data_4ED0
# 
_entry.id   4ED0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ED0         
NDB   NA1710       
RCSB  RCSB071462   
WWPDB D_1000071462 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ED0 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ED0 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ED0 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ?                                     ? 
4 non-polymer syn 'SODIUM ION'                                         22.990    1   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 water       nat water                                                18.015    550 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ED0       4ED0   2 ? ? ? 
3 PDB 4ED0       4ED0   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ED0 A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ED0 T 1 ? 12  ? 4ED0   1 ? 12  ? 1 12  
3 3 4ED0 P 1 ? 8   ? 4ED0   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ED0 GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ED0 PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ED0 HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
NA  non-polymer         . 'SODIUM ION'                         ?                               'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ED0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ED0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.65 
_reflns.number_obs                   54218 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.068 
_reflns.pdbx_netI_over_sigmaI        17.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.65 
_reflns_shell.d_res_low                   1.68 
_reflns_shell.percent_possible_all        92.0 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.433 
_reflns_shell.meanI_over_sigI_obs         1.8 
_reflns_shell.pdbx_redundancy             2.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ED0 
_refine.ls_number_reflns_obs                     51821 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.06 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.517 
_refine.ls_d_res_high                            1.653 
_refine.ls_percent_reflns_obs                    94.80 
_refine.ls_R_factor_obs                          0.1714 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1695 
_refine.ls_R_factor_R_free                       0.2079 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  2621 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               21.2084 
_refine.aniso_B[1][1]                            0.4814 
_refine.aniso_B[2][2]                            0.4814 
_refine.aniso_B[3][3]                            -0.9629 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.336 
_refine.solvent_model_param_bsol                 36.811 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_FOM_work_R_set                   0.8769 
_refine.B_iso_max                                84.810 
_refine.B_iso_min                                4.030 
_refine.pdbx_overall_phase_error                 20.0100 
_refine.occupancy_max                            1.200 
_refine.occupancy_min                            0.300 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             550 
_refine_hist.number_atoms_total               4353 
_refine_hist.d_res_high                       1.653 
_refine_hist.d_res_low                        28.517 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.007  ? ? 4004 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.146  ? ? 5497 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 18.234 ? ? 1581 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.070  ? ? 614  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 632  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
'X-RAY DIFFRACTION' . 1.6528 1.6828  2114 0.2333 78.00  0.2554 . . 120 . . . . 
'X-RAY DIFFRACTION' . 1.6828 1.7152  2375 0.2216 86.00  0.2626 . . 113 . . . . 
'X-RAY DIFFRACTION' . 1.7152 1.7502  2344 0.2037 88.00  0.2577 . . 137 . . . . 
'X-RAY DIFFRACTION' . 1.7502 1.7882  2496 0.1860 91.00  0.2207 . . 152 . . . . 
'X-RAY DIFFRACTION' . 1.7882 1.8298  2491 0.1847 91.00  0.2629 . . 145 . . . . 
'X-RAY DIFFRACTION' . 1.8298 1.8756  2511 0.1833 93.00  0.2468 . . 130 . . . . 
'X-RAY DIFFRACTION' . 1.8756 1.9263  2525 0.1770 93.00  0.2410 . . 147 . . . . 
'X-RAY DIFFRACTION' . 1.9263 1.9829  2627 0.1722 96.00  0.2161 . . 122 . . . . 
'X-RAY DIFFRACTION' . 1.9829 2.0469  2608 0.1718 96.00  0.2244 . . 142 . . . . 
'X-RAY DIFFRACTION' . 2.0469 2.1201  2632 0.1681 97.00  0.2100 . . 153 . . . . 
'X-RAY DIFFRACTION' . 2.1201 2.2049  2677 0.1634 98.00  0.1971 . . 129 . . . . 
'X-RAY DIFFRACTION' . 2.2049 2.3052  2680 0.1599 98.00  0.2174 . . 151 . . . . 
'X-RAY DIFFRACTION' . 2.3052 2.4267  2689 0.1713 98.00  0.2048 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.4267 2.5787  2717 0.1787 99.00  0.2161 . . 122 . . . . 
'X-RAY DIFFRACTION' . 2.5787 2.7776  2703 0.1820 99.00  0.2245 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.7776 3.0568  2742 0.1785 99.00  0.2199 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.0568 3.4985  2730 0.1560 100.00 0.1830 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.4985 4.4051  2766 0.1361 100.00 0.1643 . . 134 . . . . 
'X-RAY DIFFRACTION' . 4.4051 28.5213 2773 0.1584 99.00  0.1787 . . 156 . . . . 
# 
_struct.entry_id                  4ED0 
_struct.title                     'Human DNA polymerase eta - DNA ternary complex: AT crystal at pH 6.8 (Na+ MES) with 1 Ca2+ ion' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ED0 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D NA  . NA  B ? A ASP 115 A NA  501 1_555 ? ? ? ? ? ? ?            2.242 ? 
metalc2  metalc ? ? A GLU 119 OE1   B ? ? 1_555 D NA  . NA  B ? A GLU 116 A NA  501 1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc3  metalc ? ? I DTP .   O1B   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc4  metalc ? ? I DTP .   O3G   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.344 ? 
metalc5  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  ? ? A MET 14  A CA  503 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc6  metalc ? ? I DTP .   O2A   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc7  metalc ? ? A ASP 16  OD2   B ? ? 1_555 D NA  . NA  B ? A ASP 13  A NA  501 1_555 ? ? ? ? ? ? ?            2.368 ? 
metalc8  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA  ? ? A ASP 115 A CA  503 1_555 ? ? ? ? ? ? ?            2.370 ? 
metalc9  metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D NA  . NA  B ? P DT  8   A NA  501 1_555 ? ? ? ? ? ? ?            2.419 ? 
metalc10 metalc ? ? D NA  .   NA    B ? ? 1_555 I DTP . O2A ? ? A NA  501 P DTP 502 1_555 ? ? ? ? ? ? ?            2.508 ? 
metalc11 metalc ? ? A ASP 16  OD2   A ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.552 ? 
metalc12 metalc ? ? A ASP 16  OD2   B ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.571 ? 
metalc13 metalc ? ? A ASP 16  OD1   B ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.619 ? 
metalc14 metalc ? ? D NA  .   NA    B ? ? 1_555 J HOH . O   ? ? A NA  501 A HOH 939 1_555 ? ? ? ? ? ? ?            3.149 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -0.44 
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -0.42 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -6.99 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O LEU A 422 ? O LEU A 419 N LEU A 334 ? N LEU A 331 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NA A 501'  
AC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE DTP P 502' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 503'  
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 504' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 505' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 16  ? ASP A 13   . ? 1_555 ? 
2  AC1 7  SER A 116 ? SER A 113  . ? 1_555 ? 
3  AC1 7  ASP A 118 ? ASP A 115  . ? 1_555 ? 
4  AC1 7  GLU A 119 ? GLU A 116  . ? 1_555 ? 
5  AC1 7  CA  E .   ? CA  A 503  . ? 1_555 ? 
6  AC1 7  DT  C 8   ? DT  P 8    . ? 1_555 ? 
7  AC1 7  DTP I .   ? DTP P 502  . ? 1_555 ? 
8  AC2 27 ASP A 16  ? ASP A 13   . ? 1_555 ? 
9  AC2 27 MET A 17  ? MET A 14   . ? 1_555 ? 
10 AC2 27 ASP A 18  ? ASP A 15   . ? 1_555 ? 
11 AC2 27 CYS A 19  ? CYS A 16   . ? 1_555 ? 
12 AC2 27 PHE A 20  ? PHE A 17   . ? 1_555 ? 
13 AC2 27 PHE A 21  ? PHE A 18   . ? 1_555 ? 
14 AC2 27 ILE A 51  ? ILE A 48   . ? 1_555 ? 
15 AC2 27 ALA A 52  ? ALA A 49   . ? 1_555 ? 
16 AC2 27 TYR A 55  ? TYR A 52   . ? 1_555 ? 
17 AC2 27 ARG A 58  ? ARG A 55   . ? 1_555 ? 
18 AC2 27 ARG A 64  ? ARG A 61   . ? 1_555 ? 
19 AC2 27 ASP A 118 ? ASP A 115  . ? 1_555 ? 
20 AC2 27 LYS A 234 ? LYS A 231  . ? 1_555 ? 
21 AC2 27 NA  D .   ? NA  A 501  . ? 1_555 ? 
22 AC2 27 CA  E .   ? CA  A 503  . ? 1_555 ? 
23 AC2 27 HOH J .   ? HOH A 606  . ? 1_555 ? 
24 AC2 27 HOH J .   ? HOH A 623  . ? 1_555 ? 
25 AC2 27 HOH J .   ? HOH A 652  . ? 1_555 ? 
26 AC2 27 HOH J .   ? HOH A 707  . ? 1_555 ? 
27 AC2 27 HOH J .   ? HOH A 792  . ? 1_555 ? 
28 AC2 27 HOH J .   ? HOH A 939  . ? 1_555 ? 
29 AC2 27 HOH J .   ? HOH A 1033 . ? 1_555 ? 
30 AC2 27 DT  C 8   ? DT  P 8    . ? 1_555 ? 
31 AC2 27 HOH L .   ? HOH P 101  . ? 1_555 ? 
32 AC2 27 HOH L .   ? HOH P 111  . ? 1_555 ? 
33 AC2 27 DT  B 4   ? DT  T 4    . ? 1_555 ? 
34 AC2 27 DA  B 5   ? DA  T 5    . ? 1_555 ? 
35 AC3 5  ASP A 16  ? ASP A 13   . ? 1_555 ? 
36 AC3 5  MET A 17  ? MET A 14   . ? 1_555 ? 
37 AC3 5  ASP A 118 ? ASP A 115  . ? 1_555 ? 
38 AC3 5  NA  D .   ? NA  A 501  . ? 1_555 ? 
39 AC3 5  DTP I .   ? DTP P 502  . ? 1_555 ? 
40 AC4 10 ARG A 27  ? ARG A 24   . ? 6_545 ? 
41 AC4 10 PRO A 247 ? PRO A 244  . ? 1_555 ? 
42 AC4 10 PHE A 250 ? PHE A 247  . ? 1_555 ? 
43 AC4 10 SER A 251 ? SER A 248  . ? 1_555 ? 
44 AC4 10 GLY A 279 ? GLY A 276  . ? 1_555 ? 
45 AC4 10 GLU A 280 ? GLU A 277  . ? 1_555 ? 
46 AC4 10 HOH J .   ? HOH A 601  . ? 1_555 ? 
47 AC4 10 HOH J .   ? HOH A 624  . ? 1_555 ? 
48 AC4 10 HOH J .   ? HOH A 663  . ? 1_555 ? 
49 AC4 10 HOH J .   ? HOH A 693  . ? 1_555 ? 
50 AC5 9  GLU A 97  ? GLU A 94   . ? 1_555 ? 
51 AC5 9  ALA A 98  ? ALA A 95   . ? 1_555 ? 
52 AC5 9  GLU A 101 ? GLU A 98   . ? 1_555 ? 
53 AC5 9  ARG A 306 ? ARG A 303  . ? 5_664 ? 
54 AC5 9  HOH J .   ? HOH A 637  . ? 1_555 ? 
55 AC5 9  HOH J .   ? HOH A 639  . ? 1_555 ? 
56 AC5 9  HOH J .   ? HOH A 762  . ? 1_555 ? 
57 AC5 9  HOH J .   ? HOH A 812  . ? 5_664 ? 
58 AC5 9  HOH J .   ? HOH A 814  . ? 5_664 ? 
59 AC6 10 ASN A 29  ? ASN A 26   . ? 1_555 ? 
60 AC6 10 PRO A 30  ? PRO A 27   . ? 1_555 ? 
61 AC6 10 HIS A 31  ? HIS A 28   . ? 1_555 ? 
62 AC6 10 GLY A 274 ? GLY A 271  . ? 5_664 ? 
63 AC6 10 GLU A 276 ? GLU A 273  . ? 5_664 ? 
64 AC6 10 TYR A 277 ? TYR A 274  . ? 5_664 ? 
65 AC6 10 GLU A 280 ? GLU A 277  . ? 5_664 ? 
66 AC6 10 HOH J .   ? HOH A 745  . ? 1_555 ? 
67 AC6 10 HOH J .   ? HOH A 833  . ? 5_664 ? 
68 AC6 10 HOH J .   ? HOH A 959  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ED0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ED0 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.886 -34.233 -3.465  1.00 41.72 ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.293 -34.060 -3.782  1.00 43.05 ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.553 -33.108 -4.938  1.00 37.35 ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.203 -31.930 -4.868  1.00 41.90 ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.172 -33.620 -6.014  1.00 37.64 ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.583 -32.847 -7.196  1.00 40.49 ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.420 -32.303 -8.033  1.00 42.89 ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.624 -31.375 -8.822  1.00 46.02 ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.395 -33.862 -8.011  1.00 39.97 ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.882 -35.193 -7.577  1.00 40.50 ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.562 -35.037 -6.121  1.00 38.14 ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.227 -32.866 -7.865  1.00 33.59 ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.054 -32.423 -8.618  1.00 35.75 ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.113 -31.580 -7.761  1.00 38.31 ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.027 -31.200 -8.203  1.00 36.72 ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.305 -33.628 -9.189  1.00 30.14 ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.203 -34.626 -9.847  1.00 30.18 ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.886 -34.357 -11.012 1.00 26.58 ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.544 -35.888 -9.491  1.00 29.73 ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.607 -35.412 -11.352 1.00 26.04 ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.416 -36.353 -10.447 1.00 26.95 ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.538 -31.292 -6.535  1.00 38.36 ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.721 -30.520 -5.607  1.00 43.96 ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.965 -29.022 -5.784  1.00 41.31 ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 65.014 -28.503 -5.400  1.00 37.25 ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 64.003 -30.938 -4.162  1.00 44.46 ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.862 -30.632 -3.200  1.00 57.00 ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.374 -31.594 -3.566  1.00 63.83 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.878 -33.225 -3.016  1.00 52.33 ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.992 -28.335 -6.375  1.00 43.70 ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.101 -26.896 -6.602  1.00 38.43 ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.186 -26.141 -5.280  1.00 32.66 ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.605 -26.555 -4.275  1.00 33.84 ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.937 -26.396 -7.435  1.00 38.83 ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.918 -25.032 -5.288  1.00 21.18 ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.204 -24.300 -4.059  1.00 17.93 ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.703 -22.859 -4.114  1.00 17.70 ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.922 -22.085 -3.182  1.00 21.54 ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.708 -24.315 -3.753  1.00 23.45 ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.424 -23.704 -4.834  1.00 20.12 ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.188 -25.751 -3.584  1.00 24.69 ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.031 -22.515 -5.210  1.00 20.51 ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.439 -21.195 -5.359  1.00 17.83 ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.479 -20.091 -5.333  1.00 21.26 ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.246 -19.043 -4.731  1.00 18.23 ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.619 -20.326 -5.985  1.00 16.25 ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.741 -19.377 -5.976  1.00 11.58 ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.062 -18.804 -7.364  1.00 14.57 ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.152 -18.288 -7.591  1.00 14.66 ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.995 -20.044 -5.391  1.00 14.78 ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.978 -20.205 -3.876  1.00 17.26 ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.157 -21.016 -3.372  1.00 13.56 ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.278 -22.204 -3.677  1.00 21.70 ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 69.037 -20.380 -2.608  1.00 18.04 ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.086 -18.881 -8.263  1.00 17.34 ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.241 -18.528 -9.675  1.00 18.14 ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.212 -17.024 -9.986  1.00 18.59 ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.715 -16.598 -11.028 1.00 20.12 ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.135 -19.210 -10.497 1.00 19.59 ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.743 -19.035 -9.878  1.00 26.06 ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.537 -19.437 -8.709  1.00 25.57 ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.841 -18.489 -10.560 1.00 32.81 ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.601 -16.235 -9.108  1.00 15.05 ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.439 -14.791 -9.327  1.00 15.81 ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.058 -13.954 -8.208  1.00 13.02 ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.275 -14.442 -7.095  1.00 10.77 ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.944 -14.423 -9.391  1.00 10.15 ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.138 -15.042 -10.518 1.00 13.73 ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.658 -14.656 -10.358 1.00 12.29 ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.035 -15.303 -9.193  1.00 13.68 ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.947 -14.856 -8.573  1.00 11.61 ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.448 -15.521 -7.532  1.00 11.22 ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.350 -13.740 -8.984  1.00 11.66 ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.323 -12.680 -8.494  1.00 8.97  ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.609 -11.708 -7.443  1.00 5.33  ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.463 -10.696 -7.467  1.00 10.53 ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.196 -10.085 -8.507  1.00 12.46 ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.951 -10.980 -7.633  1.00 8.56  ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.191 -10.002 -6.479  1.00 10.20 ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.098 -11.973 -7.732  1.00 13.72 ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.773 -10.544 -6.336  1.00 7.19  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.589 -9.689  -6.273  1.00 9.10  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.771 -8.734  -5.110  1.00 11.01 ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.218 -9.129  -4.033  1.00 8.54  ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.295 -10.516 -6.063  1.00 7.94  ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.086 -9.613  -5.794  1.00 11.19 ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.032 -11.442 -7.260  1.00 8.66  ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.451 -7.463  -5.317  1.00 7.18  ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.507 -6.531  -4.203  1.00 6.06  ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.150 -5.906  -3.994  1.00 8.12  ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.338 -5.841  -4.916  1.00 11.06 ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.567 -5.445  -4.426  1.00 9.32  ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.906 -5.464  -2.767  1.00 5.37  ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.734 -4.666  -2.464  1.00 6.67  ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.219 -3.365  -1.833  1.00 11.58 ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.936 -3.375  -0.824  1.00 9.57  ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.783 -5.434  -1.547  1.00 10.55 ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.444 -4.840  -1.089  1.00 11.00 ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.640 -3.846  0.062   1.00 11.43 ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.685 -4.165  -2.246  1.00 10.08 ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.864 -2.247  -2.460  1.00 8.03  ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.258 -0.937  -1.963  1.00 10.95 ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 59.017 -0.261  -1.406  1.00 12.48 ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.983 -0.206  -2.071  1.00 12.28 ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.884 -0.082  -3.079  1.00 8.89  ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.243 1.308   -2.552  1.00 10.94 ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 62.121 -0.780  -3.645  1.00 14.48 ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.117 0.223   -0.171  1.00 10.22 ? 13   ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 57.974 0.792   0.531   0.40 12.32 ? 13   ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 57.972 0.814   0.512   0.60 12.35 ? 13   ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.353 2.108   1.217   1.00 10.52 ? 13   ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.255 2.135   2.045   1.00 10.81 ? 13   ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.468 -0.232  1.548   0.40 11.22 ? 13   ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.392 -0.160  1.528   0.60 11.20 ? 13   ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.556 0.371   2.579   0.40 13.59 ? 13   ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.353 0.488   2.400   0.60 12.97 ? 13   ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 55.399 -0.080  2.682   0.40 19.29 ? 13   ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 56.624 0.686   3.598   0.60 18.24 ? 13   ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 57.005 1.273   3.310   0.40 13.34 ? 13   ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 55.276 0.826   1.877   0.60 12.32 ? 13   ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.648 3.197   0.900   1.00 8.36  ? 14   MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 58.002 4.498   1.472   1.00 7.33  ? 14   MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.768 4.519   2.981   1.00 9.63  ? 14   MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.802 3.957   3.457   1.00 9.64  ? 14   MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.217 5.643   0.816   1.00 10.72 ? 14   MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.288 5.662   -0.707  1.00 9.73  ? 14   MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.972 5.616   -1.351  1.00 14.03 ? 14   MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.577 7.200   -0.907  1.00 16.43 ? 14   MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.645 5.166   3.738   1.00 8.73  ? 15   ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.404 5.284   5.181   1.00 7.77  ? 15   ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.314 6.327   5.446   1.00 9.65  ? 15   ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.301 7.390   4.804   1.00 7.33  ? 15   ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.683 5.664   5.927   1.00 8.09  ? 15   ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.811 4.645   5.729   1.00 8.46  ? 15   ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.525 3.441   5.578   1.00 12.00 ? 15   ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 61.979 5.056   5.769   1.00 12.66 ? 15   ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.415 6.012   6.378   1.00 7.75  ? 16   CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.313 6.910   6.779   1.00 6.41  ? 16   CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.945 7.891   5.665   1.00 6.93  ? 16   CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.109 9.106   5.807   1.00 7.78  ? 16   CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.641 7.640   8.104   1.00 8.81  ? 16   CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.189 8.565   8.189   1.00 10.40 ? 16   CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.446 7.348   4.557   1.00 7.27  ? 17   PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.423 8.103   3.303   1.00 6.30  ? 17   PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.700 9.452   3.344   1.00 5.99  ? 17   PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.291 10.469  2.971   1.00 6.82  ? 17   PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.894 7.234   2.156   1.00 5.66  ? 17   PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 53.957 7.898   0.812   1.00 7.42  ? 17   PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.124 8.517   0.370   1.00 8.88  ? 17   PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.843 7.900   -0.013  1.00 10.52 ? 17   PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.166 9.125   -0.895  1.00 8.84  ? 17   PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.876 8.508   -1.264  1.00 11.42 ? 17   PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 54.035 9.108   -1.705  1.00 11.40 ? 17   PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.440 9.483   3.786   1.00 5.71  ? 18   PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.718 10.745  3.698   1.00 5.17  ? 18   PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.382 11.785  4.600   1.00 8.63  ? 18   PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.357 12.985  4.311   1.00 6.62  ? 18   PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.234 10.611  4.066   1.00 4.75  ? 18   PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.399 9.877   3.056   1.00 8.54  ? 18   PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 49.965 9.136   2.025   1.00 7.62  ? 18   PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 48.021 9.941   3.147   1.00 9.42  ? 18   PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.163 8.471   1.108   1.00 10.00 ? 18   PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.208 9.283   2.234   1.00 11.50 ? 18   PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.781 8.538   1.218   1.00 11.02 ? 18   PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.971 11.326  5.703   1.00 6.12  ? 19   VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.699 12.242  6.590   1.00 6.21  ? 19   VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.908 12.855  5.887   1.00 7.34  ? 19   VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.151 14.065  5.982   1.00 6.98  ? 19   VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.147 11.540  7.877   1.00 4.49  ? 19   VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.213 12.380  8.590   1.00 7.74  ? 19   VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.931 11.303  8.782   1.00 7.60  ? 19   VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.677 12.023  5.184   1.00 7.42  ? 20   GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.823 12.552  4.441   1.00 5.25  ? 20   GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.407 13.559  3.375   1.00 6.01  ? 20   GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.121 14.537  3.146   1.00 8.10  ? 20   GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.609 11.444  3.767   1.00 6.72  ? 20   GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.482 10.647  4.707   1.00 9.66  ? 20   GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.575 9.946   3.937   1.00 9.55  ? 20   GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.640 10.518  3.714   1.00 11.10 ? 20   GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.322 8.700   3.528   1.00 9.84  ? 20   GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.290 13.292  2.699   1.00 4.89  ? 21   VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.780 14.220  1.684   1.00 4.28  ? 21   VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.515 15.573  2.348   1.00 9.23  ? 21   VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.909 16.624  1.821   1.00 8.43  ? 21   VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.493 13.706  0.986   1.00 6.84  ? 21   VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.938 14.770  0.024   1.00 8.88  ? 21   VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.777 12.420  0.208   1.00 6.12  ? 21   VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.876 15.546  3.516   1.00 6.64  ? 22   GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.579 16.800  4.222   1.00 6.73  ? 22   GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.825 17.460  4.810   1.00 6.79  ? 22   GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.896 18.682  4.893   1.00 7.57  ? 22   GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.507 16.593  5.315   1.00 4.03  ? 22   GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.165 16.107  4.793   1.00 6.31  ? 22   GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.427 17.146  3.954   1.00 11.26 ? 22   GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.695 18.354  4.122   1.00 12.15 ? 22   GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.566 16.747  3.136   1.00 12.45 ? 22   GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.809 16.659  5.227   1.00 6.65  ? 23   GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.020 17.219  5.820   1.00 6.09  ? 23   GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.901 17.861  4.753   1.00 7.14  ? 23   GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.558 18.873  5.009   1.00 7.72  ? 23   GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.810 16.139  6.565   1.00 7.42  ? 23   GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.168 15.679  7.870   1.00 7.52  ? 23   GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.932 14.516  8.495   1.00 6.42  ? 23   GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.404 13.629  7.784   1.00 10.82 ? 23   GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.083 14.533  9.821   1.00 9.80  ? 23   GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.895 17.290  3.549   1.00 5.82  ? 24   ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.627 17.907  2.445   1.00 7.40  ? 24   ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.074 19.306  2.182   1.00 12.52 ? 24   ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.833 20.254  1.998   1.00 9.39  ? 24   ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.545 17.064  1.168   1.00 7.75  ? 24   ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.395 17.669  0.025   1.00 10.33 ? 24   ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.412 16.802  -1.233  1.00 8.80  ? 24   ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.118 16.743  -1.891  1.00 7.89  ? 24   ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 57.910 16.123  -3.047  1.00 9.02  ? 24   ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 58.917 15.501  -3.665  1.00 6.86  ? 24   ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.699 16.116  -3.584  1.00 10.45 ? 24   ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.746 19.413  2.177   1.00 7.33  ? 25   GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.059 20.660  1.852   1.00 8.50  ? 25   GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.236 21.697  2.940   1.00 8.93  ? 25   GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.396 22.889  2.660   1.00 8.44  ? 25   GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.566 20.399  1.639   1.00 9.41  ? 25   GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.785 21.644  1.205   1.00 8.93  ? 25   GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.310 21.345  0.980   1.00 16.08 ? 25   GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 51.961 20.307  0.433   1.00 15.37 ? 25   GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.446 22.252  1.414   1.00 24.25 ? 25   GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.164 21.239  4.184   1.00 7.69  ? 26   ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.227 22.113  5.353   1.00 9.77  ? 26   ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.387 21.733  6.274   1.00 8.70  ? 26   ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.265 20.848  7.116   1.00 7.96  ? 26   ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.894 22.088  6.124   1.00 10.37 ? 26   ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.895 23.036  7.336   1.00 11.20 ? 26   ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 55.901 23.674  7.639   1.00 9.71  ? 26   ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.754 23.140  8.008   1.00 13.77 ? 26   ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.533 22.402  6.108   1.00 9.13  ? 27   PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.732 22.074  6.886   1.00 8.07  ? 27   PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.524 22.139  8.406   1.00 9.99  ? 27   PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.270 21.491  9.136   1.00 9.49  ? 27   PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.737 23.141  6.445   1.00 13.02 ? 27   PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.263 23.538  5.059   1.00 8.80  ? 27   PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.776 23.472  5.118   1.00 10.45 ? 27   PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.536 22.891  8.874   1.00 10.16 ? 28   HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.267 22.950  10.317  1.00 15.92 ? 28   HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.851 21.594  10.870  1.00 12.33 ? 28   HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 57.928 21.357  12.083  1.00 14.20 ? 28   HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.165 23.961  10.626  1.00 14.63 ? 28   HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.628 25.385  10.626  1.00 17.86 ? 28   HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 56.894 26.403  10.054  1.00 25.06 ? 28   HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.739 25.962  11.140  1.00 17.69 ? 28   HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.536 27.548  10.212  1.00 20.13 ? 28   HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.660 27.308  10.865  1.00 22.67 ? 28   HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.397 20.698  10.000  1.00 10.31 ? 29   LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 56.975 19.371  10.464  1.00 12.30 ? 29   LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.111 18.340  10.478  1.00 10.94 ? 29   LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 57.938 17.236  10.991  1.00 8.74  ? 29   LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.819 18.841  9.602   1.00 7.66  ? 29   LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.554 19.698  9.564   1.00 10.33 ? 29   LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.555 19.158  8.540   1.00 8.76  ? 29   LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 53.940 19.775  10.959  1.00 12.31 ? 29   LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.271 18.695  9.922   1.00 9.24  ? 30   ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.370 17.738  9.765   1.00 8.84  ? 30   ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 60.970 17.360  11.111  1.00 10.18 ? 30   ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.117 18.211  11.975  1.00 12.00 ? 30   ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.459 18.312  8.846   1.00 9.53  ? 30   ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 60.945 18.614  7.433   1.00 8.16  ? 30   ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 61.982 19.227  6.532   1.00 11.53 ? 30   ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.434 19.513  5.206   1.00 11.88 ? 30   ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.150 20.011  4.202   1.00 15.95 ? 30   ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.441 20.268  4.378   1.00 15.12 ? 30   ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.576 20.247  3.029   1.00 11.55 ? 30   ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.303 16.081  11.274  1.00 12.76 ? 31   ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.944 15.586  12.494  1.00 12.61 ? 31   ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.134 15.868  13.758  1.00 15.11 ? 31   ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.696 16.185  14.812  1.00 19.07 ? 31   ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.347 16.181  12.647  1.00 17.97 ? 31   ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.226 15.920  11.438  1.00 21.26 ? 31   ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.394 14.777  11.005  1.00 29.69 ? 31   ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.771 16.987  10.870  1.00 24.29 ? 31   ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.817 15.752  13.640  1.00 9.36  ? 32   LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.893 16.017  14.733  1.00 12.73 ? 32   LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.932 14.851  14.833  1.00 12.49 ? 32   LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.712 14.152  13.852  1.00 10.88 ? 32   LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.066 17.279  14.453  1.00 12.79 ? 32   LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 58.890 18.560  14.368  1.00 16.89 ? 32   LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 59.282 19.044  15.736  1.00 26.58 ? 32   LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 59.975 20.400  15.660  1.00 32.11 ? 32   LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 59.995 21.035  17.009  1.00 29.90 ? 32   LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.352 14.648  16.023  1.00 13.13 ? 33   PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.187 13.772  16.149  1.00 9.57  ? 33   PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.043 14.453  15.396  1.00 8.60  ? 33   PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.625 15.569  15.720  1.00 10.19 ? 33   PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.924 13.738  17.659  1.00 13.10 ? 33   PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.501 15.002  18.173  1.00 16.50 ? 33   PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.681 15.328  17.288  1.00 14.82 ? 33   PRO A CD    1 
ATOM   294  N  N     . CYS A 1 37  ? 54.574 13.794  14.349  1.00 9.01  ? 34   CYS A N     1 
ATOM   295  C  CA    A CYS A 1 37  ? 53.491 14.368  13.578  0.50 10.45 ? 34   CYS A CA    1 
ATOM   296  C  CA    B CYS A 1 37  ? 53.616 14.380  13.418  0.50 10.53 ? 34   CYS A CA    1 
ATOM   297  C  C     . CYS A 1 37  ? 52.688 13.280  12.889  1.00 8.40  ? 34   CYS A C     1 
ATOM   298  O  O     . CYS A 1 37  ? 53.111 12.127  12.789  1.00 8.93  ? 34   CYS A O     1 
ATOM   299  C  CB    A CYS A 1 37  ? 54.018 15.405  12.584  0.50 12.00 ? 34   CYS A CB    1 
ATOM   300  C  CB    B CYS A 1 37  ? 54.407 15.042  12.273  0.50 13.05 ? 34   CYS A CB    1 
ATOM   301  S  SG    A CYS A 1 37  ? 55.096 14.723  11.327  0.50 7.51  ? 34   CYS A SG    1 
ATOM   302  S  SG    B CYS A 1 37  ? 53.473 15.767  10.891  0.50 14.84 ? 34   CYS A SG    1 
ATOM   303  N  N     . ALA A 1 38  ? 51.467 13.636  12.498  1.00 8.31  ? 35   ALA A N     1 
ATOM   304  C  CA    . ALA A 1 38  ? 50.560 12.677  11.876  1.00 7.87  ? 35   ALA A CA    1 
ATOM   305  C  C     . ALA A 1 38  ? 49.751 13.408  10.838  1.00 8.79  ? 35   ALA A C     1 
ATOM   306  O  O     . ALA A 1 38  ? 49.641 14.639  10.896  1.00 8.40  ? 35   ALA A O     1 
ATOM   307  C  CB    . ALA A 1 38  ? 49.638 12.076  12.904  1.00 7.86  ? 35   ALA A CB    1 
ATOM   308  N  N     . VAL A 1 39  ? 49.180 12.646  9.907   1.00 7.89  ? 36   VAL A N     1 
ATOM   309  C  CA    . VAL A 1 39  ? 48.267 13.186  8.906   1.00 8.49  ? 36   VAL A CA    1 
ATOM   310  C  C     . VAL A 1 39  ? 46.871 12.724  9.275   1.00 9.41  ? 36   VAL A C     1 
ATOM   311  O  O     . VAL A 1 39  ? 46.670 11.551  9.631   1.00 10.43 ? 36   VAL A O     1 
ATOM   312  C  CB    . VAL A 1 39  ? 48.636 12.691  7.501   1.00 8.31  ? 36   VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 39  ? 47.576 13.125  6.474   1.00 7.48  ? 36   VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 39  ? 50.037 13.181  7.126   1.00 10.37 ? 36   VAL A CG2   1 
ATOM   315  N  N     . VAL A 1 40  ? 45.917 13.654  9.219   1.00 8.80  ? 37   VAL A N     1 
ATOM   316  C  CA    . VAL A 1 40  ? 44.562 13.415  9.695   1.00 9.73  ? 37   VAL A CA    1 
ATOM   317  C  C     . VAL A 1 40  ? 43.567 13.774  8.602   1.00 12.01 ? 37   VAL A C     1 
ATOM   318  O  O     . VAL A 1 40  ? 43.850 14.626  7.752   1.00 12.50 ? 37   VAL A O     1 
ATOM   319  C  CB    . VAL A 1 40  ? 44.253 14.283  10.963  1.00 13.06 ? 37   VAL A CB    1 
ATOM   320  C  CG1   A VAL A 1 40  ? 45.077 13.819  12.145  0.50 10.32 ? 37   VAL A CG1   1 
ATOM   321  C  CG1   B VAL A 1 40  ? 44.098 15.750  10.596  0.50 13.72 ? 37   VAL A CG1   1 
ATOM   322  C  CG2   A VAL A 1 40  ? 44.493 15.762  10.679  0.50 13.44 ? 37   VAL A CG2   1 
ATOM   323  C  CG2   B VAL A 1 40  ? 43.024 13.783  11.660  0.50 13.20 ? 37   VAL A CG2   1 
ATOM   324  N  N     . GLN A 1 41  ? 42.408 13.130  8.613   1.00 12.43 ? 38   GLN A N     1 
ATOM   325  C  CA    . GLN A 1 41  ? 41.338 13.535  7.702   1.00 10.46 ? 38   GLN A CA    1 
ATOM   326  C  C     . GLN A 1 41  ? 40.110 13.942  8.481   1.00 11.31 ? 38   GLN A C     1 
ATOM   327  O  O     . GLN A 1 41  ? 39.739 13.289  9.460   1.00 9.80  ? 38   GLN A O     1 
ATOM   328  C  CB    . GLN A 1 41  ? 41.030 12.467  6.646   1.00 13.56 ? 38   GLN A CB    1 
ATOM   329  C  CG    . GLN A 1 41  ? 40.731 11.097  7.173   1.00 19.55 ? 38   GLN A CG    1 
ATOM   330  C  CD    . GLN A 1 41  ? 40.744 10.032  6.074   1.00 19.45 ? 38   GLN A CD    1 
ATOM   331  O  OE1   . GLN A 1 41  ? 41.133 10.288  4.926   1.00 20.55 ? 38   GLN A OE1   1 
ATOM   332  N  NE2   . GLN A 1 41  ? 40.305 8.837   6.427   1.00 21.88 ? 38   GLN A NE2   1 
ATOM   333  N  N     . TYR A 1 42  ? 39.499 15.039  8.034   1.00 16.27 ? 39   TYR A N     1 
ATOM   334  C  CA    . TYR A 1 42  ? 38.386 15.673  8.735   1.00 12.20 ? 39   TYR A CA    1 
ATOM   335  C  C     . TYR A 1 42  ? 38.923 16.206  10.076  1.00 20.84 ? 39   TYR A C     1 
ATOM   336  O  O     . TYR A 1 42  ? 40.119 16.085  10.349  1.00 21.98 ? 39   TYR A O     1 
ATOM   337  C  CB    . TYR A 1 42  ? 37.186 14.727  8.826   1.00 12.70 ? 39   TYR A CB    1 
ATOM   338  C  CG    . TYR A 1 42  ? 36.798 14.202  7.443   1.00 9.20  ? 39   TYR A CG    1 
ATOM   339  C  CD1   . TYR A 1 42  ? 36.390 15.074  6.445   1.00 16.08 ? 39   TYR A CD1   1 
ATOM   340  C  CD2   . TYR A 1 42  ? 36.888 12.841  7.129   1.00 12.25 ? 39   TYR A CD2   1 
ATOM   341  C  CE1   . TYR A 1 42  ? 36.053 14.617  5.175   1.00 17.74 ? 39   TYR A CE1   1 
ATOM   342  C  CE2   . TYR A 1 42  ? 36.553 12.368  5.850   1.00 11.75 ? 39   TYR A CE2   1 
ATOM   343  C  CZ    . TYR A 1 42  ? 36.131 13.267  4.884   1.00 11.92 ? 39   TYR A CZ    1 
ATOM   344  O  OH    . TYR A 1 42  ? 35.774 12.827  3.624   1.00 13.38 ? 39   TYR A OH    1 
ATOM   345  N  N     . LYS A 1 43  ? 38.091 16.843  10.882  1.00 22.79 ? 40   LYS A N     1 
ATOM   346  C  CA    . LYS A 1 43  ? 38.624 17.551  12.052  1.00 19.89 ? 40   LYS A CA    1 
ATOM   347  C  C     . LYS A 1 43  ? 37.552 17.734  13.107  1.00 26.16 ? 40   LYS A C     1 
ATOM   348  O  O     . LYS A 1 43  ? 37.839 17.755  14.304  1.00 22.96 ? 40   LYS A O     1 
ATOM   349  C  CB    . LYS A 1 43  ? 39.196 18.916  11.640  1.00 22.46 ? 40   LYS A CB    1 
ATOM   350  C  CG    . LYS A 1 43  ? 40.248 19.498  12.595  1.00 33.24 ? 40   LYS A CG    1 
ATOM   351  C  CD    . LYS A 1 43  ? 41.663 19.051  12.207  1.00 31.19 ? 40   LYS A CD    1 
ATOM   352  C  CE    . LYS A 1 43  ? 42.716 19.566  13.182  1.00 31.16 ? 40   LYS A CE    1 
ATOM   353  N  NZ    . LYS A 1 43  ? 42.736 18.822  14.478  1.00 32.89 ? 40   LYS A NZ    1 
ATOM   354  N  N     . SER A 1 44  ? 36.311 17.853  12.650  1.00 18.80 ? 41   SER A N     1 
ATOM   355  C  CA    . SER A 1 44  ? 35.177 18.072  13.531  1.00 23.43 ? 41   SER A CA    1 
ATOM   356  C  C     . SER A 1 44  ? 34.927 16.930  14.511  1.00 25.26 ? 41   SER A C     1 
ATOM   357  O  O     . SER A 1 44  ? 34.671 17.170  15.689  1.00 29.79 ? 41   SER A O     1 
ATOM   358  C  CB    . SER A 1 44  ? 33.922 18.330  12.698  1.00 33.72 ? 41   SER A CB    1 
ATOM   359  O  OG    . SER A 1 44  ? 34.134 19.427  11.829  1.00 40.36 ? 41   SER A OG    1 
ATOM   360  N  N     . TRP A 1 45  ? 34.993 15.690  14.030  1.00 24.62 ? 42   TRP A N     1 
ATOM   361  C  CA    . TRP A 1 45  ? 34.767 14.536  14.892  1.00 22.99 ? 42   TRP A CA    1 
ATOM   362  C  C     . TRP A 1 45  ? 36.079 14.097  15.539  1.00 19.32 ? 42   TRP A C     1 
ATOM   363  O  O     . TRP A 1 45  ? 36.938 13.496  14.885  1.00 18.30 ? 42   TRP A O     1 
ATOM   364  C  CB    . TRP A 1 45  ? 34.132 13.375  14.113  1.00 26.99 ? 42   TRP A CB    1 
ATOM   365  C  CG    . TRP A 1 45  ? 33.656 12.230  14.988  1.00 25.07 ? 42   TRP A CG    1 
ATOM   366  C  CD1   . TRP A 1 45  ? 34.355 11.107  15.322  1.00 27.75 ? 42   TRP A CD1   1 
ATOM   367  C  CD2   . TRP A 1 45  ? 32.378 12.109  15.627  1.00 27.30 ? 42   TRP A CD2   1 
ATOM   368  N  NE1   . TRP A 1 45  ? 33.597 10.297  16.131  1.00 30.95 ? 42   TRP A NE1   1 
ATOM   369  C  CE2   . TRP A 1 45  ? 32.378 10.889  16.334  1.00 31.00 ? 42   TRP A CE2   1 
ATOM   370  C  CE3   . TRP A 1 45  ? 31.233 12.913  15.668  1.00 32.80 ? 42   TRP A CE3   1 
ATOM   371  C  CZ2   . TRP A 1 45  ? 31.280 10.454  17.074  1.00 30.70 ? 42   TRP A CZ2   1 
ATOM   372  C  CZ3   . TRP A 1 45  ? 30.141 12.478  16.404  1.00 31.54 ? 42   TRP A CZ3   1 
ATOM   373  C  CH2   . TRP A 1 45  ? 30.171 11.258  17.095  1.00 32.04 ? 42   TRP A CH2   1 
ATOM   374  N  N     . LYS A 1 46  ? 36.221 14.449  16.817  1.00 25.97 ? 43   LYS A N     1 
ATOM   375  C  CA    . LYS A 1 46  ? 37.331 14.018  17.673  1.00 21.69 ? 43   LYS A CA    1 
