18.961 -2.941  1.00 14.44 ? 297 TRP A CD1   1 
ATOM   2311 C  CD2   . TRP A 1 300 ? 50.451 -19.051 -0.737  1.00 11.84 ? 297 TRP A CD2   1 
ATOM   2312 N  NE1   . TRP A 1 300 ? 51.344 -17.812 -2.377  1.00 13.04 ? 297 TRP A NE1   1 
ATOM   2313 C  CE2   . TRP A 1 300 ? 51.117 -17.843 -1.027  1.00 12.95 ? 297 TRP A CE2   1 
ATOM   2314 C  CE3   . TRP A 1 300 ? 50.102 -19.329 0.588   1.00 13.07 ? 297 TRP A CE3   1 
ATOM   2315 C  CZ2   . TRP A 1 300 ? 51.440 -16.913 -0.039  1.00 12.60 ? 297 TRP A CZ2   1 
ATOM   2316 C  CZ3   . TRP A 1 300 ? 50.422 -18.403 1.566   1.00 14.46 ? 297 TRP A CZ3   1 
ATOM   2317 C  CH2   . TRP A 1 300 ? 51.087 -17.212 1.247   1.00 9.16  ? 297 TRP A CH2   1 
ATOM   2318 N  N     . LEU A 1 301 ? 50.494 -22.842 0.227   1.00 9.69  ? 298 LEU A N     1 
ATOM   2319 C  CA    . LEU A 1 301 ? 50.993 -22.993 1.592   1.00 10.86 ? 298 LEU A CA    1 
ATOM   2320 C  C     . LEU A 1 301 ? 52.137 -24.001 1.689   1.00 9.11  ? 298 LEU A C     1 
ATOM   2321 O  O     . LEU A 1 301 ? 53.116 -23.771 2.396   1.00 8.29  ? 298 LEU A O     1 
ATOM   2322 C  CB    . LEU A 1 301 ? 49.859 -23.407 2.535   1.00 7.84  ? 298 LEU A CB    1 
ATOM   2323 C  CG    . LEU A 1 301 ? 48.768 -22.365 2.803   1.00 11.62 ? 298 LEU A CG    1 
ATOM   2324 C  CD1   . LEU A 1 301 ? 47.527 -23.014 3.403   1.00 8.89  ? 298 LEU A CD1   1 
ATOM   2325 C  CD2   . LEU A 1 301 ? 49.289 -21.253 3.705   1.00 11.57 ? 298 LEU A CD2   1 
ATOM   2326 N  N     . TYR A 1 302 ? 52.006 -25.120 0.984   1.00 9.73  ? 299 TYR A N     1 
ATOM   2327 C  CA    . TYR A 1 302 ? 53.039 -26.148 0.997   1.00 10.40 ? 299 TYR A CA    1 
ATOM   2328 C  C     . TYR A 1 302 ? 54.372 -25.572 0.533   1.00 10.87 ? 299 TYR A C     1 
ATOM   2329 O  O     . TYR A 1 302 ? 55.409 -25.776 1.168   1.00 8.08  ? 299 TYR A O     1 
ATOM   2330 C  CB    . TYR A 1 302 ? 52.637 -27.338 0.118   1.00 9.49  ? 299 TYR A CB    1 
ATOM   2331 C  CG    . TYR A 1 302 ? 53.647 -28.464 0.129   1.00 12.23 ? 299 TYR A CG    1 
ATOM   2332 C  CD1   . TYR A 1 302 ? 53.570 -29.483 1.068   1.00 11.39 ? 299 TYR A CD1   1 
ATOM   2333 C  CD2   . TYR A 1 302 ? 54.684 -28.503 -0.797  1.00 14.34 ? 299 TYR A CD2   1 
ATOM   2334 C  CE1   . TYR A 1 302 ? 54.494 -30.512 1.085   1.00 16.21 ? 299 TYR A CE1   1 
ATOM   2335 C  CE2   . TYR A 1 302 ? 55.612 -29.527 -0.789  1.00 18.20 ? 299 TYR A CE2   1 
ATOM   2336 C  CZ    . TYR A 1 302 ? 55.512 -30.529 0.155   1.00 19.26 ? 299 TYR A CZ    1 
ATOM   2337 O  OH    . TYR A 1 302 ? 56.434 -31.551 0.168   1.00 21.94 ? 299 TYR A OH    1 
ATOM   2338 N  N     . ALA A 1 303 ? 54.337 -24.840 -0.575  1.00 9.63  ? 300 ALA A N     1 
ATOM   2339 C  CA    . ALA A 1 303 ? 55.541 -24.214 -1.109  1.00 9.08  ? 300 ALA A CA    1 
ATOM   2340 C  C     . ALA A 1 303 ? 56.008 -23.031 -0.257  1.00 9.43  ? 300 ALA A C     1 
ATOM   2341 O  O     . ALA A 1 303 ? 57.202 -22.879 0.006   1.00 7.80  ? 300 ALA A O     1 
ATOM   2342 C  CB    . ALA A 1 303 ? 55.315 -23.780 -2.554  1.00 10.30 ? 300 ALA A CB    1 
ATOM   2343 N  N     . MET A 1 304 ? 55.066 -22.202 0.183   1.00 7.35  ? 301 MET A N     1 
ATOM   2344 C  CA    . MET A 1 304 ? 55.413 -20.963 0.882   1.00 6.88  ? 301 MET A CA    1 
ATOM   2345 C  C     . MET A 1 304 ? 56.143 -21.186 2.203   1.00 8.79  ? 301 MET A C     1 
ATOM   2346 O  O     . MET A 1 304 ? 57.061 -20.436 2.542   1.00 7.26  ? 301 MET A O     1 
ATOM   2347 C  CB    . MET A 1 304 ? 54.172 -20.105 1.127   1.00 9.16  ? 301 MET A CB    1 
ATOM   2348 C  CG    . MET A 1 304 ? 54.492 -18.681 1.570   1.00 10.66 ? 301 MET A CG    1 
ATOM   2349 S  SD    . MET A 1 304 ? 55.325 -17.741 0.277   1.00 10.26 ? 301 MET A SD    1 
ATOM   2350 C  CE    . MET A 1 304 ? 57.024 -17.753 0.849   1.00 8.96  ? 301 MET A CE    1 
ATOM   2351 N  N     . CYS A 1 305 ? 55.732 -22.205 2.953   1.00 6.18  ? 302 CYS A N     1 
ATOM   2352 C  CA    . CYS A 1 305 ? 56.343 -22.468 4.255   1.00 10.01 ? 302 CYS A CA    1 
ATOM   2353 C  C     . CYS A 1 305 ? 57.780 -22.956 4.096   1.00 8.63  ? 302 CYS A C     1 
ATOM   2354 O  O     . CYS A 1 305 ? 58.534 -23.025 5.066   1.00 9.31  ? 302 CYS A O     1 
ATOM   2355 C  CB    . CYS A 1 305 ? 55.513 -23.466 5.072   1.00 8.64  ? 302 CYS A CB    1 
ATOM   2356 S  SG    . CYS A 1 305 ? 55.538 -25.169 4.466   1.00 8.52  ? 302 CYS A SG    1 
ATOM   2357 N  N     . ARG A 1 306 ? 58.146 -23.287 2.862   1.00 7.10  ? 303 ARG A N     1 
ATOM   2358 C  CA    . ARG A 1 306 ? 59.509 -23.676 2.531   1.00 8.54  ? 303 ARG A CA    1 
ATOM   2359 C  C     . ARG A 1 306 ? 60.252 -22.528 1.847   1.00 8.80  ? 303 ARG A C     1 
ATOM   2360 O  O     . ARG A 1 306 ? 61.382 -22.695 1.385   1.00 9.81  ? 303 ARG A O     1 
ATOM   2361 C  CB    . ARG A 1 306 ? 59.505 -24.926 1.646   1.00 10.87 ? 303 ARG A CB    1 
ATOM   2362 C  CG    . ARG A 1 306 ? 58.951 -26.153 2.354   1.00 10.76 ? 303 ARG A CG    1 
ATOM   2363 C  CD    . ARG A 1 306 ? 58.787 -27.347 1.427   1.00 14.29 ? 303 ARG A CD    1 
ATOM   2364 N  NE    . ARG A 1 306 ? 58.569 -28.568 2.197   1.00 15.53 ? 303 ARG A NE    1 
ATOM   2365 C  CZ    . ARG A 1 306 ? 57.439 -28.859 2.832   1.00 12.50 ? 303 ARG A CZ    1 
ATOM   2366 N  NH1   . ARG A 1 306 ? 57.333 -29.990 3.516   1.00 14.78 ? 303 ARG A NH1   1 
ATOM   2367 N  NH2   . ARG A 1 306 ? 56.414 -28.019 2.783   1.00 8.13  ? 303 ARG A NH2   1 
ATOM   2368 N  N     . GLY A 1 307 ? 59.611 -21.364 1.793   1.00 6.23  ? 304 GLY A N     1 
ATOM   2369 C  CA    . GLY A 1 307 ? 60.222 -20.173 1.230   1.00 7.40  ? 304 GLY A CA    1 
ATOM   2370 C  C     . GLY A 1 307 ? 60.058 -20.066 -0.275  1.00 8.70  ? 304 GLY A C     1 
ATOM   2371 O  O     . GLY A 1 307 ? 60.762 -19.299 -0.932  1.00 8.12  ? 304 GLY A O     1 
ATOM   2372 N  N     . ILE A 1 308 ? 59.121 -20.834 -0.821  1.00 9.00  ? 305 ILE A N     1 
ATOM   2373 C  CA    . ILE A 1 308 ? 58.921 -20.895 -2.266  1.00 11.97 ? 305 ILE A CA    1 
ATOM   2374 C  C     . ILE A 1 308 ? 57.570 -20.321 -2.682  1.00 10.01 ? 305 ILE A C     1 
ATOM   2375 O  O     . ILE A 1 308 ? 56.531 -20.708 -2.152  1.00 10.51 ? 305 ILE A O     1 
ATOM   2376 C  CB    . ILE A 1 308 ? 59.022 -22.346 -2.779  1.00 12.70 ? 305 ILE A CB    1 
ATOM   2377 C  CG1   . ILE A 1 308 ? 60.389 -22.939 -2.432  1.00 11.21 ? 305 ILE A CG1   1 
ATOM   2378 C  CG2   . ILE A 1 308 ? 58.776 -22.406 -4.280  1.00 17.19 ? 305 ILE A CG2   1 
ATOM   2379 C  CD1   . ILE A 1 308 ? 60.553 -24.383 -2.854  1.00 18.63 ? 305 ILE A CD1   1 
ATOM   2380 N  N     . GLU A 1 309 ? 57.595 -19.397 -3.639  1.00 10.65 ? 306 GLU A N     1 
ATOM   2381 C  CA    . GLU A 1 309 ? 56.374 -18.822 -4.191  1.00 14.92 ? 306 GLU A CA    1 
ATOM   2382 C  C     . GLU A 1 309 ? 56.645 -18.376 -5.624  1.00 18.47 ? 306 GLU A C     1 
ATOM   2383 O  O     . GLU A 1 309 ? 57.751 -17.946 -5.941  1.00 16.34 ? 306 GLU A O     1 
ATOM   2384 C  CB    . GLU A 1 309 ? 55.907 -17.635 -3.350  1.00 10.79 ? 306 GLU A CB    1 
ATOM   2385 C  CG    . GLU A 1 309 ? 54.486 -17.203 -3.648  1.00 15.96 ? 306 GLU A CG    1 
ATOM   2386 C  CD    . GLU A 1 309 ? 54.299 -15.704 -3.579  1.00 18.27 ? 306 GLU A CD    1 
ATOM   2387 O  OE1   . GLU A 1 309 ? 55.312 -14.974 -3.518  1.00 16.41 ? 306 GLU A OE1   1 
ATOM   2388 O  OE2   . GLU A 1 309 ? 53.134 -15.257 -3.594  1.00 20.72 ? 306 GLU A OE2   1 
ATOM   2389 N  N     . HIS A 1 310 ? 55.643 -18.471 -6.492  1.00 15.74 ? 307 HIS A N     1 
ATOM   2390 C  CA    . HIS A 1 310 ? 55.881 -18.221 -7.912  1.00 18.32 ? 307 HIS A CA    1 
ATOM   2391 C  C     . HIS A 1 310 ? 55.077 -17.068 -8.515  1.00 16.44 ? 307 HIS A C     1 
ATOM   2392 O  O     . HIS A 1 310 ? 55.155 -16.826 -9.719  1.00 19.06 ? 307 HIS A O     1 
ATOM   2393 C  CB    . HIS A 1 310 ? 55.671 -19.503 -8.724  1.00 22.63 ? 307 HIS A CB    1 
ATOM   2394 C  CG    . HIS A 1 310 ? 56.606 -20.610 -8.350  1.00 31.42 ? 307 HIS A CG    1 
ATOM   2395 N  ND1   . HIS A 1 310 ? 57.975 -20.448 -8.318  1.00 28.00 ? 307 HIS A ND1   1 
ATOM   2396 C  CD2   . HIS A 1 310 ? 56.371 -21.895 -7.991  1.00 30.53 ? 307 HIS A CD2   1 
ATOM   2397 C  CE1   . HIS A 1 310 ? 58.543 -21.585 -7.955  1.00 29.27 ? 307 HIS A CE1   1 
ATOM   2398 N  NE2   . HIS A 1 310 ? 57.591 -22.479 -7.752  1.00 29.13 ? 307 HIS A NE2   1 
ATOM   2399 N  N     . ASP A 1 311 ? 54.316 -16.358 -7.689  1.00 15.50 ? 308 ASP A N     1 
ATOM   2400 C  CA    . ASP A 1 311 ? 53.563 -15.204 -8.170  1.00 16.35 ? 308 ASP A CA    1 
ATOM   2401 C  C     . ASP A 1 311 ? 54.505 -14.222 -8.866  1.00 16.46 ? 308 ASP A C     1 
ATOM   2402 O  O     . ASP A 1 311 ? 55.472 -13.755 -8.269  1.00 12.21 ? 308 ASP A O     1 
ATOM   2403 C  CB    . ASP A 1 311 ? 52.833 -14.515 -7.018  1.00 15.63 ? 308 ASP A CB    1 
ATOM   2404 C  CG    . ASP A 1 311 ? 51.933 -13.386 -7.492  1.00 21.14 ? 308 ASP A CG    1 
ATOM   2405 O  OD1   . ASP A 1 311 ? 51.863 -12.348 -6.804  1.00 25.80 ? 308 ASP A OD1   1 
ATOM   2406 O  OD2   . ASP A 1 311 ? 51.293 -13.538 -8.554  1.00 27.15 ? 308 ASP A OD2   1 
ATOM   2407 N  N     . PRO A 1 312 ? 54.233 -13.912 -10.143 1.00 15.37 ? 309 PRO A N     1 
ATOM   2408 C  CA    . PRO A 1 312 ? 55.156 -13.051 -10.890 1.00 12.17 ? 309 PRO A CA    1 
ATOM   2409 C  C     . PRO A 1 312 ? 54.987 -11.569 -10.573 1.00 12.58 ? 309 PRO A C     1 
ATOM   2410 O  O     . PRO A 1 312 ? 53.912 -11.133 -10.163 1.00 13.17 ? 309 PRO A O     1 
ATOM   2411 C  CB    . PRO A 1 312 ? 54.772 -13.320 -12.347 1.00 15.02 ? 309 PRO A CB    1 
ATOM   2412 C  CG    . PRO A 1 312 ? 53.320 -13.666 -12.282 1.00 15.85 ? 309 PRO A CG    1 
ATOM   2413 C  CD    . PRO A 1 312 ? 53.133 -14.413 -10.986 1.00 15.06 ? 309 PRO A CD    1 
ATOM   2414 N  N     . VAL A 1 313 ? 56.060 -10.807 -10.756 1.00 13.05 ? 310 VAL A N     1 
ATOM   2415 C  CA    . VAL A 1 313 ? 55.987 -9.357  -10.671 1.00 13.15 ? 310 VAL A CA    1 
ATOM   2416 C  C     . VAL A 1 313 ? 55.308 -8.860  -11.939 1.00 13.82 ? 310 VAL A C     1 
ATOM   2417 O  O     . VAL A 1 313 ? 55.904 -8.867  -13.014 1.00 14.06 ? 310 VAL A O     1 
ATOM   2418 C  CB    . VAL A 1 313 ? 57.386 -8.729  -10.561 1.00 13.57 ? 310 VAL A CB    1 
ATOM   2419 C  CG1   . VAL A 1 313 ? 57.295 -7.207  -10.559 1.00 12.90 ? 310 VAL A CG1   1 
ATOM   2420 C  CG2   . VAL A 1 313 ? 58.091 -9.227  -9.310  1.00 11.77 ? 310 VAL A CG2   1 
ATOM   2421 N  N     . LYS A 1 314 ? 54.052 -8.450  -11.813 1.00 13.60 ? 311 LYS A N     1 
ATOM   2422 C  CA    . LYS A 1 314 ? 53.264 -8.055  -12.972 1.00 13.32 ? 311 LYS A CA    1 
ATOM   2423 C  C     . LYS A 1 314 ? 53.664 -6.675  -13.480 1.00 12.09 ? 311 LYS A C     1 
ATOM   2424 O  O     . LYS A 1 314 ? 53.783 -5.729  -12.701 1.00 11.93 ? 311 LYS A O     1 
ATOM   2425 C  CB    . LYS A 1 314 ? 51.771 -8.104  -12.643 1.00 13.86 ? 311 LYS A CB    1 
ATOM   2426 C  CG    . LYS A 1 314 ? 51.281 -9.506  -12.305 1.00 18.26 ? 311 LYS A CG    1 
ATOM   2427 C  CD    . LYS A 1 314 ? 49.870 -9.496  -11.749 1.00 23.51 ? 311 LYS A CD    1 
ATOM   2428 C  CE    . LYS A 1 314 ? 49.445 -10.896 -11.334 1.00 28.34 ? 311 LYS A CE    1 
ATOM   2429 N  NZ    . LYS A 1 314 ? 50.428 -11.516 -10.394 1.00 30.28 ? 311 LYS A NZ    1 
ATOM   2430 N  N     . PRO A 1 315 ? 53.888 -6.564  -14.796 1.00 14.45 ? 312 PRO A N     1 
ATOM   2431 C  CA    . PRO A 1 315 ? 54.249 -5.287  -15.418 1.00 12.67 ? 312 PRO A CA    1 
ATOM   2432 C  C     . PRO A 1 315 ? 53.066 -4.327  -15.421 1.00 14.85 ? 312 PRO A C     1 
ATOM   2433 O  O     . PRO A 1 315 ? 52.337 -4.250  -16.411 1.00 14.39 ? 312 PRO A O     1 
ATOM   2434 C  CB    . PRO A 1 315 ? 54.609 -5.688  -16.852 1.00 17.22 ? 312 PRO A CB    1 
ATOM   2435 C  CG    . PRO A 1 315 ? 53.842 -6.947  -17.093 1.00 13.89 ? 312 PRO A CG    1 
ATOM   2436 C  CD    . PRO A 1 315 ? 53.824 -7.663  -15.775 1.00 14.48 ? 312 PRO A CD    1 
ATOM   2437 N  N     . ARG A 1 316 ? 52.879 -3.607  -14.320 1.00 12.34 ? 313 ARG A N     1 
ATOM   2438 C  CA    . ARG A 1 316 ? 51.767 -2.670  -14.200 1.00 14.04 ? 313 ARG A CA    1 
ATOM   2439 C  C     . ARG A 1 316 ? 52.146 -1.507  -13.294 1.00 15.33 ? 313 ARG A C     1 
ATOM   2440 O  O     . ARG A 1 316 ? 52.314 -1.679  -12.088 1.00 13.44 ? 313 ARG A O     1 
ATOM   2441 C  CB    . ARG A 1 316 ? 50.527 -3.376  -13.647 1.00 15.85 ? 313 ARG A CB    1 
ATOM   2442 C  CG    A ARG A 1 316 ? 49.295 -2.492  -13.546 0.50 18.05 ? 313 ARG A CG    1 
ATOM   2443 C  CG    B ARG A 1 316 ? 49.287 -2.497  -13.626 0.50 18.04 ? 313 ARG A CG    1 
ATOM   2444 C  CD    A ARG A 1 316 ? 48.176 -3.181  -12.776 0.50 17.67 ? 313 ARG A CD    1 
ATOM   2445 C  CD    B ARG A 1 316 ? 48.104 -3.211  -12.995 0.50 17.60 ? 313 ARG A CD    1 
ATOM   2446 N  NE    A ARG A 1 316 ? 48.490 -3.320  -11.355 0.50 17.73 ? 313 ARG A NE    1 
ATOM   2447 N  NE    B ARG A 1 316 ? 48.417 -3.704  -11.657 0.50 17.96 ? 313 ARG A NE    1 
ATOM   2448 C  CZ    A ARG A 1 316 ? 48.823 -4.465  -10.767 0.50 19.48 ? 313 ARG A CZ    1 
ATOM   2449 C  CZ    B ARG A 1 316 ? 48.375 -2.960  -10.556 0.50 17.38 ? 313 ARG A CZ    1 
ATOM   2450 N  NH1   A ARG A 1 316 ? 49.091 -4.490  -9.468  0.50 17.68 ? 313 ARG A NH1   1 
ATOM   2451 N  NH1   B ARG A 1 316 ? 48.678 -3.498  -9.383  0.50 15.65 ? 313 ARG A NH1   1 
ATOM   2452 N  NH2   A ARG A 1 316 ? 48.883 -5.587  -11.473 0.50 19.73 ? 313 ARG A NH2   1 
ATOM   2453 N  NH2   B ARG A 1 316 ? 48.035 -1.680  -10.627 0.50 17.16 ? 313 ARG A NH2   1 
ATOM   2454 N  N     . GLN A 1 317 ? 52.278 -0.321  -13.875 1.00 15.58 ? 314 GLN A N     1 
ATOM   2455 C  CA    . GLN A 1 317 ? 52.714 0.846   -13.117 1.00 20.29 ? 314 GLN A CA    1 
ATOM   2456 C  C     . GLN A 1 317 ? 51.541 1.749   -12.748 1.00 19.44 ? 314 GLN A C     1 
ATOM   2457 O  O     . GLN A 1 317 ? 51.642 2.574   -11.838 1.00 19.86 ? 314 GLN A O     1 
ATOM   2458 C  CB    . GLN A 1 317 ? 53.760 1.633   -13.910 1.00 22.95 ? 314 GLN A CB    1 
ATOM   2459 C  CG    . GLN A 1 317 ? 54.385 2.782   -13.141 1.00 27.09 ? 314 GLN A CG    1 
ATOM   2460 C  CD    . GLN A 1 317 ? 55.463 3.491   -13.932 1.00 26.15 ? 314 GLN A CD    1 
ATOM   2461 O  OE1   . GLN A 1 317 ? 55.865 3.033   -15.002 1.00 30.75 ? 314 GLN A OE1   1 
ATOM   2462 N  NE2   . GLN A 1 317 ? 55.938 4.617   -13.409 1.00 25.53 ? 314 GLN A NE2   1 
ATOM   2463 N  N     . LEU A 1 318 ? 50.430 1.585   -13.458 1.00 17.61 ? 315 LEU A N     1 
ATOM   2464 C  CA    . LEU A 1 318 ? 49.245 2.402   -13.232 1.00 17.57 ? 315 LEU A CA    1 
ATOM   2465 C  C     . LEU A 1 318 ? 48.150 1.591   -12.549 1.00 14.81 ? 315 LEU A C     1 
ATOM   2466 O  O     . LEU A 1 318 ? 48.035 0.387   -12.770 1.00 14.90 ? 315 LEU A O     1 
ATOM   2467 C  CB    . LEU A 1 318 ? 48.718 2.947   -14.561 1.00 19.56 ? 315 LEU A CB    1 
ATOM   2468 C  CG    . LEU A 1 318 ? 49.694 3.731   -15.441 1.00 19.15 ? 315 LEU A CG    1 
ATOM   2469 C  CD1   . LEU A 1 318 ? 49.077 4.005   -16.808 1.00 19.04 ? 315 LEU A CD1   1 
ATOM   2470 C  CD2   . LEU A 1 318 ? 50.122 5.028   -14.765 1.00 16.57 ? 315 LEU A CD2   1 
ATOM   2471 N  N     . PRO A 1 319 ? 47.335 2.253   -11.717 1.00 14.28 ? 316 PRO A N     1 
ATOM   2472 C  CA    . PRO A 1 319 ? 46.181 1.579   -11.112 1.00 17.18 ? 316 PRO A CA    1 
ATOM   2473 C  C     . PRO A 1 319 ? 45.191 1.107   -12.178 1.00 16.84 ? 316 PRO A C     1 
ATOM   2474 O  O     . PRO A 1 319 ? 45.056 1.754   -13.215 1.00 18.00 ? 316 PRO A O     1 
ATOM   2475 C  CB    . PRO A 1 319 ? 45.553 2.669   -10.233 1.00 17.96 ? 316 PRO A CB    1 
ATOM   2476 C  CG    . PRO A 1 319 ? 46.095 3.963   -10.760 1.00 24.12 ? 316 PRO A CG    1 
ATOM   2477 C  CD    . PRO A 1 319 ? 47.463 3.652   -11.274 1.00 16.15 ? 316 PRO A CD    1 
ATOM   2478 N  N     . LYS A 1 320 ? 44.519 -0.012  -11.918 1.00 18.30 ? 317 LYS A N     1 
ATOM   2479 C  CA    . LYS A 1 320 ? 43.544 -0.584  -12.844 1.00 18.58 ? 317 LYS A CA    1 
ATOM   2480 C  C     . LYS A 1 320 ? 42.202 0.124   -12.746 1.00 19.39 ? 317 LYS A C     1 
ATOM   2481 O  O     . LYS A 1 320 ? 41.387 0.062   -13.666 1.00 16.89 ? 317 LYS A O     1 
ATOM   2482 C  CB    . LYS A 1 320 ? 43.327 -2.070  -12.545 1.00 19.56 ? 317 LYS A CB    1 
ATOM   2483 C  CG    . LYS A 1 320 ? 44.520 -2.967  -12.813 1.00 22.81 ? 317 LYS A CG    1 
ATOM   2484 C  CD    . LYS A 1 320 ? 44.093 -4.427  -12.823 1.00 23.33 ? 317 LYS A CD    1 
ATOM   2485 C  CE    . LYS A 1 320 ? 45.207 -5.332  -13.320 1.00 29.50 ? 317 LYS A CE    1 
ATOM   2486 N  NZ    . LYS A 1 320 ? 44.739 -6.730  -13.516 1.00 30.21 ? 317 LYS A NZ    1 
ATOM   2487 N  N     . THR A 1 321 ? 41.967 0.780   -11.616 1.00 16.98 ? 318 THR A N     1 
ATOM   2488 C  CA    . THR A 1 321 ? 40.698 1.449   -11.380 1.00 15.62 ? 318 THR A CA    1 
ATOM   2489 C  C     . THR A 1 321 ? 40.910 2.847   -10.817 1.00 15.05 ? 318 THR A C     1 
ATOM   2490 O  O     . THR A 1 321 ? 41.955 3.147   -10.238 1.00 16.08 ? 318 THR A O     1 
ATOM   2491 C  CB    . THR A 1 321 ? 39.802 0.642   -10.413 1.00 18.47 ? 318 THR A CB    1 
ATOM   2492 O  OG1   . THR A 1 321 ? 40.497 0.424   -9.178  1.00 18.50 ? 318 THR A OG1   1 
ATOM   2493 C  CG2   . THR A 1 321 ? 39.431 -0.697  -11.020 1.00 15.31 ? 318 THR A CG2   1 
ATOM   2494 N  N     . ILE A 1 322 ? 39.912 3.701   -11.006 1.00 13.89 ? 319 ILE A N     1 
ATOM   2495 C  CA    . ILE A 1 322 ? 39.908 5.034   -10.419 1.00 16.58 ? 319 ILE A CA    1 
ATOM   2496 C  C     . ILE A 1 322 ? 38.589 5.227   -9.682  1.00 15.44 ? 319 ILE A C     1 
ATOM   2497 O  O     . ILE A 1 322 ? 37.524 5.262   -10.299 1.00 13.42 ? 319 ILE A O     1 
ATOM   2498 C  CB    . ILE A 1 322 ? 40.071 6.125   -11.492 1.00 12.41 ? 319 ILE A CB    1 
ATOM   2499 C  CG1   . ILE A 1 322 ? 41.398 5.943   -12.233 1.00 16.94 ? 319 ILE A CG1   1 
ATOM   2500 C  CG2   . ILE A 1 322 ? 39.997 7.511   -10.862 1.00 14.41 ? 319 ILE A CG2   1 
ATOM   2501 C  CD1   . ILE A 1 322 ? 41.671 7.013   -13.271 1.00 17.37 ? 319 ILE A CD1   1 
ATOM   2502 N  N     . GLY A 1 323 ? 38.661 5.341   -8.360  1.00 12.80 ? 320 GLY A N     1 
ATOM   2503 C  CA    . GLY A 1 323 ? 37.462 5.375   -7.543  1.00 14.17 ? 320 GLY A CA    1 
ATOM   2504 C  C     . GLY A 1 323 ? 37.361 6.552   -6.592  1.00 14.58 ? 320 GLY A C     1 
ATOM   2505 O  O     . GLY A 1 323 ? 38.366 7.150   -6.207  1.00 12.77 ? 320 GLY A O     1 
ATOM   2506 N  N     . CYS A 1 324 ? 36.125 6.869   -6.218  1.00 13.06 ? 321 CYS A N     1 
ATOM   2507 C  CA    A CYS A 1 324 ? 35.834 7.962   -5.302  0.40 14.24 ? 321 CYS A CA    1 
ATOM   2508 C  CA    B CYS A 1 324 ? 35.836 7.957   -5.289  0.60 14.20 ? 321 CYS A CA    1 
ATOM   2509 C  C     . CYS A 1 324 ? 34.779 7.488   -4.301  1.00 14.97 ? 321 CYS A C     1 
ATOM   2510 O  O     . CYS A 1 324 ? 33.730 6.984   -4.697  1.00 13.48 ? 321 CYS A O     1 
ATOM   2511 C  CB    A CYS A 1 324 ? 35.317 9.165   -6.094  0.40 15.02 ? 321 CYS A CB    1 
ATOM   2512 C  CB    B CYS A 1 324 ? 35.323 9.193   -6.035  0.60 15.01 ? 321 CYS A CB    1 
ATOM   2513 S  SG    A CYS A 1 324 ? 35.386 10.747  -5.237  0.40 18.09 ? 321 CYS A SG    1 
ATOM   2514 S  SG    B CYS A 1 324 ? 36.491 9.934   -7.195  0.60 21.63 ? 321 CYS A SG    1 
ATOM   2515 N  N     . SER A 1 325 ? 35.053 7.645   -3.008  1.00 12.57 ? 322 SER A N     1 
ATOM   2516 C  CA    . SER A 1 325 ? 34.130 7.145   -1.989  1.00 14.94 ? 322 SER A CA    1 
ATOM   2517 C  C     . SER A 1 325 ? 34.033 8.034   -0.751  1.00 12.98 ? 322 SER A C     1 
ATOM   2518 O  O     . SER A 1 325 ? 35.005 8.676   -0.356  1.00 14.27 ? 322 SER A O     1 
ATOM   2519 C  CB    . SER A 1 325 ? 34.521 5.721   -1.577  1.00 13.30 ? 322 SER A CB    1 
ATOM   2520 O  OG    A SER A 1 325 ? 35.673 5.722   -0.757  0.50 12.13 ? 322 SER A OG    1 
ATOM   2521 O  OG    B SER A 1 325 ? 33.972 5.373   -0.319  0.50 16.80 ? 322 SER A OG    1 
ATOM   2522 N  N     . LYS A 1 326 ? 32.852 8.057   -0.140  1.00 13.04 ? 323 LYS A N     1 
ATOM   2523 C  CA    . LYS A 1 326 ? 32.655 8.790   1.105   1.00 14.47 ? 323 LYS A CA    1 
ATOM   2524 C  C     . LYS A 1 326 ? 31.694 8.072   2.049   1.00 14.83 ? 323 LYS A C     1 
ATOM   2525 O  O     . LYS A 1 326 ? 30.646 7.583   1.627   1.00 14.42 ? 323 LYS A O     1 
ATOM   2526 C  CB    . LYS A 1 326 ? 32.153 10.208  0.829   1.00 12.63 ? 323 LYS A CB    1 
ATOM   2527 C  CG    . LYS A 1 326 ? 31.956 11.036  2.091   1.00 17.74 ? 323 LYS A CG    1 
ATOM   2528 C  CD    . LYS A 1 326 ? 31.644 12.486  1.769   1.00 16.43 ? 323 LYS A CD    1 
ATOM   2529 C  CE    . LYS A 1 326 ? 31.448 13.296  3.040   1.00 19.21 ? 323 LYS A CE    1 
ATOM   2530 N  NZ    . LYS A 1 326 ? 32.639 13.217  3.927   1.00 20.99 ? 323 LYS A NZ    1 
ATOM   2531 N  N     . ASN A 1 327 ? 32.067 8.010   3.324   1.00 14.66 ? 324 ASN A N     1 
ATOM   2532 C  CA    . ASN A 1 327 ? 31.210 7.450   4.362   1.00 18.02 ? 324 ASN A CA    1 
ATOM   2533 C  C     . ASN A 1 327 ? 30.320 8.520   4.977   1.00 15.79 ? 324 ASN A C     1 
ATOM   2534 O  O     . ASN A 1 327 ? 30.690 9.692   5.035   1.00 13.53 ? 324 ASN A O     1 
ATOM   2535 C  CB    . ASN A 1 327 ? 32.047 6.804   5.469   1.00 17.41 ? 324 ASN A CB    1 
ATOM   2536 C  CG    . ASN A 1 327 ? 32.595 5.446   5.078   1.00 20.83 ? 324 ASN A CG    1 
ATOM   2537 O  OD1   . ASN A 1 327 ? 32.392 4.973   3.960   1.00 21.62 ? 324 ASN A OD1   1 
ATOM   2538 N  ND2   . ASN A 1 327 ? 33.303 4.811   6.004   1.00 27.56 ? 324 ASN A ND2   1 
ATOM   2539 N  N     . PHE A 1 328 ? 29.149 8.103   5.446   1.00 16.35 ? 325 PHE A N     1 
ATOM   2540 C  CA    . PHE A 1 328 ? 28.219 9.001   6.114   1.00 20.28 ? 325 PHE A CA    1 
ATOM   2541 C  C     . PHE A 1 328 ? 27.754 8.356   7.413   1.00 21.05 ? 325 PHE A C     1 
ATOM   2542 O  O     . PHE A 1 328 ? 26.657 7.805   7.485   1.00 20.07 ? 325 PHE A O     1 
ATOM   2543 C  CB    . PHE A 1 328 ? 27.037 9.319   5.199   1.00 19.45 ? 325 PHE A CB    1 
ATOM   2544 C  CG    . PHE A 1 328 ? 27.445 9.904   3.877   1.00 18.78 ? 325 PHE A CG    1 
ATOM   2545 C  CD1   . PHE A 1 328 ? 27.608 9.092   2.766   1.00 17.66 ? 325 PHE A CD1   1 
ATOM   2546 C  CD2   . PHE A 1 328 ? 27.684 11.263  3.751   1.00 15.84 ? 325 PHE A CD2   1 
ATOM   2547 C  CE1   . PHE A 1 328 ? 27.991 9.627   1.550   1.00 15.92 ? 325 PHE A CE1   1 
ATOM   2548 C  CE2   . PHE A 1 328 ? 28.067 11.804  2.538   1.00 17.51 ? 325 PHE A CE2   1 
ATOM   2549 C  CZ    . PHE A 1 328 ? 28.222 10.983  1.435   1.00 17.22 ? 325 PHE A CZ    1 
ATOM   2550 N  N     . PRO A 1 329 ? 28.606 8.423   8.445   1.00 23.97 ? 326 PRO A N     1 
ATOM   2551 C  CA    . PRO A 1 329 ? 28.425 7.707   9.713   1.00 26.73 ? 326 PRO A CA    1 
ATOM   2552 C  C     . PRO A 1 329 ? 27.308 8.262   10.592  1.00 28.14 ? 326 PRO A C     1 
ATOM   2553 O  O     . PRO A 1 329 ? 26.997 9.453   10.545  1.00 23.37 ? 326 PRO A O     1 
ATOM   2554 C  CB    . PRO A 1 329 ? 29.778 7.892   10.406  1.00 33.51 ? 326 PRO A CB    1 
ATOM   2555 C  CG    . PRO A 1 329 ? 30.297 9.177   9.863   1.00 30.25 ? 326 PRO A CG    1 
ATOM   2556 C  CD    . PRO A 1 329 ? 29.849 9.213   8.429   1.00 24.91 ? 326 PRO A CD    1 
ATOM   2557 N  N     . GLY A 1 330 ? 26.717 7.378   11.391  1.00 30.64 ? 327 GLY A N     1 
ATOM   2558 C  CA    . GLY A 1 330 ? 25.719 7.751   12.375  1.00 31.29 ? 327 GLY A CA    1 
ATOM   2559 C  C     . GLY A 1 330 ? 24.650 8.706   11.884  1.00 29.40 ? 327 GLY A C     1 
ATOM   2560 O  O     . GLY A 1 330 ? 23.893 8.396   10.963  1.00 29.88 ? 327 GLY A O     1 
ATOM   2561 N  N     . LYS A 1 331 ? 24.599 9.878   12.506  1.00 29.29 ? 328 LYS A N     1 
ATOM   2562 C  CA    . LYS A 1 331 ? 23.535 10.844  12.262  1.00 33.94 ? 328 LYS A CA    1 
ATOM   2563 C  C     . LYS A 1 331 ? 23.629 11.504  10.888  1.00 28.21 ? 328 LYS A C     1 
ATOM   2564 O  O     . LYS A 1 331 ? 22.649 12.060  10.395  1.00 33.69 ? 328 LYS A O     1 
ATOM   2565 C  CB    . LYS A 1 331 ? 23.534 11.907  13.366  1.00 39.55 ? 328 LYS A CB    1 
ATOM   2566 C  CG    . LYS A 1 331 ? 22.394 12.908  13.277  1.00 50.65 ? 328 LYS A CG    1 
ATOM   2567 C  CD    . LYS A 1 331 ? 22.414 13.874  14.454  1.00 52.71 ? 328 LYS A CD    1 
ATOM   2568 C  CE    . LYS A 1 331 ? 21.302 14.906  14.341  1.00 46.15 ? 328 LYS A CE    1 
ATOM   2569 N  NZ    . LYS A 1 331 ? 21.436 15.729  13.106  1.00 44.44 ? 328 LYS A NZ    1 
ATOM   2570 N  N     . THR A 1 332 ? 24.804 11.438  10.268  1.00 29.66 ? 329 THR A N     1 
ATOM   2571 C  CA    . THR A 1 332 ? 25.013 12.094  8.979   1.00 28.42 ? 329 THR A CA    1 
ATOM   2572 C  C     . THR A 1 332 ? 24.550 11.238  7.800   1.00 21.97 ? 329 THR A C     1 
ATOM   2573 O  O     . THR A 1 332 ? 24.651 11.655  6.647   1.00 23.87 ? 329 THR A O     1 
ATOM   2574 C  CB    . THR A 1 332 ? 26.490 12.495  8.767   1.00 27.61 ? 329 THR A CB    1 
ATOM   2575 O  OG1   . THR A 1 332 ? 27.295 11.318  8.629   1.00 22.66 ? 329 THR A OG1   1 
ATOM   2576 C  CG2   . THR A 1 332 ? 26.995 13.326  9.941   1.00 28.12 ? 329 THR A CG2   1 
ATOM   2577 N  N     . ALA A 1 333 ? 24.045 10.044  8.093   1.00 25.37 ? 330 ALA A N     1 
ATOM   2578 C  CA    . ALA A 1 333 ? 23.548 9.150   7.051   1.00 26.23 ? 330 ALA A CA    1 
ATOM   2579 C  C     . ALA A 1 333 ? 22.538 9.864   6.157   1.00 28.93 ? 330 ALA A C     1 
ATOM   2580 O  O     . ALA A 1 333 ? 21.644 10.556  6.646   1.00 28.97 ? 330 ALA A O     1 
ATOM   2581 C  CB    . ALA A 1 333 ? 22.932 7.903   7.667   1.00 28.66 ? 330 ALA A CB    1 
ATOM   2582 N  N     . LEU A 1 334 ? 22.686 9.694   4.847   1.00 27.96 ? 331 LEU A N     1 
ATOM   2583 C  CA    . LEU A 1 334 ? 21.829 10.376  3.881   1.00 26.22 ? 331 LEU A CA    1 
ATOM   2584 C  C     . LEU A 1 334 ? 20.403 9.832   3.926   1.00 28.94 ? 331 LEU A C     1 
ATOM   2585 O  O     . LEU A 1 334 ? 20.187 8.628   3.800   1.00 31.54 ? 331 LEU A O     1 
ATOM   2586 C  CB    . LEU A 1 334 ? 22.407 10.240  2.472   1.00 24.67 ? 331 LEU A CB    1 
ATOM   2587 C  CG    . LEU A 1 334 ? 23.906 10.527  2.356   1.00 21.36 ? 331 LEU A CG    1 
ATOM   2588 C  CD1   . LEU A 1 334 ? 24.352 10.469  0.904   1.00 17.56 ? 331 LEU A CD1   1 
ATOM   2589 C  CD2   . LEU A 1 334 ? 24.246 11.877  2.974   1.00 16.33 ? 331 LEU A CD2   1 
ATOM   2590 N  N     . ALA A 1 335 ? 19.433 10.724  4.098   1.00 32.84 ? 332 ALA A N     1 
ATOM   2591 C  CA    . ALA A 1 335 ? 18.049 10.308  4.313   1.00 32.92 ? 332 ALA A CA    1 
ATOM   2592 C  C     . ALA A 1 335 ? 17.054 10.954  3.350   1.00 34.15 ? 332 ALA A C     1 
ATOM   2593 O  O     . ALA A 1 335 ? 15.851 10.705  3.437   1.00 37.56 ? 332 ALA A O     1 
ATOM   2594 C  CB    . ALA A 1 335 ? 17.639 10.576  5.755   1.00 30.29 ? 332 ALA A CB    1 
ATOM   2595 N  N     . THR A 1 336 ? 17.551 11.784  2.439   1.00 31.61 ? 333 THR A N     1 
ATOM   2596 C  CA    . THR A 1 336 ? 16.692 12.417  1.444   1.00 33.16 ? 333 THR A CA    1 
ATOM   2597 C  C     . THR A 1 336 ? 17.214 12.168  0.032   1.00 37.53 ? 333 THR A C     1 
ATOM   2598 O  O     . THR A 1 336 ? 18.394 11.876  -0.159  1.00 32.24 ? 333 THR A O     1 
ATOM   2599 C  CB    . THR A 1 336 ? 16.573 13.937  1.671   1.00 32.17 ? 333 THR A CB    1 
ATOM   2600 O  OG1   . THR A 1 336 ? 17.785 14.583  1.265   1.00 30.05 ? 333 THR A OG1   1 
ATOM   2601 C  CG2   . THR A 1 336 ? 16.297 14.243  3.137   1.00 33.00 ? 333 THR A CG2   1 
ATOM   2602 N  N     . ARG A 1 337 ? 16.329 12.286  -0.952  1.00 39.02 ? 334 ARG A N     1 
ATOM   2603 C  CA    . ARG A 1 337 ? 16.706 12.092  -2.347  1.00 36.12 ? 334 ARG A CA    1 
ATOM   2604 C  C     . ARG A 1 337 ? 17.660 13.185  -2.816  1.00 33.78 ? 334 ARG A C     1 
ATOM   2605 O  O     . ARG A 1 337 ? 18.610 12.917  -3.552  1.00 32.92 ? 334 ARG A O     1 
ATOM   2606 C  CB    . ARG A 1 337 ? 15.464 12.055  -3.241  1.00 40.67 ? 334 ARG A CB    1 
ATOM   2607 C  CG    . ARG A 1 337 ? 15.771 11.986  -4.728  1.00 43.57 ? 334 ARG A CG    1 
ATOM   2608 C  CD    . ARG A 1 337 ? 14.497 11.949  -5.558  1.00 45.99 ? 334 ARG A CD    1 
ATOM   2609 N  NE    . ARG A 1 337 ? 13.591 13.043  -5.219  1.00 52.93 ? 334 ARG A NE    1 
ATOM   2610 C  CZ    . ARG A 1 337 ? 13.678 14.271  -5.722  1.00 55.36 ? 334 ARG A CZ    1 
ATOM   2611 N  NH1   . ARG A 1 337 ? 14.637 14.570  -6.589  1.00 53.31 ? 334 ARG A NH1   1 
ATOM   2612 N  NH2   . ARG A 1 337 ? 12.808 15.203  -5.356  1.00 56.44 ? 334 ARG A NH2   1 
ATOM   2613 N  N     . GLU A 1 338 ? 17.402 14.417  -2.389  1.00 35.43 ? 335 GLU A N     1 
ATOM   2614 C  CA    . GLU A 1 338 ? 18.262 15.544  -2.736  1.00 35.22 ? 335 GLU A CA    1 
ATOM   2615 C  C     . GLU A 1 338 ? 19.671 15.350  -2.182  1.00 32.02 ? 335 GLU A C     1 
ATOM   2616 O  O     . GLU A 1 338 ? 20.656 15.727  -2.819  1.00 30.61 ? 335 GLU A O     1 
ATOM   2617 C  CB    . GLU A 1 338 ? 17.668 16.854  -2.213  1.00 31.94 ? 335 GLU A CB    1 
ATOM   2618 C  CG    . GLU A 1 338 ? 16.410 17.310  -2.939  1.00 44.43 ? 335 GLU A CG    1 
ATOM   2619 C  CD    . GLU A 1 338 ? 16.705 17.934  -4.292  1.00 51.14 ? 335 GLU A CD    1 
ATOM   2620 O  OE1   . GLU A 1 338 ? 17.888 18.222  -4.571  1.00 48.90 ? 335 GLU A OE1   1 
ATOM   2621 O  OE2   . GLU A 1 338 ? 15.752 18.139  -5.075  1.00 50.19 ? 335 GLU A OE2   1 
ATOM   2622 N  N     . GLN A 1 339 ? 19.760 14.765  -0.992  1.00 28.15 ? 336 GLN A N     1 
ATOM   2623 C  CA    . GLN A 1 339 ? 21.050 14.491  -0.368  1.00 30.08 ? 336 GLN A CA    1 
ATOM   2624 C  C     . GLN A 1 339 ? 21.851 13.489  -1.188  1.00 27.38 ? 336 GLN A C     1 
ATOM   2625 O  O     . GLN A 1 339 ? 22.994 13.750  -1.565  1.00 23.87 ? 336 GLN A O     1 
ATOM   2626 C  CB    . GLN A 1 339 ? 20.862 13.956  1.051   1.00 30.36 ? 336 GLN A CB    1 
ATOM   2627 C  CG    . GLN A 1 339 ? 21.045 14.992  2.143   1.00 25.90 ? 336 GLN A CG    1 
ATOM   2628 C  CD    . GLN A 1 339 ? 21.117 14.365  3.521   1.00 29.32 ? 336 GLN A CD    1 
ATOM   2629 O  OE1   . GLN A 1 339 ? 20.361 13.445  3.838   1.00 28.18 ? 336 GLN A OE1   1 
ATOM   2630 N  NE2   . GLN A 1 339 ? 22.037 14.852  4.346   1.00 29.17 ? 336 GLN A NE2   1 
ATOM   2631 N  N     . VAL A 1 340 ? 21.242 12.337  -1.452  1.00 25.55 ? 337 VAL A N     1 
ATOM   2632 C  CA    . VAL A 1 340 ? 21.878 11.288  -2.237  1.00 23.58 ? 337 VAL A CA    1 
ATOM   2633 C  C     . VAL A 1 340 ? 22.364 11.820  -3.582  1.00 24.58 ? 337 VAL A C     1 
ATOM   2634 O  O     . VAL A 1 340 ? 23.480 11.529  -4.009  1.00 20.85 ? 337 VAL A O     1 
ATOM   2635 C  CB    . VAL A 1 340 ? 20.916 10.109  -2.474  1.00 26.76 ? 337 VAL A CB    1 
ATOM   2636 C  CG1   . VAL A 1 340 ? 21.568 9.056   -3.355  1.00 19.86 ? 337 VAL A CG1   1 
ATOM   2637 C  CG2   . VAL A 1 340 ? 20.480 9.508   -1.147  1.00 24.18 ? 337 VAL A CG2   1 
ATOM   2638 N  N     . GLN A 1 341 ? 21.523 12.610  -4.241  1.00 23.78 ? 338 GLN A N     1 
ATOM   2639 C  CA    . GLN A 1 341 ? 21.853 13.142  -5.556  1.00 26.31 ? 338 GLN A CA    1 
ATOM   2640 C  C     . GLN A 1 341 ? 22.987 14.160  -5.496  1.00 24.62 ? 338 GLN A C     1 
ATOM   2641 O  O     . GLN A 1 341 ? 23.821 14.222  -6.396  1.00 20.84 ? 338 GLN A O     1 
ATOM   2642 C  CB    . GLN A 1 341 ? 20.618 13.764  -6.212  1.00 30.53 ? 338 GLN A CB    1 
ATOM   2643 C  CG    . GLN A 1 341 ? 19.517 12.761  -6.515  1.00 31.68 ? 338 GLN A CG    1 
ATOM   2644 C  CD    . GLN A 1 341 ? 18.332 13.388  -7.222  1.00 38.83 ? 338 GLN A CD    1 
ATOM   2645 O  OE1   . GLN A 1 341 ? 18.183 14.610  -7.249  1.00 41.42 ? 338 GLN A OE1   1 
ATOM   2646 N  NE2   . GLN A 1 341 ? 17.482 12.550  -7.804  1.00 44.56 ? 338 GLN A NE2   1 
ATOM   2647 N  N     . TRP A 1 342 ? 23.017 14.955  -4.433  1.00 23.18 ? 339 TRP A N     1 
ATOM   2648 C  CA    . TRP A 1 342 ? 24.038 15.985  -4.303  1.00 23.61 ? 339 TRP A CA    1 
ATOM   2649 C  C     . TRP A 1 342 ? 25.419 15.382  -4.060  1.00 18.57 ? 339 TRP A C     1 
ATOM   2650 O  O     . TRP A 1 342 ? 26.412 15.844  -4.618  1.00 19.40 ? 339 TRP A O     1 
ATOM   2651 C  CB    . TRP A 1 342 ? 23.685 16.970  -3.187  1.00 21.69 ? 339 TRP A CB    1 
ATOM   2652 C  CG    . TRP A 1 342 ? 24.585 18.165  -3.159  1.00 21.73 ? 339 TRP A CG    1 
ATOM   2653 C  CD1   . TRP A 1 342 ? 24.487 19.283  -3.935  1.00 25.32 ? 339 TRP A CD1   1 
ATOM   2654 C  CD2   . TRP A 1 342 ? 25.727 18.361  -2.317  1.00 23.32 ? 339 TRP A CD2   1 
ATOM   2655 N  NE1   . TRP A 1 342 ? 25.494 20.164  -3.627  1.00 26.75 ? 339 TRP A NE1   1 
ATOM   2656 C  CE2   . TRP A 1 342 ? 26.269 19.622  -2.638  1.00 24.42 ? 339 TRP A CE2   1 
ATOM   2657 C  CE3   . TRP A 1 342 ? 26.342 17.593  -1.325  1.00 20.72 ? 339 TRP A CE3   1 
ATOM   2658 C  CZ2   . TRP A 1 342 ? 27.397 20.132  -1.998  1.00 25.68 ? 339 TRP A CZ2   1 
ATOM   2659 C  CZ3   . TRP A 1 342 ? 27.460 18.102  -0.691  1.00 22.72 ? 339 TRP A CZ3   1 
ATOM   2660 C  CH2   . TRP A 1 342 ? 27.977 19.359  -1.032  1.00 24.34 ? 339 TRP A CH2   1 
ATOM   2661 N  N     . TRP A 1 343 ? 25.476 14.346  -3.230  1.00 17.08 ? 340 TRP A N     1 
ATOM   2662 C  CA    . TRP A 1 343 ? 26.745 13.696  -2.918  1.00 17.24 ? 340 TRP A CA    1 
ATOM   2663 C  C     . TRP A 1 343 ? 27.250 12.812  -4.056  1.00 15.91 ? 340 TRP A C     1 
ATOM   2664 O  O     . TRP A 1 343 ? 28.456 12.684  -4.252  1.00 15.05 ? 340 TRP A O     1 
ATOM   2665 C  CB    . TRP A 1 343 ? 26.656 12.904  -1.611  1.00 17.10 ? 340 TRP A CB    1 
ATOM   2666 C  CG    . TRP A 1 343 ? 26.763 13.773  -0.394  1.00 19.64 ? 340 TRP A CG    1 
ATOM   2667 C  CD1   . TRP A 1 343 ? 25.766 14.083  0.484   1.00 20.09 ? 340 TRP A CD1   1 
ATOM   2668 C  CD2   . TRP A 1 343 ? 27.934 14.459  0.068   1.00 16.94 ? 340 TRP A CD2   1 
ATOM   2669 N  NE1   . TRP A 1 343 ? 26.246 14.914  1.470   1.00 20.88 ? 340 TRP A NE1   1 
ATOM   2670 C  CE2   . TRP A 1 343 ? 27.574 15.159  1.236   1.00 18.43 ? 340 TRP A CE2   1 
ATOM   2671 C  CE3   . TRP A 1 343 ? 29.251 14.545  -0.392  1.00 15.61 ? 340 TRP A CE3   1 
ATOM   2672 C  CZ2   . TRP A 1 343 ? 28.484 15.935  1.952   1.00 21.12 ? 340 TRP A CZ2   1 
ATOM   2673 C  CZ3   . TRP A 1 343 ? 30.153 15.316  0.319   1.00 19.95 ? 340 TRP A CZ3   1 
ATOM   2674 C  CH2   . TRP A 1 343 ? 29.766 16.000  1.479   1.00 21.15 ? 340 TRP A CH2   1 
ATOM   2675 N  N     . LEU A 1 344 ? 26.334 12.204  -4.803  1.00 18.66 ? 341 LEU A N     1 
ATOM   2676 C  CA    . LEU A 1 344 ? 26.727 11.464  -5.998  1.00 18.10 ? 341 LEU A CA    1 
ATOM   2677 C  C     . LEU A 1 344 ? 27.373 12.427  -6.987  1.00 17.20 ? 341 LEU A C     1 
ATOM   2678 O  O     . LEU A 1 344 ? 28.348 12.088  -7.660  1.00 15.09 ? 341 LEU A O     1 
ATOM   2679 C  CB    . LEU A 1 344 ? 25.526 10.769  -6.646  1.00 16.49 ? 341 LEU A CB    1 
ATOM   2680 C  CG    . LEU A 1 344 ? 24.963 9.522   -5.957  1.00 19.66 ? 341 LEU A CG    1 
ATOM   2681 C  CD1   . LEU A 1 344 ? 23.685 9.061   -6.649  1.00 25.69 ? 341 LEU A CD1   1 
ATOM   2682 C  CD2   . LEU A 1 344 ? 25.994 8.404   -5.932  1.00 17.01 ? 341 LEU A CD2   1 
ATOM   2683 N  N     . LEU A 1 345 ? 26.829 13.636  -7.065  1.00 14.92 ? 342 LEU A N     1 
ATOM   2684 C  CA    . LEU A 1 345 ? 27.374 14.654  -7.952  1.00 16.30 ? 342 LEU A CA    1 
ATOM   2685 C  C     . LEU A 1 345 ? 28.778 15.080  -7.526  1.00 14.35 ? 342 LEU A C     1 
ATOM   2686 O  O     . LEU A 1 345 ? 29.673 15.221  -8.360  1.00 15.62 ? 342 LEU A O     1 
ATOM   2687 C  CB    . LEU A 1 345 ? 26.450 15.871  -8.016  1.00 19.38 ? 342 LEU A CB    1 
ATOM   2688 C  CG    . LEU A 1 345 ? 26.919 16.986  -8.953  1.00 19.39 ? 342 LEU A CG    1 
ATOM   2689 C  CD1   . LEU A 1 345 ? 27.157 16.438  -10.355 1.00 20.70 ? 342 LEU A CD1   1 
ATOM   2690 C  CD2   . LEU A 1 345 ? 25.919 18.132  -8.981  1.00 22.74 ? 342 LEU A CD2   1 
ATOM   2691 N  N     . GLN A 1 346 ? 28.966 15.288  -6.226  1.00 15.05 ? 343 GLN A N     1 
ATOM   2692 C  CA    . GLN A 1 346 ? 30.272 15.669  -5.701  1.00 16.69 ? 343 GLN A CA    1 
ATOM   2693 C  C     . GLN A 1 346 ? 31.305 14.592  -6.020  1.00 14.41 ? 343 GLN A C     1 
ATOM   2694 O  O     . GLN A 1 346 ? 32.408 14.894  -6.480  1.00 10.90 ? 343 GLN A O     1 
ATOM   2695 C  CB    . GLN A 1 346 ? 30.209 15.906  -4.191  1.00 15.79 ? 343 GLN A CB    1 
ATOM   2696 C  CG    . GLN A 1 346 ? 29.159 16.919  -3.761  1.00 19.51 ? 343 GLN A CG    1 
ATOM   2697 C  CD    . GLN A 1 346 ? 29.204 18.194  -4.580  1.00 19.79 ? 343 GLN A CD    1 
ATOM   2698 O  OE1   . GLN A 1 346 ? 30.245 18.846  -4.688  1.00 19.52 ? 343 GLN A OE1   1 
ATOM   2699 N  NE2   . GLN A 1 346 ? 28.070 18.553  -5.170  1.00 21.67 ? 343 GLN A NE2   1 
ATOM   2700 N  N     . LEU A 1 347 ? 30.940 13.337  -5.771  1.00 14.73 ? 344 LEU A N     1 
ATOM   2701 C  CA    . LEU A 1 347 ? 31.822 12.213  -6.068  1.00 17.18 ? 344 LEU A CA    1 
ATOM   2702 C  C     . LEU A 1 347 ? 32.100 12.130  -7.565  1.00 15.38 ? 344 LEU A C     1 
ATOM   2703 O  O     . LEU A 1 347 ? 33.235 11.906  -7.983  1.00 11.66 ? 344 LEU A O     1 
ATOM   2704 C  CB    . LEU A 1 347 ? 31.213 10.897  -5.575  1.00 14.62 ? 344 LEU A CB    1 
ATOM   2705 C  CG    . LEU A 1 347 ? 31.107 10.698  -4.061  1.00 16.87 ? 344 LEU A CG    1 
ATOM   2706 C  CD1   . LEU A 1 347 ? 30.386 9.398   -3.737  1.00 18.14 ? 344 LEU A CD1   1 
ATOM   2707 C  CD2   . LEU A 1 347 ? 32.477 10.712  -3.424  1.00 19.45 ? 344 LEU A CD2   1 
ATOM   2708 N  N     . ALA A 1 348 ? 31.054 12.320  -8.364  1.00 13.74 ? 345 ALA A N     1 
ATOM   2709 C  CA    . ALA A 1 348 ? 31.167 12.237  -9.815  1.00 15.14 ? 345 ALA A CA    1 
ATOM   2710 C  C     . ALA A 1 348 ? 32.034 13.355  -10.383 1.00 14.19 ? 345 ALA A C     1 
ATOM   2711 O  O     . ALA A 1 348 ? 32.681 13.185  -11.416 1.00 12.01 ? 345 ALA A O     1 
ATOM   2712 C  CB    . ALA A 1 348 ? 29.786 12.253  -10.458 1.00 14.94 ? 345 ALA A CB    1 
ATOM   2713 N  N     . GLN A 1 349 ? 32.045 14.501  -9.707  1.00 13.36 ? 346 GLN A N     1 
ATOM   2714 C  CA    . GLN A 1 349 ? 32.856 15.628  -10.150 1.00 14.08 ? 346 GLN A CA    1 
ATOM   2715 C  C     . GLN A 1 349 ? 34.343 15.383  -9.912  1.00 13.60 ? 346 GLN A C     1 
ATOM   2716 O  O     . GLN A 1 349 ? 35.168 15.706  -10.763 1.00 11.22 ? 346 GLN A O     1 
ATOM   2717 C  CB    . GLN A 1 349 ? 32.401 16.934  -9.490  1.00 15.59 ? 346 GLN A CB    1 
ATOM   2718 C  CG    . GLN A 1 349 ? 31.065 17.439  -10.018 1.00 18.95 ? 346 GLN A CG    1 
ATOM   2719 C  CD    . GLN A 1 349 ? 30.659 18.773  -9.424  1.00 26.27 ? 346 GLN A CD    1 
ATOM   2720 O  OE1   . GLN A 1 349 ? 31.128 19.161  -8.355  1.00 27.37 ? 346 GLN A OE1   1 
ATOM   2721 N  NE2   . GLN A 1 349 ? 29.780 19.485  -10.121 1.00 26.31 ? 346 GLN A NE2   1 
ATOM   2722 N  N     . GLU A 1 350 ? 34.687 14.811  -8.762  1.00 12.20 ? 347 GLU A N     1 
ATOM   2723 C  CA    . GLU A 1 350 ? 36.079 14.454  -8.511  1.00 14.60 ? 347 GLU A CA    1 
ATOM   2724 C  C     . GLU A 1 350 ? 36.514 13.355  -9.472  1.00 11.73 ? 347 GLU A C     1 
ATOM   2725 O  O     . GLU A 1 350 ? 37.645 13.354  -9.957  1.00 12.61 ? 347 GLU A O     1 
ATOM   2726 C  CB    . GLU A 1 350 ? 36.308 13.994  -7.069  1.00 13.42 ? 347 GLU A CB    1 
ATOM   2727 C  CG    . GLU A 1 350 ? 37.754 13.554  -6.828  1.00 16.82 ? 347 GLU A CG    1 
ATOM   2728 C  CD    . GLU A 1 350 ? 38.007 13.017  -5.431  1.00 18.13 ? 347 GLU A CD    1 
ATOM   2729 O  OE1   . GLU A 1 350 ? 37.303 13.427  -4.485  1.00 18.91 ? 347 GLU A OE1   1 
ATOM   2730 O  OE2   . GLU A 1 350 ? 38.922 12.180  -5.281  1.00 13.74 ? 347 GLU A OE2   1 
ATOM   2731 N  N     . LEU A 1 351 ? 35.608 12.421  -9.741  1.00 10.14 ? 348 LEU A N     1 
ATOM   2732 C  CA    . LEU A 1 351 ? 35.912 11.302  -10.623 1.00 10.57 ? 348 LEU A CA    1 
ATOM   2733 C  C     . LEU A 1 351 ? 36.176 11.788  -12.045 1.00 13.67 ? 348 LEU A C     1 
ATOM   2734 O  O     . LEU A 1 351 ? 37.136 11.361  -12.682 1.00 12.35 ? 348 LEU A O     1 
ATOM   2735 C  CB    . LEU A 1 351 ? 34.782 10.273  -10.608 1.00 12.46 ? 348 LEU A CB    1 
ATOM   2736 C  CG    . LEU A 1 351 ? 35.080 8.949   -11.319 1.00 13.61 ? 348 LEU A CG    1 
ATOM   2737 C  CD1   . LEU A 1 351 ? 36.339 8.298   -10.746 1.00 13.03 ? 348 LEU A CD1   1 
ATOM   2738 C  CD2   . LEU A 1 351 ? 33.891 8.002   -11.230 1.00 18.36 ? 348 LEU A CD2   1 
ATOM   2739 N  N     . GLU A 1 352 ? 35.326 12.687  -12.535 1.00 12.38 ? 349 GLU A N     1 
ATOM   2740 C  CA    . GLU A 1 352 ? 35.507 13.240  -13.874 1.00 13.16 ? 349 GLU A CA    1 
ATOM   2741 C  C     . GLU A 1 352 ? 36.861 13.924  -13.988 1.00 13.29 ? 349 GLU A C     1 
ATOM   2742 O  O     . GLU A 1 352 ? 37.568 13.774  -14.986 1.00 15.40 ? 349 GLU A O     1 
ATOM   2743 C  CB    . GLU A 1 352 ? 34.402 14.242  -14.219 1.00 13.62 ? 349 GLU A CB    1 
ATOM   2744 C  CG    . GLU A 1 352 ? 34.571 14.848  -15.607 1.00 21.53 ? 349 GLU A CG    1 
ATOM   2745 C  CD    . GLU A 1 352 ? 33.668 16.041  -15.858 1.00 28.73 ? 349 GLU A CD    1 
ATOM   2746 O  OE1   . GLU A 1 352 ? 33.945 16.799  -16.812 1.00 35.58 ? 349 GLU A OE1   1 
ATOM   2747 O  OE2   . GLU A 1 352 ? 32.683 16.221  -15.111 1.00 27.58 ? 349 GLU A OE2   1 
ATOM   2748 N  N     . GLU A 1 353 ? 37.212 14.679  -12.953 1.00 13.56 ? 350 GLU A N     1 
ATOM   2749 C  CA    . GLU A 1 353 ? 38.470 15.410  -12.917 1.00 14.77 ? 350 GLU A CA    1 
ATOM   2750 C  C     . GLU A 1 353 ? 39.666 14.464  -13.000 1.00 14.99 ? 350 GLU A C     1 
ATOM   2751 O  O     . GLU A 1 353 ? 40.629 14.720  -13.724 1.00 15.18 ? 350 GLU A O     1 
ATOM   2752 C  CB    . GLU A 1 353 ? 38.545 16.246  -11.639 1.00 23.14 ? 350 GLU A CB    1 
ATOM   2753 C  CG    . GLU A 1 353 ? 39.715 17.207  -11.579 1.00 22.82 ? 350 GLU A CG    1 
ATOM   2754 C  CD    . GLU A 1 353 ? 39.637 18.128  -10.376 1.00 38.07 ? 350 GLU A CD    1 
ATOM   2755 O  OE1   . GLU A 1 353 ? 39.128 17.688  -9.322  1.00 39.20 ? 350 GLU A OE1   1 
ATOM   2756 O  OE2   . GLU A 1 353 ? 40.073 19.293  -10.486 1.00 43.12 ? 350 GLU A OE2   1 
ATOM   2757 N  N     . ARG A 1 354 ? 39.600 13.366  -12.258 1.00 12.77 ? 351 ARG A N     1 
ATOM   2758 C  CA    . ARG A 1 354 ? 40.693 12.402  -12.254 1.00 15.34 ? 351 ARG A CA    1 
ATOM   2759 C  C     . ARG A 1 354 ? 40.731 11.588  -13.544 1.00 11.37 ? 351 ARG A C     1 
ATOM   2760 O  O     . ARG A 1 354 ? 41.805 11.284  -14.059 1.00 13.60 ? 351 ARG A O     1 
ATOM   2761 C  CB    . ARG A 1 354 ? 40.604 11.496  -11.027 1.00 13.35 ? 351 ARG A CB    1 
ATOM   2762 C  CG    . ARG A 1 354 ? 40.990 12.206  -9.736  1.00 13.41 ? 351 ARG A CG    1 
ATOM   2763 C  CD    . ARG A 1 354 ? 40.516 11.442  -8.518  1.00 18.02 ? 351 ARG A CD    1 
ATOM   2764 N  NE    . ARG A 1 354 ? 41.031 10.078  -8.486  1.00 12.96 ? 351 ARG A NE    1 
ATOM   2765 C  CZ    . ARG A 1 354 ? 40.678 9.177   -7.577  1.00 17.72 ? 351 ARG A CZ    1 
ATOM   2766 N  NH1   . ARG A 1 354 ? 39.810 9.504   -6.625  1.00 17.91 ? 351 ARG A NH1   1 
ATOM   2767 N  NH2   . ARG A 1 354 ? 41.189 7.955   -7.616  1.00 12.44 ? 351 ARG A NH2   1 
ATOM   2768 N  N     . LEU A 1 355 ? 39.558 11.248  -14.068 1.00 13.89 ? 352 LEU A N     1 
ATOM   2769 C  CA    . LEU A 1 355 ? 39.467 10.498  -15.317 1.00 13.37 ? 352 LEU A CA    1 
ATOM   2770 C  C     . LEU A 1 355 ? 40.033 11.289  -16.494 1.00 16.06 ? 352 LEU A C     1 
ATOM   2771 O  O     . LEU A 1 355 ? 40.725 10.737  -17.350 1.00 13.79 ? 352 LEU A O     1 
ATOM   2772 C  CB    . LEU A 1 355 ? 38.017 10.095  -15.603 1.00 12.93 ? 352 LEU A CB    1 
ATOM   2773 C  CG    . LEU A 1 355 ? 37.476 8.888   -14.838 1.00 12.71 ? 352 LEU A CG    1 
ATOM   2774 C  CD1   . LEU A 1 355 ? 36.001 8.673   -15.143 1.00 13.72 ? 352 LEU A CD1   1 
ATOM   2775 C  CD2   . LEU A 1 355 ? 38.282 7.641   -15.176 1.00 15.62 ? 352 LEU A CD2   1 
ATOM   2776 N  N     . THR A 1 356 ? 39.730 12.582  -16.538 1.00 14.69 ? 353 THR A N     1 
ATOM   2777 C  CA    . THR A 1 356 ? 40.204 13.431  -17.625 1.00 16.98 ? 353 THR A CA    1 
ATOM   2778 C  C     . THR A 1 356 ? 41.727 13.539  -17.597 1.00 17.32 ? 353 THR A C     1 
ATOM   2779 O  O     . THR A 1 356 ? 42.384 13.444  -18.631 1.00 16.00 ? 353 THR A O     1 
ATOM   2780 C  CB    . THR A 1 356 ? 39.575 14.837  -17.558 1.00 18.00 ? 353 THR A CB    1 
ATOM   2781 O  OG1   . THR A 1 356 ? 38.148 14.727  -17.641 1.00 18.22 ? 353 THR A OG1   1 
ATOM   2782 C  CG2   . THR A 1 356 ? 40.074 15.703  -18.701 1.00 19.49 ? 353 THR A CG2   1 
ATOM   2783 N  N     . LYS A 1 357 ? 42.279 13.731  -16.404 1.00 15.58 ? 354 LYS A N     1 
ATOM   2784 C  CA    . LYS A 1 357 ? 43.723 13.789  -16.224 1.00 17.72 ? 354 LYS A CA    1 
ATOM   2785 C  C     . LYS A 1 357 ? 44.358 12.470  -16.648 1.00 18.37 ? 354 LYS A C     1 
ATOM   2786 O  O     . LYS A 1 357 ? 45.384 12.447  -17.330 1.00 15.01 ? 354 LYS A O     1 
ATOM   2787 C  CB    . LYS A 1 357 ? 44.056 14.085  -14.760 1.00 20.11 ? 354 LYS A CB    1 
ATOM   2788 C  CG    . LYS A 1 357 ? 45.539 14.238  -14.462 1.00 25.90 ? 354 LYS A CG    1 
ATOM   2789 C  CD    . LYS A 1 357 ? 46.143 15.404  -15.231 1.00 33.33 ? 354 LYS A CD    1 
ATOM   2790 C  CE    . LYS A 1 357 ? 47.364 15.965  -14.515 1.00 37.35 ? 354 LYS A CE    1 
ATOM   2791 N  NZ    . LYS A 1 357 ? 48.382 14.917  -14.231 1.00 32.59 ? 354 LYS A NZ    1 
ATOM   2792 N  N     . ASP A 1 358 ? 43.733 11.371  -16.241 1.00 16.37 ? 355 ASP A N     1 
ATOM   2793 C  CA    . ASP A 1 358 ? 44.237 10.040  -16.556 1.00 17.69 ? 355 ASP A CA    1 
ATOM   2794 C  C     . ASP A 1 358 ? 44.261 9.793   -18.060 1.00 18.56 ? 355 ASP A C     1 
ATOM   2795 O  O     . ASP A 1 358 ? 45.201 9.195   -18.585 1.00 17.68 ? 355 ASP A O     1 
ATOM   2796 C  CB    . ASP A 1 358 ? 43.392 8.970   -15.861 1.00 13.50 ? 355 ASP A CB    1 
ATOM   2797 C  CG    . ASP A 1 358 ? 43.894 7.567   -16.133 1.00 17.75 ? 355 ASP A CG    1 
ATOM   2798 O  OD1   . ASP A 1 358 ? 44.855 7.139   -15.459 1.00 17.67 ? 355 ASP A OD1   1 
ATOM   2799 O  OD2   . ASP A 1 358 ? 43.331 6.892   -17.019 1.00 15.15 ? 355 ASP A OD2   1 
ATOM   2800 N  N     . ARG A 1 359 ? 43.224 10.255  -18.750 1.00 14.75 ? 356 ARG A N     1 
ATOM   2801 C  CA    . ARG A 1 359 ? 43.115 10.058  -20.189 1.00 16.16 ? 356 ARG A CA    1 
ATOM   2802 C  C     . ARG A 1 359 ? 44.200 10.824  -20.937 1.00 15.55 ? 356 ARG A C     1 
ATOM   2803 O  O     . ARG A 1 359 ? 44.758 10.331  -21.914 1.00 16.23 ? 356 ARG A O     1 
ATOM   2804 C  CB    . ARG A 1 359 ? 41.731 10.484  -20.686 1.00 19.34 ? 356 ARG A CB    1 
ATOM   2805 C  CG    . ARG A 1 359 ? 41.487 10.202  -22.161 1.00 21.22 ? 356 ARG A CG    1 
ATOM   2806 C  CD    . ARG A 1 359 ? 40.075 10.599  -22.566 1.00 24.55 ? 356 ARG A CD    1 
ATOM   2807 N  NE    . ARG A 1 359 ? 39.885 12.047  -22.540 1.00 23.47 ? 356 ARG A NE    1 
ATOM   2808 C  CZ    . ARG A 1 359 ? 38.703 12.644  -22.424 1.00 24.26 ? 356 ARG A CZ    1 
ATOM   2809 N  NH1   . ARG A 1 359 ? 37.598 11.917  -22.310 1.00 28.25 ? 356 ARG A NH1   1 
ATOM   2810 N  NH2   . ARG A 1 359 ? 38.625 13.968  -22.413 1.00 24.93 ? 356 ARG A NH2   1 
ATOM   2811 N  N     . ASN A 1 360 ? 44.498 12.032  -20.470 1.00 15.84 ? 357 ASN A N     1 
ATOM   2812 C  CA    . ASN A 1 360 ? 45.535 12.852  -21.088 1.00 17.25 ? 357 ASN A CA    1 
ATOM   2813 C  C     . ASN A 1 360 ? 46.943 12.305  -20.850 1.00 17.33 ? 357 ASN A C     1 
ATOM   2814 O  O     . ASN A 1 360 ? 47.793 12.350  -21.739 1.00 19.05 ? 357 ASN A O     1 
ATOM   2815 C  CB    . ASN A 1 360 ? 45.441 14.300  -20.601 1.00 19.54 ? 357 ASN A CB    1 
ATOM   2816 C  CG    . ASN A 1 360 ? 44.299 15.062  -21.248 1.00 22.01 ? 357 ASN A CG    1 
ATOM   2817 O  OD1   . ASN A 1 360 ? 43.921 14.790  -22.388 1.00 22.62 ? 357 ASN A OD1   1 
ATOM   2818 N  ND2   . ASN A 1 360 ? 43.749 16.030  -20.525 1.00 21.41 ? 357 ASN A ND2   1 
ATOM   2819 N  N     . ASP A 1 361 ? 47.181 11.782  -19.650 1.00 15.04 ? 358 ASP A N     1 
ATOM   2820 C  CA    . ASP A 1 361 ? 48.505 11.297  -19.273 1.00 19.17 ? 358 ASP A CA    1 
ATOM   2821 C  C     . ASP A 1 361 ? 48.798 9.889   -19.780 1.00 15.56 ? 358 ASP A C     1 
ATOM   2822 O  O     . ASP A 1 361 ? 49.926 9.583   -20.163 1.00 16.59 ? 358 ASP A O     1 
ATOM   2823 C  CB    . ASP A 1 361 ? 48.667 11.304  -17.750 1.00 23.20 ? 358 ASP A CB    1 
ATOM   2824 C  CG    . ASP A 1 361 ? 48.569 12.691  -17.155 1.00 27.56 ? 358 ASP A CG    1 
ATOM   2825 O  OD1   . ASP A 1 361 ? 48.805 13.677  -17.886 1.00 23.42 ? 358 ASP A OD1   1 
ATOM   2826 O  OD2   . ASP A 1 361 ? 48.262 12.790  -15.947 1.00 27.87 ? 358 ASP A OD2   1 
ATOM   2827 N  N     . ASN A 1 362 ? 47.783 9.032   -19.772 1.00 16.07 ? 359 ASN A N     1 
ATOM   2828 C  CA    . ASN A 1 362 ? 48.009 7.598   -19.920 1.00 19.80 ? 359 ASN A CA    1 
ATOM   2829 C  C     . ASN A 1 362 ? 47.366 6.950   -21.146 1.00 17.39 ? 359 ASN A C     1 
ATOM   2830 O  O     . ASN A 1 362 ? 47.402 5.730   -21.294 1.00 17.61 ? 359 ASN A O     1 
ATOM   2831 C  CB    . ASN A 1 362 ? 47.582 6.872   -18.639 1.00 16.32 ? 359 ASN A CB    1 
ATOM   2832 C  CG    . ASN A 1 362 ? 48.360 7.344   -17.418 1.00 18.87 ? 359 ASN A CG    1 
ATOM   2833 O  OD1   . ASN A 1 362 ? 49.566 7.575   -17.493 1.00 16.52 ? 359 ASN A OD1   1 
ATOM   2834 N  ND2   . ASN A 1 362 ? 47.671 7.497   -16.292 1.00 15.78 ? 359 ASN A ND2   1 
ATOM   2835 N  N     . ASP A 1 363 ? 46.782 7.764   -22.020 1.00 16.89 ? 360 ASP A N     1 
ATOM   2836 C  CA    . ASP A 1 363 ? 46.227 7.268   -23.280 1.00 15.96 ? 360 ASP A CA    1 
ATOM   2837 C  C     . ASP A 1 363 ? 45.270 6.097   -23.097 1.00 21.42 ? 360 ASP A C     1 
ATOM   2838 O  O     . ASP A 1 363 ? 45.443 5.044   -23.714 1.00 20.51 ? 360 ASP A O     1 
ATOM   2839 C  CB    . ASP A 1 363 ? 47.352 6.855   -24.228 1.00 22.94 ? 360 ASP A CB    1 
ATOM   2840 C  CG    . ASP A 1 363 ? 48.247 8.013   -24.604 1.00 25.33 ? 360 ASP A CG    1 
ATOM   2841 O  OD1   . ASP A 1 363 ? 47.712 9.084   -24.962 1.00 19.69 ? 360 ASP A OD1   1 
ATOM   2842 O  OD2   . ASP A 1 363 ? 49.483 7.853   -24.535 1.00 24.89 ? 360 ASP A OD2   1 
ATOM   2843 N  N     . ARG A 1 364 ? 44.259 6.282   -22.256 1.00 19.65 ? 361 ARG A N     1 
ATOM   2844 C  CA    . ARG A 1 364 ? 43.267 5.241   -22.024 1.00 17.29 ? 361 ARG A CA    1 
ATOM   2845 C  C     . ARG A 1 364 ? 41.945 5.846   -21.576 1.00 18.29 ? 361 ARG A C     1 
ATOM   2846 O  O     . ARG A 1 364 ? 41.900 6.977   -21.091 1.00 18.34 ? 361 ARG A O     1 
ATOM   2847 C  CB    . ARG A 1 364 ? 43.765 4.245   -20.976 1.00 18.14 ? 361 ARG A CB    1 
ATOM   2848 C  CG    . ARG A 1 364 ? 44.020 4.862   -19.610 1.00 18.72 ? 361 ARG A CG    1 
ATOM   2849 C  CD    . ARG A 1 364 ? 44.440 3.812   -18.596 1.00 18.16 ? 361 ARG A CD    1 
ATOM   2850 N  NE    . ARG A 1 364 ? 44.623 4.383   -17.264 1.00 18.74 ? 361 ARG A NE    1 
ATOM   2851 C  CZ    . ARG A 1 364 ? 44.885 3.668   -16.174 1.00 20.65 ? 361 ARG A CZ    1 
ATOM   2852 N  NH1   . ARG A 1 364 ? 45.037 4.269   -15.000 1.00 18.32 ? 361 ARG A NH1   1 
ATOM   2853 N  NH2   . ARG A 1 364 ? 44.995 2.352   -16.258 1.00 18.52 ? 361 ARG A NH2   1 