ATOM   376  C  C     . LYS A 1 46  ? 38.711 14.406  17.155  1.00 17.18 ? 43   LYS A C     1 
ATOM   377  O  O     . LYS A 1 46  ? 39.701 13.717  17.422  1.00 18.83 ? 43   LYS A O     1 
ATOM   378  C  CB    . LYS A 1 46  ? 37.246 12.513  17.945  1.00 22.06 ? 43   LYS A CB    1 
ATOM   379  C  CG    . LYS A 1 46  ? 35.939 12.100  18.612  1.00 27.55 ? 43   LYS A CG    1 
ATOM   380  C  CD    . LYS A 1 46  ? 35.846 10.604  18.817  1.00 28.74 ? 43   LYS A CD    1 
ATOM   381  C  CE    . LYS A 1 46  ? 34.566 10.253  19.562  1.00 41.58 ? 43   LYS A CE    1 
ATOM   382  N  NZ    . LYS A 1 46  ? 34.478 8.802   19.870  1.00 45.06 ? 43   LYS A NZ    1 
ATOM   383  N  N     . GLY A 1 47  ? 38.773 15.518  16.429  1.00 15.42 ? 44   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 47  ? 40.024 16.098  15.987  1.00 15.33 ? 44   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 47  ? 40.488 15.553  14.654  1.00 12.64 ? 44   GLY A C     1 
ATOM   386  O  O     . GLY A 1 47  ? 41.517 15.959  14.139  1.00 15.36 ? 44   GLY A O     1 
ATOM   387  N  N     . GLY A 1 48  ? 39.719 14.612  14.120  1.00 16.32 ? 45   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 48  ? 40.008 14.001  12.837  1.00 15.91 ? 45   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 48  ? 40.626 12.627  13.021  1.00 15.02 ? 45   GLY A C     1 
ATOM   390  O  O     . GLY A 1 48  ? 41.170 12.311  14.075  1.00 13.89 ? 45   GLY A O     1 
ATOM   391  N  N     . GLY A 1 49  ? 40.569 11.814  11.976  1.00 11.14 ? 46   GLY A N     1 
ATOM   392  C  CA    . GLY A 1 49  ? 41.085 10.466  12.063  1.00 9.27  ? 46   GLY A CA    1 
ATOM   393  C  C     . GLY A 1 49  ? 42.486 10.397  11.502  1.00 12.60 ? 46   GLY A C     1 
ATOM   394  O  O     . GLY A 1 49  ? 42.736 10.895  10.412  1.00 11.99 ? 46   GLY A O     1 
ATOM   395  N  N     . ILE A 1 50  ? 43.397 9.775   12.243  1.00 10.32 ? 47   ILE A N     1 
ATOM   396  C  CA    . ILE A 1 50  ? 44.796 9.673   11.813  1.00 8.36  ? 47   ILE A CA    1 
ATOM   397  C  C     . ILE A 1 50  ? 44.994 8.590   10.750  1.00 11.41 ? 47   ILE A C     1 
ATOM   398  O  O     . ILE A 1 50  ? 44.540 7.460   10.924  1.00 11.12 ? 47   ILE A O     1 
ATOM   399  C  CB    . ILE A 1 50  ? 45.702 9.381   13.024  1.00 9.38  ? 47   ILE A CB    1 
ATOM   400  C  CG1   . ILE A 1 50  ? 45.749 10.596  13.945  1.00 16.77 ? 47   ILE A CG1   1 
ATOM   401  C  CG2   . ILE A 1 50  ? 47.119 8.980   12.580  1.00 7.79  ? 47   ILE A CG2   1 
ATOM   402  C  CD1   . ILE A 1 50  ? 46.563 10.354  15.201  1.00 17.84 ? 47   ILE A CD1   1 
ATOM   403  N  N     . ILE A 1 51  ? 45.666 8.935   9.650   1.00 6.83  ? 48   ILE A N     1 
ATOM   404  C  CA    . ILE A 1 51  ? 45.925 7.946   8.603   1.00 8.39  ? 48   ILE A CA    1 
ATOM   405  C  C     . ILE A 1 51  ? 47.410 7.649   8.380   1.00 8.49  ? 48   ILE A C     1 
ATOM   406  O  O     . ILE A 1 51  ? 47.744 6.690   7.689   1.00 9.86  ? 48   ILE A O     1 
ATOM   407  C  CB    . ILE A 1 51  ? 45.228 8.287   7.266   1.00 13.93 ? 48   ILE A CB    1 
ATOM   408  C  CG1   . ILE A 1 51  ? 45.675 9.647   6.720   1.00 8.45  ? 48   ILE A CG1   1 
ATOM   409  C  CG2   . ILE A 1 51  ? 43.706 8.248   7.434   1.00 17.15 ? 48   ILE A CG2   1 
ATOM   410  C  CD1   . ILE A 1 51  ? 45.152 9.908   5.305   1.00 12.95 ? 48   ILE A CD1   1 
ATOM   411  N  N     . ALA A 1 52  ? 48.286 8.467   8.961   1.00 8.58  ? 49   ALA A N     1 
ATOM   412  C  CA    . ALA A 1 52  ? 49.743 8.239   8.857   1.00 4.90  ? 49   ALA A CA    1 
ATOM   413  C  C     . ALA A 1 52  ? 50.456 8.898   10.036  1.00 8.30  ? 49   ALA A C     1 
ATOM   414  O  O     . ALA A 1 52  ? 50.015 9.946   10.514  1.00 7.05  ? 49   ALA A O     1 
ATOM   415  C  CB    . ALA A 1 52  ? 50.291 8.785   7.507   1.00 6.24  ? 49   ALA A CB    1 
ATOM   416  N  N     . VAL A 1 53  ? 51.546 8.280   10.507  1.00 6.26  ? 50   VAL A N     1 
ATOM   417  C  CA    . VAL A 1 53  ? 52.191 8.677   11.762  1.00 6.34  ? 50   VAL A CA    1 
ATOM   418  C  C     . VAL A 1 53  ? 53.713 8.645   11.627  1.00 7.96  ? 50   VAL A C     1 
ATOM   419  O  O     . VAL A 1 53  ? 54.275 7.630   11.202  1.00 7.75  ? 50   VAL A O     1 
ATOM   420  C  CB    . VAL A 1 53  ? 51.779 7.688   12.887  1.00 6.11  ? 50   VAL A CB    1 
ATOM   421  C  CG1   . VAL A 1 53  ? 52.315 8.132   14.233  1.00 10.77 ? 50   VAL A CG1   1 
ATOM   422  C  CG2   . VAL A 1 53  ? 50.268 7.529   12.934  1.00 8.95  ? 50   VAL A CG2   1 
ATOM   423  N  N     . SER A 1 54  ? 54.387 9.735   11.985  1.00 6.76  ? 51   SER A N     1 
ATOM   424  C  CA    . SER A 1 54  ? 55.845 9.774   11.911  1.00 6.38  ? 51   SER A CA    1 
ATOM   425  C  C     . SER A 1 54  ? 56.433 8.842   12.972  1.00 8.14  ? 51   SER A C     1 
ATOM   426  O  O     . SER A 1 54  ? 55.794 8.559   13.991  1.00 8.69  ? 51   SER A O     1 
ATOM   427  C  CB    . SER A 1 54  ? 56.379 11.195  12.104  1.00 8.89  ? 51   SER A CB    1 
ATOM   428  O  OG    . SER A 1 54  ? 56.423 11.531  13.489  1.00 8.06  ? 51   SER A OG    1 
ATOM   429  N  N     . TYR A 1 55  ? 57.652 8.379   12.735  1.00 8.33  ? 52   TYR A N     1 
ATOM   430  C  CA    . TYR A 1 55  ? 58.283 7.462   13.677  1.00 8.79  ? 52   TYR A CA    1 
ATOM   431  C  C     . TYR A 1 55  ? 58.495 8.073   15.064  1.00 11.11 ? 52   TYR A C     1 
ATOM   432  O  O     . TYR A 1 55  ? 58.376 7.375   16.072  1.00 11.34 ? 52   TYR A O     1 
ATOM   433  C  CB    . TYR A 1 55  ? 59.565 6.872   13.077  1.00 9.40  ? 52   TYR A CB    1 
ATOM   434  C  CG    . TYR A 1 55  ? 59.235 5.784   12.082  1.00 10.26 ? 52   TYR A CG    1 
ATOM   435  C  CD1   . TYR A 1 55  ? 58.850 6.101   10.787  1.00 8.49  ? 52   TYR A CD1   1 
ATOM   436  C  CD2   . TYR A 1 55  ? 59.243 4.452   12.450  1.00 13.14 ? 52   TYR A CD2   1 
ATOM   437  C  CE1   . TYR A 1 55  ? 58.499 5.110   9.877   1.00 11.76 ? 52   TYR A CE1   1 
ATOM   438  C  CE2   . TYR A 1 55  ? 58.903 3.450   11.553  1.00 12.99 ? 52   TYR A CE2   1 
ATOM   439  C  CZ    . TYR A 1 55  ? 58.528 3.778   10.270  1.00 12.08 ? 52   TYR A CZ    1 
ATOM   440  O  OH    . TYR A 1 55  ? 58.192 2.760   9.393   1.00 12.90 ? 52   TYR A OH    1 
ATOM   441  N  N     . GLU A 1 56  ? 58.768 9.373   15.113  1.00 12.44 ? 53   GLU A N     1 
ATOM   442  C  CA    . GLU A 1 56  ? 58.851 10.066  16.391  1.00 11.75 ? 53   GLU A CA    1 
ATOM   443  C  C     . GLU A 1 56  ? 57.527 9.992   17.146  1.00 11.62 ? 53   GLU A C     1 
ATOM   444  O  O     . GLU A 1 56  ? 57.527 9.826   18.358  1.00 11.37 ? 53   GLU A O     1 
ATOM   445  C  CB    . GLU A 1 56  ? 59.263 11.529  16.200  1.00 11.41 ? 53   GLU A CB    1 
ATOM   446  C  CG    . GLU A 1 56  ? 60.629 11.714  15.551  1.00 17.81 ? 53   GLU A CG    1 
ATOM   447  C  CD    . GLU A 1 56  ? 60.632 11.713  14.014  1.00 26.91 ? 53   GLU A CD    1 
ATOM   448  O  OE1   . GLU A 1 56  ? 59.704 11.169  13.357  1.00 17.72 ? 53   GLU A OE1   1 
ATOM   449  O  OE2   . GLU A 1 56  ? 61.601 12.268  13.455  1.00 27.57 ? 53   GLU A OE2   1 
ATOM   450  N  N     . ALA A 1 57  ? 56.400 10.148  16.442  1.00 8.43  ? 54   ALA A N     1 
ATOM   451  C  CA    . ALA A 1 57  ? 55.086 10.033  17.079  1.00 9.03  ? 54   ALA A CA    1 
ATOM   452  C  C     . ALA A 1 57  ? 54.758 8.593   17.491  1.00 8.52  ? 54   ALA A C     1 
ATOM   453  O  O     . ALA A 1 57  ? 54.092 8.375   18.502  1.00 10.05 ? 54   ALA A O     1 
ATOM   454  C  CB    . ALA A 1 57  ? 53.956 10.614  16.158  1.00 9.04  ? 54   ALA A CB    1 
ATOM   455  N  N     . ARG A 1 58  ? 55.224 7.611   16.719  1.00 10.22 ? 55   ARG A N     1 
ATOM   456  C  CA    . ARG A 1 58  ? 54.962 6.206   17.064  1.00 9.33  ? 55   ARG A CA    1 
ATOM   457  C  C     . ARG A 1 58  ? 55.580 5.848   18.414  1.00 14.20 ? 55   ARG A C     1 
ATOM   458  O  O     . ARG A 1 58  ? 55.056 5.007   19.137  1.00 11.71 ? 55   ARG A O     1 
ATOM   459  C  CB    . ARG A 1 58  ? 55.495 5.260   15.987  1.00 10.35 ? 55   ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 58  ? 54.857 5.501   14.630  1.00 9.94  ? 55   ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 58  ? 55.305 4.512   13.583  1.00 9.75  ? 55   ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 58  ? 54.907 4.997   12.260  1.00 10.41 ? 55   ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 58  ? 54.959 4.284   11.148  1.00 11.51 ? 55   ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 58  ? 55.397 3.034   11.187  1.00 10.70 ? 55   ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 58  ? 54.571 4.838   9.993   1.00 10.93 ? 55   ARG A NH2   1 
ATOM   466  N  N     . ALA A 1 59  ? 56.688 6.504   18.746  1.00 10.75 ? 56   ALA A N     1 
ATOM   467  C  CA    . ALA A 1 59  ? 57.359 6.265   20.031  1.00 12.35 ? 56   ALA A CA    1 
ATOM   468  C  C     . ALA A 1 59  ? 56.465 6.583   21.232  1.00 15.98 ? 56   ALA A C     1 
ATOM   469  O  O     . ALA A 1 59  ? 56.635 6.009   22.320  1.00 15.78 ? 56   ALA A O     1 
ATOM   470  C  CB    . ALA A 1 59  ? 58.674 7.036   20.106  1.00 12.86 ? 56   ALA A CB    1 
ATOM   471  N  N     . PHE A 1 60  ? 55.506 7.486   21.039  1.00 10.63 ? 57   PHE A N     1 
ATOM   472  C  CA    . PHE A 1 60  ? 54.536 7.828   22.075  1.00 12.04 ? 57   PHE A CA    1 
ATOM   473  C  C     . PHE A 1 60  ? 53.307 6.922   22.091  1.00 12.78 ? 57   PHE A C     1 
ATOM   474  O  O     . PHE A 1 60  ? 52.467 7.034   22.983  1.00 15.48 ? 57   PHE A O     1 
ATOM   475  C  CB    . PHE A 1 60  ? 54.068 9.270   21.905  1.00 11.16 ? 57   PHE A CB    1 
ATOM   476  C  CG    . PHE A 1 60  ? 55.122 10.301  22.201  1.00 10.65 ? 57   PHE A CG    1 
ATOM   477  C  CD1   . PHE A 1 60  ? 55.160 10.931  23.433  1.00 16.89 ? 57   PHE A CD1   1 
ATOM   478  C  CD2   . PHE A 1 60  ? 56.049 10.665  21.237  1.00 12.39 ? 57   PHE A CD2   1 
ATOM   479  C  CE1   . PHE A 1 60  ? 56.108 11.899  23.714  1.00 21.56 ? 57   PHE A CE1   1 
ATOM   480  C  CE2   . PHE A 1 60  ? 57.006 11.644  21.506  1.00 13.59 ? 57   PHE A CE2   1 
ATOM   481  C  CZ    . PHE A 1 60  ? 57.035 12.258  22.750  1.00 22.36 ? 57   PHE A CZ    1 
ATOM   482  N  N     . GLY A 1 61  ? 53.188 6.042   21.100  1.00 10.53 ? 58   GLY A N     1 
ATOM   483  C  CA    . GLY A 1 61  ? 52.056 5.134   20.995  1.00 14.48 ? 58   GLY A CA    1 
ATOM   484  C  C     . GLY A 1 61  ? 50.965 5.584   20.040  1.00 12.60 ? 58   GLY A C     1 
ATOM   485  O  O     . GLY A 1 61  ? 49.878 5.001   19.993  1.00 10.66 ? 58   GLY A O     1 
ATOM   486  N  N     . VAL A 1 62  ? 51.252 6.631   19.273  1.00 10.32 ? 59   VAL A N     1 
ATOM   487  C  CA    . VAL A 1 62  ? 50.305 7.131   18.288  1.00 10.04 ? 59   VAL A CA    1 
ATOM   488  C  C     . VAL A 1 62  ? 50.223 6.143   17.131  1.00 10.69 ? 59   VAL A C     1 
ATOM   489  O  O     . VAL A 1 62  ? 51.255 5.690   16.629  1.00 11.43 ? 59   VAL A O     1 
ATOM   490  C  CB    . VAL A 1 62  ? 50.719 8.533   17.768  1.00 8.08  ? 59   VAL A CB    1 
ATOM   491  C  CG1   . VAL A 1 62  ? 49.728 9.014   16.722  1.00 13.20 ? 59   VAL A CG1   1 
ATOM   492  C  CG2   . VAL A 1 62  ? 50.765 9.531   18.917  1.00 10.69 ? 59   VAL A CG2   1 
ATOM   493  N  N     . THR A 1 63  ? 48.998 5.810   16.714  1.00 11.17 ? 60   THR A N     1 
ATOM   494  C  CA    . THR A 1 63  ? 48.797 4.844   15.633  1.00 12.03 ? 60   THR A CA    1 
ATOM   495  C  C     . THR A 1 63  ? 47.744 5.280   14.635  1.00 14.32 ? 60   THR A C     1 
ATOM   496  O  O     . THR A 1 63  ? 46.932 6.157   14.909  1.00 12.76 ? 60   THR A O     1 
ATOM   497  C  CB    . THR A 1 63  ? 48.353 3.481   16.180  1.00 13.77 ? 60   THR A CB    1 
ATOM   498  O  OG1   . THR A 1 63  ? 47.064 3.613   16.794  1.00 18.61 ? 60   THR A OG1   1 
ATOM   499  C  CG2   . THR A 1 63  ? 49.350 2.983   17.209  1.00 14.91 ? 60   THR A CG2   1 
ATOM   500  N  N     . ARG A 1 64  ? 47.763 4.651   13.465  1.00 11.54 ? 61   ARG A N     1 
ATOM   501  C  CA    . ARG A 1 64  ? 46.692 4.815   12.493  1.00 11.93 ? 61   ARG A CA    1 
ATOM   502  C  C     . ARG A 1 64  ? 45.358 4.442   13.132  1.00 14.30 ? 61   ARG A C     1 
ATOM   503  O  O     . ARG A 1 64  ? 45.303 3.587   14.015  1.00 15.90 ? 61   ARG A O     1 
ATOM   504  C  CB    . ARG A 1 64  ? 46.964 3.930   11.267  1.00 12.09 ? 61   ARG A CB    1 
ATOM   505  C  CG    . ARG A 1 64  ? 45.838 3.860   10.267  1.00 20.36 ? 61   ARG A CG    1 
ATOM   506  C  CD    . ARG A 1 64  ? 46.318 3.132   9.017   1.00 21.04 ? 61   ARG A CD    1 
ATOM   507  N  NE    . ARG A 1 64  ? 47.397 3.882   8.394   1.00 15.03 ? 61   ARG A NE    1 
ATOM   508  C  CZ    . ARG A 1 64  ? 48.579 3.386   8.036   1.00 19.28 ? 61   ARG A CZ    1 
ATOM   509  N  NH1   . ARG A 1 64  ? 48.854 2.100   8.207   1.00 24.92 ? 61   ARG A NH1   1 
ATOM   510  N  NH2   . ARG A 1 64  ? 49.478 4.187   7.471   1.00 13.93 ? 61   ARG A NH2   1 
ATOM   511  N  N     . SER A 1 65  ? 44.294 5.106   12.686  1.00 14.71 ? 62   SER A N     1 
ATOM   512  C  CA    . SER A 1 65  ? 42.923 4.858   13.145  1.00 22.08 ? 62   SER A CA    1 
ATOM   513  C  C     . SER A 1 65  ? 42.567 5.556   14.460  1.00 22.44 ? 62   SER A C     1 
ATOM   514  O  O     . SER A 1 65  ? 41.402 5.632   14.837  1.00 32.23 ? 62   SER A O     1 
ATOM   515  C  CB    . SER A 1 65  ? 42.627 3.361   13.249  1.00 24.39 ? 62   SER A CB    1 
ATOM   516  O  OG    . SER A 1 65  ? 42.695 2.930   14.597  1.00 36.68 ? 62   SER A OG    1 
ATOM   517  N  N     . MET A 1 66  ? 43.575 6.054   15.156  1.00 18.13 ? 63   MET A N     1 
ATOM   518  C  CA    . MET A 1 66  ? 43.357 6.815   16.375  1.00 14.50 ? 63   MET A CA    1 
ATOM   519  C  C     . MET A 1 66  ? 42.716 8.153   16.009  1.00 15.84 ? 63   MET A C     1 
ATOM   520  O  O     . MET A 1 66  ? 43.065 8.739   14.982  1.00 16.07 ? 63   MET A O     1 
ATOM   521  C  CB    . MET A 1 66  ? 44.717 7.047   17.018  1.00 17.21 ? 63   MET A CB    1 
ATOM   522  C  CG    . MET A 1 66  ? 44.744 7.292   18.481  1.00 26.17 ? 63   MET A CG    1 
ATOM   523  S  SD    . MET A 1 66  ? 46.450 7.014   19.001  1.00 19.25 ? 63   MET A SD    1 
ATOM   524  C  CE    . MET A 1 66  ? 46.367 5.367   19.687  1.00 17.62 ? 63   MET A CE    1 
ATOM   525  N  N     . TRP A 1 67  ? 41.783 8.637   16.833  1.00 11.96 ? 64   TRP A N     1 
ATOM   526  C  CA    . TRP A 1 67  ? 41.303 10.019  16.702  1.00 13.46 ? 64   TRP A CA    1 
ATOM   527  C  C     . TRP A 1 67  ? 42.385 10.982  17.185  1.00 10.78 ? 64   TRP A C     1 
ATOM   528  O  O     . TRP A 1 67  ? 43.048 10.711  18.175  1.00 13.31 ? 64   TRP A O     1 
ATOM   529  C  CB    . TRP A 1 67  ? 40.025 10.253  17.508  1.00 15.06 ? 64   TRP A CB    1 
ATOM   530  C  CG    . TRP A 1 67  ? 38.898 9.384   17.083  1.00 15.18 ? 64   TRP A CG    1 
ATOM   531  C  CD1   . TRP A 1 67  ? 38.286 8.407   17.819  1.00 19.51 ? 64   TRP A CD1   1 
ATOM   532  C  CD2   . TRP A 1 67  ? 38.255 9.387   15.803  1.00 16.43 ? 64   TRP A CD2   1 
ATOM   533  N  NE1   . TRP A 1 67  ? 37.290 7.812   17.073  1.00 22.99 ? 64   TRP A NE1   1 
ATOM   534  C  CE2   . TRP A 1 67  ? 37.258 8.393   15.832  1.00 22.06 ? 64   TRP A CE2   1 
ATOM   535  C  CE3   . TRP A 1 67  ? 38.426 10.139  14.635  1.00 15.40 ? 64   TRP A CE3   1 
ATOM   536  C  CZ2   . TRP A 1 67  ? 36.431 8.132   14.737  1.00 22.87 ? 64   TRP A CZ2   1 
ATOM   537  C  CZ3   . TRP A 1 67  ? 37.605 9.879   13.552  1.00 18.15 ? 64   TRP A CZ3   1 
ATOM   538  C  CH2   . TRP A 1 67  ? 36.620 8.887   13.613  1.00 18.42 ? 64   TRP A CH2   1 
ATOM   539  N  N     . ALA A 1 68  ? 42.565 12.106  16.501  1.00 11.92 ? 65   ALA A N     1 
ATOM   540  C  CA    . ALA A 1 68  ? 43.612 13.043  16.897  1.00 12.04 ? 65   ALA A CA    1 
ATOM   541  C  C     . ALA A 1 68  ? 43.465 13.496  18.356  1.00 11.74 ? 65   ALA A C     1 
ATOM   542  O  O     . ALA A 1 68  ? 44.463 13.702  19.051  1.00 13.04 ? 65   ALA A O     1 
ATOM   543  C  CB    . ALA A 1 68  ? 43.637 14.250  15.970  1.00 14.99 ? 65   ALA A CB    1 
ATOM   544  N  N     . ASP A 1 69  ? 42.228 13.665  18.817  1.00 14.10 ? 66   ASP A N     1 
ATOM   545  C  CA    . ASP A 1 69  ? 42.024 14.101  20.201  1.00 12.24 ? 66   ASP A CA    1 
ATOM   546  C  C     . ASP A 1 69  ? 42.646 13.085  21.157  1.00 11.84 ? 66   ASP A C     1 
ATOM   547  O  O     . ASP A 1 69  ? 43.202 13.449  22.205  1.00 13.16 ? 66   ASP A O     1 
ATOM   548  C  CB    . ASP A 1 69  ? 40.544 14.273  20.524  1.00 16.80 ? 66   ASP A CB    1 
ATOM   549  C  CG    . ASP A 1 69  ? 39.948 15.526  19.906  1.00 19.94 ? 66   ASP A CG    1 
ATOM   550  O  OD1   . ASP A 1 69  ? 40.707 16.375  19.380  1.00 19.09 ? 66   ASP A OD1   1 
ATOM   551  O  OD2   . ASP A 1 69  ? 38.713 15.666  19.967  1.00 23.94 ? 66   ASP A OD2   1 
ATOM   552  N  N     . ASP A 1 70  ? 42.524 11.808  20.807  1.00 12.74 ? 67   ASP A N     1 
ATOM   553  C  CA    . ASP A 1 70  ? 43.053 10.725  21.631  1.00 14.99 ? 67   ASP A CA    1 
ATOM   554  C  C     . ASP A 1 70  ? 44.571 10.612  21.503  1.00 11.88 ? 67   ASP A C     1 
ATOM   555  O  O     . ASP A 1 70  ? 45.280 10.366  22.479  1.00 11.28 ? 67   ASP A O     1 
ATOM   556  C  CB    . ASP A 1 70  ? 42.365 9.405   21.262  1.00 13.45 ? 67   ASP A CB    1 
ATOM   557  C  CG    . ASP A 1 70  ? 40.867 9.424   21.581  1.00 20.98 ? 67   ASP A CG    1 
ATOM   558  O  OD1   . ASP A 1 70  ? 40.473 10.127  22.545  1.00 19.15 ? 67   ASP A OD1   1 
ATOM   559  O  OD2   . ASP A 1 70  ? 40.084 8.746   20.875  1.00 18.84 ? 67   ASP A OD2   1 
ATOM   560  N  N     . ALA A 1 71  ? 45.074 10.790  20.286  1.00 11.46 ? 68   ALA A N     1 
ATOM   561  C  CA    . ALA A 1 71  ? 46.512 10.807  20.061  1.00 10.21 ? 68   ALA A CA    1 
ATOM   562  C  C     . ALA A 1 71  ? 47.192 11.899  20.887  1.00 9.26  ? 68   ALA A C     1 
ATOM   563  O  O     . ALA A 1 71  ? 48.292 11.698  21.397  1.00 11.98 ? 68   ALA A O     1 
ATOM   564  C  CB    . ALA A 1 71  ? 46.829 10.993  18.567  1.00 14.08 ? 68   ALA A CB    1 
ATOM   565  N  N     . LYS A 1 72  ? 46.539 13.052  20.994  1.00 9.60  ? 69   LYS A N     1 
ATOM   566  C  CA    . LYS A 1 72  ? 47.061 14.182  21.756  1.00 11.39 ? 69   LYS A CA    1 
ATOM   567  C  C     . LYS A 1 72  ? 47.183 13.857  23.250  1.00 13.15 ? 69   LYS A C     1 
ATOM   568  O  O     . LYS A 1 72  ? 47.977 14.460  23.971  1.00 12.74 ? 69   LYS A O     1 
ATOM   569  C  CB    . LYS A 1 72  ? 46.165 15.414  21.561  1.00 12.65 ? 69   LYS A CB    1 
ATOM   570  C  CG    . LYS A 1 72  ? 46.483 16.242  20.307  1.00 18.36 ? 69   LYS A CG    1 
ATOM   571  C  CD    . LYS A 1 72  ? 47.737 17.079  20.536  1.00 17.08 ? 69   LYS A CD    1 
ATOM   572  C  CE    . LYS A 1 72  ? 47.924 18.172  19.481  1.00 22.17 ? 69   LYS A CE    1 
ATOM   573  N  NZ    . LYS A 1 72  ? 49.222 18.901  19.697  1.00 15.73 ? 69   LYS A NZ    1 
ATOM   574  N  N     . LYS A 1 73  ? 46.395 12.898  23.715  1.00 11.72 ? 70   LYS A N     1 
ATOM   575  C  CA    . LYS A 1 73  ? 46.506 12.463  25.104  1.00 11.70 ? 70   LYS A CA    1 
ATOM   576  C  C     . LYS A 1 73  ? 47.826 11.720  25.319  1.00 13.12 ? 70   LYS A C     1 
ATOM   577  O  O     . LYS A 1 73  ? 48.437 11.835  26.383  1.00 15.78 ? 70   LYS A O     1 
ATOM   578  C  CB    . LYS A 1 73  ? 45.303 11.591  25.494  1.00 7.78  ? 70   LYS A CB    1 
ATOM   579  C  CG    . LYS A 1 73  ? 43.970 12.262  25.249  1.00 11.35 ? 70   LYS A CG    1 
ATOM   580  C  CD    . LYS A 1 73  ? 42.801 11.299  25.474  1.00 14.27 ? 70   LYS A CD    1 
ATOM   581  C  CE    . LYS A 1 73  ? 41.457 12.016  25.263  1.00 16.76 ? 70   LYS A CE    1 
ATOM   582  N  NZ    . LYS A 1 73  ? 40.329 11.033  25.141  1.00 15.97 ? 70   LYS A NZ    1 
ATOM   583  N  N     . LEU A 1 74  ? 48.271 10.973  24.307  1.00 12.83 ? 71   LEU A N     1 
ATOM   584  C  CA    . LEU A 1 74  ? 49.545 10.245  24.402  1.00 11.81 ? 71   LEU A CA    1 
ATOM   585  C  C     . LEU A 1 74  ? 50.729 11.142  24.078  1.00 14.74 ? 71   LEU A C     1 
ATOM   586  O  O     . LEU A 1 74  ? 51.830 10.946  24.591  1.00 16.30 ? 71   LEU A O     1 
ATOM   587  C  CB    . LEU A 1 74  ? 49.573 9.047   23.442  1.00 8.79  ? 71   LEU A CB    1 
ATOM   588  C  CG    . LEU A 1 74  ? 48.505 7.971   23.626  1.00 14.02 ? 71   LEU A CG    1 
ATOM   589  C  CD1   . LEU A 1 74  ? 48.704 6.924   22.531  1.00 15.71 ? 71   LEU A CD1   1 
ATOM   590  C  CD2   . LEU A 1 74  ? 48.609 7.340   25.007  1.00 12.49 ? 71   LEU A CD2   1 
ATOM   591  N  N     . CYS A 1 75  ? 50.492 12.119  23.208  1.00 11.22 ? 72   CYS A N     1 
ATOM   592  C  CA    . CYS A 1 75  ? 51.558 12.941  22.672  1.00 11.84 ? 72   CYS A CA    1 
ATOM   593  C  C     . CYS A 1 75  ? 51.046 14.369  22.552  1.00 14.77 ? 72   CYS A C     1 
ATOM   594  O  O     . CYS A 1 75  ? 50.548 14.775  21.507  1.00 11.28 ? 72   CYS A O     1 
ATOM   595  C  CB    . CYS A 1 75  ? 51.967 12.384  21.310  1.00 11.33 ? 72   CYS A CB    1 
ATOM   596  S  SG    . CYS A 1 75  ? 53.338 13.264  20.535  1.00 16.39 ? 72   CYS A SG    1 
ATOM   597  N  N     . PRO A 1 76  ? 51.140 15.139  23.643  1.00 13.12 ? 73   PRO A N     1 
ATOM   598  C  CA    . PRO A 1 76  ? 50.539 16.478  23.653  1.00 14.68 ? 73   PRO A CA    1 
ATOM   599  C  C     . PRO A 1 76  ? 51.157 17.419  22.613  1.00 14.22 ? 73   PRO A C     1 
ATOM   600  O  O     . PRO A 1 76  ? 50.491 18.354  22.159  1.00 17.27 ? 73   PRO A O     1 
ATOM   601  C  CB    . PRO A 1 76  ? 50.823 16.980  25.077  1.00 16.58 ? 73   PRO A CB    1 
ATOM   602  C  CG    . PRO A 1 76  ? 50.996 15.739  25.886  1.00 19.86 ? 73   PRO A CG    1 
ATOM   603  C  CD    . PRO A 1 76  ? 51.606 14.715  24.975  1.00 18.30 ? 73   PRO A CD    1 
ATOM   604  N  N     . ASP A 1 77  ? 52.402 17.165  22.239  1.00 13.80 ? 74   ASP A N     1 
ATOM   605  C  CA    . ASP A 1 77  ? 53.097 18.031  21.285  1.00 18.21 ? 74   ASP A CA    1 
ATOM   606  C  C     . ASP A 1 77  ? 52.987 17.539  19.840  1.00 17.04 ? 74   ASP A C     1 
ATOM   607  O  O     . ASP A 1 77  ? 53.671 18.062  18.953  1.00 14.70 ? 74   ASP A O     1 
ATOM   608  C  CB    . ASP A 1 77  ? 54.575 18.170  21.650  1.00 18.87 ? 74   ASP A CB    1 
ATOM   609  C  CG    . ASP A 1 77  ? 54.790 18.951  22.937  1.00 30.98 ? 74   ASP A CG    1 
ATOM   610  O  OD1   . ASP A 1 77  ? 55.665 18.542  23.728  1.00 37.00 ? 74   ASP A OD1   1 
ATOM   611  O  OD2   . ASP A 1 77  ? 54.090 19.968  23.151  1.00 30.86 ? 74   ASP A OD2   1 
ATOM   612  N  N     . LEU A 1 78  ? 52.139 16.541  19.607  1.00 12.57 ? 75   LEU A N     1 
ATOM   613  C  CA    . LEU A 1 78  ? 51.938 16.000  18.259  1.00 8.50  ? 75   LEU A CA    1 
ATOM   614  C  C     . LEU A 1 78  ? 51.562 17.103  17.286  1.00 10.55 ? 75   LEU A C     1 
ATOM   615  O  O     . LEU A 1 78  ? 50.654 17.886  17.556  1.00 10.55 ? 75   LEU A O     1 
ATOM   616  C  CB    . LEU A 1 78  ? 50.821 14.951  18.285  1.00 11.24 ? 75   LEU A CB    1 
ATOM   617  C  CG    . LEU A 1 78  ? 50.454 14.234  16.978  1.00 7.44  ? 75   LEU A CG    1 
ATOM   618  C  CD1   . LEU A 1 78  ? 51.607 13.354  16.538  1.00 10.90 ? 75   LEU A CD1   1 
ATOM   619  C  CD2   . LEU A 1 78  ? 49.191 13.408  17.179  1.00 11.24 ? 75   LEU A CD2   1 
ATOM   620  N  N     . LEU A 1 79  ? 52.251 17.157  16.146  1.00 7.96  ? 76   LEU A N     1 
ATOM   621  C  CA    . LEU A 1 79  ? 51.880 18.099  15.100  1.00 5.88  ? 76   LEU A CA    1 
ATOM   622  C  C     . LEU A 1 79  ? 50.981 17.401  14.081  1.00 11.12 ? 76   LEU A C     1 
ATOM   623  O  O     . LEU A 1 79  ? 51.093 16.200  13.866  1.00 10.00 ? 76   LEU A O     1 
ATOM   624  C  CB    . LEU A 1 79  ? 53.118 18.696  14.418  1.00 6.16  ? 76   LEU A CB    1 
ATOM   625  C  CG    . LEU A 1 79  ? 54.071 19.434  15.368  1.00 8.01  ? 76   LEU A CG    1 
ATOM   626  C  CD1   . LEU A 1 79  ? 55.288 19.987  14.641  1.00 10.75 ? 76   LEU A CD1   1 
ATOM   627  C  CD2   . LEU A 1 79  ? 53.329 20.527  16.130  1.00 10.48 ? 76   LEU A CD2   1 
ATOM   628  N  N     . LEU A 1 80  ? 50.092 18.161  13.452  1.00 10.25 ? 77   LEU A N     1 
ATOM   629  C  CA    . LEU A 1 80  ? 49.126 17.571  12.536  1.00 12.11 ? 77   LEU A CA    1 
ATOM   630  C  C     . LEU A 1 80  ? 49.126 18.267  11.188  1.00 15.24 ? 77   LEU A C     1 
ATOM   631  O  O     . LEU A 1 80  ? 49.262 19.494  11.101  1.00 16.82 ? 77   LEU A O     1 
ATOM   632  C  CB    . LEU A 1 80  ? 47.723 17.616  13.137  1.00 10.67 ? 77   LEU A CB    1 
ATOM   633  C  CG    . LEU A 1 80  ? 47.545 16.836  14.430  1.00 12.42 ? 77   LEU A CG    1 
ATOM   634  C  CD1   . LEU A 1 80  ? 46.126 16.991  14.944  1.00 14.29 ? 77   LEU A CD1   1 
ATOM   635  C  CD2   . LEU A 1 80  ? 47.898 15.366  14.210  1.00 13.20 ? 77   LEU A CD2   1 
ATOM   636  N  N     . ALA A 1 81  ? 49.000 17.472  10.135  1.00 8.13  ? 78   ALA A N     1 
ATOM   637  C  CA    . ALA A 1 81  ? 48.696 17.986  8.803   1.00 7.56  ? 78   ALA A CA    1 
ATOM   638  C  C     . ALA A 1 81  ? 47.376 17.382  8.346   1.00 10.97 ? 78   ALA A C     1 
ATOM   639  O  O     . ALA A 1 81  ? 47.127 16.194  8.561   1.00 11.19 ? 78   ALA A O     1 
ATOM   640  C  CB    . ALA A 1 81  ? 49.820 17.645  7.811   1.00 10.91 ? 78   ALA A CB    1 
ATOM   641  N  N     . GLN A 1 82  ? 46.522 18.207  7.742   1.00 12.11 ? 79   GLN A N     1 
ATOM   642  C  CA    . GLN A 1 82  ? 45.194 17.769  7.315   1.00 10.64 ? 79   GLN A CA    1 
ATOM   643  C  C     . GLN A 1 82  ? 45.155 17.447  5.831   1.00 9.73  ? 79   GLN A C     1 
ATOM   644  O  O     . GLN A 1 82  ? 45.669 18.216  5.010   1.00 11.46 ? 79   GLN A O     1 
ATOM   645  C  CB    . GLN A 1 82  ? 44.161 18.871  7.571   1.00 14.23 ? 79   GLN A CB    1 
ATOM   646  C  CG    . GLN A 1 82  ? 43.918 19.211  9.009   1.00 27.30 ? 79   GLN A CG    1 
ATOM   647  C  CD    . GLN A 1 82  ? 42.824 20.251  9.145   1.00 31.60 ? 79   GLN A CD    1 
ATOM   648  O  OE1   . GLN A 1 82  ? 43.063 21.358  9.617   1.00 33.67 ? 79   GLN A OE1   1 
ATOM   649  N  NE2   . GLN A 1 82  ? 41.616 19.901  8.708   1.00 36.86 ? 79   GLN A NE2   1 
ATOM   650  N  N     . VAL A 1 83  ? 44.528 16.322  5.493   1.00 8.31  ? 80   VAL A N     1 
ATOM   651  C  CA    . VAL A 1 83  ? 44.232 16.008  4.097   1.00 10.29 ? 80   VAL A CA    1 
ATOM   652  C  C     . VAL A 1 83  ? 43.325 17.085  3.514   1.00 13.85 ? 80   VAL A C     1 
ATOM   653  O  O     . VAL A 1 83  ? 42.375 17.522  4.154   1.00 11.27 ? 80   VAL A O     1 
ATOM   654  C  CB    . VAL A 1 83  ? 43.520 14.659  3.975   1.00 9.21  ? 80   VAL A CB    1 
ATOM   655  C  CG1   . VAL A 1 83  ? 43.167 14.377  2.531   1.00 12.57 ? 80   VAL A CG1   1 
ATOM   656  C  CG2   . VAL A 1 83  ? 44.411 13.539  4.532   1.00 9.82  ? 80   VAL A CG2   1 
ATOM   657  N  N     . ARG A 1 84  ? 43.625 17.487  2.287   1.00 12.54 ? 81   ARG A N     1 
ATOM   658  C  CA    . ARG A 1 84  ? 42.840 18.498  1.583   1.00 11.60 ? 81   ARG A CA    1 
ATOM   659  C  C     . ARG A 1 84  ? 41.388 18.051  1.460   1.00 10.71 ? 81   ARG A C     1 
ATOM   660  O  O     . ARG A 1 84  ? 41.105 16.863  1.312   1.00 11.72 ? 81   ARG A O     1 
ATOM   661  C  CB    . ARG A 1 84  ? 43.438 18.707  0.194   1.00 18.63 ? 81   ARG A CB    1 
ATOM   662  C  CG    . ARG A 1 84  ? 42.615 19.589  -0.724  1.00 17.43 ? 81   ARG A CG    1 
ATOM   663  C  CD    . ARG A 1 84  ? 43.347 19.768  -2.048  1.00 32.57 ? 81   ARG A CD    1 
ATOM   664  N  NE    . ARG A 1 84  ? 42.570 20.526  -3.022  1.00 43.45 ? 81   ARG A NE    1 
ATOM   665  C  CZ    . ARG A 1 84  ? 42.808 20.512  -4.330  1.00 52.89 ? 81   ARG A CZ    1 
ATOM   666  N  NH1   . ARG A 1 84  ? 43.799 19.773  -4.818  1.00 45.05 ? 81   ARG A NH1   1 
ATOM   667  N  NH2   . ARG A 1 84  ? 42.051 21.227  -5.152  1.00 49.54 ? 81   ARG A NH2   1 
ATOM   668  N  N     . GLU A 1 85  ? 40.467 19.007  1.542   1.00 10.34 ? 82   GLU A N     1 
ATOM   669  C  CA    . GLU A 1 85  ? 39.058 18.732  1.289   1.00 10.44 ? 82   GLU A CA    1 
ATOM   670  C  C     . GLU A 1 85  ? 38.606 19.512  0.071   1.00 13.20 ? 82   GLU A C     1 
ATOM   671  O  O     . GLU A 1 85  ? 38.870 20.711  -0.038  1.00 16.28 ? 82   GLU A O     1 
ATOM   672  C  CB    . GLU A 1 85  ? 38.206 19.080  2.513   1.00 16.24 ? 82   GLU A CB    1 
ATOM   673  C  CG    . GLU A 1 85  ? 38.287 18.009  3.599   1.00 18.71 ? 82   GLU A CG    1 
ATOM   674  C  CD    . GLU A 1 85  ? 37.565 18.400  4.876   1.00 31.09 ? 82   GLU A CD    1 
ATOM   675  O  OE1   . GLU A 1 85  ? 36.344 18.688  4.826   1.00 32.11 ? 82   GLU A OE1   1 
ATOM   676  O  OE2   . GLU A 1 85  ? 38.232 18.421  5.933   1.00 35.32 ? 82   GLU A OE2   1 
ATOM   677  N  N     . SER A 1 86  ? 37.950 18.807  -0.850  1.00 12.85 ? 83   SER A N     1 
ATOM   678  C  CA    . SER A 1 86  ? 37.357 19.401  -2.040  1.00 11.81 ? 83   SER A CA    1 
ATOM   679  C  C     . SER A 1 86  ? 35.994 18.778  -2.255  1.00 15.02 ? 83   SER A C     1 
ATOM   680  O  O     . SER A 1 86  ? 35.822 17.571  -2.073  1.00 14.61 ? 83   SER A O     1 
ATOM   681  C  CB    . SER A 1 86  ? 38.213 19.118  -3.270  1.00 18.19 ? 83   SER A CB    1 
ATOM   682  O  OG    . SER A 1 86  ? 39.505 19.656  -3.110  1.00 23.68 ? 83   SER A OG    1 
ATOM   683  N  N     . ARG A 1 87  ? 35.034 19.601  -2.668  1.00 17.13 ? 84   ARG A N     1 
ATOM   684  C  CA    . ARG A 1 87  ? 33.667 19.146  -2.906  1.00 18.91 ? 84   ARG A CA    1 
ATOM   685  C  C     . ARG A 1 87  ? 33.091 18.379  -1.726  1.00 16.20 ? 84   ARG A C     1 
ATOM   686  O  O     . ARG A 1 87  ? 32.358 17.408  -1.904  1.00 19.67 ? 84   ARG A O     1 
ATOM   687  C  CB    . ARG A 1 87  ? 33.583 18.320  -4.190  1.00 18.62 ? 84   ARG A CB    1 
ATOM   688  C  CG    . ARG A 1 87  ? 33.989 19.085  -5.433  1.00 23.63 ? 84   ARG A CG    1 
ATOM   689  C  CD    . ARG A 1 87  ? 33.858 18.226  -6.676  1.00 24.13 ? 84   ARG A CD    1 
ATOM   690  N  NE    . ARG A 1 87  ? 35.094 18.222  -7.450  1.00 28.39 ? 84   ARG A NE    1 
ATOM   691  C  CZ    . ARG A 1 87  ? 35.364 19.067  -8.437  1.00 37.61 ? 84   ARG A CZ    1 
ATOM   692  N  NH1   . ARG A 1 87  ? 34.474 19.992  -8.786  1.00 36.32 ? 84   ARG A NH1   1 
ATOM   693  N  NH2   . ARG A 1 87  ? 36.526 18.987  -9.076  1.00 33.65 ? 84   ARG A NH2   1 
ATOM   694  N  N     . GLY A 1 88  ? 33.442 18.806  -0.517  1.00 14.05 ? 85   GLY A N     1 
ATOM   695  C  CA    . GLY A 1 88  ? 32.903 18.211  0.692   1.00 15.65 ? 85   GLY A CA    1 
ATOM   696  C  C     . GLY A 1 88  ? 33.555 16.918  1.158   1.00 16.93 ? 85   GLY A C     1 
ATOM   697  O  O     . GLY A 1 88  ? 33.086 16.290  2.118   1.00 17.28 ? 85   GLY A O     1 
ATOM   698  N  N     . LYS A 1 89  ? 34.639 16.511  0.497   1.00 11.18 ? 86   LYS A N     1 
ATOM   699  C  CA    . LYS A 1 89  ? 35.245 15.223  0.805   1.00 10.24 ? 86   LYS A CA    1 
ATOM   700  C  C     . LYS A 1 89  ? 36.775 15.266  0.833   1.00 10.55 ? 86   LYS A C     1 
ATOM   701  O  O     . LYS A 1 89  ? 37.394 16.139  0.237   1.00 9.21  ? 86   LYS A O     1 
ATOM   702  C  CB    . LYS A 1 89  ? 34.777 14.150  -0.187  1.00 14.25 ? 86   LYS A CB    1 
ATOM   703  C  CG    . LYS A 1 89  ? 35.343 14.304  -1.587  1.00 13.22 ? 86   LYS A CG    1 
ATOM   704  C  CD    . LYS A 1 89  ? 34.809 13.218  -2.534  1.00 15.61 ? 86   LYS A CD    1 
ATOM   705  C  CE    . LYS A 1 89  ? 35.353 11.844  -2.194  1.00 12.68 ? 86   LYS A CE    1 
ATOM   706  N  NZ    . LYS A 1 89  ? 36.848 11.798  -2.210  1.00 13.37 ? 86   LYS A NZ    1 
ATOM   707  N  N     . ALA A 1 90  ? 37.375 14.305  1.525   1.00 12.24 ? 87   ALA A N     1 
ATOM   708  C  CA    . ALA A 1 90  ? 38.826 14.169  1.524   1.00 12.94 ? 87   ALA A CA    1 
ATOM   709  C  C     . ALA A 1 90  ? 39.292 13.969  0.096   1.00 10.94 ? 87   ALA A C     1 
ATOM   710  O  O     . ALA A 1 90  ? 38.667 13.221  -0.665  1.00 15.63 ? 87   ALA A O     1 
ATOM   711  C  CB    . ALA A 1 90  ? 39.248 12.986  2.386   1.00 13.55 ? 87   ALA A CB    1 
ATOM   712  N  N     . ASN A 1 91  ? 40.365 14.664  -0.276  1.00 9.33  ? 88   ASN A N     1 
ATOM   713  C  CA    . ASN A 1 91  ? 40.930 14.545  -1.619  1.00 12.47 ? 88   ASN A CA    1 
ATOM   714  C  C     . ASN A 1 91  ? 42.404 14.151  -1.541  1.00 12.80 ? 88   ASN A C     1 
ATOM   715  O  O     . ASN A 1 91  ? 43.217 14.885  -0.984  1.00 12.63 ? 88   ASN A O     1 
ATOM   716  C  CB    . ASN A 1 91  ? 40.759 15.857  -2.381  1.00 14.45 ? 88   ASN A CB    1 
ATOM   717  C  CG    . ASN A 1 91  ? 41.128 15.730  -3.844  1.00 19.25 ? 88   ASN A CG    1 
ATOM   718  O  OD1   . ASN A 1 91  ? 42.240 15.344  -4.172  1.00 13.87 ? 88   ASN A OD1   1 
ATOM   719  N  ND2   . ASN A 1 91  ? 40.180 16.021  -4.729  1.00 21.36 ? 88   ASN A ND2   1 
ATOM   720  N  N     . LEU A 1 92  ? 42.745 12.982  -2.080  1.00 9.63  ? 89   LEU A N     1 
ATOM   721  C  CA    . LEU A 1 92  ? 44.092 12.422  -1.889  1.00 9.91  ? 89   LEU A CA    1 
ATOM   722  C  C     . LEU A 1 92  ? 45.044 12.702  -3.049  1.00 12.28 ? 89   LEU A C     1 
ATOM   723  O  O     . LEU A 1 92  ? 46.096 12.062  -3.171  1.00 10.06 ? 89   LEU A O     1 
ATOM   724  C  CB    . LEU A 1 92  ? 44.006 10.911  -1.663  1.00 10.03 ? 89   LEU A CB    1 
ATOM   725  C  CG    . LEU A 1 92  ? 43.052 10.466  -0.552  1.00 9.73  ? 89   LEU A CG    1 
ATOM   726  C  CD1   . LEU A 1 92  ? 42.987 8.965   -0.467  1.00 13.64 ? 89   LEU A CD1   1 
ATOM   727  C  CD2   . LEU A 1 92  ? 43.541 11.068  0.759   1.00 11.98 ? 89   LEU A CD2   1 
ATOM   728  N  N     . THR A 1 93  ? 44.692 13.661  -3.892  1.00 9.25  ? 90   THR A N     1 
ATOM   729  C  CA    . THR A 1 93  ? 45.515 13.946  -5.066  1.00 9.21  ? 90   THR A CA    1 
ATOM   730  C  C     . THR A 1 93  ? 46.998 14.190  -4.788  1.00 9.68  ? 90   THR A C     1 
ATOM   731  O  O     . THR A 1 93  ? 47.856 13.683  -5.514  1.00 11.02 ? 90   THR A O     1 
ATOM   732  C  CB    . THR A 1 93  ? 44.923 15.105  -5.883  1.00 14.56 ? 90   THR A CB    1 
ATOM   733  O  OG1   . THR A 1 93  ? 43.613 14.727  -6.326  1.00 15.60 ? 90   THR A OG1   1 
ATOM   734  C  CG2   . THR A 1 93  ? 45.800 15.408  -7.090  1.00 13.92 ? 90   THR A CG2   1 
ATOM   735  N  N     . LYS A 1 94  ? 47.304 14.964  -3.755  1.00 9.37  ? 91   LYS A N     1 
ATOM   736  C  CA    . LYS A 1 94  ? 48.693 15.302  -3.468  1.00 9.53  ? 91   LYS A CA    1 
ATOM   737  C  C     . LYS A 1 94  ? 49.528 14.041  -3.272  1.00 10.71 ? 91   LYS A C     1 
ATOM   738  O  O     . LYS A 1 94  ? 50.684 13.977  -3.703  1.00 11.49 ? 91   LYS A O     1 
ATOM   739  C  CB    . LYS A 1 94  ? 48.799 16.191  -2.222  1.00 12.25 ? 91   LYS A CB    1 
ATOM   740  C  CG    . LYS A 1 94  ? 50.215 16.670  -1.918  1.00 11.97 ? 91   LYS A CG    1 
ATOM   741  C  CD    . LYS A 1 94  ? 50.327 17.207  -0.485  1.00 12.67 ? 91   LYS A CD    1 
ATOM   742  C  CE    . LYS A 1 94  ? 49.386 18.377  -0.243  1.00 17.93 ? 91   LYS A CE    1 
ATOM   743  N  NZ    . LYS A 1 94  ? 49.515 18.895  1.159   1.00 10.18 ? 91   LYS A NZ    1 
ATOM   744  N  N     . TYR A 1 95  ? 48.937 13.036  -2.631  1.00 7.85  ? 92   TYR A N     1 
ATOM   745  C  CA    . TYR A 1 95  ? 49.653 11.804  -2.322  1.00 5.83  ? 92   TYR A CA    1 
ATOM   746  C  C     . TYR A 1 95  ? 49.750 10.923  -3.556  1.00 8.45  ? 92   TYR A C     1 
ATOM   747  O  O     . TYR A 1 95  ? 50.779 10.285  -3.789  1.00 11.03 ? 92   TYR A O     1 
ATOM   748  C  CB    . TYR A 1 95  ? 48.993 11.065  -1.136  1.00 6.82  ? 92   TYR A CB    1 
ATOM   749  C  CG    . TYR A 1 95  ? 48.688 12.046  -0.031  1.00 7.44  ? 92   TYR A CG    1 
ATOM   750  C  CD1   . TYR A 1 95  ? 47.390 12.455  0.208   1.00 8.62  ? 92   TYR A CD1   1 
ATOM   751  C  CD2   . TYR A 1 95  ? 49.718 12.635  0.706   1.00 10.12 ? 92   TYR A CD2   1 
ATOM   752  C  CE1   . TYR A 1 95  ? 47.101 13.405  1.174   1.00 8.90  ? 92   TYR A CE1   1 
ATOM   753  C  CE2   . TYR A 1 95  ? 49.440 13.575  1.675   1.00 10.41 ? 92   TYR A CE2   1 
ATOM   754  C  CZ    . TYR A 1 95  ? 48.117 13.956  1.892   1.00 9.46  ? 92   TYR A CZ    1 
ATOM   755  O  OH    . TYR A 1 95  ? 47.774 14.888  2.847   1.00 11.16 ? 92   TYR A OH    1 
ATOM   756  N  N     . ARG A 1 96  ? 48.695 10.919  -4.373  1.00 8.55  ? 93   ARG A N     1 
ATOM   757  C  CA    . ARG A 1 96  ? 48.764 10.187  -5.641  1.00 10.16 ? 93   ARG A CA    1 
ATOM   758  C  C     . ARG A 1 96  ? 49.845 10.745  -6.551  1.00 12.81 ? 93   ARG A C     1 
ATOM   759  O  O     . ARG A 1 96  ? 50.564 9.982   -7.202  1.00 11.25 ? 93   ARG A O     1 
ATOM   760  C  CB    . ARG A 1 96  ? 47.412 10.164  -6.366  1.00 10.01 ? 93   ARG A CB    1 
ATOM   761  C  CG    . ARG A 1 96  ? 46.360 9.337   -5.656  1.00 13.20 ? 93   ARG A CG    1 
ATOM   762  C  CD    . ARG A 1 96  ? 45.132 9.071   -6.526  1.00 14.07 ? 93   ARG A CD    1 
ATOM   763  N  NE    . ARG A 1 96  ? 44.120 8.357   -5.753  1.00 18.19 ? 93   ARG A NE    1 
ATOM   764  C  CZ    . ARG A 1 96  ? 43.092 8.949   -5.148  1.00 12.47 ? 93   ARG A CZ    1 
ATOM   765  N  NH1   . ARG A 1 96  ? 42.234 8.224   -4.438  1.00 12.92 ? 93   ARG A NH1   1 
ATOM   766  N  NH2   . ARG A 1 96  ? 42.930 10.263  -5.258  1.00 10.80 ? 93   ARG A NH2   1 
ATOM   767  N  N     . GLU A 1 97  ? 49.971 12.067  -6.591  1.00 10.50 ? 94   GLU A N     1 
ATOM   768  C  CA    . GLU A 1 97  ? 51.006 12.697  -7.414  1.00 9.12  ? 94   GLU A CA    1 
ATOM   769  C  C     . GLU A 1 97  ? 52.412 12.410  -6.890  1.00 12.53 ? 94   GLU A C     1 
ATOM   770  O  O     . GLU A 1 97  ? 53.323 12.147  -7.679  1.00 10.47 ? 94   GLU A O     1 
ATOM   771  C  CB    . GLU A 1 97  ? 50.738 14.192  -7.586  1.00 10.43 ? 94   GLU A CB    1 
ATOM   772  C  CG    . GLU A 1 97  ? 49.464 14.415  -8.408  1.00 18.63 ? 94   GLU A CG    1 
ATOM   773  C  CD    . GLU A 1 97  ? 49.080 15.870  -8.568  1.00 28.26 ? 94   GLU A CD    1 
ATOM   774  O  OE1   . GLU A 1 97  ? 49.684 16.735  -7.899  1.00 34.07 ? 94   GLU A OE1   1 
ATOM   775  O  OE2   . GLU A 1 97  ? 48.163 16.146  -9.372  1.00 31.34 ? 94   GLU A OE2   1 
ATOM   776  N  N     . ALA A 1 98  ? 52.582 12.420  -5.565  1.00 9.89  ? 95   ALA A N     1 
ATOM   777  C  CA    . ALA A 1 98  ? 53.883 12.097  -4.977  1.00 8.51  ? 95   ALA A CA    1 
ATOM   778  C  C     . ALA A 1 98  ? 54.262 10.654  -5.290  1.00 9.15  ? 95   ALA A C     1 
ATOM   779  O  O     . ALA A 1 98  ? 55.439 10.337  -5.499  1.00 9.41  ? 95   ALA A O     1 
ATOM   780  C  CB    . ALA A 1 98  ? 53.868 12.318  -3.462  1.00 7.36  ? 95   ALA A CB    1 
ATOM   781  N  N     . SER A 1 99  ? 53.261 9.781   -5.309  1.00 10.99 ? 96   SER A N     1 
ATOM   782  C  CA    . SER A 1 99  ? 53.470 8.374   -5.632  1.00 10.20 ? 96   SER A CA    1 
ATOM   783  C  C     . SER A 1 99  ? 54.009 8.226   -7.056  1.00 10.15 ? 96   SER A C     1 
ATOM   784  O  O     . SER A 1 99  ? 54.942 7.467   -7.310  1.00 9.88  ? 96   SER A O     1 
ATOM   785  C  CB    . SER A 1 99  ? 52.147 7.622   -5.508  1.00 13.07 ? 96   SER A CB    1 
ATOM   786  O  OG    . SER A 1 99  ? 52.273 6.295   -5.953  1.00 18.63 ? 96   SER A OG    1 
ATOM   787  N  N     . VAL A 1 100 ? 53.413 8.955   -7.987  1.00 9.63  ? 97   VAL A N     1 
ATOM   788  C  CA    . VAL A 1 100 ? 53.910 8.919   -9.371  1.00 9.43  ? 97   VAL A CA    1 
ATOM   789  C  C     . VAL A 1 100 ? 55.396 9.320   -9.454  1.00 12.20 ? 97   VAL A C     1 
ATOM   790  O  O     . VAL A 1 100 ? 56.172 8.703   -10.187 1.00 11.50 ? 97   VAL A O     1 
ATOM   791  C  CB    . VAL A 1 100 ? 53.013 9.765   -10.311 1.00 11.13 ? 97   VAL A CB    1 
ATOM   792  C  CG1   . VAL A 1 100 ? 53.658 9.895   -11.718 1.00 12.97 ? 97   VAL A CG1   1 
ATOM   793  C  CG2   . VAL A 1 100 ? 51.636 9.122   -10.421 1.00 12.97 ? 97   VAL A CG2   1 
ATOM   794  N  N     . GLU A 1 101 ? 55.807 10.332  -8.686  1.00 8.40  ? 98   GLU A N     1 
ATOM   795  C  CA    . GLU A 1 101 ? 57.223 10.722  -8.637  1.00 12.33 ? 98   GLU A CA    1 
ATOM   796  C  C     . GLU A 1 101 ? 58.122 9.530   -8.336  1.00 11.39 ? 98   GLU A C     1 
ATOM   797  O  O     . GLU A 1 101 ? 59.148 9.317   -8.991  1.00 10.91 ? 98   GLU A O     1 
ATOM   798  C  CB    . GLU A 1 101 ? 57.482 11.776  -7.558  1.00 11.16 ? 98   GLU A CB    1 
ATOM   799  C  CG    . GLU A 1 101 ? 56.892 13.159  -7.802  1.00 15.57 ? 98   GLU A CG    1 
ATOM   800  C  CD    . GLU A 1 101 ? 57.312 14.159  -6.716  1.00 12.53 ? 98   GLU A CD    1 
ATOM   801  O  OE1   . GLU A 1 101 ? 58.523 14.484  -6.626  1.00 12.56 ? 98   GLU A OE1   1 
ATOM   802  O  OE2   . GLU A 1 101 ? 56.427 14.631  -5.963  1.00 15.26 ? 98   GLU A OE2   1 
ATOM   803  N  N     . VAL A 1 102 ? 57.745 8.775   -7.309  1.00 8.03  ? 99   VAL A N     1 
ATOM   804  C  CA    . VAL A 1 102 ? 58.565 7.664   -6.856  1.00 8.52  ? 99   VAL A CA    1 
ATOM   805  C  C     . VAL A 1 102 ? 58.522 6.516   -7.841  1.00 11.02 ? 99   VAL A C     1 
ATOM   806  O  O     . VAL A 1 102 ? 59.557 5.921   -8.158  1.00 11.48 ? 99   VAL A O     1 
ATOM   807  C  CB    . VAL A 1 102 ? 58.143 7.170   -5.462  1.00 8.11  ? 99   VAL A CB    1 
ATOM   808  C  CG1   . VAL A 1 102 ? 58.905 5.903   -5.112  1.00 15.66 ? 99   VAL A CG1   1 
ATOM   809  C  CG2   . VAL A 1 102 ? 58.387 8.287   -4.429  1.00 10.96 ? 99   VAL A CG2   1 
ATOM   810  N  N     . MET A 1 103 ? 57.326 6.202   -8.324  1.00 7.47  ? 100  MET A N     1 
ATOM   811  C  CA    . MET A 1 103 ? 57.157 5.102   -9.268  1.00 8.96  ? 100  MET A CA    1 
ATOM   812  C  C     . MET A 1 103 ? 57.950 5.335   -10.552 1.00 14.48 ? 100  MET A C     1 
ATOM   813  O  O     . MET A 1 103 ? 58.541 4.403   -11.098 1.00 12.31 ? 100  MET A O     1 
ATOM   814  C  CB    . MET A 1 103 ? 55.678 4.881   -9.604  1.00 14.29 ? 100  MET A CB    1 
ATOM   815  C  CG    . MET A 1 103 ? 54.792 4.566   -8.397  1.00 19.03 ? 100  MET A CG    1 
ATOM   816  S  SD    . MET A 1 103 ? 55.206 2.981   -7.629  1.00 20.52 ? 100  MET A SD    1 
ATOM   817  C  CE    . MET A 1 103 ? 54.321 3.084   -6.053  1.00 15.42 ? 100  MET A CE    1 
ATOM   818  N  N     . GLU A 1 104 ? 57.969 6.575   -11.033 1.00 9.89  ? 101  GLU A N     1 
ATOM   819  C  CA    . GLU A 1 104 ? 58.728 6.885   -12.240 1.00 14.03 ? 101  GLU A CA    1 
ATOM   820  C  C     . GLU A 1 104 ? 60.237 6.693   -12.072 1.00 11.82 ? 101  GLU A C     1 
ATOM   821  O  O     . GLU A 1 104 ? 60.899 6.182   -12.976 1.00 12.73 ? 101  GLU A O     1 
ATOM   822  C  CB    . GLU A 1 104 ? 58.347 8.278   -12.780 1.00 12.63 ? 101  GLU A CB    1 
ATOM   823  C  CG    . GLU A 1 104 ? 56.923 8.267   -13.357 1.00 19.54 ? 101  GLU A CG    1 
ATOM   824  C  CD    . GLU A 1 104 ? 56.520 9.559   -14.056 1.00 29.73 ? 101  GLU A CD    1 
ATOM   825  O  OE1   . GLU A 1 104 ? 57.236 10.574  -13.922 1.00 29.26 ? 101  GLU A OE1   1 
ATOM   826  O  OE2   . GLU A 1 104 ? 55.473 9.552   -14.740 1.00 31.59 ? 101  GLU A OE2   1 
ATOM   827  N  N     . ILE A 1 105 ? 60.777 7.061   -10.913 1.00 10.00 ? 102  ILE A N     1 
ATOM   828  C  CA    . ILE A 1 105 ? 62.190 6.799   -10.623 1.00 8.19  ? 102  ILE A CA    1 
ATOM   829  C  C     . ILE A 1 105 ? 62.482 5.290   -10.575 1.00 9.79  ? 102  ILE A C     1 
ATOM   830  O  O     . ILE A 1 105 ? 63.399 4.798   -11.245 1.00 11.63 ? 102  ILE A O     1 
ATOM   831  C  CB    . ILE A 1 105 ? 62.628 7.480   -9.309  1.00 10.94 ? 102  ILE A CB    1 
ATOM   832  C  CG1   . ILE A 1 105 ? 62.506 8.999   -9.433  1.00 10.71 ? 102  ILE A CG1   1 
ATOM   833  C  CG2   . ILE A 1 105 ? 64.056 7.094   -8.931  1.00 11.43 ? 102  ILE A CG2   1 
ATOM   834  C  CD1   . ILE A 1 105 ? 62.450 9.719   -8.087  1.00 14.79 ? 102  ILE A CD1   1 
ATOM   835  N  N     . MET A 1 106 ? 61.698 4.549   -9.801  1.00 10.04 ? 103  MET A N     1 
ATOM   836  C  CA    . MET A 1 106 ? 61.881 3.098   -9.751  1.00 9.80  ? 103  MET A CA    1 
ATOM   837  C  C     . MET A 1 106 ? 61.887 2.455   -11.131 1.00 11.52 ? 103  MET A C     1 
ATOM   838  O  O     . MET A 1 106 ? 62.675 1.554   -11.397 1.00 10.37 ? 103  MET A O     1 
ATOM   839  C  CB    . MET A 1 106 ? 60.810 2.449   -8.870  1.00 11.43 ? 103  MET A CB    1 
ATOM   840  C  CG    . MET A 1 106 ? 61.040 2.775   -7.415  1.00 11.29 ? 103  MET A CG    1 
ATOM   841  S  SD    . MET A 1 106 ? 59.870 1.910   -6.365  1.00 16.89 ? 103  MET A SD    1 
ATOM   842  C  CE    . MET A 1 106 ? 58.356 2.707   -6.858  1.00 23.82 ? 103  MET A CE    1 
ATOM   843  N  N     . SER A 1 107 ? 60.995 2.918   -11.993 1.00 10.69 ? 104  SER A N     1 
ATOM   844  C  CA    . SER A 1 107 ? 60.854 2.359   -13.332 1.00 15.22 ? 104  SER A CA    1 
ATOM   845  C  C     . SER A 1 107 ? 62.117 2.500   -14.193 1.00 11.68 ? 104  SER A C     1 
ATOM   846  O  O     . SER A 1 107 ? 62.238 1.820   -15.218 1.00 14.80 ? 104  SER A O     1 
ATOM   847  C  CB    . SER A 1 107 ? 59.661 2.997   -14.053 1.00 16.95 ? 104  SER A CB    1 
ATOM   848  O  OG    . SER A 1 107 ? 58.428 2.544   -13.517 1.00 20.39 ? 104  SER A OG    1 
ATOM   849  N  N     . ARG A 1 108 ? 63.037 3.382   -13.808 1.00 12.86 ? 105  ARG A N     1 
ATOM   850  C  CA    . ARG A 1 108 ? 64.298 3.536   -14.552 1.00 17.98 ? 105  ARG A CA    1 
ATOM   851  C  C     . ARG A 1 108 ? 65.207 2.329   -14.354 1.00 20.90 ? 105  ARG A C     1 
ATOM   852  O  O     . ARG A 1 108 ? 66.067 2.032   -15.188 1.00 19.62 ? 105  ARG A O     1 
ATOM   853  C  CB    . ARG A 1 108 ? 65.067 4.794   -14.126 1.00 18.51 ? 105  ARG A CB    1 
ATOM   854  C  CG    . ARG A 1 108 ? 64.340 6.102   -14.350 1.00 15.16 ? 105  ARG A CG    1 
ATOM   855  C  CD    . ARG A 1 108 ? 65.330 7.249   -14.499 1.00 22.12 ? 105  ARG A CD    1 
ATOM   856  N  NE    . ARG A 1 108 ? 66.309 7.310   -13.422 1.00 27.88 ? 105  ARG A NE    1 
ATOM   857  C  CZ    . ARG A 1 108 ? 66.270 8.189   -12.424 1.00 18.39 ? 105  ARG A CZ    1 
ATOM   858  N  NH1   . ARG A 1 108 ? 67.209 8.173   -11.493 1.00 21.92 ? 105  ARG A NH1   1 
ATOM   859  N  NH2   . ARG A 1 108 ? 65.294 9.083   -12.369 1.00 19.89 ? 105  ARG A NH2   1 