ATOM   2854 N  N     . VAL A 1 365 ? 40.870 5.085   -21.746 1.00 18.03 ? 362 VAL A N     1 
ATOM   2855 C  CA    . VAL A 1 365 ? 39.544 5.518   -21.330 1.00 18.34 ? 362 VAL A CA    1 
ATOM   2856 C  C     . VAL A 1 365 ? 38.820 4.398   -20.593 1.00 19.61 ? 362 VAL A C     1 
ATOM   2857 O  O     . VAL A 1 365 ? 38.828 3.246   -21.032 1.00 19.61 ? 362 VAL A O     1 
ATOM   2858 C  CB    . VAL A 1 365 ? 38.693 5.962   -22.537 1.00 22.63 ? 362 VAL A CB    1 
ATOM   2859 C  CG1   . VAL A 1 365 ? 39.221 7.270   -23.108 1.00 24.50 ? 362 VAL A CG1   1 
ATOM   2860 C  CG2   . VAL A 1 365 ? 38.677 4.878   -23.604 1.00 25.32 ? 362 VAL A CG2   1 
ATOM   2861 N  N     . ALA A 1 366 ? 38.205 4.735   -19.464 1.00 17.27 ? 363 ALA A N     1 
ATOM   2862 C  CA    . ALA A 1 366 ? 37.396 3.774   -18.726 1.00 17.53 ? 363 ALA A CA    1 
ATOM   2863 C  C     . ALA A 1 366 ? 36.079 3.556   -19.461 1.00 18.00 ? 363 ALA A C     1 
ATOM   2864 O  O     . ALA A 1 366 ? 35.545 4.481   -20.075 1.00 20.33 ? 363 ALA A O     1 
ATOM   2865 C  CB    . ALA A 1 366 ? 37.143 4.268   -17.311 1.00 14.53 ? 363 ALA A CB    1 
ATOM   2866 N  N     . THR A 1 367 ? 35.552 2.337   -19.398 1.00 14.98 ? 364 THR A N     1 
ATOM   2867 C  CA    . THR A 1 367 ? 34.343 2.005   -20.143 1.00 16.70 ? 364 THR A CA    1 
ATOM   2868 C  C     . THR A 1 367 ? 33.200 1.546   -19.243 1.00 16.26 ? 364 THR A C     1 
ATOM   2869 O  O     . THR A 1 367 ? 32.064 1.404   -19.695 1.00 17.77 ? 364 THR A O     1 
ATOM   2870 C  CB    . THR A 1 367 ? 34.621 0.917   -21.197 1.00 19.97 ? 364 THR A CB    1 
ATOM   2871 O  OG1   . THR A 1 367 ? 34.930 -0.319  -20.542 1.00 18.68 ? 364 THR A OG1   1 
ATOM   2872 C  CG2   . THR A 1 367 ? 35.792 1.322   -22.084 1.00 19.92 ? 364 THR A CG2   1 
ATOM   2873 N  N     . GLN A 1 368 ? 33.502 1.312   -17.972 1.00 17.88 ? 365 GLN A N     1 
ATOM   2874 C  CA    . GLN A 1 368 ? 32.499 0.828   -17.032 1.00 20.31 ? 365 GLN A CA    1 
ATOM   2875 C  C     . GLN A 1 368 ? 32.489 1.657   -15.751 1.00 21.42 ? 365 GLN A C     1 
ATOM   2876 O  O     . GLN A 1 368 ? 33.540 1.954   -15.182 1.00 17.28 ? 365 GLN A O     1 
ATOM   2877 C  CB    . GLN A 1 368 ? 32.741 -0.648  -16.704 1.00 25.26 ? 365 GLN A CB    1 
ATOM   2878 C  CG    . GLN A 1 368 ? 31.727 -1.247  -15.745 1.00 25.09 ? 365 GLN A CG    1 
ATOM   2879 C  CD    . GLN A 1 368 ? 31.949 -2.729  -15.508 1.00 31.58 ? 365 GLN A CD    1 
ATOM   2880 O  OE1   . GLN A 1 368 ? 32.802 -3.123  -14.711 1.00 34.82 ? 365 GLN A OE1   1 
ATOM   2881 N  NE2   . GLN A 1 368 ? 31.178 -3.561  -16.201 1.00 26.74 ? 365 GLN A NE2   1 
ATOM   2882 N  N     . LEU A 1 369 ? 31.293 2.033   -15.311 1.00 17.42 ? 366 LEU A N     1 
ATOM   2883 C  CA    . LEU A 1 369 ? 31.123 2.755   -14.055 1.00 21.13 ? 366 LEU A CA    1 
ATOM   2884 C  C     . LEU A 1 369 ? 30.483 1.844   -13.015 1.00 18.61 ? 366 LEU A C     1 
ATOM   2885 O  O     . LEU A 1 369 ? 29.362 1.372   -13.196 1.00 21.40 ? 366 LEU A O     1 
ATOM   2886 C  CB    . LEU A 1 369 ? 30.259 4.003   -14.258 1.00 19.49 ? 366 LEU A CB    1 
ATOM   2887 C  CG    . LEU A 1 369 ? 29.941 4.830   -13.010 1.00 22.21 ? 366 LEU A CG    1 
ATOM   2888 C  CD1   . LEU A 1 369 ? 31.195 5.518   -12.486 1.00 20.64 ? 366 LEU A CD1   1 
ATOM   2889 C  CD2   . LEU A 1 369 ? 28.853 5.854   -13.307 1.00 23.98 ? 366 LEU A CD2   1 
ATOM   2890 N  N     . VAL A 1 370 ? 31.205 1.592   -11.930 1.00 17.98 ? 367 VAL A N     1 
ATOM   2891 C  CA    . VAL A 1 370 ? 30.690 0.763   -10.851 1.00 17.06 ? 367 VAL A CA    1 
ATOM   2892 C  C     . VAL A 1 370 ? 30.163 1.646   -9.726  1.00 20.49 ? 367 VAL A C     1 
ATOM   2893 O  O     . VAL A 1 370 ? 30.834 2.583   -9.297  1.00 18.12 ? 367 VAL A O     1 
ATOM   2894 C  CB    . VAL A 1 370 ? 31.775 -0.182  -10.302 1.00 19.26 ? 367 VAL A CB    1 
ATOM   2895 C  CG1   . VAL A 1 370 ? 31.236 -0.989  -9.134  1.00 21.88 ? 367 VAL A CG1   1 
ATOM   2896 C  CG2   . VAL A 1 370 ? 32.283 -1.099  -11.404 1.00 20.36 ? 367 VAL A CG2   1 
ATOM   2897 N  N     . VAL A 1 371 ? 28.955 1.349   -9.260  1.00 17.90 ? 368 VAL A N     1 
ATOM   2898 C  CA    . VAL A 1 371 ? 28.327 2.137   -8.208  1.00 17.46 ? 368 VAL A CA    1 
ATOM   2899 C  C     . VAL A 1 371 ? 28.044 1.261   -6.997  1.00 18.50 ? 368 VAL A C     1 
ATOM   2900 O  O     . VAL A 1 371 ? 27.405 0.216   -7.112  1.00 21.16 ? 368 VAL A O     1 
ATOM   2901 C  CB    . VAL A 1 371 ? 27.015 2.779   -8.694  1.00 18.18 ? 368 VAL A CB    1 
ATOM   2902 C  CG1   . VAL A 1 371 ? 26.438 3.687   -7.617  1.00 20.84 ? 368 VAL A CG1   1 
ATOM   2903 C  CG2   . VAL A 1 371 ? 27.253 3.556   -9.980  1.00 17.28 ? 368 VAL A CG2   1 
ATOM   2904 N  N     . SER A 1 372 ? 28.528 1.687   -5.836  1.00 16.12 ? 369 SER A N     1 
ATOM   2905 C  CA    . SER A 1 372 ? 28.366 0.906   -4.618  1.00 18.69 ? 369 SER A CA    1 
ATOM   2906 C  C     . SER A 1 372 ? 27.844 1.770   -3.475  1.00 17.06 ? 369 SER A C     1 
ATOM   2907 O  O     . SER A 1 372 ? 28.244 2.922   -3.322  1.00 16.25 ? 369 SER A O     1 
ATOM   2908 C  CB    . SER A 1 372 ? 29.693 0.252   -4.226  1.00 21.98 ? 369 SER A CB    1 
ATOM   2909 O  OG    . SER A 1 372 ? 29.533 -0.594  -3.102  1.00 28.44 ? 369 SER A OG    1 
ATOM   2910 N  N     . ILE A 1 373 ? 26.938 1.212   -2.680  1.00 19.43 ? 370 ILE A N     1 
ATOM   2911 C  CA    . ILE A 1 373 ? 26.396 1.934   -1.536  1.00 19.69 ? 370 ILE A CA    1 
ATOM   2912 C  C     . ILE A 1 373 ? 26.310 1.036   -0.309  1.00 21.94 ? 370 ILE A C     1 
ATOM   2913 O  O     . ILE A 1 373 ? 26.334 -0.190  -0.419  1.00 22.42 ? 370 ILE A O     1 
ATOM   2914 C  CB    . ILE A 1 373 ? 24.998 2.519   -1.831  1.00 22.06 ? 370 ILE A CB    1 
ATOM   2915 C  CG1   . ILE A 1 373 ? 23.961 1.401   -1.961  1.00 24.84 ? 370 ILE A CG1   1 
ATOM   2916 C  CG2   . ILE A 1 373 ? 25.027 3.392   -3.082  1.00 19.27 ? 370 ILE A CG2   1 
ATOM   2917 C  CD1   . ILE A 1 373 ? 22.556 1.903   -2.206  1.00 28.93 ? 370 ILE A CD1   1 
ATOM   2918 N  N     . ARG A 1 374 ? 26.221 1.656   0.861   1.00 22.95 ? 371 ARG A N     1 
ATOM   2919 C  CA    . ARG A 1 374 ? 26.010 0.920   2.097   1.00 23.92 ? 371 ARG A CA    1 
ATOM   2920 C  C     . ARG A 1 374 ? 24.771 1.466   2.794   1.00 30.06 ? 371 ARG A C     1 
ATOM   2921 O  O     . ARG A 1 374 ? 24.579 2.679   2.871   1.00 25.04 ? 371 ARG A O     1 
ATOM   2922 C  CB    . ARG A 1 374 ? 27.229 1.034   3.013   1.00 28.64 ? 371 ARG A CB    1 
ATOM   2923 C  CG    . ARG A 1 374 ? 27.183 0.115   4.223   1.00 31.92 ? 371 ARG A CG    1 
ATOM   2924 C  CD    . ARG A 1 374 ? 28.333 0.400   5.173   1.00 36.44 ? 371 ARG A CD    1 
ATOM   2925 N  NE    . ARG A 1 374 ? 28.368 -0.540  6.289   1.00 44.92 ? 371 ARG A NE    1 
ATOM   2926 C  CZ    . ARG A 1 374 ? 29.208 -0.449  7.315   1.00 52.46 ? 371 ARG A CZ    1 
ATOM   2927 N  NH1   . ARG A 1 374 ? 30.083 0.547   7.372   1.00 52.49 ? 371 ARG A NH1   1 
ATOM   2928 N  NH2   . ARG A 1 374 ? 29.172 -1.349  8.288   1.00 55.57 ? 371 ARG A NH2   1 
ATOM   2929 N  N     . VAL A 1 375 ? 23.923 0.567   3.283   1.00 34.87 ? 372 VAL A N     1 
ATOM   2930 C  CA    . VAL A 1 375 ? 22.714 0.968   3.991   1.00 32.13 ? 372 VAL A CA    1 
ATOM   2931 C  C     . VAL A 1 375 ? 22.931 0.883   5.497   1.00 31.95 ? 372 VAL A C     1 
ATOM   2932 O  O     . VAL A 1 375 ? 23.664 0.020   5.981   1.00 29.65 ? 372 VAL A O     1 
ATOM   2933 C  CB    . VAL A 1 375 ? 21.506 0.101   3.591   1.00 37.31 ? 372 VAL A CB    1 
ATOM   2934 C  CG1   . VAL A 1 375 ? 21.207 0.262   2.108   1.00 36.53 ? 372 VAL A CG1   1 
ATOM   2935 C  CG2   . VAL A 1 375 ? 21.762 -1.358  3.934   1.00 36.59 ? 372 VAL A CG2   1 
ATOM   2936 N  N     . GLN A 1 376 ? 22.296 1.785   6.236   1.00 30.62 ? 373 GLN A N     1 
ATOM   2937 C  CA    . GLN A 1 376 ? 22.469 1.830   7.682   1.00 31.84 ? 373 GLN A CA    1 
ATOM   2938 C  C     . GLN A 1 376 ? 22.006 0.530   8.328   1.00 34.96 ? 373 GLN A C     1 
ATOM   2939 O  O     . GLN A 1 376 ? 20.871 0.096   8.129   1.00 34.93 ? 373 GLN A O     1 
ATOM   2940 C  CB    . GLN A 1 376 ? 21.721 3.022   8.278   1.00 32.06 ? 373 GLN A CB    1 
ATOM   2941 C  CG    . GLN A 1 376 ? 22.140 3.362   9.699   1.00 34.82 ? 373 GLN A CG    1 
ATOM   2942 C  CD    . GLN A 1 376 ? 21.798 4.790   10.077  1.00 37.99 ? 373 GLN A CD    1 
ATOM   2943 O  OE1   . GLN A 1 376 ? 20.709 5.279   9.779   1.00 40.65 ? 373 GLN A OE1   1 
ATOM   2944 N  NE2   . GLN A 1 376 ? 22.736 5.470   10.727  1.00 35.99 ? 373 GLN A NE2   1 
ATOM   2945 N  N     . GLY A 1 377 ? 22.895 -0.090  9.096   1.00 35.34 ? 374 GLY A N     1 
ATOM   2946 C  CA    . GLY A 1 377 ? 22.591 -1.346  9.754   1.00 43.17 ? 374 GLY A CA    1 
ATOM   2947 C  C     . GLY A 1 377 ? 23.461 -2.487  9.260   1.00 43.70 ? 374 GLY A C     1 
ATOM   2948 O  O     . GLY A 1 377 ? 23.851 -3.361  10.035  1.00 38.00 ? 374 GLY A O     1 
ATOM   2949 N  N     . ASP A 1 378 ? 23.768 -2.477  7.967   1.00 41.64 ? 375 ASP A N     1 
ATOM   2950 C  CA    . ASP A 1 378 ? 24.578 -3.530  7.364   1.00 43.18 ? 375 ASP A CA    1 
ATOM   2951 C  C     . ASP A 1 378 ? 25.992 -3.530  7.937   1.00 46.96 ? 375 ASP A C     1 
ATOM   2952 O  O     . ASP A 1 378 ? 26.653 -2.493  7.984   1.00 48.39 ? 375 ASP A O     1 
ATOM   2953 C  CB    . ASP A 1 378 ? 24.625 -3.364  5.843   1.00 43.33 ? 375 ASP A CB    1 
ATOM   2954 C  CG    . ASP A 1 378 ? 25.191 -4.585  5.138   1.00 45.04 ? 375 ASP A CG    1 
ATOM   2955 O  OD1   . ASP A 1 378 ? 25.879 -5.394  5.795   1.00 47.50 ? 375 ASP A OD1   1 
ATOM   2956 O  OD2   . ASP A 1 378 ? 24.948 -4.733  3.922   1.00 39.83 ? 375 ASP A OD2   1 
ATOM   2957 N  N     . LYS A 1 379 ? 26.449 -4.700  8.373   1.00 50.53 ? 376 LYS A N     1 
ATOM   2958 C  CA    . LYS A 1 379 ? 27.789 -4.840  8.933   1.00 58.35 ? 376 LYS A CA    1 
ATOM   2959 C  C     . LYS A 1 379 ? 28.851 -4.837  7.837   1.00 57.80 ? 376 LYS A C     1 
ATOM   2960 O  O     . LYS A 1 379 ? 29.974 -4.378  8.048   1.00 59.21 ? 376 LYS A O     1 
ATOM   2961 C  CB    . LYS A 1 379 ? 27.889 -6.121  9.765   1.00 62.25 ? 376 LYS A CB    1 
ATOM   2962 C  CG    . LYS A 1 379 ? 29.274 -6.393  10.328  1.00 66.15 ? 376 LYS A CG    1 
ATOM   2963 C  CD    . LYS A 1 379 ? 29.286 -7.655  11.176  1.00 68.68 ? 376 LYS A CD    1 
ATOM   2964 C  CE    . LYS A 1 379 ? 30.696 -8.005  11.625  1.00 65.94 ? 376 LYS A CE    1 
ATOM   2965 N  NZ    . LYS A 1 379 ? 31.593 -8.274  10.466  1.00 63.08 ? 376 LYS A NZ    1 
ATOM   2966 N  N     . ARG A 1 380 ? 28.489 -5.353  6.667   1.00 54.55 ? 377 ARG A N     1 
ATOM   2967 C  CA    . ARG A 1 380 ? 29.392 -5.375  5.522   1.00 52.75 ? 377 ARG A CA    1 
ATOM   2968 C  C     . ARG A 1 380 ? 29.726 -3.958  5.073   1.00 52.28 ? 377 ARG A C     1 
ATOM   2969 O  O     . ARG A 1 380 ? 28.890 -3.059  5.162   1.00 48.98 ? 377 ARG A O     1 
ATOM   2970 C  CB    . ARG A 1 380 ? 28.758 -6.140  4.360   1.00 50.77 ? 377 ARG A CB    1 
ATOM   2971 C  CG    . ARG A 1 380 ? 28.376 -7.575  4.680   1.00 50.76 ? 377 ARG A CG    1 
ATOM   2972 C  CD    . ARG A 1 380 ? 27.576 -8.181  3.541   1.00 48.05 ? 377 ARG A CD    1 
ATOM   2973 N  NE    . ARG A 1 380 ? 26.329 -7.456  3.312   1.00 42.28 ? 377 ARG A NE    1 
ATOM   2974 C  CZ    . ARG A 1 380 ? 25.515 -7.676  2.285   1.00 41.22 ? 377 ARG A CZ    1 
ATOM   2975 N  NH1   . ARG A 1 380 ? 25.816 -8.600  1.384   1.00 42.69 ? 377 ARG A NH1   1 
ATOM   2976 N  NH2   . ARG A 1 380 ? 24.400 -6.969  2.157   1.00 37.10 ? 377 ARG A NH2   1 
ATOM   2977 N  N     . LEU A 1 381 ? 30.949 -3.763  4.588   1.00 51.05 ? 378 LEU A N     1 
ATOM   2978 C  CA    . LEU A 1 381 ? 31.367 -2.460  4.081   1.00 50.47 ? 378 LEU A CA    1 
ATOM   2979 C  C     . LEU A 1 381 ? 30.526 -2.046  2.877   1.00 48.11 ? 378 LEU A C     1 
ATOM   2980 O  O     . LEU A 1 381 ? 30.197 -0.871  2.714   1.00 47.95 ? 378 LEU A O     1 
ATOM   2981 C  CB    . LEU A 1 381 ? 32.854 -2.467  3.713   1.00 57.32 ? 378 LEU A CB    1 
ATOM   2982 C  CG    . LEU A 1 381 ? 33.863 -2.319  4.855   1.00 59.83 ? 378 LEU A CG    1 
ATOM   2983 C  CD1   . LEU A 1 381 ? 33.738 -3.459  5.856   1.00 59.85 ? 378 LEU A CD1   1 
ATOM   2984 C  CD2   . LEU A 1 381 ? 35.281 -2.240  4.307   1.00 58.09 ? 378 LEU A CD2   1 
ATOM   2985 N  N     . SER A 1 382 ? 30.183 -3.016  2.036   1.00 43.78 ? 379 SER A N     1 
ATOM   2986 C  CA    . SER A 1 382 ? 29.339 -2.756  0.875   1.00 40.95 ? 379 SER A CA    1 
ATOM   2987 C  C     . SER A 1 382 ? 28.058 -3.576  0.926   1.00 36.56 ? 379 SER A C     1 
ATOM   2988 O  O     . SER A 1 382 ? 28.092 -4.784  1.160   1.00 41.25 ? 379 SER A O     1 
ATOM   2989 C  CB    . SER A 1 382 ? 30.091 -3.051  -0.423  1.00 39.77 ? 379 SER A CB    1 
ATOM   2990 O  OG    . SER A 1 382 ? 29.216 -2.980  -1.537  1.00 36.43 ? 379 SER A OG    1 
ATOM   2991 N  N     . SER A 1 383 ? 26.930 -2.913  0.699   1.00 37.50 ? 380 SER A N     1 
ATOM   2992 C  CA    . SER A 1 383 ? 25.632 -3.576  0.725   1.00 33.65 ? 380 SER A CA    1 
ATOM   2993 C  C     . SER A 1 383 ? 25.191 -3.983  -0.675  1.00 38.78 ? 380 SER A C     1 
ATOM   2994 O  O     . SER A 1 383 ? 24.557 -5.022  -0.858  1.00 36.31 ? 380 SER A O     1 
ATOM   2995 C  CB    . SER A 1 383 ? 24.578 -2.663  1.358   1.00 36.70 ? 380 SER A CB    1 
ATOM   2996 O  OG    . SER A 1 383 ? 24.917 -2.338  2.695   1.00 35.80 ? 380 SER A OG    1 
ATOM   2997 N  N     . LEU A 1 384 ? 25.532 -3.160  -1.660  1.00 37.54 ? 381 LEU A N     1 
ATOM   2998 C  CA    . LEU A 1 384 ? 25.095 -3.389  -3.031  1.00 31.98 ? 381 LEU A CA    1 
ATOM   2999 C  C     . LEU A 1 384 ? 26.075 -2.802  -4.043  1.00 29.62 ? 381 LEU A C     1 
ATOM   3000 O  O     . LEU A 1 384 ? 26.670 -1.751  -3.807  1.00 23.61 ? 381 LEU A O     1 
ATOM   3001 C  CB    . LEU A 1 384 ? 23.695 -2.806  -3.240  1.00 31.59 ? 381 LEU A CB    1 
ATOM   3002 C  CG    . LEU A 1 384 ? 23.124 -2.804  -4.659  1.00 32.55 ? 381 LEU A CG    1 
ATOM   3003 C  CD1   . LEU A 1 384 ? 21.639 -3.127  -4.642  1.00 38.43 ? 381 LEU A CD1   1 
ATOM   3004 C  CD2   . LEU A 1 384 ? 23.381 -1.470  -5.343  1.00 32.35 ? 381 LEU A CD2   1 
ATOM   3005 N  N     . ARG A 1 385 ? 26.239 -3.490  -5.167  1.00 27.41 ? 382 ARG A N     1 
ATOM   3006 C  CA    . ARG A 1 385 ? 27.138 -3.034  -6.219  1.00 26.06 ? 382 ARG A CA    1 
ATOM   3007 C  C     . ARG A 1 385 ? 26.509 -3.250  -7.592  1.00 27.01 ? 382 ARG A C     1 
ATOM   3008 O  O     . ARG A 1 385 ? 26.194 -4.379  -7.970  1.00 33.94 ? 382 ARG A O     1 
ATOM   3009 C  CB    . ARG A 1 385 ? 28.476 -3.771  -6.141  1.00 29.87 ? 382 ARG A CB    1 
ATOM   3010 C  CG    . ARG A 1 385 ? 29.626 -3.026  -6.795  1.00 32.51 ? 382 ARG A CG    1 
ATOM   3011 C  CD    . ARG A 1 385 ? 30.622 -3.973  -7.447  1.00 39.32 ? 382 ARG A CD    1 
ATOM   3012 N  NE    . ARG A 1 385 ? 30.077 -4.588  -8.655  1.00 40.66 ? 382 ARG A NE    1 
ATOM   3013 C  CZ    . ARG A 1 385 ? 30.812 -5.152  -9.608  1.00 37.59 ? 382 ARG A CZ    1 
ATOM   3014 N  NH1   . ARG A 1 385 ? 30.224 -5.685  -10.671 1.00 38.09 ? 382 ARG A NH1   1 
ATOM   3015 N  NH2   . ARG A 1 385 ? 32.134 -5.179  -9.504  1.00 42.96 ? 382 ARG A NH2   1 
ATOM   3016 N  N     . ARG A 1 386 ? 26.328 -2.162  -8.331  1.00 22.06 ? 383 ARG A N     1 
ATOM   3017 C  CA    . ARG A 1 386 ? 25.755 -2.225  -9.669  1.00 24.62 ? 383 ARG A CA    1 
ATOM   3018 C  C     . ARG A 1 386 ? 26.662 -1.517  -10.665 1.00 26.41 ? 383 ARG A C     1 
ATOM   3019 O  O     . ARG A 1 386 ? 27.386 -0.591  -10.305 1.00 20.78 ? 383 ARG A O     1 
ATOM   3020 C  CB    . ARG A 1 386 ? 24.371 -1.577  -9.685  1.00 29.10 ? 383 ARG A CB    1 
ATOM   3021 C  CG    . ARG A 1 386 ? 23.332 -2.297  -8.845  1.00 26.54 ? 383 ARG A CG    1 
ATOM   3022 C  CD    . ARG A 1 386 ? 22.942 -3.622  -9.472  1.00 27.47 ? 383 ARG A CD    1 
ATOM   3023 N  NE    . ARG A 1 386 ? 21.781 -4.210  -8.812  1.00 25.59 ? 383 ARG A NE    1 
ATOM   3024 C  CZ    . ARG A 1 386 ? 21.851 -5.069  -7.801  1.00 28.07 ? 383 ARG A CZ    1 
ATOM   3025 N  NH1   . ARG A 1 386 ? 23.031 -5.447  -7.331  1.00 27.78 ? 383 ARG A NH1   1 
ATOM   3026 N  NH2   . ARG A 1 386 ? 20.740 -5.554  -7.262  1.00 34.93 ? 383 ARG A NH2   1 
ATOM   3027 N  N     . CYS A 1 387 ? 26.623 -1.950  -11.919 1.00 27.76 ? 384 CYS A N     1 
ATOM   3028 C  CA    . CYS A 1 387 ? 27.423 -1.308  -12.954 1.00 25.27 ? 384 CYS A CA    1 
ATOM   3029 C  C     . CYS A 1 387 ? 26.554 -0.739  -14.067 1.00 25.77 ? 384 CYS A C     1 
ATOM   3030 O  O     . CYS A 1 387 ? 25.442 -1.207  -14.306 1.00 28.72 ? 384 CYS A O     1 
ATOM   3031 C  CB    . CYS A 1 387 ? 28.450 -2.284  -13.533 1.00 24.97 ? 384 CYS A CB    1 
ATOM   3032 S  SG    A CYS A 1 387 ? 27.753 -3.759  -14.316 0.50 26.84 ? 384 CYS A SG    1 
ATOM   3033 S  SG    B CYS A 1 387 ? 29.545 -3.019  -12.302 0.50 31.71 ? 384 CYS A SG    1 
ATOM   3034 N  N     . CYS A 1 388 ? 27.073 0.282   -14.737 1.00 28.44 ? 385 CYS A N     1 
ATOM   3035 C  CA    . CYS A 1 388 ? 26.438 0.825   -15.929 1.00 33.50 ? 385 CYS A CA    1 
ATOM   3036 C  C     . CYS A 1 388 ? 27.523 1.275   -16.896 1.00 29.78 ? 385 CYS A C     1 
ATOM   3037 O  O     . CYS A 1 388 ? 28.691 1.381   -16.520 1.00 30.05 ? 385 CYS A O     1 
ATOM   3038 C  CB    . CYS A 1 388 ? 25.509 1.989   -15.576 1.00 28.53 ? 385 CYS A CB    1 
ATOM   3039 S  SG    . CYS A 1 388 ? 26.331 3.442   -14.885 1.00 31.99 ? 385 CYS A SG    1 
ATOM   3040 N  N     . ALA A 1 389 ? 27.141 1.529   -18.141 1.00 27.39 ? 386 ALA A N     1 
ATOM   3041 C  CA    . ALA A 1 389 ? 28.104 1.937   -19.154 1.00 28.67 ? 386 ALA A CA    1 
ATOM   3042 C  C     . ALA A 1 389 ? 28.663 3.322   -18.861 1.00 25.13 ? 386 ALA A C     1 
ATOM   3043 O  O     . ALA A 1 389 ? 27.926 4.239   -18.500 1.00 28.78 ? 386 ALA A O     1 
ATOM   3044 C  CB    . ALA A 1 389 ? 27.472 1.902   -20.537 1.00 30.62 ? 386 ALA A CB    1 
ATOM   3045 N  N     . LEU A 1 390 ? 29.975 3.463   -19.011 1.00 22.47 ? 387 LEU A N     1 
ATOM   3046 C  CA    . LEU A 1 390 ? 30.628 4.757   -18.898 1.00 22.78 ? 387 LEU A CA    1 
ATOM   3047 C  C     . LEU A 1 390 ? 31.058 5.186   -20.297 1.00 23.67 ? 387 LEU A C     1 
ATOM   3048 O  O     . LEU A 1 390 ? 32.098 4.754   -20.794 1.00 26.05 ? 387 LEU A O     1 
ATOM   3049 C  CB    . LEU A 1 390 ? 31.842 4.659   -17.973 1.00 22.96 ? 387 LEU A CB    1 
ATOM   3050 C  CG    . LEU A 1 390 ? 32.301 5.927   -17.248 1.00 23.29 ? 387 LEU A CG    1 
ATOM   3051 C  CD1   . LEU A 1 390 ? 33.499 5.618   -16.364 1.00 20.59 ? 387 LEU A CD1   1 
ATOM   3052 C  CD2   . LEU A 1 390 ? 32.632 7.042   -18.225 1.00 19.86 ? 387 LEU A CD2   1 
ATOM   3053 N  N     . THR A 1 391 ? 30.252 6.031   -20.932 1.00 25.45 ? 388 THR A N     1 
ATOM   3054 C  CA    . THR A 1 391 ? 30.466 6.384   -22.333 1.00 27.46 ? 388 THR A CA    1 
ATOM   3055 C  C     . THR A 1 391 ? 31.002 7.801   -22.522 1.00 29.47 ? 388 THR A C     1 
ATOM   3056 O  O     . THR A 1 391 ? 31.509 8.141   -23.591 1.00 28.38 ? 388 THR A O     1 
ATOM   3057 C  CB    . THR A 1 391 ? 29.171 6.225   -23.154 1.00 30.38 ? 388 THR A CB    1 
ATOM   3058 O  OG1   . THR A 1 391 ? 28.160 7.097   -22.631 1.00 28.41 ? 388 THR A OG1   1 
ATOM   3059 C  CG2   . THR A 1 391 ? 28.676 4.790   -23.091 1.00 26.32 ? 388 THR A CG2   1 
ATOM   3060 N  N     . ARG A 1 392 ? 30.882 8.624   -21.487 1.00 26.44 ? 389 ARG A N     1 
ATOM   3061 C  CA    . ARG A 1 392 ? 31.363 9.999   -21.544 1.00 26.18 ? 389 ARG A CA    1 
ATOM   3062 C  C     . ARG A 1 392 ? 31.855 10.473  -20.182 1.00 24.51 ? 389 ARG A C     1 
ATOM   3063 O  O     . ARG A 1 392 ? 31.236 10.192  -19.157 1.00 25.12 ? 389 ARG A O     1 
ATOM   3064 C  CB    . ARG A 1 392 ? 30.265 10.935  -22.057 1.00 30.14 ? 389 ARG A CB    1 
ATOM   3065 C  CG    . ARG A 1 392 ? 29.934 10.762  -23.532 1.00 32.52 ? 389 ARG A CG    1 
ATOM   3066 C  CD    . ARG A 1 392 ? 28.845 11.727  -23.979 1.00 39.85 ? 389 ARG A CD    1 
ATOM   3067 N  NE    . ARG A 1 392 ? 29.173 13.113  -23.656 1.00 44.52 ? 389 ARG A NE    1 
ATOM   3068 C  CZ    . ARG A 1 392 ? 28.646 13.787  -22.638 1.00 46.69 ? 389 ARG A CZ    1 
ATOM   3069 N  NH1   . ARG A 1 392 ? 29.003 15.046  -22.415 1.00 43.88 ? 389 ARG A NH1   1 
ATOM   3070 N  NH2   . ARG A 1 392 ? 27.757 13.205  -21.844 1.00 42.32 ? 389 ARG A NH2   1 
ATOM   3071 N  N     . TYR A 1 393 ? 32.974 11.191  -20.180 1.00 22.78 ? 390 TYR A N     1 
ATOM   3072 C  CA    . TYR A 1 393 ? 33.501 11.775  -18.953 1.00 21.61 ? 390 TYR A CA    1 
ATOM   3073 C  C     . TYR A 1 393 ? 32.736 13.046  -18.602 1.00 25.37 ? 390 TYR A C     1 
ATOM   3074 O  O     . TYR A 1 393 ? 33.229 14.157  -18.802 1.00 25.05 ? 390 TYR A O     1 
ATOM   3075 C  CB    . TYR A 1 393 ? 34.994 12.080  -19.090 1.00 22.43 ? 390 TYR A CB    1 
ATOM   3076 C  CG    . TYR A 1 393 ? 35.887 10.857  -19.072 1.00 19.42 ? 390 TYR A CG    1 
ATOM   3077 C  CD1   . TYR A 1 393 ? 37.269 10.984  -19.106 1.00 18.57 ? 390 TYR A CD1   1 
ATOM   3078 C  CD2   . TYR A 1 393 ? 35.348 9.577   -19.024 1.00 20.83 ? 390 TYR A CD2   1 
ATOM   3079 C  CE1   . TYR A 1 393 ? 38.092 9.874   -19.089 1.00 17.69 ? 390 TYR A CE1   1 
ATOM   3080 C  CE2   . TYR A 1 393 ? 36.164 8.458   -19.006 1.00 20.18 ? 390 TYR A CE2   1 
ATOM   3081 C  CZ    . TYR A 1 393 ? 37.534 8.613   -19.037 1.00 18.05 ? 390 TYR A CZ    1 
ATOM   3082 O  OH    . TYR A 1 393 ? 38.351 7.505   -19.019 1.00 17.93 ? 390 TYR A OH    1 
ATOM   3083 N  N     . ASP A 1 394 ? 31.524 12.873  -18.087 1.00 23.23 ? 391 ASP A N     1 
ATOM   3084 C  CA    . ASP A 1 394 ? 30.699 13.999  -17.674 1.00 22.36 ? 391 ASP A CA    1 
ATOM   3085 C  C     . ASP A 1 394 ? 30.095 13.717  -16.305 1.00 18.51 ? 391 ASP A C     1 
ATOM   3086 O  O     . ASP A 1 394 ? 29.359 12.746  -16.132 1.00 18.52 ? 391 ASP A O     1 
ATOM   3087 C  CB    . ASP A 1 394 ? 29.596 14.263  -18.699 1.00 28.73 ? 391 ASP A CB    1 
ATOM   3088 C  CG    . ASP A 1 394 ? 28.827 15.536  -18.409 1.00 31.57 ? 391 ASP A CG    1 
ATOM   3089 O  OD1   . ASP A 1 394 ? 27.856 15.480  -17.625 1.00 27.81 ? 391 ASP A OD1   1 
ATOM   3090 O  OD2   . ASP A 1 394 ? 29.195 16.593  -18.964 1.00 42.27 ? 391 ASP A OD2   1 
ATOM   3091 N  N     . ALA A 1 395 ? 30.413 14.570  -15.336 1.00 21.89 ? 392 ALA A N     1 
ATOM   3092 C  CA    . ALA A 1 395 ? 30.004 14.355  -13.950 1.00 19.25 ? 392 ALA A CA    1 
ATOM   3093 C  C     . ALA A 1 395 ? 28.489 14.271  -13.772 1.00 22.64 ? 392 ALA A C     1 
ATOM   3094 O  O     . ALA A 1 395 ? 27.994 13.424  -13.028 1.00 19.33 ? 392 ALA A O     1 
ATOM   3095 C  CB    . ALA A 1 395 ? 30.588 15.439  -13.050 1.00 19.14 ? 392 ALA A CB    1 
ATOM   3096 N  N     . HIS A 1 396 ? 27.757 15.155  -14.445 1.00 20.85 ? 393 HIS A N     1 
ATOM   3097 C  CA    . HIS A 1 396 ? 26.301 15.175  -14.332 1.00 24.88 ? 393 HIS A CA    1 
ATOM   3098 C  C     . HIS A 1 396 ? 25.673 13.895  -14.870 1.00 23.41 ? 393 HIS A C     1 
ATOM   3099 O  O     . HIS A 1 396 ? 24.727 13.365  -14.286 1.00 23.62 ? 393 HIS A O     1 
ATOM   3100 C  CB    . HIS A 1 396 ? 25.712 16.402  -15.035 1.00 27.39 ? 393 HIS A CB    1 
ATOM   3101 C  CG    . HIS A 1 396 ? 25.792 17.659  -14.224 1.00 28.23 ? 393 HIS A CG    1 
ATOM   3102 N  ND1   . HIS A 1 396 ? 26.838 18.549  -14.329 1.00 31.99 ? 393 HIS A ND1   1 
ATOM   3103 C  CD2   . HIS A 1 396 ? 24.956 18.167  -13.287 1.00 33.65 ? 393 HIS A CD2   1 
ATOM   3104 C  CE1   . HIS A 1 396 ? 26.642 19.556  -13.495 1.00 33.17 ? 393 HIS A CE1   1 
ATOM   3105 N  NE2   . HIS A 1 396 ? 25.508 19.349  -12.851 1.00 33.53 ? 393 HIS A NE2   1 
ATOM   3106 N  N     . LYS A 1 397 ? 26.203 13.398  -15.984 1.00 21.66 ? 394 LYS A N     1 
ATOM   3107 C  CA    . LYS A 1 397 ? 25.715 12.152  -16.565 1.00 25.83 ? 394 LYS A CA    1 
ATOM   3108 C  C     . LYS A 1 397 ? 26.032 10.959  -15.671 1.00 22.36 ? 394 LYS A C     1 
ATOM   3109 O  O     . LYS A 1 397 ? 25.171 10.116  -15.415 1.00 23.86 ? 394 LYS A O     1 
ATOM   3110 C  CB    . LYS A 1 397 ? 26.302 11.929  -17.960 1.00 26.57 ? 394 LYS A CB    1 
ATOM   3111 C  CG    . LYS A 1 397 ? 26.029 10.537  -18.516 1.00 26.47 ? 394 LYS A CG    1 
ATOM   3112 C  CD    . LYS A 1 397 ? 26.442 10.416  -19.974 1.00 28.86 ? 394 LYS A CD    1 
ATOM   3113 C  CE    . LYS A 1 397 ? 26.305 8.982   -20.464 1.00 34.85 ? 394 LYS A CE    1 
ATOM   3114 N  NZ    . LYS A 1 397 ? 24.935 8.440   -20.237 1.00 36.70 ? 394 LYS A NZ    1 
ATOM   3115 N  N     . MET A 1 398 ? 27.270 10.890  -15.195 1.00 20.72 ? 395 MET A N     1 
ATOM   3116 C  CA    . MET A 1 398 ? 27.685 9.786   -14.338 1.00 20.90 ? 395 MET A CA    1 
ATOM   3117 C  C     . MET A 1 398 ? 26.864 9.716   -13.050 1.00 20.67 ? 395 MET A C     1 
ATOM   3118 O  O     . MET A 1 398 ? 26.452 8.634   -12.630 1.00 20.17 ? 395 MET A O     1 
ATOM   3119 C  CB    . MET A 1 398 ? 29.184 9.865   -14.030 1.00 19.05 ? 395 MET A CB    1 
ATOM   3120 C  CG    . MET A 1 398 ? 30.068 9.536   -15.224 1.00 21.67 ? 395 MET A CG    1 
ATOM   3121 S  SD    . MET A 1 398 ? 31.798 9.273   -14.787 1.00 25.68 ? 395 MET A SD    1 
ATOM   3122 C  CE    . MET A 1 398 ? 32.359 10.954  -14.541 1.00 19.36 ? 395 MET A CE    1 
ATOM   3123 N  N     . SER A 1 399 ? 26.620 10.869  -12.434 1.00 19.61 ? 396 SER A N     1 
ATOM   3124 C  CA    . SER A 1 399 ? 25.838 10.917  -11.202 1.00 22.19 ? 396 SER A CA    1 
ATOM   3125 C  C     . SER A 1 399 ? 24.383 10.527  -11.450 1.00 22.39 ? 396 SER A C     1 
ATOM   3126 O  O     . SER A 1 399 ? 23.760 9.863   -10.623 1.00 22.38 ? 396 SER A O     1 
ATOM   3127 C  CB    . SER A 1 399 ? 25.923 12.303  -10.550 1.00 24.19 ? 396 SER A CB    1 
ATOM   3128 O  OG    . SER A 1 399 ? 25.527 13.325  -11.447 1.00 24.17 ? 396 SER A OG    1 
ATOM   3129 N  N     . HIS A 1 400 ? 23.848 10.939  -12.593 1.00 24.46 ? 397 HIS A N     1 
ATOM   3130 C  CA    . HIS A 1 400 ? 22.486 10.579  -12.969 1.00 25.20 ? 397 HIS A CA    1 
ATOM   3131 C  C     . HIS A 1 400 ? 22.366 9.073   -13.194 1.00 25.11 ? 397 HIS A C     1 
ATOM   3132 O  O     . HIS A 1 400 ? 21.421 8.439   -12.724 1.00 22.51 ? 397 HIS A O     1 
ATOM   3133 C  CB    . HIS A 1 400 ? 22.057 11.337  -14.225 1.00 28.68 ? 397 HIS A CB    1 
ATOM   3134 C  CG    . HIS A 1 400 ? 20.645 11.066  -14.642 1.00 35.01 ? 397 HIS A CG    1 
ATOM   3135 N  ND1   . HIS A 1 400 ? 20.314 10.095  -15.562 1.00 35.19 ? 397 HIS A ND1   1 
ATOM   3136 C  CD2   . HIS A 1 400 ? 19.478 11.639  -14.263 1.00 36.13 ? 397 HIS A CD2   1 
ATOM   3137 C  CE1   . HIS A 1 400 ? 19.003 10.081  -15.732 1.00 35.66 ? 397 HIS A CE1   1 
ATOM   3138 N  NE2   . HIS A 1 400 ? 18.473 11.009  -14.955 1.00 36.54 ? 397 HIS A NE2   1 
ATOM   3139 N  N     . ASP A 1 401 ? 23.333 8.506   -13.910 1.00 27.37 ? 398 ASP A N     1 
ATOM   3140 C  CA    . ASP A 1 401 ? 23.336 7.074   -14.192 1.00 21.81 ? 398 ASP A CA    1 
ATOM   3141 C  C     . ASP A 1 401 ? 23.519 6.258   -12.916 1.00 24.27 ? 398 ASP A C     1 
ATOM   3142 O  O     . ASP A 1 401 ? 22.945 5.179   -12.771 1.00 25.07 ? 398 ASP A O     1 
ATOM   3143 C  CB    . ASP A 1 401 ? 24.431 6.721   -15.201 1.00 24.08 ? 398 ASP A CB    1 
ATOM   3144 C  CG    . ASP A 1 401 ? 24.189 7.339   -16.566 1.00 29.24 ? 398 ASP A CG    1 
ATOM   3145 O  OD1   . ASP A 1 401 ? 23.036 7.725   -16.852 1.00 27.62 ? 398 ASP A OD1   1 
ATOM   3146 O  OD2   . ASP A 1 401 ? 25.152 7.434   -17.357 1.00 26.92 ? 398 ASP A OD2   1 
ATOM   3147 N  N     . ALA A 1 402 ? 24.322 6.779   -11.994 1.00 22.80 ? 399 ALA A N     1 
ATOM   3148 C  CA    . ALA A 1 402 ? 24.563 6.107   -10.724 1.00 21.71 ? 399 ALA A CA    1 
ATOM   3149 C  C     . ALA A 1 402 ? 23.293 6.092   -9.884  1.00 24.47 ? 399 ALA A C     1 
ATOM   3150 O  O     . ALA A 1 402 ? 22.974 5.093   -9.238  1.00 23.09 ? 399 ALA A O     1 
ATOM   3151 C  CB    . ALA A 1 402 ? 25.698 6.786   -9.967  1.00 22.41 ? 399 ALA A CB    1 
ATOM   3152 N  N     . PHE A 1 403 ? 22.571 7.208   -9.892  1.00 24.75 ? 400 PHE A N     1 
ATOM   3153 C  CA    . PHE A 1 403 ? 21.309 7.296   -9.172  1.00 27.67 ? 400 PHE A CA    1 
ATOM   3154 C  C     . PHE A 1 403 ? 20.324 6.288   -9.746  1.00 29.73 ? 400 PHE A C     1 
ATOM   3155 O  O     . PHE A 1 403 ? 19.666 5.554   -9.009  1.00 30.38 ? 400 PHE A O     1 
ATOM   3156 C  CB    . PHE A 1 403 ? 20.727 8.708   -9.267  1.00 29.95 ? 400 PHE A CB    1 
ATOM   3157 C  CG    . PHE A 1 403 ? 19.456 8.892   -8.487  1.00 35.15 ? 400 PHE A CG    1 
ATOM   3158 C  CD1   . PHE A 1 403 ? 18.227 8.599   -9.056  1.00 40.74 ? 400 PHE A CD1   1 
ATOM   3159 C  CD2   . PHE A 1 403 ? 19.490 9.355   -7.182  1.00 34.82 ? 400 PHE A CD2   1 
ATOM   3160 C  CE1   . PHE A 1 403 ? 17.057 8.765   -8.339  1.00 39.88 ? 400 PHE A CE1   1 
ATOM   3161 C  CE2   . PHE A 1 403 ? 18.323 9.524   -6.459  1.00 40.02 ? 400 PHE A CE2   1 
ATOM   3162 C  CZ    . PHE A 1 403 ? 17.105 9.229   -7.039  1.00 41.91 ? 400 PHE A CZ    1 
ATOM   3163 N  N     . THR A 1 404 ? 20.237 6.256   -11.071 1.00 28.46 ? 401 THR A N     1 
ATOM   3164 C  CA    . THR A 1 404 ? 19.330 5.351   -11.763 1.00 28.10 ? 401 THR A CA    1 
ATOM   3165 C  C     . THR A 1 404 ? 19.509 3.905   -11.308 1.00 27.35 ? 401 THR A C     1 
ATOM   3166 O  O     . THR A 1 404 ? 18.535 3.221   -10.998 1.00 29.93 ? 401 THR A O     1 
ATOM   3167 C  CB    . THR A 1 404 ? 19.519 5.430   -13.292 1.00 26.36 ? 401 THR A CB    1 
ATOM   3168 O  OG1   . THR A 1 404 ? 19.238 6.761   -13.742 1.00 27.72 ? 401 THR A OG1   1 
ATOM   3169 C  CG2   . THR A 1 404 ? 18.589 4.454   -13.995 1.00 32.38 ? 401 THR A CG2   1 
ATOM   3170 N  N     . VAL A 1 405 ? 20.754 3.443   -11.260 1.00 26.59 ? 402 VAL A N     1 
ATOM   3171 C  CA    . VAL A 1 405 ? 21.026 2.045   -10.936 1.00 28.88 ? 402 VAL A CA    1 
ATOM   3172 C  C     . VAL A 1 405 ? 20.782 1.701   -9.465  1.00 28.65 ? 402 VAL A C     1 
ATOM   3173 O  O     . VAL A 1 405 ? 20.626 0.530   -9.122  1.00 29.90 ? 402 VAL A O     1 
ATOM   3174 C  CB    . VAL A 1 405 ? 22.460 1.624   -11.333 1.00 32.54 ? 402 VAL A CB    1 
ATOM   3175 C  CG1   . VAL A 1 405 ? 22.689 1.854   -12.820 1.00 31.65 ? 402 VAL A CG1   1 
ATOM   3176 C  CG2   . VAL A 1 405 ? 23.486 2.377   -10.508 1.00 33.96 ? 402 VAL A CG2   1 
ATOM   3177 N  N     . ILE A 1 406 ? 20.742 2.713   -8.602  1.00 26.53 ? 403 ILE A N     1 
ATOM   3178 C  CA    . ILE A 1 406 ? 20.552 2.473   -7.172  1.00 32.72 ? 403 ILE A CA    1 
ATOM   3179 C  C     . ILE A 1 406 ? 19.210 2.981   -6.649  1.00 31.93 ? 403 ILE A C     1 
ATOM   3180 O  O     . ILE A 1 406 ? 18.838 2.698   -5.511  1.00 35.05 ? 403 ILE A O     1 
ATOM   3181 C  CB    . ILE A 1 406 ? 21.671 3.121   -6.326  1.00 28.31 ? 403 ILE A CB    1 
ATOM   3182 C  CG1   . ILE A 1 406 ? 21.467 4.635   -6.240  1.00 28.78 ? 403 ILE A CG1   1 
ATOM   3183 C  CG2   . ILE A 1 406 ? 23.040 2.773   -6.887  1.00 30.39 ? 403 ILE A CG2   1 
ATOM   3184 C  CD1   . ILE A 1 406 ? 22.350 5.315   -5.217  1.00 30.84 ? 403 ILE A CD1   1 
ATOM   3185 N  N     . LYS A 1 407 ? 18.487 3.727   -7.478  1.00 31.27 ? 404 LYS A N     1 
ATOM   3186 C  CA    . LYS A 1 407 ? 17.272 4.405   -7.031  1.00 36.62 ? 404 LYS A CA    1 
ATOM   3187 C  C     . LYS A 1 407 ? 16.209 3.447   -6.495  1.00 39.25 ? 404 LYS A C     1 
ATOM   3188 O  O     . LYS A 1 407 ? 15.369 3.834   -5.683  1.00 43.58 ? 404 LYS A O     1 
ATOM   3189 C  CB    . LYS A 1 407 ? 16.690 5.273   -8.152  1.00 34.84 ? 404 LYS A CB    1 
ATOM   3190 C  CG    . LYS A 1 407 ? 16.130 4.492   -9.329  1.00 35.20 ? 404 LYS A CG    1 
ATOM   3191 C  CD    . LYS A 1 407 ? 15.680 5.428   -10.441 1.00 38.55 ? 404 LYS A CD    1 
ATOM   3192 C  CE    . LYS A 1 407 ? 14.945 4.675   -11.538 1.00 41.29 ? 404 LYS A CE    1 
ATOM   3193 N  NZ    . LYS A 1 407 ? 15.758 3.556   -12.088 1.00 42.48 ? 404 LYS A NZ    1 
ATOM   3194 N  N     . ASN A 1 408 ? 16.251 2.198   -6.947  1.00 38.95 ? 405 ASN A N     1 
ATOM   3195 C  CA    . ASN A 1 408 ? 15.271 1.205   -6.522  1.00 41.19 ? 405 ASN A CA    1 
ATOM   3196 C  C     . ASN A 1 408 ? 15.620 0.563   -5.182  1.00 43.89 ? 405 ASN A C     1 
ATOM   3197 O  O     . ASN A 1 408 ? 14.870 -0.266  -4.667  1.00 39.98 ? 405 ASN A O     1 
ATOM   3198 C  CB    . ASN A 1 408 ? 15.084 0.131   -7.596  1.00 42.83 ? 405 ASN A CB    1 
ATOM   3199 C  CG    . ASN A 1 408 ? 16.360 -0.633  -7.885  1.00 50.55 ? 405 ASN A CG    1 
ATOM   3200 O  OD1   . ASN A 1 408 ? 17.442 -0.052  -7.967  1.00 46.08 ? 405 ASN A OD1   1 
ATOM   3201 N  ND2   . ASN A 1 408 ? 16.239 -1.947  -8.037  1.00 55.56 ? 405 ASN A ND2   1 
ATOM   3202 N  N     . CYS A 1 409 ? 16.763 0.946   -4.622  1.00 41.81 ? 406 CYS A N     1 
ATOM   3203 C  CA    . CYS A 1 409 ? 17.162 0.460   -3.307  1.00 44.19 ? 406 CYS A CA    1 
ATOM   3204 C  C     . CYS A 1 409 ? 16.384 1.205   -2.232  1.00 38.96 ? 406 CYS A C     1 
ATOM   3205 O  O     . CYS A 1 409 ? 16.366 0.804   -1.069  1.00 46.06 ? 406 CYS A O     1 
ATOM   3206 C  CB    . CYS A 1 409 ? 18.665 0.646   -3.092  1.00 40.97 ? 406 CYS A CB    1 
ATOM   3207 S  SG    . CYS A 1 409 ? 19.700 -0.263  -4.255  1.00 57.38 ? 406 CYS A SG    1 
ATOM   3208 N  N     . ASN A 1 410 ? 15.742 2.295   -2.637  1.00 41.97 ? 407 ASN A N     1 
ATOM   3209 C  CA    . ASN A 1 410 ? 14.942 3.106   -1.732  1.00 40.00 ? 407 ASN A CA    1 
ATOM   3210 C  C     . ASN A 1 410 ? 13.653 2.393   -1.326  1.00 44.94 ? 407 ASN A C     1 
ATOM   3211 O  O     . ASN A 1 410 ? 12.865 1.982   -2.177  1.00 46.56 ? 407 ASN A O     1 
ATOM   3212 C  CB    . ASN A 1 410 ? 14.616 4.451   -2.384  1.00 38.18 ? 407 ASN A CB    1 
ATOM   3213 C  CG    . ASN A 1 410 ? 14.036 5.450   -1.405  1.00 40.40 ? 407 ASN A CG    1 
ATOM   3214 O  OD1   . ASN A 1 410 ? 13.662 5.097   -0.286  1.00 40.06 ? 407 ASN A OD1   1 
ATOM   3215 N  ND2   . ASN A 1 410 ? 13.954 6.707   -1.824  1.00 41.47 ? 407 ASN A ND2   1 
ATOM   3216 N  N     . THR A 1 411 ? 13.448 2.250   -0.021  1.00 47.79 ? 408 THR A N     1 
ATOM   3217 C  CA    . THR A 1 411 ? 12.254 1.602   0.510   1.00 47.20 ? 408 THR A CA    1 
ATOM   3218 C  C     . THR A 1 411 ? 11.120 2.603   0.689   1.00 51.51 ? 408 THR A C     1 
ATOM   3219 O  O     . THR A 1 411 ? 9.953  2.284   0.457   1.00 54.01 ? 408 THR A O     1 
ATOM   3220 C  CB    . THR A 1 411 ? 12.541 0.927   1.864   1.00 43.02 ? 408 THR A CB    1 
ATOM   3221 O  OG1   . THR A 1 411 ? 13.396 -0.205  1.666   1.00 49.86 ? 408 THR A OG1   1 
ATOM   3222 C  CG2   . THR A 1 411 ? 11.247 0.468   2.519   1.00 58.05 ? 408 THR A CG2   1 
ATOM   3223 N  N     . SER A 1 412 ? 11.476 3.816   1.102   1.00 49.64 ? 409 SER A N     1 
ATOM   3224 C  CA    . SER A 1 412 ? 10.501 4.869   1.367   1.00 54.53 ? 409 SER A CA    1 
ATOM   3225 C  C     . SER A 1 412 ? 9.432  4.968   0.283   1.00 58.37 ? 409 SER A C     1 
ATOM   3226 O  O     . SER A 1 412 ? 9.743  5.122   -0.898  1.00 59.47 ? 409 SER A O     1 
ATOM   3227 C  CB    . SER A 1 412 ? 11.206 6.218   1.522   1.00 52.71 ? 409 SER A CB    1 
ATOM   3228 O  OG    . SER A 1 412 ? 10.269 7.271   1.662   1.00 58.82 ? 409 SER A OG    1 
ATOM   3229 N  N     . GLY A 1 413 ? 8.171  4.877   0.695   1.00 61.69 ? 410 GLY A N     1 
ATOM   3230 C  CA    . GLY A 1 413 ? 7.059  5.065   -0.217  1.00 64.09 ? 410 GLY A CA    1 
ATOM   3231 C  C     . GLY A 1 413 ? 7.045  6.491   -0.730  1.00 64.75 ? 410 GLY A C     1 
ATOM   3232 O  O     . GLY A 1 413 ? 6.533  6.772   -1.814  1.00 65.56 ? 410 GLY A O     1 
ATOM   3233 N  N     . ILE A 1 414 ? 7.615  7.393   0.062   1.00 61.99 ? 411 ILE A N     1 
ATOM   3234 C  CA    . ILE A 1 414 ? 7.749  8.788   -0.330  1.00 64.02 ? 411 ILE A CA    1 
ATOM   3235 C  C     . ILE A 1 414 ? 8.918  8.937   -1.296  1.00 64.56 ? 411 ILE A C     1 
ATOM   3236 O  O     . ILE A 1 414 ? 10.024 8.469   -1.023  1.00 62.10 ? 411 ILE A O     1 
ATOM   3237 C  CB    . ILE A 1 414 ? 7.990  9.693   0.891   1.00 60.29 ? 411 ILE A CB    1 
ATOM   3238 C  CG1   . ILE A 1 414 ? 7.122  9.244   2.068   1.00 60.97 ? 411 ILE A CG1   1 
ATOM   3239 C  CG2   . ILE A 1 414 ? 7.728  11.150  0.537   1.00 56.52 ? 411 ILE A CG2   1 
ATOM   3240 C  CD1   . ILE A 1 414 ? 7.370  10.024  3.341   1.00 59.27 ? 411 ILE A CD1   1 
ATOM   3241 N  N     . GLN A 1 415 ? 8.669  9.590   -2.426  1.00 68.20 ? 412 GLN A N     1 
ATOM   3242 C  CA    . GLN A 1 415 ? 9.685  9.757   -3.459  1.00 66.10 ? 412 GLN A CA    1 
ATOM   3243 C  C     . GLN A 1 415 ? 10.831 10.645  -2.979  1.00 62.71 ? 412 GLN A C     1 
ATOM   3244 O  O     . GLN A 1 415 ? 11.970 10.501  -3.425  1.00 63.86 ? 412 GLN A O     1 
ATOM   3245 C  CB    . GLN A 1 415 ? 9.057  10.351  -4.722  1.00 67.89 ? 412 GLN A CB    1 
ATOM   3246 C  CG    . GLN A 1 415 ? 9.945  10.303  -5.958  1.00 72.78 ? 412 GLN A CG    1 
ATOM   3247 C  CD    . GLN A 1 415 ? 10.037 8.914   -6.565  1.00 77.88 ? 412 GLN A CD    1 
ATOM   3248 O  OE1   . GLN A 1 415 ? 10.251 7.927   -5.861  1.00 76.92 ? 412 GLN A OE1   1 
ATOM   3249 N  NE2   . GLN A 1 415 ? 9.868  8.832   -7.880  1.00 74.83 ? 412 GLN A NE2   1 
ATOM   3250 N  N     . THR A 1 416 ? 10.521 11.557  -2.062  1.00 57.26 ? 413 THR A N     1 
ATOM   3251 C  CA    . THR A 1 416 ? 11.488 12.548  -1.600  1.00 55.82 ? 413 THR A CA    1 
ATOM   3252 C  C     . THR A 1 416 ? 12.387 12.027  -0.478  1.00 52.31 ? 413 THR A C     1 
ATOM   3253 O  O     . THR A 1 416 ? 13.483 12.544  -0.260  1.00 48.25 ? 413 THR A O     1 
ATOM   3254 C  CB    . THR A 1 416 ? 10.779 13.837  -1.132  1.00 58.10 ? 413 THR A CB    1 
ATOM   3255 O  OG1   . THR A 1 416 ? 9.976  14.355  -2.200  1.00 61.95 ? 413 THR A OG1   1 
ATOM   3256 C  CG2   . THR A 1 416 ? 11.793 14.891  -0.712  1.00 57.28 ? 413 THR A CG2   1 
ATOM   3257 N  N     . GLU A 1 417 ? 11.925 11.001  0.228   1.00 50.31 ? 414 GLU A N     1 
ATOM   3258 C  CA    . GLU A 1 417 ? 12.689 10.439  1.337   1.00 49.19 ? 414 GLU A CA    1 
ATOM   3259 C  C     . GLU A 1 417 ? 13.463 9.200   0.904   1.00 49.54 ? 414 GLU A C     1 
ATOM   3260 O  O     . GLU A 1 417 ? 13.021 8.457   0.028   1.00 49.79 ? 414 GLU A O     1 
ATOM   3261 C  CB    . GLU A 1 417 ? 11.764 10.095  2.505   1.00 51.12 ? 414 GLU A CB    1 
ATOM   3262 C  CG    . GLU A 1 417 ? 10.824 11.221  2.899   1.00 57.01 ? 414 GLU A CG    1 
ATOM   3263 C  CD    . GLU A 1 417 ? 11.558 12.508  3.217   1.00 50.80 ? 414 GLU A CD    1 
ATOM   3264 O  OE1   . GLU A 1 417 ? 12.333 12.526  4.196   1.00 47.40 ? 414 GLU A OE1   1 
ATOM   3265 O  OE2   . GLU A 1 417 ? 11.363 13.500  2.483   1.00 52.54 ? 414 GLU A OE2   1 
ATOM   3266 N  N     . TRP A 1 418 ? 14.621 8.981   1.521   1.00 41.67 ? 415 TRP A N     1 
ATOM   3267 C  CA    . TRP A 1 418 ? 15.415 7.794   1.234   1.00 38.86 ? 415 TRP A CA    1 
ATOM   3268 C  C     . TRP A 1 418 ? 15.589 6.932   2.479   1.00 38.04 ? 415 TRP A C     1 
ATOM   3269 O  O     . TRP A 1 418 ? 16.088 7.395   3.505   1.00 34.94 ? 415 TRP A O     1 
ATOM   3270 C  CB    . TRP A 1 418 ? 16.784 8.169   0.664   1.00 36.57 ? 415 TRP A CB    1 
ATOM   3271 C  CG    . TRP A 1 418 ? 17.487 7.005   0.034   1.00 33.02 ? 415 TRP A CG    1 
ATOM   3272 C  CD1   . TRP A 1 418 ? 18.045 5.938   0.676   1.00 33.09 ? 415 TRP A CD1   1 
ATOM   3273 C  CD2   . TRP A 1 418 ? 17.700 6.788   -1.366  1.00 34.90 ? 415 TRP A CD2   1 
ATOM   3274 N  NE1   . TRP A 1 418 ? 18.591 5.069   -0.238  1.00 33.88 ? 415 TRP A NE1   1 
ATOM   3275 C  CE2   . TRP A 1 418 ? 18.394 5.568   -1.497  1.00 33.25 ? 415 TRP A CE2   1 
ATOM   3276 C  CE3   . TRP A 1 418 ? 17.372 7.506   -2.519  1.00 37.47 ? 415 TRP A CE3   1 
ATOM   3277 C  CZ2   . TRP A 1 418 ? 18.767 5.053   -2.738  1.00 33.68 ? 415 TRP A CZ2   1 
ATOM   3278 C  CZ3   . TRP A 1 418 ? 17.744 6.992   -3.750  1.00 33.35 ? 415 TRP A CZ3   1 
ATOM   3279 C  CH2   . TRP A 1 418 ? 18.433 5.778   -3.849  1.00 35.19 ? 415 TRP A CH2   1 
ATOM   3280 N  N     . SER A 1 419 ? 15.176 5.673   2.379   1.00 37.63 ? 416 SER A N     1 
ATOM   3281 C  CA    . SER A 1 419 ? 15.297 4.735   3.487   1.00 36.97 ? 416 SER A CA    1 
ATOM   3282 C  C     . SER A 1 419 ? 15.567 3.324   2.976   1.00 39.57 ? 416 SER A C     1 
ATOM   3283 O  O     . SER A 1 419 ? 15.071 2.941   1.918   1.00 41.83 ? 416 SER A O     1 
ATOM   3284 C  CB    . SER A 1 419 ? 14.030 4.753   4.345   1.00 42.73 ? 416 SER A CB    1 
ATOM   3285 O  OG    . SER A 1 419 ? 12.883 4.472   3.562   1.00 49.04 ? 416 SER A OG    1 
ATOM   3286 N  N     . PRO A 1 420 ? 16.376 2.554   3.719   1.00 39.08 ? 417 PRO A N     1 
ATOM   3287 C  CA    . PRO A 1 420 ? 17.064 3.043   4.917   1.00 39.06 ? 417 PRO A CA    1 
ATOM   3288 C  C     . PRO A 1 420 ? 18.195 3.987   4.529   1.00 36.68 ? 417 PRO A C     1 
ATOM   3289 O  O     . PRO A 1 420 ? 18.751 3.843   3.439   1.00 36.93 ? 417 PRO A O     1 
ATOM   3290 C  CB    . PRO A 1 420 ? 17.627 1.765   5.540   1.00 39.65 ? 417 PRO A CB    1 
ATOM   3291 C  CG    . PRO A 1 420 ? 17.806 0.840   4.388   1.00 40.33 ? 417 PRO A CG    1 
ATOM   3292 C  CD    . PRO A 1 420 ? 16.673 1.136   3.450   1.00 37.92 ? 417 PRO A CD    1 
ATOM   3293 N  N     . PRO A 1 421 ? 18.527 4.947   5.405   1.00 33.83 ? 418 PRO A N     1 
ATOM   3294 C  CA    . PRO A 1 421 ? 19.551 5.955   5.111   1.00 36.10 ? 418 PRO A CA    1 
ATOM   3295 C  C     . PRO A 1 421 ? 20.839 5.330   4.582   1.00 27.84 ? 418 PRO A C     1 
ATOM   3296 O  O     . PRO A 1 421 ? 21.183 4.210   4.960   1.00 30.02 ? 418 PRO A O     1 
ATOM   3297 C  CB    . PRO A 1 421 ? 19.797 6.603   6.475   1.00 33.86 ? 418 PRO A CB    1 
ATOM   3298 C  CG    . PRO A 1 421 ? 18.505 6.442   7.196   1.00 34.86 ? 418 PRO A CG    1 
ATOM   3299 C  CD    . PRO A 1 421 ? 17.958 5.113   6.754   1.00 35.84 ? 418 PRO A CD    1 
ATOM   3300 N  N     . LEU A 1 422 ? 21.536 6.051   3.710   1.00 28.33 ? 419 LEU A N     1 
ATOM   3301 C  CA    . LEU A 1 422 ? 22.785 5.563   3.137   1.00 27.85 ? 419 LEU A CA    1 
ATOM   3302 C  C     . LEU A 1 422 ? 23.979 6.011   3.973   1.00 24.27 ? 419 LEU A C     1 
ATOM   3303 O  O     . LEU A 1 422 ? 24.101 7.186   4.317   1.00 22.75 ? 419 LEU A O     1 
ATOM   3304 C  CB    . LEU A 1 422 ? 22.941 6.048   1.694   1.00 24.50 ? 419 LEU A CB    1 
ATOM   3305 C  CG    . LEU A 1 422 ? 21.863 5.590   0.710   1.00 28.73 ? 419 LEU A CG    1 
ATOM   3306 C  CD1   . LEU A 1 422 ? 22.171 6.081   -0.698  1.00 26.92 ? 419 LEU A CD1   1 
ATOM   3307 C  CD2   . LEU A 1 422 ? 21.731 4.076   0.735   1.00 27.19 ? 419 LEU A CD2   1 
ATOM   3308 N  N     . THR A 1 423 ? 24.859 5.070   4.297   1.00 24.55 ? 420 THR A N     1 
ATOM   3309 C  CA    . THR A 1 423 ? 26.030 5.375   5.110   1.00 23.01 ? 420 THR A CA    1 
ATOM   3310 C  C     . THR A 1 423 ? 27.326 5.338   4.304   1.00 19.74 ? 420 THR A C     1 
ATOM   3311 O  O     . THR A 1 423 ? 28.410 5.523   4.856   1.00 18.78 ? 420 THR A O     1 
ATOM   3312 C  CB    . THR A 1 423 ? 26.147 4.424   6.315   1.00 25.00 ? 420 THR A CB    1 
ATOM   3313 O  OG1   . THR A 1 423 ? 26.165 3.067   5.856   1.00 26.71 ? 420 THR A OG1   1 
ATOM   3314 C  CG2   . THR A 1 423 ? 24.970 4.620   7.263   1.00 28.58 ? 420 THR A CG2   1 
ATOM   3315 N  N     . MET A 1 424 ? 27.213 5.104   2.999   1.00 15.21 ? 421 MET A N     1 
ATOM   3316 C  CA    . MET A 1 424 ? 28.388 5.094   2.128   1.00 16.21 ? 421 MET A CA    1 
ATOM   3317 C  C     . MET A 1 424 ? 28.011 5.178   0.651   1.00 19.22 ? 421 MET A C     1 
ATOM   3318 O  O     . MET A 1 424 ? 27.090 4.500   0.196   1.00 19.36 ? 421 MET A O     1 
ATOM   3319 C  CB    . MET A 1 424 ? 29.239 3.846   2.388   1.00 18.86 ? 421 MET A CB    1 
ATOM   3320 C  CG    . MET A 1 424 ? 30.565 3.805   1.628   1.00 17.52 ? 421 MET A CG    1 
ATOM   3321 S  SD    . MET A 1 424 ? 30.411 3.250   -0.082  1.00 21.29 ? 421 MET A SD    1 
ATOM   3322 C  CE    . MET A 1 424 ? 29.803 1.581   0.158   1.00 24.24 ? 421 MET A CE    1 
ATOM   3323 N  N     . LEU A 1 425 ? 28.726 6.026   -0.085  1.00 14.88 ? 422 LEU A N     1 
ATOM   3324 C  CA    . LEU A 1 425 ? 28.597 6.106   -1.535  1.00 14.32 ? 422 LEU A CA    1 
ATOM   3325 C  C     . LEU A 1 425 ? 29.956 5.858   -2.177  1.00 16.47 ? 422 LEU A C     1 
ATOM   3326 O  O     . LEU A 1 425 ? 30.989 6.264   -1.640  1.00 13.04 ? 422 LEU A O     1 
ATOM   3327 C  CB    . LEU A 1 425 ? 28.067 7.473   -1.969  1.00 11.61 ? 422 LEU A CB    1 
ATOM   3328 C  CG    . LEU A 1 425 ? 26.648 7.874   -1.562  1.00 15.57 ? 422 LEU A CG    1 
ATOM   3329 C  CD1   . LEU A 1 425 ? 26.335 9.275   -2.074  1.00 16.03 ? 422 LEU A CD1   1 
ATOM   3330 C  CD2   . LEU A 1 425 ? 25.628 6.873   -2.076  1.00 17.12 ? 422 LEU A CD2   1 
ATOM   3331 N  N     . PHE A 1 426 ? 29.950 5.204   -3.333  1.00 14.67 ? 423 PHE A N     1 
ATOM   3332 C  CA    . PHE A 1 426 ? 31.186 4.797   -3.987  1.00 14.39 ? 423 PHE A CA    1 
ATOM   3333 C  C     . PHE A 1 426 ? 31.002 4.749   -5.502  1.00 14.86 ? 423 PHE A C     1 
ATOM   3334 O  O     . PHE A 1 426 ? 30.145 4.023   -6.005  1.00 18.59 ? 423 PHE A O     1 
ATOM   3335 C  CB    . PHE A 1 426 ? 31.605 3.418   -3.467  1.00 18.47 ? 423 PHE A CB    1 
ATOM   3336 C  CG    . PHE A 1 426 ? 32.922 2.932   -4.004  1.00 19.82 ? 423 PHE A CG    1 
ATOM   3337 C  CD1   . PHE A 1 426 ? 33.196 1.574   -4.065  1.00 29.35 ? 423 PHE A CD1   1 
ATOM   3338 C  CD2   . PHE A 1 426 ? 33.892 3.824   -4.430  1.00 20.19 ? 423 PHE A CD2   1 
ATOM   3339 C  CE1   . PHE A 1 426 ? 34.407 1.116   -4.555  1.00 28.76 ? 423 PHE A CE1   1 
ATOM   3340 C  CE2   . PHE A 1 426 ? 35.108 3.372   -4.918  1.00 20.99 ? 423 PHE A CE2   1 
ATOM   3341 C  CZ    . PHE A 1 426 ? 35.365 2.016   -4.980  1.00 23.24 ? 423 PHE A CZ    1 
ATOM   3342 N  N     . LEU A 1 427 ? 31.799 5.533   -6.222  1.00 14.54 ? 424 LEU A N     1 
ATOM   3343 C  CA    . LEU A 1 427 ? 31.824 5.476   -7.682  1.00 14.84 ? 424 LEU A CA    1 
ATOM   3344 C  C     . LEU A 1 427 ? 33.211 5.062   -8.148  1.00 14.79 ? 424 LEU A C     1 
ATOM   3345 O  O     . LEU A 1 427 ? 34.208 5.647   -7.728  1.00 15.36 ? 424 LEU A O     1 
ATOM   3346 C  CB    . LEU A 1 427 ? 31.473 6.834   -8.291  1.00 11.04 ? 424 LEU A CB    1 
ATOM   3347 C  CG    . LEU A 1 427 ? 30.107 7.449   -7.984  1.00 16.00 ? 424 LEU A CG    1 
ATOM   3348 C  CD1   . LEU A 1 427 ? 29.964 8.783   -8.708  1.00 15.09 ? 424 LEU A CD1   1 
ATOM   3349 C  CD2   . LEU A 1 427 ? 28.976 6.504   -8.368  1.00 16.66 ? 424 LEU A CD2   1 
ATOM   3350 N  N     . CYS A 1 428 ? 33.279 4.062   -9.022  1.00 17.44 ? 425 CYS A N     1 
ATOM   3351 C  CA    . CYS A 1 428 ? 34.567 3.572   -9.504  1.00 14.77 ? 425 CYS A CA    1 
ATOM   3352 C  C     . CYS A 1 428 ? 34.588 3.338   -11.016 1.00 15.25 ? 425 CYS A C     1 
ATOM   3353 O  O     . CYS A 1 428 ? 33.752 2.614   -11.555 1.00 14.54 ? 425 CYS A O     1 
ATOM   3354 C  CB    . CYS A 1 428 ? 34.957 2.287   -8.768  1.00 20.77 ? 425 CYS A CB    1 
ATOM   3355 S  SG    . CYS A 1 428 ? 36.620 1.687   -9.149  1.00 21.12 ? 425 CYS A SG    1 
ATOM   3356 N  N     . ALA A 1 429 ? 35.553 3.955   -11.691 1.00 13.86 ? 426 ALA A N     1 
ATOM   3357 C  CA    . ALA A 1 429 ? 35.737 3.759   -13.124 1.00 13.93 ? 426 ALA A CA    1 
ATOM   3358 C  C     . ALA A 1 429 ? 36.649 2.563   -13.371 1.00 16.22 ? 426 ALA A C     1 
ATOM   3359 O  O     . ALA A 1 429 ? 37.719 2.454   -12.767 1.00 12.65 ? 426 ALA A O     1 
ATOM   3360 C  CB    . ALA A 1 429 ? 36.319 5.011   -13.759 1.00 13.71 ? 426 ALA A CB    1 
ATOM   3361 N  N     . THR A 1 430 ? 36.223 1.668   -14.259 1.00 18.34 ? 427 THR A N     1 
ATOM   3362 C  CA    . THR A 1 430 ? 36.958 0.435   -14.516 1.00 18.42 ? 427 THR A CA    1 
ATOM   3363 C  C     . THR A 1 430 ? 36.952 0.061   -15.997 1.00 20.37 ? 427 THR A C     1 
ATOM   3364 O  O     . THR A 1 430 ? 36.383 0.770   -16.831 1.00 18.96 ? 427 THR A O     1 
ATOM   3365 C  CB    . THR A 1 430 ? 36.357 -0.747  -13.728 1.00 19.67 ? 427 THR A CB    1 
ATOM   3366 O  OG1   . THR A 1 430 ? 35.104 -1.122  -14.311 1.00 26.43 ? 427 THR A OG1   1 
ATOM   3367 C  CG2   . THR A 1 430 ? 36.139 -0.370  -12.267 1.00 19.73 ? 427 THR A CG2   1 
ATOM   3368 N  N     . LYS A 1 431 ? 37.584 -1.067  -16.308 1.00 22.45 ? 428 LYS A N     1 
ATOM   3369 C  CA    . LYS A 1 431 ? 37.625 -1.599  -17.668 1.00 22.61 ? 428 LYS A CA    1 
ATOM   3370 C  C     . LYS A 1 431 ? 38.169 -0.591  -18.675 1.00 17.68 ? 428 LYS A C     1 
ATOM   3371 O  O     . LYS A 1 431 ? 37.450 -0.122  -19.560 1.00 18.53 ? 428 LYS A O     1 
ATOM   3372 C  CB    . LYS A 1 431 ? 36.245 -2.106  -18.092 1.00 21.98 ? 428 LYS A CB    1 
ATOM   3373 C  CG    . LYS A 1 431 ? 35.726 -3.234  -17.216 1.00 29.62 ? 428 LYS A CG    1 
ATOM   3374 C  CD    . LYS A 1 431 ? 34.516 -3.917  -17.830 1.00 34.97 ? 428 LYS A CD    1 
ATOM   3375 C  CE    . LYS A 1 431 ? 34.029 -5.055  -16.947 1.00 38.21 ? 428 LYS A CE    1 
ATOM   3376 N  NZ    . LYS A 1 431 ? 35.118 -6.027  -16.646 1.00 41.29 ? 428 LYS A NZ    1 
ATOM   3377 N  N     . PHE A 1 432 ? 39.449 -0.270  -18.534 1.00 17.32 ? 429 PHE A N     1 
ATOM   3378 C  CA    . PHE A 1 432 ? 40.096 0.689   -19.414 1.00 15.73 ? 429 PHE A CA    1 
ATOM   3379 C  C     . PHE A 1 432 ? 40.420 0.082   -20.772 1.00 22.48 ? 429 PHE A C     1 
ATOM   3380 O  O     . PHE A 1 432 ? 40.765 -1.097  -20.873 1.00 20.98 ? 429 PHE A O     1 
ATOM   3381 C  CB    . PHE A 1 432 ? 41.370 1.236   -18.766 1.00 19.18 ? 429 PHE A CB    1 
ATOM   3382 C  CG    . PHE A 1 432 ? 41.112 2.197   -17.643 1.00 18.67 ? 429 PHE A CG    1 
ATOM   3383 C  CD1   . PHE A 1 432 ? 40.964 3.551   -17.895 1.00 14.84 ? 429 PHE A CD1   1 
ATOM   3384 C  CD2   . PHE A 1 432 ? 41.012 1.749   -16.336 1.00 18.74 ? 429 PHE A CD2   1 
ATOM   3385 C  CE1   . PHE A 1 432 ? 40.721 4.442   -16.866 1.00 16.57 ? 429 PHE A CE1   1 
ATOM   3386 C  CE2   . PHE A 1 432 ? 40.772 2.635   -15.303 1.00 21.26 ? 429 PHE A CE2   1 
ATOM   3387 C  CZ    . PHE A 1 432 ? 40.627 3.984   -15.568 1.00 17.50 ? 429 PHE A CZ    1 
ATOM   3388 N  N     . SER A 1 433 ? 40.287 0.898   -21.812 1.00 19.15 ? 430 SER A N     1 
ATOM   3389 C  CA    . SER A 1 433 ? 40.717 0.532   -23.155 1.00 21.73 ? 430 SER A CA    1 
ATOM   3390 C  C     . SER A 1 433 ? 41.682 1.596   -23.661 1.00 23.24 ? 430 SER A C     1 
ATOM   3391 O  O     . SER A 1 433 ? 41.626 2.748   -23.228 1.00 18.75 ? 430 SER A O     1 
ATOM   3392 C  CB    . SER A 1 433 ? 39.518 0.423   -24.099 1.00 21.91 ? 430 SER A CB    1 
ATOM   3393 O  OG    . SER A 1 433 ? 38.607 -0.570  -23.660 1.00 31.19 ? 430 SER A OG    1 
ATOM   3394 N  N     . ALA A 1 434 ? 42.569 1.213   -24.573 1.00 19.52 ? 431 ALA A N     1 
ATOM   3395 C  CA    . ALA A 1 434 ? 43.537 2.151   -25.127 1.00 22.17 ? 431 ALA A CA    1 
ATOM   3396 C  C     . ALA A 1 434 ? 42.825 3.248   -25.910 1.00 24.85 ? 431 ALA A C     1 