ATOM   860  N  N     . PHE A 1 109 ? 65.016 1.643   -13.235 1.00 16.28 ? 106  PHE A N     1 
ATOM   861  C  CA    . PHE A 1 109 ? 65.894 0.543   -12.852 1.00 16.26 ? 106  PHE A CA    1 
ATOM   862  C  C     . PHE A 1 109 ? 65.368 -0.798  -13.327 1.00 20.10 ? 106  PHE A C     1 
ATOM   863  O  O     . PHE A 1 109 ? 66.140 -1.696  -13.677 1.00 22.91 ? 106  PHE A O     1 
ATOM   864  C  CB    . PHE A 1 109 ? 66.067 0.530   -11.332 1.00 14.92 ? 106  PHE A CB    1 
ATOM   865  C  CG    . PHE A 1 109 ? 66.841 1.702   -10.803 1.00 20.78 ? 106  PHE A CG    1 
ATOM   866  C  CD1   . PHE A 1 109 ? 66.229 2.931   -10.606 1.00 15.15 ? 106  PHE A CD1   1 
ATOM   867  C  CD2   . PHE A 1 109 ? 68.188 1.575   -10.508 1.00 14.36 ? 106  PHE A CD2   1 
ATOM   868  C  CE1   . PHE A 1 109 ? 66.948 4.005   -10.115 1.00 12.74 ? 106  PHE A CE1   1 
ATOM   869  C  CE2   . PHE A 1 109 ? 68.912 2.645   -10.019 1.00 18.03 ? 106  PHE A CE2   1 
ATOM   870  C  CZ    . PHE A 1 109 ? 68.294 3.863   -9.820  1.00 14.70 ? 106  PHE A CZ    1 
ATOM   871  N  N     . ALA A 1 110 ? 64.052 -0.930  -13.346 1.00 18.69 ? 107  ALA A N     1 
ATOM   872  C  CA    . ALA A 1 110 ? 63.420 -2.190  -13.699 1.00 17.45 ? 107  ALA A CA    1 
ATOM   873  C  C     . ALA A 1 110 ? 61.926 -2.015  -13.868 1.00 20.41 ? 107  ALA A C     1 
ATOM   874  O  O     . ALA A 1 110 ? 61.361 -0.983  -13.512 1.00 19.45 ? 107  ALA A O     1 
ATOM   875  C  CB    . ALA A 1 110 ? 63.705 -3.244  -12.636 1.00 22.63 ? 107  ALA A CB    1 
ATOM   876  N  N     . VAL A 1 111 ? 61.288 -3.033  -14.428 1.00 24.36 ? 108  VAL A N     1 
ATOM   877  C  CA    . VAL A 1 111 ? 59.845 -3.043  -14.557 1.00 26.58 ? 108  VAL A CA    1 
ATOM   878  C  C     . VAL A 1 111 ? 59.268 -3.203  -13.160 1.00 24.62 ? 108  VAL A C     1 
ATOM   879  O  O     . VAL A 1 111 ? 59.778 -3.988  -12.355 1.00 26.87 ? 108  VAL A O     1 
ATOM   880  C  CB    . VAL A 1 111 ? 59.366 -4.205  -15.430 1.00 35.65 ? 108  VAL A CB    1 
ATOM   881  C  CG1   . VAL A 1 111 ? 57.852 -4.136  -15.604 1.00 31.90 ? 108  VAL A CG1   1 
ATOM   882  C  CG2   . VAL A 1 111 ? 60.064 -4.172  -16.777 1.00 36.23 ? 108  VAL A CG2   1 
ATOM   883  N  N     . ILE A 1 112 ? 58.230 -2.437  -12.849 1.00 22.32 ? 109  ILE A N     1 
ATOM   884  C  CA    . ILE A 1 112 ? 57.677 -2.515  -11.506 1.00 15.13 ? 109  ILE A CA    1 
ATOM   885  C  C     . ILE A 1 112 ? 56.222 -2.929  -11.504 1.00 12.44 ? 109  ILE A C     1 
ATOM   886  O  O     . ILE A 1 112 ? 55.518 -2.779  -12.504 1.00 13.43 ? 109  ILE A O     1 
ATOM   887  C  CB    . ILE A 1 112 ? 57.838 -1.182  -10.736 1.00 17.24 ? 109  ILE A CB    1 
ATOM   888  C  CG1   . ILE A 1 112 ? 56.913 -0.118  -11.306 1.00 16.11 ? 109  ILE A CG1   1 
ATOM   889  C  CG2   . ILE A 1 112 ? 59.290 -0.727  -10.761 1.00 21.29 ? 109  ILE A CG2   1 
ATOM   890  C  CD1   . ILE A 1 112 ? 56.834 1.153   -10.468 1.00 20.91 ? 109  ILE A CD1   1 
ATOM   891  N  N     . GLU A 1 113 ? 55.797 -3.497  -10.379 1.00 9.10  ? 110  GLU A N     1 
ATOM   892  C  CA    . GLU A 1 113 ? 54.386 -3.716  -10.115 1.00 8.53  ? 110  GLU A CA    1 
ATOM   893  C  C     . GLU A 1 113 ? 53.940 -2.800  -8.984  1.00 9.34  ? 110  GLU A C     1 
ATOM   894  O  O     . GLU A 1 113 ? 54.397 -2.951  -7.854  1.00 11.57 ? 110  GLU A O     1 
ATOM   895  C  CB    . GLU A 1 113 ? 54.108 -5.179  -9.732  1.00 11.59 ? 110  GLU A CB    1 
ATOM   896  C  CG    . GLU A 1 113 ? 52.644 -5.423  -9.413  1.00 11.65 ? 110  GLU A CG    1 
ATOM   897  C  CD    . GLU A 1 113 ? 52.359 -6.833  -8.910  1.00 18.39 ? 110  GLU A CD    1 
ATOM   898  O  OE1   . GLU A 1 113 ? 51.276 -7.052  -8.322  1.00 19.38 ? 110  GLU A OE1   1 
ATOM   899  O  OE2   . GLU A 1 113 ? 53.209 -7.720  -9.103  1.00 15.60 ? 110  GLU A OE2   1 
ATOM   900  N  N     . ARG A 1 114 ? 53.068 -1.842  -9.300  1.00 10.31 ? 111  ARG A N     1 
ATOM   901  C  CA    . ARG A 1 114 ? 52.502 -0.950  -8.281  1.00 12.06 ? 111  ARG A CA    1 
ATOM   902  C  C     . ARG A 1 114 ? 51.602 -1.766  -7.364  1.00 14.55 ? 111  ARG A C     1 
ATOM   903  O  O     . ARG A 1 114 ? 50.572 -2.287  -7.796  1.00 19.07 ? 111  ARG A O     1 
ATOM   904  C  CB    . ARG A 1 114 ? 51.705 0.189   -8.938  1.00 14.99 ? 111  ARG A CB    1 
ATOM   905  C  CG    . ARG A 1 114 ? 51.151 1.231   -7.948  1.00 17.02 ? 111  ARG A CG    1 
ATOM   906  C  CD    . ARG A 1 114 ? 50.040 2.032   -8.594  1.00 16.97 ? 111  ARG A CD    1 
ATOM   907  N  NE    . ARG A 1 114 ? 49.689 3.266   -7.893  1.00 20.91 ? 111  ARG A NE    1 
ATOM   908  C  CZ    . ARG A 1 114 ? 48.728 3.361   -6.978  1.00 21.59 ? 111  ARG A CZ    1 
ATOM   909  N  NH1   . ARG A 1 114 ? 48.026 2.288   -6.629  1.00 25.45 ? 111  ARG A NH1   1 
ATOM   910  N  NH2   . ARG A 1 114 ? 48.471 4.533   -6.406  1.00 18.88 ? 111  ARG A NH2   1 
ATOM   911  N  N     . ALA A 1 115 ? 51.997 -1.908  -6.102  1.00 11.04 ? 112  ALA A N     1 
ATOM   912  C  CA    . ALA A 1 115 ? 51.257 -2.737  -5.172  1.00 11.32 ? 112  ALA A CA    1 
ATOM   913  C  C     . ALA A 1 115 ? 50.309 -1.909  -4.309  1.00 13.38 ? 112  ALA A C     1 
ATOM   914  O  O     . ALA A 1 115 ? 49.322 -2.425  -3.780  1.00 19.70 ? 112  ALA A O     1 
ATOM   915  C  CB    . ALA A 1 115 ? 52.210 -3.526  -4.299  1.00 14.17 ? 112  ALA A CB    1 
ATOM   916  N  N     . SER A 1 116 ? 50.632 -0.631  -4.165  1.00 12.96 ? 113  SER A N     1 
ATOM   917  C  CA    . SER A 1 116 ? 49.819 0.286   -3.385  1.00 12.21 ? 113  SER A CA    1 
ATOM   918  C  C     . SER A 1 116 ? 50.234 1.712   -3.723  1.00 12.90 ? 113  SER A C     1 
ATOM   919  O  O     . SER A 1 116 ? 51.092 1.933   -4.562  1.00 12.81 ? 113  SER A O     1 
ATOM   920  C  CB    . SER A 1 116 ? 50.005 0.033   -1.884  1.00 14.43 ? 113  SER A CB    1 
ATOM   921  O  OG    A SER A 1 116 ? 51.264 0.498   -1.434  0.50 10.12 ? 113  SER A OG    1 
ATOM   922  O  OG    B SER A 1 116 ? 49.195 0.898   -1.112  0.50 19.22 ? 113  SER A OG    1 
ATOM   923  N  N     . ILE A 1 117 ? 49.644 2.692   -3.051  1.00 10.68 ? 114  ILE A N     1 
ATOM   924  C  CA    . ILE A 1 117 ? 50.037 4.065   -3.289  1.00 9.25  ? 114  ILE A CA    1 
ATOM   925  C  C     . ILE A 1 117 ? 51.528 4.328   -3.002  1.00 12.13 ? 114  ILE A C     1 
ATOM   926  O  O     . ILE A 1 117 ? 52.120 5.243   -3.571  1.00 12.67 ? 114  ILE A O     1 
ATOM   927  C  CB    . ILE A 1 117 ? 49.160 5.050   -2.481  1.00 11.07 ? 114  ILE A CB    1 
ATOM   928  C  CG1   . ILE A 1 117 ? 49.333 6.469   -3.025  1.00 12.87 ? 114  ILE A CG1   1 
ATOM   929  C  CG2   . ILE A 1 117 ? 49.487 4.972   -1.002  1.00 13.50 ? 114  ILE A CG2   1 
ATOM   930  C  CD1   . ILE A 1 117 ? 48.204 7.403   -2.646  1.00 14.55 ? 114  ILE A CD1   1 
ATOM   931  N  N     . ASP A 1 118 ? 52.151 3.545   -2.123  1.00 8.40  ? 115  ASP A N     1 
ATOM   932  C  CA    . ASP A 1 118 ? 53.547 3.857   -1.798  1.00 10.46 ? 115  ASP A CA    1 
ATOM   933  C  C     . ASP A 1 118 ? 54.488 2.659   -1.819  1.00 11.00 ? 115  ASP A C     1 
ATOM   934  O  O     . ASP A 1 118 ? 55.555 2.689   -1.188  1.00 12.32 ? 115  ASP A O     1 
ATOM   935  C  CB    . ASP A 1 118 ? 53.626 4.541   -0.435  1.00 8.46  ? 115  ASP A CB    1 
ATOM   936  C  CG    . ASP A 1 118 ? 53.554 3.553   0.696   1.00 12.40 ? 115  ASP A CG    1 
ATOM   937  O  OD1   . ASP A 1 118 ? 54.178 3.826   1.732   1.00 12.02 ? 115  ASP A OD1   1 
ATOM   938  O  OD2   . ASP A 1 118 ? 52.901 2.496   0.547   1.00 13.02 ? 115  ASP A OD2   1 
ATOM   939  N  N     . GLU A 1 119 ? 54.113 1.612   -2.543  1.00 11.78 ? 116  GLU A N     1 
ATOM   940  C  CA    A GLU A 1 119 ? 54.855 0.343   -2.579  0.40 13.14 ? 116  GLU A CA    1 
ATOM   941  C  CA    B GLU A 1 119 ? 55.020 0.489   -2.659  0.60 13.19 ? 116  GLU A CA    1 
ATOM   942  C  C     . GLU A 1 119 ? 54.935 -0.197  -4.000  1.00 11.48 ? 116  GLU A C     1 
ATOM   943  O  O     . GLU A 1 119 ? 53.918 -0.166  -4.699  1.00 11.19 ? 116  GLU A O     1 
ATOM   944  C  CB    A GLU A 1 119 ? 54.115 -0.729  -1.779  0.40 13.01 ? 116  GLU A CB    1 
ATOM   945  C  CB    B GLU A 1 119 ? 54.819 -0.513  -1.536  0.60 13.82 ? 116  GLU A CB    1 
ATOM   946  C  CG    A GLU A 1 119 ? 54.101 -0.588  -0.272  0.40 13.39 ? 116  GLU A CG    1 
ATOM   947  C  CG    B GLU A 1 119 ? 53.647 -1.428  -1.731  0.60 11.60 ? 116  GLU A CG    1 
ATOM   948  C  CD    A GLU A 1 119 ? 53.582 -1.847  0.388   0.40 17.90 ? 116  GLU A CD    1 
ATOM   949  C  CD    B GLU A 1 119 ? 53.221 -2.049  -0.427  0.60 20.94 ? 116  GLU A CD    1 
ATOM   950  O  OE1   A GLU A 1 119 ? 53.349 -1.835  1.612   0.40 19.52 ? 116  GLU A OE1   1 
ATOM   951  O  OE1   B GLU A 1 119 ? 52.582 -1.341  0.375   0.60 17.59 ? 116  GLU A OE1   1 
ATOM   952  O  OE2   A GLU A 1 119 ? 53.408 -2.858  -0.328  0.40 22.20 ? 116  GLU A OE2   1 
ATOM   953  O  OE2   B GLU A 1 119 ? 53.547 -3.231  -0.192  0.60 23.30 ? 116  GLU A OE2   1 
ATOM   954  N  N     . ALA A 1 120 ? 56.077 -0.762  -4.380  1.00 9.87  ? 117  ALA A N     1 
ATOM   955  C  CA    . ALA A 1 120 ? 56.199 -1.395  -5.675  1.00 10.23 ? 117  ALA A CA    1 
ATOM   956  C  C     . ALA A 1 120 ? 57.121 -2.599  -5.566  1.00 9.01  ? 117  ALA A C     1 
ATOM   957  O  O     . ALA A 1 120 ? 58.133 -2.550  -4.869  1.00 9.66  ? 117  ALA A O     1 
ATOM   958  C  CB    . ALA A 1 120 ? 56.742 -0.406  -6.696  1.00 12.19 ? 117  ALA A CB    1 
ATOM   959  N  N     . TYR A 1 121 ? 56.766 -3.670  -6.260  1.00 8.26  ? 118  TYR A N     1 
ATOM   960  C  CA    . TYR A 1 121 ? 57.690 -4.787  -6.428  1.00 7.68  ? 118  TYR A CA    1 
ATOM   961  C  C     . TYR A 1 121 ? 58.521 -4.575  -7.665  1.00 10.71 ? 118  TYR A C     1 
ATOM   962  O  O     . TYR A 1 121 ? 58.053 -3.961  -8.633  1.00 11.01 ? 118  TYR A O     1 
ATOM   963  C  CB    . TYR A 1 121 ? 56.932 -6.106  -6.546  1.00 7.67  ? 118  TYR A CB    1 
ATOM   964  C  CG    . TYR A 1 121 ? 56.217 -6.488  -5.273  1.00 8.87  ? 118  TYR A CG    1 
ATOM   965  C  CD1   . TYR A 1 121 ? 54.893 -6.129  -5.063  1.00 10.88 ? 118  TYR A CD1   1 
ATOM   966  C  CD2   . TYR A 1 121 ? 56.878 -7.189  -4.274  1.00 8.81  ? 118  TYR A CD2   1 
ATOM   967  C  CE1   . TYR A 1 121 ? 54.230 -6.474  -3.897  1.00 13.71 ? 118  TYR A CE1   1 
ATOM   968  C  CE2   . TYR A 1 121 ? 56.224 -7.530  -3.090  1.00 10.44 ? 118  TYR A CE2   1 
ATOM   969  C  CZ    . TYR A 1 121 ? 54.904 -7.168  -2.916  1.00 13.59 ? 118  TYR A CZ    1 
ATOM   970  O  OH    . TYR A 1 121 ? 54.247 -7.511  -1.762  1.00 15.35 ? 118  TYR A OH    1 
ATOM   971  N  N     . VAL A 1 122 ? 59.751 -5.095  -7.628  1.00 8.10  ? 119  VAL A N     1 
ATOM   972  C  CA    . VAL A 1 122 ? 60.686 -5.017  -8.741  1.00 12.02 ? 119  VAL A CA    1 
ATOM   973  C  C     . VAL A 1 122 ? 61.250 -6.403  -9.022  1.00 14.93 ? 119  VAL A C     1 
ATOM   974  O  O     . VAL A 1 122 ? 61.712 -7.065  -8.093  1.00 11.02 ? 119  VAL A O     1 
ATOM   975  C  CB    . VAL A 1 122 ? 61.884 -4.118  -8.351  1.00 19.36 ? 119  VAL A CB    1 
ATOM   976  C  CG1   . VAL A 1 122 ? 62.405 -3.395  -9.559  1.00 29.82 ? 119  VAL A CG1   1 
ATOM   977  C  CG2   . VAL A 1 122 ? 61.473 -3.127  -7.258  1.00 21.27 ? 119  VAL A CG2   1 
ATOM   978  N  N     . ASP A 1 123 ? 61.236 -6.859  -10.277 1.00 13.65 ? 120  ASP A N     1 
ATOM   979  C  CA    . ASP A 1 123 ? 61.977 -8.082  -10.618 1.00 12.20 ? 120  ASP A CA    1 
ATOM   980  C  C     . ASP A 1 123 ? 63.364 -7.702  -11.113 1.00 14.19 ? 120  ASP A C     1 
ATOM   981  O  O     . ASP A 1 123 ? 63.518 -7.165  -12.203 1.00 18.82 ? 120  ASP A O     1 
ATOM   982  C  CB    . ASP A 1 123 ? 61.238 -8.975  -11.636 1.00 19.64 ? 120  ASP A CB    1 
ATOM   983  C  CG    . ASP A 1 123 ? 61.960 -10.307 -11.883 1.00 21.73 ? 120  ASP A CG    1 
ATOM   984  O  OD1   . ASP A 1 123 ? 63.192 -10.289 -12.049 1.00 17.68 ? 120  ASP A OD1   1 
ATOM   985  O  OD2   . ASP A 1 123 ? 61.314 -11.384 -11.889 1.00 25.18 ? 120  ASP A OD2   1 
ATOM   986  N  N     . LEU A 1 124 ? 64.370 -7.969  -10.288 1.00 12.82 ? 121  LEU A N     1 
ATOM   987  C  CA    . LEU A 1 124 ? 65.739 -7.558  -10.569 1.00 11.33 ? 121  LEU A CA    1 
ATOM   988  C  C     . LEU A 1 124 ? 66.595 -8.652  -11.205 1.00 9.76  ? 121  LEU A C     1 
ATOM   989  O  O     . LEU A 1 124 ? 67.806 -8.479  -11.362 1.00 13.02 ? 121  LEU A O     1 
ATOM   990  C  CB    . LEU A 1 124 ? 66.395 -7.070  -9.276  1.00 13.01 ? 121  LEU A CB    1 
ATOM   991  C  CG    . LEU A 1 124 ? 65.783 -5.780  -8.727  1.00 11.35 ? 121  LEU A CG    1 
ATOM   992  C  CD1   . LEU A 1 124 ? 66.395 -5.432  -7.396  1.00 16.78 ? 121  LEU A CD1   1 
ATOM   993  C  CD2   . LEU A 1 124 ? 65.966 -4.657  -9.751  1.00 17.63 ? 121  LEU A CD2   1 
ATOM   994  N  N     . THR A 1 125 ? 65.976 -9.780  -11.547 1.00 11.35 ? 122  THR A N     1 
ATOM   995  C  CA    . THR A 1 125 ? 66.738 -10.917 -12.058 1.00 12.00 ? 122  THR A CA    1 
ATOM   996  C  C     . THR A 1 125 ? 67.673 -10.505 -13.203 1.00 12.88 ? 122  THR A C     1 
ATOM   997  O  O     . THR A 1 125 ? 68.870 -10.776 -13.150 1.00 14.98 ? 122  THR A O     1 
ATOM   998  C  CB    . THR A 1 125 ? 65.821 -12.064 -12.485 1.00 17.14 ? 122  THR A CB    1 
ATOM   999  O  OG1   . THR A 1 125 ? 64.891 -12.333 -11.430 1.00 13.81 ? 122  THR A OG1   1 
ATOM   1000 C  CG2   . THR A 1 125 ? 66.640 -13.337 -12.779 1.00 16.26 ? 122  THR A CG2   1 
ATOM   1001 N  N     . SER A 1 126 ? 67.127 -9.820  -14.207 1.00 16.75 ? 123  SER A N     1 
ATOM   1002 C  CA    . SER A 1 126 ? 67.913 -9.427  -15.378 1.00 15.33 ? 123  SER A CA    1 
ATOM   1003 C  C     . SER A 1 126 ? 68.976 -8.362  -15.060 1.00 19.18 ? 123  SER A C     1 
ATOM   1004 O  O     . SER A 1 126 ? 70.123 -8.473  -15.496 1.00 18.91 ? 123  SER A O     1 
ATOM   1005 C  CB    . SER A 1 126 ? 66.999 -8.969  -16.518 1.00 18.69 ? 123  SER A CB    1 
ATOM   1006 O  OG    A SER A 1 126 ? 66.189 -10.031 -16.988 0.50 23.11 ? 123  SER A OG    1 
ATOM   1007 O  OG    B SER A 1 126 ? 66.266 -7.813  -16.168 0.50 20.09 ? 123  SER A OG    1 
ATOM   1008 N  N     . ALA A 1 127 ? 68.598 -7.338  -14.300 1.00 14.61 ? 124  ALA A N     1 
ATOM   1009 C  CA    . ALA A 1 127 ? 69.549 -6.323  -13.857 1.00 16.46 ? 124  ALA A CA    1 
ATOM   1010 C  C     . ALA A 1 127 ? 70.730 -6.930  -13.092 1.00 14.71 ? 124  ALA A C     1 
ATOM   1011 O  O     . ALA A 1 127 ? 71.872 -6.507  -13.259 1.00 16.64 ? 124  ALA A O     1 
ATOM   1012 C  CB    . ALA A 1 127 ? 68.849 -5.273  -13.001 1.00 13.69 ? 124  ALA A CB    1 
ATOM   1013 N  N     . VAL A 1 128 ? 70.446 -7.914  -12.236 1.00 12.51 ? 125  VAL A N     1 
ATOM   1014 C  CA    . VAL A 1 128 ? 71.499 -8.585  -11.480 1.00 15.94 ? 125  VAL A CA    1 
ATOM   1015 C  C     . VAL A 1 128 ? 72.470 -9.330  -12.395 1.00 16.72 ? 125  VAL A C     1 
ATOM   1016 O  O     . VAL A 1 128 ? 73.683 -9.231  -12.222 1.00 17.09 ? 125  VAL A O     1 
ATOM   1017 C  CB    . VAL A 1 128 ? 70.910 -9.549  -10.424 1.00 15.48 ? 125  VAL A CB    1 
ATOM   1018 C  CG1   . VAL A 1 128 ? 71.959 -10.548 -9.949  1.00 14.32 ? 125  VAL A CG1   1 
ATOM   1019 C  CG2   . VAL A 1 128 ? 70.389 -8.748  -9.257  1.00 13.84 ? 125  VAL A CG2   1 
ATOM   1020 N  N     . GLN A 1 129 ? 71.932 -10.069 -13.360 1.00 17.62 ? 126  GLN A N     1 
ATOM   1021 C  CA    . GLN A 1 129 ? 72.764 -10.752 -14.346 1.00 25.94 ? 126  GLN A CA    1 
ATOM   1022 C  C     . GLN A 1 129 ? 73.706 -9.774  -15.040 1.00 26.84 ? 126  GLN A C     1 
ATOM   1023 O  O     . GLN A 1 129 ? 74.903 -10.027 -15.159 1.00 27.15 ? 126  GLN A O     1 
ATOM   1024 C  CB    . GLN A 1 129 ? 71.897 -11.472 -15.377 1.00 28.18 ? 126  GLN A CB    1 
ATOM   1025 C  CG    . GLN A 1 129 ? 71.163 -12.672 -14.810 1.00 28.17 ? 126  GLN A CG    1 
ATOM   1026 C  CD    . GLN A 1 129 ? 72.109 -13.693 -14.196 1.00 42.99 ? 126  GLN A CD    1 
ATOM   1027 O  OE1   . GLN A 1 129 ? 72.039 -13.980 -12.999 1.00 41.46 ? 126  GLN A OE1   1 
ATOM   1028 N  NE2   . GLN A 1 129 ? 73.002 -14.242 -15.014 1.00 43.08 ? 126  GLN A NE2   1 
ATOM   1029 N  N     . GLU A 1 130 ? 73.155 -8.653  -15.493 1.00 23.47 ? 127  GLU A N     1 
ATOM   1030 C  CA    . GLU A 1 130 ? 73.953 -7.618  -16.139 1.00 27.84 ? 127  GLU A CA    1 
ATOM   1031 C  C     . GLU A 1 130 ? 75.080 -7.106  -15.240 1.00 30.35 ? 127  GLU A C     1 
ATOM   1032 O  O     . GLU A 1 130 ? 76.235 -7.024  -15.665 1.00 29.74 ? 127  GLU A O     1 
ATOM   1033 C  CB    . GLU A 1 130 ? 73.060 -6.453  -16.575 1.00 25.24 ? 127  GLU A CB    1 
ATOM   1034 C  CG    . GLU A 1 130 ? 72.108 -6.796  -17.707 1.00 36.02 ? 127  GLU A CG    1 
ATOM   1035 C  CD    . GLU A 1 130 ? 71.440 -5.561  -18.291 1.00 62.08 ? 127  GLU A CD    1 
ATOM   1036 O  OE1   . GLU A 1 130 ? 71.729 -4.440  -17.810 1.00 56.08 ? 127  GLU A OE1   1 
ATOM   1037 O  OE2   . GLU A 1 130 ? 70.630 -5.710  -19.231 1.00 68.66 ? 127  GLU A OE2   1 
ATOM   1038 N  N     . ARG A 1 131 ? 74.743 -6.764  -14.000 1.00 16.48 ? 128  ARG A N     1 
ATOM   1039 C  CA    . ARG A 1 131 ? 75.714 -6.205  -13.066 1.00 25.59 ? 128  ARG A CA    1 
ATOM   1040 C  C     . ARG A 1 131 ? 76.812 -7.224  -12.759 1.00 26.00 ? 128  ARG A C     1 
ATOM   1041 O  O     . ARG A 1 131 ? 77.980 -6.861  -12.609 1.00 27.27 ? 128  ARG A O     1 
ATOM   1042 C  CB    . ARG A 1 131 ? 75.007 -5.742  -11.786 1.00 20.59 ? 128  ARG A CB    1 
ATOM   1043 C  CG    A ARG A 1 131 ? 75.880 -5.021  -10.775 0.50 22.72 ? 128  ARG A CG    1 
ATOM   1044 C  CG    B ARG A 1 131 ? 75.918 -5.085  -10.756 0.50 22.77 ? 128  ARG A CG    1 
ATOM   1045 C  CD    A ARG A 1 131 ? 76.368 -3.688  -11.311 0.50 23.40 ? 128  ARG A CD    1 
ATOM   1046 C  CD    B ARG A 1 131 ? 76.571 -3.820  -11.304 0.50 23.54 ? 128  ARG A CD    1 
ATOM   1047 N  NE    A ARG A 1 131 ? 76.935 -2.863  -10.251 0.50 24.09 ? 128  ARG A NE    1 
ATOM   1048 N  NE    B ARG A 1 131 ? 75.580 -2.790  -11.593 0.50 21.84 ? 128  ARG A NE    1 
ATOM   1049 C  CZ    A ARG A 1 131 ? 76.229 -2.015  -9.510  0.50 20.86 ? 128  ARG A CZ    1 
ATOM   1050 C  CZ    B ARG A 1 131 ? 75.104 -1.944  -10.685 0.50 20.70 ? 128  ARG A CZ    1 
ATOM   1051 N  NH1   A ARG A 1 131 ? 76.828 -1.300  -8.567  0.50 21.01 ? 128  ARG A NH1   1 
ATOM   1052 N  NH1   B ARG A 1 131 ? 74.198 -1.040  -11.029 0.50 21.15 ? 128  ARG A NH1   1 
ATOM   1053 N  NH2   A ARG A 1 131 ? 74.924 -1.881  -9.715  0.50 19.70 ? 128  ARG A NH2   1 
ATOM   1054 N  NH2   B ARG A 1 131 ? 75.538 -1.999  -9.432  0.50 20.59 ? 128  ARG A NH2   1 
ATOM   1055 N  N     . LEU A 1 132 ? 76.435 -8.497  -12.672 1.00 22.00 ? 129  LEU A N     1 
ATOM   1056 C  CA    . LEU A 1 132 ? 77.399 -9.563  -12.405 1.00 20.52 ? 129  LEU A CA    1 
ATOM   1057 C  C     . LEU A 1 132 ? 78.432 -9.655  -13.522 1.00 33.48 ? 129  LEU A C     1 
ATOM   1058 O  O     . LEU A 1 132 ? 79.597 -9.969  -13.277 1.00 32.51 ? 129  LEU A O     1 
ATOM   1059 C  CB    . LEU A 1 132 ? 76.698 -10.915 -12.203 1.00 21.67 ? 129  LEU A CB    1 
ATOM   1060 C  CG    . LEU A 1 132 ? 76.123 -11.137 -10.795 1.00 21.98 ? 129  LEU A CG    1 
ATOM   1061 C  CD1   . LEU A 1 132 ? 75.209 -12.359 -10.723 1.00 20.99 ? 129  LEU A CD1   1 
ATOM   1062 C  CD2   . LEU A 1 132 ? 77.250 -11.228 -9.771  1.00 24.93 ? 129  LEU A CD2   1 
ATOM   1063 N  N     . GLN A 1 133 ? 77.996 -9.370  -14.745 1.00 32.72 ? 130  GLN A N     1 
ATOM   1064 C  CA    . GLN A 1 133 ? 78.898 -9.344  -15.892 1.00 37.65 ? 130  GLN A CA    1 
ATOM   1065 C  C     . GLN A 1 133 ? 79.928 -8.228  -15.764 1.00 40.29 ? 130  GLN A C     1 
ATOM   1066 O  O     . GLN A 1 133 ? 81.115 -8.449  -15.983 1.00 48.29 ? 130  GLN A O     1 
ATOM   1067 C  CB    . GLN A 1 133 ? 78.114 -9.195  -17.194 1.00 40.75 ? 130  GLN A CB    1 
ATOM   1068 C  CG    . GLN A 1 133 ? 77.146 -10.341 -17.463 1.00 46.24 ? 130  GLN A CG    1 
ATOM   1069 C  CD    . GLN A 1 133 ? 77.840 -11.687 -17.549 1.00 59.02 ? 130  GLN A CD    1 
ATOM   1070 O  OE1   . GLN A 1 133 ? 79.071 -11.769 -17.542 1.00 65.34 ? 130  GLN A OE1   1 
ATOM   1071 N  NE2   . GLN A 1 133 ? 77.051 -12.754 -17.633 1.00 62.40 ? 130  GLN A NE2   1 
ATOM   1072 N  N     . LYS A 1 134 ? 79.479 -7.031  -15.403 1.00 36.61 ? 131  LYS A N     1 
ATOM   1073 C  CA    . LYS A 1 134 ? 80.404 -5.918  -15.208 1.00 44.32 ? 131  LYS A CA    1 
ATOM   1074 C  C     . LYS A 1 134 ? 81.404 -6.218  -14.097 1.00 48.66 ? 131  LYS A C     1 
ATOM   1075 O  O     . LYS A 1 134 ? 82.606 -6.004  -14.257 1.00 49.10 ? 131  LYS A O     1 
ATOM   1076 C  CB    . LYS A 1 134 ? 79.653 -4.623  -14.892 1.00 43.22 ? 131  LYS A CB    1 
ATOM   1077 C  CG    . LYS A 1 134 ? 78.776 -4.115  -16.020 1.00 48.31 ? 131  LYS A CG    1 
ATOM   1078 C  CD    . LYS A 1 134 ? 78.367 -2.671  -15.773 1.00 51.35 ? 131  LYS A CD    1 
ATOM   1079 C  CE    . LYS A 1 134 ? 77.777 -2.497  -14.380 1.00 46.92 ? 131  LYS A CE    1 
ATOM   1080 N  NZ    . LYS A 1 134 ? 77.319 -1.101  -14.126 1.00 48.31 ? 131  LYS A NZ    1 
ATOM   1081 N  N     . LEU A 1 135 ? 80.900 -6.714  -12.972 1.00 35.81 ? 132  LEU A N     1 
ATOM   1082 C  CA    . LEU A 1 135 ? 81.738 -7.017  -11.817 1.00 46.58 ? 132  LEU A CA    1 
ATOM   1083 C  C     . LEU A 1 135 ? 82.914 -7.926  -12.168 1.00 49.72 ? 132  LEU A C     1 
ATOM   1084 O  O     . LEU A 1 135 ? 84.021 -7.744  -11.659 1.00 51.53 ? 132  LEU A O     1 
ATOM   1085 C  CB    . LEU A 1 135 ? 80.900 -7.644  -10.701 1.00 40.53 ? 132  LEU A CB    1 
ATOM   1086 C  CG    . LEU A 1 135 ? 80.292 -6.662  -9.697  1.00 43.03 ? 132  LEU A CG    1 
ATOM   1087 C  CD1   . LEU A 1 135 ? 79.837 -5.383  -10.385 1.00 44.12 ? 132  LEU A CD1   1 
ATOM   1088 C  CD2   . LEU A 1 135 ? 79.148 -7.311  -8.931  1.00 37.92 ? 132  LEU A CD2   1 
ATOM   1089 N  N     . GLN A 1 136 ? 82.663 -8.903  -13.035 1.00 47.37 ? 133  GLN A N     1 
ATOM   1090 C  CA    . GLN A 1 136 ? 83.694 -9.846  -13.464 1.00 52.63 ? 133  GLN A CA    1 
ATOM   1091 C  C     . GLN A 1 136 ? 84.424 -10.515 -12.297 1.00 50.61 ? 133  GLN A C     1 
ATOM   1092 O  O     . GLN A 1 136 ? 85.640 -10.366 -12.150 1.00 43.50 ? 133  GLN A O     1 
ATOM   1093 C  CB    . GLN A 1 136 ? 84.702 -9.161  -14.394 1.00 51.42 ? 133  GLN A CB    1 
ATOM   1094 C  CG    . GLN A 1 136 ? 84.128 -8.709  -15.735 1.00 56.64 ? 133  GLN A CG    1 
ATOM   1095 C  CD    . GLN A 1 136 ? 83.601 -9.864  -16.579 1.00 62.21 ? 133  GLN A CD    1 
ATOM   1096 O  OE1   . GLN A 1 136 ? 82.731 -10.624 -16.147 1.00 62.81 ? 133  GLN A OE1   1 
ATOM   1097 N  NE2   . GLN A 1 136 ? 84.127 -9.997  -17.792 1.00 65.60 ? 133  GLN A NE2   1 
ATOM   1098 N  N     . GLY A 1 137 ? 83.676 -11.248 -11.474 1.00 44.56 ? 134  GLY A N     1 
ATOM   1099 C  CA    . GLY A 1 137 ? 84.249 -12.022 -10.384 1.00 45.07 ? 134  GLY A CA    1 
ATOM   1100 C  C     . GLY A 1 137 ? 84.727 -11.210 -9.193  1.00 46.21 ? 134  GLY A C     1 
ATOM   1101 O  O     . GLY A 1 137 ? 85.044 -11.766 -8.142  1.00 54.32 ? 134  GLY A O     1 
ATOM   1102 N  N     . GLN A 1 138 ? 84.777 -9.893  -9.356  1.00 43.72 ? 135  GLN A N     1 
ATOM   1103 C  CA    . GLN A 1 138 ? 85.224 -8.996  -8.296  1.00 44.83 ? 135  GLN A CA    1 
ATOM   1104 C  C     . GLN A 1 138 ? 84.269 -9.006  -7.104  1.00 42.85 ? 135  GLN A C     1 
ATOM   1105 O  O     . GLN A 1 138 ? 83.055 -8.918  -7.274  1.00 39.49 ? 135  GLN A O     1 
ATOM   1106 C  CB    . GLN A 1 138 ? 85.352 -7.578  -8.849  1.00 50.26 ? 135  GLN A CB    1 
ATOM   1107 C  CG    . GLN A 1 138 ? 85.655 -6.518  -7.816  1.00 49.35 ? 135  GLN A CG    1 
ATOM   1108 C  CD    . GLN A 1 138 ? 85.656 -5.129  -8.421  1.00 64.44 ? 135  GLN A CD    1 
ATOM   1109 O  OE1   . GLN A 1 138 ? 85.329 -4.955  -9.597  1.00 65.59 ? 135  GLN A OE1   1 
ATOM   1110 N  NE2   . GLN A 1 138 ? 86.025 -4.132  -7.623  1.00 53.02 ? 135  GLN A NE2   1 
ATOM   1111 N  N     . PRO A 1 139 ? 84.824 -9.096  -5.888  1.00 41.78 ? 136  PRO A N     1 
ATOM   1112 C  CA    . PRO A 1 139 ? 84.044 -9.180  -4.649  1.00 38.82 ? 136  PRO A CA    1 
ATOM   1113 C  C     . PRO A 1 139 ? 83.182 -7.942  -4.427  1.00 37.95 ? 136  PRO A C     1 
ATOM   1114 O  O     . PRO A 1 139 ? 83.399 -6.910  -5.060  1.00 35.23 ? 136  PRO A O     1 
ATOM   1115 C  CB    . PRO A 1 139 ? 85.124 -9.263  -3.568  1.00 40.43 ? 136  PRO A CB    1 
ATOM   1116 C  CG    . PRO A 1 139 ? 86.306 -8.595  -4.178  1.00 39.85 ? 136  PRO A CG    1 
ATOM   1117 C  CD    . PRO A 1 139 ? 86.268 -9.001  -5.617  1.00 46.09 ? 136  PRO A CD    1 
ATOM   1118 N  N     . ILE A 1 140 ? 82.207 -8.053  -3.534  1.00 35.46 ? 137  ILE A N     1 
ATOM   1119 C  CA    . ILE A 1 140 ? 81.325 -6.939  -3.228  1.00 30.33 ? 137  ILE A CA    1 
ATOM   1120 C  C     . ILE A 1 140 ? 81.713 -6.329  -1.894  1.00 26.22 ? 137  ILE A C     1 
ATOM   1121 O  O     . ILE A 1 140 ? 81.712 -7.001  -0.866  1.00 25.38 ? 137  ILE A O     1 
ATOM   1122 C  CB    . ILE A 1 140 ? 79.852 -7.385  -3.197  1.00 25.38 ? 137  ILE A CB    1 
ATOM   1123 C  CG1   . ILE A 1 140 ? 79.452 -7.933  -4.569  1.00 33.88 ? 137  ILE A CG1   1 
ATOM   1124 C  CG2   . ILE A 1 140 ? 78.950 -6.231  -2.780  1.00 24.01 ? 137  ILE A CG2   1 
ATOM   1125 C  CD1   . ILE A 1 140 ? 78.093 -8.578  -4.599  1.00 35.23 ? 137  ILE A CD1   1 
ATOM   1126 N  N     . SER A 1 141 ? 82.054 -5.048  -1.923  1.00 24.43 ? 138  SER A N     1 
ATOM   1127 C  CA    . SER A 1 141 ? 82.475 -4.325  -0.731  1.00 23.60 ? 138  SER A CA    1 
ATOM   1128 C  C     . SER A 1 141 ? 81.291 -3.978  0.171   1.00 20.48 ? 138  SER A C     1 
ATOM   1129 O  O     . SER A 1 141 ? 80.197 -3.685  -0.318  1.00 23.08 ? 138  SER A O     1 
ATOM   1130 C  CB    . SER A 1 141 ? 83.214 -3.049  -1.151  1.00 25.25 ? 138  SER A CB    1 
ATOM   1131 O  OG    . SER A 1 141 ? 83.356 -2.146  -0.073  1.00 29.17 ? 138  SER A OG    1 
ATOM   1132 N  N     . ALA A 1 142 ? 81.509 -4.016  1.482   1.00 19.42 ? 139  ALA A N     1 
ATOM   1133 C  CA    . ALA A 1 142 ? 80.479 -3.608  2.432   1.00 20.97 ? 139  ALA A CA    1 
ATOM   1134 C  C     . ALA A 1 142 ? 80.066 -2.162  2.174   1.00 23.53 ? 139  ALA A C     1 
ATOM   1135 O  O     . ALA A 1 142 ? 78.944 -1.762  2.483   1.00 17.97 ? 139  ALA A O     1 
ATOM   1136 C  CB    . ALA A 1 142 ? 80.958 -3.775  3.860   1.00 22.30 ? 139  ALA A CB    1 
ATOM   1137 N  N     . ASP A 1 143 ? 80.977 -1.379  1.603   1.00 21.95 ? 140  ASP A N     1 
ATOM   1138 C  CA    . ASP A 1 143 ? 80.698 0.025   1.343   1.00 27.10 ? 140  ASP A CA    1 
ATOM   1139 C  C     . ASP A 1 143 ? 79.550 0.205   0.363   1.00 24.29 ? 140  ASP A C     1 
ATOM   1140 O  O     . ASP A 1 143 ? 78.944 1.279   0.308   1.00 22.68 ? 140  ASP A O     1 
ATOM   1141 C  CB    . ASP A 1 143 ? 81.943 0.744   0.826   1.00 24.72 ? 140  ASP A CB    1 
ATOM   1142 C  CG    . ASP A 1 143 ? 83.050 0.797   1.858   1.00 41.86 ? 140  ASP A CG    1 
ATOM   1143 O  OD1   . ASP A 1 143 ? 82.742 0.663   3.065   1.00 36.28 ? 140  ASP A OD1   1 
ATOM   1144 O  OD2   . ASP A 1 143 ? 84.223 0.976   1.464   1.00 50.50 ? 140  ASP A OD2   1 
ATOM   1145 N  N     . LEU A 1 144 ? 79.248 -0.842  -0.402  1.00 17.36 ? 141  LEU A N     1 
ATOM   1146 C  CA    . LEU A 1 144 ? 78.174 -0.776  -1.385  1.00 18.93 ? 141  LEU A CA    1 
ATOM   1147 C  C     . LEU A 1 144 ? 76.817 -1.121  -0.771  1.00 14.24 ? 141  LEU A C     1 
ATOM   1148 O  O     . LEU A 1 144 ? 75.796 -1.015  -1.434  1.00 15.12 ? 141  LEU A O     1 
ATOM   1149 C  CB    . LEU A 1 144 ? 78.449 -1.706  -2.560  1.00 14.56 ? 141  LEU A CB    1 
ATOM   1150 C  CG    . LEU A 1 144 ? 79.648 -1.383  -3.453  1.00 16.68 ? 141  LEU A CG    1 
ATOM   1151 C  CD1   . LEU A 1 144 ? 79.764 -2.408  -4.569  1.00 25.72 ? 141  LEU A CD1   1 
ATOM   1152 C  CD2   . LEU A 1 144 ? 79.486 0.013   -4.021  1.00 27.68 ? 141  LEU A CD2   1 
ATOM   1153 N  N     . LEU A 1 145 ? 76.820 -1.515  0.495   1.00 13.36 ? 142  LEU A N     1 
ATOM   1154 C  CA    . LEU A 1 145 ? 75.603 -1.932  1.187   1.00 13.54 ? 142  LEU A CA    1 
ATOM   1155 C  C     . LEU A 1 145 ? 75.466 -1.198  2.515   1.00 13.98 ? 142  LEU A C     1 
ATOM   1156 O  O     . LEU A 1 145 ? 75.306 -1.819  3.570   1.00 13.60 ? 142  LEU A O     1 
ATOM   1157 C  CB    . LEU A 1 145 ? 75.646 -3.458  1.395   1.00 12.07 ? 142  LEU A CB    1 
ATOM   1158 C  CG    . LEU A 1 145 ? 75.598 -4.248  0.085   1.00 10.81 ? 142  LEU A CG    1 
ATOM   1159 C  CD1   . LEU A 1 145 ? 76.023 -5.718  0.271   1.00 16.07 ? 142  LEU A CD1   1 
ATOM   1160 C  CD2   . LEU A 1 145 ? 74.218 -4.185  -0.545  1.00 16.80 ? 142  LEU A CD2   1 
ATOM   1161 N  N     . PRO A 1 146 ? 75.506 0.147   2.468   1.00 14.03 ? 143  PRO A N     1 
ATOM   1162 C  CA    . PRO A 1 146 ? 75.564 0.963   3.689   1.00 17.19 ? 143  PRO A CA    1 
ATOM   1163 C  C     . PRO A 1 146 ? 74.307 0.928   4.559   1.00 16.56 ? 143  PRO A C     1 
ATOM   1164 O  O     . PRO A 1 146 ? 74.380 1.348   5.708   1.00 17.03 ? 143  PRO A O     1 
ATOM   1165 C  CB    . PRO A 1 146 ? 75.790 2.382   3.147   1.00 20.92 ? 143  PRO A CB    1 
ATOM   1166 C  CG    . PRO A 1 146 ? 75.206 2.353   1.770   1.00 16.48 ? 143  PRO A CG    1 
ATOM   1167 C  CD    . PRO A 1 146 ? 75.507 0.974   1.245   1.00 14.94 ? 143  PRO A CD    1 
ATOM   1168 N  N     . SER A 1 147 ? 73.182 0.439   4.043   1.00 15.06 ? 144  SER A N     1 
ATOM   1169 C  CA    . SER A 1 147 ? 71.958 0.425   4.841   1.00 12.89 ? 144  SER A CA    1 
ATOM   1170 C  C     . SER A 1 147 ? 71.269 -0.943  4.832   1.00 12.35 ? 144  SER A C     1 
ATOM   1171 O  O     . SER A 1 147 ? 70.083 -1.054  5.140   1.00 12.17 ? 144  SER A O     1 
ATOM   1172 C  CB    . SER A 1 147 ? 70.986 1.521   4.380   1.00 16.39 ? 144  SER A CB    1 
ATOM   1173 O  OG    . SER A 1 147 ? 70.523 1.290   3.061   1.00 16.34 ? 144  SER A OG    1 
ATOM   1174 N  N     . THR A 1 148 ? 72.047 -1.975  4.523   1.00 10.75 ? 145  THR A N     1 
ATOM   1175 C  CA    . THR A 1 148 ? 71.532 -3.335  4.364   1.00 10.49 ? 145  THR A CA    1 
ATOM   1176 C  C     . THR A 1 148 ? 71.714 -4.186  5.618   1.00 12.21 ? 145  THR A C     1 
ATOM   1177 O  O     . THR A 1 148 ? 72.789 -4.195  6.240   1.00 13.97 ? 145  THR A O     1 
ATOM   1178 C  CB    . THR A 1 148 ? 72.229 -4.028  3.173   1.00 10.27 ? 145  THR A CB    1 
ATOM   1179 O  OG1   . THR A 1 148 ? 71.882 -3.340  1.968   1.00 10.48 ? 145  THR A OG1   1 
ATOM   1180 C  CG2   . THR A 1 148 ? 71.795 -5.491  3.053   1.00 10.83 ? 145  THR A CG2   1 
ATOM   1181 N  N     . TYR A 1 149 ? 70.645 -4.876  5.992   1.00 10.02 ? 146  TYR A N     1 
ATOM   1182 C  CA    . TYR A 1 149 ? 70.692 -5.902  7.029   1.00 10.54 ? 146  TYR A CA    1 
ATOM   1183 C  C     . TYR A 1 149 ? 70.619 -7.251  6.355   1.00 13.46 ? 146  TYR A C     1 
ATOM   1184 O  O     . TYR A 1 149 ? 69.864 -7.428  5.394   1.00 12.60 ? 146  TYR A O     1 
ATOM   1185 C  CB    . TYR A 1 149 ? 69.496 -5.780  7.965   1.00 10.37 ? 146  TYR A CB    1 
ATOM   1186 C  CG    . TYR A 1 149 ? 69.666 -4.711  9.014   1.00 9.92  ? 146  TYR A CG    1 
ATOM   1187 C  CD1   . TYR A 1 149 ? 70.082 -5.042  10.297  1.00 12.67 ? 146  TYR A CD1   1 
ATOM   1188 C  CD2   . TYR A 1 149 ? 69.422 -3.369  8.714   1.00 13.60 ? 146  TYR A CD2   1 
ATOM   1189 C  CE1   . TYR A 1 149 ? 70.242 -4.068  11.263  1.00 16.34 ? 146  TYR A CE1   1 
ATOM   1190 C  CE2   . TYR A 1 149 ? 69.581 -2.380  9.683   1.00 14.77 ? 146  TYR A CE2   1 
ATOM   1191 C  CZ    . TYR A 1 149 ? 69.997 -2.744  10.951  1.00 16.69 ? 146  TYR A CZ    1 
ATOM   1192 O  OH    . TYR A 1 149 ? 70.158 -1.786  11.925  1.00 24.01 ? 146  TYR A OH    1 
ATOM   1193 N  N     . ILE A 1 150 ? 71.390 -8.209  6.862   1.00 10.39 ? 147  ILE A N     1 
ATOM   1194 C  CA    . ILE A 1 150 ? 71.263 -9.591  6.415   1.00 8.31  ? 147  ILE A CA    1 
ATOM   1195 C  C     . ILE A 1 150 ? 70.494 -10.371 7.481   1.00 10.58 ? 147  ILE A C     1 
ATOM   1196 O  O     . ILE A 1 150 ? 70.991 -10.577 8.584   1.00 11.06 ? 147  ILE A O     1 
ATOM   1197 C  CB    . ILE A 1 150 ? 72.637 -10.241 6.197   1.00 10.24 ? 147  ILE A CB    1 
ATOM   1198 C  CG1   . ILE A 1 150 ? 73.504 -9.370  5.275   1.00 10.57 ? 147  ILE A CG1   1 
ATOM   1199 C  CG2   . ILE A 1 150 ? 72.467 -11.677 5.640   1.00 9.49  ? 147  ILE A CG2   1 
ATOM   1200 C  CD1   . ILE A 1 150 ? 72.909 -9.124  3.863   1.00 10.97 ? 147  ILE A CD1   1 
ATOM   1201 N  N     . GLU A 1 151 ? 69.267 -10.782 7.171   1.00 9.36  ? 148  GLU A N     1 
ATOM   1202 C  CA    . GLU A 1 151 ? 68.429 -11.406 8.193   1.00 9.91  ? 148  GLU A CA    1 
ATOM   1203 C  C     . GLU A 1 151 ? 69.060 -12.704 8.690   1.00 11.99 ? 148  GLU A C     1 
ATOM   1204 O  O     . GLU A 1 151 ? 69.497 -13.518 7.889   1.00 10.97 ? 148  GLU A O     1 
ATOM   1205 C  CB    . GLU A 1 151 ? 67.012 -11.669 7.654   1.00 11.09 ? 148  GLU A CB    1 
ATOM   1206 C  CG    . GLU A 1 151 ? 66.099 -12.444 8.633   1.00 12.42 ? 148  GLU A CG    1 
ATOM   1207 C  CD    . GLU A 1 151 ? 65.913 -11.755 9.983   1.00 17.73 ? 148  GLU A CD    1 
ATOM   1208 O  OE1   . GLU A 1 151 ? 65.666 -12.452 10.992  1.00 19.71 ? 148  GLU A OE1   1 
ATOM   1209 O  OE2   . GLU A 1 151 ? 65.995 -10.514 10.040  1.00 20.16 ? 148  GLU A OE2   1 
ATOM   1210 N  N     . GLY A 1 152 ? 69.129 -12.866 10.015  1.00 10.41 ? 149  GLY A N     1 
ATOM   1211 C  CA    . GLY A 1 152 ? 69.714 -14.049 10.628  1.00 14.45 ? 149  GLY A CA    1 
ATOM   1212 C  C     . GLY A 1 152 ? 71.164 -13.892 11.064  1.00 17.12 ? 149  GLY A C     1 
ATOM   1213 O  O     . GLY A 1 152 ? 71.693 -14.725 11.804  1.00 17.62 ? 149  GLY A O     1 
ATOM   1214 N  N     . LEU A 1 153 ? 71.816 -12.832 10.603  1.00 12.09 ? 150  LEU A N     1 
ATOM   1215 C  CA    . LEU A 1 153 ? 73.193 -12.565 11.013  1.00 14.19 ? 150  LEU A CA    1 
ATOM   1216 C  C     . LEU A 1 153 ? 73.280 -11.261 11.806  1.00 18.38 ? 150  LEU A C     1 
ATOM   1217 O  O     . LEU A 1 153 ? 72.422 -10.392 11.666  1.00 16.61 ? 150  LEU A O     1 
ATOM   1218 C  CB    . LEU A 1 153 ? 74.101 -12.519 9.790   1.00 11.80 ? 150  LEU A CB    1 
ATOM   1219 C  CG    . LEU A 1 153 ? 74.095 -13.782 8.934   1.00 14.98 ? 150  LEU A CG    1 
ATOM   1220 C  CD1   . LEU A 1 153 ? 74.959 -13.575 7.699   1.00 12.44 ? 150  LEU A CD1   1 
ATOM   1221 C  CD2   . LEU A 1 153 ? 74.579 -14.985 9.759   1.00 16.77 ? 150  LEU A CD2   1 
ATOM   1222 N  N     . PRO A 1 154 ? 74.316 -11.121 12.657  1.00 15.30 ? 151  PRO A N     1 
ATOM   1223 C  CA    . PRO A 1 154 ? 75.369 -12.113 12.901  1.00 16.14 ? 151  PRO A CA    1 
ATOM   1224 C  C     . PRO A 1 154 ? 74.885 -13.290 13.743  1.00 12.56 ? 151  PRO A C     1 
ATOM   1225 O  O     . PRO A 1 154 ? 73.878 -13.205 14.449  1.00 18.98 ? 151  PRO A O     1 
ATOM   1226 C  CB    . PRO A 1 154 ? 76.408 -11.319 13.708  1.00 16.13 ? 151  PRO A CB    1 
ATOM   1227 C  CG    . PRO A 1 154 ? 75.604 -10.288 14.425  1.00 20.23 ? 151  PRO A CG    1 
ATOM   1228 C  CD    . PRO A 1 154 ? 74.538 -9.885  13.426  1.00 17.67 ? 151  PRO A CD    1 
ATOM   1229 N  N     . GLN A 1 155 ? 75.626 -14.387 13.675  1.00 18.34 ? 152  GLN A N     1 
ATOM   1230 C  CA    . GLN A 1 155 ? 75.323 -15.563 14.469  1.00 22.64 ? 152  GLN A CA    1 
ATOM   1231 C  C     . GLN A 1 155 ? 76.618 -16.283 14.811  1.00 31.65 ? 152  GLN A C     1 
ATOM   1232 O  O     . GLN A 1 155 ? 77.638 -16.077 14.154  1.00 30.44 ? 152  GLN A O     1 
ATOM   1233 C  CB    . GLN A 1 155 ? 74.425 -16.517 13.682  1.00 24.85 ? 152  GLN A CB    1 
ATOM   1234 C  CG    . GLN A 1 155 ? 74.769 -17.983 13.915  1.00 35.75 ? 152  GLN A CG    1 
ATOM   1235 C  CD    . GLN A 1 155 ? 74.715 -18.803 12.648  1.00 36.17 ? 152  GLN A CD    1 
ATOM   1236 O  OE1   . GLN A 1 155 ? 73.631 -19.114 12.148  1.00 34.19 ? 152  GLN A OE1   1 
ATOM   1237 N  NE2   . GLN A 1 155 ? 75.884 -19.157 12.113  1.00 29.84 ? 152  GLN A NE2   1 
ATOM   1238 N  N     . GLY A 1 156 ? 76.571 -17.126 15.840  1.00 34.53 ? 153  GLY A N     1 
ATOM   1239 C  CA    . GLY A 1 156 ? 77.635 -18.080 16.095  1.00 40.45 ? 153  GLY A CA    1 
ATOM   1240 C  C     . GLY A 1 156 ? 78.644 -17.649 17.139  1.00 42.99 ? 153  GLY A C     1 
ATOM   1241 O  O     . GLY A 1 156 ? 78.451 -16.637 17.817  1.00 45.37 ? 153  GLY A O     1 
ATOM   1242 N  N     . PRO A 1 157 ? 79.736 -18.424 17.264  1.00 48.27 ? 154  PRO A N     1 
ATOM   1243 C  CA    . PRO A 1 157 ? 80.825 -18.218 18.224  1.00 41.38 ? 154  PRO A CA    1 
ATOM   1244 C  C     . PRO A 1 157 ? 81.670 -17.001 17.866  1.00 42.44 ? 154  PRO A C     1 
ATOM   1245 O  O     . PRO A 1 157 ? 81.623 -16.585 16.710  1.00 44.18 ? 154  PRO A O     1 
ATOM   1246 C  CB    . PRO A 1 157 ? 81.658 -19.493 18.073  1.00 28.62 ? 154  PRO A CB    1 
ATOM   1247 C  CG    . PRO A 1 157 ? 81.432 -19.918 16.667  1.00 28.54 ? 154  PRO A CG    1 
ATOM   1248 C  CD    . PRO A 1 157 ? 79.989 -19.582 16.388  1.00 38.46 ? 154  PRO A CD    1 
ATOM   1249 N  N     . THR A 1 163 ? 80.105 -5.752  20.519  1.00 55.04 ? 160  THR A N     1 
ATOM   1250 C  CA    . THR A 1 163 ? 79.354 -4.513  20.334  1.00 58.45 ? 160  THR A CA    1 
ATOM   1251 C  C     . THR A 1 163 ? 77.925 -4.640  20.854  1.00 54.76 ? 160  THR A C     1 
ATOM   1252 O  O     . THR A 1 163 ? 77.309 -5.706  20.765  1.00 55.45 ? 160  THR A O     1 
ATOM   1253 C  CB    . THR A 1 163 ? 79.312 -4.083  18.852  1.00 53.90 ? 160  THR A CB    1 
ATOM   1254 O  OG1   . THR A 1 163 ? 78.542 -2.880  18.722  1.00 53.46 ? 160  THR A OG1   1 
ATOM   1255 C  CG2   . THR A 1 163 ? 78.682 -5.172  17.998  1.00 52.04 ? 160  THR A CG2   1 
ATOM   1256 N  N     . VAL A 1 164 ? 77.401 -3.545  21.392  1.00 49.92 ? 161  VAL A N     1 
ATOM   1257 C  CA    . VAL A 1 164 ? 76.046 -3.538  21.930  1.00 48.61 ? 161  VAL A CA    1 
ATOM   1258 C  C     . VAL A 1 164 ? 75.190 -2.473  21.245  1.00 49.31 ? 161  VAL A C     1 
ATOM   1259 O  O     . VAL A 1 164 ? 74.121 -2.110  21.740  1.00 48.94 ? 161  VAL A O     1 
ATOM   1260 C  CB    . VAL A 1 164 ? 76.046 -3.314  23.462  1.00 48.32 ? 161  VAL A CB    1 
ATOM   1261 C  CG1   . VAL A 1 164 ? 76.843 -4.414  24.164  1.00 37.44 ? 161  VAL A CG1   1 
ATOM   1262 C  CG2   . VAL A 1 164 ? 76.601 -1.934  23.807  1.00 42.48 ? 161  VAL A CG2   1 
ATOM   1263 N  N     . GLN A 1 165 ? 75.668 -1.981  20.103  1.00 39.61 ? 162  GLN A N     1 
ATOM   1264 C  CA    . GLN A 1 165 ? 74.973 -0.941  19.349  1.00 43.92 ? 162  GLN A CA    1 
ATOM   1265 C  C     . GLN A 1 165 ? 74.335 -1.496  18.075  1.00 39.53 ? 162  GLN A C     1 
ATOM   1266 O  O     . GLN A 1 165 ? 74.755 -2.529  17.552  1.00 36.62 ? 162  GLN A O     1 
ATOM   1267 C  CB    . GLN A 1 165 ? 75.934 0.193   18.991  1.00 40.99 ? 162  GLN A CB    1 
ATOM   1268 C  CG    . GLN A 1 165 ? 77.134 -0.254  18.167  1.00 48.57 ? 162  GLN A CG    1 
ATOM   1269 C  CD    . GLN A 1 165 ? 78.129 0.867   17.914  1.00 60.60 ? 162  GLN A CD    1 
ATOM   1270 O  OE1   . GLN A 1 165 ? 78.090 1.908   18.572  1.00 70.17 ? 162  GLN A OE1   1 
ATOM   1271 N  NE2   . GLN A 1 165 ? 79.027 0.658   16.956  1.00 51.59 ? 162  GLN A NE2   1 
ATOM   1272 N  N     . LYS A 1 166 ? 73.326 -0.792  17.577  1.00 34.40 ? 163  LYS A N     1 
ATOM   1273 C  CA    . LYS A 1 166 ? 72.546 -1.260  16.438  1.00 37.96 ? 163  LYS A CA    1 
ATOM   1274 C  C     . LYS A 1 166 ? 73.351 -1.303  15.141  1.00 29.10 ? 163  LYS A C     1 
ATOM   1275 O  O     . LYS A 1 166 ? 73.336 -2.306  14.423  1.00 24.06 ? 163  LYS A O     1 
ATOM   1276 C  CB    . LYS A 1 166 ? 71.307 -0.384  16.263  1.00 35.96 ? 163  LYS A CB    1 
ATOM   1277 C  CG    . LYS A 1 166 ? 70.391 -0.807  15.137  1.00 40.34 ? 163  LYS A CG    1 
ATOM   1278 C  CD    . LYS A 1 166 ? 69.218 0.151   15.015  1.00 49.22 ? 163  LYS A CD    1 
ATOM   1279 C  CE    . LYS A 1 166 ? 69.699 1.587   14.840  1.00 49.78 ? 163  LYS A CE    1 
ATOM   1280 N  NZ    . LYS A 1 166 ? 68.569 2.562   14.840  1.00 57.13 ? 163  LYS A NZ    1 
ATOM   1281 N  N     . GLU A 1 167 ? 74.043 -0.213  14.832  1.00 24.75 ? 164  GLU A N     1 
ATOM   1282 C  CA    . GLU A 1 167 ? 74.801 -0.134  13.589  1.00 27.97 ? 164  GLU A CA    1 
ATOM   1283 C  C     . GLU A 1 167 ? 75.962 -1.130  13.592  1.00 28.41 ? 164  GLU A C     1 
ATOM   1284 O  O     . GLU A 1 167 ? 76.318 -1.684  12.554  1.00 23.40 ? 164  GLU A O     1 
ATOM   1285 C  CB    . GLU A 1 167 ? 75.285 1.300   13.337  1.00 30.50 ? 164  GLU A CB    1 
ATOM   1286 C  CG    . GLU A 1 167 ? 76.239 1.473   12.153  1.00 22.03 ? 164  GLU A CG    1 
ATOM   1287 C  CD    . GLU A 1 167 ? 75.625 1.118   10.796  1.00 33.96 ? 164  GLU A CD    1 
ATOM   1288 O  OE1   . GLU A 1 167 ? 76.389 1.054   9.807   1.00 32.04 ? 164  GLU A OE1   1 
ATOM   1289 O  OE2   . GLU A 1 167 ? 74.391 0.914   10.706  1.00 31.02 ? 164  GLU A OE2   1 
ATOM   1290 N  N     . GLY A 1 168 ? 76.537 -1.368  14.765  1.00 31.08 ? 165  GLY A N     1 
ATOM   1291 C  CA    . GLY A 1 168 ? 77.617 -2.326  14.899  1.00 32.92 ? 165  GLY A CA    1 
ATOM   1292 C  C     . GLY A 1 168 ? 77.162 -3.737  14.584  1.00 25.54 ? 165  GLY A C     1 
ATOM   1293 O  O     . GLY A 1 168 ? 77.851 -4.476  13.881  1.00 29.15 ? 165  GLY A O     1 
ATOM   1294 N  N     . MET A 1 169 ? 76.002 -4.111  15.116  1.00 27.45 ? 166  MET A N     1 
ATOM   1295 C  CA    . MET A 1 169 ? 75.405 -5.409  14.826  1.00 25.79 ? 166  MET A CA    1 
ATOM   1296 C  C     . MET A 1 169 ? 75.155 -5.550  13.325  1.00 22.25 ? 166  MET A C     1 
ATOM   1297 O  O     . MET A 1 169 ? 75.513 -6.564  12.725  1.00 22.23 ? 166  MET A O     1 
ATOM   1298 C  CB    . MET A 1 169 ? 74.096 -5.590  15.601  1.00 33.13 ? 166  MET A CB    1 
ATOM   1299 C  CG    . MET A 1 169 ? 74.263 -5.715  17.114  1.00 42.08 ? 166  MET A CG    1 
ATOM   1300 S  SD    . MET A 1 169 ? 74.899 -7.321  17.652  1.00 56.87 ? 166  MET A SD    1 
ATOM   1301 C  CE    . MET A 1 169 ? 73.612 -8.423  17.052  1.00 34.70 ? 166  MET A CE    1 
ATOM   1302 N  N     . ARG A 1 170 ? 74.551 -4.530  12.714  1.00 20.87 ? 167  ARG A N     1 
ATOM   1303 C  CA    . ARG A 1 170 ? 74.289 -4.581  11.277  1.00 16.82 ? 167  ARG A CA    1 
ATOM   1304 C  C     . ARG A 1 170 ? 75.562 -4.884  10.499  1.00 17.44 ? 167  ARG A C     1 
ATOM   1305 O  O     . ARG A 1 170 ? 75.566 -5.732  9.609   1.00 15.60 ? 167  ARG A O     1 
ATOM   1306 C  CB    . ARG A 1 170 ? 73.665 -3.280  10.752  1.00 18.08 ? 167  ARG A CB    1 
ATOM   1307 C  CG    . ARG A 1 170 ? 73.342 -3.333  9.249   1.00 13.56 ? 167  ARG A CG    1 
ATOM   1308 C  CD    . ARG A 1 170 ? 73.128 -1.940  8.635   1.00 15.40 ? 167  ARG A CD    1 
ATOM   1309 N  NE    . ARG A 1 170 ? 74.390 -1.216  8.457   1.00 17.44 ? 167  ARG A NE    1 
ATOM   1310 C  CZ    . ARG A 1 170 ? 75.203 -1.360  7.412   1.00 14.34 ? 167  ARG A CZ    1 
ATOM   1311 N  NH1   . ARG A 1 170 ? 74.905 -2.210  6.431   1.00 16.03 ? 167  ARG A NH1   1 
ATOM   1312 N  NH2   . ARG A 1 170 ? 76.324 -0.655  7.339   1.00 19.84 ? 167  ARG A NH2   1 
ATOM   1313 N  N     . LYS A 1 171 ? 76.637 -4.172  10.828  1.00 17.19 ? 168  LYS A N     1 
ATOM   1314 C  CA    . LYS A 1 171 ? 77.904 -4.362  10.135  1.00 16.47 ? 168  LYS A CA    1 
ATOM   1315 C  C     . LYS A 1 171 ? 78.498 -5.749  10.372  1.00 16.53 ? 168  LYS A C     1 
ATOM   1316 O  O     . LYS A 1 171 ? 79.045 -6.353  9.449   1.00 16.80 ? 168  LYS A O     1 
ATOM   1317 C  CB    . LYS A 1 171 ? 78.927 -3.289  10.529  1.00 26.46 ? 168  LYS A CB    1 
ATOM   1318 C  CG    . LYS A 1 171 ? 78.752 -1.946  9.823   1.00 28.12 ? 168  LYS A CG    1 
ATOM   1319 C  CD    . LYS A 1 171 ? 80.044 -1.127  9.934   1.00 37.17 ? 168  LYS A CD    1 
ATOM   1320 C  CE    . LYS A 1 171 ? 79.937 0.225   9.246   1.00 37.03 ? 168  LYS A CE    1 
ATOM   1321 N  NZ    . LYS A 1 171 ? 79.173 1.215   10.066  1.00 40.85 ? 168  LYS A NZ    1 
ATOM   1322 N  N     . GLN A 1 172 ? 78.404 -6.250  11.599  1.00 19.19 ? 169  GLN A N     1 
ATOM   1323 C  CA    . GLN A 1 172 ? 78.914 -7.590  11.891  1.00 21.81 ? 169  GLN A CA    1 
ATOM   1324 C  C     . GLN A 1 172 ? 78.195 -8.631  11.040  1.00 18.41 ? 169  GLN A C     1 
ATOM   1325 O  O     . GLN A 1 172 ? 78.820 -9.515  10.450  1.00 18.86 ? 169  GLN A O     1 
ATOM   1326 C  CB    . GLN A 1 172 ? 78.748 -7.939  13.366  1.00 26.13 ? 169  GLN A CB    1 
ATOM   1327 C  CG    . GLN A 1 172 ? 79.698 -7.224  14.302  1.00 38.67 ? 169  GLN A CG    1 
ATOM   1328 C  CD    . GLN A 1 172 ? 79.570 -7.725  15.727  1.00 56.80 ? 169  GLN A CD    1 
ATOM   1329 O  OE1   . GLN A 1 172 ? 78.641 -8.471  16.052  1.00 53.40 ? 169  GLN A OE1   1 
ATOM   1330 N  NE2   . GLN A 1 172 ? 80.505 -7.326  16.585  1.00 57.97 ? 169  GLN A NE2   1 
ATOM   1331 N  N     . GLY A 1 173 ? 76.873 -8.517  10.971  1.00 19.56 ? 170  GLY A N     1 
ATOM   1332 C  CA    . GLY A 1 173 ? 76.088 -9.450  10.183  1.00 14.08 ? 170  GLY A CA    1 
ATOM   1333 C  C     . GLY A 1 173 ? 76.450 -9.361  8.721   1.00 12.42 ? 170  GLY A C     1 
ATOM   1334 O  O     . GLY A 1 173 ? 76.611 -10.377 8.035   1.00 13.80 ? 170  GLY A O     1 
ATOM   1335 N  N     . LEU A 1 174 ? 76.576 -8.135  8.227   1.00 14.24 ? 171  LEU A N     1 
ATOM   1336 C  CA    . LEU A 1 174 ? 76.954 -7.916  6.841   1.00 12.08 ? 171  LEU A CA    1 
ATOM   1337 C  C     . LEU A 1 174 ? 78.337 -8.498  6.539   1.00 16.69 ? 171  LEU A C     1 
ATOM   1338 O  O     . LEU A 1 174 ? 78.549 -9.098  5.489   1.00 14.92 ? 171  LEU A O     1 
ATOM   1339 C  CB    . LEU A 1 174 ? 76.912 -6.422  6.493   1.00 11.57 ? 171  LEU A CB    1 
ATOM   1340 C  CG    . LEU A 1 174 ? 77.295 -6.040  5.061   1.00 13.32 ? 171  LEU A CG    1 
ATOM   1341 C  CD1   . LEU A 1 174 ? 76.415 -6.757  4.016   1.00 12.93 ? 171  LEU A CD1   1 
ATOM   1342 C  CD2   . LEU A 1 174 ? 77.250 -4.508  4.878   1.00 14.91 ? 171  LEU A CD2   1 
ATOM   1343 N  N     . PHE A 1 175 ? 79.273 -8.326  7.464   1.00 16.86 ? 172  PHE A N     1 
ATOM   1344 C  CA    . PHE A 1 175 ? 80.609 -8.884  7.270   1.00 20.67 ? 172  PHE A CA    1 