ATOM   3397 O  O     . ALA A 1 434 ? 41.795 3.004   -26.540 1.00 22.42 ? 431 ALA A O     1 
ATOM   3398 C  CB    . ALA A 1 434 ? 44.537 1.425   -26.011 1.00 32.81 ? 431 ALA A CB    1 
ATOM   3399 N  N     . SER A 1 435 ? 43.369 4.458   -25.857 1.00 20.46 ? 432 SER A N     1 
ATOM   3400 C  CA    . SER A 1 435 ? 42.787 5.586   -26.577 1.00 28.38 ? 432 SER A CA    1 
ATOM   3401 C  C     . SER A 1 435 ? 43.867 6.551   -27.057 1.00 30.27 ? 432 SER A C     1 
ATOM   3402 O  O     . SER A 1 435 ? 43.570 7.633   -27.561 1.00 35.95 ? 432 SER A O     1 
ATOM   3403 C  CB    . SER A 1 435 ? 41.768 6.320   -25.702 1.00 25.53 ? 432 SER A CB    1 
ATOM   3404 O  OG    . SER A 1 435 ? 42.387 6.886   -24.559 1.00 28.91 ? 432 SER A OG    1 
ATOM   3405 O  OXT   . SER A 1 435 ? 45.061 6.272   -26.950 1.00 32.50 ? 432 SER A OXT   1 
ATOM   3406 O  "O3'" . DC  B 2 1   ? 27.921 4.929   11.963  1.00 41.14 ? 1   DC  T "O3'" 1 
ATOM   3407 P  P     . DA  B 2 2   ? 28.247 4.620   13.507  1.00 57.31 ? 2   DA  T P     1 
ATOM   3408 O  OP1   . DA  B 2 2   ? 28.308 3.151   13.676  1.00 49.16 ? 2   DA  T OP1   1 
ATOM   3409 O  OP2   . DA  B 2 2   ? 27.319 5.420   14.338  1.00 48.59 ? 2   DA  T OP2   1 
ATOM   3410 O  "O5'" . DA  B 2 2   ? 29.712 5.230   13.710  1.00 43.92 ? 2   DA  T "O5'" 1 
ATOM   3411 C  "C5'" . DA  B 2 2   ? 30.781 4.841   12.857  1.00 39.83 ? 2   DA  T "C5'" 1 
ATOM   3412 C  "C4'" . DA  B 2 2   ? 32.043 5.609   13.206  1.00 37.50 ? 2   DA  T "C4'" 1 
ATOM   3413 O  "O4'" . DA  B 2 2   ? 31.881 6.998   12.827  1.00 37.17 ? 2   DA  T "O4'" 1 
ATOM   3414 C  "C3'" . DA  B 2 2   ? 32.397 5.602   14.689  1.00 41.16 ? 2   DA  T "C3'" 1 
ATOM   3415 O  "O3'" . DA  B 2 2   ? 33.803 5.470   14.856  1.00 37.21 ? 2   DA  T "O3'" 1 
ATOM   3416 C  "C2'" . DA  B 2 2   ? 31.903 6.956   15.192  1.00 36.87 ? 2   DA  T "C2'" 1 
ATOM   3417 C  "C1'" . DA  B 2 2   ? 32.012 7.840   13.955  1.00 34.12 ? 2   DA  T "C1'" 1 
ATOM   3418 N  N9    . DA  B 2 2   ? 30.962 8.850   13.897  1.00 32.83 ? 2   DA  T N9    1 
ATOM   3419 C  C8    . DA  B 2 2   ? 29.697 8.750   14.408  1.00 33.61 ? 2   DA  T C8    1 
ATOM   3420 N  N7    . DA  B 2 2   ? 28.961 9.818   14.213  1.00 34.54 ? 2   DA  T N7    1 
ATOM   3421 C  C5    . DA  B 2 2   ? 29.801 10.676  13.525  1.00 33.44 ? 2   DA  T C5    1 
ATOM   3422 C  C6    . DA  B 2 2   ? 29.619 11.978  13.020  1.00 34.20 ? 2   DA  T C6    1 
ATOM   3423 N  N6    . DA  B 2 2   ? 28.476 12.661  13.143  1.00 35.97 ? 2   DA  T N6    1 
ATOM   3424 N  N1    . DA  B 2 2   ? 30.661 12.551  12.383  1.00 33.86 ? 2   DA  T N1    1 
ATOM   3425 C  C2    . DA  B 2 2   ? 31.804 11.864  12.262  1.00 29.54 ? 2   DA  T C2    1 
ATOM   3426 N  N3    . DA  B 2 2   ? 32.092 10.638  12.694  1.00 32.52 ? 2   DA  T N3    1 
ATOM   3427 C  C4    . DA  B 2 2   ? 31.038 10.096  13.322  1.00 30.85 ? 2   DA  T C4    1 
ATOM   3428 P  P     . DT  B 2 3   ? 34.431 4.066   15.319  1.00 37.50 ? 3   DT  T P     1 
ATOM   3429 O  OP1   . DT  B 2 3   ? 33.368 3.291   15.996  1.00 47.39 ? 3   DT  T OP1   1 
ATOM   3430 O  OP2   . DT  B 2 3   ? 35.704 4.344   16.021  1.00 40.64 ? 3   DT  T OP2   1 
ATOM   3431 O  "O5'" . DT  B 2 3   ? 34.782 3.336   13.939  1.00 38.54 ? 3   DT  T "O5'" 1 
ATOM   3432 C  "C5'" . DT  B 2 3   ? 36.034 3.572   13.302  1.00 35.97 ? 3   DT  T "C5'" 1 
ATOM   3433 C  "C4'" . DT  B 2 3   ? 36.056 4.902   12.571  1.00 35.49 ? 3   DT  T "C4'" 1 
ATOM   3434 O  "O4'" . DT  B 2 3   ? 37.431 5.257   12.277  1.00 31.91 ? 3   DT  T "O4'" 1 
ATOM   3435 C  "C3'" . DT  B 2 3   ? 35.334 4.921   11.229  1.00 34.04 ? 3   DT  T "C3'" 1 
ATOM   3436 O  "O3'" . DT  B 2 3   ? 34.803 6.217   10.997  1.00 31.85 ? 3   DT  T "O3'" 1 
ATOM   3437 C  "C2'" . DT  B 2 3   ? 36.452 4.583   10.248  1.00 32.51 ? 3   DT  T "C2'" 1 
ATOM   3438 C  "C1'" . DT  B 2 3   ? 37.631 5.318   10.877  1.00 28.67 ? 3   DT  T "C1'" 1 
ATOM   3439 N  N1    . DT  B 2 3   ? 38.957 4.707   10.579  1.00 30.95 ? 3   DT  T N1    1 
ATOM   3440 C  C2    . DT  B 2 3   ? 39.944 5.476   9.997   1.00 30.74 ? 3   DT  T C2    1 
ATOM   3441 O  O2    . DT  B 2 3   ? 39.792 6.649   9.702   1.00 36.37 ? 3   DT  T O2    1 
ATOM   3442 N  N3    . DT  B 2 3   ? 41.127 4.817   9.771   1.00 30.85 ? 3   DT  T N3    1 
ATOM   3443 C  C4    . DT  B 2 3   ? 41.411 3.495   10.064  1.00 27.89 ? 3   DT  T C4    1 
ATOM   3444 O  O4    . DT  B 2 3   ? 42.504 2.993   9.822   1.00 30.68 ? 3   DT  T O4    1 
ATOM   3445 C  C5    . DT  B 2 3   ? 40.336 2.749   10.673  1.00 27.33 ? 3   DT  T C5    1 
ATOM   3446 C  C7    . DT  B 2 3   ? 40.528 1.305   11.035  1.00 33.19 ? 3   DT  T C7    1 
ATOM   3447 C  C6    . DT  B 2 3   ? 39.177 3.381   10.900  1.00 30.55 ? 3   DT  T C6    1 
ATOM   3448 P  P     . DT  B 2 4   ? 34.042 6.545   9.620   1.00 35.22 ? 4   DT  T P     1 
ATOM   3449 O  OP1   . DT  B 2 4   ? 33.277 7.797   9.808   1.00 35.33 ? 4   DT  T OP1   1 
ATOM   3450 O  OP2   . DT  B 2 4   ? 33.354 5.314   9.173   1.00 37.38 ? 4   DT  T OP2   1 
ATOM   3451 O  "O5'" . DT  B 2 4   ? 35.234 6.823   8.592   1.00 29.93 ? 4   DT  T "O5'" 1 
ATOM   3452 C  "C5'" . DT  B 2 4   ? 35.993 8.017   8.702   1.00 24.24 ? 4   DT  T "C5'" 1 
ATOM   3453 C  "C4'" . DT  B 2 4   ? 36.787 8.237   7.430   1.00 21.20 ? 4   DT  T "C4'" 1 
ATOM   3454 O  "O4'" . DT  B 2 4   ? 37.959 7.383   7.420   1.00 18.16 ? 4   DT  T "O4'" 1 
ATOM   3455 C  "C3'" . DT  B 2 4   ? 36.033 7.926   6.142   1.00 17.51 ? 4   DT  T "C3'" 1 
ATOM   3456 O  "O3'" . DT  B 2 4   ? 36.373 8.921   5.197   1.00 17.62 ? 4   DT  T "O3'" 1 
ATOM   3457 C  "C2'" . DT  B 2 4   ? 36.568 6.550   5.747   1.00 17.19 ? 4   DT  T "C2'" 1 
ATOM   3458 C  "C1'" . DT  B 2 4   ? 38.016 6.687   6.192   1.00 17.00 ? 4   DT  T "C1'" 1 
ATOM   3459 N  N1    . DT  B 2 4   ? 38.742 5.416   6.447   1.00 18.60 ? 4   DT  T N1    1 
ATOM   3460 C  C2    . DT  B 2 4   ? 40.066 5.353   6.083   1.00 18.43 ? 4   DT  T C2    1 
ATOM   3461 O  O2    . DT  B 2 4   ? 40.653 6.282   5.557   1.00 14.33 ? 4   DT  T O2    1 
ATOM   3462 N  N3    . DT  B 2 4   ? 40.677 4.159   6.355   1.00 18.57 ? 4   DT  T N3    1 
ATOM   3463 C  C4    . DT  B 2 4   ? 40.108 3.047   6.945   1.00 19.54 ? 4   DT  T C4    1 
ATOM   3464 O  O4    . DT  B 2 4   ? 40.750 2.022   7.147   1.00 18.40 ? 4   DT  T O4    1 
ATOM   3465 C  C5    . DT  B 2 4   ? 38.718 3.180   7.305   1.00 21.76 ? 4   DT  T C5    1 
ATOM   3466 C  C7    . DT  B 2 4   ? 37.996 2.034   7.953   1.00 21.55 ? 4   DT  T C7    1 
ATOM   3467 C  C6    . DT  B 2 4   ? 38.107 4.346   7.045   1.00 18.64 ? 4   DT  T C6    1 
ATOM   3468 P  P     . DA  B 2 5   ? 35.751 8.881   3.717   1.00 14.61 ? 5   DA  T P     1 
ATOM   3469 O  OP1   . DA  B 2 5   ? 35.427 10.267  3.327   1.00 14.29 ? 5   DA  T OP1   1 
ATOM   3470 O  OP2   . DA  B 2 5   ? 34.706 7.833   3.685   1.00 16.43 ? 5   DA  T OP2   1 
ATOM   3471 O  "O5'" . DA  B 2 5   ? 36.968 8.373   2.816   1.00 13.70 ? 5   DA  T "O5'" 1 
ATOM   3472 C  "C5'" . DA  B 2 5   ? 38.079 9.230   2.613   1.00 10.70 ? 5   DA  T "C5'" 1 
ATOM   3473 C  "C4'" . DA  B 2 5   ? 39.061 8.600   1.648   1.00 13.72 ? 5   DA  T "C4'" 1 
ATOM   3474 O  "O4'" . DA  B 2 5   ? 39.653 7.427   2.265   1.00 13.71 ? 5   DA  T "O4'" 1 
ATOM   3475 C  "C3'" . DA  B 2 5   ? 38.444 8.131   0.334   1.00 11.07 ? 5   DA  T "C3'" 1 
ATOM   3476 O  "O3'" . DA  B 2 5   ? 39.328 8.446   -0.725  1.00 13.64 ? 5   DA  T "O3'" 1 
ATOM   3477 C  "C2'" . DA  B 2 5   ? 38.331 6.623   0.528   1.00 13.34 ? 5   DA  T "C2'" 1 
ATOM   3478 C  "C1'" . DA  B 2 5   ? 39.583 6.352   1.356   1.00 15.12 ? 5   DA  T "C1'" 1 
ATOM   3479 N  N9    . DA  B 2 5   ? 39.534 5.098   2.101   1.00 14.19 ? 5   DA  T N9    1 
ATOM   3480 C  C8    . DA  B 2 5   ? 38.450 4.556   2.731   1.00 14.84 ? 5   DA  T C8    1 
ATOM   3481 N  N7    . DA  B 2 5   ? 38.702 3.414   3.325   1.00 15.37 ? 5   DA  T N7    1 
ATOM   3482 C  C5    . DA  B 2 5   ? 40.044 3.191   3.065   1.00 15.40 ? 5   DA  T C5    1 
ATOM   3483 C  C6    . DA  B 2 5   ? 40.917 2.144   3.420   1.00 17.42 ? 5   DA  T C6    1 
ATOM   3484 N  N6    . DA  B 2 5   ? 40.538 1.087   4.142   1.00 14.11 ? 5   DA  T N6    1 
ATOM   3485 N  N1    . DA  B 2 5   ? 42.197 2.229   3.001   1.00 15.68 ? 5   DA  T N1    1 
ATOM   3486 C  C2    . DA  B 2 5   ? 42.572 3.290   2.276   1.00 16.16 ? 5   DA  T C2    1 
ATOM   3487 N  N3    . DA  B 2 5   ? 41.841 4.331   1.880   1.00 12.32 ? 5   DA  T N3    1 
ATOM   3488 C  C4    . DA  B 2 5   ? 40.574 4.219   2.312   1.00 15.21 ? 5   DA  T C4    1 
ATOM   3489 P  P     . DT  B 2 6   ? 38.824 8.377   -2.250  1.00 13.35 ? 6   DT  T P     1 
ATOM   3490 O  OP1   . DT  B 2 6   ? 39.953 8.776   -3.118  1.00 15.85 ? 6   DT  T OP1   1 
ATOM   3491 O  OP2   . DT  B 2 6   ? 37.538 9.096   -2.339  1.00 14.25 ? 6   DT  T OP2   1 
ATOM   3492 O  "O5'" . DT  B 2 6   ? 38.516 6.823   -2.473  1.00 14.67 ? 6   DT  T "O5'" 1 
ATOM   3493 C  "C5'" . DT  B 2 6   ? 39.254 6.049   -3.412  1.00 16.47 ? 6   DT  T "C5'" 1 
ATOM   3494 C  "C4'" . DT  B 2 6   ? 40.518 5.454   -2.813  1.00 18.63 ? 6   DT  T "C4'" 1 
ATOM   3495 O  "O4'" . DT  B 2 6   ? 40.222 4.787   -1.566  1.00 15.75 ? 6   DT  T "O4'" 1 
ATOM   3496 C  "C3'" . DT  B 2 6   ? 41.148 4.376   -3.684  1.00 18.45 ? 6   DT  T "C3'" 1 
ATOM   3497 O  "O3'" . DT  B 2 6   ? 42.128 4.962   -4.519  1.00 18.99 ? 6   DT  T "O3'" 1 
ATOM   3498 C  "C2'" . DT  B 2 6   ? 41.791 3.402   -2.699  1.00 19.75 ? 6   DT  T "C2'" 1 
ATOM   3499 C  "C1'" . DT  B 2 6   ? 41.196 3.783   -1.346  1.00 17.61 ? 6   DT  T "C1'" 1 
ATOM   3500 N  N1    . DT  B 2 6   ? 40.545 2.647   -0.635  1.00 16.67 ? 6   DT  T N1    1 
ATOM   3501 C  C2    . DT  B 2 6   ? 41.296 1.558   -0.244  1.00 17.27 ? 6   DT  T C2    1 
ATOM   3502 O  O2    . DT  B 2 6   ? 42.493 1.447   -0.451  1.00 15.84 ? 6   DT  T O2    1 
ATOM   3503 N  N3    . DT  B 2 6   ? 40.585 0.585   0.410   1.00 14.68 ? 6   DT  T N3    1 
ATOM   3504 C  C4    . DT  B 2 6   ? 39.237 0.593   0.709   1.00 17.50 ? 6   DT  T C4    1 
ATOM   3505 O  O4    . DT  B 2 6   ? 38.692 -0.332  1.302   1.00 18.61 ? 6   DT  T O4    1 
ATOM   3506 C  C5    . DT  B 2 6   ? 38.513 1.760   0.274   1.00 17.49 ? 6   DT  T C5    1 
ATOM   3507 C  C7    . DT  B 2 6   ? 37.041 1.872   0.544   1.00 18.53 ? 6   DT  T C7    1 
ATOM   3508 C  C6    . DT  B 2 6   ? 39.192 2.719   -0.366  1.00 15.56 ? 6   DT  T C6    1 
ATOM   3509 P  P     . DG  B 2 7   ? 42.186 4.589   -6.079  1.00 15.57 ? 7   DG  T P     1 
ATOM   3510 O  OP1   . DG  B 2 7   ? 43.312 5.335   -6.680  1.00 16.81 ? 7   DG  T OP1   1 
ATOM   3511 O  OP2   . DG  B 2 7   ? 40.821 4.725   -6.633  1.00 14.39 ? 7   DG  T OP2   1 
ATOM   3512 O  "O5'" . DG  B 2 7   ? 42.519 3.024   -6.083  1.00 20.77 ? 7   DG  T "O5'" 1 
ATOM   3513 C  "C5'" . DG  B 2 7   ? 43.843 2.565   -5.891  1.00 20.45 ? 7   DG  T "C5'" 1 
ATOM   3514 C  "C4'" . DG  B 2 7   ? 43.868 1.061   -5.672  1.00 14.21 ? 7   DG  T "C4'" 1 
ATOM   3515 O  "O4'" . DG  B 2 7   ? 43.100 0.725   -4.495  1.00 19.15 ? 7   DG  T "O4'" 1 
ATOM   3516 C  "C3'" . DG  B 2 7   ? 43.273 0.207   -6.791  1.00 20.66 ? 7   DG  T "C3'" 1 
ATOM   3517 O  "O3'" . DG  B 2 7   ? 44.332 -0.360  -7.546  1.00 20.31 ? 7   DG  T "O3'" 1 
ATOM   3518 C  "C2'" . DG  B 2 7   ? 42.467 -0.873  -6.067  1.00 17.48 ? 7   DG  T "C2'" 1 
ATOM   3519 C  "C1'" . DG  B 2 7   ? 42.818 -0.647  -4.601  1.00 17.57 ? 7   DG  T "C1'" 1 
ATOM   3520 N  N9    . DG  B 2 7   ? 41.736 -0.995  -3.688  1.00 18.00 ? 7   DG  T N9    1 
ATOM   3521 C  C8    . DG  B 2 7   ? 40.550 -0.332  -3.486  1.00 17.23 ? 7   DG  T C8    1 
ATOM   3522 N  N7    . DG  B 2 7   ? 39.785 -0.904  -2.596  1.00 16.76 ? 7   DG  T N7    1 
ATOM   3523 C  C5    . DG  B 2 7   ? 40.511 -2.018  -2.189  1.00 19.72 ? 7   DG  T C5    1 
ATOM   3524 C  C6    . DG  B 2 7   ? 40.199 -3.023  -1.244  1.00 16.27 ? 7   DG  T C6    1 
ATOM   3525 O  O6    . DG  B 2 7   ? 39.178 -3.139  -0.551  1.00 16.68 ? 7   DG  T O6    1 
ATOM   3526 N  N1    . DG  B 2 7   ? 41.219 -3.968  -1.142  1.00 18.38 ? 7   DG  T N1    1 
ATOM   3527 C  C2    . DG  B 2 7   ? 42.393 -3.944  -1.856  1.00 17.32 ? 7   DG  T C2    1 
ATOM   3528 N  N2    . DG  B 2 7   ? 43.259 -4.940  -1.620  1.00 17.02 ? 7   DG  T N2    1 
ATOM   3529 N  N3    . DG  B 2 7   ? 42.697 -3.007  -2.743  1.00 17.57 ? 7   DG  T N3    1 
ATOM   3530 C  C4    . DG  B 2 7   ? 41.713 -2.085  -2.854  1.00 19.30 ? 7   DG  T C4    1 
ATOM   3531 P  P     . DA  B 2 8   ? 44.021 -1.358  -8.768  1.00 19.35 ? 8   DA  T P     1 
ATOM   3532 O  OP1   . DA  B 2 8   ? 45.075 -1.169  -9.784  1.00 18.76 ? 8   DA  T OP1   1 
ATOM   3533 O  OP2   . DA  B 2 8   ? 42.594 -1.212  -9.131  1.00 20.43 ? 8   DA  T OP2   1 
ATOM   3534 O  "O5'" . DA  B 2 8   ? 44.218 -2.808  -8.126  1.00 19.82 ? 8   DA  T "O5'" 1 
ATOM   3535 C  "C5'" . DA  B 2 8   ? 45.489 -3.164  -7.603  1.00 16.88 ? 8   DA  T "C5'" 1 
ATOM   3536 C  "C4'" . DA  B 2 8   ? 45.532 -4.643  -7.270  1.00 18.51 ? 8   DA  T "C4'" 1 
ATOM   3537 O  "O4'" . DA  B 2 8   ? 44.677 -4.898  -6.128  1.00 20.67 ? 8   DA  T "O4'" 1 
ATOM   3538 C  "C3'" . DA  B 2 8   ? 45.058 -5.568  -8.385  1.00 20.55 ? 8   DA  T "C3'" 1 
ATOM   3539 O  "O3'" . DA  B 2 8   ? 45.904 -6.705  -8.433  1.00 18.53 ? 8   DA  T "O3'" 1 
ATOM   3540 C  "C2'" . DA  B 2 8   ? 43.637 -5.938  -7.971  1.00 22.00 ? 8   DA  T "C2'" 1 
ATOM   3541 C  "C1'" . DA  B 2 8   ? 43.712 -5.877  -6.450  1.00 20.90 ? 8   DA  T "C1'" 1 
ATOM   3542 N  N9    . DA  B 2 8   ? 42.445 -5.495  -5.834  1.00 19.92 ? 8   DA  T N9    1 
ATOM   3543 C  C8    . DA  B 2 8   ? 41.647 -4.439  -6.176  1.00 20.94 ? 8   DA  T C8    1 
ATOM   3544 N  N7    . DA  B 2 8   ? 40.561 -4.341  -5.448  1.00 18.15 ? 8   DA  T N7    1 
ATOM   3545 C  C5    . DA  B 2 8   ? 40.652 -5.405  -4.567  1.00 18.11 ? 8   DA  T C5    1 
ATOM   3546 C  C6    . DA  B 2 8   ? 39.809 -5.857  -3.532  1.00 19.49 ? 8   DA  T C6    1 
ATOM   3547 N  N6    . DA  B 2 8   ? 38.658 -5.258  -3.201  1.00 16.28 ? 8   DA  T N6    1 
ATOM   3548 N  N1    . DA  B 2 8   ? 40.198 -6.953  -2.849  1.00 15.79 ? 8   DA  T N1    1 
ATOM   3549 C  C2    . DA  B 2 8   ? 41.349 -7.548  -3.180  1.00 19.31 ? 8   DA  T C2    1 
ATOM   3550 N  N3    . DA  B 2 8   ? 42.222 -7.217  -4.131  1.00 17.52 ? 8   DA  T N3    1 
ATOM   3551 C  C4    . DA  B 2 8   ? 41.809 -6.126  -4.793  1.00 19.74 ? 8   DA  T C4    1 
ATOM   3552 P  P     . DC  B 2 9   ? 45.777 -7.761  -9.637  1.00 21.24 ? 9   DC  T P     1 
ATOM   3553 O  OP1   . DC  B 2 9   ? 47.138 -8.221  -9.982  1.00 25.11 ? 9   DC  T OP1   1 
ATOM   3554 O  OP2   . DC  B 2 9   ? 44.913 -7.167  -10.681 1.00 21.96 ? 9   DC  T OP2   1 
ATOM   3555 O  "O5'" . DC  B 2 9   ? 44.965 -8.972  -8.982  1.00 22.77 ? 9   DC  T "O5'" 1 
ATOM   3556 C  "C5'" . DC  B 2 9   ? 45.451 -9.545  -7.779  1.00 22.09 ? 9   DC  T "C5'" 1 
ATOM   3557 C  "C4'" . DC  B 2 9   ? 44.395 -10.432 -7.152  1.00 21.58 ? 9   DC  T "C4'" 1 
ATOM   3558 O  "O4'" . DC  B 2 9   ? 43.315 -9.627  -6.615  1.00 26.02 ? 9   DC  T "O4'" 1 
ATOM   3559 C  "C3'" . DC  B 2 9   ? 43.751 -11.426 -8.115  1.00 23.65 ? 9   DC  T "C3'" 1 
ATOM   3560 O  "O3'" . DC  B 2 9   ? 43.810 -12.705 -7.523  1.00 27.37 ? 9   DC  T "O3'" 1 
ATOM   3561 C  "C2'" . DC  B 2 9   ? 42.310 -10.938 -8.239  1.00 21.25 ? 9   DC  T "C2'" 1 
ATOM   3562 C  "C1'" . DC  B 2 9   ? 42.107 -10.308 -6.870  1.00 23.19 ? 9   DC  T "C1'" 1 
ATOM   3563 N  N1    . DC  B 2 9   ? 40.982 -9.342  -6.811  1.00 20.94 ? 9   DC  T N1    1 
ATOM   3564 C  C2    . DC  B 2 9   ? 40.048 -9.458  -5.779  1.00 22.02 ? 9   DC  T C2    1 
ATOM   3565 O  O2    . DC  B 2 9   ? 40.188 -10.359 -4.942  1.00 18.87 ? 9   DC  T O2    1 
ATOM   3566 N  N3    . DC  B 2 9   ? 39.022 -8.576  -5.725  1.00 18.74 ? 9   DC  T N3    1 
ATOM   3567 C  C4    . DC  B 2 9   ? 38.910 -7.618  -6.645  1.00 19.83 ? 9   DC  T C4    1 
ATOM   3568 N  N4    . DC  B 2 9   ? 37.875 -6.777  -6.543  1.00 20.81 ? 9   DC  T N4    1 
ATOM   3569 C  C5    . DC  B 2 9   ? 39.852 -7.486  -7.709  1.00 24.04 ? 9   DC  T C5    1 
ATOM   3570 C  C6    . DC  B 2 9   ? 40.864 -8.361  -7.751  1.00 21.64 ? 9   DC  T C6    1 
ATOM   3571 P  P     . DG  B 2 10  ? 43.614 -14.023 -8.418  1.00 27.59 ? 10  DG  T P     1 
ATOM   3572 O  OP1   . DG  B 2 10  ? 44.929 -14.684 -8.547  1.00 35.34 ? 10  DG  T OP1   1 
ATOM   3573 O  OP2   . DG  B 2 10  ? 42.851 -13.646 -9.631  1.00 25.34 ? 10  DG  T OP2   1 
ATOM   3574 O  "O5'" . DG  B 2 10  ? 42.655 -14.934 -7.525  1.00 26.27 ? 10  DG  T "O5'" 1 
ATOM   3575 C  "C5'" . DG  B 2 10  ? 42.861 -15.023 -6.122  1.00 28.41 ? 10  DG  T "C5'" 1 
ATOM   3576 C  "C4'" . DG  B 2 10  ? 41.603 -15.553 -5.463  1.00 26.31 ? 10  DG  T "C4'" 1 
ATOM   3577 O  "O4'" . DG  B 2 10  ? 40.653 -14.471 -5.295  1.00 26.38 ? 10  DG  T "O4'" 1 
ATOM   3578 C  "C3'" . DG  B 2 10  ? 40.892 -16.630 -6.275  1.00 28.55 ? 10  DG  T "C3'" 1 
ATOM   3579 O  "O3'" . DG  B 2 10  ? 40.403 -17.655 -5.417  1.00 27.51 ? 10  DG  T "O3'" 1 
ATOM   3580 C  "C2'" . DG  B 2 10  ? 39.760 -15.869 -6.959  1.00 23.97 ? 10  DG  T "C2'" 1 
ATOM   3581 C  "C1'" . DG  B 2 10  ? 39.430 -14.803 -5.923  1.00 24.37 ? 10  DG  T "C1'" 1 
ATOM   3582 N  N9    . DG  B 2 10  ? 38.846 -13.597 -6.508  1.00 21.72 ? 10  DG  T N9    1 
ATOM   3583 C  C8    . DG  B 2 10  ? 39.401 -12.782 -7.467  1.00 23.20 ? 10  DG  T C8    1 
ATOM   3584 N  N7    . DG  B 2 10  ? 38.641 -11.774 -7.798  1.00 17.46 ? 10  DG  T N7    1 
ATOM   3585 C  C5    . DG  B 2 10  ? 37.509 -11.930 -7.010  1.00 19.79 ? 10  DG  T C5    1 
ATOM   3586 C  C6    . DG  B 2 10  ? 36.338 -11.142 -6.931  1.00 20.08 ? 10  DG  T C6    1 
ATOM   3587 O  O6    . DG  B 2 10  ? 36.061 -10.113 -7.563  1.00 19.80 ? 10  DG  T O6    1 
ATOM   3588 N  N1    . DG  B 2 10  ? 35.434 -11.654 -6.003  1.00 21.81 ? 10  DG  T N1    1 
ATOM   3589 C  C2    . DG  B 2 10  ? 35.635 -12.786 -5.247  1.00 20.71 ? 10  DG  T C2    1 
ATOM   3590 N  N2    . DG  B 2 10  ? 34.646 -13.123 -4.406  1.00 18.66 ? 10  DG  T N2    1 
ATOM   3591 N  N3    . DG  B 2 10  ? 36.728 -13.534 -5.312  1.00 20.04 ? 10  DG  T N3    1 
ATOM   3592 C  C4    . DG  B 2 10  ? 37.619 -13.048 -6.210  1.00 19.79 ? 10  DG  T C4    1 
ATOM   3593 P  P     . DC  B 2 11  ? 39.670 -18.943 -6.036  1.00 26.60 ? 11  DC  T P     1 
ATOM   3594 O  OP1   . DC  B 2 11  ? 40.044 -20.118 -5.221  1.00 32.00 ? 11  DC  T OP1   1 
ATOM   3595 O  OP2   . DC  B 2 11  ? 39.920 -18.956 -7.494  1.00 22.99 ? 11  DC  T OP2   1 
ATOM   3596 O  "O5'" . DC  B 2 11  ? 38.121 -18.635 -5.808  1.00 25.55 ? 11  DC  T "O5'" 1 
ATOM   3597 C  "C5'" . DC  B 2 11  ? 37.631 -18.448 -4.490  1.00 20.94 ? 11  DC  T "C5'" 1 
ATOM   3598 C  "C4'" . DC  B 2 11  ? 36.115 -18.375 -4.498  1.00 21.91 ? 11  DC  T "C4'" 1 
ATOM   3599 O  "O4'" . DC  B 2 11  ? 35.684 -17.100 -5.035  1.00 22.03 ? 11  DC  T "O4'" 1 
ATOM   3600 C  "C3'" . DC  B 2 11  ? 35.422 -19.451 -5.327  1.00 19.42 ? 11  DC  T "C3'" 1 
ATOM   3601 O  "O3'" . DC  B 2 11  ? 34.366 -20.008 -4.551  1.00 17.99 ? 11  DC  T "O3'" 1 
ATOM   3602 C  "C2'" . DC  B 2 11  ? 34.914 -18.707 -6.563  1.00 18.47 ? 11  DC  T "C2'" 1 
ATOM   3603 C  "C1'" . DC  B 2 11  ? 34.699 -17.295 -6.030  1.00 21.60 ? 11  DC  T "C1'" 1 
ATOM   3604 N  N1    . DC  B 2 11  ? 34.886 -16.209 -7.037  1.00 16.53 ? 11  DC  T N1    1 
ATOM   3605 C  C2    . DC  B 2 11  ? 33.858 -15.287 -7.266  1.00 19.54 ? 11  DC  T C2    1 
ATOM   3606 O  O2    . DC  B 2 11  ? 32.797 -15.393 -6.641  1.00 18.13 ? 11  DC  T O2    1 
ATOM   3607 N  N3    . DC  B 2 11  ? 34.051 -14.301 -8.176  1.00 20.48 ? 11  DC  T N3    1 
ATOM   3608 C  C4    . DC  B 2 11  ? 35.206 -14.215 -8.835  1.00 19.21 ? 11  DC  T C4    1 
ATOM   3609 N  N4    . DC  B 2 11  ? 35.342 -13.224 -9.722  1.00 21.30 ? 11  DC  T N4    1 
ATOM   3610 C  C5    . DC  B 2 11  ? 36.268 -15.142 -8.613  1.00 22.31 ? 11  DC  T C5    1 
ATOM   3611 C  C6    . DC  B 2 11  ? 36.067 -16.111 -7.712  1.00 18.65 ? 11  DC  T C6    1 
ATOM   3612 P  P     . DT  B 2 12  ? 33.610 -21.336 -5.047  1.00 16.82 ? 12  DT  T P     1 
ATOM   3613 O  OP1   . DT  B 2 12  ? 33.095 -22.041 -3.854  1.00 19.81 ? 12  DT  T OP1   1 
ATOM   3614 O  OP2   . DT  B 2 12  ? 34.498 -22.042 -5.989  1.00 14.51 ? 12  DT  T OP2   1 
ATOM   3615 O  "O5'" . DT  B 2 12  ? 32.366 -20.767 -5.872  1.00 19.81 ? 12  DT  T "O5'" 1 
ATOM   3616 C  "C5'" . DT  B 2 12  ? 31.310 -20.121 -5.177  1.00 19.23 ? 12  DT  T "C5'" 1 
ATOM   3617 C  "C4'" . DT  B 2 12  ? 30.302 -19.574 -6.165  1.00 20.62 ? 12  DT  T "C4'" 1 
ATOM   3618 O  "O4'" . DT  B 2 12  ? 30.885 -18.449 -6.871  1.00 20.00 ? 12  DT  T "O4'" 1 
ATOM   3619 C  "C3'" . DT  B 2 12  ? 29.871 -20.575 -7.234  1.00 21.57 ? 12  DT  T "C3'" 1 
ATOM   3620 O  "O3'" . DT  B 2 12  ? 28.457 -20.540 -7.388  1.00 18.09 ? 12  DT  T "O3'" 1 
ATOM   3621 C  "C2'" . DT  B 2 12  ? 30.587 -20.080 -8.488  1.00 21.31 ? 12  DT  T "C2'" 1 
ATOM   3622 C  "C1'" . DT  B 2 12  ? 30.552 -18.579 -8.236  1.00 24.24 ? 12  DT  T "C1'" 1 
ATOM   3623 N  N1    . DT  B 2 12  ? 31.505 -17.789 -9.068  1.00 23.82 ? 12  DT  T N1    1 
ATOM   3624 C  C2    . DT  B 2 12  ? 31.150 -16.512 -9.438  1.00 20.81 ? 12  DT  T C2    1 
ATOM   3625 O  O2    . DT  B 2 12  ? 30.098 -15.992 -9.113  1.00 26.45 ? 12  DT  T O2    1 
ATOM   3626 N  N3    . DT  B 2 12  ? 32.078 -15.859 -10.203 1.00 23.62 ? 12  DT  T N3    1 
ATOM   3627 C  C4    . DT  B 2 12  ? 33.299 -16.345 -10.631 1.00 23.02 ? 12  DT  T C4    1 
ATOM   3628 O  O4    . DT  B 2 12  ? 34.058 -15.672 -11.321 1.00 23.01 ? 12  DT  T O4    1 
ATOM   3629 C  C5    . DT  B 2 12  ? 33.610 -17.690 -10.211 1.00 20.63 ? 12  DT  T C5    1 
ATOM   3630 C  C7    . DT  B 2 12  ? 34.908 -18.324 -10.614 1.00 22.54 ? 12  DT  T C7    1 
ATOM   3631 C  C6    . DT  B 2 12  ? 32.709 -18.341 -9.460  1.00 22.12 ? 12  DT  T C6    1 
ATOM   3632 O  "O5'" A DA  C 3 1   ? 29.144 -7.647  -14.769 0.50 31.39 ? 1   DA  P "O5'" 1 
ATOM   3633 O  "O5'" B DA  C 3 1   ? 29.041 -8.160  -15.607 0.50 30.17 ? 1   DA  P "O5'" 1 
ATOM   3634 C  "C5'" A DA  C 3 1   ? 27.887 -7.882  -15.393 0.50 28.00 ? 1   DA  P "C5'" 1 
ATOM   3635 C  "C5'" B DA  C 3 1   ? 27.625 -8.055  -15.704 0.50 28.01 ? 1   DA  P "C5'" 1 
ATOM   3636 C  "C4'" A DA  C 3 1   ? 26.927 -8.574  -14.442 0.50 28.20 ? 1   DA  P "C4'" 1 
ATOM   3637 C  "C4'" B DA  C 3 1   ? 26.950 -8.581  -14.449 0.50 28.20 ? 1   DA  P "C4'" 1 
ATOM   3638 O  "O4'" A DA  C 3 1   ? 27.306 -9.965  -14.292 0.50 28.32 ? 1   DA  P "O4'" 1 
ATOM   3639 O  "O4'" B DA  C 3 1   ? 27.293 -9.978  -14.279 0.50 28.32 ? 1   DA  P "O4'" 1 
ATOM   3640 C  "C3'" A DA  C 3 1   ? 26.874 -7.983  -13.038 0.50 27.05 ? 1   DA  P "C3'" 1 
ATOM   3641 C  "C3'" B DA  C 3 1   ? 27.331 -7.858  -13.161 0.50 27.11 ? 1   DA  P "C3'" 1 
ATOM   3642 O  "O3'" A DA  C 3 1   ? 25.528 -7.937  -12.569 0.50 26.88 ? 1   DA  P "O3'" 1 
ATOM   3643 O  "O3'" B DA  C 3 1   ? 26.201 -7.142  -12.685 0.50 28.13 ? 1   DA  P "O3'" 1 
ATOM   3644 C  "C2'" A DA  C 3 1   ? 27.735 -8.919  -12.191 0.50 26.77 ? 1   DA  P "C2'" 1 
ATOM   3645 C  "C2'" B DA  C 3 1   ? 27.717 -8.949  -12.166 0.50 26.77 ? 1   DA  P "C2'" 1 
ATOM   3646 C  "C1'" A DA  C 3 1   ? 27.824 -10.212 -13.000 0.50 26.88 ? 1   DA  P "C1'" 1 
ATOM   3647 C  "C1'" B DA  C 3 1   ? 27.822 -10.225 -12.993 0.50 26.88 ? 1   DA  P "C1'" 1 
ATOM   3648 N  N9    . DA  C 3 1   ? 29.193 -10.706 -13.142 1.00 24.78 ? 1   DA  P N9    1 
ATOM   3649 C  C8    . DA  C 3 1   ? 30.139 -10.268 -14.025 1.00 26.42 ? 1   DA  P C8    1 
ATOM   3650 N  N7    . DA  C 3 1   ? 31.288 -10.896 -13.926 1.00 27.07 ? 1   DA  P N7    1 
ATOM   3651 C  C5    . DA  C 3 1   ? 31.077 -11.809 -12.906 1.00 23.44 ? 1   DA  P C5    1 
ATOM   3652 C  C6    . DA  C 3 1   ? 31.909 -12.780 -12.315 1.00 24.83 ? 1   DA  P C6    1 
ATOM   3653 N  N6    . DA  C 3 1   ? 33.175 -12.997 -12.687 1.00 23.82 ? 1   DA  P N6    1 
ATOM   3654 N  N1    . DA  C 3 1   ? 31.385 -13.524 -11.320 1.00 27.58 ? 1   DA  P N1    1 
ATOM   3655 C  C2    . DA  C 3 1   ? 30.118 -13.310 -10.947 1.00 24.06 ? 1   DA  P C2    1 
ATOM   3656 N  N3    A DA  C 3 1   ? 29.242 -12.429 -11.426 0.50 23.73 ? 1   DA  P N3    1 
ATOM   3657 N  N3    B DA  C 3 1   ? 29.242 -12.430 -11.427 0.50 23.73 ? 1   DA  P N3    1 
ATOM   3658 C  C4    . DA  C 3 1   ? 29.791 -11.704 -12.413 1.00 26.09 ? 1   DA  P C4    1 
ATOM   3659 P  P     A DG  C 3 2   ? 25.039 -6.719  -11.641 0.50 21.71 ? 2   DG  P P     1 
ATOM   3660 P  P     B DG  C 3 2   ? 26.361 -6.087  -11.484 0.50 27.93 ? 2   DG  P P     1 
ATOM   3661 O  OP1   A DG  C 3 2   ? 23.563 -6.673  -11.688 0.50 23.74 ? 2   DG  P OP1   1 
ATOM   3662 O  OP1   B DG  C 3 2   ? 25.116 -5.290  -11.411 0.50 29.45 ? 2   DG  P OP1   1 
ATOM   3663 O  OP2   A DG  C 3 2   ? 25.824 -5.521  -12.012 0.50 27.22 ? 2   DG  P OP2   1 
ATOM   3664 O  OP2   B DG  C 3 2   ? 27.664 -5.404  -11.647 0.50 27.97 ? 2   DG  P OP2   1 
ATOM   3665 O  "O5'" A DG  C 3 2   ? 25.491 -7.163  -10.174 0.50 26.89 ? 2   DG  P "O5'" 1 
ATOM   3666 O  "O5'" B DG  C 3 2   ? 26.457 -7.011  -10.181 0.50 26.96 ? 2   DG  P "O5'" 1 
ATOM   3667 C  "C5'" A DG  C 3 2   ? 24.825 -8.244  -9.540  0.50 26.39 ? 2   DG  P "C5'" 1 
ATOM   3668 C  "C5'" B DG  C 3 2   ? 25.348 -7.811  -9.777  0.50 26.79 ? 2   DG  P "C5'" 1 
ATOM   3669 C  "C4'" A DG  C 3 2   ? 25.657 -8.826  -8.411  0.50 26.90 ? 2   DG  P "C4'" 1 
ATOM   3670 C  "C4'" B DG  C 3 2   ? 25.706 -8.630  -8.549  0.50 26.90 ? 2   DG  P "C4'" 1 
ATOM   3671 O  "O4'" A DG  C 3 2   ? 26.881 -9.402  -8.925  0.50 26.14 ? 2   DG  P "O4'" 1 
ATOM   3672 O  "O4'" B DG  C 3 2   ? 26.841 -9.476  -8.867  0.50 26.12 ? 2   DG  P "O4'" 1 
ATOM   3673 C  "C3'" A DG  C 3 2   ? 26.076 -7.847  -7.316  0.50 26.29 ? 2   DG  P "C3'" 1 
ATOM   3674 C  "C3'" B DG  C 3 2   ? 26.102 -7.802  -7.328  0.50 26.29 ? 2   DG  P "C3'" 1 
ATOM   3675 O  "O3'" A DG  C 3 2   ? 25.424 -8.272  -6.134  0.50 28.40 ? 2   DG  P "O3'" 1 
ATOM   3676 O  "O3'" B DG  C 3 2   ? 25.437 -8.263  -6.144  0.50 28.40 ? 2   DG  P "O3'" 1 
ATOM   3677 C  "C2'" A DG  C 3 2   ? 27.596 -7.987  -7.222  0.50 26.43 ? 2   DG  P "C2'" 1 
ATOM   3678 C  "C2'" B DG  C 3 2   ? 27.618 -7.968  -7.240  0.50 26.42 ? 2   DG  P "C2'" 1 
ATOM   3679 C  "C1'" A DG  C 3 2   ? 27.842 -9.331  -7.895  0.50 26.47 ? 2   DG  P "C1'" 1 
ATOM   3680 C  "C1'" B DG  C 3 2   ? 27.842 -9.333  -7.881  0.50 26.47 ? 2   DG  P "C1'" 1 
ATOM   3681 N  N9    . DG  C 3 2   ? 29.159 -9.468  -8.501  1.00 24.28 ? 2   DG  P N9    1 
ATOM   3682 C  C8    . DG  C 3 2   ? 29.767 -8.598  -9.374  1.00 25.30 ? 2   DG  P C8    1 
ATOM   3683 N  N7    . DG  C 3 2   ? 30.952 -8.991  -9.757  1.00 22.16 ? 2   DG  P N7    1 
ATOM   3684 C  C5    . DG  C 3 2   ? 31.140 -10.201 -9.098  1.00 24.52 ? 2   DG  P C5    1 
ATOM   3685 C  C6    . DG  C 3 2   ? 32.236 -11.099 -9.118  1.00 21.14 ? 2   DG  P C6    1 
ATOM   3686 O  O6    . DG  C 3 2   ? 33.297 -10.998 -9.747  1.00 19.41 ? 2   DG  P O6    1 
ATOM   3687 N  N1    . DG  C 3 2   ? 32.013 -12.208 -8.304  1.00 17.99 ? 2   DG  P N1    1 
ATOM   3688 C  C2    . DG  C 3 2   ? 30.876 -12.421 -7.564  1.00 20.62 ? 2   DG  P C2    1 
ATOM   3689 N  N2    . DG  C 3 2   ? 30.834 -13.547 -6.836  1.00 22.73 ? 2   DG  P N2    1 
ATOM   3690 N  N3    . DG  C 3 2   ? 29.844 -11.590 -7.537  1.00 21.82 ? 2   DG  P N3    1 
ATOM   3691 C  C4    . DG  C 3 2   ? 30.045 -10.507 -8.323  1.00 24.84 ? 2   DG  P C4    1 
ATOM   3692 P  P     . DC  C 3 3   ? 25.747 -7.574  -4.724  1.00 26.75 ? 3   DC  P P     1 
ATOM   3693 O  OP1   . DC  C 3 3   ? 24.511 -7.610  -3.912  1.00 29.96 ? 3   DC  P OP1   1 
ATOM   3694 O  OP2   . DC  C 3 3   ? 26.417 -6.281  -4.985  1.00 27.22 ? 3   DC  P OP2   1 
ATOM   3695 O  "O5'" . DC  C 3 3   ? 26.825 -8.551  -4.062  1.00 32.09 ? 3   DC  P "O5'" 1 
ATOM   3696 C  "C5'" . DC  C 3 3   ? 26.503 -9.917  -3.838  1.00 31.09 ? 3   DC  P "C5'" 1 
ATOM   3697 C  "C4'" . DC  C 3 3   ? 27.686 -10.644 -3.227  1.00 29.72 ? 3   DC  P "C4'" 1 
ATOM   3698 O  "O4'" . DC  C 3 3   ? 28.745 -10.731 -4.210  1.00 26.26 ? 3   DC  P "O4'" 1 
ATOM   3699 C  "C3'" . DC  C 3 3   ? 28.278 -9.965  -1.993  1.00 32.30 ? 3   DC  P "C3'" 1 
ATOM   3700 O  "O3'" . DC  C 3 3   ? 28.216 -10.843 -0.874  1.00 33.64 ? 3   DC  P "O3'" 1 
ATOM   3701 C  "C2'" . DC  C 3 3   ? 29.720 -9.634  -2.371  1.00 27.05 ? 3   DC  P "C2'" 1 
ATOM   3702 C  "C1'" . DC  C 3 3   ? 29.987 -10.530 -3.575  1.00 27.23 ? 3   DC  P "C1'" 1 
ATOM   3703 N  N1    . DC  C 3 3   ? 30.927 -9.913  -4.550  1.00 28.33 ? 3   DC  P N1    1 
ATOM   3704 C  C2    . DC  C 3 3   ? 32.072 -10.616 -4.926  1.00 23.70 ? 3   DC  P C2    1 
ATOM   3705 O  O2    . DC  C 3 3   ? 32.265 -11.736 -4.443  1.00 26.10 ? 3   DC  P O2    1 
ATOM   3706 N  N3    . DC  C 3 3   ? 32.932 -10.051 -5.809  1.00 25.16 ? 3   DC  P N3    1 
ATOM   3707 C  C4    . DC  C 3 3   ? 32.680 -8.838  -6.303  1.00 24.06 ? 3   DC  P C4    1 
ATOM   3708 N  N4    . DC  C 3 3   ? 33.560 -8.324  -7.170  1.00 22.19 ? 3   DC  P N4    1 
ATOM   3709 C  C5    . DC  C 3 3   ? 31.516 -8.103  -5.928  1.00 25.27 ? 3   DC  P C5    1 
ATOM   3710 C  C6    . DC  C 3 3   ? 30.675 -8.671  -5.055  1.00 24.70 ? 3   DC  P C6    1 
ATOM   3711 P  P     . DG  C 3 4   ? 28.792 -10.376 0.552   1.00 33.12 ? 4   DG  P P     1 
ATOM   3712 O  OP1   . DG  C 3 4   ? 28.038 -11.093 1.605   1.00 35.32 ? 4   DG  P OP1   1 
ATOM   3713 O  OP2   . DG  C 3 4   ? 28.846 -8.897  0.562   1.00 35.07 ? 4   DG  P OP2   1 
ATOM   3714 O  "O5'" . DG  C 3 4   ? 30.295 -10.920 0.543   1.00 31.25 ? 4   DG  P "O5'" 1 
ATOM   3715 C  "C5'" . DG  C 3 4   ? 30.526 -12.319 0.443   1.00 27.85 ? 4   DG  P "C5'" 1 
ATOM   3716 C  "C4'" . DG  C 3 4   ? 32.014 -12.612 0.436   1.00 31.24 ? 4   DG  P "C4'" 1 
ATOM   3717 O  "O4'" . DG  C 3 4   ? 32.609 -12.034 -0.751  1.00 28.28 ? 4   DG  P "O4'" 1 
ATOM   3718 C  "C3'" . DG  C 3 4   ? 32.772 -12.051 1.636   1.00 27.12 ? 4   DG  P "C3'" 1 
ATOM   3719 O  "O3'" . DG  C 3 4   ? 33.400 -13.122 2.338   1.00 34.90 ? 4   DG  P "O3'" 1 
ATOM   3720 C  "C2'" . DG  C 3 4   ? 33.784 -11.070 1.044   1.00 28.43 ? 4   DG  P "C2'" 1 
ATOM   3721 C  "C1'" . DG  C 3 4   ? 33.860 -11.471 -0.425  1.00 24.87 ? 4   DG  P "C1'" 1 
ATOM   3722 N  N9    . DG  C 3 4   ? 34.096 -10.344 -1.323  1.00 24.61 ? 4   DG  P N9    1 
ATOM   3723 C  C8    . DG  C 3 4   ? 33.284 -9.254  -1.527  1.00 23.02 ? 4   DG  P C8    1 
ATOM   3724 N  N7    . DG  C 3 4   ? 33.759 -8.406  -2.397  1.00 21.77 ? 4   DG  P N7    1 
ATOM   3725 C  C5    . DG  C 3 4   ? 34.964 -8.968  -2.795  1.00 20.24 ? 4   DG  P C5    1 
ATOM   3726 C  C6    . DG  C 3 4   ? 35.925 -8.504  -3.722  1.00 22.13 ? 4   DG  P C6    1 
ATOM   3727 O  O6    . DG  C 3 4   ? 35.900 -7.464  -4.395  1.00 24.10 ? 4   DG  P O6    1 
ATOM   3728 N  N1    . DG  C 3 4   ? 37.003 -9.382  -3.829  1.00 20.84 ? 4   DG  P N1    1 
ATOM   3729 C  C2    . DG  C 3 4   ? 37.131 -10.560 -3.131  1.00 20.82 ? 4   DG  P C2    1 
ATOM   3730 N  N2    . DG  C 3 4   ? 38.236 -11.283 -3.362  1.00 18.12 ? 4   DG  P N2    1 
ATOM   3731 N  N3    . DG  C 3 4   ? 36.236 -11.005 -2.262  1.00 22.09 ? 4   DG  P N3    1 
ATOM   3732 C  C4    . DG  C 3 4   ? 35.184 -10.161 -2.146  1.00 21.42 ? 4   DG  P C4    1 
ATOM   3733 P  P     . DT  C 3 5   ? 34.228 -12.834 3.685   1.00 32.79 ? 5   DT  P P     1 
ATOM   3734 O  OP1   . DT  C 3 5   ? 34.214 -14.069 4.500   1.00 33.79 ? 5   DT  P OP1   1 
ATOM   3735 O  OP2   . DT  C 3 5   ? 33.736 -11.565 4.263   1.00 30.92 ? 5   DT  P OP2   1 
ATOM   3736 O  "O5'" . DT  C 3 5   ? 35.715 -12.586 3.159   1.00 27.05 ? 5   DT  P "O5'" 1 
ATOM   3737 C  "C5'" . DT  C 3 5   ? 36.303 -13.550 2.303   1.00 20.19 ? 5   DT  P "C5'" 1 
ATOM   3738 C  "C4'" . DT  C 3 5   ? 37.734 -13.176 1.969   1.00 20.52 ? 5   DT  P "C4'" 1 
ATOM   3739 O  "O4'" . DT  C 3 5   ? 37.770 -12.162 0.934   1.00 18.20 ? 5   DT  P "O4'" 1 
ATOM   3740 C  "C3'" . DT  C 3 5   ? 38.540 -12.633 3.143   1.00 19.35 ? 5   DT  P "C3'" 1 
ATOM   3741 O  "O3'" . DT  C 3 5   ? 39.739 -13.379 3.183   1.00 20.16 ? 5   DT  P "O3'" 1 
ATOM   3742 C  "C2'" . DT  C 3 5   ? 38.770 -11.160 2.799   1.00 15.84 ? 5   DT  P "C2'" 1 
ATOM   3743 C  "C1'" . DT  C 3 5   ? 38.723 -11.179 1.275   1.00 18.33 ? 5   DT  P "C1'" 1 
ATOM   3744 N  N1    . DT  C 3 5   ? 38.282 -9.909  0.634   1.00 17.29 ? 5   DT  P N1    1 
ATOM   3745 C  C2    . DT  C 3 5   ? 39.071 -9.351  -0.346  1.00 18.50 ? 5   DT  P C2    1 
ATOM   3746 O  O2    . DT  C 3 5   ? 40.126 -9.836  -0.709  1.00 17.30 ? 5   DT  P O2    1 
ATOM   3747 N  N3    . DT  C 3 5   ? 38.579 -8.191  -0.889  1.00 17.13 ? 5   DT  P N3    1 
ATOM   3748 C  C4    . DT  C 3 5   ? 37.401 -7.551  -0.557  1.00 18.35 ? 5   DT  P C4    1 
ATOM   3749 O  O4    . DT  C 3 5   ? 37.050 -6.510  -1.105  1.00 16.21 ? 5   DT  P O4    1 
ATOM   3750 C  C5    . DT  C 3 5   ? 36.620 -8.191  0.476   1.00 21.06 ? 5   DT  P C5    1 
ATOM   3751 C  C7    . DT  C 3 5   ? 35.320 -7.587  0.921   1.00 19.45 ? 5   DT  P C7    1 
ATOM   3752 C  C6    . DT  C 3 5   ? 37.089 -9.326  1.013   1.00 17.27 ? 5   DT  P C6    1 
ATOM   3753 P  P     . DC  C 3 6   ? 40.726 -13.266 4.442   1.00 12.09 ? 6   DC  P P     1 
ATOM   3754 O  OP1   . DC  C 3 6   ? 41.474 -14.541 4.546   1.00 14.41 ? 6   DC  P OP1   1 
ATOM   3755 O  OP2   . DC  C 3 6   ? 39.950 -12.759 5.592   1.00 13.16 ? 6   DC  P OP2   1 
ATOM   3756 O  "O5'" . DC  C 3 6   ? 41.758 -12.131 4.002   1.00 15.76 ? 6   DC  P "O5'" 1 
ATOM   3757 C  "C5'" . DC  C 3 6   ? 42.673 -12.416 2.961   1.00 13.83 ? 6   DC  P "C5'" 1 
ATOM   3758 C  "C4'" . DC  C 3 6   ? 43.400 -11.150 2.560   1.00 17.77 ? 6   DC  P "C4'" 1 
ATOM   3759 O  "O4'" . DC  C 3 6   ? 42.465 -10.249 1.923   1.00 16.06 ? 6   DC  P "O4'" 1 
ATOM   3760 C  "C3'" . DC  C 3 6   ? 44.014 -10.373 3.721   1.00 15.04 ? 6   DC  P "C3'" 1 
ATOM   3761 O  "O3'" . DC  C 3 6   ? 45.421 -10.517 3.653   1.00 12.31 ? 6   DC  P "O3'" 1 
ATOM   3762 C  "C2'" . DC  C 3 6   ? 43.568 -8.924  3.504   1.00 15.65 ? 6   DC  P "C2'" 1 
ATOM   3763 C  "C1'" . DC  C 3 6   ? 42.954 -8.942  2.108   1.00 15.66 ? 6   DC  P "C1'" 1 
ATOM   3764 N  N1    . DC  C 3 6   ? 41.826 -7.982  1.930   1.00 16.94 ? 6   DC  P N1    1 
ATOM   3765 C  C2    . DC  C 3 6   ? 41.874 -7.064  0.878   1.00 15.48 ? 6   DC  P C2    1 
ATOM   3766 O  O2    . DC  C 3 6   ? 42.852 -7.079  0.120   1.00 14.38 ? 6   DC  P O2    1 
ATOM   3767 N  N3    . DC  C 3 6   ? 40.848 -6.190  0.718   1.00 15.83 ? 6   DC  P N3    1 
ATOM   3768 C  C4    . DC  C 3 6   ? 39.815 -6.212  1.563   1.00 16.73 ? 6   DC  P C4    1 
ATOM   3769 N  N4    . DC  C 3 6   ? 38.829 -5.331  1.368   1.00 15.31 ? 6   DC  P N4    1 
ATOM   3770 C  C5    . DC  C 3 6   ? 39.746 -7.141  2.643   1.00 15.41 ? 6   DC  P C5    1 
ATOM   3771 C  C6    . DC  C 3 6   ? 40.763 -8.001  2.789   1.00 15.86 ? 6   DC  P C6    1 
ATOM   3772 P  P     . DA  C 3 7   ? 46.364 -9.804  4.740   1.00 11.65 ? 7   DA  P P     1 
ATOM   3773 O  OP1   . DA  C 3 7   ? 47.611 -10.588 4.839   1.00 12.10 ? 7   DA  P OP1   1 
ATOM   3774 O  OP2   . DA  C 3 7   ? 45.558 -9.565  5.958   1.00 12.52 ? 7   DA  P OP2   1 
ATOM   3775 O  "O5'" A DA  C 3 7   ? 46.678 -8.380  4.092   0.50 15.69 ? 7   DA  P "O5'" 1 
ATOM   3776 O  "O5'" B DA  C 3 7   ? 46.655 -8.366  4.100   0.50 15.69 ? 7   DA  P "O5'" 1 
ATOM   3777 C  "C5'" A DA  C 3 7   ? 47.353 -8.308  2.852   0.50 17.60 ? 7   DA  P "C5'" 1 
ATOM   3778 C  "C5'" B DA  C 3 7   ? 47.456 -8.197  2.941   0.50 17.69 ? 7   DA  P "C5'" 1 
ATOM   3779 C  "C4'" A DA  C 3 7   ? 47.260 -6.915  2.257   0.50 19.10 ? 7   DA  P "C4'" 1 
ATOM   3780 C  "C4'" B DA  C 3 7   ? 47.307 -6.790  2.383   0.50 19.11 ? 7   DA  P "C4'" 1 
ATOM   3781 O  "O4'" A DA  C 3 7   ? 45.899 -6.629  1.854   0.50 18.21 ? 7   DA  P "O4'" 1 
ATOM   3782 O  "O4'" B DA  C 3 7   ? 45.970 -6.594  1.855   0.50 18.22 ? 7   DA  P "O4'" 1 
ATOM   3783 C  "C3'" A DA  C 3 7   ? 47.597 -5.767  3.199   0.50 19.39 ? 7   DA  P "C3'" 1 
ATOM   3784 C  "C3'" B DA  C 3 7   ? 47.431 -5.623  3.350   0.50 19.46 ? 7   DA  P "C3'" 1 
ATOM   3785 O  "O3'" A DA  C 3 7   ? 49.010 -5.556  3.271   0.50 21.65 ? 7   DA  P "O3'" 1 
ATOM   3786 O  "O3'" B DA  C 3 7   ? 48.779 -5.435  3.839   0.50 21.83 ? 7   DA  P "O3'" 1 
ATOM   3787 C  "C2'" A DA  C 3 7   ? 46.904 -4.589  2.522   0.50 20.49 ? 7   DA  P "C2'" 1 
ATOM   3788 C  "C2'" B DA  C 3 7   ? 46.922 -4.502  2.454   0.50 20.49 ? 7   DA  P "C2'" 1 
ATOM   3789 C  "C1'" A DA  C 3 7   ? 45.777 -5.226  1.717   0.50 19.13 ? 7   DA  P "C1'" 1 
ATOM   3790 C  "C1'" B DA  C 3 7   ? 45.784 -5.195  1.702   0.50 19.13 ? 7   DA  P "C1'" 1 
ATOM   3791 N  N9    . DA  C 3 7   ? 44.470 -4.790  2.194   1.00 16.51 ? 7   DA  P N9    1 
ATOM   3792 C  C8    . DA  C 3 7   ? 43.692 -5.386  3.144   1.00 16.40 ? 7   DA  P C8    1 
ATOM   3793 N  N7    . DA  C 3 7   ? 42.558 -4.757  3.369   1.00 18.48 ? 7   DA  P N7    1 
ATOM   3794 C  C5    . DA  C 3 7   ? 42.596 -3.671  2.508   1.00 18.19 ? 7   DA  P C5    1 
ATOM   3795 C  C6    . DA  C 3 7   ? 41.705 -2.607  2.243   1.00 17.20 ? 7   DA  P C6    1 
ATOM   3796 N  N6    . DA  C 3 7   ? 40.527 -2.446  2.854   1.00 15.29 ? 7   DA  P N6    1 
ATOM   3797 N  N1    . DA  C 3 7   ? 42.072 -1.698  1.315   1.00 16.61 ? 7   DA  P N1    1 
ATOM   3798 C  C2    . DA  C 3 7   ? 43.245 -1.839  0.695   1.00 17.57 ? 7   DA  P C2    1 
ATOM   3799 N  N3    . DA  C 3 7   ? 44.164 -2.789  0.856   1.00 17.52 ? 7   DA  P N3    1 
ATOM   3800 C  C4    . DA  C 3 7   ? 43.772 -3.680  1.782   1.00 17.76 ? 7   DA  P C4    1 
ATOM   3801 P  P     A DT  C 3 8   ? 49.598 -4.248  4.003   0.50 22.64 ? 8   DT  P P     1 
ATOM   3802 P  P     B DT  C 3 8   ? 49.917 -4.790  2.897   0.50 25.29 ? 8   DT  P P     1 
ATOM   3803 O  OP1   A DT  C 3 8   ? 51.070 -4.388  4.073   0.50 21.51 ? 8   DT  P OP1   1 
ATOM   3804 O  OP1   B DT  C 3 8   ? 50.014 -5.609  1.669   0.50 20.26 ? 8   DT  P OP1   1 
ATOM   3805 O  OP2   A DT  C 3 8   ? 48.812 -4.019  5.233   0.50 19.32 ? 8   DT  P OP2   1 
ATOM   3806 O  OP2   B DT  C 3 8   ? 51.108 -4.530  3.733   0.50 22.06 ? 8   DT  P OP2   1 
ATOM   3807 O  "O5'" A DT  C 3 8   ? 49.231 -3.059  2.999   0.50 22.10 ? 8   DT  P "O5'" 1 
ATOM   3808 O  "O5'" B DT  C 3 8   ? 49.348 -3.336  2.539   0.50 21.94 ? 8   DT  P "O5'" 1 
ATOM   3809 C  "C5'" A DT  C 3 8   ? 50.261 -2.317  2.356   0.50 22.06 ? 8   DT  P "C5'" 1 
ATOM   3810 C  "C5'" B DT  C 3 8   ? 50.275 -2.270  2.391   0.50 22.06 ? 8   DT  P "C5'" 1 
ATOM   3811 C  "C4'" . DT  C 3 8   ? 49.704 -1.114  1.603   1.00 20.76 ? 8   DT  P "C4'" 1 
ATOM   3812 O  "O4'" . DT  C 3 8   ? 48.256 -1.154  1.622   1.00 17.66 ? 8   DT  P "O4'" 1 
ATOM   3813 C  "C3'" . DT  C 3 8   ? 50.101 0.244   2.170   1.00 17.08 ? 8   DT  P "C3'" 1 
ATOM   3814 O  "O3'" . DT  C 3 8   ? 50.498 1.105   1.113   1.00 20.49 ? 8   DT  P "O3'" 1 
ATOM   3815 C  "C2'" . DT  C 3 8   ? 48.838 0.751   2.865   1.00 18.40 ? 8   DT  P "C2'" 1 
ATOM   3816 C  "C1'" . DT  C 3 8   ? 47.744 0.100   2.028   1.00 18.34 ? 8   DT  P "C1'" 1 
ATOM   3817 N  N1    . DT  C 3 8   ? 46.463 -0.116  2.761   1.00 15.94 ? 8   DT  P N1    1 
ATOM   3818 C  C2    . DT  C 3 8   ? 45.450 0.800   2.586   1.00 18.66 ? 8   DT  P C2    1 
ATOM   3819 O  O2    . DT  C 3 8   ? 45.560 1.775   1.868   1.00 19.08 ? 8   DT  P O2    1 
ATOM   3820 N  N3    . DT  C 3 8   ? 44.302 0.535   3.282   1.00 15.55 ? 8   DT  P N3    1 
ATOM   3821 C  C4    . DT  C 3 8   ? 44.071 -0.537  4.119   1.00 18.02 ? 8   DT  P C4    1 
ATOM   3822 O  O4    . DT  C 3 8   ? 43.002 -0.684  4.701   1.00 16.24 ? 8   DT  P O4    1 
ATOM   3823 C  C5    . DT  C 3 8   ? 45.169 -1.461  4.263   1.00 19.15 ? 8   DT  P C5    1 
ATOM   3824 C  C7    . DT  C 3 8   ? 45.023 -2.662  5.152   1.00 19.60 ? 8   DT  P C7    1 
ATOM   3825 C  C6    . DT  C 3 8   ? 46.300 -1.212  3.586   1.00 18.42 ? 8   DT  P C6    1 
HETATM 3826 CA CA    . CA  D 4 .   ? 54.791 2.530   3.674   1.00 11.79 ? 501 CA  A CA    1 
HETATM 3827 C  C1    . GOL E 5 .   ? 60.647 -25.219 11.955  1.00 16.40 ? 502 GOL A C1    1 
HETATM 3828 O  O1    . GOL E 5 .   ? 59.319 -24.803 12.180  1.00 14.92 ? 502 GOL A O1    1 
HETATM 3829 C  C2    . GOL E 5 .   ? 61.216 -24.511 10.728  1.00 14.23 ? 502 GOL A C2    1 
HETATM 3830 O  O2    . GOL E 5 .   ? 60.615 -23.244 10.582  1.00 12.51 ? 502 GOL A O2    1 
HETATM 3831 C  C3    . GOL E 5 .   ? 60.948 -25.354 9.486   1.00 16.48 ? 502 GOL A C3    1 
HETATM 3832 O  O3    . GOL E 5 .   ? 61.746 -24.891 8.420   1.00 17.13 ? 502 GOL A O3    1 
HETATM 3833 C  C1    . GOL F 5 .   ? 54.223 16.382  -7.099  1.00 22.32 ? 503 GOL A C1    1 
HETATM 3834 O  O1    . GOL F 5 .   ? 54.027 15.003  -6.879  1.00 16.86 ? 503 GOL A O1    1 
HETATM 3835 C  C2    . GOL F 5 .   ? 54.873 16.588  -8.461  1.00 24.89 ? 503 GOL A C2    1 
HETATM 3836 O  O2    . GOL F 5 .   ? 53.999 16.118  -9.464  1.00 23.89 ? 503 GOL A O2    1 
HETATM 3837 C  C3    . GOL F 5 .   ? 55.138 18.075  -8.674  1.00 22.74 ? 503 GOL A C3    1 
HETATM 3838 O  O3    . GOL F 5 .   ? 55.812 18.259  -9.899  1.00 28.47 ? 503 GOL A O3    1 
HETATM 3839 C  C1    . GOL G 5 .   ? 54.627 28.176  4.899   1.00 21.62 ? 504 GOL A C1    1 
HETATM 3840 O  O1    . GOL G 5 .   ? 53.422 27.811  4.262   1.00 22.61 ? 504 GOL A O1    1 
HETATM 3841 C  C2    . GOL G 5 .   ? 55.133 27.015  5.749   1.00 28.13 ? 504 GOL A C2    1 
HETATM 3842 O  O2    . GOL G 5 .   ? 54.661 25.799  5.212   1.00 28.69 ? 504 GOL A O2    1 
HETATM 3843 C  C3    . GOL G 5 .   ? 56.658 27.010  5.750   1.00 26.42 ? 504 GOL A C3    1 
HETATM 3844 O  O3    . GOL G 5 .   ? 57.135 26.000  6.614   1.00 19.32 ? 504 GOL A O3    1 
HETATM 3845 P  PG    . DTP H 6 .   ? 55.318 2.627   7.307   1.00 10.47 ? 101 DTP P PG    1 
HETATM 3846 O  O1G   . DTP H 6 .   ? 55.107 1.709   8.485   1.00 9.21  ? 101 DTP P O1G   1 
HETATM 3847 O  O2G   . DTP H 6 .   ? 56.565 3.478   7.409   1.00 8.83  ? 101 DTP P O2G   1 
HETATM 3848 O  O3G   . DTP H 6 .   ? 55.162 1.924   5.992   1.00 8.85  ? 101 DTP P O3G   1 
HETATM 3849 P  PB    . DTP H 6 .   ? 53.083 4.143   6.258   1.00 9.02  ? 101 DTP P PB    1 
HETATM 3850 O  O1B   . DTP H 6 .   ? 53.806 4.319   4.952   1.00 8.22  ? 101 DTP P O1B   1 
HETATM 3851 O  O2B   . DTP H 6 .   ? 52.341 5.349   6.780   1.00 8.60  ? 101 DTP P O2B   1 
HETATM 3852 O  O3B   . DTP H 6 .   ? 54.086 3.671   7.438   1.00 9.61  ? 101 DTP P O3B   1 
HETATM 3853 P  PA    . DTP H 6 .   ? 51.456 2.070   5.008   1.00 10.90 ? 101 DTP P PA    1 
HETATM 3854 O  O1A   . DTP H 6 .   ? 50.514 1.041   5.585   1.00 10.85 ? 101 DTP P O1A   1 
HETATM 3855 O  O2A   . DTP H 6 .   ? 52.563 1.558   4.130   1.00 11.67 ? 101 DTP P O2A   1 
HETATM 3856 O  O3A   . DTP H 6 .   ? 52.078 2.874   6.267   1.00 11.17 ? 101 DTP P O3A   1 
HETATM 3857 O  "O5'" . DTP H 6 .   ? 50.550 3.112   4.186   1.00 10.20 ? 101 DTP P "O5'" 1 
HETATM 3858 C  "C5'" . DTP H 6 .   ? 51.056 3.928   3.141   1.00 9.63  ? 101 DTP P "C5'" 1 
HETATM 3859 C  "C4'" . DTP H 6 .   ? 50.197 5.183   3.109   1.00 8.95  ? 101 DTP P "C4'" 1 
HETATM 3860 O  "O4'" . DTP H 6 .   ? 48.848 4.892   2.722   1.00 9.81  ? 101 DTP P "O4'" 1 
HETATM 3861 C  "C3'" . DTP H 6 .   ? 50.117 5.794   4.497   1.00 7.24  ? 101 DTP P "C3'" 1 
HETATM 3862 O  "O3'" . DTP H 6 .   ? 51.104 6.815   4.657   1.00 7.45  ? 101 DTP P "O3'" 1 
HETATM 3863 C  "C2'" . DTP H 6 .   ? 48.717 6.368   4.576   1.00 8.23  ? 101 DTP P "C2'" 1 
HETATM 3864 C  "C1'" . DTP H 6 .   ? 47.907 5.520   3.603   1.00 10.10 ? 101 DTP P "C1'" 1 
HETATM 3865 N  N9    . DTP H 6 .   ? 47.137 4.494   4.355   1.00 12.89 ? 101 DTP P N9    1 
HETATM 3866 C  C8    . DTP H 6 .   ? 47.605 3.325   4.817   1.00 14.05 ? 101 DTP P C8    1 
HETATM 3867 N  N7    . DTP H 6 .   ? 46.602 2.664   5.441   1.00 12.33 ? 101 DTP P N7    1 
HETATM 3868 C  C5    . DTP H 6 .   ? 45.495 3.430   5.359   1.00 14.17 ? 101 DTP P C5    1 
HETATM 3869 C  C6    . DTP H 6 .   ? 44.187 3.279   5.808   1.00 18.00 ? 101 DTP P C6    1 
HETATM 3870 N  N6    . DTP H 6 .   ? 43.807 2.167   6.486   1.00 18.94 ? 101 DTP P N6    1 
HETATM 3871 N  N1    . DTP H 6 .   ? 43.291 4.259   5.562   1.00 13.65 ? 101 DTP P N1    1 
HETATM 3872 C  C2    . DTP H 6 .   ? 43.650 5.364   4.894   1.00 12.07 ? 101 DTP P C2    1 
HETATM 3873 N  N3    . DTP H 6 .   ? 44.903 5.533   4.452   1.00 14.88 ? 101 DTP P N3    1 
HETATM 3874 C  C4    . DTP H 6 .   ? 45.840 4.578   4.669   1.00 11.64 ? 101 DTP P C4    1 
HETATM 3875 O  O     . HOH I 7 .   ? 64.203 -3.482  5.831   1.00 8.70  ? 601 HOH A O     1 
HETATM 3876 O  O     . HOH I 7 .   ? 58.093 -23.490 14.128  1.00 8.87  ? 602 HOH A O     1 
HETATM 3877 O  O     . HOH I 7 .   ? 69.294 -13.608 5.001   1.00 9.02  ? 603 HOH A O     1 
HETATM 3878 O  O     . HOH I 7 .   ? 56.466 -14.127 -5.895  1.00 9.86  ? 604 HOH A O     1 
HETATM 3879 O  O     . HOH I 7 .   ? 44.052 -14.618 5.662   1.00 9.03  ? 605 HOH A O     1 
HETATM 3880 O  O     . HOH I 7 .   ? 40.809 11.368  -3.538  1.00 12.42 ? 606 HOH A O     1 
HETATM 3881 O  O     . HOH I 7 .   ? 59.475 9.497   10.730  1.00 9.26  ? 607 HOH A O     1 
HETATM 3882 O  O     . HOH I 7 .   ? 51.869 5.842   9.320   1.00 10.36 ? 608 HOH A O     1 
HETATM 3883 O  O     . HOH I 7 .   ? 43.544 -33.244 -0.519  1.00 14.62 ? 609 HOH A O     1 
HETATM 3884 O  O     . HOH I 7 .   ? 46.447 16.634  1.087   1.00 8.59  ? 610 HOH A O     1 
HETATM 3885 O  O     . HOH I 7 .   ? 60.513 -18.645 -4.768  1.00 8.75  ? 611 HOH A O     1 
HETATM 3886 O  O     . HOH I 7 .   ? 53.749 13.433  -10.028 1.00 12.14 ? 612 HOH A O     1 
HETATM 3887 O  O     . HOH I 7 .   ? 45.565 15.925  -1.609  1.00 9.72  ? 613 HOH A O     1 
HETATM 3888 O  O     . HOH I 7 .   ? 67.569 -20.766 8.726   1.00 9.32  ? 614 HOH A O     1 
HETATM 3889 O  O     . HOH I 7 .   ? 54.129 -28.612 4.073   1.00 12.05 ? 615 HOH A O     1 
HETATM 3890 O  O     . HOH I 7 .   ? 43.629 12.057  -7.306  1.00 12.57 ? 616 HOH A O     1 
HETATM 3891 O  O     . HOH I 7 .   ? 51.545 5.562   -8.506  1.00 13.33 ? 617 HOH A O     1 
HETATM 3892 O  O     . HOH I 7 .   ? 49.058 6.713   -11.833 1.00 13.99 ? 618 HOH A O     1 
HETATM 3893 O  O     . HOH I 7 .   ? 73.277 -7.489  8.952   1.00 13.29 ? 619 HOH A O     1 
HETATM 3894 O  O     . HOH I 7 .   ? 67.295 -16.749 9.622   1.00 10.06 ? 620 HOH A O     1 
HETATM 3895 O  O     . HOH I 7 .   ? 59.854 11.311  -10.423 1.00 11.90 ? 621 HOH A O     1 
HETATM 3896 O  O     . HOH I 7 .   ? 55.639 17.331  -0.611  1.00 9.35  ? 622 HOH A O     1 
HETATM 3897 O  O     . HOH I 7 .   ? 69.177 -17.669 -1.430  1.00 12.60 ? 623 HOH A O     1 
HETATM 3898 O  O     . HOH I 7 .   ? 65.765 -23.060 3.275   1.00 11.94 ? 624 HOH A O     1 
HETATM 3899 O  O     . HOH I 7 .   ? 54.863 -11.514 3.414   1.00 9.04  ? 625 HOH A O     1 
HETATM 3900 O  O     . HOH I 7 .   ? 62.658 14.692  -9.258  1.00 11.81 ? 626 HOH A O     1 
HETATM 3901 O  O     . HOH I 7 .   ? 62.476 7.183   6.961   1.00 11.82 ? 627 HOH A O     1 
HETATM 3902 O  O     . HOH I 7 .   ? 66.139 -15.267 11.641  1.00 16.43 ? 628 HOH A O     1 
HETATM 3903 O  O     . HOH I 7 .   ? 52.689 1.261   9.597   1.00 13.40 ? 629 HOH A O     1 
HETATM 3904 O  O     . HOH I 7 .   ? 68.940 16.223  -4.273  1.00 13.52 ? 630 HOH A O     1 
HETATM 3905 O  O     . HOH I 7 .   ? 44.552 7.282   2.348   1.00 12.78 ? 631 HOH A O     1 
HETATM 3906 O  O     . HOH I 7 .   ? 70.860 16.169  -6.245  1.00 14.71 ? 632 HOH A O     1 
HETATM 3907 O  O     . HOH I 7 .   ? 45.215 -14.362 10.431  1.00 13.92 ? 633 HOH A O     1 
HETATM 3908 O  O     . HOH I 7 .   ? 68.115 -15.795 -7.690  1.00 15.91 ? 634 HOH A O     1 
HETATM 3909 O  O     . HOH I 7 .   ? 53.898 -20.487 -2.549  1.00 12.75 ? 635 HOH A O     1 
HETATM 3910 O  O     . HOH I 7 .   ? 60.903 -23.439 6.344   1.00 14.54 ? 636 HOH A O     1 
HETATM 3911 O  O     . HOH I 7 .   ? 54.150 17.174  -3.168  1.00 16.99 ? 637 HOH A O     1 
HETATM 3912 O  O     . HOH I 7 .   ? 48.664 -37.041 2.525   1.00 17.50 ? 638 HOH A O     1 
HETATM 3913 O  O     . HOH I 7 .   ? 42.078 8.305   3.372   1.00 17.10 ? 639 HOH A O     1 
HETATM 3914 O  O     . HOH I 7 .   ? 65.668 -6.606  -13.883 1.00 15.77 ? 640 HOH A O     1 
HETATM 3915 O  O     . HOH I 7 .   ? 37.036 16.063  -4.263  1.00 20.78 ? 641 HOH A O     1 
HETATM 3916 O  O     . HOH I 7 .   ? 61.659 14.639  8.582   1.00 20.81 ? 642 HOH A O     1 
HETATM 3917 O  O     . HOH I 7 .   ? 65.553 5.545   2.348   1.00 17.33 ? 643 HOH A O     1 
HETATM 3918 O  O     . HOH I 7 .   ? 41.402 17.025  -14.785 1.00 18.10 ? 644 HOH A O     1 
HETATM 3919 O  O     . HOH I 7 .   ? 52.515 20.152  4.841   1.00 11.52 ? 645 HOH A O     1 
HETATM 3920 O  O     . HOH I 7 .   ? 49.275 -15.685 13.513  1.00 12.25 ? 646 HOH A O     1 
HETATM 3921 O  O     . HOH I 7 .   ? 45.038 7.391   -10.394 1.00 17.88 ? 647 HOH A O     1 
HETATM 3922 O  O     . HOH I 7 .   ? 35.195 5.525   2.124   1.00 16.15 ? 648 HOH A O     1 
HETATM 3923 O  O     . HOH I 7 .   ? 71.136 3.488   -0.339  1.00 14.43 ? 649 HOH A O     1 
HETATM 3924 O  O     . HOH I 7 .   ? 43.680 9.701   -10.061 1.00 16.50 ? 650 HOH A O     1 
HETATM 3925 O  O     . HOH I 7 .   ? 43.917 10.982  -12.376 1.00 20.08 ? 651 HOH A O     1 
HETATM 3926 O  O     . HOH I 7 .   ? 48.534 -17.922 17.408  1.00 21.23 ? 652 HOH A O     1 
HETATM 3927 O  O     . HOH I 7 .   ? 50.116 2.897   12.840  1.00 19.42 ? 653 HOH A O     1 
HETATM 3928 O  O     . HOH I 7 .   ? 44.211 -15.245 1.388   1.00 15.71 ? 654 HOH A O     1 
HETATM 3929 O  O     . HOH I 7 .   ? 41.267 7.063   19.135  1.00 17.99 ? 655 HOH A O     1 
HETATM 3930 O  O     . HOH I 7 .   ? 54.445 -9.656  5.283   1.00 13.69 ? 656 HOH A O     1 
HETATM 3931 O  O     . HOH I 7 .   ? 58.464 -12.194 -11.435 1.00 14.53 ? 657 HOH A O     1 
HETATM 3932 O  O     . HOH I 7 .   ? 33.159 10.910  5.544   1.00 19.21 ? 658 HOH A O     1 
HETATM 3933 O  O     . HOH I 7 .   ? 41.821 -30.465 -6.354  1.00 21.42 ? 659 HOH A O     1 
HETATM 3934 O  O     . HOH I 7 .   ? 60.346 -17.991 -7.640  1.00 23.18 ? 660 HOH A O     1 
HETATM 3935 O  O     . HOH I 7 .   ? 53.359 -33.502 -0.307  1.00 17.57 ? 661 HOH A O     1 
HETATM 3936 O  O     . HOH I 7 .   ? 51.851 -8.771  4.716   1.00 19.98 ? 662 HOH A O     1 
HETATM 3937 O  O     . HOH I 7 .   ? 63.250 -26.735 7.045   1.00 14.93 ? 663 HOH A O     1 
HETATM 3938 O  O     . HOH I 7 .   ? 52.317 15.649  -4.804  1.00 11.15 ? 664 HOH A O     1 
HETATM 3939 O  O     . HOH I 7 .   ? 47.190 2.400   -1.455  1.00 19.61 ? 665 HOH A O     1 