ATOM   1345 C  C     . PHE A 1 175 ? 80.590 -10.414 7.204   1.00 16.82 ? 172  PHE A C     1 
ATOM   1346 O  O     . PHE A 1 175 ? 81.251 -10.998 6.353   1.00 19.94 ? 172  PHE A O     1 
ATOM   1347 C  CB    . PHE A 1 175 ? 81.561 -8.416  8.367   1.00 16.60 ? 172  PHE A CB    1 
ATOM   1348 C  CG    . PHE A 1 175 ? 81.997 -6.986  8.224   1.00 34.57 ? 172  PHE A CG    1 
ATOM   1349 C  CD1   . PHE A 1 175 ? 82.051 -6.384  6.978   1.00 38.59 ? 172  PHE A CD1   1 
ATOM   1350 C  CD2   . PHE A 1 175 ? 82.353 -6.244  9.340   1.00 42.40 ? 172  PHE A CD2   1 
ATOM   1351 C  CE1   . PHE A 1 175 ? 82.453 -5.069  6.845   1.00 45.45 ? 172  PHE A CE1   1 
ATOM   1352 C  CE2   . PHE A 1 175 ? 82.759 -4.925  9.215   1.00 45.42 ? 172  PHE A CE2   1 
ATOM   1353 C  CZ    . PHE A 1 175 ? 82.807 -4.338  7.966   1.00 49.28 ? 172  PHE A CZ    1 
ATOM   1354 N  N     . GLN A 1 176 ? 79.840 -11.060 8.098   1.00 17.32 ? 173  GLN A N     1 
ATOM   1355 C  CA    . GLN A 1 176 ? 79.752 -12.521 8.071   1.00 21.42 ? 173  GLN A CA    1 
ATOM   1356 C  C     . GLN A 1 176 ? 79.187 -12.979 6.738   1.00 19.76 ? 173  GLN A C     1 
ATOM   1357 O  O     . GLN A 1 176 ? 79.665 -13.941 6.142   1.00 19.37 ? 173  GLN A O     1 
ATOM   1358 C  CB    . GLN A 1 176 ? 78.901 -13.065 9.226   1.00 17.49 ? 173  GLN A CB    1 
ATOM   1359 C  CG    . GLN A 1 176 ? 79.512 -12.842 10.612  1.00 19.92 ? 173  GLN A CG    1 
ATOM   1360 C  CD    . GLN A 1 176 ? 78.712 -13.499 11.719  1.00 20.89 ? 173  GLN A CD    1 
ATOM   1361 O  OE1   . GLN A 1 176 ? 77.617 -14.004 11.492  1.00 22.89 ? 173  GLN A OE1   1 
ATOM   1362 N  NE2   . GLN A 1 176 ? 79.260 -13.496 12.930  1.00 25.91 ? 173  GLN A NE2   1 
ATOM   1363 N  N     . TRP A 1 177 ? 78.171 -12.269 6.259   1.00 15.10 ? 174  TRP A N     1 
ATOM   1364 C  CA    . TRP A 1 177 ? 77.546 -12.616 4.988   1.00 13.62 ? 174  TRP A CA    1 
ATOM   1365 C  C     . TRP A 1 177 ? 78.534 -12.524 3.834   1.00 14.44 ? 174  TRP A C     1 
ATOM   1366 O  O     . TRP A 1 177 ? 78.693 -13.469 3.057   1.00 17.21 ? 174  TRP A O     1 
ATOM   1367 C  CB    . TRP A 1 177 ? 76.348 -11.691 4.724   1.00 11.17 ? 174  TRP A CB    1 
ATOM   1368 C  CG    . TRP A 1 177 ? 75.691 -11.871 3.386   1.00 12.05 ? 174  TRP A CG    1 
ATOM   1369 C  CD1   . TRP A 1 177 ? 75.796 -11.036 2.302   1.00 10.79 ? 174  TRP A CD1   1 
ATOM   1370 C  CD2   . TRP A 1 177 ? 74.803 -12.930 2.987   1.00 11.84 ? 174  TRP A CD2   1 
ATOM   1371 N  NE1   . TRP A 1 177 ? 75.040 -11.516 1.262   1.00 13.61 ? 174  TRP A NE1   1 
ATOM   1372 C  CE2   . TRP A 1 177 ? 74.416 -12.670 1.656   1.00 14.30 ? 174  TRP A CE2   1 
ATOM   1373 C  CE3   . TRP A 1 177 ? 74.298 -14.065 3.628   1.00 14.51 ? 174  TRP A CE3   1 
ATOM   1374 C  CZ2   . TRP A 1 177 ? 73.554 -13.512 0.948   1.00 10.46 ? 174  TRP A CZ2   1 
ATOM   1375 C  CZ3   . TRP A 1 177 ? 73.444 -14.903 2.927   1.00 12.48 ? 174  TRP A CZ3   1 
ATOM   1376 C  CH2   . TRP A 1 177 ? 73.078 -14.625 1.600   1.00 13.04 ? 174  TRP A CH2   1 
ATOM   1377 N  N     . LEU A 1 178 ? 79.201 -11.379 3.720   1.00 16.06 ? 175  LEU A N     1 
ATOM   1378 C  CA    . LEU A 1 178 ? 80.119 -11.167 2.610   1.00 13.37 ? 175  LEU A CA    1 
ATOM   1379 C  C     . LEU A 1 178 ? 81.297 -12.127 2.702   1.00 22.72 ? 175  LEU A C     1 
ATOM   1380 O  O     . LEU A 1 178 ? 81.792 -12.610 1.688   1.00 24.97 ? 175  LEU A O     1 
ATOM   1381 C  CB    . LEU A 1 178 ? 80.609 -9.723  2.574   1.00 16.20 ? 175  LEU A CB    1 
ATOM   1382 C  CG    . LEU A 1 178 ? 79.491 -8.715  2.293   1.00 17.61 ? 175  LEU A CG    1 
ATOM   1383 C  CD1   . LEU A 1 178 ? 79.981 -7.287  2.499   1.00 20.28 ? 175  LEU A CD1   1 
ATOM   1384 C  CD2   . LEU A 1 178 ? 78.940 -8.907  0.885   1.00 15.03 ? 175  LEU A CD2   1 
ATOM   1385 N  N     . ASP A 1 179 ? 81.732 -12.407 3.927   1.00 19.49 ? 176  ASP A N     1 
ATOM   1386 C  CA    . ASP A 1 179 ? 82.852 -13.327 4.129   1.00 26.78 ? 176  ASP A CA    1 
ATOM   1387 C  C     . ASP A 1 179 ? 82.561 -14.690 3.538   1.00 26.16 ? 176  ASP A C     1 
ATOM   1388 O  O     . ASP A 1 179 ? 83.465 -15.363 3.036   1.00 33.61 ? 176  ASP A O     1 
ATOM   1389 C  CB    . ASP A 1 179 ? 83.185 -13.473 5.612   1.00 22.74 ? 176  ASP A CB    1 
ATOM   1390 C  CG    . ASP A 1 179 ? 84.028 -12.335 6.124   1.00 36.00 ? 176  ASP A CG    1 
ATOM   1391 O  OD1   . ASP A 1 179 ? 84.636 -11.634 5.286   1.00 41.28 ? 176  ASP A OD1   1 
ATOM   1392 O  OD2   . ASP A 1 179 ? 84.089 -12.146 7.358   1.00 45.13 ? 176  ASP A OD2   1 
ATOM   1393 N  N     . SER A 1 180 ? 81.292 -15.082 3.587   1.00 22.74 ? 177  SER A N     1 
ATOM   1394 C  CA    . SER A 1 180 ? 80.866 -16.413 3.163   1.00 29.55 ? 177  SER A CA    1 
ATOM   1395 C  C     . SER A 1 180 ? 80.533 -16.535 1.679   1.00 34.31 ? 177  SER A C     1 
ATOM   1396 O  O     . SER A 1 180 ? 80.310 -17.642 1.178   1.00 32.98 ? 177  SER A O     1 
ATOM   1397 C  CB    . SER A 1 180 ? 79.649 -16.846 3.980   1.00 30.63 ? 177  SER A CB    1 
ATOM   1398 O  OG    . SER A 1 180 ? 79.942 -16.803 5.363   1.00 38.49 ? 177  SER A OG    1 
ATOM   1399 N  N     . LEU A 1 181 ? 80.483 -15.407 0.978   1.00 17.37 ? 178  LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 181 ? 80.008 -15.400 -0.405  1.00 18.88 ? 178  LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 181 ? 80.959 -16.050 -1.398  1.00 33.68 ? 178  LEU A C     1 
ATOM   1402 O  O     . LEU A 1 181 ? 82.173 -15.908 -1.284  1.00 34.27 ? 178  LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 181 ? 79.710 -13.971 -0.866  1.00 26.50 ? 178  LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 181 ? 78.279 -13.455 -0.748  1.00 26.77 ? 178  LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 181 ? 78.186 -12.096 -1.440  1.00 18.80 ? 178  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 181 ? 77.282 -14.445 -1.359  1.00 22.80 ? 178  LEU A CD2   1 
ATOM   1407 N  N     . GLN A 1 182 ? 80.398 -16.759 -2.376  1.00 36.37 ? 179  GLN A N     1 
ATOM   1408 C  CA    . GLN A 1 182 ? 81.188 -17.278 -3.486  1.00 42.32 ? 179  GLN A CA    1 
ATOM   1409 C  C     . GLN A 1 182 ? 80.969 -16.447 -4.749  1.00 47.44 ? 179  GLN A C     1 
ATOM   1410 O  O     . GLN A 1 182 ? 80.090 -16.750 -5.558  1.00 47.68 ? 179  GLN A O     1 
ATOM   1411 C  CB    . GLN A 1 182 ? 80.866 -18.748 -3.758  1.00 46.46 ? 179  GLN A CB    1 
ATOM   1412 C  CG    . GLN A 1 182 ? 81.764 -19.376 -4.819  1.00 53.15 ? 179  GLN A CG    1 
ATOM   1413 C  CD    . GLN A 1 182 ? 83.242 -19.095 -4.573  1.00 63.78 ? 179  GLN A CD    1 
ATOM   1414 O  OE1   . GLN A 1 182 ? 83.850 -18.259 -5.246  1.00 61.54 ? 179  GLN A OE1   1 
ATOM   1415 N  NE2   . GLN A 1 182 ? 83.824 -19.793 -3.602  1.00 60.87 ? 179  GLN A NE2   1 
ATOM   1416 N  N     . ILE A 1 183 ? 81.784 -15.409 -4.919  1.00 45.68 ? 180  ILE A N     1 
ATOM   1417 C  CA    . ILE A 1 183 ? 81.612 -14.465 -6.023  1.00 49.90 ? 180  ILE A CA    1 
ATOM   1418 C  C     . ILE A 1 183 ? 82.085 -15.005 -7.373  1.00 51.79 ? 180  ILE A C     1 
ATOM   1419 O  O     . ILE A 1 183 ? 81.951 -14.337 -8.401  1.00 48.95 ? 180  ILE A O     1 
ATOM   1420 C  CB    . ILE A 1 183 ? 82.304 -13.114 -5.732  1.00 46.63 ? 180  ILE A CB    1 
ATOM   1421 C  CG1   . ILE A 1 183 ? 83.691 -13.333 -5.122  1.00 45.19 ? 180  ILE A CG1   1 
ATOM   1422 C  CG2   . ILE A 1 183 ? 81.454 -12.281 -4.791  1.00 46.30 ? 180  ILE A CG2   1 
ATOM   1423 C  CD1   . ILE A 1 183 ? 84.698 -13.946 -6.065  1.00 51.07 ? 180  ILE A CD1   1 
ATOM   1424 N  N     . ASP A 1 184 ? 82.634 -16.214 -7.358  1.00 52.55 ? 181  ASP A N     1 
ATOM   1425 C  CA    . ASP A 1 184 ? 83.161 -16.841 -8.563  1.00 53.84 ? 181  ASP A CA    1 
ATOM   1426 C  C     . ASP A 1 184 ? 82.052 -17.534 -9.351  1.00 51.97 ? 181  ASP A C     1 
ATOM   1427 O  O     . ASP A 1 184 ? 82.237 -17.903 -10.509 1.00 50.86 ? 181  ASP A O     1 
ATOM   1428 C  CB    . ASP A 1 184 ? 84.250 -17.850 -8.189  1.00 58.38 ? 181  ASP A CB    1 
ATOM   1429 C  CG    . ASP A 1 184 ? 84.972 -18.409 -9.398  1.00 76.69 ? 181  ASP A CG    1 
ATOM   1430 O  OD1   . ASP A 1 184 ? 85.066 -17.695 -10.420 1.00 77.50 ? 181  ASP A OD1   1 
ATOM   1431 O  OD2   . ASP A 1 184 ? 85.449 -19.562 -9.324  1.00 84.81 ? 181  ASP A OD2   1 
ATOM   1432 N  N     . ASN A 1 185 ? 80.898 -17.707 -8.713  1.00 44.99 ? 182  ASN A N     1 
ATOM   1433 C  CA    . ASN A 1 185 ? 79.771 -18.390 -9.336  1.00 45.95 ? 182  ASN A CA    1 
ATOM   1434 C  C     . ASN A 1 185 ? 78.639 -17.425 -9.687  1.00 45.38 ? 182  ASN A C     1 
ATOM   1435 O  O     . ASN A 1 185 ? 77.939 -16.927 -8.800  1.00 37.60 ? 182  ASN A O     1 
ATOM   1436 C  CB    . ASN A 1 185 ? 79.260 -19.505 -8.419  1.00 41.78 ? 182  ASN A CB    1 
ATOM   1437 C  CG    . ASN A 1 185 ? 78.092 -20.267 -9.015  1.00 43.38 ? 182  ASN A CG    1 
ATOM   1438 O  OD1   . ASN A 1 185 ? 77.794 -20.149 -10.208 1.00 38.12 ? 182  ASN A OD1   1 
ATOM   1439 N  ND2   . ASN A 1 185 ? 77.422 -21.060 -8.183  1.00 44.48 ? 182  ASN A ND2   1 
ATOM   1440 N  N     . LEU A 1 186 ? 78.464 -17.169 -10.982 1.00 39.33 ? 183  LEU A N     1 
ATOM   1441 C  CA    . LEU A 1 186 ? 77.452 -16.227 -11.455 1.00 39.62 ? 183  LEU A CA    1 
ATOM   1442 C  C     . LEU A 1 186 ? 76.027 -16.721 -11.200 1.00 40.20 ? 183  LEU A C     1 
ATOM   1443 O  O     . LEU A 1 186 ? 75.071 -15.946 -11.278 1.00 39.99 ? 183  LEU A O     1 
ATOM   1444 C  CB    . LEU A 1 186 ? 77.636 -15.927 -12.948 1.00 42.88 ? 183  LEU A CB    1 
ATOM   1445 C  CG    . LEU A 1 186 ? 78.713 -14.920 -13.363 1.00 50.08 ? 183  LEU A CG    1 
ATOM   1446 C  CD1   . LEU A 1 186 ? 80.107 -15.503 -13.198 1.00 55.54 ? 183  LEU A CD1   1 
ATOM   1447 C  CD2   . LEU A 1 186 ? 78.496 -14.483 -14.799 1.00 51.07 ? 183  LEU A CD2   1 
ATOM   1448 N  N     . THR A 1 187 ? 75.888 -18.010 -10.903 1.00 34.30 ? 184  THR A N     1 
ATOM   1449 C  CA    . THR A 1 187 ? 74.573 -18.593 -10.655 1.00 38.74 ? 184  THR A CA    1 
ATOM   1450 C  C     . THR A 1 187 ? 74.278 -18.837 -9.171  1.00 30.48 ? 184  THR A C     1 
ATOM   1451 O  O     . THR A 1 187 ? 73.242 -19.410 -8.840  1.00 36.14 ? 184  THR A O     1 
ATOM   1452 C  CB    . THR A 1 187 ? 74.381 -19.925 -11.417 1.00 39.61 ? 184  THR A CB    1 
ATOM   1453 O  OG1   . THR A 1 187 ? 75.313 -20.902 -10.931 1.00 41.14 ? 184  THR A OG1   1 
ATOM   1454 C  CG2   . THR A 1 187 ? 74.583 -19.722 -12.914 1.00 49.54 ? 184  THR A CG2   1 
ATOM   1455 N  N     . SER A 1 188 ? 75.177 -18.421 -8.282  1.00 31.84 ? 185  SER A N     1 
ATOM   1456 C  CA    . SER A 1 188 ? 74.914 -18.561 -6.846  1.00 21.58 ? 185  SER A CA    1 
ATOM   1457 C  C     . SER A 1 188 ? 73.753 -17.671 -6.432  1.00 18.31 ? 185  SER A C     1 
ATOM   1458 O  O     . SER A 1 188 ? 73.839 -16.454 -6.542  1.00 13.69 ? 185  SER A O     1 
ATOM   1459 C  CB    . SER A 1 188 ? 76.141 -18.196 -6.016  1.00 27.28 ? 185  SER A CB    1 
ATOM   1460 O  OG    . SER A 1 188 ? 75.810 -18.117 -4.633  1.00 29.22 ? 185  SER A OG    1 
ATOM   1461 N  N     . PRO A 1 189 ? 72.657 -18.275 -5.953  1.00 16.53 ? 186  PRO A N     1 
ATOM   1462 C  CA    . PRO A 1 189 ? 71.523 -17.439 -5.534  1.00 12.16 ? 186  PRO A CA    1 
ATOM   1463 C  C     . PRO A 1 189 ? 71.881 -16.405 -4.457  1.00 11.93 ? 186  PRO A C     1 
ATOM   1464 O  O     . PRO A 1 189 ? 71.351 -15.286 -4.519  1.00 10.78 ? 186  PRO A O     1 
ATOM   1465 C  CB    . PRO A 1 189 ? 70.506 -18.461 -5.011  1.00 12.51 ? 186  PRO A CB    1 
ATOM   1466 C  CG    . PRO A 1 189 ? 70.854 -19.738 -5.787  1.00 17.07 ? 186  PRO A CG    1 
ATOM   1467 C  CD    . PRO A 1 189 ? 72.350 -19.714 -5.902  1.00 16.94 ? 186  PRO A CD    1 
ATOM   1468 N  N     . ASP A 1 190 ? 72.737 -16.749 -3.492  1.00 13.05 ? 187  ASP A N     1 
ATOM   1469 C  CA    . ASP A 1 190 ? 73.086 -15.781 -2.451  1.00 9.62  ? 187  ASP A CA    1 
ATOM   1470 C  C     . ASP A 1 190 ? 73.824 -14.591 -3.057  1.00 13.29 ? 187  ASP A C     1 
ATOM   1471 O  O     . ASP A 1 190 ? 73.655 -13.454 -2.615  1.00 11.32 ? 187  ASP A O     1 
ATOM   1472 C  CB    . ASP A 1 190 ? 73.951 -16.414 -1.348  1.00 13.30 ? 187  ASP A CB    1 
ATOM   1473 C  CG    . ASP A 1 190 ? 73.172 -17.378 -0.462  1.00 17.52 ? 187  ASP A CG    1 
ATOM   1474 O  OD1   . ASP A 1 190 ? 71.933 -17.371 -0.502  1.00 12.26 ? 187  ASP A OD1   1 
ATOM   1475 O  OD2   . ASP A 1 190 ? 73.805 -18.141 0.298   1.00 20.14 ? 187  ASP A OD2   1 
ATOM   1476 N  N     . LEU A 1 191 ? 74.656 -14.854 -4.061  1.00 10.75 ? 188  LEU A N     1 
ATOM   1477 C  CA    . LEU A 1 191 ? 75.390 -13.772 -4.707  1.00 11.31 ? 188  LEU A CA    1 
ATOM   1478 C  C     . LEU A 1 191 ? 74.424 -12.903 -5.501  1.00 12.65 ? 188  LEU A C     1 
ATOM   1479 O  O     . LEU A 1 191 ? 74.546 -11.676 -5.504  1.00 11.50 ? 188  LEU A O     1 
ATOM   1480 C  CB    . LEU A 1 191 ? 76.500 -14.322 -5.617  1.00 13.84 ? 188  LEU A CB    1 
ATOM   1481 C  CG    . LEU A 1 191 ? 77.270 -13.309 -6.472  1.00 18.57 ? 188  LEU A CG    1 
ATOM   1482 C  CD1   . LEU A 1 191 ? 78.026 -12.337 -5.600  1.00 17.84 ? 188  LEU A CD1   1 
ATOM   1483 C  CD2   . LEU A 1 191 ? 78.232 -14.030 -7.428  1.00 19.63 ? 188  LEU A CD2   1 
ATOM   1484 N  N     . GLN A 1 192 ? 73.465 -13.541 -6.160  1.00 12.27 ? 189  GLN A N     1 
ATOM   1485 C  CA    . GLN A 1 192 ? 72.464 -12.815 -6.925  1.00 13.92 ? 189  GLN A CA    1 
ATOM   1486 C  C     . GLN A 1 192 ? 71.673 -11.890 -6.009  1.00 11.48 ? 189  GLN A C     1 
ATOM   1487 O  O     . GLN A 1 192 ? 71.440 -10.728 -6.342  1.00 11.58 ? 189  GLN A O     1 
ATOM   1488 C  CB    . GLN A 1 192 ? 71.555 -13.779 -7.695  1.00 12.35 ? 189  GLN A CB    1 
ATOM   1489 C  CG    . GLN A 1 192 ? 72.294 -14.481 -8.833  1.00 17.01 ? 189  GLN A CG    1 
ATOM   1490 C  CD    . GLN A 1 192 ? 71.545 -15.660 -9.410  1.00 23.96 ? 189  GLN A CD    1 
ATOM   1491 O  OE1   . GLN A 1 192 ? 70.522 -16.082 -8.881  1.00 30.89 ? 189  GLN A OE1   1 
ATOM   1492 N  NE2   . GLN A 1 192 ? 72.062 -16.207 -10.505 1.00 34.74 ? 189  GLN A NE2   1 
ATOM   1493 N  N     . LEU A 1 193 ? 71.271 -12.399 -4.850  1.00 9.33  ? 190  LEU A N     1 
ATOM   1494 C  CA    . LEU A 1 193 ? 70.562 -11.564 -3.877  1.00 8.07  ? 190  LEU A CA    1 
ATOM   1495 C  C     . LEU A 1 193 ? 71.406 -10.378 -3.424  1.00 11.55 ? 190  LEU A C     1 
ATOM   1496 O  O     . LEU A 1 193 ? 70.896 -9.280  -3.230  1.00 10.81 ? 190  LEU A O     1 
ATOM   1497 C  CB    . LEU A 1 193 ? 70.148 -12.384 -2.649  1.00 10.56 ? 190  LEU A CB    1 
ATOM   1498 C  CG    . LEU A 1 193 ? 68.997 -13.375 -2.788  1.00 10.03 ? 190  LEU A CG    1 
ATOM   1499 C  CD1   . LEU A 1 193 ? 68.688 -13.998 -1.416  1.00 10.27 ? 190  LEU A CD1   1 
ATOM   1500 C  CD2   . LEU A 1 193 ? 67.773 -12.686 -3.322  1.00 9.40  ? 190  LEU A CD2   1 
ATOM   1501 N  N     . THR A 1 194 ? 72.695 -10.618 -3.225  1.00 10.12 ? 191  THR A N     1 
ATOM   1502 C  CA    . THR A 1 194 ? 73.605 -9.574  -2.799  1.00 9.68  ? 191  THR A CA    1 
ATOM   1503 C  C     . THR A 1 194 ? 73.719 -8.468  -3.841  1.00 9.97  ? 191  THR A C     1 
ATOM   1504 O  O     . THR A 1 194 ? 73.679 -7.285  -3.496  1.00 12.13 ? 191  THR A O     1 
ATOM   1505 C  CB    . THR A 1 194 ? 74.982 -10.142 -2.526  1.00 11.57 ? 191  THR A CB    1 
ATOM   1506 O  OG1   . THR A 1 194 ? 74.860 -11.142 -1.514  1.00 12.56 ? 191  THR A OG1   1 
ATOM   1507 C  CG2   . THR A 1 194 ? 75.911 -9.049  -2.029  1.00 9.79  ? 191  THR A CG2   1 
ATOM   1508 N  N     . VAL A 1 195 ? 73.850 -8.861  -5.105  1.00 11.41 ? 192  VAL A N     1 
ATOM   1509 C  CA    . VAL A 1 195 ? 73.924 -7.881  -6.184  1.00 11.21 ? 192  VAL A CA    1 
ATOM   1510 C  C     . VAL A 1 195 ? 72.580 -7.157  -6.267  1.00 12.64 ? 192  VAL A C     1 
ATOM   1511 O  O     . VAL A 1 195 ? 72.529 -5.941  -6.487  1.00 12.63 ? 192  VAL A O     1 
ATOM   1512 C  CB    . VAL A 1 195 ? 74.313 -8.535  -7.518  1.00 12.43 ? 192  VAL A CB    1 
ATOM   1513 C  CG1   . VAL A 1 195 ? 74.166 -7.533  -8.678  1.00 14.09 ? 192  VAL A CG1   1 
ATOM   1514 C  CG2   . VAL A 1 195 ? 75.733 -9.047  -7.426  1.00 11.40 ? 192  VAL A CG2   1 
ATOM   1515 N  N     . GLY A 1 196 ? 71.496 -7.894  -6.050  1.00 8.42  ? 193  GLY A N     1 
ATOM   1516 C  CA    . GLY A 1 196 ? 70.175 -7.279  -6.003  1.00 9.24  ? 193  GLY A CA    1 
ATOM   1517 C  C     . GLY A 1 196 ? 70.135 -6.169  -4.965  1.00 12.20 ? 193  GLY A C     1 
ATOM   1518 O  O     . GLY A 1 196 ? 69.611 -5.067  -5.217  1.00 12.27 ? 193  GLY A O     1 
ATOM   1519 N  N     . ALA A 1 197 ? 70.678 -6.449  -3.784  1.00 10.56 ? 194  ALA A N     1 
ATOM   1520 C  CA    . ALA A 1 197 ? 70.712 -5.468  -2.719  1.00 6.57  ? 194  ALA A CA    1 
ATOM   1521 C  C     . ALA A 1 197 ? 71.559 -4.236  -3.083  1.00 9.68  ? 194  ALA A C     1 
ATOM   1522 O  O     . ALA A 1 197 ? 71.218 -3.116  -2.698  1.00 11.12 ? 194  ALA A O     1 
ATOM   1523 C  CB    . ALA A 1 197 ? 71.210 -6.110  -1.406  1.00 11.95 ? 194  ALA A CB    1 
ATOM   1524 N  N     . VAL A 1 198 ? 72.659 -4.439  -3.810  1.00 8.42  ? 195  VAL A N     1 
ATOM   1525 C  CA    . VAL A 1 198 ? 73.467 -3.307  -4.269  1.00 9.39  ? 195  VAL A CA    1 
ATOM   1526 C  C     . VAL A 1 198 ? 72.642 -2.368  -5.148  1.00 10.32 ? 195  VAL A C     1 
ATOM   1527 O  O     . VAL A 1 198 ? 72.664 -1.133  -4.969  1.00 12.69 ? 195  VAL A O     1 
ATOM   1528 C  CB    . VAL A 1 198 ? 74.719 -3.776  -5.026  1.00 11.76 ? 195  VAL A CB    1 
ATOM   1529 C  CG1   . VAL A 1 198 ? 75.431 -2.577  -5.691  1.00 14.06 ? 195  VAL A CG1   1 
ATOM   1530 C  CG2   . VAL A 1 198 ? 75.649 -4.495  -4.072  1.00 15.68 ? 195  VAL A CG2   1 
ATOM   1531 N  N     . ILE A 1 199 ? 71.890 -2.960  -6.073  1.00 9.85  ? 196  ILE A N     1 
ATOM   1532 C  CA    . ILE A 1 199 ? 71.034 -2.185  -6.972  1.00 12.62 ? 196  ILE A CA    1 
ATOM   1533 C  C     . ILE A 1 199 ? 69.948 -1.443  -6.191  1.00 11.05 ? 196  ILE A C     1 
ATOM   1534 O  O     . ILE A 1 199 ? 69.656 -0.283  -6.473  1.00 10.83 ? 196  ILE A O     1 
ATOM   1535 C  CB    . ILE A 1 199 ? 70.420 -3.074  -8.049  1.00 11.04 ? 196  ILE A CB    1 
ATOM   1536 C  CG1   . ILE A 1 199 ? 71.535 -3.601  -8.972  1.00 10.27 ? 196  ILE A CG1   1 
ATOM   1537 C  CG2   . ILE A 1 199 ? 69.351 -2.314  -8.847  1.00 10.68 ? 196  ILE A CG2   1 
ATOM   1538 C  CD1   . ILE A 1 199 ? 71.067 -4.667  -9.967  1.00 12.78 ? 196  ILE A CD1   1 
ATOM   1539 N  N     . VAL A 1 200 ? 69.368 -2.110  -5.198  1.00 9.99  ? 197  VAL A N     1 
ATOM   1540 C  CA    . VAL A 1 200 ? 68.326 -1.481  -4.388  1.00 8.66  ? 197  VAL A CA    1 
ATOM   1541 C  C     . VAL A 1 200 ? 68.860 -0.320  -3.544  1.00 10.06 ? 197  VAL A C     1 
ATOM   1542 O  O     . VAL A 1 200 ? 68.158 0.687   -3.359  1.00 9.82  ? 197  VAL A O     1 
ATOM   1543 C  CB    . VAL A 1 200 ? 67.552 -2.515  -3.545  1.00 6.81  ? 197  VAL A CB    1 
ATOM   1544 C  CG1   . VAL A 1 200 ? 66.562 -1.811  -2.608  1.00 9.18  ? 197  VAL A CG1   1 
ATOM   1545 C  CG2   . VAL A 1 200 ? 66.831 -3.495  -4.484  1.00 10.57 ? 197  VAL A CG2   1 
ATOM   1546 N  N     . GLU A 1 201 ? 70.105 -0.414  -3.078  1.00 8.76  ? 198  GLU A N     1 
ATOM   1547 C  CA    . GLU A 1 201 ? 70.734 0.738   -2.425  1.00 9.41  ? 198  GLU A CA    1 
ATOM   1548 C  C     . GLU A 1 201 ? 70.759 1.904   -3.407  1.00 12.47 ? 198  GLU A C     1 
ATOM   1549 O  O     . GLU A 1 201 ? 70.459 3.043   -3.036  1.00 11.87 ? 198  GLU A O     1 
ATOM   1550 C  CB    . GLU A 1 201 ? 72.177 0.437   -1.961  1.00 12.84 ? 198  GLU A CB    1 
ATOM   1551 C  CG    . GLU A 1 201 ? 72.323 -0.586  -0.810  1.00 12.18 ? 198  GLU A CG    1 
ATOM   1552 C  CD    . GLU A 1 201 ? 72.200 0.009   0.585   1.00 12.84 ? 198  GLU A CD    1 
ATOM   1553 O  OE1   . GLU A 1 201 ? 71.841 1.199   0.723   1.00 13.80 ? 198  GLU A OE1   1 
ATOM   1554 O  OE2   . GLU A 1 201 ? 72.443 -0.718  1.582   1.00 11.98 ? 198  GLU A OE2   1 
ATOM   1555 N  N     . GLU A 1 202 ? 71.127 1.617   -4.651  1.00 10.58 ? 199  GLU A N     1 
ATOM   1556 C  CA    . GLU A 1 202 ? 71.190 2.644   -5.689  1.00 10.60 ? 199  GLU A CA    1 
ATOM   1557 C  C     . GLU A 1 202 ? 69.807 3.250   -5.969  1.00 16.57 ? 199  GLU A C     1 
ATOM   1558 O  O     . GLU A 1 202 ? 69.676 4.470   -6.087  1.00 12.18 ? 199  GLU A O     1 
ATOM   1559 C  CB    . GLU A 1 202 ? 71.823 2.079   -6.967  1.00 15.23 ? 199  GLU A CB    1 
ATOM   1560 C  CG    . GLU A 1 202 ? 73.307 1.761   -6.780  1.00 16.50 ? 199  GLU A CG    1 
ATOM   1561 C  CD    . GLU A 1 202 ? 73.904 0.865   -7.868  1.00 18.54 ? 199  GLU A CD    1 
ATOM   1562 O  OE1   . GLU A 1 202 ? 75.125 0.625   -7.810  1.00 22.62 ? 199  GLU A OE1   1 
ATOM   1563 O  OE2   . GLU A 1 202 ? 73.176 0.404   -8.768  1.00 24.98 ? 199  GLU A OE2   1 
ATOM   1564 N  N     . MET A 1 203 ? 68.789 2.397   -6.065  1.00 10.87 ? 200  MET A N     1 
ATOM   1565 C  CA    . MET A 1 203 ? 67.420 2.852   -6.299  1.00 9.89  ? 200  MET A CA    1 
ATOM   1566 C  C     . MET A 1 203 ? 66.934 3.730   -5.153  1.00 10.83 ? 200  MET A C     1 
ATOM   1567 O  O     . MET A 1 203 ? 66.294 4.774   -5.369  1.00 9.92  ? 200  MET A O     1 
ATOM   1568 C  CB    . MET A 1 203 ? 66.472 1.657   -6.440  1.00 9.59  ? 200  MET A CB    1 
ATOM   1569 C  CG    A MET A 1 203 ? 65.070 2.069   -6.794  0.50 10.74 ? 200  MET A CG    1 
ATOM   1570 C  CG    B MET A 1 203 ? 66.802 0.668   -7.534  0.50 10.99 ? 200  MET A CG    1 
ATOM   1571 S  SD    A MET A 1 203 ? 63.945 0.675   -6.757  0.50 18.98 ? 200  MET A SD    1 
ATOM   1572 S  SD    B MET A 1 203 ? 65.551 -0.635  -7.587  0.50 12.33 ? 200  MET A SD    1 
ATOM   1573 C  CE    A MET A 1 203 ? 64.272 -0.122  -8.316  0.50 11.82 ? 200  MET A CE    1 
ATOM   1574 C  CE    B MET A 1 203 ? 64.084 0.374   -7.800  0.50 6.43  ? 200  MET A CE    1 
ATOM   1575 N  N     . ARG A 1 204 ? 67.216 3.310   -3.926  1.00 10.06 ? 201  ARG A N     1 
ATOM   1576 C  CA    . ARG A 1 204 ? 66.753 4.048   -2.755  1.00 7.94  ? 201  ARG A CA    1 
ATOM   1577 C  C     . ARG A 1 204 ? 67.461 5.402   -2.648  1.00 9.31  ? 201  ARG A C     1 
ATOM   1578 O  O     . ARG A 1 204 ? 66.864 6.395   -2.236  1.00 11.49 ? 201  ARG A O     1 
ATOM   1579 C  CB    . ARG A 1 204 ? 66.907 3.209   -1.484  1.00 9.90  ? 201  ARG A CB    1 
ATOM   1580 C  CG    . ARG A 1 204 ? 65.937 2.010   -1.474  1.00 8.67  ? 201  ARG A CG    1 
ATOM   1581 C  CD    . ARG A 1 204 ? 66.032 1.185   -0.211  1.00 10.41 ? 201  ARG A CD    1 
ATOM   1582 N  NE    . ARG A 1 204 ? 66.034 2.031   0.972   1.00 11.03 ? 201  ARG A NE    1 
ATOM   1583 C  CZ    . ARG A 1 204 ? 67.073 2.154   1.787   1.00 12.79 ? 201  ARG A CZ    1 
ATOM   1584 N  NH1   . ARG A 1 204 ? 66.993 2.955   2.834   1.00 11.69 ? 201  ARG A NH1   1 
ATOM   1585 N  NH2   . ARG A 1 204 ? 68.186 1.458   1.560   1.00 14.14 ? 201  ARG A NH2   1 
ATOM   1586 N  N     . ALA A 1 205 ? 68.729 5.435   -3.054  1.00 11.64 ? 202  ALA A N     1 
ATOM   1587 C  CA    . ALA A 1 205 ? 69.493 6.681   -3.048  1.00 13.03 ? 202  ALA A CA    1 
ATOM   1588 C  C     . ALA A 1 205 ? 68.914 7.664   -4.071  1.00 11.46 ? 202  ALA A C     1 
ATOM   1589 O  O     . ALA A 1 205 ? 68.770 8.858   -3.775  1.00 10.75 ? 202  ALA A O     1 
ATOM   1590 C  CB    . ALA A 1 205 ? 70.972 6.405   -3.342  1.00 13.61 ? 202  ALA A CB    1 
ATOM   1591 N  N     . ALA A 1 206 ? 68.567 7.152   -5.253  1.00 9.63  ? 203  ALA A N     1 
ATOM   1592 C  CA    . ALA A 1 206 ? 67.959 7.959   -6.310  1.00 11.84 ? 203  ALA A CA    1 
ATOM   1593 C  C     . ALA A 1 206 ? 66.610 8.496   -5.859  1.00 9.45  ? 203  ALA A C     1 
ATOM   1594 O  O     . ALA A 1 206 ? 66.292 9.663   -6.083  1.00 12.37 ? 203  ALA A O     1 
ATOM   1595 C  CB    . ALA A 1 206 ? 67.815 7.156   -7.606  1.00 14.53 ? 203  ALA A CB    1 
ATOM   1596 N  N     . ILE A 1 207 ? 65.813 7.656   -5.208  1.00 8.11  ? 204  ILE A N     1 
ATOM   1597 C  CA    . ILE A 1 207 ? 64.519 8.142   -4.732  1.00 11.23 ? 204  ILE A CA    1 
ATOM   1598 C  C     . ILE A 1 207 ? 64.723 9.286   -3.743  1.00 10.01 ? 204  ILE A C     1 
ATOM   1599 O  O     . ILE A 1 207 ? 64.060 10.316  -3.844  1.00 8.34  ? 204  ILE A O     1 
ATOM   1600 C  CB    . ILE A 1 207 ? 63.662 7.020   -4.107  1.00 5.81  ? 204  ILE A CB    1 
ATOM   1601 C  CG1   . ILE A 1 207 ? 63.267 6.016   -5.185  1.00 6.72  ? 204  ILE A CG1   1 
ATOM   1602 C  CG2   . ILE A 1 207 ? 62.413 7.583   -3.436  1.00 8.71  ? 204  ILE A CG2   1 
ATOM   1603 C  CD1   . ILE A 1 207 ? 62.647 4.739   -4.622  1.00 10.46 ? 204  ILE A CD1   1 
ATOM   1604 N  N     . GLU A 1 208 ? 65.646 9.124   -2.799  1.00 9.28  ? 205  GLU A N     1 
ATOM   1605 C  CA    . GLU A 1 208 ? 65.829 10.164  -1.790  1.00 8.15  ? 205  GLU A CA    1 
ATOM   1606 C  C     . GLU A 1 208 ? 66.430 11.437  -2.400  1.00 11.24 ? 205  GLU A C     1 
ATOM   1607 O  O     . GLU A 1 208 ? 65.961 12.543  -2.122  1.00 10.63 ? 205  GLU A O     1 
ATOM   1608 C  CB    . GLU A 1 208 ? 66.662 9.684   -0.598  1.00 10.70 ? 205  GLU A CB    1 
ATOM   1609 C  CG    . GLU A 1 208 ? 66.704 10.719  0.524   1.00 15.59 ? 205  GLU A CG    1 
ATOM   1610 C  CD    . GLU A 1 208 ? 67.464 10.249  1.754   1.00 15.56 ? 205  GLU A CD    1 
ATOM   1611 O  OE1   . GLU A 1 208 ? 67.475 10.993  2.759   1.00 17.92 ? 205  GLU A OE1   1 
ATOM   1612 O  OE2   . GLU A 1 208 ? 68.054 9.146   1.707   1.00 19.19 ? 205  GLU A OE2   1 
ATOM   1613 N  N     . ARG A 1 209 ? 67.433 11.273  -3.262  1.00 11.10 ? 206  ARG A N     1 
ATOM   1614 C  CA    . ARG A 1 209 ? 68.047 12.427  -3.931  1.00 11.91 ? 206  ARG A CA    1 
ATOM   1615 C  C     . ARG A 1 209 ? 67.015 13.231  -4.704  1.00 11.18 ? 206  ARG A C     1 
ATOM   1616 O  O     . ARG A 1 209 ? 66.987 14.463  -4.614  1.00 12.20 ? 206  ARG A O     1 
ATOM   1617 C  CB    . ARG A 1 209 ? 69.182 12.013  -4.885  1.00 11.92 ? 206  ARG A CB    1 
ATOM   1618 C  CG    . ARG A 1 209 ? 69.953 13.230  -5.450  1.00 16.01 ? 206  ARG A CG    1 
ATOM   1619 C  CD    . ARG A 1 209 ? 70.987 12.858  -6.513  1.00 18.89 ? 206  ARG A CD    1 
ATOM   1620 N  NE    . ARG A 1 209 ? 70.406 12.629  -7.842  1.00 26.61 ? 206  ARG A NE    1 
ATOM   1621 C  CZ    . ARG A 1 209 ? 70.091 13.588  -8.714  1.00 25.14 ? 206  ARG A CZ    1 
ATOM   1622 N  NH1   . ARG A 1 209 ? 69.578 13.272  -9.905  1.00 20.87 ? 206  ARG A NH1   1 
ATOM   1623 N  NH2   . ARG A 1 209 ? 70.288 14.862  -8.406  1.00 20.72 ? 206  ARG A NH2   1 
ATOM   1624 N  N     . GLU A 1 210 ? 66.168 12.536  -5.456  1.00 8.90  ? 207  GLU A N     1 
ATOM   1625 C  CA    . GLU A 1 210 ? 65.304 13.201  -6.432  1.00 9.49  ? 207  GLU A CA    1 
ATOM   1626 C  C     . GLU A 1 210 ? 63.925 13.598  -5.898  1.00 9.67  ? 207  GLU A C     1 
ATOM   1627 O  O     . GLU A 1 210 ? 63.221 14.369  -6.548  1.00 9.73  ? 207  GLU A O     1 
ATOM   1628 C  CB    . GLU A 1 210 ? 65.171 12.348  -7.694  1.00 13.46 ? 207  GLU A CB    1 
ATOM   1629 C  CG    . GLU A 1 210 ? 66.521 12.059  -8.348  1.00 11.54 ? 207  GLU A CG    1 
ATOM   1630 C  CD    . GLU A 1 210 ? 66.420 11.134  -9.534  1.00 17.11 ? 207  GLU A CD    1 
ATOM   1631 O  OE1   . GLU A 1 210 ? 65.367 11.129  -10.210 1.00 20.19 ? 207  GLU A OE1   1 
ATOM   1632 O  OE2   . GLU A 1 210 ? 67.403 10.409  -9.792  1.00 24.81 ? 207  GLU A OE2   1 
ATOM   1633 N  N     . THR A 1 211 ? 63.553 13.110  -4.712  1.00 9.38  ? 208  THR A N     1 
ATOM   1634 C  CA    . THR A 1 211 ? 62.235 13.445  -4.164  1.00 8.93  ? 208  THR A CA    1 
ATOM   1635 C  C     . THR A 1 211 ? 62.285 13.971  -2.746  1.00 10.05 ? 208  THR A C     1 
ATOM   1636 O  O     . THR A 1 211 ? 61.367 14.665  -2.315  1.00 11.70 ? 208  THR A O     1 
ATOM   1637 C  CB    . THR A 1 211 ? 61.244 12.253  -4.181  1.00 11.51 ? 208  THR A CB    1 
ATOM   1638 O  OG1   . THR A 1 211 ? 61.641 11.275  -3.205  1.00 8.94  ? 208  THR A OG1   1 
ATOM   1639 C  CG2   . THR A 1 211 ? 61.153 11.624  -5.571  1.00 10.01 ? 208  THR A CG2   1 
ATOM   1640 N  N     . GLY A 1 212 ? 63.340 13.628  -2.012  1.00 10.52 ? 209  GLY A N     1 
ATOM   1641 C  CA    . GLY A 1 212 ? 63.407 13.934  -0.595  1.00 12.39 ? 209  GLY A CA    1 
ATOM   1642 C  C     . GLY A 1 212 ? 62.849 12.825  0.293   1.00 11.51 ? 209  GLY A C     1 
ATOM   1643 O  O     . GLY A 1 212 ? 63.000 12.881  1.505   1.00 17.38 ? 209  GLY A O     1 
ATOM   1644 N  N     . PHE A 1 213 ? 62.225 11.816  -0.311  1.00 9.86  ? 210  PHE A N     1 
ATOM   1645 C  CA    . PHE A 1 213 ? 61.537 10.777  0.456   1.00 7.58  ? 210  PHE A CA    1 
ATOM   1646 C  C     . PHE A 1 213 ? 62.462 9.607   0.779   1.00 11.06 ? 210  PHE A C     1 
ATOM   1647 O  O     . PHE A 1 213 ? 63.187 9.116   -0.090  1.00 12.43 ? 210  PHE A O     1 
ATOM   1648 C  CB    . PHE A 1 213 ? 60.312 10.248  -0.304  1.00 7.52  ? 210  PHE A CB    1 
ATOM   1649 C  CG    . PHE A 1 213 ? 59.300 11.313  -0.669  1.00 7.83  ? 210  PHE A CG    1 
ATOM   1650 C  CD1   . PHE A 1 213 ? 58.625 11.250  -1.881  1.00 10.88 ? 210  PHE A CD1   1 
ATOM   1651 C  CD2   . PHE A 1 213 ? 59.013 12.359  0.198   1.00 9.27  ? 210  PHE A CD2   1 
ATOM   1652 C  CE1   . PHE A 1 213 ? 57.689 12.203  -2.231  1.00 8.75  ? 210  PHE A CE1   1 
ATOM   1653 C  CE2   . PHE A 1 213 ? 58.072 13.323  -0.158  1.00 8.67  ? 210  PHE A CE2   1 
ATOM   1654 C  CZ    . PHE A 1 213 ? 57.405 13.230  -1.372  1.00 7.04  ? 210  PHE A CZ    1 
ATOM   1655 N  N     . GLN A 1 214 ? 62.389 9.141   2.020   1.00 8.19  ? 211  GLN A N     1 
ATOM   1656 C  CA    . GLN A 1 214 ? 63.101 7.942   2.444   1.00 10.45 ? 211  GLN A CA    1 
ATOM   1657 C  C     . GLN A 1 214 ? 62.212 6.699   2.358   1.00 9.10  ? 211  GLN A C     1 
ATOM   1658 O  O     . GLN A 1 214 ? 60.987 6.785   2.449   1.00 9.77  ? 211  GLN A O     1 
ATOM   1659 C  CB    . GLN A 1 214 ? 63.625 8.109   3.871   1.00 10.59 ? 211  GLN A CB    1 
ATOM   1660 C  CG    . GLN A 1 214 ? 64.764 9.120   3.974   1.00 12.34 ? 211  GLN A CG    1 
ATOM   1661 C  CD    . GLN A 1 214 ? 65.313 9.264   5.383   1.00 13.59 ? 211  GLN A CD    1 
ATOM   1662 O  OE1   . GLN A 1 214 ? 64.723 8.790   6.353   1.00 15.58 ? 211  GLN A OE1   1 
ATOM   1663 N  NE2   . GLN A 1 214 ? 66.460 9.921   5.494   1.00 18.83 ? 211  GLN A NE2   1 
ATOM   1664 N  N     . CYS A 1 215 ? 62.829 5.533   2.184   1.00 9.37  ? 212  CYS A N     1 
ATOM   1665 C  CA    . CYS A 1 215 ? 62.048 4.305   2.115   1.00 10.24 ? 212  CYS A CA    1 
ATOM   1666 C  C     . CYS A 1 215 ? 62.823 3.126   2.667   1.00 10.24 ? 212  CYS A C     1 
ATOM   1667 O  O     . CYS A 1 215 ? 64.026 3.226   2.955   1.00 12.16 ? 212  CYS A O     1 
ATOM   1668 C  CB    . CYS A 1 215 ? 61.631 4.012   0.674   1.00 10.39 ? 212  CYS A CB    1 
ATOM   1669 S  SG    . CYS A 1 215 ? 63.036 3.725   -0.418  1.00 16.65 ? 212  CYS A SG    1 
ATOM   1670 N  N     . SER A 1 216 ? 62.114 2.017   2.837   1.00 9.47  ? 213  SER A N     1 
ATOM   1671 C  CA    . SER A 1 216 ? 62.727 0.757   3.219   1.00 9.47  ? 213  SER A CA    1 
ATOM   1672 C  C     . SER A 1 216 ? 62.522 -0.231  2.081   1.00 8.79  ? 213  SER A C     1 
ATOM   1673 O  O     . SER A 1 216 ? 61.765 0.026   1.147   1.00 9.45  ? 213  SER A O     1 
ATOM   1674 C  CB    . SER A 1 216 ? 62.100 0.228   4.500   1.00 12.70 ? 213  SER A CB    1 
ATOM   1675 O  OG    . SER A 1 216 ? 62.301 1.161   5.561   1.00 14.28 ? 213  SER A OG    1 
ATOM   1676 N  N     . ALA A 1 217 ? 63.237 -1.347  2.106   1.00 9.73  ? 214  ALA A N     1 
ATOM   1677 C  CA    . ALA A 1 217 ? 63.046 -2.327  1.056   1.00 5.78  ? 214  ALA A CA    1 
ATOM   1678 C  C     . ALA A 1 217 ? 63.399 -3.708  1.553   1.00 6.83  ? 214  ALA A C     1 
ATOM   1679 O  O     . ALA A 1 217 ? 64.187 -3.846  2.490   1.00 8.23  ? 214  ALA A O     1 
ATOM   1680 C  CB    . ALA A 1 217 ? 63.900 -1.983  -0.183  1.00 7.63  ? 214  ALA A CB    1 
ATOM   1681 N  N     . GLY A 1 218 ? 62.790 -4.714  0.935   1.00 6.64  ? 215  GLY A N     1 
ATOM   1682 C  CA    . GLY A 1 218 ? 63.179 -6.105  1.153   1.00 7.42  ? 215  GLY A CA    1 
ATOM   1683 C  C     . GLY A 1 218 ? 63.728 -6.683  -0.138  1.00 9.15  ? 215  GLY A C     1 
ATOM   1684 O  O     . GLY A 1 218 ? 63.234 -6.378  -1.222  1.00 8.40  ? 215  GLY A O     1 
ATOM   1685 N  N     . ILE A 1 219 ? 64.749 -7.529  -0.033  1.00 6.29  ? 216  ILE A N     1 
ATOM   1686 C  CA    . ILE A 1 219 ? 65.277 -8.215  -1.204  1.00 4.26  ? 216  ILE A CA    1 
ATOM   1687 C  C     . ILE A 1 219 ? 65.281 -9.717  -0.915  1.00 7.89  ? 216  ILE A C     1 
ATOM   1688 O  O     . ILE A 1 219 ? 65.883 -10.152 0.070   1.00 9.50  ? 216  ILE A O     1 
ATOM   1689 C  CB    . ILE A 1 219 ? 66.736 -7.773  -1.526  1.00 9.51  ? 216  ILE A CB    1 
ATOM   1690 C  CG1   . ILE A 1 219 ? 66.830 -6.248  -1.743  1.00 9.90  ? 216  ILE A CG1   1 
ATOM   1691 C  CG2   . ILE A 1 219 ? 67.261 -8.521  -2.753  1.00 9.37  ? 216  ILE A CG2   1 
ATOM   1692 C  CD1   . ILE A 1 219 ? 67.229 -5.431  -0.490  1.00 12.60 ? 216  ILE A CD1   1 
ATOM   1693 N  N     . SER A 1 220 ? 64.588 -10.492 -1.745  1.00 8.65  ? 217  SER A N     1 
ATOM   1694 C  CA    . SER A 1 220 ? 64.585 -11.944 -1.616  1.00 5.93  ? 217  SER A CA    1 
ATOM   1695 C  C     . SER A 1 220 ? 64.314 -12.592 -2.978  1.00 7.70  ? 217  SER A C     1 
ATOM   1696 O  O     . SER A 1 220 ? 64.619 -12.000 -4.015  1.00 8.55  ? 217  SER A O     1 
ATOM   1697 C  CB    . SER A 1 220 ? 63.558 -12.381 -0.569  1.00 9.79  ? 217  SER A CB    1 
ATOM   1698 O  OG    . SER A 1 220 ? 63.731 -13.743 -0.210  1.00 9.29  ? 217  SER A OG    1 
ATOM   1699 N  N     . HIS A 1 221 ? 63.787 -13.814 -2.973  1.00 8.47  ? 218  HIS A N     1 
ATOM   1700 C  CA    . HIS A 1 221 ? 63.593 -14.582 -4.198  1.00 7.17  ? 218  HIS A CA    1 
ATOM   1701 C  C     . HIS A 1 221 ? 62.155 -14.556 -4.697  1.00 9.64  ? 218  HIS A C     1 
ATOM   1702 O  O     . HIS A 1 221 ? 61.852 -15.096 -5.760  1.00 7.62  ? 218  HIS A O     1 
ATOM   1703 C  CB    . HIS A 1 221 ? 64.029 -16.036 -3.984  1.00 8.59  ? 218  HIS A CB    1 
ATOM   1704 C  CG    . HIS A 1 221 ? 65.509 -16.208 -3.890  1.00 10.55 ? 218  HIS A CG    1 
ATOM   1705 N  ND1   . HIS A 1 221 ? 66.361 -15.857 -4.915  1.00 9.42  ? 218  HIS A ND1   1 
ATOM   1706 C  CD2   . HIS A 1 221 ? 66.289 -16.703 -2.898  1.00 8.97  ? 218  HIS A CD2   1 
ATOM   1707 C  CE1   . HIS A 1 221 ? 67.607 -16.131 -4.556  1.00 11.50 ? 218  HIS A CE1   1 
ATOM   1708 N  NE2   . HIS A 1 221 ? 67.588 -16.647 -3.339  1.00 9.40  ? 218  HIS A NE2   1 
ATOM   1709 N  N     . ASN A 1 222 ? 61.276 -13.926 -3.932  1.00 6.50  ? 219  ASN A N     1 
ATOM   1710 C  CA    . ASN A 1 222 ? 59.868 -13.820 -4.308  1.00 6.34  ? 219  ASN A CA    1 
ATOM   1711 C  C     . ASN A 1 222 ? 59.178 -12.649 -3.608  1.00 8.25  ? 219  ASN A C     1 
ATOM   1712 O  O     . ASN A 1 222 ? 59.746 -12.016 -2.708  1.00 8.95  ? 219  ASN A O     1 
ATOM   1713 C  CB    . ASN A 1 222 ? 59.108 -15.132 -4.058  1.00 8.61  ? 219  ASN A CB    1 
ATOM   1714 C  CG    . ASN A 1 222 ? 59.223 -15.608 -2.616  1.00 12.16 ? 219  ASN A CG    1 
ATOM   1715 O  OD1   . ASN A 1 222 ? 58.729 -14.949 -1.708  1.00 9.18  ? 219  ASN A OD1   1 
ATOM   1716 N  ND2   . ASN A 1 222 ? 59.863 -16.762 -2.405  1.00 10.70 ? 219  ASN A ND2   1 
ATOM   1717 N  N     . LYS A 1 223 ? 57.953 -12.356 -4.027  1.00 9.52  ? 220  LYS A N     1 
ATOM   1718 C  CA    . LYS A 1 223 ? 57.237 -11.195 -3.495  1.00 6.66  ? 220  LYS A CA    1 
ATOM   1719 C  C     . LYS A 1 223 ? 56.924 -11.314 -2.001  1.00 9.17  ? 220  LYS A C     1 
ATOM   1720 O  O     . LYS A 1 223 ? 57.081 -10.351 -1.256  1.00 9.31  ? 220  LYS A O     1 
ATOM   1721 C  CB    . LYS A 1 223 ? 55.964 -10.932 -4.311  1.00 8.58  ? 220  LYS A CB    1 
ATOM   1722 C  CG    . LYS A 1 223 ? 56.238 -10.548 -5.760  1.00 10.43 ? 220  LYS A CG    1 
ATOM   1723 C  CD    . LYS A 1 223 ? 54.983 -10.736 -6.634  1.00 22.06 ? 220  LYS A CD    1 
ATOM   1724 C  CE    . LYS A 1 223 ? 53.926 -9.708  -6.343  1.00 23.25 ? 220  LYS A CE    1 
ATOM   1725 N  NZ    . LYS A 1 223 ? 52.721 -9.878  -7.230  1.00 15.93 ? 220  LYS A NZ    1 
ATOM   1726 N  N     . VAL A 1 224 ? 56.481 -12.488 -1.555  1.00 9.26  ? 221  VAL A N     1 
ATOM   1727 C  CA    . VAL A 1 224 ? 56.080 -12.643 -0.152  1.00 8.41  ? 221  VAL A CA    1 
ATOM   1728 C  C     . VAL A 1 224 ? 57.272 -12.448 0.783   1.00 8.42  ? 221  VAL A C     1 
ATOM   1729 O  O     . VAL A 1 224 ? 57.179 -11.716 1.777   1.00 8.87  ? 221  VAL A O     1 
ATOM   1730 C  CB    . VAL A 1 224 ? 55.385 -14.004 0.110   1.00 10.63 ? 221  VAL A CB    1 
ATOM   1731 C  CG1   . VAL A 1 224 ? 55.362 -14.330 1.604   1.00 12.16 ? 221  VAL A CG1   1 
ATOM   1732 C  CG2   . VAL A 1 224 ? 53.979 -13.988 -0.458  1.00 13.38 ? 221  VAL A CG2   1 
ATOM   1733 N  N     . LEU A 1 225 ? 58.402 -13.065 0.452   1.00 8.48  ? 222  LEU A N     1 
ATOM   1734 C  CA    . LEU A 1 225 ? 59.589 -12.891 1.285   1.00 7.74  ? 222  LEU A CA    1 
ATOM   1735 C  C     . LEU A 1 225 ? 60.137 -11.457 1.210   1.00 8.22  ? 222  LEU A C     1 
ATOM   1736 O  O     . LEU A 1 225 ? 60.641 -10.921 2.203   1.00 9.29  ? 222  LEU A O     1 
ATOM   1737 C  CB    . LEU A 1 225 ? 60.690 -13.909 0.935   1.00 7.28  ? 222  LEU A CB    1 
ATOM   1738 C  CG    . LEU A 1 225 ? 60.441 -15.361 1.370   1.00 8.68  ? 222  LEU A CG    1 
ATOM   1739 C  CD1   . LEU A 1 225 ? 61.624 -16.238 0.989   1.00 12.58 ? 222  LEU A CD1   1 
ATOM   1740 C  CD2   . LEU A 1 225 ? 60.173 -15.447 2.863   1.00 11.89 ? 222  LEU A CD2   1 
ATOM   1741 N  N     . ALA A 1 226 ? 60.069 -10.847 0.030   1.00 7.45  ? 223  ALA A N     1 
ATOM   1742 C  CA    . ALA A 1 226 ? 60.538 -9.471  -0.110  1.00 7.01  ? 223  ALA A CA    1 
ATOM   1743 C  C     . ALA A 1 226 ? 59.720 -8.521  0.756   1.00 9.42  ? 223  ALA A C     1 
ATOM   1744 O  O     . ALA A 1 226 ? 60.262 -7.602  1.389   1.00 7.88  ? 223  ALA A O     1 
ATOM   1745 C  CB    . ALA A 1 226 ? 60.475 -9.042  -1.580  1.00 7.81  ? 223  ALA A CB    1 
ATOM   1746 N  N     . LYS A 1 227 ? 58.404 -8.719  0.763   1.00 9.47  ? 224  LYS A N     1 
ATOM   1747 C  CA    . LYS A 1 227 ? 57.515 -7.884  1.568   1.00 9.27  ? 224  LYS A CA    1 
ATOM   1748 C  C     . LYS A 1 227 ? 57.798 -8.096  3.053   1.00 11.01 ? 224  LYS A C     1 
ATOM   1749 O  O     . LYS A 1 227 ? 57.887 -7.132  3.819   1.00 9.25  ? 224  LYS A O     1 
ATOM   1750 C  CB    . LYS A 1 227 ? 56.044 -8.208  1.268   1.00 8.30  ? 224  LYS A CB    1 
ATOM   1751 C  CG    . LYS A 1 227 ? 55.038 -7.430  2.151   1.00 13.55 ? 224  LYS A CG    1 
ATOM   1752 C  CD    A LYS A 1 227 ? 55.107 -5.928  1.888   0.50 16.94 ? 224  LYS A CD    1 
ATOM   1753 C  CD    B LYS A 1 227 ? 55.146 -5.917  1.980   0.50 16.94 ? 224  LYS A CD    1 
ATOM   1754 C  CE    A LYS A 1 227 ? 54.183 -5.168  2.831   0.50 22.96 ? 224  LYS A CE    1 
ATOM   1755 C  CE    B LYS A 1 227 ? 54.075 -5.211  2.812   0.50 22.95 ? 224  LYS A CE    1 
ATOM   1756 N  NZ    A LYS A 1 227 ? 52.845 -5.815  2.917   0.50 22.54 ? 224  LYS A NZ    1 
ATOM   1757 N  NZ    B LYS A 1 227 ? 54.127 -3.729  2.703   0.50 18.73 ? 224  LYS A NZ    1 
ATOM   1758 N  N     . LEU A 1 228 ? 57.944 -9.354  3.450   1.00 9.19  ? 225  LEU A N     1 
ATOM   1759 C  CA    . LEU A 1 228 ? 58.229 -9.665  4.844   1.00 9.12  ? 225  LEU A CA    1 
ATOM   1760 C  C     . LEU A 1 228 ? 59.552 -9.024  5.246   1.00 12.08 ? 225  LEU A C     1 
ATOM   1761 O  O     . LEU A 1 228 ? 59.660 -8.370  6.287   1.00 11.56 ? 225  LEU A O     1 
ATOM   1762 C  CB    . LEU A 1 228 ? 58.293 -11.172 5.056   1.00 10.48 ? 225  LEU A CB    1 
ATOM   1763 C  CG    . LEU A 1 228 ? 58.507 -11.629 6.502   1.00 15.17 ? 225  LEU A CG    1 
ATOM   1764 C  CD1   . LEU A 1 228 ? 57.306 -11.226 7.351   1.00 18.05 ? 225  LEU A CD1   1 
ATOM   1765 C  CD2   . LEU A 1 228 ? 58.710 -13.131 6.551   1.00 13.48 ? 225  LEU A CD2   1 
ATOM   1766 N  N     . ALA A 1 229 ? 60.555 -9.202  4.396   1.00 9.17  ? 226  ALA A N     1 
ATOM   1767 C  CA    . ALA A 1 229 ? 61.880 -8.651  4.642   1.00 8.89  ? 226  ALA A CA    1 
ATOM   1768 C  C     . ALA A 1 229 ? 61.839 -7.133  4.837   1.00 9.55  ? 226  ALA A C     1 
ATOM   1769 O  O     . ALA A 1 229 ? 62.491 -6.588  5.732   1.00 11.69 ? 226  ALA A O     1 
ATOM   1770 C  CB    . ALA A 1 229 ? 62.812 -9.002  3.493   1.00 7.83  ? 226  ALA A CB    1 
ATOM   1771 N  N     . CYS A 1 230 ? 61.086 -6.449  3.982   1.00 8.60  ? 227  CYS A N     1 
ATOM   1772 C  CA    . CYS A 1 230 ? 61.048 -4.990  4.009   1.00 7.80  ? 227  CYS A CA    1 
ATOM   1773 C  C     . CYS A 1 230 ? 60.689 -4.463  5.400   1.00 11.88 ? 227  CYS A C     1 
ATOM   1774 O  O     . CYS A 1 230 ? 61.289 -3.496  5.887   1.00 12.76 ? 227  CYS A O     1 
ATOM   1775 C  CB    . CYS A 1 230 ? 60.054 -4.474  2.964   1.00 11.01 ? 227  CYS A CB    1 
ATOM   1776 S  SG    . CYS A 1 230 ? 59.945 -2.663  2.900   1.00 12.46 ? 227  CYS A SG    1 
ATOM   1777 N  N     . GLY A 1 231 ? 59.743 -5.128  6.055   1.00 9.96  ? 228  GLY A N     1 
ATOM   1778 C  CA    . GLY A 1 231 ? 59.287 -4.701  7.373   1.00 11.82 ? 228  GLY A CA    1 
ATOM   1779 C  C     . GLY A 1 231 ? 60.206 -5.022  8.554   1.00 13.44 ? 228  GLY A C     1 
ATOM   1780 O  O     . GLY A 1 231 ? 59.961 -4.566  9.673   1.00 16.34 ? 228  GLY A O     1 
ATOM   1781 N  N     . LEU A 1 232 ? 61.266 -5.788  8.325   1.00 11.18 ? 229  LEU A N     1 
ATOM   1782 C  CA    . LEU A 1 232 ? 62.101 -6.266  9.431   1.00 10.46 ? 229  LEU A CA    1 
ATOM   1783 C  C     . LEU A 1 232 ? 62.985 -5.165  10.007  1.00 12.25 ? 229  LEU A C     1 
ATOM   1784 O  O     . LEU A 1 232 ? 63.318 -5.175  11.203  1.00 14.50 ? 229  LEU A O     1 
ATOM   1785 C  CB    . LEU A 1 232 ? 62.968 -7.443  8.984   1.00 10.73 ? 229  LEU A CB    1 
ATOM   1786 C  CG    . LEU A 1 232 ? 62.174 -8.725  8.698   1.00 14.05 ? 229  LEU A CG    1 
ATOM   1787 C  CD1   . LEU A 1 232 ? 63.103 -9.843  8.263   1.00 13.86 ? 229  LEU A CD1   1 
ATOM   1788 C  CD2   . LEU A 1 232 ? 61.353 -9.133  9.921   1.00 19.93 ? 229  LEU A CD2   1 
ATOM   1789 N  N     . ASN A 1 233 ? 63.396 -4.235  9.153   1.00 9.27  ? 230  ASN A N     1 
ATOM   1790 C  CA    . ASN A 1 233 ? 64.189 -3.104  9.598   1.00 9.75  ? 230  ASN A CA    1 
ATOM   1791 C  C     . ASN A 1 233 ? 63.699 -1.803  8.954   1.00 14.08 ? 230  ASN A C     1 
ATOM   1792 O  O     . ASN A 1 233 ? 64.153 -1.414  7.886   1.00 27.71 ? 230  ASN A O     1 
ATOM   1793 C  CB    . ASN A 1 233 ? 65.678 -3.331  9.310   1.00 10.87 ? 230  ASN A CB    1 
ATOM   1794 C  CG    . ASN A 1 233 ? 66.225 -4.572  10.011  1.00 11.93 ? 230  ASN A CG    1 
ATOM   1795 O  OD1   . ASN A 1 233 ? 66.544 -4.527  11.202  1.00 14.71 ? 230  ASN A OD1   1 
ATOM   1796 N  ND2   . ASN A 1 233 ? 66.354 -5.673  9.275   1.00 11.58 ? 230  ASN A ND2   1 
ATOM   1797 N  N     . LYS A 1 234 ? 62.734 -1.170  9.603   1.00 24.01 ? 231  LYS A N     1 
ATOM   1798 C  CA    . LYS A 1 234 ? 62.216 0.124   9.171   1.00 15.66 ? 231  LYS A CA    1 
ATOM   1799 C  C     . LYS A 1 234 ? 62.516 1.064   10.317  1.00 15.99 ? 231  LYS A C     1 
ATOM   1800 O  O     . LYS A 1 234 ? 62.584 0.629   11.470  1.00 23.74 ? 231  LYS A O     1 
ATOM   1801 C  CB    . LYS A 1 234 ? 60.693 0.061   8.971   1.00 19.92 ? 231  LYS A CB    1 
ATOM   1802 C  CG    . LYS A 1 234 ? 60.211 -0.274  7.566   1.00 21.36 ? 231  LYS A CG    1 
ATOM   1803 C  CD    . LYS A 1 234 ? 58.733 0.149   7.389   1.00 20.28 ? 231  LYS A CD    1 
ATOM   1804 C  CE    . LYS A 1 234 ? 58.298 0.217   5.918   1.00 20.00 ? 231  LYS A CE    1 
ATOM   1805 N  NZ    . LYS A 1 234 ? 58.382 1.607   5.314   1.00 11.31 ? 231  LYS A NZ    1 
ATOM   1806 N  N     . PRO A 1 235 ? 62.686 2.358   10.030  1.00 12.94 ? 232  PRO A N     1 
ATOM   1807 C  CA    . PRO A 1 235 ? 62.622 2.982   8.704   1.00 12.71 ? 232  PRO A CA    1 
ATOM   1808 C  C     . PRO A 1 235 ? 63.994 3.159   8.076   1.00 13.37 ? 232  PRO A C     1 
ATOM   1809 O  O     . PRO A 1 235 ? 65.013 2.949   8.742   1.00 11.97 ? 232  PRO A O     1 
ATOM   1810 C  CB    . PRO A 1 235 ? 62.072 4.367   9.028   1.00 14.48 ? 232  PRO A CB    1 
ATOM   1811 C  CG    . PRO A 1 235 ? 62.696 4.682   10.371  1.00 15.69 ? 232  PRO A CG    1 
ATOM   1812 C  CD    . PRO A 1 235 ? 62.713 3.364   11.109  1.00 19.14 ? 232  PRO A CD    1 
ATOM   1813 N  N     . ASN A 1 236 ? 63.998 3.560   6.805   1.00 11.62 ? 233  ASN A N     1 
ATOM   1814 C  CA    . ASN A 1 236 ? 65.218 3.954   6.102   1.00 10.09 ? 233  ASN A CA    1 
ATOM   1815 C  C     . ASN A 1 236 ? 66.321 2.889   6.065   1.00 8.82  ? 233  ASN A C     1 
ATOM   1816 O  O     . ASN A 1 236 ? 67.501 3.228   6.155   1.00 10.10 ? 233  ASN A O     1 
ATOM   1817 C  CB    . ASN A 1 236 ? 65.750 5.271   6.703   1.00 11.10 ? 233  ASN A CB    1 
ATOM   1818 C  CG    . ASN A 1 236 ? 66.799 5.939   5.825   1.00 12.81 ? 233  ASN A CG    1 
ATOM   1819 O  OD1   . ASN A 1 236 ? 66.751 5.843   4.601   1.00 15.62 ? 233  ASN A OD1   1 
ATOM   1820 N  ND2   . ASN A 1 236 ? 67.744 6.629   6.452   1.00 20.91 ? 233  ASN A ND2   1 
ATOM   1821 N  N     . ARG A 1 237 ? 65.932 1.616   5.931   1.00 8.25  ? 234  ARG A N     1 
ATOM   1822 C  CA    . ARG A 1 237 ? 66.895 0.512   5.857   1.00 9.75  ? 234  ARG A CA    1 
ATOM   1823 C  C     . ARG A 1 237 ? 66.367 -0.542  4.912   1.00 10.36 ? 234  ARG A C     1 
ATOM   1824 O  O     . ARG A 1 237 ? 65.178 -0.547  4.583   1.00 10.88 ? 234  ARG A O     1 
ATOM   1825 C  CB    . ARG A 1 237 ? 67.098 -0.128  7.235   1.00 11.38 ? 234  ARG A CB    1 
ATOM   1826 C  CG    . ARG A 1 237 ? 67.710 0.776   8.291   1.00 11.92 ? 234  ARG A CG    1 
ATOM   1827 C  CD    . ARG A 1 237 ? 69.164 1.074   7.969   1.00 13.49 ? 234  ARG A CD    1 
ATOM   1828 N  NE    . ARG A 1 237 ? 69.834 1.829   9.035   1.00 22.55 ? 234  ARG A NE    1 
ATOM   1829 C  CZ    . ARG A 1 237 ? 69.947 3.157   9.057   1.00 24.54 ? 234  ARG A CZ    1 
ATOM   1830 N  NH1   . ARG A 1 237 ? 69.439 3.891   8.076   1.00 20.65 ? 234  ARG A NH1   1 
ATOM   1831 N  NH2   . ARG A 1 237 ? 70.574 3.754   10.061  1.00 25.74 ? 234  ARG A NH2   1 
ATOM   1832 N  N     . GLN A 1 238 ? 67.237 -1.439  4.465   1.00 8.70  ? 235  GLN A N     1 
ATOM   1833 C  CA    . GLN A 1 238 ? 66.775 -2.534  3.625   1.00 7.54  ? 235  GLN A CA    1 
ATOM   1834 C  C     . GLN A 1 238 ? 67.285 -3.861  4.158   1.00 8.77  ? 235  GLN A C     1 
ATOM   1835 O  O     . GLN A 1 238 ? 68.321 -3.919  4.821   1.00 9.94  ? 235  GLN A O     1 
ATOM   1836 C  CB    . GLN A 1 238 ? 67.203 -2.323  2.173   1.00 8.61  ? 235  GLN A CB    1 
ATOM   1837 C  CG    . GLN A 1 238 ? 68.715 -2.182  1.992   1.00 11.44 ? 235  GLN A CG    1 
ATOM   1838 C  CD    . GLN A 1 238 ? 69.082 -1.914  0.539   1.00 10.70 ? 235  GLN A CD    1 
ATOM   1839 O  OE1   . GLN A 1 238 ? 68.658 -0.913  -0.052  1.00 12.99 ? 235  GLN A OE1   1 
ATOM   1840 N  NE2   . GLN A 1 238 ? 69.848 -2.818  -0.055  1.00 9.96  ? 235  GLN A NE2   1 
ATOM   1841 N  N     . THR A 1 239 ? 66.552 -4.931  3.868   1.00 8.65  ? 236  THR A N     1 
ATOM   1842 C  CA    . THR A 1 239 ? 66.864 -6.217  4.473   1.00 9.80  ? 236  THR A CA    1 
ATOM   1843 C  C     . THR A 1 239 ? 66.877 -7.288  3.402   1.00 7.98  ? 236  THR A C     1 
ATOM   1844 O  O     . THR A 1 239 ? 65.967 -7.348  2.565   1.00 9.65  ? 236  THR A O     1 
ATOM   1845 C  CB    . THR A 1 239 ? 65.833 -6.582  5.533   1.00 9.31  ? 236  THR A CB    1 
ATOM   1846 O  OG1   . THR A 1 239 ? 65.757 -5.538  6.509   1.00 11.11 ? 236  THR A OG1   1 
ATOM   1847 C  CG2   . THR A 1 239 ? 66.217 -7.891  6.246   1.00 10.19 ? 236  THR A CG2   1 
ATOM   1848 N  N     . LEU A 1 240 ? 67.920 -8.117  3.429   1.00 8.06  ? 237  LEU A N     1 
ATOM   1849 C  CA    . LEU A 1 240 ? 68.056 -9.258  2.531   1.00 6.44  ? 237  LEU A CA    1 
ATOM   1850 C  C     . LEU A 1 240 ? 67.669 -10.525 3.282   1.00 7.16  ? 237  LEU A C     1 
ATOM   1851 O  O     . LEU A 1 240 ? 68.224 -10.825 4.344   1.00 9.15  ? 237  LEU A O     1 
ATOM   1852 C  CB    . LEU A 1 240 ? 69.509 -9.344  2.028   1.00 7.09  ? 237  LEU A CB    1 
ATOM   1853 C  CG    . LEU A 1 240 ? 69.903 -10.391 0.984   1.00 8.22  ? 237  LEU A CG    1 
ATOM   1854 C  CD1   . LEU A 1 240 ? 71.217 -9.980  0.302   1.00 10.80 ? 237  LEU A CD1   1 
ATOM   1855 C  CD2   . LEU A 1 240 ? 70.040 -11.800 1.576   1.00 10.32 ? 237  LEU A CD2   1 
ATOM   1856 N  N     . VAL A 1 241 ? 66.694 -11.252 2.745   1.00 6.42  ? 238  VAL A N     1 
ATOM   1857 C  CA    . VAL A 1 241 ? 66.272 -12.519 3.334   1.00 9.82  ? 238  VAL A CA    1 
ATOM   1858 C  C     . VAL A 1 241 ? 66.647 -13.617 2.352   1.00 11.39 ? 238  VAL A C     1 
ATOM   1859 O  O     . VAL A 1 241 ? 66.085 -13.706 1.264   1.00 9.99  ? 238  VAL A O     1 
ATOM   1860 C  CB    . VAL A 1 241 ? 64.753 -12.527 3.601   1.00 8.64  ? 238  VAL A CB    1 
ATOM   1861 C  CG1   . VAL A 1 241 ? 64.222 -13.972 3.832   1.00 8.41  ? 238  VAL A CG1   1 
ATOM   1862 C  CG2   . VAL A 1 241 ? 64.423 -11.660 4.789   1.00 7.35  ? 238  VAL A CG2   1 
ATOM   1863 N  N     . SER A 1 242 ? 67.635 -14.425 2.721   1.00 9.03  ? 239  SER A N     1 
ATOM   1864 C  CA    . SER A 1 242 ? 68.126 -15.460 1.826   1.00 9.62  ? 239  SER A CA    1 
ATOM   1865 C  C     . SER A 1 242 ? 67.267 -16.708 1.947   1.00 7.06  ? 239  SER A C     1 
ATOM   1866 O  O     . SER A 1 242 ? 66.497 -16.854 2.900   1.00 9.42  ? 239  SER A O     1 
ATOM   1867 C  CB    . SER A 1 242 ? 69.573 -15.819 2.180   1.00 12.46 ? 239  SER A CB    1 
ATOM   1868 O  OG    . SER A 1 242 ? 69.632 -16.312 3.516   1.00 12.47 ? 239  SER A OG    1 
ATOM   1869 N  N     . HIS A 1 243 ? 67.409 -17.625 0.999   1.00 7.19  ? 240  HIS A N     1 
ATOM   1870 C  CA    . HIS A 1 243 ? 66.646 -18.864 1.083   1.00 8.16  ? 240  HIS A CA    1 
ATOM   1871 C  C     . HIS A 1 243 ? 67.023 -19.608 2.371   1.00 9.58  ? 240  HIS A C     1 
ATOM   1872 O  O     . HIS A 1 243 ? 66.157 -20.169 3.060   1.00 7.98  ? 240  HIS A O     1 
ATOM   1873 C  CB    . HIS A 1 243 ? 66.900 -19.762 -0.130  1.00 11.73 ? 240  HIS A CB    1 
ATOM   1874 C  CG    . HIS A 1 243 ? 66.140 -21.054 -0.087  1.00 12.61 ? 240  HIS A CG    1 
ATOM   1875 N  ND1   . HIS A 1 243 ? 64.785 -21.129 -0.322  1.00 14.00 ? 240  HIS A ND1   1 
ATOM   1876 C  CD2   . HIS A 1 243 ? 66.549 -22.319 0.170   1.00 15.99 ? 240  HIS A CD2   1 
ATOM   1877 C  CE1   . HIS A 1 243 ? 64.390 -22.389 -0.221  1.00 15.47 ? 240  HIS A CE1   1 
ATOM   1878 N  NE2   . HIS A 1 243 ? 65.442 -23.129 0.077   1.00 17.88 ? 240  HIS A NE2   1 
ATOM   1879 N  N     . GLY A 1 244 ? 68.316 -19.587 2.688   1.00 10.16 ? 241  GLY A N     1 
ATOM   1880 C  CA    . GLY A 1 244 ? 68.832 -20.302 3.843   1.00 10.65 ? 241  GLY A CA    1 
ATOM   1881 C  C     . GLY A 1 244 ? 68.335 -19.745 5.163   1.00 8.97  ? 241  GLY A C     1 
ATOM   1882 O  O     . GLY A 1 244 ? 68.274 -20.468 6.160   1.00 12.63 ? 241  GLY A O     1 
ATOM   1883 N  N     . SER A 1 245 ? 67.954 -18.464 5.170   1.00 9.27  ? 242  SER A N     1 
ATOM   1884 C  CA    . SER A 1 245 ? 67.453 -17.834 6.396   1.00 9.21  ? 242  SER A CA    1 
ATOM   1885 C  C     . SER A 1 245 ? 66.027 -18.250 6.759   1.00 9.52  ? 242  SER A C     1 
ATOM   1886 O  O     . SER A 1 245 ? 65.551 -17.982 7.865   1.00 8.91  ? 242  SER A O     1 
ATOM   1887 C  CB    . SER A 1 245 ? 67.525 -16.306 6.288   1.00 10.90 ? 242  SER A CB    1 
ATOM   1888 O  OG    . SER A 1 245 ? 66.451 -15.793 5.505   1.00 10.30 ? 242  SER A OG    1 
ATOM   1889 N  N     . VAL A 1 246 ? 65.343 -18.904 5.831   1.00 6.99  ? 243  VAL A N     1 
ATOM   1890 C  CA    . VAL A 1 246 ? 63.922 -19.185 6.014   1.00 7.64  ? 243  VAL A CA    1 
ATOM   1891 C  C     . VAL A 1 246 ? 63.558 -20.114 7.191   1.00 8.89  ? 243  VAL A C     1 
ATOM   1892 O  O     . VAL A 1 246 ? 62.700 -19.775 7.995   1.00 8.16  ? 243  VAL A O     1 
ATOM   1893 C  CB    . VAL A 1 246 ? 63.265 -19.627 4.697   1.00 7.60  ? 243  VAL A CB    1 
ATOM   1894 C  CG1   . VAL A 1 246 ? 61.829 -20.092 4.945   1.00 9.01  ? 243  VAL A CG1   1 
ATOM   1895 C  CG2   . VAL A 1 246 ? 63.299 -18.466 3.695   1.00 9.56  ? 243  VAL A CG2   1 
ATOM   1896 N  N     . PRO A 1 247 ? 64.219 -21.275 7.320   1.00 8.41  ? 244  PRO A N     1 
ATOM   1897 C  CA    . PRO A 1 247 ? 63.816 -22.135 8.443   1.00 7.14  ? 244  PRO A CA    1 
ATOM   1898 C  C     . PRO A 1 247 ? 63.861 -21.438 9.815   1.00 7.58  ? 244  PRO A C     1 
ATOM   1899 O  O     . PRO A 1 247 ? 62.908 -21.572 10.580  1.00 8.43  ? 244  PRO A O     1 
ATOM   1900 C  CB    . PRO A 1 247 ? 64.824 -23.301 8.373   1.00 9.41  ? 244  PRO A CB    1 
ATOM   1901 C  CG    . PRO A 1 247 ? 65.141 -23.395 6.885   1.00 9.57  ? 244  PRO A CG    1 
ATOM   1902 C  CD    . PRO A 1 247 ? 65.215 -21.931 6.448   1.00 8.52  ? 244  PRO A CD    1 
ATOM   1903 N  N     . GLN A 1 248 ? 64.925 -20.704 10.131  1.00 8.35  ? 245  GLN A N     1 
ATOM   1904 C  CA    . GLN A 1 248 ? 64.969 -20.025 11.428  1.00 9.37  ? 245  GLN A CA    1 
ATOM   1905 C  C     . GLN A 1 248 ? 63.960 -18.879 11.517  1.00 10.30 ? 245  GLN A C     1 
ATOM   1906 O  O     . GLN A 1 248 ? 63.274 -18.714 12.525  1.00 9.42  ? 245  GLN A O     1 
ATOM   1907 C  CB    . GLN A 1 248 ? 66.385 -19.547 11.771  1.00 10.49 ? 245  GLN A CB    1 
ATOM   1908 C  CG    . GLN A 1 248 ? 67.354 -20.700 12.028  1.00 20.31 ? 245  GLN A CG    1 
ATOM   1909 C  CD    . GLN A 1 248 ? 68.473 -20.339 12.992  1.00 31.43 ? 245  GLN A CD    1 
ATOM   1910 O  OE1   . GLN A 1 248 ? 68.248 -20.210 14.200  1.00 36.74 ? 245  GLN A OE1   1 
ATOM   1911 N  NE2   . GLN A 1 248 ? 69.692 -20.190 12.466  1.00 21.87 ? 245  GLN A NE2   1 
ATOM   1912 N  N     . LEU A 1 249 ? 63.857 -18.100 10.444  1.00 8.32  ? 246  LEU A N     1 
ATOM   1913 C  CA    . LEU A 1 249 ? 62.936 -16.968 10.433  1.00 7.67  ? 246  LEU A CA    1 
ATOM   1914 C  C     . LEU A 1 249 ? 61.511 -17.443 10.639  1.00 7.36  ? 246  LEU A C     1 
ATOM   1915 O  O     . LEU A 1 249 ? 60.749 -16.850 11.414  1.00 10.58 ? 246  LEU A O     1 
ATOM   1916 C  CB    . LEU A 1 249 ? 63.044 -16.223 9.104   1.00 9.76  ? 246  LEU A CB    1 
ATOM   1917 C  CG    . LEU A 1 249 ? 62.143 -14.999 8.965   1.00 12.17 ? 246  LEU A CG    1 
ATOM   1918 C  CD1   . LEU A 1 249 ? 62.504 -13.945 10.010  1.00 12.28 ? 246  LEU A CD1   1 
ATOM   1919 C  CD2   . LEU A 1 249 ? 62.288 -14.465 7.553   1.00 12.43 ? 246  LEU A CD2   1 
ATOM   1920 N  N     . PHE A 1 250 ? 61.144 -18.518 9.952   1.00 8.68  ? 247  PHE A N     1 
ATOM   1921 C  CA    . PHE A 1 250 ? 59.770 -18.985 10.011  1.00 8.03  ? 247  PHE A CA    1 
ATOM   1922 C  C     . PHE A 1 250 ? 59.460 -19.773 11.274  1.00 7.53  ? 247  PHE A C     1 
ATOM   1923 O  O     . PHE A 1 250 ? 58.293 -19.970 11.600  1.00 7.35  ? 247  PHE A O     1 
ATOM   1924 C  CB    . PHE A 1 250 ? 59.435 -19.832 8.782   1.00 8.21  ? 247  PHE A CB    1 
ATOM   1925 C  CG    . PHE A 1 250 ? 59.042 -19.028 7.566   1.00 6.27  ? 247  PHE A CG    1 
ATOM   1926 C  CD1   . PHE A 1 250 ? 58.515 -19.668 6.465   1.00 8.31  ? 247  PHE A CD1   1 
ATOM   1927 C  CD2   . PHE A 1 250 ? 59.194 -17.646 7.534   1.00 10.73 ? 247  PHE A CD2   1 
ATOM   1928 C  CE1   . PHE A 1 250 ? 58.143 -18.946 5.330   1.00 9.87  ? 247  PHE A CE1   1 
ATOM   1929 C  CE2   . PHE A 1 250 ? 58.832 -16.913 6.404   1.00 9.30  ? 247  PHE A CE2   1 
ATOM   1930 C  CZ    . PHE A 1 250 ? 58.294 -17.576 5.302   1.00 10.26 ? 247  PHE A CZ    1 
ATOM   1931 N  N     . SER A 1 251 ? 60.494 -20.194 12.000  1.00 7.12  ? 248  SER A N     1 
ATOM   1932 C  CA    . SER A 1 251 ? 60.278 -21.074 13.145  1.00 6.87  ? 248  SER A CA    1 
ATOM   1933 C  C     . SER A 1 251 ? 59.538 -20.363 14.283  1.00 7.57  ? 248  SER A C     1 
ATOM   1934 O  O     . SER A 1 251 ? 58.889 -21.020 15.096  1.00 7.52  ? 248  SER A O     1 
ATOM   1935 C  CB    . SER A 1 251 ? 61.609 -21.658 13.640  1.00 8.65  ? 248  SER A CB    1 
ATOM   1936 O  OG    . SER A 1 251 ? 62.377 -20.688 14.336  1.00 8.81  ? 248  SER A OG    1 
ATOM   1937 N  N     . GLN A 1 252 ? 59.616 -19.033 14.333  1.00 8.29  ? 249  GLN A N     1 
ATOM   1938 C  CA    . GLN A 1 252 ? 58.872 -18.274 15.334  1.00 10.43 ? 249  GLN A CA    1 
ATOM   1939 C  C     . GLN A 1 252 ? 58.027 -17.173 14.699  1.00 11.43 ? 249  GLN A C     1 
ATOM   1940 O  O     . GLN A 1 252 ? 57.692 -16.189 15.362  1.00 12.57 ? 249  GLN A O     1 
ATOM   1941 C  CB    . GLN A 1 252 ? 59.827 -17.622 16.335  1.00 13.23 ? 249  GLN A CB    1 
ATOM   1942 C  CG    . GLN A 1 252 ? 60.725 -18.575 17.078  1.00 14.68 ? 249  GLN A CG    1 
ATOM   1943 C  CD    . GLN A 1 252 ? 61.518 -17.847 18.143  1.00 16.18 ? 249  GLN A CD    1 
ATOM   1944 O  OE1   . GLN A 1 252 ? 61.043 -17.645 19.263  1.00 20.53 ? 249  GLN A OE1   1 
ATOM   1945 N  NE2   . GLN A 1 252 ? 62.720 -17.420 17.790  1.00 18.02 ? 249  GLN A NE2   1 
ATOM   1946 N  N     . MET A 1 253 ? 57.715 -17.325 13.416  1.00 6.63  ? 250  MET A N     1 
ATOM   1947 C  CA    . MET A 1 253 ? 56.988 -16.293 12.692  1.00 12.54 ? 250  MET A CA    1 
ATOM   1948 C  C     . MET A 1 253 ? 55.498 -16.577 12.740  1.00 8.85  ? 250  MET A C     1 
ATOM   1949 O  O     . MET A 1 253 ? 55.042 -17.539 12.150  1.00 9.53  ? 250  MET A O     1 
ATOM   1950 C  CB    . MET A 1 253 ? 57.454 -16.235 11.227  1.00 10.49 ? 250  MET A CB    1 
ATOM   1951 C  CG    . MET A 1 253 ? 56.783 -15.131 10.393  1.00 16.06 ? 250  MET A CG    1 
ATOM   1952 S  SD    . MET A 1 253 ? 57.129 -13.440 10.929  1.00 15.89 ? 250  MET A SD    1 
ATOM   1953 C  CE    . MET A 1 253 ? 58.914 -13.291 10.708  1.00 12.90 ? 250  MET A CE    1 
ATOM   1954 N  N     . PRO A 1 254 ? 54.726 -15.732 13.439  1.00 9.11  ? 251  PRO A N     1 
ATOM   1955 C  CA    . PRO A 1 254 ? 53.278 -15.961 13.444  1.00 11.47 ? 251  PRO A CA    1 
ATOM   1956 C  C     . PRO A 1 254 ? 52.715 -15.994 12.025  1.00 9.19  ? 251  PRO A C     1 
ATOM   1957 O  O     . PRO A 1 254 ? 53.087 -15.180 11.175  1.00 8.79  ? 251  PRO A O     1 
ATOM   1958 C  CB    . PRO A 1 254 ? 52.729 -14.753 14.219  1.00 11.37 ? 251  PRO A CB    1 
ATOM   1959 C  CG    . PRO A 1 254 ? 53.889 -14.271 15.025  1.00 14.04 ? 251  PRO A CG    1 
ATOM   1960 C  CD    . PRO A 1 254 ? 55.088 -14.493 14.138  1.00 11.70 ? 251  PRO A CD    1 
ATOM   1961 N  N     . ILE A 1 255 ? 51.825 -16.948 11.785  1.00 7.82  ? 252  ILE A N     1 
ATOM   1962 C  CA    . ILE A 1 255 ? 51.208 -17.133 10.483  1.00 9.28  ? 252  ILE A CA    1 
ATOM   1963 C  C     . ILE A 1 255 ? 50.621 -15.831 9.906   1.00 10.19 ? 252  ILE A C     1 
ATOM   1964 O  O     . ILE A 1 255 ? 50.775 -15.568 8.713   1.00 9.44  ? 252  ILE A O     1 
ATOM   1965 C  CB    . ILE A 1 255 ? 50.184 -18.296 10.521  1.00 11.23 ? 252  ILE A CB    1 
ATOM   1966 C  CG1   . ILE A 1 255 ? 50.934 -19.639 10.573  1.00 11.41 ? 252  ILE A CG1   1 
ATOM   1967 C  CG2   . ILE A 1 255 ? 49.268 -18.253 9.300   1.00 12.90 ? 252  ILE A CG2   1 
ATOM   1968 C  CD1   . ILE A 1 255 ? 50.128 -20.782 11.173  1.00 17.29 ? 252  ILE A CD1   1 
ATOM   1969 N  N     . ARG A 1 256 ? 50.004 -15.006 10.759  1.00 8.15  ? 253  ARG A N     1 
ATOM   1970 C  CA    . ARG A 1 256 ? 49.309 -13.799 10.306  1.00 8.07  ? 253  ARG A CA    1 
ATOM   1971 C  C     . ARG A 1 256 ? 50.242 -12.749 9.704   1.00 11.46 ? 253  ARG A C     1 
ATOM   1972 O  O     . ARG A 1 256 ? 49.785 -11.781 9.076   1.00 12.26 ? 253  ARG A O     1 
ATOM   1973 C  CB    . ARG A 1 256 ? 48.530 -13.158 11.452  1.00 11.10 ? 253  ARG A CB    1 
ATOM   1974 C  CG    . ARG A 1 256 ? 49.414 -12.633 12.543  1.00 12.09 ? 253  ARG A CG    1 
ATOM   1975 C  CD    . ARG A 1 256 ? 48.596 -11.962 13.656  1.00 14.45 ? 253  ARG A CD    1 
ATOM   1976 N  NE    . ARG A 1 256 ? 49.474 -11.471 14.719  1.00 15.18 ? 253  ARG A NE    1 
ATOM   1977 C  CZ    . ARG A 1 256 ? 49.865 -12.200 15.758  1.00 21.21 ? 253  ARG A CZ    1 
ATOM   1978 N  NH1   . ARG A 1 256 ? 49.449 -13.457 15.886  1.00 14.14 ? 253  ARG A NH1   1 
ATOM   1979 N  NH2   . ARG A 1 256 ? 50.669 -11.669 16.670  1.00 16.27 ? 253  ARG A NH2   1 
ATOM   1980 N  N     . LYS A 1 257 ? 51.545 -12.902 9.911   1.00 9.28  ? 254  LYS A N     1 
ATOM   1981 C  CA    . LYS A 1 257 ? 52.485 -11.909 9.387   1.00 9.34  ? 254  LYS A CA    1 
ATOM   1982 C  C     . LYS A 1 257 ? 52.741 -12.037 7.896   1.00 11.69 ? 254  LYS A C     1 
ATOM   1983 O  O     . LYS A 1 257 ? 53.302 -11.126 7.278   1.00 13.17 ? 254  LYS A O     1 
ATOM   1984 C  CB    . LYS A 1 257 ? 53.824 -12.001 10.111  1.00 9.15  ? 254  LYS A CB    1 
ATOM   1985 C  CG    . LYS A 1 257 ? 53.736 -11.735 11.605  1.00 13.00 ? 254  LYS A CG    1 
ATOM   1986 C  CD    . LYS A 1 257 ? 53.029 -10.446 11.957  1.00 16.57 ? 254  LYS A CD    1 
ATOM   1987 C  CE    . LYS A 1 257 ? 53.161 -10.178 13.464  1.00 24.45 ? 254  LYS A CE    1 
ATOM   1988 N  NZ    . LYS A 1 257 ? 52.631 -8.833  13.860  1.00 25.62 ? 254  LYS A NZ    1 
ATOM   1989 N  N     . ILE A 1 258 ? 52.379 -13.181 7.322   1.00 8.64  ? 255  ILE A N     1 
ATOM   1990 C  CA    . ILE A 1 258 ? 52.679 -13.435 5.912   1.00 8.52  ? 255  ILE A CA    1 
ATOM   1991 C  C     . ILE A 1 258 ? 51.555 -12.855 5.074   1.00 11.44 ? 255  ILE A C     1 
ATOM   1992 O  O     . ILE A 1 258 ? 50.385 -13.042 5.394   1.00 12.31 ? 255  ILE A O     1 
ATOM   1993 C  CB    . ILE A 1 258 ? 52.826 -14.947 5.643   1.00 13.57 ? 255  ILE A CB    1 
ATOM   1994 C  CG1   . ILE A 1 258 ? 54.190 -15.440 6.136   1.00 18.09 ? 255  ILE A CG1   1 
ATOM   1995 C  CG2   . ILE A 1 258 ? 52.691 -15.276 4.152   1.00 12.38 ? 255  ILE A CG2   1 
ATOM   1996 C  CD1   . ILE A 1 258 ? 54.401 -15.284 7.617   1.00 20.73 ? 255  ILE A CD1   1 
ATOM   1997 N  N     . ARG A 1 259 ? 51.899 -12.145 4.006   1.00 10.89 ? 256  ARG A N     1 
ATOM   1998 C  CA    . ARG A 1 259 ? 50.875 -11.479 3.205   1.00 12.72 ? 256  ARG A CA    1 
ATOM   1999 C  C     . ARG A 1 259 ? 49.853 -12.479 2.652   1.00 14.76 ? 256  ARG A C     1 
ATOM   2000 O  O     . ARG A 1 259 ? 50.226 -13.492 2.035   1.00 14.04 ? 256  ARG A O     1 
ATOM   2001 C  CB    . ARG A 1 259 ? 51.505 -10.669 2.064   1.00 13.70 ? 256  ARG A CB    1 
ATOM   2002 C  CG    . ARG A 1 259 ? 50.518 -9.781  1.322   1.00 18.93 ? 256  ARG A CG    1 
ATOM   2003 C  CD    . ARG A 1 259 ? 51.163 -9.111  0.108   1.00 24.88 ? 256  ARG A CD    1 
ATOM   2004 N  NE    . ARG A 1 259 ? 50.255 -8.139  -0.505  1.00 25.11 ? 256  ARG A NE    1 
ATOM   2005 C  CZ    . ARG A 1 259 ? 49.283 -8.464  -1.355  1.00 35.42 ? 256  ARG A CZ    1 
ATOM   2006 N  NH1   . ARG A 1 259 ? 49.095 -9.735  -1.693  1.00 33.53 ? 256  ARG A NH1   1 
ATOM   2007 N  NH2   . ARG A 1 259 ? 48.499 -7.521  -1.862  1.00 31.90 ? 256  ARG A NH2   1 
ATOM   2008 N  N     . SER A 1 260 ? 48.576 -12.173 2.899   1.00 12.97 ? 257  SER A N     1 
ATOM   2009 C  CA    . SER A 1 260 ? 47.395 -12.971 2.504   1.00 13.20 ? 257  SER A CA    1 
ATOM   2010 C  C     . SER A 1 260 ? 46.881 -13.883 3.624   1.00 11.93 ? 257  SER A C     1 
ATOM   2011 O  O     . SER A 1 260 ? 45.787 -14.445 3.526   1.00 11.41 ? 257  SER A O     1 
ATOM   2012 C  CB    . SER A 1 260 ? 47.616 -13.771 1.209   1.00 16.27 ? 257  SER A CB    1 
ATOM   2013 O  OG    . SER A 1 260 ? 48.202 -15.038 1.458   1.00 13.92 ? 257  SER A OG    1 
ATOM   2014 N  N     . LEU A 1 261 ? 47.669 -14.015 4.690   1.00 8.54  ? 258  LEU A N     1 
ATOM   2015 C  CA    . LEU A 1 261 ? 47.268 -14.836 5.833   1.00 7.85  ? 258  LEU A CA    1 
ATOM   2016 C  C     . LEU A 1 261 ? 46.868 -14.014 7.059   1.00 10.21 ? 258  LEU A C     1 
ATOM   2017 O  O     . LEU A 1 261 ? 46.753 -14.543 8.159   1.00 11.14 ? 258  LEU A O     1 
ATOM   2018 C  CB    . LEU A 1 261 ? 48.393 -15.814 6.200   1.00 12.26 ? 258  LEU A CB    1 
ATOM   2019 C  CG    . LEU A 1 261 ? 48.779 -16.786 5.078   1.00 9.46  ? 258  LEU A CG    1 
ATOM   2020 C  CD1   . LEU A 1 261 ? 49.916 -17.714 5.523   1.00 7.81  ? 258  LEU A CD1   1 
ATOM   2021 C  CD2   . LEU A 1 261 ? 47.555 -17.596 4.618   1.00 9.99  ? 258  LEU A CD2   1 
ATOM   2022 N  N     . GLY A 1 262 ? 46.658 -12.715 6.875   1.00 11.02 ? 259  GLY A N     1 
ATOM   2023 C  CA    . GLY A 1 262 ? 46.348 -11.852 8.002   1.00 11.89 ? 259  GLY A CA    1 
ATOM   2024 C  C     . GLY A 1 262 ? 44.883 -11.821 8.404   1.00 15.45 ? 259  GLY A C     1 
ATOM   2025 O  O     . GLY A 1 262 ? 44.523 -11.140 9.366   1.00 14.96 ? 259  GLY A O     1 
ATOM   2026 N  N     . GLY A 1 263 ? 44.045 -12.546 7.666   1.00 11.08 ? 260  GLY A N     1 
ATOM   2027 C  CA    . GLY A 1 263 ? 42.609 -12.537 7.897   1.00 11.56 ? 260  GLY A CA    1 
ATOM   2028 C  C     . GLY A 1 263 ? 42.026 -13.894 8.238   1.00 16.10 ? 260  GLY A C     1 
ATOM   2029 O  O     . GLY A 1 263 ? 42.611 -14.663 9.010   1.00 12.88 ? 260  GLY A O     1 
ATOM   2030 N  N     . LYS A 1 264 ? 40.871 -14.203 7.650   1.00 15.08 ? 261  LYS A N     1 
ATOM   2031 C  CA    . LYS A 1 264 ? 40.157 -15.431 7.985   1.00 14.53 ? 261  LYS A CA    1 
ATOM   2032 C  C     . LYS A 1 264 ? 40.891 -16.716 7.596   1.00 13.53 ? 261  LYS A C     1 
ATOM   2033 O  O     . LYS A 1 264 ? 40.877 -17.679 8.364   1.00 17.64 ? 261  LYS A O     1 
ATOM   2034 C  CB    . LYS A 1 264 ? 38.734 -15.411 7.402   1.00 16.71 ? 261  LYS A CB    1 
ATOM   2035 C  CG    . LYS A 1 264 ? 37.830 -14.381 8.067   1.00 22.59 ? 261  LYS A CG    1 
ATOM   2036 C  CD    . LYS A 1 264 ? 36.486 -14.252 7.354   1.00 29.33 ? 261  LYS A CD    1 
ATOM   2037 C  CE    . LYS A 1 264 ? 35.580 -13.260 8.077   1.00 40.30 ? 261  LYS A CE    1 
ATOM   2038 N  NZ    . LYS A 1 264 ? 34.274 -13.073 7.376   1.00 41.59 ? 261  LYS A NZ    1 
ATOM   2039 N  N     . LEU A 1 265 ? 41.527 -16.747 6.426   1.00 11.20 ? 262  LEU A N     1 
ATOM   2040 C  CA    . LEU A 1 265 ? 42.264 -17.944 6.033   1.00 10.61 ? 262  LEU A CA    1 
ATOM   2041 C  C     . LEU A 1 265 ? 43.353 -18.243 7.065   1.00 11.20 ? 262  LEU A C     1 
ATOM   2042 O  O     . LEU A 1 265 ? 43.459 -19.374 7.558   1.00 12.89 ? 262  LEU A O     1 
ATOM   2043 C  CB    . LEU A 1 265 ? 42.891 -17.795 4.650   1.00 12.18 ? 262  LEU A CB    1 
ATOM   2044 C  CG    . LEU A 1 265 ? 43.792 -18.939 4.168   1.00 12.04 ? 262  LEU A CG    1 
ATOM   2045 C  CD1   . LEU A 1 265 ? 43.022 -20.250 4.147   1.00 17.44 ? 262  LEU A CD1   1 
ATOM   2046 C  CD2   . LEU A 1 265 ? 44.352 -18.632 2.778   1.00 10.28 ? 262  LEU A CD2   1 
ATOM   2047 N  N     . GLY A 1 266 ? 44.149 -17.228 7.403   1.00 10.07 ? 263  GLY A N     1 
ATOM   2048 C  CA    . GLY A 1 266 ? 45.206 -17.407 8.387   1.00 10.39 ? 263  GLY A CA    1 
ATOM   2049 C  C     . GLY A 1 266 ? 44.688 -17.907 9.725   1.00 13.24 ? 263  GLY A C     1 
ATOM   2050 O  O     . GLY A 1 266 ? 45.285 -18.785 10.350  1.00 12.72 ? 263  GLY A O     1 
ATOM   2051 N  N     . ALA A 1 267 ? 43.555 -17.360 10.161  1.00 12.78 ? 264  ALA A N     1 
ATOM   2052 C  CA    . ALA A 1 267 ? 42.951 -17.791 11.411  1.00 13.78 ? 264  ALA A CA    1 
ATOM   2053 C  C     . ALA A 1 267 ? 42.518 -19.255 11.320  1.00 12.93 ? 264  ALA A C     1 
ATOM   2054 O  O     . ALA A 1 267 ? 42.636 -20.010 12.283  1.00 14.51 ? 264  ALA A O     1 
ATOM   2055 C  CB    . ALA A 1 267 ? 41.767 -16.890 11.778  1.00 17.82 ? 264  ALA A CB    1 
ATOM   2056 N  N     . SER A 1 268 ? 42.019 -19.662 10.158  1.00 13.13 ? 265  SER A N     1 
ATOM   2057 C  CA    . SER A 1 268 ? 41.603 -21.045 9.989   1.00 13.38 ? 265  SER A CA    1 
ATOM   2058 C  C     . SER A 1 268 ? 42.791 -22.011 9.960   1.00 12.88 ? 265  SER A C     1 
ATOM   2059 O  O     . SER A 1 268 ? 42.682 -23.137 10.449  1.00 11.01 ? 265  SER A O     1 
ATOM   2060 C  CB    . SER A 1 268 ? 40.705 -21.223 8.763   1.00 16.03 ? 265  SER A CB    1 
ATOM   2061 O  OG    . SER A 1 268 ? 41.431 -21.073 7.563   1.00 25.74 ? 265  SER A OG    1 
ATOM   2062 N  N     . VAL A 1 269 ? 43.916 -21.577 9.393   1.00 10.68 ? 266  VAL A N     1 
ATOM   2063 C  CA    . VAL A 1 269 ? 45.128 -22.403 9.399   1.00 10.09 ? 266  VAL A CA    1 
ATOM   2064 C  C     . VAL A 1 269 ? 45.524 -22.693 10.846  1.00 13.76 ? 266  VAL A C     1 
ATOM   2065 O  O     . VAL A 1 269 ? 45.806 -23.833 11.221  1.00 13.82 ? 266  VAL A O     1 
ATOM   2066 C  CB    . VAL A 1 269 ? 46.308 -21.729 8.653   1.00 9.96  ? 266  VAL A CB    1 
ATOM   2067 C  CG1   . VAL A 1 269 ? 47.593 -22.537 8.861   1.00 13.07 ? 266  VAL A CG1   1 
ATOM   2068 C  CG2   . VAL A 1 269 ? 46.003 -21.626 7.163   1.00 11.15 ? 266  VAL A CG2   1 
ATOM   2069 N  N     . ILE A 1 270 ? 45.506 -21.649 11.664  1.00 9.76  ? 267  ILE A N     1 
ATOM   2070 C  CA    . ILE A 1 270 ? 45.854 -21.769 13.068  1.00 12.91 ? 267  ILE A CA    1 
ATOM   2071 C  C     . ILE A 1 270 ? 44.879 -22.679 13.799  1.00 12.19 ? 267  ILE A C     1 
ATOM   2072 O  O     . ILE A 1 270 ? 45.289 -23.568 14.558  1.00 14.64 ? 267  ILE A O     1 
ATOM   2073 C  CB    . ILE A 1 270 ? 45.859 -20.390 13.726  1.00 11.93 ? 267  ILE A CB    1 
ATOM   2074 C  CG1   . ILE A 1 270 ? 47.051 -19.576 13.218  1.00 12.57 ? 267  ILE A CG1   1 
ATOM   2075 C  CG2   . ILE A 1 270 ? 45.912 -20.517 15.240  1.00 18.65 ? 267  ILE A CG2   1 
ATOM   2076 C  CD1   . ILE A 1 270 ? 46.964 -18.105 13.557  1.00 16.30 ? 267  ILE A CD1   1 
ATOM   2077 N  N     . GLU A 1 271 ? 43.586 -22.455 13.571  1.00 11.90 ? 268  GLU A N     1 
ATOM   2078 C  CA    . GLU A 1 271 ? 42.551 -23.180 14.294  1.00 15.33 ? 268  GLU A CA    1 
ATOM   2079 C  C     . GLU A 1 271 ? 42.509 -24.652 13.908  1.00 15.08 ? 268  GLU A C     1 
ATOM   2080 O  O     . GLU A 1 271 ? 42.521 -25.543 14.768  1.00 17.49 ? 268  GLU A O     1 
ATOM   2081 C  CB    . GLU A 1 271 ? 41.182 -22.535 14.060  1.00 22.68 ? 268  GLU A CB    1 
ATOM   2082 C  CG    . GLU A 1 271 ? 40.002 -23.379 14.532  1.00 32.29 ? 268  GLU A CG    1 
ATOM   2083 C  CD    . GLU A 1 271 ? 38.945 -22.564 15.264  1.00 41.30 ? 268  GLU A CD    1 
ATOM   2084 O  OE1   . GLU A 1 271 ? 37.759 -22.957 15.232  1.00 47.87 ? 268  GLU A OE1   1 
ATOM   2085 O  OE2   . GLU A 1 271 ? 39.300 -21.536 15.883  1.00 52.55 ? 268  GLU A OE2   1 
ATOM   2086 N  N     . ILE A 1 272 ? 42.467 -24.908 12.609  1.00 13.60 ? 269  ILE A N     1 
ATOM   2087 C  CA    . ILE A 1 272 ? 42.263 -26.264 12.126  1.00 12.20 ? 269  ILE A CA    1 
ATOM   2088 C  C     . ILE A 1 272 ? 43.477 -27.131 12.398  1.00 14.08 ? 269  ILE A C     1 
ATOM   2089 O  O     . ILE A 1 272 ? 43.352 -28.302 12.768  1.00 16.84 ? 269  ILE A O     1 
ATOM   2090 C  CB    . ILE A 1 272 ? 41.937 -26.290 10.625  1.00 12.02 ? 269  ILE A CB    1 
ATOM   2091 C  CG1   . ILE A 1 272 ? 40.503 -25.804 10.387  1.00 19.79 ? 269  ILE A CG1   1 
ATOM   2092 C  CG2   . ILE A 1 272 ? 42.098 -27.708 10.074  1.00 13.53 ? 269  ILE A CG2   1 
ATOM   2093 C  CD1   . ILE A 1 272 ? 40.195 -25.475 8.947   1.00 23.93 ? 269  ILE A CD1   1 
ATOM   2094 N  N     . LEU A 1 273 ? 44.665 -26.563 12.211  1.00 13.21 ? 270  LEU A N     1 
ATOM   2095 C  CA    . LEU A 1 273 ? 45.885 -27.349 12.335  1.00 12.12 ? 270  LEU A CA    1 
ATOM   2096 C  C     . LEU A 1 273 ? 46.468 -27.347 13.743  1.00 13.88 ? 270  LEU A C     1 
ATOM   2097 O  O     . LEU A 1 273 ? 47.286 -28.203 14.079  1.00 16.54 ? 270  LEU A O     1 
ATOM   2098 C  CB    . LEU A 1 273 ? 46.941 -26.875 11.339  1.00 12.47 ? 270  LEU A CB    1 
ATOM   2099 C  CG    . LEU A 1 273 ? 46.562 -27.054 9.877   1.00 13.98 ? 270  LEU A CG    1 
ATOM   2100 C  CD1   . LEU A 1 273 ? 47.690 -26.547 9.020   1.00 13.45 ? 270  LEU A CD1   1 
ATOM   2101 C  CD2   . LEU A 1 273 ? 46.311 -28.525 9.591   1.00 17.68 ? 270  LEU A CD2   1 
ATOM   2102 N  N     . GLY A 1 274 ? 46.053 -26.381 14.556  1.00 13.85 ? 271  GLY A N     1 
ATOM   2103 C  CA    . GLY A 1 274 ? 46.543 -26.264 15.917  1.00 15.17 ? 271  GLY A CA    1 
ATOM   2104 C  C     . GLY A 1 274 ? 47.997 -25.840 15.970  1.00 16.66 ? 271  GLY A C     1 
ATOM   2105 O  O     . GLY A 1 274 ? 48.770 -26.364 16.771  1.00 19.17 ? 271  GLY A O     1 
ATOM   2106 N  N     . ILE A 1 275 ? 48.375 -24.896 15.109  1.00 11.73 ? 272  ILE A N     1 
ATOM   2107 C  CA    . ILE A 1 275 ? 49.750 -24.410 15.054  1.00 11.91 ? 272  ILE A CA    1 
ATOM   2108 C  C     . ILE A 1 275 ? 49.752 -22.890 15.205  1.00 9.47  ? 272  ILE A C     1 
ATOM   2109 O  O     . ILE A 1 275 ? 48.692 -22.263 15.158  1.00 12.62 ? 272  ILE A O     1 
ATOM   2110 C  CB    . ILE A 1 275 ? 50.452 -24.820 13.732  1.00 11.19 ? 272  ILE A CB    1 
ATOM   2111 C  CG1   . ILE A 1 275 ? 49.732 -24.222 12.520  1.00 11.14 ? 272  ILE A CG1   1 
ATOM   2112 C  CG2   . ILE A 1 275 ? 50.537 -26.351 13.625  1.00 10.48 ? 272  ILE A CG2   1 
ATOM   2113 C  CD1   . ILE A 1 275 ? 50.463 -24.506 11.179  1.00 8.74  ? 272  ILE A CD1   1 
ATOM   2114 N  N     . GLU A 1 276 ? 50.939 -22.306 15.381  1.00 9.68  ? 273  GLU A N     1 
ATOM   2115 C  CA    . GLU A 1 276 ? 51.074 -20.858 15.571  1.00 11.09 ? 273  GLU A CA    1 
ATOM   2116 C  C     . GLU A 1 276 ? 52.016 -20.209 14.552  1.00 12.91 ? 273  GLU A C     1 
ATOM   2117 O  O     . GLU A 1 276 ? 51.834 -19.047 14.184  1.00 11.99 ? 273  GLU A O     1 
ATOM   2118 C  CB    . GLU A 1 276 ? 51.576 -20.542 16.985  1.00 11.92 ? 273  GLU A CB    1 
ATOM   2119 C  CG    . GLU A 1 276 ? 50.616 -20.992 18.090  1.00 16.79 ? 273  GLU A CG    1 
ATOM   2120 C  CD    . GLU A 1 276 ? 51.174 -20.799 19.500  1.00 30.55 ? 273  GLU A CD    1 
ATOM   2121 O  OE1   . GLU A 1 276 ? 50.804 -21.588 20.398  1.00 34.70 ? 273  GLU A OE1   1 
ATOM   2122 O  OE2   . GLU A 1 276 ? 51.962 -19.854 19.717  1.00 29.64 ? 273  GLU A OE2   1 
ATOM   2123 N  N     . TYR A 1 277 ? 53.022 -20.949 14.104  1.00 10.01 ? 274  TYR A N     1 
ATOM   2124 C  CA    . TYR A 1 277 ? 54.108 -20.347 13.315  1.00 9.39  ? 274  TYR A CA    1 
ATOM   2125 C  C     . TYR A 1 277 ? 54.195 -20.916 11.905  1.00 7.90  ? 274  TYR A C     1 
ATOM   2126 O  O     . TYR A 1 277 ? 53.872 -22.087 11.661  1.00 9.41  ? 274  TYR A O     1 
ATOM   2127 C  CB    . TYR A 1 277 ? 55.456 -20.552 14.010  1.00 10.10 ? 274  TYR A CB    1 
ATOM   2128 C  CG    . TYR A 1 277 ? 55.476 -20.054 15.439  1.00 8.13  ? 274  TYR A CG    1 
ATOM   2129 C  CD1   . TYR A 1 277 ? 55.720 -20.922 16.499  1.00 11.02 ? 274  TYR A CD1   1 
ATOM   2130 C  CD2   . TYR A 1 277 ? 55.223 -18.724 15.718  1.00 8.21  ? 274  TYR A CD2   1 
ATOM   2131 C  CE1   . TYR A 1 277 ? 55.730 -20.468 17.813  1.00 13.15 ? 274  TYR A CE1   1 
ATOM   2132 C  CE2   . TYR A 1 277 ? 55.219 -18.255 17.025  1.00 11.17 ? 274  TYR A CE2   1 
ATOM   2133 C  CZ    . TYR A 1 277 ? 55.475 -19.133 18.069  1.00 12.18 ? 274  TYR A CZ    1 
ATOM   2134 O  OH    . TYR A 1 277 ? 55.477 -18.667 19.371  1.00 14.35 ? 274  TYR A OH    1 
ATOM   2135 N  N     . MET A 1 278 ? 54.676 -20.092 10.981  1.00 6.83  ? 275  MET A N     1 
ATOM   2136 C  CA    . MET A 1 278 ? 54.771 -20.505 9.583   1.00 8.52  ? 275  MET A CA    1 
ATOM   2137 C  C     . MET A 1 278 ? 55.543 -21.808 9.403   1.00 8.83  ? 275  MET A C     1 
ATOM   2138 O  O     . MET A 1 278 ? 55.148 -22.664 8.618   1.00 10.37 ? 275  MET A O     1 
ATOM   2139 C  CB    . MET A 1 278 ? 55.433 -19.412 8.744   1.00 12.60 ? 275  MET A CB    1 
ATOM   2140 C  CG    . MET A 1 278 ? 54.469 -18.383 8.220   1.00 24.53 ? 275  MET A CG    1 
ATOM   2141 S  SD    . MET A 1 278 ? 53.297 -19.060 7.025   1.00 16.59 ? 275  MET A SD    1 
ATOM   2142 C  CE    . MET A 1 278 ? 54.366 -19.694 5.749   1.00 25.73 ? 275  MET A CE    1 
ATOM   2143 N  N     . GLY A 1 279 ? 56.659 -21.947 10.115  1.00 7.57  ? 276  GLY A N     1 
ATOM   2144 C  CA    . GLY A 1 279 ? 57.509 -23.110 9.956   1.00 7.66  ? 276  GLY A CA    1 
ATOM   2145 C  C     . GLY A 1 279 ? 56.802 -24.417 10.284  1.00 12.56 ? 276  GLY A C     1 
ATOM   2146 O  O     . GLY A 1 279 ? 57.149 -25.458 9.729   1.00 9.40  ? 276  GLY A O     1 
ATOM   2147 N  N     . GLU A 1 280 ? 55.826 -24.375 11.193  1.00 7.93  ? 277  GLU A N     1 
ATOM   2148 C  CA    . GLU A 1 280 ? 55.083 -25.573 11.566  1.00 6.75  ? 277  GLU A CA    1 
ATOM   2149 C  C     . GLU A 1 280 ? 54.299 -26.169 10.393  1.00 9.07  ? 277  GLU A C     1 
ATOM   2150 O  O     . GLU A 1 280 ? 53.919 -27.343 10.427  1.00 8.75  ? 277  GLU A O     1 
ATOM   2151 C  CB    . GLU A 1 280 ? 54.138 -25.283 12.742  1.00 8.03  ? 277  GLU A CB    1 
ATOM   2152 C  CG    . GLU A 1 280 ? 54.844 -25.030 14.053  1.00 9.08  ? 277  GLU A CG    1 
ATOM   2153 C  CD    . GLU A 1 280 ? 53.857 -24.728 15.174  1.00 15.36 ? 277  GLU A CD    1 
ATOM   2154 O  OE1   . GLU A 1 280 ? 53.522 -23.547 15.347  1.00 13.28 ? 277  GLU A OE1   1 
ATOM   2155 O  OE2   . GLU A 1 280 ? 53.417 -25.666 15.881  1.00 14.60 ? 277  GLU A OE2   1 
ATOM   2156 N  N     . LEU A 1 281 ? 54.052 -25.376 9.357   1.00 9.40  ? 278  LEU A N     1 
ATOM   2157 C  CA    . LEU A 1 281 ? 53.347 -25.886 8.186   1.00 7.50  ? 278  LEU A CA    1 
ATOM   2158 C  C     . LEU A 1 281 ? 54.111 -26.989 7.457   1.00 7.98  ? 278  LEU A C     1 
ATOM   2159 O  O     . LEU A 1 281 ? 53.508 -27.762 6.709   1.00 8.88  ? 278  LEU A O     1 
ATOM   2160 C  CB    . LEU A 1 281 ? 53.003 -24.740 7.211   1.00 6.68  ? 278  LEU A CB    1 
ATOM   2161 C  CG    . LEU A 1 281 ? 51.810 -23.892 7.647   1.00 11.89 ? 278  LEU A CG    1 
ATOM   2162 C  CD1   . LEU A 1 281 ? 51.773 -22.569 6.878   1.00 14.35 ? 278  LEU A CD1   1 
ATOM   2163 C  CD2   . LEU A 1 281 ? 50.495 -24.672 7.470   1.00 13.98 ? 278  LEU A CD2   1 
ATOM   2164 N  N     . THR A 1 282 ? 55.426 -27.059 7.632   1.00 10.19 ? 279  THR A N     1 
ATOM   2165 C  CA    . THR A 1 282 ? 56.204 -28.007 6.824   1.00 10.18 ? 279  THR A CA    1 
ATOM   2166 C  C     . THR A 1 282 ? 55.837 -29.458 7.120   1.00 11.52 ? 279  THR A C     1 
ATOM   2167 O  O     . THR A 1 282 ? 56.128 -30.336 6.325   1.00 11.85 ? 279  THR A O     1 
ATOM   2168 C  CB    . THR A 1 282 ? 57.720 -27.847 7.007   1.00 9.31  ? 279  THR A CB    1 
ATOM   2169 O  OG1   . THR A 1 282 ? 58.079 -28.161 8.365   1.00 10.98 ? 279  THR A OG1   1 
ATOM   2170 C  CG2   . THR A 1 282 ? 58.162 -26.415 6.668   1.00 9.98  ? 279  THR A CG2   1 
ATOM   2171 N  N     . GLN A 1 283 ? 55.214 -29.711 8.269   1.00 10.73 ? 280  GLN A N     1 
ATOM   2172 C  CA    . GLN A 1 283 ? 54.942 -31.091 8.661   1.00 13.19 ? 280  GLN A CA    1 
ATOM   2173 C  C     . GLN A 1 283 ? 53.677 -31.693 8.056   1.00 15.85 ? 280  GLN A C     1 
ATOM   2174 O  O     . GLN A 1 283 ? 53.309 -32.821 8.372   1.00 19.83 ? 280  GLN A O     1 
ATOM   2175 C  CB    . GLN A 1 283 ? 54.898 -31.196 10.179  1.00 14.42 ? 280  GLN A CB    1 
ATOM   2176 C  CG    A GLN A 1 283 ? 56.241 -30.893 10.758  0.50 7.99  ? 280  GLN A CG    1 
ATOM   2177 C  CG    B GLN A 1 283 ? 53.706 -30.535 10.778  0.50 11.93 ? 280  GLN A CG    1 
ATOM   2178 C  CD    A GLN A 1 283 ? 57.304 -31.680 10.025  0.50 12.46 ? 280  GLN A CD    1 
ATOM   2179 C  CD    B GLN A 1 283 ? 53.882 -30.266 12.247  0.50 21.83 ? 280  GLN A CD    1 
ATOM   2180 O  OE1   A GLN A 1 283 ? 57.320 -32.908 10.091  0.50 12.84 ? 280  GLN A OE1   1 
ATOM   2181 O  OE1   B GLN A 1 283 ? 54.432 -31.092 12.986  0.50 22.73 ? 280  GLN A OE1   1 
ATOM   2182 N  NE2   A GLN A 1 283 ? 58.170 -30.984 9.286   0.50 11.09 ? 280  GLN A NE2   1 
ATOM   2183 N  NE2   B GLN A 1 283 ? 53.415 -29.105 12.687  0.50 11.54 ? 280  GLN A NE2   1 
ATOM   2184 N  N     . PHE A 1 284 ? 53.022 -30.954 7.177   1.00 13.28 ? 281  PHE A N     1 
ATOM   2185 C  CA    . PHE A 1 284 ? 51.818 -31.447 6.529   1.00 12.03 ? 281  PHE A CA    1 
ATOM   2186 C  C     . PHE A 1 284 ? 52.089 -31.736 5.058   1.00 12.40 ? 281  PHE A C     1 
ATOM   2187 O  O     . PHE A 1 284 ? 52.899 -31.062 4.431   1.00 15.92 ? 281  PHE A O     1 
ATOM   2188 C  CB    . PHE A 1 284 ? 50.697 -30.427 6.689   1.00 11.20 ? 281  PHE A CB    1 
ATOM   2189 C  CG    . PHE A 1 284 ? 50.366 -30.149 8.127   1.00 12.16 ? 281  PHE A CG    1 
ATOM   2190 C  CD1   . PHE A 1 284 ? 49.500 -30.975 8.820   1.00 18.77 ? 281  PHE A CD1   1 
ATOM   2191 C  CD2   . PHE A 1 284 ? 50.964 -29.099 8.802   1.00 9.90  ? 281  PHE A CD2   1 
ATOM   2192 C  CE1   . PHE A 1 284 ? 49.208 -30.736 10.157  1.00 19.58 ? 281  PHE A CE1   1 
ATOM   2193 C  CE2   . PHE A 1 284 ? 50.686 -28.868 10.131  1.00 12.59 ? 281  PHE A CE2   1 
ATOM   2194 C  CZ    . PHE A 1 284 ? 49.808 -29.690 10.811  1.00 18.29 ? 281  PHE A CZ    1 
ATOM   2195 N  N     . THR A 1 285 ? 51.427 -32.742 4.506   1.00 11.45 ? 282  THR A N     1 
ATOM   2196 C  CA    . THR A 1 285 ? 51.615 -33.018 3.086   1.00 12.99 ? 282  THR A CA    1 
ATOM   2197 C  C     . THR A 1 285 ? 50.868 -31.983 2.264   1.00 9.95  ? 282  THR A C     1 
ATOM   2198 O  O     . THR A 1 285 ? 49.988 -31.307 2.766   1.00 10.84 ? 282  THR A O     1 
ATOM   2199 C  CB    . THR A 1 285 ? 51.097 -34.404 2.688   1.00 13.26 ? 282  THR A CB    1 
ATOM   2200 O  OG1   . THR A 1 285 ? 49.677 -34.412 2.797   1.00 13.82 ? 282  THR A OG1   1 
ATOM   2201 C  CG2   . THR A 1 285 ? 51.666 -35.460 3.601   1.00 16.83 ? 282  THR A CG2   1 
ATOM   2202 N  N     . GLU A 1 286 ? 51.234 -31.851 0.996   1.00 9.70  ? 283  GLU A N     1 
ATOM   2203 C  CA    . GLU A 1 286 ? 50.512 -30.925 0.128   1.00 11.93 ? 283  GLU A CA    1 
ATOM   2204 C  C     . GLU A 1 286 ? 49.020 -31.295 0.071   1.00 11.47 ? 283  GLU A C     1 
ATOM   2205 O  O     . GLU A 1 286 ? 48.142 -30.412 0.173   1.00 9.40  ? 283  GLU A O     1 
ATOM   2206 C  CB    . GLU A 1 286 ? 51.153 -30.880 -1.262  1.00 11.97 ? 283  GLU A CB    1 
ATOM   2207 C  CG    . GLU A 1 286 ? 50.515 -29.853 -2.169  1.00 12.21 ? 283  GLU A CG    1 
ATOM   2208 C  CD    . GLU A 1 286 ? 51.216 -29.757 -3.507  1.00 28.00 ? 283  GLU A CD    1 
ATOM   2209 O  OE1   . GLU A 1 286 ? 52.151 -30.548 -3.741  1.00 20.97 ? 283  GLU A OE1   1 
ATOM   2210 O  OE2   . GLU A 1 286 ? 50.827 -28.897 -4.325  1.00 21.16 ? 283  GLU A OE2   1 
ATOM   2211 N  N     . SER A 1 287 ? 48.724 -32.597 -0.028  1.00 11.12 ? 284  SER A N     1 
ATOM   2212 C  CA    . SER A 1 287 ? 47.332 -33.052 -0.062  1.00 13.51 ? 284  SER A CA    1 
ATOM   2213 C  C     . SER A 1 287 ? 46.577 -32.743 1.230   1.00 9.37  ? 284  SER A C     1 
ATOM   2214 O  O     . SER A 1 287 ? 45.400 -32.371 1.194   1.00 11.87 ? 284  SER A O     1 
ATOM   2215 C  CB    . SER A 1 287 ? 47.232 -34.548 -0.380  1.00 14.44 ? 284  SER A CB    1 
ATOM   2216 O  OG    A SER A 1 287 ? 47.791 -34.837 -1.647  0.50 13.56 ? 284  SER A OG    1 
ATOM   2217 O  OG    B SER A 1 287 ? 47.961 -35.308 0.563   0.50 18.94 ? 284  SER A OG    1 
ATOM   2218 N  N     . GLN A 1 288 ? 47.248 -32.880 2.375   1.00 10.61 ? 285  GLN A N     1 
ATOM   2219 C  CA    . GLN A 1 288 ? 46.602 -32.517 3.629   1.00 9.45  ? 285  GLN A CA    1 
ATOM   2220 C  C     . GLN A 1 288 ? 46.211 -31.042 3.594   1.00 12.30 ? 285  GLN A C     1 
ATOM   2221 O  O     . GLN A 1 288 ? 45.089 -30.668 3.946   1.00 11.09 ? 285  GLN A O     1 
ATOM   2222 C  CB    . GLN A 1 288 ? 47.512 -32.780 4.836   1.00 11.11 ? 285  GLN A CB    1 
ATOM   2223 C  CG    . GLN A 1 288 ? 47.689 -34.247 5.206   1.00 15.92 ? 285  GLN A CG    1 
ATOM   2224 C  CD    . GLN A 1 288 ? 48.593 -34.423 6.414   1.00 23.30 ? 285  GLN A CD    1 
ATOM   2225 O  OE1   . GLN A 1 288 ? 49.743 -33.990 6.410   1.00 14.68 ? 285  GLN A OE1   1 
ATOM   2226 N  NE2   . GLN A 1 288 ? 48.071 -35.056 7.457   1.00 26.90 ? 285  GLN A NE2   1 
ATOM   2227 N  N     . LEU A 1 289 ? 47.136 -30.190 3.164   1.00 10.31 ? 286  LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 289 ? 46.837 -28.754 3.156   1.00 11.09 ? 286  LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 289 ? 45.726 -28.408 2.166   1.00 12.37 ? 286  LEU A C     1 
ATOM   2230 O  O     . LEU A 1 289 ? 44.850 -27.589 2.455   1.00 12.80 ? 286  LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 289 ? 48.098 -27.931 2.874   1.00 8.25  ? 286  LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 289 ? 49.187 -28.026 3.955   1.00 8.07  ? 286  LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 289 ? 50.465 -27.286 3.544   1.00 9.39  ? 286  LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 289 ? 48.662 -27.543 5.322   1.00 11.14 ? 286  LEU A CD2   1 
ATOM   2235 N  N     . GLN A 1 290 ? 45.764 -29.033 0.996   1.00 12.11 ? 287  GLN A N     1 
ATOM   2236 C  CA    . GLN A 1 290 ? 44.719 -28.818 0.005   1.00 12.41 ? 287  GLN A CA    1 
ATOM   2237 C  C     . GLN A 1 290 ? 43.356 -29.279 0.515   1.00 14.30 ? 287  GLN A C     1 
ATOM   2238 O  O     . GLN A 1 290 ? 42.317 -28.706 0.175   1.00 12.60 ? 287  GLN A O     1 
ATOM   2239 C  CB    . GLN A 1 290 ? 45.060 -29.567 -1.279  1.00 14.88 ? 287  GLN A CB    1 
ATOM   2240 C  CG    . GLN A 1 290 ? 46.190 -28.932 -2.084  1.00 15.58 ? 287  GLN A CG    1 
ATOM   2241 C  CD    . GLN A 1 290 ? 46.598 -29.804 -3.252  1.00 15.47 ? 287  GLN A CD    1 
ATOM   2242 O  OE1   . GLN A 1 290 ? 46.626 -31.036 -3.141  1.00 15.97 ? 287  GLN A OE1   1 
ATOM   2243 N  NE2   . GLN A 1 290 ? 46.931 -29.173 -4.378  1.00 16.01 ? 287  GLN A NE2   1 
ATOM   2244 N  N     . SER A 1 291 ? 43.356 -30.329 1.322   1.00 12.97 ? 288  SER A N     1 
ATOM   2245 C  CA    . SER A 1 291 ? 42.108 -30.837 1.868   1.00 10.71 ? 288  SER A CA    1 
ATOM   2246 C  C     . SER A 1 291 ? 41.415 -29.840 2.792   1.00 15.54 ? 288  SER A C     1 
ATOM   2247 O  O     . SER A 1 291 ? 40.189 -29.739 2.800   1.00 20.96 ? 288  SER A O     1 
ATOM   2248 C  CB    . SER A 1 291 ? 42.313 -32.173 2.580   1.00 10.76 ? 288  SER A CB    1 
ATOM   2249 O  OG    A SER A 1 291 ? 42.862 -32.006 3.889   0.50 11.30 ? 288  SER A OG    1 
ATOM   2250 O  OG    B SER A 1 291 ? 41.051 -32.742 2.880   0.50 15.31 ? 288  SER A OG    1 
ATOM   2251 N  N     . HIS A 1 292 ? 42.199 -29.093 3.563   1.00 15.22 ? 289  HIS A N     1 
ATOM   2252 C  CA    . HIS A 1 292 ? 41.636 -28.112 4.476   1.00 15.19 ? 289  HIS A CA    1 
ATOM   2253 C  C     . HIS A 1 292 ? 41.346 -26.759 3.829   1.00 19.11 ? 289  HIS A C     1 
ATOM   2254 O  O     . HIS A 1 292 ? 40.341 -26.118 4.135   1.00 21.89 ? 289  HIS A O     1 
ATOM   2255 C  CB    . HIS A 1 292 ? 42.582 -27.886 5.651   1.00 15.18 ? 289  HIS A CB    1 
ATOM   2256 C  CG    . HIS A 1 292 ? 42.798 -29.093 6.506   1.00 15.72 ? 289  HIS A CG    1 
ATOM   2257 N  ND1   . HIS A 1 292 ? 41.783 -29.692 7.221   1.00 22.37 ? 289  HIS A ND1   1 
ATOM   2258 C  CD2   . HIS A 1 292 ? 43.921 -29.795 6.786   1.00 19.27 ? 289  HIS A CD2   1 
ATOM   2259 C  CE1   . HIS A 1 292 ? 42.271 -30.716 7.899   1.00 16.51 ? 289  HIS A CE1   1 
ATOM   2260 N  NE2   . HIS A 1 292 ? 43.566 -30.802 7.650   1.00 26.99 ? 289  HIS A NE2   1 
ATOM   2261 N  N     . PHE A 1 293 ? 42.234 -26.319 2.941   1.00 14.24 ? 290  PHE A N     1 
ATOM   2262 C  CA    . PHE A 1 293 ? 42.213 -24.931 2.479   1.00 14.05 ? 290  PHE A CA    1 
ATOM   2263 C  C     . PHE A 1 293 ? 41.963 -24.762 0.980   1.00 15.70 ? 290  PHE A C     1 
ATOM   2264 O  O     . PHE A 1 293 ? 41.997 -23.642 0.461   1.00 19.12 ? 290  PHE A O     1 
ATOM   2265 C  CB    . PHE A 1 293 ? 43.519 -24.248 2.899   1.00 12.37 ? 290  PHE A CB    1 
ATOM   2266 C  CG    . PHE A 1 293 ? 43.864 -24.495 4.339   1.00 13.67 ? 290  PHE A CG    1 
ATOM   2267 C  CD1   . PHE A 1 293 ? 43.059 -23.983 5.351   1.00 14.67 ? 290  PHE A CD1   1 
ATOM   2268 C  CD2   . PHE A 1 293 ? 44.960 -25.271 4.687   1.00 11.14 ? 290  PHE A CD2   1 
ATOM   2269 C  CE1   . PHE A 1 293 ? 43.337 -24.236 6.685   1.00 13.26 ? 290  PHE A CE1   1 
ATOM   2270 C  CE2   . PHE A 1 293 ? 45.258 -25.523 6.019   1.00 12.19 ? 290  PHE A CE2   1 
ATOM   2271 C  CZ    . PHE A 1 293 ? 44.443 -25.005 7.020   1.00 13.00 ? 290  PHE A CZ    1 
ATOM   2272 N  N     . GLY A 1 294 ? 41.712 -25.869 0.287   1.00 16.07 ? 291  GLY A N     1 
ATOM   2273 C  CA    . GLY A 1 294 ? 41.483 -25.819 -1.144  1.00 16.14 ? 291  GLY A CA    1 
ATOM   2274 C  C     . GLY A 1 294 ? 42.730 -26.109 -1.942  1.00 14.49 ? 291  GLY A C     1 
ATOM   2275 O  O     . GLY A 1 294 ? 43.844 -25.959 -1.450  1.00 15.00 ? 291  GLY A O     1 
ATOM   2276 N  N     . GLU A 1 295 ? 42.537 -26.525 -3.190  1.00 12.98 ? 292  GLU A N     1 
ATOM   2277 C  CA    . GLU A 1 295 ? 43.632 -26.883 -4.076  1.00 14.72 ? 292  GLU A CA    1 
ATOM   2278 C  C     . GLU A 1 295 ? 44.672 -25.771 -4.212  1.00 14.89 ? 292  GLU A C     1 
ATOM   2279 O  O     . GLU A 1 295 ? 45.870 -26.004 -4.060  1.00 14.25 ? 292  GLU A O     1 
ATOM   2280 C  CB    . GLU A 1 295 ? 43.058 -27.233 -5.450  1.00 18.59 ? 292  GLU A CB    1 
ATOM   2281 C  CG    . GLU A 1 295 ? 44.073 -27.685 -6.459  1.00 18.69 ? 292  GLU A CG    1 
ATOM   2282 C  CD    . GLU A 1 295 ? 43.443 -27.914 -7.820  1.00 35.31 ? 292  GLU A CD    1 
ATOM   2283 O  OE1   . GLU A 1 295 ? 44.122 -27.665 -8.838  1.00 41.05 ? 292  GLU A OE1   1 
ATOM   2284 O  OE2   . GLU A 1 295 ? 42.264 -28.336 -7.865  1.00 27.19 ? 292  GLU A OE2   1 
ATOM   2285 N  N     . LYS A 1 296 ? 44.208 -24.559 -4.500  1.00 12.47 ? 293  LYS A N     1 
ATOM   2286 C  CA    . LYS A 1 296 ? 45.105 -23.442 -4.758  1.00 12.31 ? 293  LYS A CA    1 
ATOM   2287 C  C     . LYS A 1 296 ? 45.812 -23.014 -3.472  1.00 12.27 ? 293  LYS A C     1 
ATOM   2288 O  O     . LYS A 1 296 ? 47.040 -22.893 -3.438  1.00 13.06 ? 293  LYS A O     1 
ATOM   2289 C  CB    . LYS A 1 296 ? 44.336 -22.272 -5.381  1.00 19.36 ? 293  LYS A CB    1 
ATOM   2290 C  CG    . LYS A 1 296 ? 45.198 -21.089 -5.786  1.00 30.52 ? 293  LYS A CG    1 
ATOM   2291 C  CD    . LYS A 1 296 ? 44.388 -20.090 -6.610  1.00 34.66 ? 293  LYS A CD    1 
ATOM   2292 C  CE    . LYS A 1 296 ? 45.112 -18.754 -6.758  1.00 36.31 ? 293  LYS A CE    1 
ATOM   2293 N  NZ    . LYS A 1 296 ? 44.297 -17.778 -7.531  1.00 36.12 ? 293  LYS A NZ    1 
ATOM   2294 N  N     . ASN A 1 297 ? 45.039 -22.788 -2.420  1.00 12.01 ? 294  ASN A N     1 
ATOM   2295 C  CA    . ASN A 1 297 ? 45.629 -22.364 -1.141  1.00 12.41 ? 294  ASN A CA    1 
ATOM   2296 C  C     . ASN A 1 297 ? 46.574 -23.411 -0.563  1.00 15.39 ? 294  ASN A C     1 
ATOM   2297 O  O     . ASN A 1 297 ? 47.603 -23.077 0.017   1.00 11.92 ? 294  ASN A O     1 
ATOM   2298 C  CB    . ASN A 1 297 ? 44.549 -22.076 -0.102  1.00 17.47 ? 294  ASN A CB    1 
ATOM   2299 C  CG    . ASN A 1 297 ? 43.848 -20.765 -0.331  1.00 17.41 ? 294  ASN A CG    1 
ATOM   2300 O  OD1   . ASN A 1 297 ? 44.391 -19.847 -0.956  1.00 17.06 ? 294  ASN A OD1   1 
ATOM   2301 N  ND2   . ASN A 1 297 ? 42.627 -20.660 0.192   1.00 18.39 ? 294  ASN A ND2   1 
ATOM   2302 N  N     . GLY A 1 298 ? 46.198 -24.680 -0.677  1.00 13.09 ? 295  GLY A N     1 
ATOM   2303 C  CA    . GLY A 1 298 ? 47.029 -25.749 -0.147  1.00 13.29 ? 295  GLY A CA    1 
ATOM   2304 C  C     . GLY A 1 298 ? 48.393 -25.842 -0.819  1.00 8.24  ? 295  GLY A C     1 
ATOM   2305 O  O     . GLY A 1 298 ? 49.415 -25.992 -0.137  1.00 10.39 ? 295  GLY A O     1 
ATOM   2306 N  N     . SER A 1 299 ? 48.420 -25.782 -2.152  1.00 8.11  ? 296  SER A N     1 
ATOM   2307 C  CA    . SER A 1 299 ? 49.681 -25.830 -2.872  1.00 9.54  ? 296  SER A CA    1 
ATOM   2308 C  C     . SER A 1 299 ? 50.499 -24.601 -2.527  1.00 8.33  ? 296  SER A C     1 
ATOM   2309 O  O     . SER A 1 299 ? 51.718 -24.671 -2.370  1.00 9.39  ? 296  SER A O     1 
ATOM   2310 C  CB    . SER A 1 299 ? 49.445 -25.892 -4.381  1.00 14.82 ? 296  SER A CB    1 
ATOM   2311 O  OG    . SER A 1 299 ? 48.922 -27.160 -4.728  1.00 15.58 ? 296  SER A OG    1 
ATOM   2312 N  N     . TRP A 1 300 ? 49.816 -23.471 -2.388  1.00 8.77  ? 297  TRP A N     1 
ATOM   2313 C  CA    . TRP A 1 300 ? 50.513 -22.229 -2.063  1.00 7.47  ? 297  TRP A CA    1 