HETATM 3940 O  O     . HOH I 7 .   ? 49.388 7.241   -7.814  1.00 19.86 ? 666 HOH A O     1 
HETATM 3941 O  O     . HOH I 7 .   ? 48.968 2.785   21.213  1.00 19.50 ? 667 HOH A O     1 
HETATM 3942 O  O     . HOH I 7 .   ? 42.286 -22.829 -2.485  1.00 15.99 ? 668 HOH A O     1 
HETATM 3943 O  O     . HOH I 7 .   ? 40.670 16.672  5.978   1.00 15.74 ? 669 HOH A O     1 
HETATM 3944 O  O     . HOH I 7 .   ? 52.966 -26.636 -3.931  1.00 18.25 ? 670 HOH A O     1 
HETATM 3945 O  O     . HOH I 7 .   ? 51.400 3.425   10.548  1.00 18.32 ? 671 HOH A O     1 
HETATM 3946 O  O     . HOH I 7 .   ? 61.766 8.166   9.842   1.00 21.03 ? 672 HOH A O     1 
HETATM 3947 O  O     . HOH I 7 .   ? 55.968 13.345  -11.610 1.00 22.79 ? 673 HOH A O     1 
HETATM 3948 O  O     . HOH I 7 .   ? 47.797 7.953   -9.767  1.00 20.90 ? 674 HOH A O     1 
HETATM 3949 O  O     . HOH I 7 .   ? 41.222 7.685   -18.537 1.00 16.55 ? 675 HOH A O     1 
HETATM 3950 O  O     . HOH I 7 .   ? 64.623 6.544   -0.665  1.00 13.96 ? 676 HOH A O     1 
HETATM 3951 O  O     . HOH I 7 .   ? 49.651 -9.286  -8.437  1.00 24.15 ? 677 HOH A O     1 
HETATM 3952 O  O     . HOH I 7 .   ? 63.403 -19.113 -1.765  1.00 14.37 ? 678 HOH A O     1 
HETATM 3953 O  O     . HOH I 7 .   ? 56.020 -7.323  6.326   1.00 17.86 ? 679 HOH A O     1 
HETATM 3954 O  O     . HOH I 7 .   ? 23.393 14.228  -9.107  1.00 25.26 ? 680 HOH A O     1 
HETATM 3955 O  O     . HOH I 7 .   ? 51.182 -8.904  -5.285  1.00 22.61 ? 681 HOH A O     1 
HETATM 3956 O  O     . HOH I 7 .   ? 42.966 15.799  23.741  1.00 21.01 ? 682 HOH A O     1 
HETATM 3957 O  O     . HOH I 7 .   ? 48.172 10.638  -9.608  1.00 21.64 ? 683 HOH A O     1 
HETATM 3958 O  O     . HOH I 7 .   ? 50.665 -34.956 -0.707  1.00 16.55 ? 684 HOH A O     1 
HETATM 3959 O  O     . HOH I 7 .   ? 58.715 -18.154 19.744  1.00 18.99 ? 685 HOH A O     1 
HETATM 3960 O  O     . HOH I 7 .   ? 43.017 -1.433  -25.085 1.00 19.67 ? 686 HOH A O     1 
HETATM 3961 O  O     . HOH I 7 .   ? 46.758 -0.382  -15.071 1.00 16.47 ? 687 HOH A O     1 
HETATM 3962 O  O     . HOH I 7 .   ? 59.369 11.086  8.500   1.00 14.23 ? 688 HOH A O     1 
HETATM 3963 O  O     . HOH I 7 .   ? 47.136 -14.659 14.811  1.00 21.97 ? 689 HOH A O     1 
HETATM 3964 O  O     . HOH I 7 .   ? 67.509 -8.395  9.942   1.00 21.97 ? 690 HOH A O     1 
HETATM 3965 O  O     . HOH I 7 .   ? 58.022 -14.419 -13.137 1.00 19.86 ? 691 HOH A O     1 
HETATM 3966 O  O     . HOH I 7 .   ? 51.773 11.624  -19.859 1.00 29.81 ? 692 HOH A O     1 
HETATM 3967 O  O     . HOH I 7 .   ? 51.459 5.226   -11.170 1.00 17.79 ? 693 HOH A O     1 
HETATM 3968 O  O     . HOH I 7 .   ? 51.181 5.967   -19.132 1.00 24.93 ? 694 HOH A O     1 
HETATM 3969 O  O     . HOH I 7 .   ? 50.362 -17.225 15.453  1.00 10.95 ? 695 HOH A O     1 
HETATM 3970 O  O     . HOH I 7 .   ? 50.770 0.524   -16.183 1.00 26.79 ? 696 HOH A O     1 
HETATM 3971 O  O     . HOH I 7 .   ? 45.053 0.537   -18.486 1.00 16.86 ? 697 HOH A O     1 
HETATM 3972 O  O     . HOH I 7 .   ? 40.935 -1.871  -16.624 1.00 23.10 ? 698 HOH A O     1 
HETATM 3973 O  O     . HOH I 7 .   ? 51.646 -35.426 7.704   1.00 21.13 ? 699 HOH A O     1 
HETATM 3974 O  O     . HOH I 7 .   ? 41.357 15.800  -23.005 1.00 18.47 ? 700 HOH A O     1 
HETATM 3975 O  O     . HOH I 7 .   ? 34.165 6.000   -21.940 1.00 24.87 ? 701 HOH A O     1 
HETATM 3976 O  O     . HOH I 7 .   ? 78.162 -1.088  4.984   1.00 17.75 ? 702 HOH A O     1 
HETATM 3977 O  O     . HOH I 7 .   ? 54.106 -1.554  -17.399 1.00 29.00 ? 703 HOH A O     1 
HETATM 3978 O  O     . HOH I 7 .   ? 54.516 -0.943  7.167   1.00 22.12 ? 704 HOH A O     1 
HETATM 3979 O  O     . HOH I 7 .   ? 49.103 -9.535  10.302  1.00 19.80 ? 705 HOH A O     1 
HETATM 3980 O  O     . HOH I 7 .   ? 44.972 16.937  -18.210 1.00 29.03 ? 706 HOH A O     1 
HETATM 3981 O  O     . HOH I 7 .   ? 71.673 5.826   -7.561  1.00 19.34 ? 707 HOH A O     1 
HETATM 3982 O  O     . HOH I 7 .   ? 44.220 -13.033 -0.279  1.00 17.91 ? 708 HOH A O     1 
HETATM 3983 O  O     . HOH I 7 .   ? 44.040 -28.899 15.724  1.00 22.18 ? 709 HOH A O     1 
HETATM 3984 O  O     . HOH I 7 .   ? 58.088 -7.835  8.272   1.00 16.71 ? 710 HOH A O     1 
HETATM 3985 O  O     . HOH I 7 .   ? 70.812 -19.183 1.064   1.00 13.14 ? 711 HOH A O     1 
HETATM 3986 O  O     . HOH I 7 .   ? 51.238 21.618  7.033   1.00 20.03 ? 712 HOH A O     1 
HETATM 3987 O  O     . HOH I 7 .   ? 48.379 19.670  4.617   1.00 17.24 ? 713 HOH A O     1 
HETATM 3988 O  O     . HOH I 7 .   ? 48.944 13.807  28.341  1.00 22.60 ? 714 HOH A O     1 
HETATM 3989 O  O     . HOH I 7 .   ? 69.492 4.527   3.769   1.00 18.07 ? 715 HOH A O     1 
HETATM 3990 O  O     . HOH I 7 .   ? 50.705 -6.422  -5.572  1.00 23.93 ? 716 HOH A O     1 
HETATM 3991 O  O     . HOH I 7 .   ? 71.964 -19.182 13.890  1.00 30.33 ? 717 HOH A O     1 
HETATM 3992 O  O     . HOH I 7 .   ? 27.620 6.656   -16.816 1.00 23.32 ? 718 HOH A O     1 
HETATM 3993 O  O     . HOH I 7 .   ? 65.642 -4.368  -15.323 1.00 21.21 ? 719 HOH A O     1 
HETATM 3994 O  O     . HOH I 7 .   ? 62.102 16.193  2.339   1.00 24.24 ? 720 HOH A O     1 
HETATM 3995 O  O     . HOH I 7 .   ? 58.719 15.208  -10.776 1.00 19.92 ? 721 HOH A O     1 
HETATM 3996 O  O     . HOH I 7 .   ? 49.898 -3.164  -17.305 1.00 19.38 ? 722 HOH A O     1 
HETATM 3997 O  O     . HOH I 7 .   ? 46.893 19.480  1.071   1.00 16.29 ? 723 HOH A O     1 
HETATM 3998 O  O     . HOH I 7 .   ? 48.313 -33.548 -3.773  1.00 21.05 ? 724 HOH A O     1 
HETATM 3999 O  O     . HOH I 7 .   ? 47.573 16.067  -17.963 1.00 30.36 ? 725 HOH A O     1 
HETATM 4000 O  O     . HOH I 7 .   ? 47.315 -16.793 -0.687  1.00 21.10 ? 726 HOH A O     1 
HETATM 4001 O  O     . HOH I 7 .   ? 63.999 -9.554  -14.515 1.00 15.76 ? 727 HOH A O     1 
HETATM 4002 O  O     . HOH I 7 .   ? 36.991 13.216  12.116  1.00 20.41 ? 728 HOH A O     1 
HETATM 4003 O  O     . HOH I 7 .   ? 59.705 10.380  19.896  1.00 17.38 ? 729 HOH A O     1 
HETATM 4004 O  O     . HOH I 7 .   ? 69.661 -13.108 -11.658 1.00 19.94 ? 730 HOH A O     1 
HETATM 4005 O  O     . HOH I 7 .   ? 57.796 0.108   -14.699 1.00 23.18 ? 731 HOH A O     1 
HETATM 4006 O  O     . HOH I 7 .   ? 29.064 8.237   -18.708 1.00 26.30 ? 732 HOH A O     1 
HETATM 4007 O  O     . HOH I 7 .   ? 48.279 16.815  28.074  1.00 23.24 ? 733 HOH A O     1 
HETATM 4008 O  O     . HOH I 7 .   ? 47.020 -30.841 13.381  1.00 25.84 ? 734 HOH A O     1 
HETATM 4009 O  O     . HOH I 7 .   ? 59.963 14.237  -8.698  1.00 13.68 ? 735 HOH A O     1 
HETATM 4010 O  O     . HOH I 7 .   ? 24.165 16.511  3.563   1.00 27.99 ? 736 HOH A O     1 
HETATM 4011 O  O     . HOH I 7 .   ? 58.416 18.533  -9.022  1.00 18.74 ? 737 HOH A O     1 
HETATM 4012 O  O     . HOH I 7 .   ? 29.483 3.819   6.591   1.00 29.35 ? 738 HOH A O     1 
HETATM 4013 O  O     . HOH I 7 .   ? 56.839 -3.491  4.678   1.00 25.51 ? 739 HOH A O     1 
HETATM 4014 O  O     . HOH I 7 .   ? 55.017 17.750  -12.547 1.00 27.51 ? 740 HOH A O     1 
HETATM 4015 O  O     . HOH I 7 .   ? 48.657 -22.358 -5.766  1.00 19.35 ? 741 HOH A O     1 
HETATM 4016 O  O     . HOH I 7 .   ? 46.473 -9.489  10.918  1.00 23.65 ? 742 HOH A O     1 
HETATM 4017 O  O     . HOH I 7 .   ? 73.754 4.422   -1.299  1.00 27.95 ? 743 HOH A O     1 
HETATM 4018 O  O     . HOH I 7 .   ? 76.572 2.759   6.557   1.00 19.85 ? 744 HOH A O     1 
HETATM 4019 O  O     . HOH I 7 .   ? 72.044 -3.923  -14.033 1.00 23.91 ? 745 HOH A O     1 
HETATM 4020 O  O     . HOH I 7 .   ? 51.341 8.632   -15.659 1.00 28.59 ? 746 HOH A O     1 
HETATM 4021 O  O     . HOH I 7 .   ? 62.324 11.753  5.221   1.00 23.29 ? 747 HOH A O     1 
HETATM 4022 O  O     . HOH I 7 .   ? 39.710 5.019   18.160  1.00 29.28 ? 748 HOH A O     1 
HETATM 4023 O  O     . HOH I 7 .   ? 38.306 10.613  9.648   1.00 21.00 ? 749 HOH A O     1 
HETATM 4024 O  O     . HOH I 7 .   ? 64.283 -24.644 -8.008  1.00 26.25 ? 750 HOH A O     1 
HETATM 4025 O  O     . HOH I 7 .   ? 59.919 12.934  11.137  1.00 20.06 ? 751 HOH A O     1 
HETATM 4026 O  O     . HOH I 7 .   ? 45.751 18.073  -3.573  1.00 18.70 ? 752 HOH A O     1 
HETATM 4027 O  O     . HOH I 7 .   ? 39.808 18.953  18.256  1.00 24.62 ? 753 HOH A O     1 
HETATM 4028 O  O     . HOH I 7 .   ? 61.030 20.964  11.991  1.00 20.71 ? 754 HOH A O     1 
HETATM 4029 O  O     . HOH I 7 .   ? 53.637 6.002   -12.410 1.00 19.58 ? 755 HOH A O     1 
HETATM 4030 O  O     . HOH I 7 .   ? 64.335 -11.623 12.980  1.00 34.78 ? 756 HOH A O     1 
HETATM 4031 O  O     . HOH I 7 .   ? 39.605 7.292   13.290  1.00 24.53 ? 757 HOH A O     1 
HETATM 4032 O  O     . HOH I 7 .   ? 71.004 0.488   11.268  1.00 25.68 ? 758 HOH A O     1 
HETATM 4033 O  O     . HOH I 7 .   ? 58.429 -8.821  -14.252 1.00 23.68 ? 759 HOH A O     1 
HETATM 4034 O  O     . HOH I 7 .   ? 50.128 -8.942  12.808  1.00 21.93 ? 760 HOH A O     1 
HETATM 4035 O  O     . HOH I 7 .   ? 52.778 3.546   17.936  1.00 22.05 ? 761 HOH A O     1 
HETATM 4036 O  O     . HOH I 7 .   ? 66.619 -2.514  12.746  1.00 25.27 ? 762 HOH A O     1 
HETATM 4037 O  O     . HOH I 7 .   ? 69.291 2.264   -15.508 1.00 33.17 ? 763 HOH A O     1 
HETATM 4038 O  O     . HOH I 7 .   ? 49.102 12.246  -11.558 1.00 26.83 ? 764 HOH A O     1 
HETATM 4039 O  O     . HOH I 7 .   ? 62.583 9.030   -13.664 1.00 27.66 ? 765 HOH A O     1 
HETATM 4040 O  O     . HOH I 7 .   ? 59.183 4.896   16.818  1.00 20.22 ? 766 HOH A O     1 
HETATM 4041 O  O     . HOH I 7 .   ? 65.793 -21.569 14.541  1.00 25.83 ? 767 HOH A O     1 
HETATM 4042 O  O     . HOH I 7 .   ? 61.369 -16.278 13.782  1.00 20.40 ? 768 HOH A O     1 
HETATM 4043 O  O     . HOH I 7 .   ? 49.397 8.495   -13.773 1.00 23.18 ? 769 HOH A O     1 
HETATM 4044 O  O     . HOH I 7 .   ? 54.649 -35.248 1.176   1.00 27.29 ? 770 HOH A O     1 
HETATM 4045 O  O     . HOH I 7 .   ? 61.139 9.819   6.833   1.00 20.88 ? 771 HOH A O     1 
HETATM 4046 O  O     . HOH I 7 .   ? 41.556 -24.028 -5.242  1.00 22.13 ? 772 HOH A O     1 
HETATM 4047 O  O     . HOH I 7 .   ? 56.247 -3.305  7.529   1.00 21.13 ? 773 HOH A O     1 
HETATM 4048 O  O     . HOH I 7 .   ? 53.184 -20.027 -5.230  1.00 23.31 ? 774 HOH A O     1 
HETATM 4049 O  O     . HOH I 7 .   ? 71.222 -12.282 14.076  1.00 26.32 ? 775 HOH A O     1 
HETATM 4050 O  O     . HOH I 7 .   ? 80.652 -4.003  14.009  1.00 36.47 ? 776 HOH A O     1 
HETATM 4051 O  O     . HOH I 7 .   ? 64.350 16.272  4.248   1.00 28.54 ? 777 HOH A O     1 
HETATM 4052 O  O     . HOH I 7 .   ? 61.736 -31.550 -10.712 1.00 25.61 ? 778 HOH A O     1 
HETATM 4053 O  O     . HOH I 7 .   ? 48.074 -27.726 -7.382  1.00 26.96 ? 779 HOH A O     1 
HETATM 4054 O  O     . HOH I 7 .   ? 52.574 2.425   -17.508 1.00 29.66 ? 780 HOH A O     1 
HETATM 4055 O  O     . HOH I 7 .   ? 72.423 -7.750  11.625  1.00 18.61 ? 781 HOH A O     1 
HETATM 4056 O  O     . HOH I 7 .   ? 57.222 -34.734 8.511   1.00 24.38 ? 782 HOH A O     1 
HETATM 4057 O  O     . HOH I 7 .   ? 53.411 -0.962  4.310   1.00 23.21 ? 783 HOH A O     1 
HETATM 4058 O  O     . HOH I 7 .   ? 34.806 15.313  11.330  1.00 20.29 ? 784 HOH A O     1 
HETATM 4059 O  O     . HOH I 7 .   ? 52.333 17.901  -10.673 1.00 32.25 ? 785 HOH A O     1 
HETATM 4060 O  O     . HOH I 7 .   ? 50.818 21.952  9.938   1.00 25.77 ? 786 HOH A O     1 
HETATM 4061 O  O     . HOH I 7 .   ? 47.647 -0.414  -7.840  1.00 19.08 ? 787 HOH A O     1 
HETATM 4062 O  O     . HOH I 7 .   ? 41.382 21.631  2.342   1.00 18.90 ? 788 HOH A O     1 
HETATM 4063 O  O     . HOH I 7 .   ? 50.859 6.050   -22.961 1.00 28.75 ? 789 HOH A O     1 
HETATM 4064 O  O     . HOH I 7 .   ? 52.058 -6.116  -0.854  1.00 19.23 ? 790 HOH A O     1 
HETATM 4065 O  O     . HOH I 7 .   ? 67.452 6.443   0.724   1.00 22.03 ? 791 HOH A O     1 
HETATM 4066 O  O     . HOH I 7 .   ? 53.713 -28.397 15.388  1.00 17.02 ? 792 HOH A O     1 
HETATM 4067 O  O     . HOH I 7 .   ? 37.537 18.855  16.845  1.00 26.56 ? 793 HOH A O     1 
HETATM 4068 O  O     . HOH I 7 .   ? 48.957 14.793  -22.632 1.00 23.01 ? 794 HOH A O     1 
HETATM 4069 O  O     . HOH I 7 .   ? 47.462 -20.196 18.394  1.00 21.38 ? 795 HOH A O     1 
HETATM 4070 O  O     . HOH I 7 .   ? 55.484 -1.294  -14.880 1.00 20.33 ? 796 HOH A O     1 
HETATM 4071 O  O     . HOH I 7 .   ? 64.258 20.159  11.200  1.00 30.89 ? 797 HOH A O     1 
HETATM 4072 O  O     . HOH I 7 .   ? 42.390 -9.083  9.636   1.00 31.34 ? 798 HOH A O     1 
HETATM 4073 O  O     . HOH I 7 .   ? 41.115 -29.974 13.367  1.00 32.79 ? 799 HOH A O     1 
HETATM 4074 O  O     . HOH I 7 .   ? 53.071 -12.660 -3.930  1.00 21.02 ? 800 HOH A O     1 
HETATM 4075 O  O     . HOH I 7 .   ? 62.814 -17.159 -7.292  1.00 20.60 ? 801 HOH A O     1 
HETATM 4076 O  O     . HOH I 7 .   ? 60.006 9.616   22.569  1.00 26.42 ? 802 HOH A O     1 
HETATM 4077 O  O     . HOH I 7 .   ? 63.386 12.824  -10.960 1.00 18.65 ? 803 HOH A O     1 
HETATM 4078 O  O     . HOH I 7 .   ? 79.000 3.379   1.736   1.00 28.60 ? 804 HOH A O     1 
HETATM 4079 O  O     . HOH I 7 .   ? 37.520 15.192  -20.318 1.00 26.53 ? 805 HOH A O     1 
HETATM 4080 O  O     . HOH I 7 .   ? 58.286 -27.508 11.195  1.00 15.75 ? 806 HOH A O     1 
HETATM 4081 O  O     . HOH I 7 .   ? 81.584 -11.145 -8.661  1.00 33.99 ? 807 HOH A O     1 
HETATM 4082 O  O     . HOH I 7 .   ? 78.726 -17.312 20.557  1.00 41.28 ? 808 HOH A O     1 
HETATM 4083 O  O     . HOH I 7 .   ? 51.209 -22.583 -5.921  1.00 23.53 ? 809 HOH A O     1 
HETATM 4084 O  O     . HOH I 7 .   ? 84.052 -5.197  2.358   1.00 30.79 ? 810 HOH A O     1 
HETATM 4085 O  O     . HOH I 7 .   ? 65.894 -22.397 -7.850  1.00 20.51 ? 811 HOH A O     1 
HETATM 4086 O  O     . HOH I 7 .   ? 58.932 4.618   23.203  1.00 26.84 ? 812 HOH A O     1 
HETATM 4087 O  O     . HOH I 7 .   ? 75.335 0.389   -3.752  1.00 19.47 ? 813 HOH A O     1 
HETATM 4088 O  O     . HOH I 7 .   ? 39.963 -22.452 2.963   1.00 24.46 ? 814 HOH A O     1 
HETATM 4089 O  O     . HOH I 7 .   ? 37.623 17.506  -6.559  1.00 30.74 ? 815 HOH A O     1 
HETATM 4090 O  O     . HOH I 7 .   ? 54.549 15.301  23.498  1.00 25.72 ? 816 HOH A O     1 
HETATM 4091 O  O     . HOH I 7 .   ? 41.908 15.344  -8.556  1.00 27.39 ? 817 HOH A O     1 
HETATM 4092 O  O     . HOH I 7 .   ? 47.052 16.487  25.523  1.00 24.00 ? 818 HOH A O     1 
HETATM 4093 O  O     . HOH I 7 .   ? 39.480 -2.010  -14.284 1.00 27.44 ? 819 HOH A O     1 
HETATM 4094 O  O     . HOH I 7 .   ? 44.972 20.700  3.614   1.00 25.91 ? 820 HOH A O     1 
HETATM 4095 O  O     . HOH I 7 .   ? 67.386 -6.675  12.633  1.00 22.38 ? 821 HOH A O     1 
HETATM 4096 O  O     . HOH I 7 .   ? 30.818 2.023   -22.160 1.00 29.69 ? 822 HOH A O     1 
HETATM 4097 O  O     . HOH I 7 .   ? 40.350 20.871  15.751  1.00 31.63 ? 823 HOH A O     1 
HETATM 4098 O  O     . HOH I 7 .   ? 63.840 21.915  8.938   1.00 30.77 ? 824 HOH A O     1 
HETATM 4099 O  O     . HOH I 7 .   ? 70.718 -17.316 12.354  1.00 25.08 ? 825 HOH A O     1 
HETATM 4100 O  O     . HOH I 7 .   ? 38.493 13.888  24.367  1.00 28.87 ? 826 HOH A O     1 
HETATM 4101 O  O     . HOH I 7 .   ? 44.587 13.207  -10.664 1.00 30.96 ? 827 HOH A O     1 
HETATM 4102 O  O     . HOH I 7 .   ? 55.923 -32.979 4.986   1.00 25.08 ? 828 HOH A O     1 
HETATM 4103 O  O     . HOH I 7 .   ? 50.987 17.666  -5.992  1.00 25.91 ? 829 HOH A O     1 
HETATM 4104 O  O     . HOH I 7 .   ? 53.362 19.311  -1.590  1.00 20.19 ? 830 HOH A O     1 
HETATM 4105 O  O     . HOH I 7 .   ? 39.713 -22.686 5.663   1.00 26.40 ? 831 HOH A O     1 
HETATM 4106 O  O     . HOH I 7 .   ? 61.215 16.079  4.876   1.00 21.86 ? 832 HOH A O     1 
HETATM 4107 O  O     . HOH I 7 .   ? 48.561 -19.764 -6.405  1.00 35.85 ? 833 HOH A O     1 
HETATM 4108 O  O     . HOH I 7 .   ? 42.543 12.995  -23.927 1.00 24.20 ? 834 HOH A O     1 
HETATM 4109 O  O     . HOH I 7 .   ? 67.286 -5.175  -17.543 1.00 34.69 ? 835 HOH A O     1 
HETATM 4110 O  O     . HOH I 7 .   ? 33.497 2.440   -0.360  1.00 21.27 ? 836 HOH A O     1 
HETATM 4111 O  O     . HOH I 7 .   ? 82.905 -3.645  -4.626  1.00 30.62 ? 837 HOH A O     1 
HETATM 4112 O  O     . HOH I 7 .   ? 48.364 -4.944  -5.283  1.00 24.93 ? 838 HOH A O     1 
HETATM 4113 O  O     . HOH I 7 .   ? 34.211 15.734  18.712  1.00 27.79 ? 839 HOH A O     1 
HETATM 4114 O  O     . HOH I 7 .   ? 40.491 15.489  25.338  1.00 33.18 ? 840 HOH A O     1 
HETATM 4115 O  O     . HOH I 7 .   ? 65.543 19.525  6.557   1.00 27.82 ? 841 HOH A O     1 
HETATM 4116 O  O     . HOH I 7 .   ? 45.860 7.275   -13.054 1.00 23.44 ? 842 HOH A O     1 
HETATM 4117 O  O     . HOH I 7 .   ? 40.221 -18.396 -1.719  1.00 31.81 ? 843 HOH A O     1 
HETATM 4118 O  O     . HOH I 7 .   ? 73.604 9.157   -4.453  1.00 30.56 ? 844 HOH A O     1 
HETATM 4119 O  O     . HOH I 7 .   ? 50.709 -13.451 -0.856  1.00 18.34 ? 845 HOH A O     1 
HETATM 4120 O  O     . HOH I 7 .   ? 39.155 -10.839 9.858   1.00 35.88 ? 846 HOH A O     1 
HETATM 4121 O  O     . HOH I 7 .   ? 41.470 20.256  4.704   1.00 20.68 ? 847 HOH A O     1 
HETATM 4122 O  O     . HOH I 7 .   ? 53.182 0.059   12.281  1.00 23.49 ? 848 HOH A O     1 
HETATM 4123 O  O     . HOH I 7 .   ? 55.823 -20.596 21.261  1.00 22.41 ? 849 HOH A O     1 
HETATM 4124 O  O     . HOH I 7 .   ? 68.139 -14.607 -10.132 1.00 19.05 ? 850 HOH A O     1 
HETATM 4125 O  O     . HOH I 7 .   ? 40.836 -29.544 -2.237  1.00 23.48 ? 851 HOH A O     1 
HETATM 4126 O  O     . HOH I 7 .   ? 46.711 -19.034 -2.100  1.00 28.82 ? 852 HOH A O     1 
HETATM 4127 O  O     . HOH I 7 .   ? 80.905 -15.852 7.540   1.00 26.52 ? 853 HOH A O     1 
HETATM 4128 O  O     . HOH I 7 .   ? 35.890 11.169  10.616  1.00 26.74 ? 854 HOH A O     1 
HETATM 4129 O  O     . HOH I 7 .   ? 64.958 -19.238 15.608  1.00 19.82 ? 855 HOH A O     1 
HETATM 4130 O  O     . HOH I 7 .   ? 37.457 14.240  21.847  1.00 27.00 ? 856 HOH A O     1 
HETATM 4131 O  O     . HOH I 7 .   ? 42.762 17.450  -16.971 1.00 30.12 ? 857 HOH A O     1 
HETATM 4132 O  O     . HOH I 7 .   ? 71.201 8.936   -6.596  1.00 24.33 ? 858 HOH A O     1 
HETATM 4133 O  O     . HOH I 7 .   ? 43.349 -25.523 17.357  1.00 25.22 ? 859 HOH A O     1 
HETATM 4134 O  O     . HOH I 7 .   ? 44.363 10.625  -24.631 1.00 24.89 ? 860 HOH A O     1 
HETATM 4135 O  O     . HOH I 7 .   ? 47.321 -22.867 17.452  1.00 18.52 ? 861 HOH A O     1 
HETATM 4136 O  O     . HOH I 7 .   ? 69.735 9.944   -8.776  1.00 21.96 ? 862 HOH A O     1 
HETATM 4137 O  O     . HOH I 7 .   ? 57.408 3.158   18.194  1.00 22.52 ? 863 HOH A O     1 
HETATM 4138 O  O     . HOH I 7 .   ? 43.263 -2.575  -20.189 1.00 24.50 ? 864 HOH A O     1 
HETATM 4139 O  O     . HOH I 7 .   ? 42.847 -30.199 -3.949  1.00 24.95 ? 865 HOH A O     1 
HETATM 4140 O  O     . HOH I 7 .   ? 46.526 2.353   -4.347  1.00 27.22 ? 866 HOH A O     1 
HETATM 4141 O  O     . HOH I 7 .   ? 43.513 15.766  -10.819 1.00 36.12 ? 867 HOH A O     1 
HETATM 4142 O  O     . HOH I 7 .   ? 57.260 -16.673 -11.519 1.00 26.01 ? 868 HOH A O     1 
HETATM 4143 O  O     . HOH I 7 .   ? 49.352 -38.379 0.266   1.00 25.29 ? 869 HOH A O     1 
HETATM 4144 O  O     . HOH I 7 .   ? 47.076 -38.162 4.594   1.00 27.36 ? 870 HOH A O     1 
HETATM 4145 O  O     . HOH I 7 .   ? 69.201 -10.953 12.169  1.00 26.60 ? 871 HOH A O     1 
HETATM 4146 O  O     . HOH I 7 .   ? 60.112 14.253  3.170   1.00 19.86 ? 872 HOH A O     1 
HETATM 4147 O  O     . HOH I 7 .   ? 49.117 -23.704 19.545  1.00 27.93 ? 873 HOH A O     1 
HETATM 4148 O  O     . HOH I 7 .   ? 57.652 -18.908 21.982  1.00 24.92 ? 874 HOH A O     1 
HETATM 4149 O  O     . HOH I 7 .   ? 61.775 9.113   18.805  1.00 24.12 ? 875 HOH A O     1 
HETATM 4150 O  O     . HOH I 7 .   ? 63.251 -7.477  12.741  1.00 22.12 ? 876 HOH A O     1 
HETATM 4151 O  O     . HOH I 7 .   ? 56.547 1.281   13.144  1.00 19.59 ? 877 HOH A O     1 
HETATM 4152 O  O     . HOH I 7 .   ? 14.875 15.116  -1.042  1.00 39.59 ? 878 HOH A O     1 
HETATM 4153 O  O     . HOH I 7 .   ? 44.547 -22.577 18.032  1.00 29.47 ? 879 HOH A O     1 
HETATM 4154 O  O     . HOH I 7 .   ? 45.312 -15.091 12.994  1.00 29.09 ? 880 HOH A O     1 
HETATM 4155 O  O     . HOH I 7 .   ? 61.638 -17.596 -13.184 1.00 31.29 ? 881 HOH A O     1 
HETATM 4156 O  O     . HOH I 7 .   ? 79.941 2.231   4.164   1.00 35.82 ? 882 HOH A O     1 
HETATM 4157 O  O     . HOH I 7 .   ? 22.024 11.868  -9.372  1.00 24.26 ? 883 HOH A O     1 
HETATM 4158 O  O     . HOH I 7 .   ? 70.797 -6.862  13.876  1.00 29.03 ? 884 HOH A O     1 
HETATM 4159 O  O     . HOH I 7 .   ? 34.239 3.034   2.750   1.00 28.77 ? 885 HOH A O     1 
HETATM 4160 O  O     . HOH I 7 .   ? 44.231 18.503  23.227  1.00 29.90 ? 886 HOH A O     1 
HETATM 4161 O  O     . HOH I 7 .   ? 44.388 15.765  26.303  1.00 27.12 ? 887 HOH A O     1 
HETATM 4162 O  O     . HOH I 7 .   ? 53.582 7.270   -14.874 1.00 26.96 ? 888 HOH A O     1 
HETATM 4163 O  O     . HOH I 7 .   ? 54.076 -22.523 -5.427  1.00 29.47 ? 889 HOH A O     1 
HETATM 4164 O  O     . HOH I 7 .   ? 51.546 13.214  -11.537 1.00 22.40 ? 890 HOH A O     1 
HETATM 4165 O  O     . HOH I 7 .   ? 61.707 11.330  -12.503 1.00 25.67 ? 891 HOH A O     1 
HETATM 4166 O  O     . HOH I 7 .   ? 58.199 18.130  19.759  1.00 28.54 ? 892 HOH A O     1 
HETATM 4167 O  O     . HOH I 7 .   ? 56.223 18.809  18.111  1.00 21.51 ? 893 HOH A O     1 
HETATM 4168 O  O     . HOH I 7 .   ? 73.825 -20.776 0.995   1.00 26.91 ? 894 HOH A O     1 
HETATM 4169 O  O     . HOH I 7 .   ? 32.646 3.071   -24.066 1.00 29.66 ? 895 HOH A O     1 
HETATM 4170 O  O     . HOH I 7 .   ? 47.297 3.169   -23.568 1.00 27.17 ? 896 HOH A O     1 
HETATM 4171 O  O     . HOH I 7 .   ? 31.015 21.762  -3.444  1.00 25.73 ? 897 HOH A O     1 
HETATM 4172 O  O     . HOH I 7 .   ? 54.275 -32.448 14.010  1.00 27.71 ? 898 HOH A O     1 
HETATM 4173 O  O     . HOH I 7 .   ? 38.780 -17.892 10.337  1.00 22.65 ? 899 HOH A O     1 
HETATM 4174 O  O     . HOH I 7 .   ? 62.155 24.013  9.835   1.00 27.27 ? 900 HOH A O     1 
HETATM 4175 O  O     . HOH I 7 .   ? 62.551 -29.762 -12.553 1.00 31.46 ? 901 HOH A O     1 
HETATM 4176 O  O     . HOH I 7 .   ? 69.853 5.456   0.898   1.00 29.45 ? 902 HOH A O     1 
HETATM 4177 O  O     . HOH I 7 .   ? 70.563 -21.971 0.552   1.00 25.03 ? 903 HOH A O     1 
HETATM 4178 O  O     . HOH I 7 .   ? 49.815 17.393  -11.583 1.00 36.28 ? 904 HOH A O     1 
HETATM 4179 O  O     . HOH I 7 .   ? 40.668 -12.881 11.074  1.00 32.66 ? 905 HOH A O     1 
HETATM 4180 O  O     . HOH I 7 .   ? 34.457 17.606  -12.758 1.00 24.75 ? 906 HOH A O     1 
HETATM 4181 O  O     . HOH I 7 .   ? 47.945 3.121   -20.420 1.00 30.52 ? 907 HOH A O     1 
HETATM 4182 O  O     . HOH I 7 .   ? 42.587 -18.953 14.928  1.00 20.50 ? 908 HOH A O     1 
HETATM 4183 O  O     . HOH I 7 .   ? 46.011 18.002  29.798  1.00 27.53 ? 909 HOH A O     1 
HETATM 4184 O  O     . HOH I 7 .   ? 51.517 -29.153 16.951  1.00 31.48 ? 910 HOH A O     1 
HETATM 4185 O  O     . HOH I 7 .   ? 49.756 -15.896 -9.189  1.00 29.84 ? 911 HOH A O     1 
HETATM 4186 O  O     . HOH I 7 .   ? 40.646 -18.501 1.016   1.00 31.41 ? 912 HOH A O     1 
HETATM 4187 O  O     . HOH I 7 .   ? 51.922 -15.986 17.240  1.00 23.61 ? 913 HOH A O     1 
HETATM 4188 O  O     . HOH I 7 .   ? 53.038 -19.762 22.212  1.00 27.43 ? 914 HOH A O     1 
HETATM 4189 O  O     . HOH I 7 .   ? 52.827 -24.887 -5.981  1.00 31.25 ? 915 HOH A O     1 
HETATM 4190 O  O     . HOH I 7 .   ? 47.060 -18.686 -4.621  1.00 34.86 ? 916 HOH A O     1 
HETATM 4191 O  O     . HOH I 7 .   ? 70.646 -14.809 15.045  1.00 36.76 ? 917 HOH A O     1 
HETATM 4192 O  O     . HOH I 7 .   ? 59.015 -13.364 15.125  1.00 26.37 ? 918 HOH A O     1 
HETATM 4193 O  O     . HOH I 7 .   ? 58.122 -7.785  -16.865 1.00 30.31 ? 919 HOH A O     1 
HETATM 4194 O  O     . HOH I 7 .   ? 19.893 10.293  8.845   1.00 30.74 ? 920 HOH A O     1 
HETATM 4195 O  O     . HOH I 7 .   ? 83.921 -8.128  0.342   1.00 31.11 ? 921 HOH A O     1 
HETATM 4196 O  O     . HOH I 7 .   ? 34.765 14.654  21.909  1.00 31.75 ? 922 HOH A O     1 
HETATM 4197 O  O     . HOH I 7 .   ? 61.500 7.405   22.950  1.00 35.73 ? 923 HOH A O     1 
HETATM 4198 O  O     . HOH I 7 .   ? 44.732 -18.905 19.060  1.00 32.91 ? 924 HOH A O     1 
HETATM 4199 O  O     . HOH I 7 .   ? 76.794 1.917   -5.361  1.00 29.13 ? 925 HOH A O     1 
HETATM 4200 O  O     . HOH I 7 .   ? 55.885 -27.430 -4.227  1.00 30.05 ? 926 HOH A O     1 
HETATM 4201 O  O     . HOH I 7 .   ? 35.271 14.943  -21.694 1.00 32.38 ? 927 HOH A O     1 
HETATM 4202 O  O     . HOH I 7 .   ? 70.113 -8.888  10.580  1.00 22.75 ? 928 HOH A O     1 
HETATM 4203 O  O     . HOH I 7 .   ? 32.237 -1.376  -2.410  1.00 33.88 ? 929 HOH A O     1 
HETATM 4204 O  O     . HOH I 7 .   ? 46.027 -10.795 -0.058  1.00 21.98 ? 930 HOH A O     1 
HETATM 4205 O  O     . HOH I 7 .   ? 60.632 13.630  6.194   1.00 24.85 ? 931 HOH A O     1 
HETATM 4206 O  O     . HOH I 7 .   ? 52.970 23.929  4.078   1.00 24.80 ? 932 HOH A O     1 
HETATM 4207 O  O     . HOH I 7 .   ? 45.753 11.594  -9.024  1.00 28.64 ? 933 HOH A O     1 
HETATM 4208 O  O     . HOH I 7 .   ? 52.739 8.478   25.532  1.00 27.71 ? 934 HOH A O     1 
HETATM 4209 O  O     . HOH I 7 .   ? 47.498 -24.035 -7.846  1.00 28.49 ? 935 HOH A O     1 
HETATM 4210 O  O     . HOH I 7 .   ? 59.938 3.492   20.943  1.00 24.17 ? 936 HOH A O     1 
HETATM 4211 O  O     . HOH I 7 .   ? 68.857 -1.356  -13.572 1.00 25.15 ? 937 HOH A O     1 