ATOM   2314 C  C     . TRP A 1 300 ? 51.158 -22.307 -0.679  1.00 12.15 ? 297  TRP A C     1 
ATOM   2315 O  O     . TRP A 1 300 ? 52.328 -21.953 -0.524  1.00 10.62 ? 297  TRP A O     1 
ATOM   2316 C  CB    . TRP A 1 300 ? 49.558 -21.040 -2.160  1.00 9.86  ? 297  TRP A CB    1 
ATOM   2317 C  CG    . TRP A 1 300 ? 50.229 -19.708 -2.008  1.00 9.93  ? 297  TRP A CG    1 
ATOM   2318 C  CD1   . TRP A 1 300 ? 50.774 -18.947 -2.998  1.00 14.82 ? 297  TRP A CD1   1 
ATOM   2319 C  CD2   . TRP A 1 300 ? 50.396 -18.969 -0.792  1.00 9.59  ? 297  TRP A CD2   1 
ATOM   2320 N  NE1   . TRP A 1 300 ? 51.281 -17.777 -2.470  1.00 19.41 ? 297  TRP A NE1   1 
ATOM   2321 C  CE2   . TRP A 1 300 ? 51.059 -17.770 -1.118  1.00 15.63 ? 297  TRP A CE2   1 
ATOM   2322 C  CE3   . TRP A 1 300 ? 50.049 -19.206 0.536   1.00 13.87 ? 297  TRP A CE3   1 
ATOM   2323 C  CZ2   . TRP A 1 300 ? 51.382 -16.810 -0.156  1.00 12.94 ? 297  TRP A CZ2   1 
ATOM   2324 C  CZ3   . TRP A 1 300 ? 50.374 -18.252 1.488   1.00 20.12 ? 297  TRP A CZ3   1 
ATOM   2325 C  CH2   . TRP A 1 300 ? 51.030 -17.076 1.136   1.00 12.73 ? 297  TRP A CH2   1 
ATOM   2326 N  N     . LEU A 1 301 ? 50.408 -22.793 0.309   1.00 9.80  ? 298  LEU A N     1 
ATOM   2327 C  CA    . LEU A 1 301 ? 50.935 -22.951 1.668   1.00 10.43 ? 298  LEU A CA    1 
ATOM   2328 C  C     . LEU A 1 301 ? 52.092 -23.936 1.740   1.00 11.29 ? 298  LEU A C     1 
ATOM   2329 O  O     . LEU A 1 301 ? 53.075 -23.713 2.460   1.00 9.17  ? 298  LEU A O     1 
ATOM   2330 C  CB    . LEU A 1 301 ? 49.835 -23.380 2.640   1.00 7.62  ? 298  LEU A CB    1 
ATOM   2331 C  CG    . LEU A 1 301 ? 48.788 -22.287 2.935   1.00 9.88  ? 298  LEU A CG    1 
ATOM   2332 C  CD1   . LEU A 1 301 ? 47.517 -22.881 3.544   1.00 11.37 ? 298  LEU A CD1   1 
ATOM   2333 C  CD2   . LEU A 1 301 ? 49.365 -21.217 3.851   1.00 13.25 ? 298  LEU A CD2   1 
ATOM   2334 N  N     . TYR A 1 302 ? 51.969 -25.029 1.004   1.00 9.23  ? 299  TYR A N     1 
ATOM   2335 C  CA    . TYR A 1 302 ? 52.999 -26.059 1.022   1.00 9.57  ? 299  TYR A CA    1 
ATOM   2336 C  C     . TYR A 1 302 ? 54.342 -25.497 0.558   1.00 10.78 ? 299  TYR A C     1 
ATOM   2337 O  O     . TYR A 1 302 ? 55.393 -25.736 1.179   1.00 10.29 ? 299  TYR A O     1 
ATOM   2338 C  CB    . TYR A 1 302 ? 52.567 -27.244 0.142   1.00 9.43  ? 299  TYR A CB    1 
ATOM   2339 C  CG    . TYR A 1 302 ? 53.568 -28.363 0.151   1.00 10.18 ? 299  TYR A CG    1 
ATOM   2340 C  CD1   . TYR A 1 302 ? 53.556 -29.314 1.163   1.00 9.95  ? 299  TYR A CD1   1 
ATOM   2341 C  CD2   . TYR A 1 302 ? 54.549 -28.459 -0.832  1.00 13.70 ? 299  TYR A CD2   1 
ATOM   2342 C  CE1   . TYR A 1 302 ? 54.482 -30.340 1.190   1.00 13.21 ? 299  TYR A CE1   1 
ATOM   2343 C  CE2   . TYR A 1 302 ? 55.489 -29.481 -0.805  1.00 14.95 ? 299  TYR A CE2   1 
ATOM   2344 C  CZ    . TYR A 1 302 ? 55.442 -30.418 0.212   1.00 18.03 ? 299  TYR A CZ    1 
ATOM   2345 O  OH    . TYR A 1 302 ? 56.364 -31.442 0.256   1.00 24.79 ? 299  TYR A OH    1 
ATOM   2346 N  N     . ALA A 1 303 ? 54.303 -24.726 -0.527  1.00 8.79  ? 300  ALA A N     1 
ATOM   2347 C  CA    . ALA A 1 303 ? 55.501 -24.071 -1.045  1.00 9.40  ? 300  ALA A CA    1 
ATOM   2348 C  C     . ALA A 1 303 ? 55.960 -22.906 -0.163  1.00 8.13  ? 300  ALA A C     1 
ATOM   2349 O  O     . ALA A 1 303 ? 57.159 -22.771 0.126   1.00 8.84  ? 300  ALA A O     1 
ATOM   2350 C  CB    . ALA A 1 303 ? 55.252 -23.583 -2.486  1.00 10.55 ? 300  ALA A CB    1 
ATOM   2351 N  N     . MET A 1 304 ? 55.013 -22.070 0.259   1.00 9.31  ? 301  MET A N     1 
ATOM   2352 C  CA    . MET A 1 304 ? 55.360 -20.842 0.978   1.00 9.10  ? 301  MET A CA    1 
ATOM   2353 C  C     . MET A 1 304 ? 56.057 -21.101 2.304   1.00 7.95  ? 301  MET A C     1 
ATOM   2354 O  O     . MET A 1 304 ? 56.966 -20.357 2.674   1.00 9.06  ? 301  MET A O     1 
ATOM   2355 C  CB    . MET A 1 304 ? 54.126 -19.969 1.215   1.00 9.59  ? 301  MET A CB    1 
ATOM   2356 C  CG    . MET A 1 304 ? 54.459 -18.551 1.685   1.00 12.65 ? 301  MET A CG    1 
ATOM   2357 S  SD    . MET A 1 304 ? 55.210 -17.593 0.363   1.00 13.37 ? 301  MET A SD    1 
ATOM   2358 C  CE    . MET A 1 304 ? 56.934 -17.529 0.892   1.00 13.30 ? 301  MET A CE    1 
ATOM   2359 N  N     . CYS A 1 305 ? 55.648 -22.148 3.020   1.00 7.31  ? 302  CYS A N     1 
ATOM   2360 C  CA    . CYS A 1 305 ? 56.269 -22.412 4.325   1.00 8.26  ? 302  CYS A CA    1 
ATOM   2361 C  C     . CYS A 1 305 ? 57.710 -22.897 4.167   1.00 7.68  ? 302  CYS A C     1 
ATOM   2362 O  O     . CYS A 1 305 ? 58.463 -22.940 5.142   1.00 9.35  ? 302  CYS A O     1 
ATOM   2363 C  CB    . CYS A 1 305 ? 55.452 -23.412 5.160   1.00 8.46  ? 302  CYS A CB    1 
ATOM   2364 S  SG    . CYS A 1 305 ? 55.478 -25.120 4.527   1.00 9.22  ? 302  CYS A SG    1 
ATOM   2365 N  N     . ARG A 1 306 ? 58.081 -23.243 2.936   1.00 6.56  ? 303  ARG A N     1 
ATOM   2366 C  CA    . ARG A 1 306 ? 59.447 -23.611 2.569   1.00 8.30  ? 303  ARG A CA    1 
ATOM   2367 C  C     . ARG A 1 306 ? 60.198 -22.446 1.894   1.00 9.71  ? 303  ARG A C     1 
ATOM   2368 O  O     . ARG A 1 306 ? 61.341 -22.600 1.457   1.00 13.25 ? 303  ARG A O     1 
ATOM   2369 C  CB    . ARG A 1 306 ? 59.451 -24.842 1.650   1.00 9.50  ? 303  ARG A CB    1 
ATOM   2370 C  CG    . ARG A 1 306 ? 58.985 -26.116 2.338   1.00 7.69  ? 303  ARG A CG    1 
ATOM   2371 C  CD    . ARG A 1 306 ? 58.623 -27.261 1.380   1.00 12.57 ? 303  ARG A CD    1 
ATOM   2372 N  NE    . ARG A 1 306 ? 58.430 -28.481 2.167   1.00 13.71 ? 303  ARG A NE    1 
ATOM   2373 C  CZ    . ARG A 1 306 ? 57.334 -28.740 2.869   1.00 12.02 ? 303  ARG A CZ    1 
ATOM   2374 N  NH1   . ARG A 1 306 ? 57.248 -29.852 3.592   1.00 13.07 ? 303  ARG A NH1   1 
ATOM   2375 N  NH2   . ARG A 1 306 ? 56.312 -27.895 2.838   1.00 8.44  ? 303  ARG A NH2   1 
ATOM   2376 N  N     . GLY A 1 307 ? 59.560 -21.282 1.833   1.00 6.78  ? 304  GLY A N     1 
ATOM   2377 C  CA    . GLY A 1 307 ? 60.195 -20.090 1.311   1.00 9.06  ? 304  GLY A CA    1 
ATOM   2378 C  C     . GLY A 1 307 ? 60.010 -19.938 -0.188  1.00 8.61  ? 304  GLY A C     1 
ATOM   2379 O  O     . GLY A 1 307 ? 60.674 -19.106 -0.815  1.00 12.47 ? 304  GLY A O     1 
ATOM   2380 N  N     . ILE A 1 308 ? 59.106 -20.730 -0.757  1.00 8.98  ? 305  ILE A N     1 
ATOM   2381 C  CA    . ILE A 1 308 ? 58.942 -20.790 -2.218  1.00 10.65 ? 305  ILE A CA    1 
ATOM   2382 C  C     . ILE A 1 308 ? 57.603 -20.213 -2.658  1.00 9.97  ? 305  ILE A C     1 
ATOM   2383 O  O     . ILE A 1 308 ? 56.578 -20.571 -2.109  1.00 10.09 ? 305  ILE A O     1 
ATOM   2384 C  CB    . ILE A 1 308 ? 59.022 -22.244 -2.701  1.00 10.47 ? 305  ILE A CB    1 
ATOM   2385 C  CG1   . ILE A 1 308 ? 60.373 -22.853 -2.293  1.00 14.84 ? 305  ILE A CG1   1 
ATOM   2386 C  CG2   . ILE A 1 308 ? 58.763 -22.313 -4.221  1.00 12.59 ? 305  ILE A CG2   1 
ATOM   2387 C  CD1   . ILE A 1 308 ? 60.528 -24.323 -2.658  1.00 17.58 ? 305  ILE A CD1   1 
ATOM   2388 N  N     . GLU A 1 309 ? 57.608 -19.326 -3.657  1.00 8.01  ? 306  GLU A N     1 
ATOM   2389 C  CA    . GLU A 1 309 ? 56.369 -18.694 -4.102  1.00 14.15 ? 306  GLU A CA    1 
ATOM   2390 C  C     . GLU A 1 309 ? 56.610 -18.220 -5.517  1.00 16.82 ? 306  GLU A C     1 
ATOM   2391 O  O     . GLU A 1 309 ? 57.695 -17.741 -5.822  1.00 14.66 ? 306  GLU A O     1 
ATOM   2392 C  CB    . GLU A 1 309 ? 56.040 -17.490 -3.220  1.00 17.85 ? 306  GLU A CB    1 
ATOM   2393 C  CG    . GLU A 1 309 ? 54.569 -17.176 -3.168  1.00 19.96 ? 306  GLU A CG    1 
ATOM   2394 C  CD    . GLU A 1 309 ? 54.243 -15.734 -3.490  1.00 23.45 ? 306  GLU A CD    1 
ATOM   2395 O  OE1   . GLU A 1 309 ? 55.172 -14.887 -3.595  1.00 19.21 ? 306  GLU A OE1   1 
ATOM   2396 O  OE2   . GLU A 1 309 ? 53.035 -15.446 -3.628  1.00 29.22 ? 306  GLU A OE2   1 
ATOM   2397 N  N     . HIS A 1 310 ? 55.618 -18.343 -6.390  1.00 15.57 ? 307  HIS A N     1 
ATOM   2398 C  CA    . HIS A 1 310 ? 55.895 -18.101 -7.805  1.00 15.41 ? 307  HIS A CA    1 
ATOM   2399 C  C     . HIS A 1 310 ? 55.165 -16.911 -8.416  1.00 12.62 ? 307  HIS A C     1 
ATOM   2400 O  O     . HIS A 1 310 ? 55.332 -16.642 -9.601  1.00 20.11 ? 307  HIS A O     1 
ATOM   2401 C  CB    . HIS A 1 310 ? 55.621 -19.358 -8.629  1.00 26.24 ? 307  HIS A CB    1 
ATOM   2402 C  CG    . HIS A 1 310 ? 56.495 -20.518 -8.263  1.00 35.30 ? 307  HIS A CG    1 
ATOM   2403 N  ND1   . HIS A 1 310 ? 57.873 -20.438 -8.251  1.00 32.99 ? 307  HIS A ND1   1 
ATOM   2404 C  CD2   . HIS A 1 310 ? 56.189 -21.781 -7.887  1.00 38.41 ? 307  HIS A CD2   1 
ATOM   2405 C  CE1   . HIS A 1 310 ? 58.375 -21.604 -7.887  1.00 33.18 ? 307  HIS A CE1   1 
ATOM   2406 N  NE2   . HIS A 1 310 ? 57.375 -22.437 -7.660  1.00 37.02 ? 307  HIS A NE2   1 
ATOM   2407 N  N     . ASP A 1 311 ? 54.361 -16.210 -7.625  1.00 12.83 ? 308  ASP A N     1 
ATOM   2408 C  CA    . ASP A 1 311 ? 53.577 -15.094 -8.168  1.00 13.78 ? 308  ASP A CA    1 
ATOM   2409 C  C     . ASP A 1 311 ? 54.488 -14.102 -8.898  1.00 15.00 ? 308  ASP A C     1 
ATOM   2410 O  O     . ASP A 1 311 ? 55.457 -13.607 -8.320  1.00 14.10 ? 308  ASP A O     1 
ATOM   2411 C  CB    . ASP A 1 311 ? 52.822 -14.382 -7.052  1.00 14.29 ? 308  ASP A CB    1 
ATOM   2412 C  CG    . ASP A 1 311 ? 51.840 -13.357 -7.583  1.00 23.75 ? 308  ASP A CG    1 
ATOM   2413 O  OD1   . ASP A 1 311 ? 51.726 -12.266 -6.991  1.00 28.48 ? 308  ASP A OD1   1 
ATOM   2414 O  OD2   . ASP A 1 311 ? 51.176 -13.649 -8.599  1.00 26.74 ? 308  ASP A OD2   1 
ATOM   2415 N  N     . PRO A 1 312 ? 54.194 -13.810 -10.178 1.00 11.09 ? 309  PRO A N     1 
ATOM   2416 C  CA    . PRO A 1 312 ? 55.130 -12.923 -10.876 1.00 11.28 ? 309  PRO A CA    1 
ATOM   2417 C  C     . PRO A 1 312 ? 54.969 -11.464 -10.491 1.00 9.70  ? 309  PRO A C     1 
ATOM   2418 O  O     . PRO A 1 312 ? 53.918 -11.045 -10.009 1.00 11.90 ? 309  PRO A O     1 
ATOM   2419 C  CB    . PRO A 1 312 ? 54.769 -13.119 -12.358 1.00 14.97 ? 309  PRO A CB    1 
ATOM   2420 C  CG    . PRO A 1 312 ? 53.356 -13.577 -12.347 1.00 14.24 ? 309  PRO A CG    1 
ATOM   2421 C  CD    . PRO A 1 312 ? 53.175 -14.377 -11.082 1.00 16.11 ? 309  PRO A CD    1 
ATOM   2422 N  N     . VAL A 1 313 ? 56.052 -10.715 -10.660 1.00 11.39 ? 310  VAL A N     1 
ATOM   2423 C  CA    . VAL A 1 313 ? 56.002 -9.263  -10.589 1.00 10.06 ? 310  VAL A CA    1 
ATOM   2424 C  C     . VAL A 1 313 ? 55.314 -8.826  -11.867 1.00 12.05 ? 310  VAL A C     1 
ATOM   2425 O  O     . VAL A 1 313 ? 55.877 -8.967  -12.946 1.00 13.52 ? 310  VAL A O     1 
ATOM   2426 C  CB    . VAL A 1 313 ? 57.408 -8.675  -10.540 1.00 10.65 ? 310  VAL A CB    1 
ATOM   2427 C  CG1   . VAL A 1 313 ? 57.361 -7.144  -10.598 1.00 12.69 ? 310  VAL A CG1   1 
ATOM   2428 C  CG2   . VAL A 1 313 ? 58.119 -9.133  -9.259  1.00 12.07 ? 310  VAL A CG2   1 
ATOM   2429 N  N     . LYS A 1 314 ? 54.085 -8.335  -11.755 1.00 10.93 ? 311  LYS A N     1 
ATOM   2430 C  CA    . LYS A 1 314 ? 53.333 -7.953  -12.943 1.00 14.15 ? 311  LYS A CA    1 
ATOM   2431 C  C     . LYS A 1 314 ? 53.782 -6.597  -13.494 1.00 12.10 ? 311  LYS A C     1 
ATOM   2432 O  O     . LYS A 1 314 ? 54.018 -5.649  -12.742 1.00 12.26 ? 311  LYS A O     1 
ATOM   2433 C  CB    . LYS A 1 314 ? 51.830 -7.969  -12.647 1.00 14.04 ? 311  LYS A CB    1 
ATOM   2434 C  CG    . LYS A 1 314 ? 51.327 -9.364  -12.262 1.00 20.17 ? 311  LYS A CG    1 
ATOM   2435 C  CD    . LYS A 1 314 ? 49.936 -9.346  -11.652 1.00 28.04 ? 311  LYS A CD    1 
ATOM   2436 C  CE    . LYS A 1 314 ? 49.539 -10.750 -11.201 1.00 30.45 ? 311  LYS A CE    1 
ATOM   2437 N  NZ    . LYS A 1 314 ? 50.642 -11.418 -10.427 1.00 30.53 ? 311  LYS A NZ    1 
ATOM   2438 N  N     . PRO A 1 315 ? 53.925 -6.508  -14.818 1.00 10.11 ? 312  PRO A N     1 
ATOM   2439 C  CA    . PRO A 1 315 ? 54.316 -5.241  -15.431 1.00 11.27 ? 312  PRO A CA    1 
ATOM   2440 C  C     . PRO A 1 315 ? 53.145 -4.269  -15.437 1.00 15.00 ? 312  PRO A C     1 
ATOM   2441 O  O     . PRO A 1 315 ? 52.443 -4.139  -16.443 1.00 16.44 ? 312  PRO A O     1 
ATOM   2442 C  CB    . PRO A 1 315 ? 54.698 -5.656  -16.859 1.00 17.60 ? 312  PRO A CB    1 
ATOM   2443 C  CG    . PRO A 1 315 ? 53.906 -6.903  -17.111 1.00 15.28 ? 312  PRO A CG    1 
ATOM   2444 C  CD    . PRO A 1 315 ? 53.872 -7.616  -15.795 1.00 12.63 ? 312  PRO A CD    1 
ATOM   2445 N  N     . ARG A 1 316 ? 52.930 -3.589  -14.313 1.00 12.97 ? 313  ARG A N     1 
ATOM   2446 C  CA    . ARG A 1 316 ? 51.809 -2.653  -14.208 1.00 12.44 ? 313  ARG A CA    1 
ATOM   2447 C  C     . ARG A 1 316 ? 52.132 -1.529  -13.240 1.00 17.81 ? 313  ARG A C     1 
ATOM   2448 O  O     . ARG A 1 316 ? 52.278 -1.763  -12.043 1.00 14.45 ? 313  ARG A O     1 
ATOM   2449 C  CB    . ARG A 1 316 ? 50.543 -3.375  -13.747 1.00 16.96 ? 313  ARG A CB    1 
ATOM   2450 C  CG    A ARG A 1 316 ? 49.290 -2.523  -13.702 0.50 17.56 ? 313  ARG A CG    1 
ATOM   2451 C  CG    B ARG A 1 316 ? 49.335 -2.450  -13.690 0.50 17.55 ? 313  ARG A CG    1 
ATOM   2452 C  CD    A ARG A 1 316 ? 48.171 -3.255  -12.968 0.50 17.68 ? 313  ARG A CD    1 
ATOM   2453 C  CD    B ARG A 1 316 ? 48.111 -3.125  -13.099 0.50 17.63 ? 313  ARG A CD    1 
ATOM   2454 N  NE    A ARG A 1 316 ? 48.434 -3.344  -11.532 0.50 19.28 ? 313  ARG A NE    1 
ATOM   2455 N  NE    B ARG A 1 316 ? 48.355 -3.602  -11.742 0.50 19.37 ? 313  ARG A NE    1 
ATOM   2456 C  CZ    A ARG A 1 316 ? 48.758 -4.461  -10.882 0.50 21.56 ? 313  ARG A CZ    1 
ATOM   2457 C  CZ    B ARG A 1 316 ? 48.375 -2.825  -10.661 0.50 18.64 ? 313  ARG A CZ    1 
ATOM   2458 N  NH1   A ARG A 1 316 ? 48.977 -4.418  -9.573  0.50 20.07 ? 313  ARG A NH1   1 
ATOM   2459 N  NH1   B ARG A 1 316 ? 48.606 -3.363  -9.468  0.50 18.57 ? 313  ARG A NH1   1 
ATOM   2460 N  NH2   A ARG A 1 316 ? 48.860 -5.617  -11.530 0.50 22.46 ? 313  ARG A NH2   1 
ATOM   2461 N  NH2   B ARG A 1 316 ? 48.171 -1.515  -10.768 0.50 15.57 ? 313  ARG A NH2   1 
ATOM   2462 N  N     . GLN A 1 317 ? 52.228 -0.311  -13.768 1.00 13.99 ? 314  GLN A N     1 
ATOM   2463 C  CA    . GLN A 1 317 ? 52.662 0.841   -12.983 1.00 17.33 ? 314  GLN A CA    1 
ATOM   2464 C  C     . GLN A 1 317 ? 51.478 1.732   -12.613 1.00 18.03 ? 314  GLN A C     1 
ATOM   2465 O  O     . GLN A 1 317 ? 51.543 2.521   -11.665 1.00 24.00 ? 314  GLN A O     1 
ATOM   2466 C  CB    . GLN A 1 317 ? 53.688 1.646   -13.783 1.00 28.94 ? 314  GLN A CB    1 
ATOM   2467 C  CG    . GLN A 1 317 ? 54.421 2.694   -12.976 1.00 34.00 ? 314  GLN A CG    1 
ATOM   2468 C  CD    . GLN A 1 317 ? 55.361 3.521   -13.823 1.00 23.90 ? 314  GLN A CD    1 
ATOM   2469 O  OE1   . GLN A 1 317 ? 55.666 3.162   -14.965 1.00 34.75 ? 314  GLN A OE1   1 
ATOM   2470 N  NE2   . GLN A 1 317 ? 55.830 4.637   -13.273 1.00 29.19 ? 314  GLN A NE2   1 
ATOM   2471 N  N     . LEU A 1 318 ? 50.398 1.609   -13.375 1.00 15.55 ? 315  LEU A N     1 
ATOM   2472 C  CA    . LEU A 1 318 ? 49.219 2.448   -13.185 1.00 16.77 ? 315  LEU A CA    1 
ATOM   2473 C  C     . LEU A 1 318 ? 48.090 1.681   -12.515 1.00 18.93 ? 315  LEU A C     1 
ATOM   2474 O  O     . LEU A 1 318 ? 47.904 0.495   -12.775 1.00 14.46 ? 315  LEU A O     1 
ATOM   2475 C  CB    . LEU A 1 318 ? 48.705 2.933   -14.541 1.00 17.12 ? 315  LEU A CB    1 
ATOM   2476 C  CG    . LEU A 1 318 ? 49.650 3.735   -15.433 1.00 18.58 ? 315  LEU A CG    1 
ATOM   2477 C  CD1   . LEU A 1 318 ? 48.987 3.947   -16.791 1.00 19.15 ? 315  LEU A CD1   1 
ATOM   2478 C  CD2   . LEU A 1 318 ? 50.019 5.057   -14.778 1.00 19.66 ? 315  LEU A CD2   1 
ATOM   2479 N  N     . PRO A 1 319 ? 47.299 2.370   -11.678 1.00 12.59 ? 316  PRO A N     1 
ATOM   2480 C  CA    . PRO A 1 319 ? 46.119 1.703   -11.108 1.00 16.94 ? 316  PRO A CA    1 
ATOM   2481 C  C     . PRO A 1 319 ? 45.147 1.242   -12.192 1.00 12.51 ? 316  PRO A C     1 
ATOM   2482 O  O     . PRO A 1 319 ? 45.060 1.890   -13.231 1.00 18.79 ? 316  PRO A O     1 
ATOM   2483 C  CB    . PRO A 1 319 ? 45.484 2.782   -10.222 1.00 19.11 ? 316  PRO A CB    1 
ATOM   2484 C  CG    . PRO A 1 319 ? 46.147 4.071   -10.599 1.00 26.91 ? 316  PRO A CG    1 
ATOM   2485 C  CD    . PRO A 1 319 ? 47.481 3.745   -11.184 1.00 14.73 ? 316  PRO A CD    1 
ATOM   2486 N  N     . LYS A 1 320 ? 44.450 0.131   -11.948 1.00 16.17 ? 317  LYS A N     1 
ATOM   2487 C  CA    . LYS A 1 320 ? 43.500 -0.474  -12.886 1.00 14.12 ? 317  LYS A CA    1 
ATOM   2488 C  C     . LYS A 1 320 ? 42.103 0.129   -12.785 1.00 21.47 ? 317  LYS A C     1 
ATOM   2489 O  O     . LYS A 1 320 ? 41.238 -0.152  -13.617 1.00 17.82 ? 317  LYS A O     1 
ATOM   2490 C  CB    . LYS A 1 320 ? 43.325 -1.964  -12.565 1.00 21.05 ? 317  LYS A CB    1 
ATOM   2491 C  CG    . LYS A 1 320 ? 44.466 -2.882  -12.916 1.00 24.91 ? 317  LYS A CG    1 
ATOM   2492 C  CD    . LYS A 1 320 ? 44.001 -4.333  -12.806 1.00 27.47 ? 317  LYS A CD    1 
ATOM   2493 C  CE    . LYS A 1 320 ? 45.029 -5.289  -13.378 1.00 32.14 ? 317  LYS A CE    1 
ATOM   2494 N  NZ    . LYS A 1 320 ? 44.505 -6.677  -13.475 1.00 33.12 ? 317  LYS A NZ    1 
ATOM   2495 N  N     . THR A 1 321 ? 41.865 0.889   -11.721 1.00 15.35 ? 318  THR A N     1 
ATOM   2496 C  CA    . THR A 1 321 ? 40.565 1.497   -11.472 1.00 16.76 ? 318  THR A CA    1 
ATOM   2497 C  C     . THR A 1 321 ? 40.805 2.862   -10.871 1.00 15.01 ? 318  THR A C     1 
ATOM   2498 O  O     . THR A 1 321 ? 41.877 3.126   -10.325 1.00 16.94 ? 318  THR A O     1 
ATOM   2499 C  CB    . THR A 1 321 ? 39.680 0.660   -10.501 1.00 18.90 ? 318  THR A CB    1 
ATOM   2500 O  OG1   . THR A 1 321 ? 40.358 0.477   -9.246  1.00 17.52 ? 318  THR A OG1   1 
ATOM   2501 C  CG2   . THR A 1 321 ? 39.323 -0.692  -11.096 1.00 17.85 ? 318  THR A CG2   1 
ATOM   2502 N  N     . ILE A 1 322 ? 39.822 3.744   -11.014 1.00 11.25 ? 319  ILE A N     1 
ATOM   2503 C  CA    . ILE A 1 322 ? 39.874 5.071   -10.441 1.00 16.36 ? 319  ILE A CA    1 
ATOM   2504 C  C     . ILE A 1 322 ? 38.530 5.271   -9.742  1.00 13.35 ? 319  ILE A C     1 
ATOM   2505 O  O     . ILE A 1 322 ? 37.478 5.217   -10.378 1.00 13.51 ? 319  ILE A O     1 
ATOM   2506 C  CB    . ILE A 1 322 ? 40.130 6.128   -11.538 1.00 11.12 ? 319  ILE A CB    1 
ATOM   2507 C  CG1   . ILE A 1 322 ? 41.501 5.882   -12.184 1.00 16.99 ? 319  ILE A CG1   1 
ATOM   2508 C  CG2   . ILE A 1 322 ? 40.009 7.545   -10.979 1.00 14.36 ? 319  ILE A CG2   1 
ATOM   2509 C  CD1   . ILE A 1 322 ? 41.816 6.802   -13.350 1.00 20.44 ? 319  ILE A CD1   1 
ATOM   2510 N  N     . GLY A 1 323 ? 38.560 5.419   -8.423  1.00 11.06 ? 320  GLY A N     1 
ATOM   2511 C  CA    . GLY A 1 323 ? 37.339 5.439   -7.637  1.00 13.58 ? 320  GLY A CA    1 
ATOM   2512 C  C     . GLY A 1 323 ? 37.298 6.587   -6.654  1.00 14.47 ? 320  GLY A C     1 
ATOM   2513 O  O     . GLY A 1 323 ? 38.326 7.144   -6.304  1.00 13.32 ? 320  GLY A O     1 
ATOM   2514 N  N     . CYS A 1 324 ? 36.090 6.904   -6.194  1.00 11.61 ? 321  CYS A N     1 
ATOM   2515 C  CA    . CYS A 1 324 ? 35.824 8.026   -5.299  1.00 12.44 ? 321  CYS A CA    1 
ATOM   2516 C  C     . CYS A 1 324 ? 34.772 7.504   -4.336  1.00 11.35 ? 321  CYS A C     1 
ATOM   2517 O  O     . CYS A 1 324 ? 33.760 6.947   -4.775  1.00 14.06 ? 321  CYS A O     1 
ATOM   2518 C  CB    . CYS A 1 324 ? 35.220 9.198   -6.102  1.00 15.35 ? 321  CYS A CB    1 
ATOM   2519 S  SG    A CYS A 1 324 ? 35.569 10.833  -5.474  0.40 23.46 ? 321  CYS A SG    1 
ATOM   2520 S  SG    B CYS A 1 324 ? 36.329 10.006  -7.269  0.60 16.74 ? 321  CYS A SG    1 
ATOM   2521 N  N     . SER A 1 325 ? 34.994 7.663   -3.034  1.00 10.85 ? 322  SER A N     1 
ATOM   2522 C  CA    . SER A 1 325 ? 34.104 7.054   -2.045  1.00 14.00 ? 322  SER A CA    1 
ATOM   2523 C  C     . SER A 1 325 ? 33.928 7.964   -0.838  1.00 16.23 ? 322  SER A C     1 
ATOM   2524 O  O     . SER A 1 325 ? 34.870 8.649   -0.427  1.00 13.62 ? 322  SER A O     1 
ATOM   2525 C  CB    . SER A 1 325 ? 34.663 5.681   -1.626  1.00 16.25 ? 322  SER A CB    1 
ATOM   2526 O  OG    A SER A 1 325 ? 35.893 5.799   -0.959  0.50 13.41 ? 322  SER A OG    1 
ATOM   2527 O  OG    B SER A 1 325 ? 34.079 5.169   -0.444  0.50 16.58 ? 322  SER A OG    1 
ATOM   2528 N  N     . LYS A 1 326 ? 32.718 7.988   -0.278  1.00 12.09 ? 323  LYS A N     1 
ATOM   2529 C  CA    . LYS A 1 326 ? 32.494 8.713   0.969   1.00 12.97 ? 323  LYS A CA    1 
ATOM   2530 C  C     . LYS A 1 326 ? 31.517 7.997   1.893   1.00 16.54 ? 323  LYS A C     1 
ATOM   2531 O  O     . LYS A 1 326 ? 30.478 7.491   1.440   1.00 11.99 ? 323  LYS A O     1 
ATOM   2532 C  CB    . LYS A 1 326 ? 32.005 10.139  0.699   1.00 13.30 ? 323  LYS A CB    1 
ATOM   2533 C  CG    . LYS A 1 326 ? 31.884 10.966  1.984   1.00 15.04 ? 323  LYS A CG    1 
ATOM   2534 C  CD    . LYS A 1 326 ? 31.614 12.421  1.672   1.00 15.71 ? 323  LYS A CD    1 
ATOM   2535 C  CE    . LYS A 1 326 ? 31.523 13.252  2.949   1.00 21.71 ? 323  LYS A CE    1 
ATOM   2536 N  NZ    . LYS A 1 326 ? 32.720 13.064  3.795   1.00 25.43 ? 323  LYS A NZ    1 
ATOM   2537 N  N     . ASN A 1 327 ? 31.874 7.940   3.178   1.00 12.32 ? 324  ASN A N     1 
ATOM   2538 C  CA    . ASN A 1 327 ? 31.006 7.436   4.242   1.00 14.41 ? 324  ASN A CA    1 
ATOM   2539 C  C     . ASN A 1 327 ? 30.175 8.564   4.844   1.00 17.57 ? 324  ASN A C     1 
ATOM   2540 O  O     . ASN A 1 327 ? 30.599 9.715   4.874   1.00 13.76 ? 324  ASN A O     1 
ATOM   2541 C  CB    . ASN A 1 327 ? 31.822 6.810   5.381   1.00 15.19 ? 324  ASN A CB    1 
ATOM   2542 C  CG    . ASN A 1 327 ? 32.513 5.515   4.988   1.00 18.34 ? 324  ASN A CG    1 
ATOM   2543 O  OD1   . ASN A 1 327 ? 32.256 4.937   3.927   1.00 22.36 ? 324  ASN A OD1   1 
ATOM   2544 N  ND2   . ASN A 1 327 ? 33.394 5.042   5.863   1.00 24.42 ? 324  ASN A ND2   1 
ATOM   2545 N  N     . PHE A 1 328 ? 28.995 8.213   5.347   1.00 15.70 ? 325  PHE A N     1 
ATOM   2546 C  CA    . PHE A 1 328 ? 28.093 9.170   5.955   1.00 17.63 ? 325  PHE A CA    1 
ATOM   2547 C  C     . PHE A 1 328 ? 27.599 8.531   7.248   1.00 22.04 ? 325  PHE A C     1 
ATOM   2548 O  O     . PHE A 1 328 ? 26.510 7.953   7.294   1.00 20.01 ? 325  PHE A O     1 
ATOM   2549 C  CB    . PHE A 1 328 ? 26.939 9.480   4.989   1.00 16.78 ? 325  PHE A CB    1 
ATOM   2550 C  CG    . PHE A 1 328 ? 27.391 10.049  3.664   1.00 16.11 ? 325  PHE A CG    1 
ATOM   2551 C  CD1   . PHE A 1 328 ? 27.564 9.228   2.561   1.00 18.75 ? 325  PHE A CD1   1 
ATOM   2552 C  CD2   . PHE A 1 328 ? 27.653 11.405  3.530   1.00 13.23 ? 325  PHE A CD2   1 
ATOM   2553 C  CE1   . PHE A 1 328 ? 27.980 9.755   1.341   1.00 11.91 ? 325  PHE A CE1   1 
ATOM   2554 C  CE2   . PHE A 1 328 ? 28.066 11.939  2.325   1.00 15.03 ? 325  PHE A CE2   1 
ATOM   2555 C  CZ    . PHE A 1 328 ? 28.241 11.106  1.223   1.00 14.97 ? 325  PHE A CZ    1 
ATOM   2556 N  N     . PRO A 1 329 ? 28.432 8.599   8.300   1.00 22.40 ? 326  PRO A N     1 
ATOM   2557 C  CA    . PRO A 1 329 ? 28.212 7.829   9.529   1.00 21.91 ? 326  PRO A CA    1 
ATOM   2558 C  C     . PRO A 1 329 ? 27.154 8.423   10.450  1.00 25.71 ? 326  PRO A C     1 
ATOM   2559 O  O     . PRO A 1 329 ? 26.824 9.605   10.353  1.00 23.30 ? 326  PRO A O     1 
ATOM   2560 C  CB    . PRO A 1 329 ? 29.580 7.877   10.214  1.00 27.77 ? 326  PRO A CB    1 
ATOM   2561 C  CG    . PRO A 1 329 ? 30.186 9.147   9.732   1.00 30.23 ? 326  PRO A CG    1 
ATOM   2562 C  CD    . PRO A 1 329 ? 29.742 9.269   8.299   1.00 26.17 ? 326  PRO A CD    1 
ATOM   2563 N  N     . GLY A 1 330 ? 26.636 7.575   11.334  1.00 34.34 ? 327  GLY A N     1 
ATOM   2564 C  CA    . GLY A 1 330 ? 25.681 7.986   12.343  1.00 34.81 ? 327  GLY A CA    1 
ATOM   2565 C  C     . GLY A 1 330 ? 24.615 8.918   11.810  1.00 27.99 ? 327  GLY A C     1 
ATOM   2566 O  O     . GLY A 1 330 ? 23.888 8.591   10.871  1.00 32.31 ? 327  GLY A O     1 
ATOM   2567 N  N     . LYS A 1 331 ? 24.543 10.098  12.409  1.00 28.65 ? 328  LYS A N     1 
ATOM   2568 C  CA    . LYS A 1 331 ? 23.482 11.050  12.119  1.00 32.15 ? 328  LYS A CA    1 
ATOM   2569 C  C     . LYS A 1 331 ? 23.598 11.705  10.744  1.00 32.67 ? 328  LYS A C     1 
ATOM   2570 O  O     . LYS A 1 331 ? 22.647 12.328  10.275  1.00 35.28 ? 328  LYS A O     1 
ATOM   2571 C  CB    . LYS A 1 331 ? 23.437 12.112  13.224  1.00 39.08 ? 328  LYS A CB    1 
ATOM   2572 C  CG    . LYS A 1 331 ? 22.222 13.018  13.189  1.00 61.78 ? 328  LYS A CG    1 
ATOM   2573 C  CD    . LYS A 1 331 ? 22.136 13.869  14.450  1.00 61.12 ? 328  LYS A CD    1 
ATOM   2574 C  CE    . LYS A 1 331 ? 21.076 14.950  14.316  1.00 50.62 ? 328  LYS A CE    1 
ATOM   2575 N  NZ    . LYS A 1 331 ? 21.396 15.890  13.203  1.00 49.34 ? 328  LYS A NZ    1 
ATOM   2576 N  N     . THR A 1 332 ? 24.751 11.568  10.093  1.00 29.84 ? 329  THR A N     1 
ATOM   2577 C  CA    . THR A 1 332 ? 24.965 12.238  8.807   1.00 26.88 ? 329  THR A CA    1 
ATOM   2578 C  C     . THR A 1 332 ? 24.468 11.421  7.612   1.00 22.04 ? 329  THR A C     1 
ATOM   2579 O  O     . THR A 1 332 ? 24.519 11.898  6.480   1.00 21.50 ? 329  THR A O     1 
ATOM   2580 C  CB    . THR A 1 332 ? 26.452 12.613  8.561   1.00 25.35 ? 329  THR A CB    1 
ATOM   2581 O  OG1   . THR A 1 332 ? 27.205 11.437  8.242   1.00 24.54 ? 329  THR A OG1   1 
ATOM   2582 C  CG2   . THR A 1 332 ? 27.056 13.304  9.784   1.00 27.58 ? 329  THR A CG2   1 
ATOM   2583 N  N     . ALA A 1 333 ? 23.995 10.205  7.868   1.00 22.58 ? 330  ALA A N     1 
ATOM   2584 C  CA    . ALA A 1 333 ? 23.467 9.335   6.810   1.00 23.07 ? 330  ALA A CA    1 
ATOM   2585 C  C     . ALA A 1 333 ? 22.462 10.059  5.923   1.00 29.92 ? 330  ALA A C     1 
ATOM   2586 O  O     . ALA A 1 333 ? 21.703 10.904  6.397   1.00 31.76 ? 330  ALA A O     1 
ATOM   2587 C  CB    . ALA A 1 333 ? 22.847 8.080   7.413   1.00 26.28 ? 330  ALA A CB    1 
ATOM   2588 N  N     . LEU A 1 334 ? 22.450 9.723   4.635   1.00 22.46 ? 331  LEU A N     1 
ATOM   2589 C  CA    . LEU A 1 334 ? 21.648 10.461  3.665   1.00 24.69 ? 331  LEU A CA    1 
ATOM   2590 C  C     . LEU A 1 334 ? 20.201 9.951   3.631   1.00 24.37 ? 331  LEU A C     1 
ATOM   2591 O  O     . LEU A 1 334 ? 19.954 8.791   3.311   1.00 28.95 ? 331  LEU A O     1 
ATOM   2592 C  CB    . LEU A 1 334 ? 22.283 10.377  2.278   1.00 22.95 ? 331  LEU A CB    1 
ATOM   2593 C  CG    . LEU A 1 334 ? 23.793 10.629  2.218   1.00 18.91 ? 331  LEU A CG    1 
ATOM   2594 C  CD1   . LEU A 1 334 ? 24.263 10.561  0.778   1.00 20.33 ? 331  LEU A CD1   1 
ATOM   2595 C  CD2   . LEU A 1 334 ? 24.160 11.981  2.849   1.00 19.70 ? 331  LEU A CD2   1 
ATOM   2596 N  N     . ALA A 1 335 ? 19.257 10.832  3.952   1.00 34.27 ? 332  ALA A N     1 
ATOM   2597 C  CA    . ALA A 1 335 ? 17.866 10.426  4.159   1.00 31.26 ? 332  ALA A CA    1 
ATOM   2598 C  C     . ALA A 1 335 ? 16.882 11.127  3.223   1.00 37.07 ? 332  ALA A C     1 
ATOM   2599 O  O     . ALA A 1 335 ? 15.668 10.964  3.358   1.00 34.31 ? 332  ALA A O     1 
ATOM   2600 C  CB    . ALA A 1 335 ? 17.468 10.655  5.608   1.00 31.65 ? 332  ALA A CB    1 
ATOM   2601 N  N     . THR A 1 336 ? 17.404 11.913  2.289   1.00 25.85 ? 333  THR A N     1 
ATOM   2602 C  CA    . THR A 1 336 ? 16.576 12.572  1.287   1.00 29.70 ? 333  THR A CA    1 
ATOM   2603 C  C     . THR A 1 336 ? 17.145 12.376  -0.114  1.00 39.95 ? 333  THR A C     1 
ATOM   2604 O  O     . THR A 1 336 ? 18.363 12.333  -0.301  1.00 32.13 ? 333  THR A O     1 
ATOM   2605 C  CB    . THR A 1 336 ? 16.457 14.083  1.536   1.00 34.60 ? 333  THR A CB    1 
ATOM   2606 O  OG1   . THR A 1 336 ? 17.643 14.743  1.072   1.00 34.39 ? 333  THR A OG1   1 
ATOM   2607 C  CG2   . THR A 1 336 ? 16.233 14.384  3.020   1.00 33.95 ? 333  THR A CG2   1 
ATOM   2608 N  N     . ARG A 1 337 ? 16.259 12.275  -1.099  1.00 36.96 ? 334  ARG A N     1 
ATOM   2609 C  CA    . ARG A 1 337 ? 16.673 12.114  -2.488  1.00 35.79 ? 334  ARG A CA    1 
ATOM   2610 C  C     . ARG A 1 337 ? 17.634 13.216  -2.919  1.00 37.58 ? 334  ARG A C     1 
ATOM   2611 O  O     . ARG A 1 337 ? 18.616 12.953  -3.614  1.00 37.66 ? 334  ARG A O     1 
ATOM   2612 C  CB    . ARG A 1 337 ? 15.450 12.095  -3.407  1.00 45.52 ? 334  ARG A CB    1 
ATOM   2613 C  CG    . ARG A 1 337 ? 15.780 11.956  -4.886  1.00 50.53 ? 334  ARG A CG    1 
ATOM   2614 C  CD    . ARG A 1 337 ? 14.514 11.960  -5.738  1.00 49.51 ? 334  ARG A CD    1 
ATOM   2615 N  NE    . ARG A 1 337 ? 13.651 13.096  -5.422  1.00 62.88 ? 334  ARG A NE    1 
ATOM   2616 C  CZ    . ARG A 1 337 ? 13.865 14.337  -5.846  1.00 61.69 ? 334  ARG A CZ    1 
ATOM   2617 N  NH1   . ARG A 1 337 ? 14.920 14.607  -6.604  1.00 63.31 ? 334  ARG A NH1   1 
ATOM   2618 N  NH2   . ARG A 1 337 ? 13.028 15.311  -5.510  1.00 64.34 ? 334  ARG A NH2   1 
ATOM   2619 N  N     . GLU A 1 338 ? 17.347 14.448  -2.506  1.00 39.61 ? 335  GLU A N     1 
ATOM   2620 C  CA    . GLU A 1 338 ? 18.187 15.598  -2.840  1.00 39.16 ? 335  GLU A CA    1 
ATOM   2621 C  C     . GLU A 1 338 ? 19.605 15.457  -2.283  1.00 32.55 ? 335  GLU A C     1 
ATOM   2622 O  O     . GLU A 1 338 ? 20.585 15.830  -2.937  1.00 27.99 ? 335  GLU A O     1 
ATOM   2623 C  CB    . GLU A 1 338 ? 17.556 16.890  -2.313  1.00 37.58 ? 335  GLU A CB    1 
ATOM   2624 C  CG    . GLU A 1 338 ? 16.267 17.293  -3.017  1.00 52.08 ? 335  GLU A CG    1 
ATOM   2625 C  CD    . GLU A 1 338 ? 16.507 17.855  -4.407  1.00 61.03 ? 335  GLU A CD    1 
ATOM   2626 O  OE1   . GLU A 1 338 ? 17.687 17.996  -4.794  1.00 49.53 ? 335  GLU A OE1   1 
ATOM   2627 O  OE2   . GLU A 1 338 ? 15.518 18.159  -5.111  1.00 60.31 ? 335  GLU A OE2   1 
ATOM   2628 N  N     . GLN A 1 339 ? 19.706 14.938  -1.065  1.00 30.94 ? 336  GLN A N     1 
ATOM   2629 C  CA    . GLN A 1 339 ? 21.004 14.668  -0.464  1.00 31.29 ? 336  GLN A CA    1 
ATOM   2630 C  C     . GLN A 1 339 ? 21.770 13.676  -1.322  1.00 29.09 ? 336  GLN A C     1 
ATOM   2631 O  O     . GLN A 1 339 ? 22.906 13.936  -1.724  1.00 25.55 ? 336  GLN A O     1 
ATOM   2632 C  CB    . GLN A 1 339 ? 20.835 14.074  0.927   1.00 31.68 ? 336  GLN A CB    1 
ATOM   2633 C  CG    . GLN A 1 339 ? 20.901 15.067  2.055   1.00 26.40 ? 336  GLN A CG    1 
ATOM   2634 C  CD    . GLN A 1 339 ? 20.917 14.369  3.390   1.00 23.00 ? 336  GLN A CD    1 
ATOM   2635 O  OE1   . GLN A 1 339 ? 20.082 13.506  3.660   1.00 26.31 ? 336  GLN A OE1   1 
ATOM   2636 N  NE2   . GLN A 1 339 ? 21.878 14.729  4.234   1.00 27.38 ? 336  GLN A NE2   1 
ATOM   2637 N  N     . VAL A 1 340 ? 21.137 12.536  -1.592  1.00 27.19 ? 337  VAL A N     1 
ATOM   2638 C  CA    . VAL A 1 340 ? 21.755 11.471  -2.374  1.00 28.92 ? 337  VAL A CA    1 
ATOM   2639 C  C     . VAL A 1 340 ? 22.239 11.993  -3.727  1.00 28.46 ? 337  VAL A C     1 
ATOM   2640 O  O     . VAL A 1 340 ? 23.321 11.632  -4.194  1.00 24.90 ? 337  VAL A O     1 
ATOM   2641 C  CB    . VAL A 1 340 ? 20.792 10.272  -2.568  1.00 32.63 ? 337  VAL A CB    1 
ATOM   2642 C  CG1   . VAL A 1 340 ? 21.416 9.209   -3.463  1.00 21.44 ? 337  VAL A CG1   1 
ATOM   2643 C  CG2   . VAL A 1 340 ? 20.429 9.665   -1.227  1.00 27.79 ? 337  VAL A CG2   1 
ATOM   2644 N  N     . GLN A 1 341 ? 21.447 12.858  -4.346  1.00 23.28 ? 338  GLN A N     1 
ATOM   2645 C  CA    . GLN A 1 341 ? 21.794 13.377  -5.662  1.00 23.78 ? 338  GLN A CA    1 
ATOM   2646 C  C     . GLN A 1 341 ? 22.925 14.389  -5.602  1.00 26.28 ? 338  GLN A C     1 
ATOM   2647 O  O     . GLN A 1 341 ? 23.783 14.423  -6.477  1.00 24.72 ? 338  GLN A O     1 
ATOM   2648 C  CB    . GLN A 1 341 ? 20.563 13.953  -6.361  1.00 31.70 ? 338  GLN A CB    1 
ATOM   2649 C  CG    . GLN A 1 341 ? 19.536 12.885  -6.680  1.00 30.80 ? 338  GLN A CG    1 
ATOM   2650 C  CD    . GLN A 1 341 ? 18.281 13.440  -7.321  1.00 43.14 ? 338  GLN A CD    1 
ATOM   2651 O  OE1   . GLN A 1 341 ? 17.948 14.615  -7.154  1.00 43.45 ? 338  GLN A OE1   1 
ATOM   2652 N  NE2   . GLN A 1 341 ? 17.577 12.591  -8.067  1.00 40.40 ? 338  GLN A NE2   1 
ATOM   2653 N  N     . TRP A 1 342 ? 22.935 15.205  -4.559  1.00 21.02 ? 339  TRP A N     1 
ATOM   2654 C  CA    . TRP A 1 342 ? 23.973 16.204  -4.415  1.00 19.58 ? 339  TRP A CA    1 
ATOM   2655 C  C     . TRP A 1 342 ? 25.331 15.537  -4.209  1.00 17.85 ? 339  TRP A C     1 
ATOM   2656 O  O     . TRP A 1 342 ? 26.327 15.947  -4.793  1.00 19.04 ? 339  TRP A O     1 
ATOM   2657 C  CB    . TRP A 1 342 ? 23.659 17.140  -3.246  1.00 18.65 ? 339  TRP A CB    1 
ATOM   2658 C  CG    . TRP A 1 342 ? 24.587 18.293  -3.213  1.00 22.37 ? 339  TRP A CG    1 
ATOM   2659 C  CD1   . TRP A 1 342 ? 24.539 19.403  -4.000  1.00 25.54 ? 339  TRP A CD1   1 
ATOM   2660 C  CD2   . TRP A 1 342 ? 25.734 18.441  -2.376  1.00 21.61 ? 339  TRP A CD2   1 
ATOM   2661 N  NE1   . TRP A 1 342 ? 25.579 20.243  -3.697  1.00 26.07 ? 339  TRP A NE1   1 
ATOM   2662 C  CE2   . TRP A 1 342 ? 26.330 19.674  -2.703  1.00 20.19 ? 339  TRP A CE2   1 
ATOM   2663 C  CE3   . TRP A 1 342 ? 26.317 17.650  -1.384  1.00 19.68 ? 339  TRP A CE3   1 
ATOM   2664 C  CZ2   . TRP A 1 342 ? 27.481 20.138  -2.070  1.00 26.86 ? 339  TRP A CZ2   1 
ATOM   2665 C  CZ3   . TRP A 1 342 ? 27.449 18.112  -0.753  1.00 23.01 ? 339  TRP A CZ3   1 
ATOM   2666 C  CH2   . TRP A 1 342 ? 28.026 19.342  -1.100  1.00 23.00 ? 339  TRP A CH2   1 
ATOM   2667 N  N     . TRP A 1 343 ? 25.364 14.505  -3.382  1.00 16.60 ? 340  TRP A N     1 
ATOM   2668 C  CA    . TRP A 1 343 ? 26.627 13.830  -3.099  1.00 17.50 ? 340  TRP A CA    1 
ATOM   2669 C  C     . TRP A 1 343 ? 27.107 12.969  -4.264  1.00 17.14 ? 340  TRP A C     1 
ATOM   2670 O  O     . TRP A 1 343 ? 28.307 12.874  -4.503  1.00 14.98 ? 340  TRP A O     1 
ATOM   2671 C  CB    . TRP A 1 343 ? 26.551 13.011  -1.812  1.00 17.79 ? 340  TRP A CB    1 
ATOM   2672 C  CG    . TRP A 1 343 ? 26.675 13.864  -0.576  1.00 16.50 ? 340  TRP A CG    1 
ATOM   2673 C  CD1   . TRP A 1 343 ? 25.677 14.201  0.293   1.00 20.79 ? 340  TRP A CD1   1 
ATOM   2674 C  CD2   . TRP A 1 343 ? 27.865 14.504  -0.090  1.00 14.55 ? 340  TRP A CD2   1 
ATOM   2675 N  NE1   . TRP A 1 343 ? 26.176 15.007  1.298   1.00 20.98 ? 340  TRP A NE1   1 
ATOM   2676 C  CE2   . TRP A 1 343 ? 27.516 15.205  1.083   1.00 15.49 ? 340  TRP A CE2   1 
ATOM   2677 C  CE3   . TRP A 1 343 ? 29.194 14.542  -0.530  1.00 15.15 ? 340  TRP A CE3   1 
ATOM   2678 C  CZ2   . TRP A 1 343 ? 28.448 15.933  1.826   1.00 16.08 ? 340  TRP A CZ2   1 
ATOM   2679 C  CZ3   . TRP A 1 343 ? 30.113 15.272  0.201   1.00 17.46 ? 340  TRP A CZ3   1 
ATOM   2680 C  CH2   . TRP A 1 343 ? 29.733 15.961  1.370   1.00 19.95 ? 340  TRP A CH2   1 
ATOM   2681 N  N     . LEU A 1 344 ? 26.186 12.348  -4.997  1.00 17.52 ? 341  LEU A N     1 
ATOM   2682 C  CA    . LEU A 1 344 ? 26.607 11.582  -6.165  1.00 17.15 ? 341  LEU A CA    1 
ATOM   2683 C  C     . LEU A 1 344 ? 27.278 12.531  -7.136  1.00 17.52 ? 341  LEU A C     1 
ATOM   2684 O  O     . LEU A 1 344 ? 28.243 12.166  -7.803  1.00 14.33 ? 341  LEU A O     1 
ATOM   2685 C  CB    . LEU A 1 344 ? 25.438 10.873  -6.860  1.00 15.77 ? 341  LEU A CB    1 
ATOM   2686 C  CG    . LEU A 1 344 ? 24.862 9.621   -6.195  1.00 20.11 ? 341  LEU A CG    1 
ATOM   2687 C  CD1   . LEU A 1 344 ? 23.592 9.211   -6.924  1.00 23.58 ? 341  LEU A CD1   1 
ATOM   2688 C  CD2   . LEU A 1 344 ? 25.857 8.465   -6.165  1.00 18.22 ? 341  LEU A CD2   1 
ATOM   2689 N  N     . LEU A 1 345 ? 26.763 13.754  -7.218  1.00 16.49 ? 342  LEU A N     1 
ATOM   2690 C  CA    . LEU A 1 345 ? 27.353 14.761  -8.084  1.00 13.83 ? 342  LEU A CA    1 
ATOM   2691 C  C     . LEU A 1 345 ? 28.750 15.163  -7.615  1.00 14.03 ? 342  LEU A C     1 
ATOM   2692 O  O     . LEU A 1 345 ? 29.661 15.314  -8.420  1.00 13.81 ? 342  LEU A O     1 
ATOM   2693 C  CB    . LEU A 1 345 ? 26.450 15.996  -8.186  1.00 19.05 ? 342  LEU A CB    1 
ATOM   2694 C  CG    . LEU A 1 345 ? 26.990 17.135  -9.050  1.00 16.94 ? 342  LEU A CG    1 
ATOM   2695 C  CD1   . LEU A 1 345 ? 27.284 16.659  -10.486 1.00 19.21 ? 342  LEU A CD1   1 
ATOM   2696 C  CD2   . LEU A 1 345 ? 26.010 18.306  -9.074  1.00 24.09 ? 342  LEU A CD2   1 
ATOM   2697 N  N     . GLN A 1 346 ? 28.914 15.343  -6.309  1.00 13.53 ? 343  GLN A N     1 
ATOM   2698 C  CA    . GLN A 1 346 ? 30.206 15.747  -5.785  1.00 13.07 ? 343  GLN A CA    1 
ATOM   2699 C  C     . GLN A 1 346 ? 31.230 14.680  -6.137  1.00 13.24 ? 343  GLN A C     1 
ATOM   2700 O  O     . GLN A 1 346 ? 32.327 14.995  -6.607  1.00 13.41 ? 343  GLN A O     1 
ATOM   2701 C  CB    . GLN A 1 346 ? 30.173 15.918  -4.264  1.00 17.07 ? 343  GLN A CB    1 
ATOM   2702 C  CG    . GLN A 1 346 ? 29.190 16.965  -3.762  1.00 17.17 ? 343  GLN A CG    1 
ATOM   2703 C  CD    . GLN A 1 346 ? 29.144 18.195  -4.638  1.00 18.89 ? 343  GLN A CD    1 
ATOM   2704 O  OE1   . GLN A 1 346 ? 30.105 18.964  -4.708  1.00 20.41 ? 343  GLN A OE1   1 
ATOM   2705 N  NE2   . GLN A 1 346 ? 28.016 18.389  -5.324  1.00 16.41 ? 343  GLN A NE2   1 
ATOM   2706 N  N     . LEU A 1 347 ? 30.855 13.427  -5.899  1.00 17.45 ? 344  LEU A N     1 
ATOM   2707 C  CA    . LEU A 1 347 ? 31.721 12.287  -6.205  1.00 13.55 ? 344  LEU A CA    1 
ATOM   2708 C  C     . LEU A 1 347 ? 32.033 12.237  -7.701  1.00 13.11 ? 344  LEU A C     1 
ATOM   2709 O  O     . LEU A 1 347 ? 33.177 12.016  -8.092  1.00 12.97 ? 344  LEU A O     1 
ATOM   2710 C  CB    . LEU A 1 347 ? 31.094 10.967  -5.740  1.00 10.55 ? 344  LEU A CB    1 
ATOM   2711 C  CG    . LEU A 1 347 ? 31.253 10.632  -4.250  1.00 18.31 ? 344  LEU A CG    1 
ATOM   2712 C  CD1   . LEU A 1 347 ? 30.694 9.260   -3.925  1.00 23.58 ? 344  LEU A CD1   1 
ATOM   2713 C  CD2   . LEU A 1 347 ? 32.697 10.708  -3.853  1.00 20.64 ? 344  LEU A CD2   1 
ATOM   2714 N  N     . ALA A 1 348 ? 31.011 12.456  -8.524  1.00 12.65 ? 345  ALA A N     1 
ATOM   2715 C  CA    . ALA A 1 348 ? 31.158 12.375  -9.977  1.00 13.28 ? 345  ALA A CA    1 
ATOM   2716 C  C     . ALA A 1 348 ? 32.075 13.459  -10.502 1.00 15.86 ? 345  ALA A C     1 
ATOM   2717 O  O     . ALA A 1 348 ? 32.805 13.260  -11.471 1.00 14.73 ? 345  ALA A O     1 
ATOM   2718 C  CB    . ALA A 1 348 ? 29.802 12.489  -10.651 1.00 12.37 ? 345  ALA A CB    1 
ATOM   2719 N  N     . GLN A 1 349 ? 32.014 14.626  -9.873  1.00 12.07 ? 346  GLN A N     1 
ATOM   2720 C  CA    . GLN A 1 349 ? 32.865 15.728  -10.265 1.00 10.74 ? 346  GLN A CA    1 
ATOM   2721 C  C     . GLN A 1 349 ? 34.335 15.434  -9.962  1.00 13.21 ? 346  GLN A C     1 
ATOM   2722 O  O     . GLN A 1 349 ? 35.204 15.756  -10.765 1.00 13.51 ? 346  GLN A O     1 
ATOM   2723 C  CB    . GLN A 1 349 ? 32.416 17.026  -9.603  1.00 14.78 ? 346  GLN A CB    1 
ATOM   2724 C  CG    . GLN A 1 349 ? 31.061 17.502  -10.136 1.00 17.83 ? 346  GLN A CG    1 
ATOM   2725 C  CD    . GLN A 1 349 ? 30.607 18.822  -9.534  1.00 25.62 ? 346  GLN A CD    1 
ATOM   2726 O  OE1   . GLN A 1 349 ? 31.219 19.338  -8.606  1.00 32.26 ? 346  GLN A OE1   1 
ATOM   2727 N  NE2   . GLN A 1 349 ? 29.526 19.373  -10.071 1.00 30.78 ? 346  GLN A NE2   1 
ATOM   2728 N  N     . GLU A 1 350 ? 34.610 14.827  -8.812  1.00 11.14 ? 347  GLU A N     1 
ATOM   2729 C  CA    . GLU A 1 350 ? 35.990 14.459  -8.511  1.00 11.43 ? 347  GLU A CA    1 
ATOM   2730 C  C     . GLU A 1 350 ? 36.457 13.383  -9.492  1.00 10.77 ? 347  GLU A C     1 
ATOM   2731 O  O     . GLU A 1 350 ? 37.572 13.450  -10.002 1.00 14.81 ? 347  GLU A O     1 
ATOM   2732 C  CB    . GLU A 1 350 ? 36.189 13.982  -7.061  1.00 11.64 ? 347  GLU A CB    1 
ATOM   2733 C  CG    . GLU A 1 350 ? 37.671 13.648  -6.790  1.00 16.05 ? 347  GLU A CG    1 
ATOM   2734 C  CD    . GLU A 1 350 ? 37.940 13.003  -5.439  1.00 18.97 ? 347  GLU A CD    1 
ATOM   2735 O  OE1   . GLU A 1 350 ? 37.303 13.383  -4.431  1.00 18.86 ? 347  GLU A OE1   1 
ATOM   2736 O  OE2   . GLU A 1 350 ? 38.810 12.113  -5.382  1.00 18.35 ? 347  GLU A OE2   1 
ATOM   2737 N  N     . LEU A 1 351 ? 35.592 12.408  -9.751  1.00 11.08 ? 348  LEU A N     1 
ATOM   2738 C  CA    . LEU A 1 351 ? 35.914 11.310  -10.658 1.00 12.55 ? 348  LEU A CA    1 
ATOM   2739 C  C     . LEU A 1 351 ? 36.172 11.836  -12.069 1.00 11.28 ? 348  LEU A C     1 
ATOM   2740 O  O     . LEU A 1 351 ? 37.133 11.430  -12.731 1.00 12.20 ? 348  LEU A O     1 
ATOM   2741 C  CB    . LEU A 1 351 ? 34.787 10.279  -10.678 1.00 13.62 ? 348  LEU A CB    1 
ATOM   2742 C  CG    . LEU A 1 351 ? 35.034 8.974   -11.449 1.00 14.43 ? 348  LEU A CG    1 
ATOM   2743 C  CD1   . LEU A 1 351 ? 36.317 8.286   -10.956 1.00 16.38 ? 348  LEU A CD1   1 
ATOM   2744 C  CD2   . LEU A 1 351 ? 33.835 8.041   -11.346 1.00 17.81 ? 348  LEU A CD2   1 
ATOM   2745 N  N     . GLU A 1 352 ? 35.312 12.737  -12.542 1.00 11.85 ? 349  GLU A N     1 
ATOM   2746 C  CA    . GLU A 1 352 ? 35.509 13.311  -13.874 1.00 15.26 ? 349  GLU A CA    1 
ATOM   2747 C  C     . GLU A 1 352 ? 36.882 13.958  -13.979 1.00 13.24 ? 349  GLU A C     1 
ATOM   2748 O  O     . GLU A 1 352 ? 37.595 13.800  -14.971 1.00 15.39 ? 349  GLU A O     1 
ATOM   2749 C  CB    . GLU A 1 352 ? 34.443 14.367  -14.186 1.00 14.19 ? 349  GLU A CB    1 
ATOM   2750 C  CG    . GLU A 1 352 ? 34.625 14.958  -15.586 1.00 20.07 ? 349  GLU A CG    1 
ATOM   2751 C  CD    . GLU A 1 352 ? 33.676 16.099  -15.894 1.00 37.81 ? 349  GLU A CD    1 
ATOM   2752 O  OE1   . GLU A 1 352 ? 34.058 16.976  -16.701 1.00 46.94 ? 349  GLU A OE1   1 
ATOM   2753 O  OE2   . GLU A 1 352 ? 32.550 16.117  -15.349 1.00 27.46 ? 349  GLU A OE2   1 
ATOM   2754 N  N     . GLU A 1 353 ? 37.231 14.714  -12.947 1.00 12.34 ? 350  GLU A N     1 
ATOM   2755 C  CA    . GLU A 1 353 ? 38.497 15.421  -12.900 1.00 11.18 ? 350  GLU A CA    1 
ATOM   2756 C  C     . GLU A 1 353 ? 39.656 14.433  -12.993 1.00 13.57 ? 350  GLU A C     1 
ATOM   2757 O  O     . GLU A 1 353 ? 40.604 14.617  -13.767 1.00 15.01 ? 350  GLU A O     1 
ATOM   2758 C  CB    . GLU A 1 353 ? 38.574 16.221  -11.595 1.00 19.60 ? 350  GLU A CB    1 
ATOM   2759 C  CG    . GLU A 1 353 ? 39.803 17.090  -11.446 1.00 28.36 ? 350  GLU A CG    1 
ATOM   2760 C  CD    . GLU A 1 353 ? 39.710 17.988  -10.226 1.00 41.00 ? 350  GLU A CD    1 
ATOM   2761 O  OE1   . GLU A 1 353 ? 39.492 17.458  -9.114  1.00 44.31 ? 350  GLU A OE1   1 
ATOM   2762 O  OE2   . GLU A 1 353 ? 39.833 19.221  -10.383 1.00 42.02 ? 350  GLU A OE2   1 
ATOM   2763 N  N     . ARG A 1 354 ? 39.581 13.375  -12.200 1.00 12.70 ? 351  ARG A N     1 
ATOM   2764 C  CA    . ARG A 1 354 ? 40.649 12.380  -12.218 1.00 12.83 ? 351  ARG A CA    1 
ATOM   2765 C  C     . ARG A 1 354 ? 40.722 11.608  -13.535 1.00 14.00 ? 351  ARG A C     1 
ATOM   2766 O  O     . ARG A 1 354 ? 41.816 11.344  -14.042 1.00 13.35 ? 351  ARG A O     1 
ATOM   2767 C  CB    . ARG A 1 354 ? 40.534 11.443  -11.023 1.00 11.99 ? 351  ARG A CB    1 
ATOM   2768 C  CG    A ARG A 1 354 ? 41.013 12.137  -9.746  0.50 12.72 ? 351  ARG A CG    1 
ATOM   2769 C  CG    B ARG A 1 354 ? 40.915 12.036  -9.665  0.50 12.85 ? 351  ARG A CG    1 
ATOM   2770 C  CD    A ARG A 1 354 ? 40.506 11.447  -8.511  0.50 14.08 ? 351  ARG A CD    1 
ATOM   2771 C  CD    B ARG A 1 354 ? 40.844 10.944  -8.593  0.50 13.88 ? 351  ARG A CD    1 
ATOM   2772 N  NE    A ARG A 1 354 ? 40.997 10.080  -8.434  0.50 10.01 ? 351  ARG A NE    1 
ATOM   2773 N  NE    B ARG A 1 354 ? 41.760 9.850   -8.902  0.50 13.02 ? 351  ARG A NE    1 
ATOM   2774 C  CZ    A ARG A 1 354 ? 40.605 9.201   -7.523  0.50 12.64 ? 351  ARG A CZ    1 
ATOM   2775 C  CZ    B ARG A 1 354 ? 41.772 8.661   -8.304  0.50 14.17 ? 351  ARG A CZ    1 
ATOM   2776 N  NH1   A ARG A 1 354 ? 39.711 9.547   -6.600  0.50 7.67  ? 351  ARG A NH1   1 
ATOM   2777 N  NH1   B ARG A 1 354 ? 40.902 8.372   -7.352  0.50 13.93 ? 351  ARG A NH1   1 
ATOM   2778 N  NH2   A ARG A 1 354 ? 41.112 7.973   -7.543  0.50 10.92 ? 351  ARG A NH2   1 
ATOM   2779 N  NH2   B ARG A 1 354 ? 42.662 7.751   -8.670  0.50 15.11 ? 351  ARG A NH2   1 
ATOM   2780 N  N     . LEU A 1 355 ? 39.564 11.252  -14.084 1.00 13.11 ? 352  LEU A N     1 
ATOM   2781 C  CA    . LEU A 1 355 ? 39.504 10.517  -15.348 1.00 13.41 ? 352  LEU A CA    1 
ATOM   2782 C  C     . LEU A 1 355 ? 40.052 11.338  -16.508 1.00 14.82 ? 352  LEU A C     1 
ATOM   2783 O  O     . LEU A 1 355 ? 40.784 10.820  -17.355 1.00 15.35 ? 352  LEU A O     1 
ATOM   2784 C  CB    . LEU A 1 355 ? 38.071 10.081  -15.653 1.00 13.10 ? 352  LEU A CB    1 
ATOM   2785 C  CG    . LEU A 1 355 ? 37.517 8.889   -14.871 1.00 12.34 ? 352  LEU A CG    1 
ATOM   2786 C  CD1   . LEU A 1 355 ? 36.033 8.714   -15.165 1.00 15.24 ? 352  LEU A CD1   1 
ATOM   2787 C  CD2   . LEU A 1 355 ? 38.287 7.602   -15.212 1.00 14.08 ? 352  LEU A CD2   1 
ATOM   2788 N  N     . THR A 1 356 ? 39.682 12.614  -16.565 1.00 12.69 ? 353  THR A N     1 
ATOM   2789 C  CA    . THR A 1 356 ? 40.152 13.462  -17.650 1.00 14.16 ? 353  THR A CA    1 
ATOM   2790 C  C     . THR A 1 356 ? 41.675 13.587  -17.639 1.00 17.34 ? 353  THR A C     1 
ATOM   2791 O  O     . THR A 1 356 ? 42.329 13.482  -18.683 1.00 16.48 ? 353  THR A O     1 
ATOM   2792 C  CB    . THR A 1 356 ? 39.450 14.829  -17.628 1.00 18.75 ? 353  THR A CB    1 
ATOM   2793 O  OG1   . THR A 1 356 ? 38.048 14.615  -17.823 1.00 18.33 ? 353  THR A OG1   1 
ATOM   2794 C  CG2   . THR A 1 356 ? 39.971 15.716  -18.731 1.00 19.14 ? 353  THR A CG2   1 
ATOM   2795 N  N     . LYS A 1 357 ? 42.242 13.792  -16.456 1.00 18.37 ? 354  LYS A N     1 
ATOM   2796 C  CA    . LYS A 1 357 ? 43.685 13.836  -16.303 1.00 12.61 ? 354  LYS A CA    1 
ATOM   2797 C  C     . LYS A 1 357 ? 44.293 12.495  -16.709 1.00 13.54 ? 354  LYS A C     1 
ATOM   2798 O  O     . LYS A 1 357 ? 45.311 12.445  -17.408 1.00 15.67 ? 354  LYS A O     1 