HETATM 4212 O  O     . HOH I 7 .   ? 47.180 14.035  -10.855 1.00 33.00 ? 938 HOH A O     1 
HETATM 4213 O  O     . HOH I 7 .   ? 63.651 -17.196 14.950  1.00 23.39 ? 939 HOH A O     1 
HETATM 4214 O  O     . HOH I 7 .   ? 58.767 0.716   -17.165 1.00 28.81 ? 940 HOH A O     1 
HETATM 4215 O  O     . HOH I 7 .   ? 19.693 11.542  -10.705 1.00 35.37 ? 941 HOH A O     1 
HETATM 4216 O  O     . HOH I 7 .   ? 51.753 -22.665 22.371  1.00 31.25 ? 942 HOH A O     1 
HETATM 4217 O  O     . HOH I 7 .   ? 80.708 -18.212 -12.771 1.00 39.25 ? 943 HOH A O     1 
HETATM 4218 O  O     . HOH I 7 .   ? 67.901 1.691   12.422  1.00 33.69 ? 944 HOH A O     1 
HETATM 4219 O  O     . HOH I 7 .   ? 68.491 4.712   -14.268 1.00 25.67 ? 945 HOH A O     1 
HETATM 4220 O  O     . HOH I 7 .   ? 25.694 -3.734  12.225  1.00 45.28 ? 946 HOH A O     1 
HETATM 4221 O  O     . HOH I 7 .   ? 44.668 -0.433  8.624   1.00 30.49 ? 947 HOH A O     1 
HETATM 4222 O  O     . HOH I 7 .   ? 28.688 23.540  -4.185  1.00 38.36 ? 948 HOH A O     1 
HETATM 4223 O  O     . HOH I 7 .   ? 61.448 24.807  12.660  1.00 35.70 ? 949 HOH A O     1 
HETATM 4224 O  O     . HOH I 7 .   ? 66.533 3.375   10.795  1.00 26.06 ? 950 HOH A O     1 
HETATM 4225 O  O     . HOH I 7 .   ? 55.367 5.434   25.182  1.00 29.59 ? 951 HOH A O     1 
HETATM 4226 O  O     . HOH I 7 .   ? 46.684 0.310   6.929   1.00 23.34 ? 952 HOH A O     1 
HETATM 4227 O  O     . HOH I 7 .   ? 41.970 -20.931 17.086  1.00 35.16 ? 953 HOH A O     1 
HETATM 4228 O  O     . HOH I 7 .   ? 65.232 12.919  2.975   1.00 22.55 ? 954 HOH A O     1 
HETATM 4229 O  O     . HOH I 7 .   ? 29.308 17.823  -15.335 1.00 28.69 ? 955 HOH A O     1 
HETATM 4230 O  O     . HOH I 7 .   ? 21.910 13.806  6.923   1.00 32.38 ? 956 HOH A O     1 
HETATM 4231 O  O     . HOH I 7 .   ? 30.415 -1.066  -20.639 1.00 38.50 ? 957 HOH A O     1 
HETATM 4232 O  O     . HOH I 7 .   ? 35.467 21.031  0.546   1.00 22.81 ? 958 HOH A O     1 
HETATM 4233 O  O     . HOH I 7 .   ? 57.679 5.586   -16.056 1.00 32.46 ? 959 HOH A O     1 
HETATM 4234 O  O     . HOH I 7 .   ? 38.946 -19.054 5.640   1.00 28.48 ? 960 HOH A O     1 
HETATM 4235 O  O     . HOH I 7 .   ? 39.007 -19.927 12.661  1.00 25.15 ? 961 HOH A O     1 
HETATM 4236 O  O     . HOH I 7 .   ? 60.768 -28.500 8.312   1.00 19.49 ? 962 HOH A O     1 
HETATM 4237 O  O     . HOH I 7 .   ? 50.753 26.139  6.672   1.00 27.20 ? 963 HOH A O     1 
HETATM 4238 O  O     . HOH J 7 .   ? 41.191 -3.637  -9.519  1.00 22.10 ? 101 HOH T O     1 
HETATM 4239 O  O     . HOH J 7 .   ? 42.137 -7.539  -10.615 1.00 26.01 ? 102 HOH T O     1 
HETATM 4240 O  O     . HOH J 7 .   ? 43.438 5.484   -9.190  1.00 19.31 ? 103 HOH T O     1 
HETATM 4241 O  O     . HOH J 7 .   ? 36.045 11.029  0.855   1.00 18.79 ? 104 HOH T O     1 
HETATM 4242 O  O     . HOH J 7 .   ? 36.914 -23.271 -5.490  1.00 21.72 ? 105 HOH T O     1 
HETATM 4243 O  O     . HOH J 7 .   ? 40.217 -0.548  7.950   1.00 24.91 ? 106 HOH T O     1 
HETATM 4244 O  O     . HOH J 7 .   ? 42.061 -20.238 -3.628  1.00 23.44 ? 107 HOH T O     1 
HETATM 4245 O  O     . HOH J 7 .   ? 44.550 -8.513  -3.701  1.00 24.67 ? 108 HOH T O     1 
HETATM 4246 O  O     . HOH J 7 .   ? 38.842 -2.492  -6.603  1.00 25.11 ? 109 HOH T O     1 
HETATM 4247 O  O     . HOH J 7 .   ? 37.372 0.215   -3.110  1.00 23.97 ? 110 HOH T O     1 
HETATM 4248 O  O     . HOH J 7 .   ? 34.160 9.159   11.933  1.00 33.78 ? 111 HOH T O     1 
HETATM 4249 O  O     . HOH J 7 .   ? 36.510 2.115   4.485   1.00 24.68 ? 112 HOH T O     1 
HETATM 4250 O  O     . HOH J 7 .   ? 31.231 -16.314 -4.547  1.00 25.86 ? 113 HOH T O     1 
HETATM 4251 O  O     . HOH J 7 .   ? 32.098 14.480  10.975  1.00 35.85 ? 114 HOH T O     1 
HETATM 4252 O  O     . HOH J 7 .   ? 35.212 5.911   18.160  1.00 32.40 ? 115 HOH T O     1 
HETATM 4253 O  O     . HOH J 7 .   ? 36.710 -2.026  -1.160  1.00 25.40 ? 116 HOH T O     1 
HETATM 4254 O  O     . HOH J 7 .   ? 47.120 -8.898  -4.507  1.00 31.14 ? 117 HOH T O     1 
HETATM 4255 O  O     . HOH J 7 .   ? 33.306 10.883  8.566   1.00 31.59 ? 118 HOH T O     1 
HETATM 4256 O  O     . HOH J 7 .   ? 37.981 -22.955 -7.928  1.00 29.11 ? 119 HOH T O     1 
HETATM 4257 O  O     . HOH J 7 .   ? 30.674 4.969   8.692   1.00 36.63 ? 120 HOH T O     1 
HETATM 4258 O  O     . HOH J 7 .   ? 32.650 -17.262 -2.455  1.00 26.07 ? 121 HOH T O     1 
HETATM 4259 O  O     . HOH J 7 .   ? 37.891 -12.802 -11.102 1.00 30.45 ? 122 HOH T O     1 
HETATM 4260 O  O     . HOH J 7 .   ? 37.031 -2.767  -4.203  1.00 25.87 ? 123 HOH T O     1 
HETATM 4261 O  O     . HOH J 7 .   ? 34.836 3.223   7.864   1.00 37.46 ? 124 HOH T O     1 
HETATM 4262 O  O     . HOH J 7 .   ? 43.849 0.855   10.656  1.00 34.33 ? 125 HOH T O     1 
HETATM 4263 O  O     . HOH J 7 .   ? 45.695 -2.330  -3.436  1.00 24.68 ? 126 HOH T O     1 
HETATM 4264 O  O     . HOH J 7 .   ? 38.226 -21.829 -3.458  1.00 29.15 ? 127 HOH T O     1 
HETATM 4265 O  O     . HOH J 7 .   ? 41.128 -10.119 -11.535 1.00 33.70 ? 128 HOH T O     1 
HETATM 4266 O  O     . HOH J 7 .   ? 45.463 -4.978  -3.423  1.00 26.31 ? 129 HOH T O     1 
HETATM 4267 O  O     . HOH K 7 .   ? 43.209 -9.112  7.083   1.00 17.52 ? 201 HOH P O     1 
HETATM 4268 O  O     . HOH K 7 .   ? 45.179 -8.147  -0.964  1.00 19.25 ? 202 HOH P O     1 
HETATM 4269 O  O     . HOH K 7 .   ? 49.666 -10.342 6.696   1.00 11.94 ? 203 HOH P O     1 
HETATM 4270 O  O     . HOH K 7 .   ? 41.651 -15.830 1.840   1.00 18.38 ? 204 HOH P O     1 
HETATM 4271 O  O     . HOH K 7 .   ? 46.782 3.855   0.853   1.00 22.00 ? 205 HOH P O     1 
HETATM 4272 O  O     . HOH K 7 .   ? 40.818 -5.369  5.662   1.00 24.20 ? 206 HOH P O     1 
HETATM 4273 O  O     . HOH K 7 .   ? 40.764 -9.088  5.850   1.00 26.29 ? 207 HOH P O     1 
HETATM 4274 O  O     . HOH K 7 .   ? 46.540 -2.281  -0.641  1.00 20.94 ? 208 HOH P O     1 
HETATM 4275 O  O     . HOH K 7 .   ? 38.318 -10.834 6.359   1.00 25.72 ? 209 HOH P O     1 
HETATM 4276 O  O     . HOH K 7 .   ? 42.058 -11.466 -1.135  1.00 23.33 ? 210 HOH P O     1 
HETATM 4277 O  O     . HOH K 7 .   ? 38.886 -3.903  4.646   1.00 28.40 ? 211 HOH P O     1 
HETATM 4278 O  O     . HOH K 7 .   ? 32.312 -9.235  3.905   1.00 30.59 ? 212 HOH P O     1 
HETATM 4279 O  O     . HOH K 7 .   ? 52.698 -3.201  5.765   1.00 28.43 ? 213 HOH P O     1 
HETATM 4280 O  O     . HOH K 7 .   ? 35.297 -9.455  4.064   1.00 32.01 ? 214 HOH P O     1 
HETATM 4281 O  O     . HOH K 7 .   ? 45.368 5.992   -0.106  1.00 23.82 ? 215 HOH P O     1 
HETATM 4282 O  O     . HOH K 7 .   ? 31.275 -13.922 -3.039  1.00 29.65 ? 216 HOH P O     1 
HETATM 4283 O  O     . HOH K 7 .   ? 40.214 -14.343 -0.118  1.00 23.91 ? 217 HOH P O     1 
HETATM 4284 O  O     . HOH K 7 .   ? 42.540 -1.657  7.051   1.00 29.36 ? 218 HOH P O     1 
HETATM 4285 O  O     . HOH K 7 .   ? 38.342 -1.717  6.123   1.00 36.04 ? 219 HOH P O     1 
HETATM 4286 O  O     . HOH K 7 .   ? 35.131 -4.622  -0.635  1.00 28.78 ? 220 HOH P O     1 
HETATM 4287 O  O     . HOH K 7 .   ? 34.771 -9.207  -11.262 1.00 33.35 ? 221 HOH P O     1 
HETATM 4288 O  O     . HOH K 7 .   ? 32.392 -7.436  -11.757 1.00 35.13 ? 222 HOH P O     1 
HETATM 4289 O  O     . HOH K 7 .   ? 36.324 -12.610 -13.551 1.00 36.48 ? 223 HOH P O     1 
HETATM 4290 O  O     . HOH K 7 .   ? 44.934 -6.264  6.279   1.00 23.19 ? 224 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1   501 502 CA  CA  A . 
E 5 GOL 1   502 436 GOL GOL A . 
F 5 GOL 1   503 437 GOL GOL A . 
G 5 GOL 1   504 438 GOL GOL A . 
H 6 DTP 1   101 9   DTP DTP P . 
I 7 HOH 1   601 1   HOH HOH A . 
I 7 HOH 2   602 2   HOH HOH A . 
I 7 HOH 3   603 3   HOH HOH A . 
I 7 HOH 4   604 4   HOH HOH A . 
I 7 HOH 5   605 5   HOH HOH A . 
I 7 HOH 6   606 6   HOH HOH A . 
I 7 HOH 7   607 7   HOH HOH A . 
I 7 HOH 8   608 8   HOH HOH A . 
I 7 HOH 9   609 9   HOH HOH A . 
I 7 HOH 10  610 10  HOH HOH A . 
I 7 HOH 11  611 11  HOH HOH A . 
I 7 HOH 12  612 12  HOH HOH A . 
I 7 HOH 13  613 13  HOH HOH A . 
I 7 HOH 14  614 14  HOH HOH A . 
I 7 HOH 15  615 15  HOH HOH A . 
I 7 HOH 16  616 16  HOH HOH A . 
I 7 HOH 17  617 17  HOH HOH A . 
I 7 HOH 18  618 18  HOH HOH A . 
I 7 HOH 19  619 19  HOH HOH A . 
I 7 HOH 20  620 20  HOH HOH A . 
I 7 HOH 21  621 21  HOH HOH A . 
I 7 HOH 22  622 22  HOH HOH A . 
I 7 HOH 23  623 23  HOH HOH A . 
I 7 HOH 24  624 24  HOH HOH A . 
I 7 HOH 25  625 25  HOH HOH A . 
I 7 HOH 26  626 26  HOH HOH A . 
I 7 HOH 27  627 27  HOH HOH A . 
I 7 HOH 28  628 28  HOH HOH A . 
I 7 HOH 29  629 29  HOH HOH A . 
I 7 HOH 30  630 30  HOH HOH A . 
I 7 HOH 31  631 31  HOH HOH A . 
I 7 HOH 32  632 32  HOH HOH A . 
I 7 HOH 33  633 33  HOH HOH A . 
I 7 HOH 34  634 36  HOH HOH A . 
I 7 HOH 35  635 37  HOH HOH A . 
I 7 HOH 36  636 38  HOH HOH A . 
I 7 HOH 37  637 39  HOH HOH A . 
I 7 HOH 38  638 41  HOH HOH A . 
I 7 HOH 39  639 42  HOH HOH A . 
I 7 HOH 40  640 43  HOH HOH A . 
I 7 HOH 41  641 44  HOH HOH A . 
I 7 HOH 42  642 45  HOH HOH A . 
I 7 HOH 43  643 46  HOH HOH A . 
I 7 HOH 44  644 47  HOH HOH A . 
I 7 HOH 45  645 48  HOH HOH A . 
I 7 HOH 46  646 49  HOH HOH A . 
I 7 HOH 47  647 50  HOH HOH A . 
I 7 HOH 48  648 51  HOH HOH A . 
I 7 HOH 49  649 52  HOH HOH A . 
I 7 HOH 50  650 53  HOH HOH A . 
I 7 HOH 51  651 54  HOH HOH A . 
I 7 HOH 52  652 55  HOH HOH A . 
I 7 HOH 53  653 56  HOH HOH A . 
I 7 HOH 54  654 57  HOH HOH A . 
I 7 HOH 55  655 58  HOH HOH A . 
I 7 HOH 56  656 59  HOH HOH A . 
I 7 HOH 57  657 60  HOH HOH A . 
I 7 HOH 58  658 61  HOH HOH A . 
I 7 HOH 59  659 62  HOH HOH A . 
I 7 HOH 60  660 64  HOH HOH A . 
I 7 HOH 61  661 65  HOH HOH A . 
I 7 HOH 62  662 66  HOH HOH A . 
I 7 HOH 63  663 67  HOH HOH A . 
I 7 HOH 64  664 68  HOH HOH A . 
I 7 HOH 65  665 69  HOH HOH A . 
I 7 HOH 66  666 70  HOH HOH A . 
I 7 HOH 67  667 71  HOH HOH A . 
I 7 HOH 68  668 72  HOH HOH A . 
I 7 HOH 69  669 73  HOH HOH A . 
I 7 HOH 70  670 74  HOH HOH A . 
I 7 HOH 71  671 75  HOH HOH A . 
I 7 HOH 72  672 76  HOH HOH A . 
I 7 HOH 73  673 77  HOH HOH A . 
I 7 HOH 74  674 78  HOH HOH A . 
I 7 HOH 75  675 79  HOH HOH A . 
I 7 HOH 76  676 80  HOH HOH A . 
I 7 HOH 77  677 81  HOH HOH A . 
I 7 HOH 78  678 82  HOH HOH A . 
I 7 HOH 79  679 83  HOH HOH A . 
I 7 HOH 80  680 84  HOH HOH A . 
I 7 HOH 81  681 85  HOH HOH A . 
I 7 HOH 82  682 86  HOH HOH A . 
I 7 HOH 83  683 87  HOH HOH A . 
I 7 HOH 84  684 88  HOH HOH A . 
I 7 HOH 85  685 89  HOH HOH A . 
I 7 HOH 86  686 91  HOH HOH A . 
I 7 HOH 87  687 92  HOH HOH A . 
I 7 HOH 88  688 93  HOH HOH A . 
I 7 HOH 89  689 94  HOH HOH A . 
I 7 HOH 90  690 96  HOH HOH A . 
I 7 HOH 91  691 97  HOH HOH A . 
I 7 HOH 92  692 98  HOH HOH A . 
I 7 HOH 93  693 99  HOH HOH A . 
I 7 HOH 94  694 100 HOH HOH A . 
I 7 HOH 95  695 101 HOH HOH A . 
I 7 HOH 96  696 102 HOH HOH A . 
I 7 HOH 97  697 103 HOH HOH A . 
I 7 HOH 98  698 106 HOH HOH A . 
I 7 HOH 99  699 108 HOH HOH A . 
I 7 HOH 100 700 109 HOH HOH A . 
I 7 HOH 101 701 110 HOH HOH A . 
I 7 HOH 102 702 111 HOH HOH A . 
I 7 HOH 103 703 113 HOH HOH A . 
I 7 HOH 104 704 114 HOH HOH A . 
I 7 HOH 105 705 115 HOH HOH A . 
I 7 HOH 106 706 116 HOH HOH A . 
I 7 HOH 107 707 117 HOH HOH A . 
I 7 HOH 108 708 118 HOH HOH A . 
I 7 HOH 109 709 119 HOH HOH A . 
I 7 HOH 110 710 120 HOH HOH A . 
I 7 HOH 111 711 121 HOH HOH A . 
I 7 HOH 112 712 122 HOH HOH A . 
I 7 HOH 113 713 124 HOH HOH A . 
I 7 HOH 114 714 125 HOH HOH A . 
I 7 HOH 115 715 126 HOH HOH A . 
I 7 HOH 116 716 127 HOH HOH A . 
I 7 HOH 117 717 128 HOH HOH A . 
I 7 HOH 118 718 129 HOH HOH A . 
I 7 HOH 119 719 130 HOH HOH A . 
I 7 HOH 120 720 131 HOH HOH A . 
I 7 HOH 121 721 132 HOH HOH A . 
I 7 HOH 122 722 133 HOH HOH A . 
I 7 HOH 123 723 134 HOH HOH A . 
I 7 HOH 124 724 135 HOH HOH A . 
I 7 HOH 125 725 136 HOH HOH A . 
I 7 HOH 126 726 137 HOH HOH A . 
I 7 HOH 127 727 138 HOH HOH A . 
I 7 HOH 128 728 139 HOH HOH A . 
I 7 HOH 129 729 140 HOH HOH A . 
I 7 HOH 130 730 141 HOH HOH A . 
I 7 HOH 131 731 142 HOH HOH A . 
I 7 HOH 132 732 143 HOH HOH A . 
I 7 HOH 133 733 144 HOH HOH A . 
I 7 HOH 134 734 145 HOH HOH A . 
I 7 HOH 135 735 146 HOH HOH A . 
I 7 HOH 136 736 147 HOH HOH A . 
I 7 HOH 137 737 149 HOH HOH A . 
I 7 HOH 138 738 151 HOH HOH A . 
I 7 HOH 139 739 152 HOH HOH A . 
I 7 HOH 140 740 153 HOH HOH A . 
I 7 HOH 141 741 154 HOH HOH A . 
I 7 HOH 142 742 155 HOH HOH A . 
I 7 HOH 143 743 156 HOH HOH A . 
I 7 HOH 144 744 157 HOH HOH A . 
I 7 HOH 145 745 158 HOH HOH A . 
I 7 HOH 146 746 159 HOH HOH A . 
I 7 HOH 147 747 161 HOH HOH A . 
I 7 HOH 148 748 162 HOH HOH A . 
I 7 HOH 149 749 163 HOH HOH A . 
I 7 HOH 150 750 164 HOH HOH A . 
I 7 HOH 151 751 165 HOH HOH A . 
I 7 HOH 152 752 166 HOH HOH A . 
I 7 HOH 153 753 167 HOH HOH A . 
I 7 HOH 154 754 168 HOH HOH A . 
I 7 HOH 155 755 169 HOH HOH A . 
I 7 HOH 156 756 170 HOH HOH A . 
I 7 HOH 157 757 171 HOH HOH A . 
I 7 HOH 158 758 172 HOH HOH A . 
I 7 HOH 159 759 173 HOH HOH A . 
I 7 HOH 160 760 174 HOH HOH A . 
I 7 HOH 161 761 175 HOH HOH A . 
I 7 HOH 162 762 177 HOH HOH A . 
I 7 HOH 163 763 178 HOH HOH A . 
I 7 HOH 164 764 179 HOH HOH A . 
I 7 HOH 165 765 180 HOH HOH A . 
I 7 HOH 166 766 181 HOH HOH A . 
I 7 HOH 167 767 183 HOH HOH A . 
I 7 HOH 168 768 184 HOH HOH A . 
I 7 HOH 169 769 185 HOH HOH A . 
I 7 HOH 170 770 186 HOH HOH A . 
I 7 HOH 171 771 187 HOH HOH A . 
I 7 HOH 172 772 188 HOH HOH A . 
I 7 HOH 173 773 189 HOH HOH A . 
I 7 HOH 174 774 190 HOH HOH A . 
I 7 HOH 175 775 191 HOH HOH A . 
I 7 HOH 176 776 192 HOH HOH A . 
I 7 HOH 177 777 193 HOH HOH A . 
I 7 HOH 178 778 194 HOH HOH A . 
I 7 HOH 179 779 195 HOH HOH A . 
I 7 HOH 180 780 197 HOH HOH A . 
I 7 HOH 181 781 198 HOH HOH A . 
I 7 HOH 182 782 199 HOH HOH A . 
I 7 HOH 183 783 200 HOH HOH A . 
I 7 HOH 184 784 201 HOH HOH A . 
I 7 HOH 185 785 203 HOH HOH A . 
I 7 HOH 186 786 204 HOH HOH A . 
I 7 HOH 187 787 205 HOH HOH A . 
I 7 HOH 188 788 206 HOH HOH A . 
I 7 HOH 189 789 207 HOH HOH A . 
I 7 HOH 190 790 208 HOH HOH A . 
I 7 HOH 191 791 209 HOH HOH A . 
I 7 HOH 192 792 211 HOH HOH A . 
I 7 HOH 193 793 213 HOH HOH A . 
I 7 HOH 194 794 214 HOH HOH A . 
I 7 HOH 195 795 215 HOH HOH A . 
I 7 HOH 196 796 216 HOH HOH A . 
I 7 HOH 197 797 217 HOH HOH A . 
I 7 HOH 198 798 218 HOH HOH A . 
I 7 HOH 199 799 219 HOH HOH A . 
I 7 HOH 200 800 220 HOH HOH A . 
I 7 HOH 201 801 221 HOH HOH A . 
I 7 HOH 202 802 222 HOH HOH A . 
I 7 HOH 203 803 223 HOH HOH A . 
I 7 HOH 204 804 224 HOH HOH A . 
I 7 HOH 205 805 225 HOH HOH A . 
I 7 HOH 206 806 227 HOH HOH A . 
I 7 HOH 207 807 228 HOH HOH A . 
I 7 HOH 208 808 229 HOH HOH A . 
I 7 HOH 209 809 230 HOH HOH A . 
I 7 HOH 210 810 231 HOH HOH A . 
I 7 HOH 211 811 233 HOH HOH A . 
I 7 HOH 212 812 236 HOH HOH A . 
I 7 HOH 213 813 237 HOH HOH A . 
I 7 HOH 214 814 238 HOH HOH A . 
I 7 HOH 215 815 239 HOH HOH A . 
I 7 HOH 216 816 240 HOH HOH A . 
I 7 HOH 217 817 241 HOH HOH A . 
I 7 HOH 218 818 242 HOH HOH A . 
I 7 HOH 219 819 243 HOH HOH A . 
I 7 HOH 220 820 244 HOH HOH A . 
I 7 HOH 221 821 245 HOH HOH A . 
I 7 HOH 222 822 246 HOH HOH A . 
I 7 HOH 223 823 247 HOH HOH A . 
I 7 HOH 224 824 248 HOH HOH A . 
I 7 HOH 225 825 249 HOH HOH A . 
I 7 HOH 226 826 250 HOH HOH A . 
I 7 HOH 227 827 252 HOH HOH A . 
I 7 HOH 228 828 253 HOH HOH A . 
I 7 HOH 229 829 254 HOH HOH A . 
I 7 HOH 230 830 255 HOH HOH A . 
I 7 HOH 231 831 256 HOH HOH A . 
I 7 HOH 232 832 258 HOH HOH A . 
I 7 HOH 233 833 259 HOH HOH A . 
I 7 HOH 234 834 261 HOH HOH A . 
I 7 HOH 235 835 262 HOH HOH A . 
I 7 HOH 236 836 263 HOH HOH A . 
I 7 HOH 237 837 265 HOH HOH A . 
I 7 HOH 238 838 268 HOH HOH A . 
I 7 HOH 239 839 269 HOH HOH A . 
I 7 HOH 240 840 270 HOH HOH A . 
I 7 HOH 241 841 271 HOH HOH A . 
I 7 HOH 242 842 272 HOH HOH A . 
I 7 HOH 243 843 274 HOH HOH A . 
I 7 HOH 244 844 275 HOH HOH A . 
I 7 HOH 245 845 276 HOH HOH A . 
I 7 HOH 246 846 277 HOH HOH A . 
I 7 HOH 247 847 278 HOH HOH A . 
I 7 HOH 248 848 279 HOH HOH A . 
I 7 HOH 249 849 280 HOH HOH A . 
I 7 HOH 250 850 281 HOH HOH A . 
I 7 HOH 251 851 282 HOH HOH A . 
I 7 HOH 252 852 283 HOH HOH A . 
I 7 HOH 253 853 284 HOH HOH A . 
I 7 HOH 254 854 285 HOH HOH A . 
I 7 HOH 255 855 286 HOH HOH A . 
I 7 HOH 256 856 287 HOH HOH A . 
I 7 HOH 257 857 288 HOH HOH A . 
I 7 HOH 258 858 289 HOH HOH A . 
I 7 HOH 259 859 290 HOH HOH A . 
I 7 HOH 260 860 291 HOH HOH A . 
I 7 HOH 261 861 292 HOH HOH A . 
I 7 HOH 262 862 293 HOH HOH A . 
I 7 HOH 263 863 294 HOH HOH A . 
I 7 HOH 264 864 295 HOH HOH A . 
I 7 HOH 265 865 296 HOH HOH A . 
I 7 HOH 266 866 297 HOH HOH A . 
I 7 HOH 267 867 300 HOH HOH A . 
I 7 HOH 268 868 301 HOH HOH A . 
I 7 HOH 269 869 302 HOH HOH A . 
I 7 HOH 270 870 304 HOH HOH A . 
I 7 HOH 271 871 306 HOH HOH A . 
I 7 HOH 272 872 307 HOH HOH A . 
I 7 HOH 273 873 308 HOH HOH A . 
I 7 HOH 274 874 309 HOH HOH A . 
I 7 HOH 275 875 310 HOH HOH A . 
I 7 HOH 276 876 311 HOH HOH A . 
I 7 HOH 277 877 312 HOH HOH A . 
I 7 HOH 278 878 313 HOH HOH A . 
I 7 HOH 279 879 314 HOH HOH A . 
I 7 HOH 280 880 315 HOH HOH A . 
I 7 HOH 281 881 316 HOH HOH A . 
I 7 HOH 282 882 317 HOH HOH A . 
I 7 HOH 283 883 318 HOH HOH A . 
I 7 HOH 284 884 320 HOH HOH A . 
I 7 HOH 285 885 321 HOH HOH A . 
I 7 HOH 286 886 322 HOH HOH A . 
I 7 HOH 287 887 323 HOH HOH A . 
I 7 HOH 288 888 324 HOH HOH A . 
I 7 HOH 289 889 325 HOH HOH A . 
I 7 HOH 290 890 326 HOH HOH A . 
I 7 HOH 291 891 327 HOH HOH A . 
I 7 HOH 292 892 328 HOH HOH A . 
I 7 HOH 293 893 329 HOH HOH A . 
I 7 HOH 294 894 330 HOH HOH A . 
I 7 HOH 295 895 331 HOH HOH A . 
I 7 HOH 296 896 332 HOH HOH A . 
I 7 HOH 297 897 333 HOH HOH A . 
I 7 HOH 298 898 335 HOH HOH A . 
I 7 HOH 299 899 336 HOH HOH A . 
I 7 HOH 300 900 337 HOH HOH A . 
I 7 HOH 301 901 338 HOH HOH A . 
I 7 HOH 302 902 339 HOH HOH A . 
I 7 HOH 303 903 340 HOH HOH A . 
I 7 HOH 304 904 341 HOH HOH A . 
I 7 HOH 305 905 342 HOH HOH A . 
I 7 HOH 306 906 343 HOH HOH A . 
I 7 HOH 307 907 344 HOH HOH A . 
I 7 HOH 308 908 345 HOH HOH A . 
I 7 HOH 309 909 346 HOH HOH A . 
I 7 HOH 310 910 347 HOH HOH A . 
I 7 HOH 311 911 348 HOH HOH A . 
I 7 HOH 312 912 349 HOH HOH A . 
I 7 HOH 313 913 351 HOH HOH A . 
I 7 HOH 314 914 352 HOH HOH A . 
I 7 HOH 315 915 353 HOH HOH A . 
I 7 HOH 316 916 356 HOH HOH A . 
I 7 HOH 317 917 359 HOH HOH A . 
I 7 HOH 318 918 360 HOH HOH A . 
I 7 HOH 319 919 362 HOH HOH A . 
I 7 HOH 320 920 363 HOH HOH A . 
I 7 HOH 321 921 364 HOH HOH A . 
I 7 HOH 322 922 365 HOH HOH A . 
I 7 HOH 323 923 366 HOH HOH A . 
I 7 HOH 324 924 367 HOH HOH A . 
I 7 HOH 325 925 368 HOH HOH A . 
I 7 HOH 326 926 369 HOH HOH A . 
I 7 HOH 327 927 370 HOH HOH A . 
I 7 HOH 328 928 372 HOH HOH A . 
I 7 HOH 329 929 373 HOH HOH A . 
I 7 HOH 330 930 375 HOH HOH A . 
I 7 HOH 331 931 377 HOH HOH A . 
I 7 HOH 332 932 378 HOH HOH A . 
I 7 HOH 333 933 380 HOH HOH A . 
I 7 HOH 334 934 381 HOH HOH A . 
I 7 HOH 335 935 382 HOH HOH A . 
I 7 HOH 336 936 384 HOH HOH A . 
I 7 HOH 337 937 386 HOH HOH A . 
I 7 HOH 338 938 387 HOH HOH A . 
I 7 HOH 339 939 388 HOH HOH A . 
I 7 HOH 340 940 389 HOH HOH A . 
I 7 HOH 341 941 390 HOH HOH A . 
I 7 HOH 342 942 391 HOH HOH A . 
I 7 HOH 343 943 392 HOH HOH A . 
I 7 HOH 344 944 394 HOH HOH A . 
I 7 HOH 345 945 395 HOH HOH A . 
I 7 HOH 346 946 396 HOH HOH A . 
I 7 HOH 347 947 397 HOH HOH A . 
I 7 HOH 348 948 398 HOH HOH A . 
I 7 HOH 349 949 399 HOH HOH A . 
I 7 HOH 350 950 400 HOH HOH A . 
I 7 HOH 351 951 401 HOH HOH A . 
I 7 HOH 352 952 402 HOH HOH A . 
I 7 HOH 353 953 404 HOH HOH A . 
I 7 HOH 354 954 405 HOH HOH A . 
I 7 HOH 355 955 406 HOH HOH A . 
I 7 HOH 356 956 407 HOH HOH A . 
I 7 HOH 357 957 408 HOH HOH A . 
I 7 HOH 358 958 411 HOH HOH A . 
I 7 HOH 359 959 412 HOH HOH A . 
I 7 HOH 360 960 413 HOH HOH A . 
I 7 HOH 361 961 414 HOH HOH A . 
I 7 HOH 362 962 415 HOH HOH A . 
I 7 HOH 363 963 416 HOH HOH A . 
J 7 HOH 1   101 35  HOH HOH T . 
J 7 HOH 2   102 63  HOH HOH T . 
J 7 HOH 3   103 104 HOH HOH T . 
J 7 HOH 4   104 105 HOH HOH T . 
J 7 HOH 5   105 107 HOH HOH T . 
J 7 HOH 6   106 123 HOH HOH T . 
J 7 HOH 7   107 150 HOH HOH T . 
J 7 HOH 8   108 160 HOH HOH T . 
J 7 HOH 9   109 210 HOH HOH T . 
J 7 HOH 10  110 212 HOH HOH T . 
J 7 HOH 11  111 226 HOH HOH T . 
J 7 HOH 12  112 232 HOH HOH T . 
J 7 HOH 13  113 234 HOH HOH T . 
J 7 HOH 14  114 235 HOH HOH T . 
J 7 HOH 15  115 260 HOH HOH T . 
J 7 HOH 16  116 267 HOH HOH T . 
J 7 HOH 17  117 298 HOH HOH T . 
J 7 HOH 18  118 299 HOH HOH T . 
J 7 HOH 19  119 334 HOH HOH T . 
J 7 HOH 20  120 350 HOH HOH T . 
J 7 HOH 21  121 355 HOH HOH T . 
J 7 HOH 22  122 357 HOH HOH T . 
J 7 HOH 23  123 358 HOH HOH T . 
J 7 HOH 24  124 361 HOH HOH T . 
J 7 HOH 25  125 371 HOH HOH T . 
J 7 HOH 26  126 374 HOH HOH T . 
J 7 HOH 27  127 376 HOH HOH T . 
J 7 HOH 28  128 403 HOH HOH T . 
J 7 HOH 29  129 417 HOH HOH T . 
K 7 HOH 1   201 34  HOH HOH P . 
K 7 HOH 2   202 40  HOH HOH P . 
K 7 HOH 3   203 90  HOH HOH P . 
K 7 HOH 4   204 95  HOH HOH P . 
K 7 HOH 5   205 112 HOH HOH P . 
K 7 HOH 6   206 148 HOH HOH P . 
K 7 HOH 7   207 176 HOH HOH P . 
K 7 HOH 8   208 182 HOH HOH P . 
K 7 HOH 9   209 196 HOH HOH P . 
K 7 HOH 10  210 202 HOH HOH P . 
K 7 HOH 11  211 251 HOH HOH P . 
K 7 HOH 12  212 257 HOH HOH P . 
K 7 HOH 13  213 264 HOH HOH P . 
K 7 HOH 14  214 266 HOH HOH P . 
K 7 HOH 15  215 273 HOH HOH P . 
K 7 HOH 16  216 303 HOH HOH P . 
K 7 HOH 17  217 305 HOH HOH P . 
K 7 HOH 18  218 319 HOH HOH P . 
K 7 HOH 19  219 354 HOH HOH P . 
K 7 HOH 20  220 379 HOH HOH P . 
K 7 HOH 21  221 383 HOH HOH P . 
K 7 HOH 22  222 385 HOH HOH P . 
K 7 HOH 23  223 393 HOH HOH P . 
K 7 HOH 24  224 410 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5580  ? 
1 MORE         -46   ? 
1 'SSA (A^2)'  22040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O1B ? H DTP .   ? P DTP 101 ? 1_555 88.6  ? 
2  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O3G ? H DTP .   ? P DTP 101 ? 1_555 95.3  ? 
3  O1B ? H DTP .   ? P DTP 101 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O3G ? H DTP .   ? P DTP 101 ? 1_555 75.0  ? 
4  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 81.9  ? 
5  O1B ? H DTP .   ? P DTP 101 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 87.4  ? 
6  O3G ? H DTP .   ? P DTP 101 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 162.2 ? 
7  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 101 ? 1_555 168.6 ? 
8  O1B ? H DTP .   ? P DTP 101 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 101 ? 1_555 80.0  ? 
9  O3G ? H DTP .   ? P DTP 101 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 101 ? 1_555 82.1  ? 
10 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 O2A ? H DTP .   ? P DTP 101 ? 1_555 97.1  ? 
11 O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 92.4  ? 
12 O1B ? H DTP .   ? P DTP 101 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 176.1 ? 
13 O3G ? H DTP .   ? P DTP 101 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 108.7 ? 
14 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 89.0  ? 
15 O2A ? H DTP .   ? P DTP 101 ? 1_555 CA ? D CA . ? A CA 501 ? 1_555 OD2 ? A ASP 16  ? A ASP 13  ? 1_555 99.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" P DA 7 ? B "C4'" P DA 7 ? B "C3'" P DA 7 ? B 101.71 104.50 -2.79 0.40 N 
2 1 "O4'" P DA 7 ? B "C1'" P DA 7 ? B N9    P DA 7 ? ? 110.79 108.30 2.49  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 22.10   66.29   
2 1 TYR A 39  ? ? 65.29   164.72  
3 1 LYS A 40  ? ? -142.91 -23.99  
4 1 SER A 62  ? ? 81.78   -17.16  
5 1 ILE A 180 ? ? -66.71  1.46    
6 1 SER A 217 ? ? -155.20 -157.04 
7 1 SER A 257 ? ? 96.75   -12.50  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ECY 'double helix'        
4ECY 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 6  1_555 C DA 7 1_555 -0.148 -0.046 0.246  -1.256 -17.942 3.370  1 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.118 -0.092 -0.391 -9.558 -3.010  0.509  2 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.067  -0.137 -0.087 3.361  -1.761  -0.533 3 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.402  -0.145 -0.314 10.045 -7.906  3.174  4 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.505 -0.077 -0.270 -6.669 -7.027  3.318  5 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.147  -0.073 0.367  -6.796 -2.640  2.176  6 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.266 -0.134 -0.231 21.548 -0.817  8.723  7 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.203 -1.154 3.497 6.965  10.204 30.397 -3.823 1.573  2.858 18.528 
-12.647 32.757 1 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.696 -0.411 3.102 -1.827 2.919  33.908 -1.142 0.912  3.089 4.988  3.122 
34.077 2 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.410  -0.626 3.295 1.765  0.908  31.311 -1.330 -0.423 3.294 1.680  -3.267 
31.372 3 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.484 -0.466 3.845 -4.146 5.428  33.005 -1.842 0.043  3.754 9.429  7.202 
33.685 4 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.422 -0.612 3.449 -5.322 0.244  37.242 -0.984 -0.081 3.470 0.379  8.282 
37.607 5 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.479  -0.103 2.794 0.585  1.129  25.428 -0.510 -0.943 2.797 2.563  -1.327 
25.459 6 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                       CA  
5 GLYCEROL                            GOL 
6 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
7 water                               HOH 
#