ATOM   2799 C  CB    . LYS A 1 357 ? 44.050 14.149  -14.850 1.00 19.08 ? 354  LYS A CB    1 
ATOM   2800 C  CG    . LYS A 1 357 ? 45.540 14.144  -14.552 1.00 26.66 ? 354  LYS A CG    1 
ATOM   2801 C  CD    . LYS A 1 357 ? 46.241 15.264  -15.295 1.00 34.31 ? 354  LYS A CD    1 
ATOM   2802 C  CE    . LYS A 1 357 ? 47.388 15.832  -14.476 1.00 43.36 ? 354  LYS A CE    1 
ATOM   2803 N  NZ    . LYS A 1 357 ? 48.324 14.766  -14.044 1.00 33.29 ? 354  LYS A NZ    1 
ATOM   2804 N  N     . ASP A 1 358 ? 43.671 11.400  -16.275 1.00 13.34 ? 355  ASP A N     1 
ATOM   2805 C  CA    . ASP A 1 358 ? 44.184 10.070  -16.605 1.00 14.73 ? 355  ASP A CA    1 
ATOM   2806 C  C     . ASP A 1 358 ? 44.211 9.825   -18.116 1.00 15.90 ? 355  ASP A C     1 
ATOM   2807 O  O     . ASP A 1 358 ? 45.175 9.269   -18.633 1.00 18.20 ? 355  ASP A O     1 
ATOM   2808 C  CB    . ASP A 1 358 ? 43.389 8.965   -15.893 1.00 11.74 ? 355  ASP A CB    1 
ATOM   2809 C  CG    . ASP A 1 358 ? 43.920 7.579   -16.199 1.00 19.76 ? 355  ASP A CG    1 
ATOM   2810 O  OD1   . ASP A 1 358 ? 44.953 7.201   -15.610 1.00 16.05 ? 355  ASP A OD1   1 
ATOM   2811 O  OD2   . ASP A 1 358 ? 43.306 6.875   -17.027 1.00 17.61 ? 355  ASP A OD2   1 
ATOM   2812 N  N     . ARG A 1 359 ? 43.156 10.234  -18.820 1.00 13.27 ? 356  ARG A N     1 
ATOM   2813 C  CA    . ARG A 1 359 ? 43.095 10.050  -20.268 1.00 14.57 ? 356  ARG A CA    1 
ATOM   2814 C  C     . ARG A 1 359 ? 44.228 10.796  -20.976 1.00 12.22 ? 356  ARG A C     1 
ATOM   2815 O  O     . ARG A 1 359 ? 44.831 10.285  -21.922 1.00 15.38 ? 356  ARG A O     1 
ATOM   2816 C  CB    . ARG A 1 359 ? 41.731 10.520  -20.812 1.00 16.26 ? 356  ARG A CB    1 
ATOM   2817 C  CG    . ARG A 1 359 ? 41.472 10.188  -22.284 1.00 18.22 ? 356  ARG A CG    1 
ATOM   2818 C  CD    . ARG A 1 359 ? 40.085 10.679  -22.722 1.00 23.52 ? 356  ARG A CD    1 
ATOM   2819 N  NE    . ARG A 1 359 ? 39.991 12.139  -22.669 1.00 25.29 ? 356  ARG A NE    1 
ATOM   2820 C  CZ    . ARG A 1 359 ? 38.890 12.834  -22.381 1.00 26.65 ? 356  ARG A CZ    1 
ATOM   2821 N  NH1   . ARG A 1 359 ? 37.748 12.216  -22.107 1.00 27.57 ? 356  ARG A NH1   1 
ATOM   2822 N  NH2   . ARG A 1 359 ? 38.934 14.162  -22.369 1.00 25.00 ? 356  ARG A NH2   1 
ATOM   2823 N  N     . ASN A 1 360 ? 44.521 12.008  -20.519 1.00 14.87 ? 357  ASN A N     1 
ATOM   2824 C  CA    . ASN A 1 360 ? 45.585 12.812  -21.121 1.00 15.52 ? 357  ASN A CA    1 
ATOM   2825 C  C     . ASN A 1 360 ? 46.985 12.270  -20.817 1.00 20.42 ? 357  ASN A C     1 
ATOM   2826 O  O     . ASN A 1 360 ? 47.864 12.268  -21.680 1.00 20.09 ? 357  ASN A O     1 
ATOM   2827 C  CB    . ASN A 1 360 ? 45.481 14.260  -20.643 1.00 17.02 ? 357  ASN A CB    1 
ATOM   2828 C  CG    . ASN A 1 360 ? 44.327 15.002  -21.284 1.00 22.11 ? 357  ASN A CG    1 
ATOM   2829 O  OD1   . ASN A 1 360 ? 43.957 14.741  -22.431 1.00 24.39 ? 357  ASN A OD1   1 
ATOM   2830 N  ND2   . ASN A 1 360 ? 43.754 15.935  -20.546 1.00 21.78 ? 357  ASN A ND2   1 
ATOM   2831 N  N     . ASP A 1 361 ? 47.188 11.816  -19.582 1.00 13.65 ? 358  ASP A N     1 
ATOM   2832 C  CA    . ASP A 1 361 ? 48.496 11.322  -19.155 1.00 17.74 ? 358  ASP A CA    1 
ATOM   2833 C  C     . ASP A 1 361 ? 48.815 9.947   -19.700 1.00 14.91 ? 358  ASP A C     1 
ATOM   2834 O  O     . ASP A 1 361 ? 49.951 9.670   -20.084 1.00 14.70 ? 358  ASP A O     1 
ATOM   2835 C  CB    . ASP A 1 361 ? 48.585 11.257  -17.625 1.00 17.41 ? 358  ASP A CB    1 
ATOM   2836 C  CG    . ASP A 1 361 ? 48.696 12.626  -16.984 1.00 28.23 ? 358  ASP A CG    1 
ATOM   2837 O  OD1   . ASP A 1 361 ? 48.909 13.625  -17.710 1.00 24.05 ? 358  ASP A OD1   1 
ATOM   2838 O  OD2   . ASP A 1 361 ? 48.586 12.694  -15.742 1.00 27.97 ? 358  ASP A OD2   1 
ATOM   2839 N  N     . ASN A 1 362 ? 47.804 9.090   -19.729 1.00 14.83 ? 359  ASN A N     1 
ATOM   2840 C  CA    . ASN A 1 362 ? 48.031 7.657   -19.879 1.00 16.79 ? 359  ASN A CA    1 
ATOM   2841 C  C     . ASN A 1 362 ? 47.419 7.007   -21.117 1.00 16.29 ? 359  ASN A C     1 
ATOM   2842 O  O     . ASN A 1 362 ? 47.498 5.797   -21.266 1.00 18.40 ? 359  ASN A O     1 
ATOM   2843 C  CB    . ASN A 1 362 ? 47.589 6.928   -18.594 1.00 13.26 ? 359  ASN A CB    1 
ATOM   2844 C  CG    . ASN A 1 362 ? 48.370 7.397   -17.368 1.00 17.83 ? 359  ASN A CG    1 
ATOM   2845 O  OD1   . ASN A 1 362 ? 49.584 7.526   -17.422 1.00 15.36 ? 359  ASN A OD1   1 
ATOM   2846 N  ND2   . ASN A 1 362 ? 47.672 7.660   -16.267 1.00 12.96 ? 359  ASN A ND2   1 
ATOM   2847 N  N     . ASP A 1 363 ? 46.819 7.803   -22.003 1.00 16.36 ? 360  ASP A N     1 
ATOM   2848 C  CA    . ASP A 1 363 ? 46.309 7.286   -23.282 1.00 16.37 ? 360  ASP A CA    1 
ATOM   2849 C  C     . ASP A 1 363 ? 45.364 6.104   -23.135 1.00 23.05 ? 360  ASP A C     1 
ATOM   2850 O  O     . ASP A 1 363 ? 45.534 5.070   -23.791 1.00 21.21 ? 360  ASP A O     1 
ATOM   2851 C  CB    . ASP A 1 363 ? 47.470 6.881   -24.190 1.00 20.83 ? 360  ASP A CB    1 
ATOM   2852 C  CG    . ASP A 1 363 ? 48.348 8.052   -24.554 1.00 25.17 ? 360  ASP A CG    1 
ATOM   2853 O  OD1   . ASP A 1 363 ? 47.799 9.090   -24.982 1.00 23.14 ? 360  ASP A OD1   1 
ATOM   2854 O  OD2   . ASP A 1 363 ? 49.582 7.937   -24.402 1.00 28.17 ? 360  ASP A OD2   1 
ATOM   2855 N  N     . ARG A 1 364 ? 44.365 6.257   -22.274 1.00 22.90 ? 361  ARG A N     1 
ATOM   2856 C  CA    . ARG A 1 364 ? 43.380 5.211   -22.048 1.00 19.10 ? 361  ARG A CA    1 
ATOM   2857 C  C     . ARG A 1 364 ? 42.070 5.852   -21.616 1.00 15.69 ? 361  ARG A C     1 
ATOM   2858 O  O     . ARG A 1 364 ? 42.063 6.992   -21.154 1.00 18.10 ? 361  ARG A O     1 
ATOM   2859 C  CB    . ARG A 1 364 ? 43.863 4.232   -20.971 1.00 19.78 ? 361  ARG A CB    1 
ATOM   2860 C  CG    . ARG A 1 364 ? 44.175 4.893   -19.631 1.00 15.47 ? 361  ARG A CG    1 
ATOM   2861 C  CD    . ARG A 1 364 ? 44.666 3.872   -18.603 1.00 14.60 ? 361  ARG A CD    1 
ATOM   2862 N  NE    . ARG A 1 364 ? 44.665 4.414   -17.246 1.00 17.43 ? 361  ARG A NE    1 
ATOM   2863 C  CZ    . ARG A 1 364 ? 44.898 3.688   -16.153 1.00 22.02 ? 361  ARG A CZ    1 
ATOM   2864 N  NH1   . ARG A 1 364 ? 44.875 4.250   -14.949 1.00 15.02 ? 361  ARG A NH1   1 
ATOM   2865 N  NH2   . ARG A 1 364 ? 45.160 2.399   -16.259 1.00 17.19 ? 361  ARG A NH2   1 
ATOM   2866 N  N     . VAL A 1 365 ? 40.979 5.115   -21.785 1.00 18.51 ? 362  VAL A N     1 
ATOM   2867 C  CA    . VAL A 1 365 ? 39.645 5.544   -21.375 1.00 18.89 ? 362  VAL A CA    1 
ATOM   2868 C  C     . VAL A 1 365 ? 38.898 4.423   -20.654 1.00 21.09 ? 362  VAL A C     1 
ATOM   2869 O  O     . VAL A 1 365 ? 38.852 3.282   -21.118 1.00 16.32 ? 362  VAL A O     1 
ATOM   2870 C  CB    . VAL A 1 365 ? 38.800 5.990   -22.588 1.00 20.42 ? 362  VAL A CB    1 
ATOM   2871 C  CG1   . VAL A 1 365 ? 39.236 7.368   -23.069 1.00 30.35 ? 362  VAL A CG1   1 
ATOM   2872 C  CG2   . VAL A 1 365 ? 38.896 4.972   -23.717 1.00 30.21 ? 362  VAL A CG2   1 
ATOM   2873 N  N     . ALA A 1 366 ? 38.294 4.757   -19.521 1.00 17.29 ? 363  ALA A N     1 
ATOM   2874 C  CA    . ALA A 1 366 ? 37.464 3.817   -18.786 1.00 16.90 ? 363  ALA A CA    1 
ATOM   2875 C  C     . ALA A 1 366 ? 36.128 3.581   -19.498 1.00 17.38 ? 363  ALA A C     1 
ATOM   2876 O  O     . ALA A 1 366 ? 35.558 4.503   -20.086 1.00 20.63 ? 363  ALA A O     1 
ATOM   2877 C  CB    . ALA A 1 366 ? 37.227 4.342   -17.377 1.00 12.96 ? 363  ALA A CB    1 
ATOM   2878 N  N     . THR A 1 367 ? 35.616 2.357   -19.436 1.00 17.94 ? 364  THR A N     1 
ATOM   2879 C  CA    . THR A 1 367 ? 34.388 2.037   -20.161 1.00 17.67 ? 364  THR A CA    1 
ATOM   2880 C  C     . THR A 1 367 ? 33.207 1.591   -19.297 1.00 20.27 ? 364  THR A C     1 
ATOM   2881 O  O     . THR A 1 367 ? 32.090 1.463   -19.786 1.00 19.75 ? 364  THR A O     1 
ATOM   2882 C  CB    . THR A 1 367 ? 34.652 0.988   -21.271 1.00 19.98 ? 364  THR A CB    1 
ATOM   2883 O  OG1   . THR A 1 367 ? 34.964 -0.277  -20.678 1.00 20.50 ? 364  THR A OG1   1 
ATOM   2884 C  CG2   . THR A 1 367 ? 35.829 1.435   -22.131 1.00 18.42 ? 364  THR A CG2   1 
ATOM   2885 N  N     . GLN A 1 368 ? 33.453 1.354   -18.014 1.00 20.72 ? 365  GLN A N     1 
ATOM   2886 C  CA    . GLN A 1 368 ? 32.401 0.903   -17.116 1.00 22.60 ? 365  GLN A CA    1 
ATOM   2887 C  C     . GLN A 1 368 ? 32.403 1.755   -15.852 1.00 22.71 ? 365  GLN A C     1 
ATOM   2888 O  O     . GLN A 1 368 ? 33.457 2.119   -15.348 1.00 18.78 ? 365  GLN A O     1 
ATOM   2889 C  CB    . GLN A 1 368 ? 32.604 -0.567  -16.748 1.00 22.25 ? 365  GLN A CB    1 
ATOM   2890 C  CG    . GLN A 1 368 ? 31.504 -1.149  -15.891 1.00 25.21 ? 365  GLN A CG    1 
ATOM   2891 C  CD    . GLN A 1 368 ? 31.597 -2.659  -15.783 1.00 31.91 ? 365  GLN A CD    1 
ATOM   2892 O  OE1   . GLN A 1 368 ? 32.371 -3.188  -14.988 1.00 38.90 ? 365  GLN A OE1   1 
ATOM   2893 N  NE2   . GLN A 1 368 ? 30.808 -3.360  -16.587 1.00 34.71 ? 365  GLN A NE2   1 
ATOM   2894 N  N     . LEU A 1 369 ? 31.214 2.083   -15.365 1.00 19.25 ? 366  LEU A N     1 
ATOM   2895 C  CA    . LEU A 1 369 ? 31.067 2.811   -14.105 1.00 20.60 ? 366  LEU A CA    1 
ATOM   2896 C  C     . LEU A 1 369 ? 30.418 1.879   -13.088 1.00 21.11 ? 366  LEU A C     1 
ATOM   2897 O  O     . LEU A 1 369 ? 29.350 1.321   -13.343 1.00 19.23 ? 366  LEU A O     1 
ATOM   2898 C  CB    . LEU A 1 369 ? 30.197 4.058   -14.306 1.00 15.16 ? 366  LEU A CB    1 
ATOM   2899 C  CG    . LEU A 1 369 ? 29.947 4.875   -13.034 1.00 19.82 ? 366  LEU A CG    1 
ATOM   2900 C  CD1   . LEU A 1 369 ? 31.230 5.597   -12.618 1.00 20.21 ? 366  LEU A CD1   1 
ATOM   2901 C  CD2   . LEU A 1 369 ? 28.805 5.866   -13.236 1.00 27.71 ? 366  LEU A CD2   1 
ATOM   2902 N  N     . VAL A 1 370 ? 31.078 1.691   -11.949 1.00 14.68 ? 367  VAL A N     1 
ATOM   2903 C  CA    . VAL A 1 370 ? 30.559 0.847   -10.887 1.00 18.28 ? 367  VAL A CA    1 
ATOM   2904 C  C     . VAL A 1 370 ? 30.031 1.724   -9.759  1.00 19.79 ? 367  VAL A C     1 
ATOM   2905 O  O     . VAL A 1 370 ? 30.723 2.630   -9.303  1.00 17.94 ? 367  VAL A O     1 
ATOM   2906 C  CB    . VAL A 1 370 ? 31.669 -0.073  -10.334 1.00 19.02 ? 367  VAL A CB    1 
ATOM   2907 C  CG1   . VAL A 1 370 ? 31.179 -0.839  -9.110  1.00 21.19 ? 367  VAL A CG1   1 
ATOM   2908 C  CG2   . VAL A 1 370 ? 32.158 -1.014  -11.423 1.00 25.04 ? 367  VAL A CG2   1 
ATOM   2909 N  N     . VAL A 1 371 ? 28.810 1.444   -9.310  1.00 17.50 ? 368  VAL A N     1 
ATOM   2910 C  CA    . VAL A 1 371 ? 28.167 2.245   -8.274  1.00 15.47 ? 368  VAL A CA    1 
ATOM   2911 C  C     . VAL A 1 371 ? 27.883 1.351   -7.093  1.00 17.14 ? 368  VAL A C     1 
ATOM   2912 O  O     . VAL A 1 371 ? 27.282 0.291   -7.238  1.00 18.50 ? 368  VAL A O     1 
ATOM   2913 C  CB    . VAL A 1 371 ? 26.841 2.838   -8.771  1.00 20.95 ? 368  VAL A CB    1 
ATOM   2914 C  CG1   . VAL A 1 371 ? 26.245 3.783   -7.719  1.00 17.62 ? 368  VAL A CG1   1 
ATOM   2915 C  CG2   . VAL A 1 371 ? 27.048 3.547   -10.104 1.00 18.95 ? 368  VAL A CG2   1 
ATOM   2916 N  N     . SER A 1 372 ? 28.343 1.757   -5.917  1.00 16.45 ? 369  SER A N     1 
ATOM   2917 C  CA    . SER A 1 372 ? 28.157 0.937   -4.731  1.00 16.48 ? 369  SER A CA    1 
ATOM   2918 C  C     . SER A 1 372 ? 27.630 1.805   -3.600  1.00 18.84 ? 369  SER A C     1 
ATOM   2919 O  O     . SER A 1 372 ? 27.970 2.985   -3.510  1.00 15.98 ? 369  SER A O     1 
ATOM   2920 C  CB    . SER A 1 372 ? 29.480 0.284   -4.326  1.00 19.05 ? 369  SER A CB    1 
ATOM   2921 O  OG    . SER A 1 372 ? 29.326 -0.483  -3.146  1.00 29.76 ? 369  SER A OG    1 
ATOM   2922 N  N     . ILE A 1 373 ? 26.765 1.231   -2.771  1.00 20.10 ? 370  ILE A N     1 
ATOM   2923 C  CA    . ILE A 1 373 ? 26.229 1.943   -1.617  1.00 18.59 ? 370  ILE A CA    1 
ATOM   2924 C  C     . ILE A 1 373 ? 26.182 1.048   -0.387  1.00 22.93 ? 370  ILE A C     1 
ATOM   2925 O  O     . ILE A 1 373 ? 26.263 -0.175  -0.487  1.00 19.30 ? 370  ILE A O     1 
ATOM   2926 C  CB    . ILE A 1 373 ? 24.809 2.513   -1.878  1.00 20.58 ? 370  ILE A CB    1 
ATOM   2927 C  CG1   . ILE A 1 373 ? 23.795 1.379   -2.061  1.00 29.69 ? 370  ILE A CG1   1 
ATOM   2928 C  CG2   . ILE A 1 373 ? 24.808 3.490   -3.070  1.00 15.25 ? 370  ILE A CG2   1 
ATOM   2929 C  CD1   . ILE A 1 373 ? 22.362 1.854   -2.192  1.00 31.16 ? 370  ILE A CD1   1 
ATOM   2930 N  N     . ARG A 1 374 ? 26.065 1.670   0.781   1.00 23.21 ? 371  ARG A N     1 
ATOM   2931 C  CA    . ARG A 1 374 ? 25.804 0.934   2.007   1.00 25.03 ? 371  ARG A CA    1 
ATOM   2932 C  C     . ARG A 1 374 ? 24.538 1.510   2.622   1.00 31.35 ? 371  ARG A C     1 
ATOM   2933 O  O     . ARG A 1 374 ? 24.302 2.722   2.560   1.00 25.36 ? 371  ARG A O     1 
ATOM   2934 C  CB    . ARG A 1 374 ? 26.979 1.046   2.976   1.00 26.88 ? 371  ARG A CB    1 
ATOM   2935 C  CG    . ARG A 1 374 ? 26.927 0.068   4.144   1.00 33.38 ? 371  ARG A CG    1 
ATOM   2936 C  CD    . ARG A 1 374 ? 28.035 0.366   5.136   1.00 37.14 ? 371  ARG A CD    1 
ATOM   2937 N  NE    . ARG A 1 374 ? 28.091 -0.605  6.225   1.00 48.18 ? 371  ARG A NE    1 
ATOM   2938 C  CZ    . ARG A 1 374 ? 28.899 -0.495  7.274   1.00 50.43 ? 371  ARG A CZ    1 
ATOM   2939 N  NH1   . ARG A 1 374 ? 29.714 0.547   7.380   1.00 43.89 ? 371  ARG A NH1   1 
ATOM   2940 N  NH2   . ARG A 1 374 ? 28.890 -1.423  8.221   1.00 56.03 ? 371  ARG A NH2   1 
ATOM   2941 N  N     . VAL A 1 375 ? 23.705 0.635   3.176   1.00 28.68 ? 372  VAL A N     1 
ATOM   2942 C  CA    . VAL A 1 375 ? 22.504 1.072   3.872   1.00 32.83 ? 372  VAL A CA    1 
ATOM   2943 C  C     . VAL A 1 375 ? 22.710 0.933   5.373   1.00 26.79 ? 372  VAL A C     1 
ATOM   2944 O  O     . VAL A 1 375 ? 23.404 0.025   5.832   1.00 28.32 ? 372  VAL A O     1 
ATOM   2945 C  CB    . VAL A 1 375 ? 21.278 0.256   3.443   1.00 38.68 ? 372  VAL A CB    1 
ATOM   2946 C  CG1   . VAL A 1 375 ? 20.906 0.583   2.010   1.00 40.00 ? 372  VAL A CG1   1 
ATOM   2947 C  CG2   . VAL A 1 375 ? 21.553 -1.226  3.608   1.00 42.51 ? 372  VAL A CG2   1 
ATOM   2948 N  N     . GLN A 1 376 ? 22.125 1.848   6.136   1.00 32.30 ? 373  GLN A N     1 
ATOM   2949 C  CA    . GLN A 1 376 ? 22.287 1.833   7.583   1.00 35.82 ? 373  GLN A CA    1 
ATOM   2950 C  C     . GLN A 1 376 ? 21.749 0.533   8.166   1.00 33.03 ? 373  GLN A C     1 
ATOM   2951 O  O     . GLN A 1 376 ? 20.616 0.148   7.899   1.00 38.84 ? 373  GLN A O     1 
ATOM   2952 C  CB    . GLN A 1 376 ? 21.585 3.036   8.213   1.00 36.94 ? 373  GLN A CB    1 
ATOM   2953 C  CG    . GLN A 1 376 ? 22.104 3.388   9.605   1.00 43.08 ? 373  GLN A CG    1 
ATOM   2954 C  CD    . GLN A 1 376 ? 21.912 4.856   9.940   1.00 45.28 ? 373  GLN A CD    1 
ATOM   2955 O  OE1   . GLN A 1 376 ? 20.797 5.377   9.872   1.00 41.80 ? 373  GLN A OE1   1 
ATOM   2956 N  NE2   . GLN A 1 376 ? 23.006 5.537   10.290  1.00 41.11 ? 373  GLN A NE2   1 
ATOM   2957 N  N     . GLY A 1 377 ? 22.576 -0.144  8.955   1.00 43.26 ? 374  GLY A N     1 
ATOM   2958 C  CA    . GLY A 1 377 ? 22.190 -1.405  9.562   1.00 45.30 ? 374  GLY A CA    1 
ATOM   2959 C  C     . GLY A 1 377 ? 23.104 -2.547  9.152   1.00 52.44 ? 374  GLY A C     1 
ATOM   2960 O  O     . GLY A 1 377 ? 23.382 -3.450  9.943   1.00 46.42 ? 374  GLY A O     1 
ATOM   2961 N  N     . ASP A 1 378 ? 23.582 -2.497  7.913   1.00 45.32 ? 375  ASP A N     1 
ATOM   2962 C  CA    . ASP A 1 378 ? 24.397 -3.568  7.354   1.00 40.18 ? 375  ASP A CA    1 
ATOM   2963 C  C     . ASP A 1 378 ? 25.803 -3.576  7.949   1.00 48.73 ? 375  ASP A C     1 
ATOM   2964 O  O     . ASP A 1 378 ? 26.469 -2.542  7.999   1.00 52.05 ? 375  ASP A O     1 
ATOM   2965 C  CB    . ASP A 1 378 ? 24.469 -3.424  5.832   1.00 40.78 ? 375  ASP A CB    1 
ATOM   2966 C  CG    . ASP A 1 378 ? 24.972 -4.681  5.148   1.00 44.32 ? 375  ASP A CG    1 
ATOM   2967 O  OD1   . ASP A 1 378 ? 25.702 -5.469  5.788   1.00 43.14 ? 375  ASP A OD1   1 
ATOM   2968 O  OD2   . ASP A 1 378 ? 24.628 -4.877  3.964   1.00 43.70 ? 375  ASP A OD2   1 
ATOM   2969 N  N     . LYS A 1 379 ? 26.254 -4.744  8.398   1.00 50.13 ? 376  LYS A N     1 
ATOM   2970 C  CA    . LYS A 1 379 ? 27.598 -4.868  8.958   1.00 59.87 ? 376  LYS A CA    1 
ATOM   2971 C  C     . LYS A 1 379 ? 28.649 -4.939  7.856   1.00 60.39 ? 376  LYS A C     1 
ATOM   2972 O  O     . LYS A 1 379 ? 29.834 -4.699  8.095   1.00 60.37 ? 376  LYS A O     1 
ATOM   2973 C  CB    . LYS A 1 379 ? 27.710 -6.099  9.862   1.00 63.45 ? 376  LYS A CB    1 
ATOM   2974 C  CG    . LYS A 1 379 ? 29.096 -6.279  10.468  1.00 63.44 ? 376  LYS A CG    1 
ATOM   2975 C  CD    . LYS A 1 379 ? 29.259 -7.638  11.126  1.00 69.95 ? 376  LYS A CD    1 
ATOM   2976 C  CE    . LYS A 1 379 ? 30.699 -7.857  11.562  1.00 69.85 ? 376  LYS A CE    1 
ATOM   2977 N  NZ    . LYS A 1 379 ? 31.653 -7.662  10.431  1.00 62.16 ? 376  LYS A NZ    1 
ATOM   2978 N  N     . ARG A 1 380 ? 28.204 -5.275  6.649   1.00 57.85 ? 377  ARG A N     1 
ATOM   2979 C  CA    . ARG A 1 380 ? 29.091 -5.346  5.493   1.00 56.87 ? 377  ARG A CA    1 
ATOM   2980 C  C     . ARG A 1 380 ? 29.444 -3.948  5.006   1.00 56.86 ? 377  ARG A C     1 
ATOM   2981 O  O     . ARG A 1 380 ? 28.596 -3.054  5.007   1.00 54.33 ? 377  ARG A O     1 
ATOM   2982 C  CB    . ARG A 1 380 ? 28.424 -6.125  4.363   1.00 53.32 ? 377  ARG A CB    1 
ATOM   2983 C  CG    . ARG A 1 380 ? 28.025 -7.540  4.734   1.00 54.46 ? 377  ARG A CG    1 
ATOM   2984 C  CD    . ARG A 1 380 ? 27.230 -8.176  3.612   1.00 49.26 ? 377  ARG A CD    1 
ATOM   2985 N  NE    . ARG A 1 380 ? 25.973 -7.474  3.365   1.00 43.85 ? 377  ARG A NE    1 
ATOM   2986 C  CZ    . ARG A 1 380 ? 25.230 -7.648  2.277   1.00 45.35 ? 377  ARG A CZ    1 
ATOM   2987 N  NH1   . ARG A 1 380 ? 25.627 -8.493  1.335   1.00 43.16 ? 377  ARG A NH1   1 
ATOM   2988 N  NH2   . ARG A 1 380 ? 24.096 -6.976  2.125   1.00 37.06 ? 377  ARG A NH2   1 
ATOM   2989 N  N     . LEU A 1 381 ? 30.693 -3.761  4.588   1.00 56.80 ? 378  LEU A N     1 
ATOM   2990 C  CA    . LEU A 1 381 ? 31.138 -2.464  4.090   1.00 50.79 ? 378  LEU A CA    1 
ATOM   2991 C  C     . LEU A 1 381 ? 30.352 -2.023  2.855   1.00 49.05 ? 378  LEU A C     1 
ATOM   2992 O  O     . LEU A 1 381 ? 30.087 -0.836  2.673   1.00 44.90 ? 378  LEU A O     1 
ATOM   2993 C  CB    . LEU A 1 381 ? 32.643 -2.468  3.806   1.00 55.81 ? 378  LEU A CB    1 
ATOM   2994 C  CG    . LEU A 1 381 ? 33.565 -2.190  4.999   1.00 55.49 ? 378  LEU A CG    1 
ATOM   2995 C  CD1   . LEU A 1 381 ? 33.462 -3.292  6.044   1.00 53.96 ? 378  LEU A CD1   1 
ATOM   2996 C  CD2   . LEU A 1 381 ? 35.009 -2.015  4.542   1.00 57.69 ? 378  LEU A CD2   1 
ATOM   2997 N  N     . SER A 1 382 ? 29.981 -2.975  2.006   1.00 48.90 ? 379  SER A N     1 
ATOM   2998 C  CA    . SER A 1 382 ? 29.136 -2.663  0.856   1.00 44.70 ? 379  SER A CA    1 
ATOM   2999 C  C     . SER A 1 382 ? 27.862 -3.481  0.865   1.00 37.05 ? 379  SER A C     1 
ATOM   3000 O  O     . SER A 1 382 ? 27.890 -4.686  1.106   1.00 45.58 ? 379  SER A O     1 
ATOM   3001 C  CB    . SER A 1 382 ? 29.868 -2.895  -0.464  1.00 43.95 ? 379  SER A CB    1 
ATOM   3002 O  OG    . SER A 1 382 ? 28.940 -2.881  -1.543  1.00 36.69 ? 379  SER A OG    1 
ATOM   3003 N  N     . SER A 1 383 ? 26.745 -2.822  0.577   1.00 37.89 ? 380  SER A N     1 
ATOM   3004 C  CA    . SER A 1 383 ? 25.447 -3.487  0.581   1.00 41.08 ? 380  SER A CA    1 
ATOM   3005 C  C     . SER A 1 383 ? 25.009 -3.887  -0.822  1.00 43.06 ? 380  SER A C     1 
ATOM   3006 O  O     . SER A 1 383 ? 24.404 -4.941  -1.014  1.00 42.35 ? 380  SER A O     1 
ATOM   3007 C  CB    . SER A 1 383 ? 24.382 -2.585  1.219   1.00 40.42 ? 380  SER A CB    1 
ATOM   3008 O  OG    . SER A 1 383 ? 24.661 -2.352  2.590   1.00 35.94 ? 380  SER A OG    1 
ATOM   3009 N  N     . LEU A 1 384 ? 25.317 -3.041  -1.800  1.00 38.14 ? 381  LEU A N     1 
ATOM   3010 C  CA    . LEU A 1 384 ? 24.857 -3.250  -3.166  1.00 32.50 ? 381  LEU A CA    1 
ATOM   3011 C  C     . LEU A 1 384 ? 25.823 -2.643  -4.177  1.00 32.80 ? 381  LEU A C     1 
ATOM   3012 O  O     . LEU A 1 384 ? 26.309 -1.528  -3.994  1.00 25.72 ? 381  LEU A O     1 
ATOM   3013 C  CB    . LEU A 1 384 ? 23.463 -2.651  -3.352  1.00 37.17 ? 381  LEU A CB    1 
ATOM   3014 C  CG    . LEU A 1 384 ? 22.839 -2.759  -4.745  1.00 37.66 ? 381  LEU A CG    1 
ATOM   3015 C  CD1   . LEU A 1 384 ? 21.390 -3.207  -4.651  1.00 40.08 ? 381  LEU A CD1   1 
ATOM   3016 C  CD2   . LEU A 1 384 ? 22.947 -1.443  -5.493  1.00 34.67 ? 381  LEU A CD2   1 
ATOM   3017 N  N     . ARG A 1 385 ? 26.099 -3.382  -5.244  1.00 27.92 ? 382  ARG A N     1 
ATOM   3018 C  CA    . ARG A 1 385 ? 27.005 -2.899  -6.273  1.00 20.67 ? 382  ARG A CA    1 
ATOM   3019 C  C     . ARG A 1 385 ? 26.392 -3.175  -7.637  1.00 28.67 ? 382  ARG A C     1 
ATOM   3020 O  O     . ARG A 1 385 ? 25.990 -4.302  -7.933  1.00 29.73 ? 382  ARG A O     1 
ATOM   3021 C  CB    . ARG A 1 385 ? 28.363 -3.588  -6.161  1.00 31.98 ? 382  ARG A CB    1 
ATOM   3022 C  CG    . ARG A 1 385 ? 29.508 -2.782  -6.736  1.00 35.48 ? 382  ARG A CG    1 
ATOM   3023 C  CD    . ARG A 1 385 ? 30.591 -3.677  -7.317  1.00 46.96 ? 382  ARG A CD    1 
ATOM   3024 N  NE    . ARG A 1 385 ? 30.143 -4.341  -8.538  1.00 46.21 ? 382  ARG A NE    1 
ATOM   3025 C  CZ    . ARG A 1 385 ? 30.956 -4.791  -9.490  1.00 42.49 ? 382  ARG A CZ    1 
ATOM   3026 N  NH1   . ARG A 1 385 ? 30.453 -5.379  -10.564 1.00 36.17 ? 382  ARG A NH1   1 
ATOM   3027 N  NH2   . ARG A 1 385 ? 32.270 -4.646  -9.374  1.00 46.08 ? 382  ARG A NH2   1 
ATOM   3028 N  N     . ARG A 1 386 ? 26.291 -2.135  -8.452  1.00 17.60 ? 383  ARG A N     1 
ATOM   3029 C  CA    . ARG A 1 386 ? 25.725 -2.269  -9.787  1.00 23.81 ? 383  ARG A CA    1 
ATOM   3030 C  C     . ARG A 1 386 ? 26.613 -1.547  -10.791 1.00 22.38 ? 383  ARG A C     1 
ATOM   3031 O  O     . ARG A 1 386 ? 27.211 -0.520  -10.478 1.00 21.42 ? 383  ARG A O     1 
ATOM   3032 C  CB    . ARG A 1 386 ? 24.321 -1.678  -9.830  1.00 26.55 ? 383  ARG A CB    1 
ATOM   3033 C  CG    . ARG A 1 386 ? 23.318 -2.353  -8.919  1.00 31.70 ? 383  ARG A CG    1 
ATOM   3034 C  CD    . ARG A 1 386 ? 22.843 -3.661  -9.509  1.00 27.83 ? 383  ARG A CD    1 
ATOM   3035 N  NE    . ARG A 1 386 ? 21.680 -4.191  -8.804  1.00 27.85 ? 383  ARG A NE    1 
ATOM   3036 C  CZ    . ARG A 1 386 ? 21.739 -5.065  -7.807  1.00 36.06 ? 383  ARG A CZ    1 
ATOM   3037 N  NH1   . ARG A 1 386 ? 22.914 -5.521  -7.386  1.00 31.88 ? 383  ARG A NH1   1 
ATOM   3038 N  NH2   . ARG A 1 386 ? 20.619 -5.491  -7.235  1.00 39.91 ? 383  ARG A NH2   1 
ATOM   3039 N  N     . CYS A 1 387 ? 26.696 -2.078  -12.003 1.00 27.46 ? 384  CYS A N     1 
ATOM   3040 C  CA    . CYS A 1 387 ? 27.464 -1.410  -13.045 1.00 24.28 ? 384  CYS A CA    1 
ATOM   3041 C  C     . CYS A 1 387 ? 26.576 -0.815  -14.123 1.00 29.10 ? 384  CYS A C     1 
ATOM   3042 O  O     . CYS A 1 387 ? 25.456 -1.268  -14.344 1.00 28.81 ? 384  CYS A O     1 
ATOM   3043 C  CB    . CYS A 1 387 ? 28.469 -2.372  -13.684 1.00 30.24 ? 384  CYS A CB    1 
ATOM   3044 S  SG    A CYS A 1 387 ? 27.737 -3.755  -14.596 0.50 24.98 ? 384  CYS A SG    1 
ATOM   3045 S  SG    B CYS A 1 387 ? 29.663 -3.026  -12.533 0.50 31.00 ? 384  CYS A SG    1 
ATOM   3046 N  N     . CYS A 1 388 ? 27.087 0.208   -14.792 1.00 24.22 ? 385  CYS A N     1 
ATOM   3047 C  CA    . CYS A 1 388 ? 26.458 0.708   -16.008 1.00 35.13 ? 385  CYS A CA    1 
ATOM   3048 C  C     . CYS A 1 388 ? 27.531 1.199   -16.972 1.00 28.82 ? 385  CYS A C     1 
ATOM   3049 O  O     . CYS A 1 388 ? 28.704 1.297   -16.610 1.00 30.08 ? 385  CYS A O     1 
ATOM   3050 C  CB    . CYS A 1 388 ? 25.461 1.823   -15.695 1.00 29.31 ? 385  CYS A CB    1 
ATOM   3051 S  SG    . CYS A 1 388 ? 26.212 3.338   -15.073 1.00 31.75 ? 385  CYS A SG    1 
ATOM   3052 N  N     . ALA A 1 389 ? 27.137 1.504   -18.203 1.00 25.46 ? 386  ALA A N     1 
ATOM   3053 C  CA    . ALA A 1 389 ? 28.106 1.943   -19.195 1.00 22.39 ? 386  ALA A CA    1 
ATOM   3054 C  C     . ALA A 1 389 ? 28.667 3.319   -18.861 1.00 27.86 ? 386  ALA A C     1 
ATOM   3055 O  O     . ALA A 1 389 ? 27.938 4.218   -18.440 1.00 32.60 ? 386  ALA A O     1 
ATOM   3056 C  CB    . ALA A 1 389 ? 27.489 1.949   -20.590 1.00 25.90 ? 386  ALA A CB    1 
ATOM   3057 N  N     . LEU A 1 390 ? 29.967 3.479   -19.052 1.00 21.71 ? 387  LEU A N     1 
ATOM   3058 C  CA    . LEU A 1 390 ? 30.600 4.784   -18.931 1.00 17.16 ? 387  LEU A CA    1 
ATOM   3059 C  C     . LEU A 1 390 ? 31.034 5.212   -20.327 1.00 26.67 ? 387  LEU A C     1 
ATOM   3060 O  O     . LEU A 1 390 ? 32.072 4.781   -20.823 1.00 23.19 ? 387  LEU A O     1 
ATOM   3061 C  CB    . LEU A 1 390 ? 31.812 4.707   -17.998 1.00 24.19 ? 387  LEU A CB    1 
ATOM   3062 C  CG    . LEU A 1 390 ? 32.237 5.961   -17.227 1.00 20.52 ? 387  LEU A CG    1 
ATOM   3063 C  CD1   . LEU A 1 390 ? 33.453 5.639   -16.367 1.00 17.24 ? 387  LEU A CD1   1 
ATOM   3064 C  CD2   . LEU A 1 390 ? 32.532 7.127   -18.143 1.00 26.08 ? 387  LEU A CD2   1 
ATOM   3065 N  N     . THR A 1 391 ? 30.237 6.067   -20.954 1.00 28.18 ? 388  THR A N     1 
ATOM   3066 C  CA    . THR A 1 391 ? 30.438 6.406   -22.355 1.00 30.73 ? 388  THR A CA    1 
ATOM   3067 C  C     . THR A 1 391 ? 30.973 7.824   -22.550 1.00 33.53 ? 388  THR A C     1 
ATOM   3068 O  O     . THR A 1 391 ? 31.526 8.147   -23.602 1.00 34.22 ? 388  THR A O     1 
ATOM   3069 C  CB    . THR A 1 391 ? 29.126 6.238   -23.150 1.00 34.93 ? 388  THR A CB    1 
ATOM   3070 O  OG1   . THR A 1 391 ? 28.169 7.206   -22.707 1.00 36.63 ? 388  THR A OG1   1 
ATOM   3071 C  CG2   . THR A 1 391 ? 28.549 4.840   -22.939 1.00 24.68 ? 388  THR A CG2   1 
ATOM   3072 N  N     . ARG A 1 392 ? 30.801 8.665   -21.534 1.00 24.55 ? 389  ARG A N     1 
ATOM   3073 C  CA    . ARG A 1 392 ? 31.276 10.041  -21.567 1.00 25.68 ? 389  ARG A CA    1 
ATOM   3074 C  C     . ARG A 1 392 ? 31.789 10.481  -20.198 1.00 21.58 ? 389  ARG A C     1 
ATOM   3075 O  O     . ARG A 1 392 ? 31.156 10.220  -19.179 1.00 29.48 ? 389  ARG A O     1 
ATOM   3076 C  CB    . ARG A 1 392 ? 30.160 10.990  -22.017 1.00 33.81 ? 389  ARG A CB    1 
ATOM   3077 C  CG    . ARG A 1 392 ? 29.783 10.860  -23.482 1.00 35.80 ? 389  ARG A CG    1 
ATOM   3078 C  CD    . ARG A 1 392 ? 28.741 11.895  -23.876 1.00 47.90 ? 389  ARG A CD    1 
ATOM   3079 N  NE    . ARG A 1 392 ? 29.184 13.253  -23.563 1.00 43.34 ? 389  ARG A NE    1 
ATOM   3080 C  CZ    . ARG A 1 392 ? 28.666 14.007  -22.595 1.00 53.79 ? 389  ARG A CZ    1 
ATOM   3081 N  NH1   . ARG A 1 392 ? 29.134 15.231  -22.382 1.00 51.24 ? 389  ARG A NH1   1 
ATOM   3082 N  NH2   . ARG A 1 392 ? 27.676 13.539  -21.844 1.00 53.47 ? 389  ARG A NH2   1 
ATOM   3083 N  N     . TYR A 1 393 ? 32.941 11.143  -20.197 1.00 19.21 ? 390  TYR A N     1 
ATOM   3084 C  CA    . TYR A 1 393 ? 33.509 11.745  -18.996 1.00 21.14 ? 390  TYR A CA    1 
ATOM   3085 C  C     . TYR A 1 393 ? 32.765 13.042  -18.688 1.00 24.17 ? 390  TYR A C     1 
ATOM   3086 O  O     . TYR A 1 393 ? 33.258 14.143  -18.954 1.00 22.48 ? 390  TYR A O     1 
ATOM   3087 C  CB    . TYR A 1 393 ? 35.001 12.031  -19.207 1.00 22.39 ? 390  TYR A CB    1 
ATOM   3088 C  CG    . TYR A 1 393 ? 35.917 10.810  -19.143 1.00 17.68 ? 390  TYR A CG    1 
ATOM   3089 C  CD1   . TYR A 1 393 ? 37.302 10.957  -19.189 1.00 19.15 ? 390  TYR A CD1   1 
ATOM   3090 C  CD2   . TYR A 1 393 ? 35.398 9.524   -19.028 1.00 23.09 ? 390  TYR A CD2   1 
ATOM   3091 C  CE1   . TYR A 1 393 ? 38.150 9.844   -19.123 1.00 12.93 ? 390  TYR A CE1   1 
ATOM   3092 C  CE2   . TYR A 1 393 ? 36.237 8.408   -18.959 1.00 19.68 ? 390  TYR A CE2   1 
ATOM   3093 C  CZ    . TYR A 1 393 ? 37.608 8.578   -19.005 1.00 19.66 ? 390  TYR A CZ    1 
ATOM   3094 O  OH    . TYR A 1 393 ? 38.439 7.477   -18.925 1.00 18.17 ? 390  TYR A OH    1 
ATOM   3095 N  N     . ASP A 1 394 ? 31.562 12.902  -18.149 1.00 21.91 ? 391  ASP A N     1 
ATOM   3096 C  CA    . ASP A 1 394 ? 30.740 14.047  -17.808 1.00 21.19 ? 391  ASP A CA    1 
ATOM   3097 C  C     . ASP A 1 394 ? 30.113 13.755  -16.456 1.00 17.05 ? 391  ASP A C     1 
ATOM   3098 O  O     . ASP A 1 394 ? 29.430 12.746  -16.295 1.00 21.17 ? 391  ASP A O     1 
ATOM   3099 C  CB    . ASP A 1 394 ? 29.670 14.263  -18.879 1.00 26.97 ? 391  ASP A CB    1 
ATOM   3100 C  CG    . ASP A 1 394 ? 28.861 15.520  -18.643 1.00 32.04 ? 391  ASP A CG    1 
ATOM   3101 O  OD1   . ASP A 1 394 ? 27.979 15.493  -17.762 1.00 26.97 ? 391  ASP A OD1   1 
ATOM   3102 O  OD2   . ASP A 1 394 ? 29.112 16.532  -19.331 1.00 48.14 ? 391  ASP A OD2   1 
ATOM   3103 N  N     . ALA A 1 395 ? 30.385 14.616  -15.478 1.00 20.40 ? 392  ALA A N     1 
ATOM   3104 C  CA    . ALA A 1 395 ? 29.975 14.375  -14.093 1.00 22.54 ? 392  ALA A CA    1 
ATOM   3105 C  C     . ALA A 1 395 ? 28.457 14.323  -13.888 1.00 18.79 ? 392  ALA A C     1 
ATOM   3106 O  O     . ALA A 1 395 ? 27.957 13.482  -13.145 1.00 20.25 ? 392  ALA A O     1 
ATOM   3107 C  CB    . ALA A 1 395 ? 30.627 15.407  -13.150 1.00 18.68 ? 392  ALA A CB    1 
ATOM   3108 N  N     . HIS A 1 396 ? 27.725 15.223  -14.538 1.00 21.99 ? 393  HIS A N     1 
ATOM   3109 C  CA    . HIS A 1 396 ? 26.269 15.215  -14.429 1.00 25.51 ? 393  HIS A CA    1 
ATOM   3110 C  C     . HIS A 1 396 ? 25.677 13.926  -14.990 1.00 14.95 ? 393  HIS A C     1 
ATOM   3111 O  O     . HIS A 1 396 ? 24.785 13.321  -14.384 1.00 22.21 ? 393  HIS A O     1 
ATOM   3112 C  CB    . HIS A 1 396 ? 25.663 16.455  -15.102 1.00 20.44 ? 393  HIS A CB    1 
ATOM   3113 C  CG    . HIS A 1 396 ? 25.847 17.713  -14.309 1.00 30.52 ? 393  HIS A CG    1 
ATOM   3114 N  ND1   . HIS A 1 396 ? 26.918 18.561  -14.492 1.00 37.94 ? 393  HIS A ND1   1 
ATOM   3115 C  CD2   . HIS A 1 396 ? 25.110 18.250  -13.307 1.00 35.33 ? 393  HIS A CD2   1 
ATOM   3116 C  CE1   . HIS A 1 396 ? 26.826 19.574  -13.648 1.00 35.60 ? 393  HIS A CE1   1 
ATOM   3117 N  NE2   . HIS A 1 396 ? 25.739 19.408  -12.917 1.00 37.42 ? 393  HIS A NE2   1 
ATOM   3118 N  N     . LYS A 1 397 ? 26.184 13.486  -16.140 1.00 21.17 ? 394  LYS A N     1 
ATOM   3119 C  CA    . LYS A 1 397 ? 25.747 12.202  -16.686 1.00 21.76 ? 394  LYS A CA    1 
ATOM   3120 C  C     . LYS A 1 397 ? 26.084 11.007  -15.798 1.00 18.23 ? 394  LYS A C     1 
ATOM   3121 O  O     . LYS A 1 397 ? 25.237 10.148  -15.559 1.00 22.50 ? 394  LYS A O     1 
ATOM   3122 C  CB    . LYS A 1 397 ? 26.284 11.960  -18.097 1.00 26.95 ? 394  LYS A CB    1 
ATOM   3123 C  CG    . LYS A 1 397 ? 25.993 10.538  -18.571 1.00 26.92 ? 394  LYS A CG    1 
ATOM   3124 C  CD    . LYS A 1 397 ? 26.252 10.342  -20.053 1.00 36.13 ? 394  LYS A CD    1 
ATOM   3125 C  CE    . LYS A 1 397 ? 25.943 8.907   -20.463 1.00 34.40 ? 394  LYS A CE    1 
ATOM   3126 N  NZ    . LYS A 1 397 ? 24.555 8.488   -20.105 1.00 40.12 ? 394  LYS A NZ    1 
ATOM   3127 N  N     . MET A 1 398 ? 27.320 10.934  -15.318 1.00 20.50 ? 395  MET A N     1 
ATOM   3128 C  CA    . MET A 1 398 ? 27.695 9.833   -14.439 1.00 19.20 ? 395  MET A CA    1 
ATOM   3129 C  C     . MET A 1 398 ? 26.852 9.784   -13.164 1.00 17.77 ? 395  MET A C     1 
ATOM   3130 O  O     . MET A 1 398 ? 26.480 8.704   -12.711 1.00 17.51 ? 395  MET A O     1 
ATOM   3131 C  CB    . MET A 1 398 ? 29.188 9.878   -14.102 1.00 19.19 ? 395  MET A CB    1 
ATOM   3132 C  CG    . MET A 1 398 ? 30.076 9.611   -15.299 1.00 16.94 ? 395  MET A CG    1 
ATOM   3133 S  SD    . MET A 1 398 ? 31.765 9.305   -14.789 1.00 25.02 ? 395  MET A SD    1 
ATOM   3134 C  CE    . MET A 1 398 ? 32.326 10.987  -14.515 1.00 21.85 ? 395  MET A CE    1 
ATOM   3135 N  N     . SER A 1 399 ? 26.553 10.947  -12.593 1.00 20.94 ? 396  SER A N     1 
ATOM   3136 C  CA    . SER A 1 399 ? 25.787 10.993  -11.348 1.00 19.80 ? 396  SER A CA    1 
ATOM   3137 C  C     . SER A 1 399 ? 24.318 10.659  -11.600 1.00 15.31 ? 396  SER A C     1 
ATOM   3138 O  O     . SER A 1 399 ? 23.675 9.991   -10.785 1.00 19.21 ? 396  SER A O     1 
ATOM   3139 C  CB    . SER A 1 399 ? 25.945 12.348  -10.635 1.00 19.84 ? 396  SER A CB    1 
ATOM   3140 O  OG    . SER A 1 399 ? 25.515 13.435  -11.434 1.00 22.60 ? 396  SER A OG    1 
ATOM   3141 N  N     . HIS A 1 400 ? 23.794 11.104  -12.736 1.00 21.13 ? 397  HIS A N     1 
ATOM   3142 C  CA    . HIS A 1 400 ? 22.431 10.741  -13.106 1.00 24.73 ? 397  HIS A CA    1 
ATOM   3143 C  C     . HIS A 1 400 ? 22.342 9.235   -13.354 1.00 18.67 ? 397  HIS A C     1 
ATOM   3144 O  O     . HIS A 1 400 ? 21.413 8.570   -12.912 1.00 23.41 ? 397  HIS A O     1 
ATOM   3145 C  CB    . HIS A 1 400 ? 21.971 11.517  -14.341 1.00 29.51 ? 397  HIS A CB    1 
ATOM   3146 C  CG    . HIS A 1 400 ? 20.574 11.184  -14.765 1.00 36.36 ? 397  HIS A CG    1 
ATOM   3147 N  ND1   . HIS A 1 400 ? 20.276 10.087  -15.548 1.00 40.85 ? 397  HIS A ND1   1 
ATOM   3148 C  CD2   . HIS A 1 400 ? 19.393 11.786  -14.497 1.00 40.17 ? 397  HIS A CD2   1 
ATOM   3149 C  CE1   . HIS A 1 400 ? 18.973 10.037  -15.752 1.00 41.34 ? 397  HIS A CE1   1 
ATOM   3150 N  NE2   . HIS A 1 400 ? 18.412 11.056  -15.125 1.00 42.33 ? 397  HIS A NE2   1 
ATOM   3151 N  N     . ASP A 1 401 ? 23.339 8.696   -14.048 1.00 25.83 ? 398  ASP A N     1 
ATOM   3152 C  CA    . ASP A 1 401 ? 23.388 7.266   -14.321 1.00 20.65 ? 398  ASP A CA    1 
ATOM   3153 C  C     . ASP A 1 401 ? 23.491 6.423   -13.051 1.00 22.35 ? 398  ASP A C     1 
ATOM   3154 O  O     . ASP A 1 401 ? 22.872 5.364   -12.946 1.00 23.50 ? 398  ASP A O     1 
ATOM   3155 C  CB    . ASP A 1 401 ? 24.540 6.939   -15.270 1.00 18.37 ? 398  ASP A CB    1 
ATOM   3156 C  CG    . ASP A 1 401 ? 24.281 7.422   -16.686 1.00 31.11 ? 398  ASP A CG    1 
ATOM   3157 O  OD1   . ASP A 1 401 ? 23.148 7.874   -16.968 1.00 30.50 ? 398  ASP A OD1   1 
ATOM   3158 O  OD2   . ASP A 1 401 ? 25.205 7.341   -17.521 1.00 31.64 ? 398  ASP A OD2   1 
ATOM   3159 N  N     . ALA A 1 402 ? 24.279 6.890   -12.084 1.00 23.18 ? 399  ALA A N     1 
ATOM   3160 C  CA    . ALA A 1 402 ? 24.426 6.173   -10.823 1.00 17.28 ? 399  ALA A CA    1 
ATOM   3161 C  C     . ALA A 1 402 ? 23.135 6.209   -10.008 1.00 15.00 ? 399  ALA A C     1 
ATOM   3162 O  O     . ALA A 1 402 ? 22.772 5.228   -9.360  1.00 22.10 ? 399  ALA A O     1 
ATOM   3163 C  CB    . ALA A 1 402 ? 25.597 6.756   -10.007 1.00 18.05 ? 399  ALA A CB    1 
ATOM   3164 N  N     . PHE A 1 403 ? 22.453 7.349   -10.030 1.00 22.85 ? 400  PHE A N     1 
ATOM   3165 C  CA    . PHE A 1 403 ? 21.177 7.460   -9.338  1.00 24.96 ? 400  PHE A CA    1 
ATOM   3166 C  C     . PHE A 1 403 ? 20.177 6.478   -9.943  1.00 27.75 ? 400  PHE A C     1 
ATOM   3167 O  O     . PHE A 1 403 ? 19.455 5.791   -9.228  1.00 27.69 ? 400  PHE A O     1 
ATOM   3168 C  CB    . PHE A 1 403 ? 20.637 8.884   -9.426  1.00 23.30 ? 400  PHE A CB    1 
ATOM   3169 C  CG    . PHE A 1 403 ? 19.365 9.093   -8.660  1.00 38.58 ? 400  PHE A CG    1 
ATOM   3170 C  CD1   . PHE A 1 403 ? 18.142 9.115   -9.314  1.00 36.91 ? 400  PHE A CD1   1 
ATOM   3171 C  CD2   . PHE A 1 403 ? 19.390 9.256   -7.285  1.00 32.57 ? 400  PHE A CD2   1 
ATOM   3172 C  CE1   . PHE A 1 403 ? 16.967 9.304   -8.609  1.00 43.27 ? 400  PHE A CE1   1 
ATOM   3173 C  CE2   . PHE A 1 403 ? 18.218 9.447   -6.574  1.00 43.38 ? 400  PHE A CE2   1 
ATOM   3174 C  CZ    . PHE A 1 403 ? 17.005 9.470   -7.237  1.00 44.02 ? 400  PHE A CZ    1 
ATOM   3175 N  N     . THR A 1 404 ? 20.148 6.413   -11.267 1.00 31.95 ? 401  THR A N     1 
ATOM   3176 C  CA    . THR A 1 404 ? 19.262 5.487   -11.961 1.00 30.06 ? 401  THR A CA    1 
ATOM   3177 C  C     . THR A 1 404 ? 19.472 4.035   -11.522 1.00 27.74 ? 401  THR A C     1 
ATOM   3178 O  O     . THR A 1 404 ? 18.508 3.293   -11.334 1.00 30.14 ? 401  THR A O     1 
ATOM   3179 C  CB    . THR A 1 404 ? 19.414 5.593   -13.497 1.00 27.07 ? 401  THR A CB    1 
ATOM   3180 O  OG1   . THR A 1 404 ? 19.045 6.909   -13.932 1.00 29.31 ? 401  THR A OG1   1 
ATOM   3181 C  CG2   . THR A 1 404 ? 18.538 4.566   -14.196 1.00 33.21 ? 401  THR A CG2   1 
ATOM   3182 N  N     . VAL A 1 405 ? 20.724 3.617   -11.352 1.00 25.56 ? 402  VAL A N     1 
ATOM   3183 C  CA    . VAL A 1 405 ? 20.981 2.214   -11.031 1.00 25.48 ? 402  VAL A CA    1 
ATOM   3184 C  C     . VAL A 1 405 ? 20.711 1.851   -9.570  1.00 28.18 ? 402  VAL A C     1 
ATOM   3185 O  O     . VAL A 1 405 ? 20.502 0.681   -9.260  1.00 36.16 ? 402  VAL A O     1 
ATOM   3186 C  CB    . VAL A 1 405 ? 22.401 1.744   -11.455 1.00 36.39 ? 402  VAL A CB    1 
ATOM   3187 C  CG1   . VAL A 1 405 ? 22.556 1.832   -12.961 1.00 38.67 ? 402  VAL A CG1   1 
ATOM   3188 C  CG2   . VAL A 1 405 ? 23.474 2.555   -10.762 1.00 34.96 ? 402  VAL A CG2   1 
ATOM   3189 N  N     . ILE A 1 406 ? 20.712 2.844   -8.682  1.00 30.12 ? 403  ILE A N     1 
ATOM   3190 C  CA    . ILE A 1 406 ? 20.480 2.594   -7.259  1.00 33.37 ? 403  ILE A CA    1 
ATOM   3191 C  C     . ILE A 1 406 ? 19.115 3.061   -6.754  1.00 32.49 ? 403  ILE A C     1 
ATOM   3192 O  O     . ILE A 1 406 ? 18.718 2.719   -5.638  1.00 36.61 ? 403  ILE A O     1 
ATOM   3193 C  CB    . ILE A 1 406 ? 21.537 3.289   -6.367  1.00 29.77 ? 403  ILE A CB    1 
ATOM   3194 C  CG1   . ILE A 1 406 ? 21.250 4.790   -6.278  1.00 26.14 ? 403  ILE A CG1   1 
ATOM   3195 C  CG2   . ILE A 1 406 ? 22.936 3.006   -6.867  1.00 25.50 ? 403  ILE A CG2   1 
ATOM   3196 C  CD1   . ILE A 1 406 ? 22.033 5.505   -5.187  1.00 31.50 ? 403  ILE A CD1   1 
ATOM   3197 N  N     . LYS A 1 407 ? 18.407 3.845   -7.561  1.00 32.75 ? 404  LYS A N     1 
ATOM   3198 C  CA    . LYS A 1 407 ? 17.183 4.501   -7.097  1.00 38.93 ? 404  LYS A CA    1 
ATOM   3199 C  C     . LYS A 1 407 ? 16.090 3.529   -6.648  1.00 40.50 ? 404  LYS A C     1 
ATOM   3200 O  O     . LYS A 1 407 ? 15.117 3.937   -6.018  1.00 42.67 ? 404  LYS A O     1 
ATOM   3201 C  CB    . LYS A 1 407 ? 16.636 5.463   -8.157  1.00 37.65 ? 404  LYS A CB    1 
ATOM   3202 C  CG    . LYS A 1 407 ? 16.027 4.787   -9.376  1.00 37.77 ? 404  LYS A CG    1 
ATOM   3203 C  CD    . LYS A 1 407 ? 15.641 5.817   -10.430 1.00 43.56 ? 404  LYS A CD    1 
ATOM   3204 C  CE    . LYS A 1 407 ? 14.872 5.182   -11.580 1.00 48.34 ? 404  LYS A CE    1 
ATOM   3205 N  NZ    . LYS A 1 407 ? 15.653 4.101   -12.243 1.00 57.98 ? 404  LYS A NZ    1 
ATOM   3206 N  N     . ASN A 1 408 ? 16.253 2.249   -6.966  1.00 39.18 ? 405  ASN A N     1 
ATOM   3207 C  CA    . ASN A 1 408 ? 15.264 1.247   -6.586  1.00 46.74 ? 405  ASN A CA    1 
ATOM   3208 C  C     . ASN A 1 408 ? 15.563 0.619   -5.230  1.00 47.70 ? 405  ASN A C     1 
ATOM   3209 O  O     . ASN A 1 408 ? 14.792 -0.202  -4.732  1.00 49.06 ? 405  ASN A O     1 
ATOM   3210 C  CB    . ASN A 1 408 ? 15.145 0.161   -7.658  1.00 47.19 ? 405  ASN A CB    1 
ATOM   3211 C  CG    . ASN A 1 408 ? 16.435 -0.613  -7.848  1.00 58.75 ? 405  ASN A CG    1 
ATOM   3212 O  OD1   . ASN A 1 408 ? 17.516 -0.028  -7.969  1.00 46.29 ? 405  ASN A OD1   1 
ATOM   3213 N  ND2   . ASN A 1 408 ? 16.331 -1.939  -7.866  1.00 60.76 ? 405  ASN A ND2   1 
ATOM   3214 N  N     . CYS A 1 409 ? 16.689 1.001   -4.638  1.00 44.93 ? 406  CYS A N     1 
ATOM   3215 C  CA    . CYS A 1 409 ? 17.048 0.513   -3.312  1.00 47.30 ? 406  CYS A CA    1 
ATOM   3216 C  C     . CYS A 1 409 ? 16.258 1.275   -2.266  1.00 41.48 ? 406  CYS A C     1 
ATOM   3217 O  O     . CYS A 1 409 ? 16.173 0.864   -1.111  1.00 50.32 ? 406  CYS A O     1 
ATOM   3218 C  CB    . CYS A 1 409 ? 18.544 0.687   -3.055  1.00 47.84 ? 406  CYS A CB    1 
ATOM   3219 S  SG    . CYS A 1 409 ? 19.578 -0.276  -4.155  1.00 62.32 ? 406  CYS A SG    1 
ATOM   3220 N  N     . ASN A 1 410 ? 15.684 2.395   -2.686  1.00 41.75 ? 407  ASN A N     1 
ATOM   3221 C  CA    . ASN A 1 410 ? 14.898 3.233   -1.799  1.00 37.58 ? 407  ASN A CA    1 
ATOM   3222 C  C     . ASN A 1 410 ? 13.592 2.550   -1.380  1.00 49.83 ? 407  ASN A C     1 
ATOM   3223 O  O     . ASN A 1 410 ? 12.727 2.277   -2.211  1.00 47.84 ? 407  ASN A O     1 
ATOM   3224 C  CB    . ASN A 1 410 ? 14.615 4.575   -2.473  1.00 36.84 ? 407  ASN A CB    1 
ATOM   3225 C  CG    . ASN A 1 410 ? 13.952 5.559   -1.545  1.00 36.40 ? 407  ASN A CG    1 
ATOM   3226 O  OD1   . ASN A 1 410 ? 13.731 5.264   -0.372  1.00 36.94 ? 407  ASN A OD1   1 
ATOM   3227 N  ND2   . ASN A 1 410 ? 13.639 6.746   -2.060  1.00 38.67 ? 407  ASN A ND2   1 
ATOM   3228 N  N     . THR A 1 411 ? 13.469 2.272   -0.085  1.00 47.88 ? 408  THR A N     1 
ATOM   3229 C  CA    . THR A 1 411 ? 12.291 1.614   0.474   1.00 50.95 ? 408  THR A CA    1 
ATOM   3230 C  C     . THR A 1 411 ? 11.149 2.600   0.674   1.00 48.83 ? 408  THR A C     1 
ATOM   3231 O  O     . THR A 1 411 ? 9.979  2.246   0.530   1.00 54.14 ? 408  THR A O     1 
ATOM   3232 C  CB    . THR A 1 411 ? 12.617 0.949   1.828   1.00 43.99 ? 408  THR A CB    1 
ATOM   3233 O  OG1   . THR A 1 411 ? 13.217 -0.333  1.603   1.00 55.39 ? 408  THR A OG1   1 
ATOM   3234 C  CG2   . THR A 1 411 ? 11.359 0.772   2.663   1.00 56.07 ? 408  THR A CG2   1 
ATOM   3235 N  N     . SER A 1 412 ? 11.497 3.836   1.012   1.00 48.45 ? 409  SER A N     1 
ATOM   3236 C  CA    . SER A 1 412 ? 10.506 4.873   1.277   1.00 52.85 ? 409  SER A CA    1 
ATOM   3237 C  C     . SER A 1 412 ? 9.370  4.853   0.264   1.00 57.18 ? 409  SER A C     1 
ATOM   3238 O  O     . SER A 1 412 ? 9.603  4.818   -0.943  1.00 58.07 ? 409  SER A O     1 
ATOM   3239 C  CB    . SER A 1 412 ? 11.166 6.253   1.279   1.00 53.68 ? 409  SER A CB    1 
ATOM   3240 O  OG    . SER A 1 412 ? 10.194 7.285   1.297   1.00 54.81 ? 409  SER A OG    1 
ATOM   3241 N  N     . GLY A 1 413 ? 8.138  4.869   0.762   1.00 61.43 ? 410  GLY A N     1 
ATOM   3242 C  CA    . GLY A 1 413 ? 6.981  4.992   -0.103  1.00 63.11 ? 410  GLY A CA    1 
ATOM   3243 C  C     . GLY A 1 413 ? 6.952  6.386   -0.693  1.00 61.46 ? 410  GLY A C     1 
ATOM   3244 O  O     . GLY A 1 413 ? 6.432  6.608   -1.787  1.00 57.19 ? 410  GLY A O     1 
ATOM   3245 N  N     . ILE A 1 414 ? 7.526  7.329   0.045   1.00 58.86 ? 411  ILE A N     1 
ATOM   3246 C  CA    . ILE A 1 414 ? 7.615  8.712   -0.396  1.00 58.05 ? 411  ILE A CA    1 
ATOM   3247 C  C     . ILE A 1 414 ? 8.765  8.867   -1.386  1.00 61.07 ? 411  ILE A C     1 
ATOM   3248 O  O     . ILE A 1 414 ? 9.852  8.324   -1.180  1.00 60.07 ? 411  ILE A O     1 
ATOM   3249 C  CB    . ILE A 1 414 ? 7.838  9.659   0.798   1.00 56.95 ? 411  ILE A CB    1 
ATOM   3250 C  CG1   . ILE A 1 414 ? 6.993  9.213   1.994   1.00 56.15 ? 411  ILE A CG1   1 
ATOM   3251 C  CG2   . ILE A 1 414 ? 7.525  11.098  0.411   1.00 52.48 ? 411  ILE A CG2   1 
ATOM   3252 C  CD1   . ILE A 1 414 ? 7.223  10.036  3.242   1.00 56.24 ? 411  ILE A CD1   1 
ATOM   3253 N  N     . GLN A 1 415 ? 8.515  9.612   -2.458  1.00 67.87 ? 412  GLN A N     1 
ATOM   3254 C  CA    . GLN A 1 415 ? 9.497  9.809   -3.520  1.00 60.33 ? 412  GLN A CA    1 
ATOM   3255 C  C     . GLN A 1 415 ? 10.673 10.662  -3.047  1.00 62.46 ? 412  GLN A C     1 
ATOM   3256 O  O     . GLN A 1 415 ? 11.812 10.464  -3.475  1.00 62.75 ? 412  GLN A O     1 
ATOM   3257 C  CB    . GLN A 1 415 ? 8.826  10.473  -4.727  1.00 64.06 ? 412  GLN A CB    1 
ATOM   3258 C  CG    . GLN A 1 415 ? 9.672  10.517  -5.992  1.00 68.23 ? 412  GLN A CG    1 
ATOM   3259 C  CD    . GLN A 1 415 ? 9.746  9.175   -6.701  1.00 70.42 ? 412  GLN A CD    1 
ATOM   3260 O  OE1   . GLN A 1 415 ? 9.859  8.126   -6.064  1.00 71.99 ? 412  GLN A OE1   1 
ATOM   3261 N  NE2   . GLN A 1 415 ? 9.678  9.203   -8.030  1.00 62.37 ? 412  GLN A NE2   1 
ATOM   3262 N  N     . THR A 1 416 ? 10.384 11.606  -2.157  1.00 55.90 ? 413  THR A N     1 
ATOM   3263 C  CA    . THR A 1 416 ? 11.362 12.596  -1.720  1.00 53.24 ? 413  THR A CA    1 
ATOM   3264 C  C     . THR A 1 416 ? 12.272 12.084  -0.605  1.00 49.54 ? 413  THR A C     1 
ATOM   3265 O  O     . THR A 1 416 ? 13.365 12.610  -0.396  1.00 48.36 ? 413  THR A O     1 
ATOM   3266 C  CB    . THR A 1 416 ? 10.655 13.874  -1.234  1.00 54.10 ? 413  THR A CB    1 
ATOM   3267 O  OG1   . THR A 1 416 ? 9.698  14.289  -2.215  1.00 60.39 ? 413  THR A OG1   1 
ATOM   3268 C  CG2   . THR A 1 416 ? 11.659 14.994  -0.999  1.00 58.10 ? 413  THR A CG2   1 
ATOM   3269 N  N     . GLU A 1 417 ? 11.817 11.061  0.110   1.00 47.36 ? 414  GLU A N     1 
ATOM   3270 C  CA    . GLU A 1 417 ? 12.573 10.514  1.228   1.00 44.29 ? 414  GLU A CA    1 
ATOM   3271 C  C     . GLU A 1 417 ? 13.394 9.309   0.803   1.00 47.59 ? 414  GLU A C     1 
ATOM   3272 O  O     . GLU A 1 417 ? 13.006 8.572   -0.104  1.00 47.85 ? 414  GLU A O     1 
ATOM   3273 C  CB    . GLU A 1 417 ? 11.629 10.117  2.363   1.00 48.52 ? 414  GLU A CB    1 
ATOM   3274 C  CG    . GLU A 1 417 ? 10.674 11.220  2.772   1.00 55.21 ? 414  GLU A CG    1 
ATOM   3275 C  CD    . GLU A 1 417 ? 11.396 12.495  3.143   1.00 50.10 ? 414  GLU A CD    1 
ATOM   3276 O  OE1   . GLU A 1 417 ? 12.189 12.466  4.108   1.00 44.95 ? 414  GLU A OE1   1 
ATOM   3277 O  OE2   . GLU A 1 417 ? 11.178 13.522  2.464   1.00 53.74 ? 414  GLU A OE2   1 
ATOM   3278 N  N     . TRP A 1 418 ? 14.532 9.109   1.459   1.00 32.87 ? 415  TRP A N     1 
ATOM   3279 C  CA    . TRP A 1 418 ? 15.344 7.930   1.200   1.00 34.46 ? 415  TRP A CA    1 
ATOM   3280 C  C     . TRP A 1 418 ? 15.470 7.057   2.440   1.00 36.40 ? 415  TRP A C     1 
ATOM   3281 O  O     . TRP A 1 418 ? 15.952 7.504   3.479   1.00 38.01 ? 415  TRP A O     1 
ATOM   3282 C  CB    . TRP A 1 418 ? 16.739 8.304   0.680   1.00 34.11 ? 415  TRP A CB    1 
ATOM   3283 C  CG    . TRP A 1 418 ? 17.412 7.128   0.049   1.00 26.84 ? 415  TRP A CG    1 
ATOM   3284 C  CD1   . TRP A 1 418 ? 17.936 6.043   0.687   1.00 30.45 ? 415  TRP A CD1   1 
ATOM   3285 C  CD2   . TRP A 1 418 ? 17.592 6.898   -1.350  1.00 34.71 ? 415  TRP A CD2   1 
ATOM   3286 N  NE1   . TRP A 1 418 ? 18.439 5.151   -0.231  1.00 33.40 ? 415  TRP A NE1   1 
ATOM   3287 C  CE2   . TRP A 1 418 ? 18.242 5.655   -1.489  1.00 26.74 ? 415  TRP A CE2   1 
ATOM   3288 C  CE3   . TRP A 1 418 ? 17.273 7.626   -2.500  1.00 36.73 ? 415  TRP A CE3   1 
ATOM   3289 C  CZ2   . TRP A 1 418 ? 18.583 5.126   -2.733  1.00 34.51 ? 415  TRP A CZ2   1 
ATOM   3290 C  CZ3   . TRP A 1 418 ? 17.612 7.099   -3.736  1.00 35.58 ? 415  TRP A CZ3   1 
ATOM   3291 C  CH2   . TRP A 1 418 ? 18.258 5.863   -3.842  1.00 30.45 ? 415  TRP A CH2   1 
ATOM   3292 N  N     . SER A 1 419 ? 15.041 5.805   2.327   1.00 40.59 ? 416  SER A N     1 
ATOM   3293 C  CA    . SER A 1 419 ? 15.150 4.869   3.439   1.00 34.66 ? 416  SER A CA    1 
ATOM   3294 C  C     . SER A 1 419 ? 15.415 3.454   2.943   1.00 44.90 ? 416  SER A C     1 
ATOM   3295 O  O     . SER A 1 419 ? 14.942 3.074   1.874   1.00 42.97 ? 416  SER A O     1 
ATOM   3296 C  CB    . SER A 1 419 ? 13.884 4.900   4.298   1.00 49.16 ? 416  SER A CB    1 
ATOM   3297 O  OG    . SER A 1 419 ? 12.741 4.556   3.534   1.00 54.51 ? 416  SER A OG    1 
ATOM   3298 N  N     . PRO A 1 420 ? 16.208 2.684   3.706   1.00 45.02 ? 417  PRO A N     1 
ATOM   3299 C  CA    . PRO A 1 420 ? 16.917 3.213   4.877   1.00 45.45 ? 417  PRO A CA    1 
ATOM   3300 C  C     . PRO A 1 420 ? 18.022 4.165   4.433   1.00 35.49 ? 417  PRO A C     1 
ATOM   3301 O  O     . PRO A 1 420 ? 18.496 4.042   3.303   1.00 39.07 ? 417  PRO A O     1 
ATOM   3302 C  CB    . PRO A 1 420 ? 17.517 1.959   5.518   1.00 40.46 ? 417  PRO A CB    1 
ATOM   3303 C  CG    . PRO A 1 420 ? 17.629 0.981   4.403   1.00 45.94 ? 417  PRO A CG    1 
ATOM   3304 C  CD    . PRO A 1 420 ? 16.455 1.245   3.513   1.00 41.72 ? 417  PRO A CD    1 
ATOM   3305 N  N     . PRO A 1 421 ? 18.415 5.111   5.303   1.00 38.20 ? 418  PRO A N     1 
ATOM   3306 C  CA    . PRO A 1 421 ? 19.431 6.112   4.954   1.00 35.11 ? 418  PRO A CA    1 
ATOM   3307 C  C     . PRO A 1 421 ? 20.708 5.461   4.428   1.00 23.79 ? 418  PRO A C     1 
ATOM   3308 O  O     . PRO A 1 421 ? 21.021 4.333   4.809   1.00 26.49 ? 418  PRO A O     1 
ATOM   3309 C  CB    . PRO A 1 421 ? 19.707 6.813   6.288   1.00 33.17 ? 418  PRO A CB    1 
ATOM   3310 C  CG    . PRO A 1 421 ? 18.465 6.608   7.089   1.00 37.75 ? 418  PRO A CG    1 
ATOM   3311 C  CD    . PRO A 1 421 ? 17.929 5.266   6.686   1.00 36.92 ? 418  PRO A CD    1 
ATOM   3312 N  N     . LEU A 1 422 ? 21.425 6.173   3.565   1.00 28.64 ? 419  LEU A N     1 
ATOM   3313 C  CA    . LEU A 1 422 ? 22.663 5.666   2.975   1.00 21.06 ? 419  LEU A CA    1 
ATOM   3314 C  C     . LEU A 1 422 ? 23.864 6.128   3.794   1.00 20.57 ? 419  LEU A C     1 
ATOM   3315 O  O     . LEU A 1 422 ? 24.002 7.316   4.090   1.00 25.36 ? 419  LEU A O     1 
ATOM   3316 C  CB    . LEU A 1 422 ? 22.808 6.141   1.526   1.00 23.21 ? 419  LEU A CB    1 
ATOM   3317 C  CG    . LEU A 1 422 ? 21.712 5.717   0.547   1.00 27.12 ? 419  LEU A CG    1 
ATOM   3318 C  CD1   . LEU A 1 422 ? 22.073 6.125   -0.881  1.00 23.99 ? 419  LEU A CD1   1 
ATOM   3319 C  CD2   . LEU A 1 422 ? 21.481 4.226   0.635   1.00 24.87 ? 419  LEU A CD2   1 
ATOM   3320 N  N     . THR A 1 423 ? 24.726 5.186   4.159   1.00 22.11 ? 420  THR A N     1 
ATOM   3321 C  CA    . THR A 1 423 ? 25.906 5.500   4.968   1.00 20.92 ? 420  THR A CA    1 
ATOM   3322 C  C     . THR A 1 423 ? 27.211 5.413   4.167   1.00 20.35 ? 420  THR A C     1 
ATOM   3323 O  O     . THR A 1 423 ? 28.305 5.594   4.714   1.00 18.92 ? 420  THR A O     1 
ATOM   3324 C  CB    . THR A 1 423 ? 26.002 4.571   6.178   1.00 25.96 ? 420  THR A CB    1 
ATOM   3325 O  OG1   . THR A 1 423 ? 25.929 3.210   5.733   1.00 30.15 ? 420  THR A OG1   1 
ATOM   3326 C  CG2   . THR A 1 423 ? 24.849 4.846   7.139   1.00 30.66 ? 420  THR A CG2   1 
ATOM   3327 N  N     . MET A 1 424 ? 27.093 5.120   2.877   1.00 16.35 ? 421  MET A N     1 
ATOM   3328 C  CA    . MET A 1 424 ? 28.270 5.109   2.011   1.00 16.70 ? 421  MET A CA    1 
ATOM   3329 C  C     . MET A 1 424 ? 27.852 5.254   0.558   1.00 19.02 ? 421  MET A C     1 
ATOM   3330 O  O     . MET A 1 424 ? 26.857 4.660   0.141   1.00 17.04 ? 421  MET A O     1 
ATOM   3331 C  CB    . MET A 1 424 ? 29.073 3.817   2.207   1.00 20.46 ? 421  MET A CB    1 
ATOM   3332 C  CG    . MET A 1 424 ? 30.382 3.738   1.398   1.00 20.97 ? 421  MET A CG    1 
ATOM   3333 S  SD    . MET A 1 424 ? 30.137 3.213   -0.320  1.00 19.76 ? 421  MET A SD    1 
ATOM   3334 C  CE    . MET A 1 424 ? 29.620 1.519   -0.069  1.00 18.90 ? 421  MET A CE    1 
ATOM   3335 N  N     . LEU A 1 425 ? 28.591 6.074   -0.192  1.00 13.71 ? 422  LEU A N     1 
ATOM   3336 C  CA    . LEU A 1 425 ? 28.474 6.139   -1.650  1.00 15.46 ? 422  LEU A CA    1 
ATOM   3337 C  C     . LEU A 1 425 ? 29.851 5.904   -2.270  1.00 14.89 ? 422  LEU A C     1 
ATOM   3338 O  O     . LEU A 1 425 ? 30.862 6.365   -1.732  1.00 15.30 ? 422  LEU A O     1 
ATOM   3339 C  CB    . LEU A 1 425 ? 27.956 7.503   -2.115  1.00 14.77 ? 422  LEU A CB    1 
ATOM   3340 C  CG    . LEU A 1 425 ? 26.537 7.953   -1.760  1.00 18.34 ? 422  LEU A CG    1 
ATOM   3341 C  CD1   . LEU A 1 425 ? 26.279 9.357   -2.304  1.00 20.92 ? 422  LEU A CD1   1 
ATOM   3342 C  CD2   . LEU A 1 425 ? 25.497 6.967   -2.280  1.00 18.80 ? 422  LEU A CD2   1 
ATOM   3343 N  N     . PHE A 1 426 ? 29.883 5.217   -3.413  1.00 13.25 ? 423  PHE A N     1 
ATOM   3344 C  CA    . PHE A 1 426 ? 31.137 4.836   -4.061  1.00 13.91 ? 423  PHE A CA    1 
ATOM   3345 C  C     . PHE A 1 426 ? 30.911 4.855   -5.564  1.00 16.23 ? 423  PHE A C     1 
ATOM   3346 O  O     . PHE A 1 426 ? 29.959 4.241   -6.051  1.00 19.72 ? 423  PHE A O     1 
ATOM   3347 C  CB    . PHE A 1 426 ? 31.540 3.423   -3.599  1.00 15.01 ? 423  PHE A CB    1 
ATOM   3348 C  CG    . PHE A 1 426 ? 32.839 2.921   -4.173  1.00 19.41 ? 423  PHE A CG    1 
ATOM   3349 C  CD1   . PHE A 1 426 ? 33.005 1.570   -4.437  1.00 39.17 ? 423  PHE A CD1   1 
ATOM   3350 C  CD2   . PHE A 1 426 ? 33.899 3.777   -4.420  1.00 18.92 ? 423  PHE A CD2   1 
ATOM   3351 C  CE1   . PHE A 1 426 ? 34.196 1.087   -4.956  1.00 31.63 ? 423  PHE A CE1   1 
ATOM   3352 C  CE2   . PHE A 1 426 ? 35.094 3.301   -4.934  1.00 23.76 ? 423  PHE A CE2   1 
ATOM   3353 C  CZ    . PHE A 1 426 ? 35.243 1.956   -5.201  1.00 26.80 ? 423  PHE A CZ    1 
ATOM   3354 N  N     . LEU A 1 427 ? 31.747 5.589   -6.291  1.00 10.84 ? 424  LEU A N     1 
ATOM   3355 C  CA    . LEU A 1 427 ? 31.746 5.536   -7.755  1.00 12.20 ? 424  LEU A CA    1 
ATOM   3356 C  C     . LEU A 1 427 ? 33.111 5.074   -8.231  1.00 13.97 ? 424  LEU A C     1 
ATOM   3357 O  O     . LEU A 1 427 ? 34.127 5.584   -7.778  1.00 15.47 ? 424  LEU A O     1 
ATOM   3358 C  CB    . LEU A 1 427 ? 31.446 6.909   -8.376  1.00 11.67 ? 424  LEU A CB    1 
ATOM   3359 C  CG    . LEU A 1 427 ? 30.103 7.572   -8.100  1.00 17.10 ? 424  LEU A CG    1 
ATOM   3360 C  CD1   . LEU A 1 427 ? 30.043 8.945   -8.781  1.00 16.23 ? 424  LEU A CD1   1 
ATOM   3361 C  CD2   . LEU A 1 427 ? 28.976 6.653   -8.566  1.00 17.13 ? 424  LEU A CD2   1 
ATOM   3362 N  N     . CYS A 1 428 ? 33.150 4.127   -9.164  1.00 10.74 ? 425  CYS A N     1 
ATOM   3363 C  CA    . CYS A 1 428 ? 34.439 3.608   -9.614  1.00 13.75 ? 425  CYS A CA    1 
ATOM   3364 C  C     . CYS A 1 428 ? 34.464 3.387   -11.128 1.00 17.48 ? 425  CYS A C     1 
ATOM   3365 O  O     . CYS A 1 428 ? 33.600 2.698   -11.675 1.00 19.30 ? 425  CYS A O     1 
ATOM   3366 C  CB    . CYS A 1 428 ? 34.782 2.316   -8.876  1.00 18.37 ? 425  CYS A CB    1 
ATOM   3367 S  SG    . CYS A 1 428 ? 36.466 1.719   -9.210  1.00 21.55 ? 425  CYS A SG    1 
ATOM   3368 N  N     . ALA A 1 429 ? 35.458 3.983   -11.784 1.00 12.29 ? 426  ALA A N     1 
ATOM   3369 C  CA    . ALA A 1 429 ? 35.655 3.829   -13.222 1.00 12.97 ? 426  ALA A CA    1 
ATOM   3370 C  C     . ALA A 1 429 ? 36.559 2.629   -13.470 1.00 18.61 ? 426  ALA A C     1 
ATOM   3371 O  O     . ALA A 1 429 ? 37.613 2.497   -12.840 1.00 14.56 ? 426  ALA A O     1 
ATOM   3372 C  CB    . ALA A 1 429 ? 36.278 5.081   -13.804 1.00 14.04 ? 426  ALA A CB    1 
ATOM   3373 N  N     . THR A 1 430 ? 36.148 1.758   -14.386 1.00 14.76 ? 427  THR A N     1 
ATOM   3374 C  CA    . THR A 1 430 ? 36.865 0.503   -14.609 1.00 21.05 ? 427  THR A CA    1 
ATOM   3375 C  C     . THR A 1 430 ? 36.879 0.112   -16.083 1.00 20.53 ? 427  THR A C     1 
ATOM   3376 O  O     . THR A 1 430 ? 36.270 0.781   -16.915 1.00 16.14 ? 427  THR A O     1 
ATOM   3377 C  CB    . THR A 1 430 ? 36.241 -0.665  -13.800 1.00 19.84 ? 427  THR A CB    1 
ATOM   3378 O  OG1   . THR A 1 430 ? 34.951 -0.987  -14.332 1.00 24.04 ? 427  THR A OG1   1 
ATOM   3379 C  CG2   . THR A 1 430 ? 36.091 -0.295  -12.326 1.00 24.19 ? 427  THR A CG2   1 
ATOM   3380 N  N     . LYS A 1 431 ? 37.584 -0.977  -16.386 1.00 17.32 ? 428  LYS A N     1 
ATOM   3381 C  CA    . LYS A 1 431 ? 37.629 -1.548  -17.734 1.00 21.64 ? 428  LYS A CA    1 
ATOM   3382 C  C     . LYS A 1 431 ? 38.219 -0.585  -18.763 1.00 16.04 ? 428  LYS A C     1 
ATOM   3383 O  O     . LYS A 1 431 ? 37.545 -0.152  -19.708 1.00 17.85 ? 428  LYS A O     1 
ATOM   3384 C  CB    . LYS A 1 431 ? 36.248 -2.054  -18.162 1.00 19.12 ? 428  LYS A CB    1 
ATOM   3385 C  CG    . LYS A 1 431 ? 35.747 -3.198  -17.293 1.00 30.98 ? 428  LYS A CG    1 
ATOM   3386 C  CD    . LYS A 1 431 ? 34.608 -3.960  -17.955 1.00 36.22 ? 428  LYS A CD    1 
ATOM   3387 C  CE    . LYS A 1 431 ? 34.111 -5.083  -17.056 1.00 45.05 ? 428  LYS A CE    1 
ATOM   3388 N  NZ    . LYS A 1 431 ? 35.233 -5.933  -16.565 1.00 42.59 ? 428  LYS A NZ    1 
ATOM   3389 N  N     . PHE A 1 432 ? 39.492 -0.261  -18.579 1.00 17.51 ? 429  PHE A N     1 
ATOM   3390 C  CA    . PHE A 1 432 ? 40.165 0.689   -19.454 1.00 12.94 ? 429  PHE A CA    1 
ATOM   3391 C  C     . PHE A 1 432 ? 40.503 0.097   -20.814 1.00 19.87 ? 429  PHE A C     1 
ATOM   3392 O  O     . PHE A 1 432 ? 40.834 -1.092  -20.929 1.00 19.52 ? 429  PHE A O     1 
ATOM   3393 C  CB    . PHE A 1 432 ? 41.435 1.239   -18.788 1.00 15.19 ? 429  PHE A CB    1 
ATOM   3394 C  CG    . PHE A 1 432 ? 41.160 2.227   -17.686 1.00 17.15 ? 429  PHE A CG    1 
ATOM   3395 C  CD1   . PHE A 1 432 ? 41.106 3.588   -17.951 1.00 16.18 ? 429  PHE A CD1   1 
ATOM   3396 C  CD2   . PHE A 1 432 ? 40.950 1.797   -16.386 1.00 24.05 ? 429  PHE A CD2   1 
ATOM   3397 C  CE1   . PHE A 1 432 ? 40.845 4.504   -16.943 1.00 17.88 ? 429  PHE A CE1   1 
ATOM   3398 C  CE2   . PHE A 1 432 ? 40.691 2.710   -15.368 1.00 23.81 ? 429  PHE A CE2   1 
ATOM   3399 C  CZ    . PHE A 1 432 ? 40.639 4.064   -15.646 1.00 21.50 ? 429  PHE A CZ    1 
ATOM   3400 N  N     . SER A 1 433 ? 40.403 0.948   -21.834 1.00 18.48 ? 430  SER A N     1 
ATOM   3401 C  CA    . SER A 1 433 ? 40.809 0.619   -23.198 1.00 20.97 ? 430  SER A CA    1 
ATOM   3402 C  C     . SER A 1 433 ? 41.770 1.681   -23.716 1.00 23.08 ? 430  SER A C     1 
ATOM   3403 O  O     . SER A 1 433 ? 41.672 2.854   -23.352 1.00 17.22 ? 430  SER A O     1 
ATOM   3404 C  CB    . SER A 1 433 ? 39.589 0.536   -24.121 1.00 26.54 ? 430  SER A CB    1 
ATOM   3405 O  OG    . SER A 1 433 ? 38.769 -0.568  -23.790 1.00 33.85 ? 430  SER A OG    1 
ATOM   3406 N  N     . ALA A 1 434 ? 42.707 1.273   -24.564 1.00 20.11 ? 431  ALA A N     1 
ATOM   3407 C  CA    . ALA A 1 434 ? 43.676 2.213   -25.098 1.00 22.75 ? 431  ALA A CA    1 
ATOM   3408 C  C     . ALA A 1 434 ? 42.953 3.305   -25.873 1.00 26.87 ? 431  ALA A C     1 
ATOM   3409 O  O     . ALA A 1 434 ? 41.901 3.061   -26.468 1.00 26.88 ? 431  ALA A O     1 
ATOM   3410 C  CB    . ALA A 1 434 ? 44.683 1.497   -25.982 1.00 25.88 ? 431  ALA A CB    1 
ATOM   3411 N  N     . SER A 1 435 ? 43.509 4.512   -25.848 1.00 22.58 ? 432  SER A N     1 
ATOM   3412 C  CA    . SER A 1 435 ? 42.937 5.628   -26.596 1.00 25.53 ? 432  SER A CA    1 
ATOM   3413 C  C     . SER A 1 435 ? 44.035 6.567   -27.089 1.00 28.16 ? 432  SER A C     1 
ATOM   3414 O  O     . SER A 1 435 ? 43.766 7.592   -27.712 1.00 36.20 ? 432  SER A O     1 
ATOM   3415 C  CB    . SER A 1 435 ? 41.931 6.390   -25.737 1.00 28.64 ? 432  SER A CB    1 
ATOM   3416 O  OG    . SER A 1 435 ? 42.574 6.970   -24.615 1.00 38.50 ? 432  SER A OG    1 
ATOM   3417 O  OXT   . SER A 1 435 ? 45.225 6.318   -26.881 1.00 35.78 ? 432  SER A OXT   1 
ATOM   3418 O  "O3'" . DC  B 2 1   ? 27.921 4.896   11.748  1.00 41.40 ? 1    DC  T "O3'" 1 
ATOM   3419 P  P     . DA  B 2 2   ? 28.198 4.543   13.293  1.00 65.80 ? 2    DA  T P     1 
ATOM   3420 O  OP1   . DA  B 2 2   ? 28.158 3.067   13.440  1.00 59.30 ? 2    DA  T OP1   1 
ATOM   3421 O  OP2   . DA  B 2 2   ? 27.316 5.397   14.123  1.00 54.77 ? 2    DA  T OP2   1 
ATOM   3422 O  "O5'" . DA  B 2 2   ? 29.692 5.057   13.535  1.00 48.89 ? 2    DA  T "O5'" 1 
ATOM   3423 C  "C5'" . DA  B 2 2   ? 30.746 4.752   12.633  1.00 41.70 ? 2    DA  T "C5'" 1 
ATOM   3424 C  "C4'" . DA  B 2 2   ? 31.982 5.502   13.087  1.00 39.04 ? 2    DA  T "C4'" 1 
ATOM   3425 O  "O4'" . DA  B 2 2   ? 31.832 6.912   12.790  1.00 40.54 ? 2    DA  T "O4'" 1 
ATOM   3426 C  "C3'" . DA  B 2 2   ? 32.217 5.423   14.592  1.00 43.30 ? 2    DA  T "C3'" 1 
ATOM   3427 O  "O3'" . DA  B 2 2   ? 33.603 5.368   14.856  1.00 40.13 ? 2    DA  T "O3'" 1 
ATOM   3428 C  "C2'" . DA  B 2 2   ? 31.597 6.709   15.133  1.00 41.24 ? 2    DA  T "C2'" 1 
ATOM   3429 C  "C1'" . DA  B 2 2   ? 31.851 7.674   13.984  1.00 37.21 ? 2    DA  T "C1'" 1 
ATOM   3430 N  N9    . DA  B 2 2   ? 30.839 8.723   13.881  1.00 30.17 ? 2    DA  T N9    1 
ATOM   3431 C  C8    . DA  B 2 2   ? 29.563 8.725   14.378  1.00 30.31 ? 2    DA  T C8    1 
ATOM   3432 N  N7    . DA  B 2 2   ? 28.897 9.825   14.114  1.00 33.12 ? 2    DA  T N7    1 
ATOM   3433 C  C5    . DA  B 2 2   ? 29.802 10.596  13.401  1.00 31.68 ? 2    DA  T C5    1 
ATOM   3434 C  C6    . DA  B 2 2   ? 29.723 11.879  12.828  1.00 33.50 ? 2    DA  T C6    1 
ATOM   3435 N  N6    . DA  B 2 2   ? 28.636 12.656  12.883  1.00 29.90 ? 2    DA  T N6    1 
ATOM   3436 N  N1    . DA  B 2 2   ? 30.814 12.338  12.186  1.00 34.11 ? 2    DA  T N1    1 
ATOM   3437 C  C2    . DA  B 2 2   ? 31.905 11.570  12.118  1.00 23.84 ? 2    DA  T C2    1 
ATOM   3438 N  N3    . DA  B 2 2   ? 32.101 10.356  12.619  1.00 33.53 ? 2    DA  T N3    1 
ATOM   3439 C  C4    . DA  B 2 2   ? 31.000 9.929   13.253  1.00 28.97 ? 2    DA  T C4    1 
ATOM   3440 P  P     . DT  B 2 3   ? 34.287 3.972   15.251  1.00 37.85 ? 3    DT  T P     1 
ATOM   3441 O  OP1   . DT  B 2 3   ? 33.249 3.113   15.860  1.00 48.51 ? 3    DT  T OP1   1 
ATOM   3442 O  OP2   . DT  B 2 3   ? 35.538 4.270   15.983  1.00 38.19 ? 3    DT  T OP2   1 
ATOM   3443 O  "O5'" . DT  B 2 3   ? 34.667 3.326   13.839  1.00 43.59 ? 3    DT  T "O5'" 1 
ATOM   3444 C  "C5'" . DT  B 2 3   ? 35.961 3.534   13.287  1.00 33.46 ? 3    DT  T "C5'" 1 
ATOM   3445 C  "C4'" . DT  B 2 3   ? 35.979 4.816   12.483  1.00 36.31 ? 3    DT  T "C4'" 1 
ATOM   3446 O  "O4'" . DT  B 2 3   ? 37.341 5.143   12.123  1.00 35.97 ? 3    DT  T "O4'" 1 
ATOM   3447 C  "C3'" . DT  B 2 3   ? 35.225 4.759   11.164  1.00 34.07 ? 3    DT  T "C3'" 1 
ATOM   3448 O  "O3'" . DT  B 2 3   ? 34.770 6.050   10.870  1.00 31.69 ? 3    DT  T "O3'" 1 
ATOM   3449 C  "C2'" . DT  B 2 3   ? 36.301 4.329   10.173  1.00 34.40 ? 3    DT  T "C2'" 1 
ATOM   3450 C  "C1'" . DT  B 2 3   ? 37.494 5.106   10.714  1.00 33.19 ? 3    DT  T "C1'" 1 
ATOM   3451 N  N1    . DT  B 2 3   ? 38.823 4.486   10.467  1.00 36.74 ? 3    DT  T N1    1 
ATOM   3452 C  C2    . DT  B 2 3   ? 39.819 5.254   9.901   1.00 30.53 ? 3    DT  T C2    1 
ATOM   3453 O  O2    . DT  B 2 3   ? 39.657 6.420   9.579   1.00 44.29 ? 3    DT  T O2    1 
ATOM   3454 N  N3    . DT  B 2 3   ? 41.017 4.605   9.724   1.00 34.36 ? 3    DT  T N3    1 
ATOM   3455 C  C4    . DT  B 2 3   ? 41.300 3.290   10.058  1.00 32.16 ? 3    DT  T C4    1 
ATOM   3456 O  O4    . DT  B 2 3   ? 42.406 2.798   9.864   1.00 31.11 ? 3    DT  T O4    1 
ATOM   3457 C  C5    . DT  B 2 3   ? 40.211 2.546   10.651  1.00 27.66 ? 3    DT  T C5    1 
ATOM   3458 C  C7    . DT  B 2 3   ? 40.398 1.110   11.057  1.00 42.18 ? 3    DT  T C7    1 
ATOM   3459 C  C6    . DT  B 2 3   ? 39.040 3.170   10.833  1.00 33.89 ? 3    DT  T C6    1 
ATOM   3460 P  P     . DT  B 2 4   ? 34.103 6.358   9.445   1.00 36.88 ? 4    DT  T P     1 
ATOM   3461 O  OP1   . DT  B 2 4   ? 33.294 7.588   9.576   1.00 36.87 ? 4    DT  T OP1   1 
ATOM   3462 O  OP2   . DT  B 2 4   ? 33.487 5.106   8.950   1.00 40.27 ? 4    DT  T OP2   1 
ATOM   3463 O  "O5'" . DT  B 2 4   ? 35.362 6.666   8.508   1.00 24.18 ? 4    DT  T "O5'" 1 
ATOM   3464 C  "C5'" . DT  B 2 4   ? 35.989 7.935   8.584   1.00 20.90 ? 4    DT  T "C5'" 1 
ATOM   3465 C  "C4'" . DT  B 2 4   ? 36.750 8.133   7.287   1.00 15.91 ? 4    DT  T "C4'" 1 
ATOM   3466 O  "O4'" . DT  B 2 4   ? 37.892 7.246   7.260   1.00 19.31 ? 4    DT  T "O4'" 1 
ATOM   3467 C  "C3'" . DT  B 2 4   ? 35.968 7.825   6.019   1.00 15.42 ? 4    DT  T "C3'" 1 
ATOM   3468 O  "O3'" . DT  B 2 4   ? 36.283 8.889   5.145   1.00 15.55 ? 4    DT  T "O3'" 1 
ATOM   3469 C  "C2'" . DT  B 2 4   ? 36.518 6.474   5.556   1.00 15.97 ? 4    DT  T "C2'" 1 
ATOM   3470 C  "C1'" . DT  B 2 4   ? 37.966 6.589   6.011   1.00 18.75 ? 4    DT  T "C1'" 1 
ATOM   3471 N  N1    . DT  B 2 4   ? 38.686 5.332   6.311   1.00 16.17 ? 4    DT  T N1    1 
ATOM   3472 C  C2    . DT  B 2 4   ? 40.026 5.302   6.001   1.00 14.26 ? 4    DT  T C2    1 
ATOM   3473 O  O2    . DT  B 2 4   ? 40.607 6.236   5.466   1.00 14.55 ? 4    DT  T O2    1 
ATOM   3474 N  N3    . DT  B 2 4   ? 40.653 4.133   6.318   1.00 17.66 ? 4    DT  T N3    1 
ATOM   3475 C  C4    . DT  B 2 4   ? 40.112 3.017   6.914   1.00 16.65 ? 4    DT  T C4    1 
ATOM   3476 O  O4    . DT  B 2 4   ? 40.793 2.027   7.153   1.00 18.46 ? 4    DT  T O4    1 
ATOM   3477 C  C5    . DT  B 2 4   ? 38.705 3.114   7.233   1.00 19.51 ? 4    DT  T C5    1 
ATOM   3478 C  C7    . DT  B 2 4   ? 38.016 1.950   7.880   1.00 20.84 ? 4    DT  T C7    1 
ATOM   3479 C  C6    . DT  B 2 4   ? 38.065 4.260   6.928   1.00 15.91 ? 4    DT  T C6    1 
ATOM   3480 P  P     . DA  B 2 5   ? 35.713 8.914   3.646   1.00 14.49 ? 5    DA  T P     1 
ATOM   3481 O  OP1   . DA  B 2 5   ? 35.437 10.313  3.299   1.00 18.35 ? 5    DA  T OP1   1 
ATOM   3482 O  OP2   . DA  B 2 5   ? 34.660 7.885   3.527   1.00 15.57 ? 5    DA  T OP2   1 
ATOM   3483 O  "O5'" . DA  B 2 5   ? 36.944 8.377   2.776   1.00 13.55 ? 5    DA  T "O5'" 1 
ATOM   3484 C  "C5'" . DA  B 2 5   ? 38.095 9.203   2.617   1.00 12.23 ? 5    DA  T "C5'" 1 
ATOM   3485 C  "C4'" . DA  B 2 5   ? 39.038 8.569   1.626   1.00 10.69 ? 5    DA  T "C4'" 1 
ATOM   3486 O  "O4'" . DA  B 2 5   ? 39.619 7.363   2.198   1.00 14.80 ? 5    DA  T "O4'" 1 
ATOM   3487 C  "C3'" . DA  B 2 5   ? 38.368 8.135   0.318   1.00 10.28 ? 5    DA  T "C3'" 1 
ATOM   3488 O  "O3'" . DA  B 2 5   ? 39.288 8.335   -0.743  1.00 12.93 ? 5    DA  T "O3'" 1 
ATOM   3489 C  "C2'" . DA  B 2 5   ? 38.160 6.648   0.566   1.00 14.41 ? 5    DA  T "C2'" 1 
ATOM   3490 C  "C1'" . DA  B 2 5   ? 39.467 6.316   1.278   1.00 17.07 ? 5    DA  T "C1'" 1 
ATOM   3491 N  N9    . DA  B 2 5   ? 39.422 5.078   2.038   1.00 13.10 ? 5    DA  T N9    1 
ATOM   3492 C  C8    . DA  B 2 5   ? 38.346 4.560   2.695   1.00 13.53 ? 5    DA  T C8    1 
ATOM   3493 N  N7    . DA  B 2 5   ? 38.593 3.437   3.314   1.00 16.12 ? 5    DA  T N7    1 
ATOM   3494 C  C5    . DA  B 2 5   ? 39.931 3.195   3.038   1.00 14.73 ? 5    DA  T C5    1 
ATOM   3495 C  C6    . DA  B 2 5   ? 40.795 2.147   3.401   1.00 17.04 ? 5    DA  T C6    1 
ATOM   3496 N  N6    . DA  B 2 5   ? 40.430 1.108   4.154   1.00 15.73 ? 5    DA  T N6    1 
ATOM   3497 N  N1    . DA  B 2 5   ? 42.060 2.220   2.958   1.00 13.92 ? 5    DA  T N1    1 
ATOM   3498 C  C2    . DA  B 2 5   ? 42.439 3.265   2.213   1.00 14.14 ? 5    DA  T C2    1 
ATOM   3499 N  N3    . DA  B 2 5   ? 41.726 4.303   1.800   1.00 11.90 ? 5    DA  T N3    1 
ATOM   3500 C  C4    . DA  B 2 5   ? 40.461 4.200   2.257   1.00 13.77 ? 5    DA  T C4    1 
ATOM   3501 P  P     . DT  B 2 6   ? 38.786 8.363   -2.277  1.00 12.77 ? 6    DT  T P     1 
ATOM   3502 O  OP1   . DT  B 2 6   ? 39.913 8.842   -3.098  1.00 13.24 ? 6    DT  T OP1   1 
ATOM   3503 O  OP2   . DT  B 2 6   ? 37.509 9.103   -2.330  1.00 14.13 ? 6    DT  T OP2   1 
ATOM   3504 O  "O5'" . DT  B 2 6   ? 38.444 6.831   -2.582  1.00 15.54 ? 6    DT  T "O5'" 1 
ATOM   3505 C  "C5'" . DT  B 2 6   ? 39.220 6.055   -3.472  1.00 14.60 ? 6    DT  T "C5'" 1 
ATOM   3506 C  "C4'" . DT  B 2 6   ? 40.464 5.457   -2.840  1.00 15.00 ? 6    DT  T "C4'" 1 
ATOM   3507 O  "O4'" . DT  B 2 6   ? 40.145 4.780   -1.608  1.00 16.42 ? 6    DT  T "O4'" 1 
ATOM   3508 C  "C3'" . DT  B 2 6   ? 41.020 4.374   -3.747  1.00 16.35 ? 6    DT  T "C3'" 1 
ATOM   3509 O  "O3'" . DT  B 2 6   ? 42.001 4.985   -4.522  1.00 14.65 ? 6    DT  T "O3'" 1 
ATOM   3510 C  "C2'" . DT  B 2 6   ? 41.606 3.310   -2.821  1.00 21.41 ? 6    DT  T "C2'" 1 
ATOM   3511 C  "C1'" . DT  B 2 6   ? 41.051 3.704   -1.456  1.00 16.66 ? 6    DT  T "C1'" 1 
ATOM   3512 N  N1    . DT  B 2 6   ? 40.345 2.633   -0.735  1.00 15.71 ? 6    DT  T N1    1 
ATOM   3513 C  C2    . DT  B 2 6   ? 41.058 1.540   -0.307  1.00 15.68 ? 6    DT  T C2    1 
ATOM   3514 O  O2    . DT  B 2 6   ? 42.244 1.387   -0.536  1.00 17.13 ? 6    DT  T O2    1 
ATOM   3515 N  N3    . DT  B 2 6   ? 40.322 0.627   0.397   1.00 13.74 ? 6    DT  T N3    1 
ATOM   3516 C  C4    . DT  B 2 6   ? 38.981 0.697   0.710   1.00 19.68 ? 6    DT  T C4    1 
ATOM   3517 O  O4    . DT  B 2 6   ? 38.417 -0.184  1.350   1.00 17.72 ? 6    DT  T O4    1 
ATOM   3518 C  C5    . DT  B 2 6   ? 38.301 1.877   0.246   1.00 17.46 ? 6    DT  T C5    1 
ATOM   3519 C  C7    . DT  B 2 6   ? 36.835 2.071   0.531   1.00 17.60 ? 6    DT  T C7    1 
ATOM   3520 C  C6    . DT  B 2 6   ? 39.009 2.781   -0.439  1.00 17.78 ? 6    DT  T C6    1 
ATOM   3521 P  P     . DG  B 2 7   ? 42.145 4.622   -6.078  1.00 14.85 ? 7    DG  T P     1 
ATOM   3522 O  OP1   . DG  B 2 7   ? 43.300 5.371   -6.605  1.00 16.12 ? 7    DG  T OP1   1 
ATOM   3523 O  OP2   . DG  B 2 7   ? 40.825 4.729   -6.709  1.00 14.10 ? 7    DG  T OP2   1 
ATOM   3524 O  "O5'" . DG  B 2 7   ? 42.438 3.038   -6.072  1.00 17.53 ? 7    DG  T "O5'" 1 
ATOM   3525 C  "C5'" . DG  B 2 7   ? 43.755 2.560   -5.923  1.00 23.35 ? 7    DG  T "C5'" 1 
ATOM   3526 C  "C4'" . DG  B 2 7   ? 43.751 1.053   -5.750  1.00 14.49 ? 7    DG  T "C4'" 1 
ATOM   3527 O  "O4'" . DG  B 2 7   ? 43.053 0.713   -4.537  1.00 17.68 ? 7    DG  T "O4'" 1 
ATOM   3528 C  "C3'" . DG  B 2 7   ? 43.089 0.243   -6.871  1.00 20.99 ? 7    DG  T "C3'" 1 
ATOM   3529 O  "O3'" . DG  B 2 7   ? 44.116 -0.468  -7.515  1.00 21.12 ? 7    DG  T "O3'" 1 
ATOM   3530 C  "C2'" . DG  B 2 7   ? 42.171 -0.718  -6.133  1.00 22.89 ? 7    DG  T "C2'" 1 
ATOM   3531 C  "C1'" . DG  B 2 7   ? 42.656 -0.623  -4.693  1.00 19.01 ? 7    DG  T "C1'" 1 
ATOM   3532 N  N9    . DG  B 2 7   ? 41.583 -0.947  -3.766  1.00 17.65 ? 7    DG  T N9    1 
ATOM   3533 C  C8    . DG  B 2 7   ? 40.398 -0.287  -3.557  1.00 15.87 ? 7    DG  T C8    1 
ATOM   3534 N  N7    . DG  B 2 7   ? 39.644 -0.857  -2.655  1.00 16.56 ? 7    DG  T N7    1 
ATOM   3535 C  C5    . DG  B 2 7   ? 40.379 -1.961  -2.256  1.00 13.66 ? 7    DG  T C5    1 
ATOM   3536 C  C6    . DG  B 2 7   ? 40.081 -2.957  -1.305  1.00 12.51 ? 7    DG  T C6    1 
ATOM   3537 O  O6    . DG  B 2 7   ? 39.062 -3.062  -0.613  1.00 15.73 ? 7    DG  T O6    1 
ATOM   3538 N  N1    . DG  B 2 7   ? 41.112 -3.896  -1.222  1.00 12.54 ? 7    DG  T N1    1 
ATOM   3539 C  C2    . DG  B 2 7   ? 42.278 -3.874  -1.943  1.00 13.58 ? 7    DG  T C2    1 
ATOM   3540 N  N2    . DG  B 2 7   ? 43.163 -4.866  -1.724  1.00 13.43 ? 7    DG  T N2    1 
ATOM   3541 N  N3    . DG  B 2 7   ? 42.565 -2.942  -2.837  1.00 15.76 ? 7    DG  T N3    1 
ATOM   3542 C  C4    . DG  B 2 7   ? 41.576 -2.027  -2.925  1.00 14.09 ? 7    DG  T C4    1 
ATOM   3543 P  P     . DA  B 2 8   ? 43.825 -1.355  -8.825  1.00 17.52 ? 8    DA  T P     1 
ATOM   3544 O  OP1   . DA  B 2 8   ? 44.877 -1.061  -9.803  1.00 19.66 ? 8    DA  T OP1   1 
ATOM   3545 O  OP2   . DA  B 2 8   ? 42.377 -1.262  -9.166  1.00 19.78 ? 8    DA  T OP2   1 
ATOM   3546 O  "O5'" . DA  B 2 8   ? 44.105 -2.847  -8.331  1.00 16.66 ? 8    DA  T "O5'" 1 
ATOM   3547 C  "C5'" . DA  B 2 8   ? 45.401 -3.092  -7.785  1.00 15.61 ? 8    DA  T "C5'" 1 
ATOM   3548 C  "C4'" . DA  B 2 8   ? 45.499 -4.544  -7.365  1.00 17.34 ? 8    DA  T "C4'" 1 
ATOM   3549 O  "O4'" . DA  B 2 8   ? 44.674 -4.722  -6.192  1.00 19.51 ? 8    DA  T "O4'" 1 
ATOM   3550 C  "C3'" . DA  B 2 8   ? 45.002 -5.524  -8.422  1.00 19.37 ? 8    DA  T "C3'" 1 
ATOM   3551 O  "O3'" . DA  B 2 8   ? 45.865 -6.628  -8.488  1.00 20.73 ? 8    DA  T "O3'" 1 
ATOM   3552 C  "C2'" . DA  B 2 8   ? 43.634 -5.949  -7.915  1.00 19.39 ? 8    DA  T "C2'" 1 
ATOM   3553 C  "C1'" . DA  B 2 8   ? 43.770 -5.785  -6.406  1.00 23.23 ? 8    DA  T "C1'" 1 
ATOM   3554 N  N9    . DA  B 2 8   ? 42.478 -5.434  -5.841  1.00 18.52 ? 8    DA  T N9    1 
ATOM   3555 C  C8    . DA  B 2 8   ? 41.678 -4.408  -6.252  1.00 19.21 ? 8    DA  T C8    1 
ATOM   3556 N  N7    . DA  B 2 8   ? 40.559 -4.329  -5.587  1.00 13.70 ? 8    DA  T N7    1 
ATOM   3557 C  C5    . DA  B 2 8   ? 40.625 -5.377  -4.685  1.00 13.44 ? 8    DA  T C5    1 
ATOM   3558 C  C6    . DA  B 2 8   ? 39.736 -5.825  -3.699  1.00 12.05 ? 8    DA  T C6    1 
ATOM   3559 N  N6    . DA  B 2 8   ? 38.561 -5.241  -3.439  1.00 14.61 ? 8    DA  T N6    1 
ATOM   3560 N  N1    . DA  B 2 8   ? 40.103 -6.910  -2.969  1.00 13.51 ? 8    DA  T N1    1 
ATOM   3561 C  C2    . DA  B 2 8   ? 41.282 -7.474  -3.230  1.00 12.01 ? 8    DA  T C2    1 
ATOM   3562 N  N3    . DA  B 2 8   ? 42.207 -7.147  -4.136  1.00 12.97 ? 8    DA  T N3    1 
ATOM   3563 C  C4    . DA  B 2 8   ? 41.803 -6.076  -4.835  1.00 14.11 ? 8    DA  T C4    1 
ATOM   3564 P  P     . DC  B 2 9   ? 45.701 -7.722  -9.656  1.00 21.56 ? 9    DC  T P     1 
ATOM   3565 O  OP1   . DC  B 2 9   ? 47.044 -8.222  -9.987  1.00 22.56 ? 9    DC  T OP1   1 
ATOM   3566 O  OP2   . DC  B 2 9   ? 44.835 -7.154  -10.714 1.00 24.35 ? 9    DC  T OP2   1 
ATOM   3567 O  "O5'" . DC  B 2 9   ? 44.870 -8.888  -8.957  1.00 15.99 ? 9    DC  T "O5'" 1 
ATOM   3568 C  "C5'" . DC  B 2 9   ? 45.493 -9.536  -7.870  1.00 23.20 ? 9    DC  T "C5'" 1 
ATOM   3569 C  "C4'" . DC  B 2 9   ? 44.493 -10.443 -7.201  1.00 19.99 ? 9    DC  T "C4'" 1 
ATOM   3570 O  "O4'" . DC  B 2 9   ? 43.412 -9.656  -6.641  1.00 22.86 ? 9    DC  T "O4'" 1 
ATOM   3571 C  "C3'" . DC  B 2 9   ? 43.828 -11.428 -8.152  1.00 20.45 ? 9    DC  T "C3'" 1 
ATOM   3572 O  "O3'" . DC  B 2 9   ? 43.810 -12.657 -7.478  1.00 28.64 ? 9    DC  T "O3'" 1 
ATOM   3573 C  "C2'" . DC  B 2 9   ? 42.416 -10.873 -8.323  1.00 21.22 ? 9    DC  T "C2'" 1 
ATOM   3574 C  "C1'" . DC  B 2 9   ? 42.201 -10.318 -6.922  1.00 20.63 ? 9    DC  T "C1'" 1 
ATOM   3575 N  N1    . DC  B 2 9   ? 41.088 -9.357  -6.851  1.00 16.84 ? 9    DC  T N1    1 
ATOM   3576 C  C2    . DC  B 2 9   ? 40.150 -9.468  -5.828  1.00 16.59 ? 9    DC  T C2    1 
ATOM   3577 O  O2    . DC  B 2 9   ? 40.277 -10.372 -4.982  1.00 18.31 ? 9    DC  T O2    1 
ATOM   3578 N  N3    . DC  B 2 9   ? 39.126 -8.588  -5.795  1.00 13.97 ? 9    DC  T N3    1 
ATOM   3579 C  C4    . DC  B 2 9   ? 39.027 -7.627  -6.716  1.00 16.84 ? 9    DC  T C4    1 
ATOM   3580 N  N4    . DC  B 2 9   ? 37.992 -6.788  -6.621  1.00 17.15 ? 9    DC  T N4    1 
ATOM   3581 C  C5    . DC  B 2 9   ? 39.971 -7.502  -7.773  1.00 21.41 ? 9    DC  T C5    1 
ATOM   3582 C  C6    . DC  B 2 9   ? 40.979 -8.381  -7.800  1.00 19.29 ? 9    DC  T C6    1 
ATOM   3583 P  P     . DG  B 2 10  ? 43.443 -14.006 -8.263  1.00 27.30 ? 10   DG  T P     1 
ATOM   3584 O  OP1   . DG  B 2 10  ? 44.643 -14.863 -8.267  1.00 36.29 ? 10   DG  T OP1   1 
ATOM   3585 O  OP2   . DG  B 2 10  ? 42.767 -13.637 -9.524  1.00 27.38 ? 10   DG  T OP2   1 
ATOM   3586 O  "O5'" . DG  B 2 10  ? 42.344 -14.682 -7.335  1.00 23.50 ? 10   DG  T "O5'" 1 
ATOM   3587 C  "C5'" . DG  B 2 10  ? 42.551 -14.749 -5.942  1.00 28.81 ? 10   DG  T "C5'" 1 
ATOM   3588 C  "C4'" . DG  B 2 10  ? 41.350 -15.422 -5.313  1.00 22.88 ? 10   DG  T "C4'" 1 
ATOM   3589 O  "O4'" . DG  B 2 10  ? 40.301 -14.449 -5.086  1.00 30.26 ? 10   DG  T "O4'" 1 
ATOM   3590 C  "C3'" . DG  B 2 10  ? 40.737 -16.518 -6.178  1.00 32.48 ? 10   DG  T "C3'" 1 
ATOM   3591 O  "O3'" . DG  B 2 10  ? 40.210 -17.527 -5.321  1.00 32.91 ? 10   DG  T "O3'" 1 
ATOM   3592 C  "C2'" . DG  B 2 10  ? 39.653 -15.767 -6.946  1.00 31.59 ? 10   DG  T "C2'" 1 
ATOM   3593 C  "C1'" . DG  B 2 10  ? 39.187 -14.751 -5.908  1.00 25.84 ? 10   DG  T "C1'" 1 
ATOM   3594 N  N9    . DG  B 2 10  ? 38.673 -13.518 -6.501  1.00 20.68 ? 10   DG  T N9    1 
ATOM   3595 C  C8    . DG  B 2 10  ? 39.281 -12.710 -7.432  1.00 21.48 ? 10   DG  T C8    1 
ATOM   3596 N  N7    . DG  B 2 10  ? 38.562 -11.676 -7.774  1.00 17.54 ? 10   DG  T N7    1 
ATOM   3597 C  C5    . DG  B 2 10  ? 37.404 -11.806 -7.028  1.00 19.16 ? 10   DG  T C5    1 
ATOM   3598 C  C6    . DG  B 2 10  ? 36.251 -10.985 -6.979  1.00 15.87 ? 10   DG  T C6    1 
ATOM   3599 O  O6    . DG  B 2 10  ? 36.027 -9.943  -7.605  1.00 20.96 ? 10   DG  T O6    1 
ATOM   3600 N  N1    . DG  B 2 10  ? 35.305 -11.478 -6.083  1.00 20.37 ? 10   DG  T N1    1 
ATOM   3601 C  C2    . DG  B 2 10  ? 35.454 -12.632 -5.345  1.00 19.00 ? 10   DG  T C2    1 
ATOM   3602 N  N2    . DG  B 2 10  ? 34.435 -12.955 -4.538  1.00 22.65 ? 10   DG  T N2    1 
ATOM   3603 N  N3    . DG  B 2 10  ? 36.526 -13.411 -5.378  1.00 21.08 ? 10   DG  T N3    1 
ATOM   3604 C  C4    . DG  B 2 10  ? 37.460 -12.935 -6.235  1.00 15.31 ? 10   DG  T C4    1 
ATOM   3605 P  P     . DC  B 2 11  ? 39.570 -18.870 -5.937  1.00 33.47 ? 11   DC  T P     1 
ATOM   3606 O  OP1   . DC  B 2 11  ? 40.042 -20.012 -5.128  1.00 39.29 ? 11   DC  T OP1   1 
ATOM   3607 O  OP2   . DC  B 2 11  ? 39.830 -18.885 -7.387  1.00 29.45 ? 11   DC  T OP2   1 
ATOM   3608 O  "O5'" . DC  B 2 11  ? 38.003 -18.658 -5.726  1.00 33.85 ? 11   DC  T "O5'" 1 
ATOM   3609 C  "C5'" . DC  B 2 11  ? 37.478 -18.346 -4.451  1.00 27.29 ? 11   DC  T "C5'" 1 
ATOM   3610 C  "C4'" . DC  B 2 11  ? 35.958 -18.279 -4.515  1.00 25.37 ? 11   DC  T "C4'" 1 
ATOM   3611 O  "O4'" . DC  B 2 11  ? 35.521 -17.021 -5.097  1.00 21.83 ? 11   DC  T "O4'" 1 
ATOM   3612 C  "C3'" . DC  B 2 11  ? 35.297 -19.382 -5.343  1.00 18.31 ? 11   DC  T "C3'" 1 
ATOM   3613 O  "O3'" . DC  B 2 11  ? 34.229 -19.900 -4.554  1.00 15.92 ? 11   DC  T "O3'" 1 
ATOM   3614 C  "C2'" . DC  B 2 11  ? 34.832 -18.671 -6.620  1.00 17.46 ? 11   DC  T "C2'" 1 
ATOM   3615 C  "C1'" . DC  B 2 11  ? 34.554 -17.265 -6.112  1.00 22.90 ? 11   DC  T "C1'" 1 
ATOM   3616 N  N1    . DC  B 2 11  ? 34.745 -16.159 -7.086  1.00 14.19 ? 11   DC  T N1    1 
ATOM   3617 C  C2    . DC  B 2 11  ? 33.729 -15.208 -7.263  1.00 14.61 ? 11   DC  T C2    1 
ATOM   3618 O  O2    . DC  B 2 11  ? 32.658 -15.303 -6.653  1.00 14.94 ? 11   DC  T O2    1 
ATOM   3619 N  N3    . DC  B 2 11  ? 33.944 -14.195 -8.147  1.00 14.70 ? 11   DC  T N3    1 
ATOM   3620 C  C4    . DC  B 2 11  ? 35.103 -14.123 -8.808  1.00 15.26 ? 11   DC  T C4    1 
ATOM   3621 N  N4    . DC  B 2 11  ? 35.269 -13.094 -9.658  1.00 15.56 ? 11   DC  T N4    1 
ATOM   3622 C  C5    . DC  B 2 11  ? 36.147 -15.074 -8.632  1.00 12.98 ? 11   DC  T C5    1 
ATOM   3623 C  C6    . DC  B 2 11  ? 35.930 -16.074 -7.757  1.00 14.27 ? 11   DC  T C6    1 
ATOM   3624 P  P     . DT  B 2 12  ? 33.482 -21.256 -4.994  1.00 17.97 ? 12   DT  T P     1 
ATOM   3625 O  OP1   . DT  B 2 12  ? 32.945 -21.894 -3.774  1.00 21.32 ? 12   DT  T OP1   1 
ATOM   3626 O  OP2   . DT  B 2 12  ? 34.385 -22.007 -5.879  1.00 16.26 ? 12   DT  T OP2   1 
ATOM   3627 O  "O5'" . DT  B 2 12  ? 32.252 -20.726 -5.863  1.00 19.67 ? 12   DT  T "O5'" 1 
ATOM   3628 C  "C5'" . DT  B 2 12  ? 31.171 -20.139 -5.167  1.00 19.62 ? 12   DT  T "C5'" 1 
ATOM   3629 C  "C4'" . DT  B 2 12  ? 30.130 -19.687 -6.157  1.00 22.64 ? 12   DT  T "C4'" 1 
ATOM   3630 O  "O4'" . DT  B 2 12  ? 30.684 -18.570 -6.888  1.00 18.93 ? 12   DT  T "O4'" 1 
ATOM   3631 C  "C3'" . DT  B 2 12  ? 29.788 -20.758 -7.189  1.00 22.22 ? 12   DT  T "C3'" 1 
ATOM   3632 O  "O3'" . DT  B 2 12  ? 28.393 -20.731 -7.465  1.00 20.67 ? 12   DT  T "O3'" 1 
ATOM   3633 C  "C2'" . DT  B 2 12  ? 30.627 -20.339 -8.395  1.00 19.44 ? 12   DT  T "C2'" 1 
ATOM   3634 C  "C1'" . DT  B 2 12  ? 30.504 -18.825 -8.268  1.00 23.92 ? 12   DT  T "C1'" 1 
ATOM   3635 N  N1    . DT  B 2 12  ? 31.485 -18.028 -9.069  1.00 24.50 ? 12   DT  T N1    1 
ATOM   3636 C  C2    . DT  B 2 12  ? 31.101 -16.764 -9.456  1.00 18.26 ? 12   DT  T C2    1 
ATOM   3637 O  O2    . DT  B 2 12  ? 30.024 -16.289 -9.168  1.00 24.49 ? 12   DT  T O2    1 
ATOM   3638 N  N3    . DT  B 2 12  ? 32.012 -16.073 -10.193 1.00 24.18 ? 12   DT  T N3    1 
ATOM   3639 C  C4    . DT  B 2 12  ? 33.259 -16.512 -10.587 1.00 13.07 ? 12   DT  T C4    1 
ATOM   3640 O  O4    . DT  B 2 12  ? 33.985 -15.799 -11.264 1.00 21.60 ? 12   DT  T O4    1 
ATOM   3641 C  C5    . DT  B 2 12  ? 33.615 -17.847 -10.153 1.00 20.76 ? 12   DT  T C5    1 
ATOM   3642 C  C7    . DT  B 2 12  ? 34.946 -18.426 -10.522 1.00 23.68 ? 12   DT  T C7    1 
ATOM   3643 C  C6    . DT  B 2 12  ? 32.721 -18.540 -9.423  1.00 21.69 ? 12   DT  T C6    1 
ATOM   3644 O  "O5'" A DA  C 3 1   ? 29.099 -7.724  -15.080 0.50 31.11 ? 1    DA  P "O5'" 1 
ATOM   3645 O  "O5'" B DA  C 3 1   ? 29.317 -8.249  -15.670 0.50 30.24 ? 1    DA  P "O5'" 1 
ATOM   3646 C  "C5'" A DA  C 3 1   ? 27.754 -7.871  -15.509 0.50 29.22 ? 1    DA  P "C5'" 1 
ATOM   3647 C  "C5'" B DA  C 3 1   ? 27.914 -8.182  -15.867 0.50 29.32 ? 1    DA  P "C5'" 1 
ATOM   3648 C  "C4'" A DA  C 3 1   ? 26.927 -8.591  -14.460 0.50 28.93 ? 1    DA  P "C4'" 1 
ATOM   3649 C  "C4'" B DA  C 3 1   ? 27.153 -8.601  -14.620 0.50 28.78 ? 1    DA  P "C4'" 1 
ATOM   3650 O  "O4'" A DA  C 3 1   ? 27.489 -9.911  -14.265 0.50 29.38 ? 1    DA  P "O4'" 1 
ATOM   3651 O  "O4'" B DA  C 3 1   ? 27.508 -9.961  -14.282 0.50 29.38 ? 1    DA  P "O4'" 1 
ATOM   3652 C  "C3'" A DA  C 3 1   ? 26.875 -7.917  -13.091 0.50 25.75 ? 1    DA  P "C3'" 1 
ATOM   3653 C  "C3'" B DA  C 3 1   ? 27.395 -7.750  -13.377 0.50 25.77 ? 1    DA  P "C3'" 1 
ATOM   3654 O  "O3'" A DA  C 3 1   ? 25.530 -7.914  -12.588 0.50 21.93 ? 1    DA  P "O3'" 1 
ATOM   3655 O  "O3'" B DA  C 3 1   ? 26.163 -7.312  -12.851 0.50 25.75 ? 1    DA  P "O3'" 1 
ATOM   3656 C  "C2'" A DA  C 3 1   ? 27.834 -8.732  -12.222 0.50 26.39 ? 1    DA  P "C2'" 1 
ATOM   3657 C  "C2'" B DA  C 3 1   ? 28.047 -8.661  -12.347 0.50 26.59 ? 1    DA  P "C2'" 1 
ATOM   3658 C  "C1'" A DA  C 3 1   ? 27.958 -10.076 -12.942 0.50 27.73 ? 1    DA  P "C1'" 1 
ATOM   3659 C  "C1'" B DA  C 3 1   ? 27.985 -10.053 -12.958 0.50 27.74 ? 1    DA  P "C1'" 1 
ATOM   3660 N  N9    . DA  C 3 1   ? 29.319 -10.617 -13.023 1.00 23.33 ? 1    DA  P N9    1 
ATOM   3661 C  C8    . DA  C 3 1   ? 30.347 -10.174 -13.804 1.00 28.79 ? 1    DA  P C8    1 
ATOM   3662 N  N7    . DA  C 3 1   ? 31.453 -10.869 -13.659 1.00 28.48 ? 1    DA  P N7    1 
ATOM   3663 C  C5    . DA  C 3 1   ? 31.111 -11.825 -12.720 1.00 21.83 ? 1    DA  P C5    1 
ATOM   3664 C  C6    . DA  C 3 1   ? 31.839 -12.872 -12.137 1.00 23.54 ? 1    DA  P C6    1 
ATOM   3665 N  N6    . DA  C 3 1   ? 33.109 -13.115 -12.441 1.00 20.62 ? 1    DA  P N6    1 
ATOM   3666 N  N1    . DA  C 3 1   ? 31.206 -13.650 -11.236 1.00 25.13 ? 1    DA  P N1    1 
ATOM   3667 C  C2    . DA  C 3 1   ? 29.928 -13.394 -10.944 1.00 20.81 ? 1    DA  P C2    1 
ATOM   3668 N  N3    A DA  C 3 1   ? 29.139 -12.439 -11.428 0.50 21.18 ? 1    DA  P N3    1 
ATOM   3669 N  N3    B DA  C 3 1   ? 29.140 -12.437 -11.426 0.50 21.18 ? 1    DA  P N3    1 
ATOM   3670 C  C4    . DA  C 3 1   ? 29.803 -11.688 -12.317 1.00 20.66 ? 1    DA  P C4    1 
ATOM   3671 P  P     A DG  C 3 2   ? 24.997 -6.676  -11.709 0.50 18.63 ? 2    DG  P P     1 
ATOM   3672 P  P     B DG  C 3 2   ? 26.136 -6.223  -11.670 0.50 25.83 ? 2    DG  P P     1 
ATOM   3673 O  OP1   A DG  C 3 2   ? 23.527 -6.641  -11.807 0.50 21.79 ? 2    DG  P OP1   1 
ATOM   3674 O  OP1   B DG  C 3 2   ? 24.796 -5.594  -11.669 0.50 29.79 ? 2    DG  P OP1   1 
ATOM   3675 O  OP2   A DG  C 3 2   ? 25.781 -5.478  -12.090 0.50 24.44 ? 2    DG  P OP2   1 
ATOM   3676 O  OP2   B DG  C 3 2   ? 27.357 -5.396  -11.784 0.50 25.02 ? 2    DG  P OP2   1 
ATOM   3677 O  "O5'" A DG  C 3 2   ? 25.404 -7.074  -10.217 0.50 23.93 ? 2    DG  P "O5'" 1 
ATOM   3678 O  "O5'" B DG  C 3 2   ? 26.302 -7.102  -10.345 0.50 26.59 ? 2    DG  P "O5'" 1 
ATOM   3679 C  "C5'" A DG  C 3 2   ? 24.765 -8.172  -9.589  0.50 27.48 ? 2    DG  P "C5'" 1 
ATOM   3680 C  "C5'" B DG  C 3 2   ? 25.209 -7.841  -9.823  0.50 26.76 ? 2    DG  P "C5'" 1 
ATOM   3681 C  "C4'" A DG  C 3 2   ? 25.610 -8.714  -8.450  0.50 23.47 ? 2    DG  P "C4'" 1 
ATOM   3682 C  "C4'" B DG  C 3 2   ? 25.642 -8.573  -8.566  0.50 23.62 ? 2    DG  P "C4'" 1 
ATOM   3683 O  "O4'" A DG  C 3 2   ? 26.846 -9.281  -8.946  0.50 21.75 ? 2    DG  P "O4'" 1 
ATOM   3684 O  "O4'" B DG  C 3 2   ? 26.809 -9.378  -8.872  0.50 21.70 ? 2    DG  P "O4'" 1 
ATOM   3685 C  "C3'" A DG  C 3 2   ? 26.003 -7.703  -7.374  0.50 25.12 ? 2    DG  P "C3'" 1 
ATOM   3686 C  "C3'" B DG  C 3 2   ? 26.017 -7.672  -7.390  0.50 25.12 ? 2    DG  P "C3'" 1 
ATOM   3687 O  "O3'" A DG  C 3 2   ? 25.363 -8.177  -6.207  0.50 27.72 ? 2    DG  P "O3'" 1 
ATOM   3688 O  "O3'" B DG  C 3 2   ? 25.371 -8.172  -6.214  0.50 27.71 ? 2    DG  P "O3'" 1 
ATOM   3689 C  "C2'" A DG  C 3 2   ? 27.531 -7.778  -7.305  0.50 24.17 ? 2    DG  P "C2'" 1 
ATOM   3690 C  "C2'" B DG  C 3 2   ? 27.544 -7.757  -7.332  0.50 24.16 ? 2    DG  P "C2'" 1 
ATOM   3691 C  "C1'" A DG  C 3 2   ? 27.825 -9.132  -7.940  0.50 22.94 ? 2    DG  P "C1'" 1 
ATOM   3692 C  "C1'" B DG  C 3 2   ? 27.828 -9.135  -7.923  0.50 22.94 ? 2    DG  P "C1'" 1 
ATOM   3693 N  N9    . DG  C 3 2   ? 29.151 -9.275  -8.546  1.00 22.72 ? 2    DG  P N9    1 
ATOM   3694 C  C8    . DG  C 3 2   ? 29.806 -8.406  -9.398  1.00 21.25 ? 2    DG  P C8    1 
ATOM   3695 N  N7    . DG  C 3 2   ? 30.985 -8.842  -9.773  1.00 20.43 ? 2    DG  P N7    1 
ATOM   3696 C  C5    . DG  C 3 2   ? 31.131 -10.075 -9.130  1.00 18.79 ? 2    DG  P C5    1 
ATOM   3697 C  C6    . DG  C 3 2   ? 32.193 -11.029 -9.131  1.00 15.52 ? 2    DG  P C6    1 
ATOM   3698 O  O6    . DG  C 3 2   ? 33.280 -11.002 -9.728  1.00 16.47 ? 2    DG  P O6    1 
ATOM   3699 N  N1    . DG  C 3 2   ? 31.903 -12.139 -8.333  1.00 17.96 ? 2    DG  P N1    1 
ATOM   3700 C  C2    . DG  C 3 2   ? 30.733 -12.298 -7.629  1.00 14.59 ? 2    DG  P C2    1 
ATOM   3701 N  N2    . DG  C 3 2   ? 30.599 -13.423 -6.904  1.00 17.37 ? 2    DG  P N2    1 
ATOM   3702 N  N3    . DG  C 3 2   ? 29.744 -11.424 -7.615  1.00 22.41 ? 2    DG  P N3    1 
ATOM   3703 C  C4    . DG  C 3 2   ? 30.007 -10.342 -8.383  1.00 22.43 ? 2    DG  P C4    1 
ATOM   3704 P  P     . DC  C 3 3   ? 25.599 -7.463  -4.786  1.00 29.93 ? 3    DC  P P     1 
ATOM   3705 O  OP1   . DC  C 3 3   ? 24.338 -7.555  -4.023  1.00 31.37 ? 3    DC  P OP1   1 
ATOM   3706 O  OP2   . DC  C 3 3   ? 26.248 -6.158  -5.018  1.00 30.99 ? 3    DC  P OP2   1 
ATOM   3707 O  "O5'" . DC  C 3 3   ? 26.674 -8.406  -4.072  1.00 37.00 ? 3    DC  P "O5'" 1 
ATOM   3708 C  "C5'" . DC  C 3 3   ? 26.431 -9.804  -3.984  1.00 34.72 ? 3    DC  P "C5'" 1 
ATOM   3709 C  "C4'" . DC  C 3 3   ? 27.652 -10.495 -3.410  1.00 32.51 ? 3    DC  P "C4'" 1 
ATOM   3710 O  "O4'" . DC  C 3 3   ? 28.677 -10.519 -4.431  1.00 32.58 ? 3    DC  P "O4'" 1 
ATOM   3711 C  "C3'" . DC  C 3 3   ? 28.252 -9.804  -2.182  1.00 33.43 ? 3    DC  P "C3'" 1 
ATOM   3712 O  "O3'" . DC  C 3 3   ? 28.132 -10.649 -1.039  1.00 39.33 ? 3    DC  P "O3'" 1 
ATOM   3713 C  "C2'" . DC  C 3 3   ? 29.710 -9.542  -2.553  1.00 33.19 ? 3    DC  P "C2'" 1 
ATOM   3714 C  "C1'" . DC  C 3 3   ? 29.930 -10.399 -3.800  1.00 34.46 ? 3    DC  P "C1'" 1 
ATOM   3715 N  N1    . DC  C 3 3   ? 30.904 -9.769  -4.728  1.00 28.76 ? 3    DC  P N1    1 
ATOM   3716 C  C2    . DC  C 3 3   ? 32.057 -10.471 -5.071  1.00 19.54 ? 3    DC  P C2    1 
ATOM   3717 O  O2    . DC  C 3 3   ? 32.210 -11.604 -4.614  1.00 31.53 ? 3    DC  P O2    1 
ATOM   3718 N  N3    . DC  C 3 3   ? 32.960 -9.887  -5.900  1.00 26.74 ? 3    DC  P N3    1 
ATOM   3719 C  C4    . DC  C 3 3   ? 32.742 -8.657  -6.368  1.00 17.34 ? 3    DC  P C4    1 
ATOM   3720 N  N4    . DC  C 3 3   ? 33.652 -8.114  -7.184  1.00 23.01 ? 3    DC  P N4    1 
ATOM   3721 C  C5    . DC  C 3 3   ? 31.567 -7.923  -6.020  1.00 31.34 ? 3    DC  P C5    1 
ATOM   3722 C  C6    . DC  C 3 3   ? 30.690 -8.509  -5.199  1.00 24.99 ? 3    DC  P C6    1 
ATOM   3723 P  P     . DG  C 3 4   ? 28.699 -10.174 0.389   1.00 41.00 ? 4    DG  P P     1 
ATOM   3724 O  OP1   . DG  C 3 4   ? 27.925 -10.871 1.439   1.00 45.29 ? 4    DG  P OP1   1 
ATOM   3725 O  OP2   . DG  C 3 4   ? 28.790 -8.697  0.383   1.00 37.68 ? 4    DG  P OP2   1 
ATOM   3726 O  "O5'" . DG  C 3 4   ? 30.199 -10.735 0.402   1.00 33.07 ? 4    DG  P "O5'" 1 
ATOM   3727 C  "C5'" . DG  C 3 4   ? 30.407 -12.124 0.211   1.00 32.82 ? 4    DG  P "C5'" 1 
ATOM   3728 C  "C4'" . DG  C 3 4   ? 31.893 -12.416 0.205   1.00 38.79 ? 4    DG  P "C4'" 1 
ATOM   3729 O  "O4'" . DG  C 3 4   ? 32.488 -11.795 -0.960  1.00 36.27 ? 4    DG  P "O4'" 1 
ATOM   3730 C  "C3'" . DG  C 3 4   ? 32.637 -11.887 1.431   1.00 29.32 ? 4    DG  P "C3'" 1 
ATOM   3731 O  "O3'" . DG  C 3 4   ? 33.260 -12.991 2.102   1.00 39.95 ? 4    DG  P "O3'" 1 
ATOM   3732 C  "C2'" . DG  C 3 4   ? 33.622 -10.861 0.867   1.00 28.08 ? 4    DG  P "C2'" 1 
ATOM   3733 C  "C1'" . DG  C 3 4   ? 33.739 -11.248 -0.603  1.00 27.61 ? 4    DG  P "C1'" 1 
ATOM   3734 N  N9    . DG  C 3 4   ? 34.003 -10.128 -1.502  1.00 23.03 ? 4    DG  P N9    1 
ATOM   3735 C  C8    . DG  C 3 4   ? 33.206 -9.036  -1.764  1.00 24.29 ? 4    DG  P C8    1 
ATOM   3736 N  N7    . DG  C 3 4   ? 33.725 -8.209  -2.636  1.00 22.94 ? 4    DG  P N7    1 
ATOM   3737 C  C5    . DG  C 3 4   ? 34.943 -8.793  -2.969  1.00 19.68 ? 4    DG  P C5    1 
ATOM   3738 C  C6    . DG  C 3 4   ? 35.951 -8.371  -3.860  1.00 20.21 ? 4    DG  P C6    1 
ATOM   3739 O  O6    . DG  C 3 4   ? 35.984 -7.342  -4.556  1.00 24.32 ? 4    DG  P O6    1 
ATOM   3740 N  N1    . DG  C 3 4   ? 37.017 -9.270  -3.889  1.00 16.50 ? 4    DG  P N1    1 
ATOM   3741 C  C2    . DG  C 3 4   ? 37.094 -10.430 -3.153  1.00 18.02 ? 4    DG  P C2    1 
ATOM   3742 N  N2    . DG  C 3 4   ? 38.192 -11.181 -3.313  1.00 15.09 ? 4    DG  P N2    1 
ATOM   3743 N  N3    . DG  C 3 4   ? 36.154 -10.843 -2.323  1.00 18.64 ? 4    DG  P N3    1 
ATOM   3744 C  C4    . DG  C 3 4   ? 35.120 -9.972  -2.281  1.00 20.08 ? 4    DG  P C4    1 
ATOM   3745 P  P     . DT  C 3 5   ? 34.043 -12.766 3.491   1.00 38.69 ? 5    DT  P P     1 
ATOM   3746 O  OP1   . DT  C 3 5   ? 33.957 -14.020 4.271   1.00 38.21 ? 5    DT  P OP1   1 
ATOM   3747 O  OP2   . DT  C 3 5   ? 33.590 -11.486 4.073   1.00 32.88 ? 5    DT  P OP2   1 
ATOM   3748 O  "O5'" . DT  C 3 5   ? 35.561 -12.559 3.027   1.00 30.18 ? 5    DT  P "O5'" 1 
ATOM   3749 C  "C5'" . DT  C 3 5   ? 36.134 -13.538 2.187   1.00 22.91 ? 5    DT  P "C5'" 1 
ATOM   3750 C  "C4'" . DT  C 3 5   ? 37.565 -13.165 1.856   1.00 18.98 ? 5    DT  P "C4'" 1 
ATOM   3751 O  "O4'" . DT  C 3 5   ? 37.599 -12.135 0.831   1.00 19.17 ? 5    DT  P "O4'" 1 
ATOM   3752 C  "C3'" . DT  C 3 5   ? 38.369 -12.640 3.041   1.00 18.19 ? 5    DT  P "C3'" 1 
ATOM   3753 O  "O3'" . DT  C 3 5   ? 39.571 -13.396 3.070   1.00 17.77 ? 5    DT  P "O3'" 1 
ATOM   3754 C  "C2'" . DT  C 3 5   ? 38.598 -11.166 2.701   1.00 15.00 ? 5    DT  P "C2'" 1 
ATOM   3755 C  "C1'" . DT  C 3 5   ? 38.589 -11.179 1.181   1.00 16.32 ? 5    DT  P "C1'" 1 
ATOM   3756 N  N1    . DT  C 3 5   ? 38.188 -9.894  0.545   1.00 13.96 ? 5    DT  P N1    1 
ATOM   3757 C  C2    . DT  C 3 5   ? 39.013 -9.288  -0.381  1.00 12.74 ? 5    DT  P C2    1 
ATOM   3758 O  O2    . DT  C 3 5   ? 40.092 -9.725  -0.727  1.00 15.39 ? 5    DT  P O2    1 
ATOM   3759 N  N3    . DT  C 3 5   ? 38.526 -8.120  -0.908  1.00 14.44 ? 5    DT  P N3    1 
ATOM   3760 C  C4    . DT  C 3 5   ? 37.324 -7.516  -0.610  1.00 17.42 ? 5    DT  P C4    1 
ATOM   3761 O  O4    . DT  C 3 5   ? 36.991 -6.453  -1.149  1.00 15.61 ? 5    DT  P O4    1 
ATOM   3762 C  C5    . DT  C 3 5   ? 36.516 -8.197  0.374   1.00 20.60 ? 5    DT  P C5    1 
ATOM   3763 C  C7    . DT  C 3 5   ? 35.189 -7.633  0.788   1.00 18.90 ? 5    DT  P C7    1 
ATOM   3764 C  C6    . DT  C 3 5   ? 36.977 -9.343  0.910   1.00 14.24 ? 5    DT  P C6    1 
ATOM   3765 P  P     . DC  C 3 6   ? 40.572 -13.294 4.327   1.00 14.54 ? 6    DC  P P     1 
ATOM   3766 O  OP1   . DC  C 3 6   ? 41.289 -14.595 4.445   1.00 16.13 ? 6    DC  P OP1   1 
ATOM   3767 O  OP2   . DC  C 3 6   ? 39.832 -12.721 5.464   1.00 13.46 ? 6    DC  P OP2   1 
ATOM   3768 O  "O5'" . DC  C 3 6   ? 41.614 -12.174 3.875   1.00 13.70 ? 6    DC  P "O5'" 1 
ATOM   3769 C  "C5'" . DC  C 3 6   ? 42.515 -12.418 2.815   1.00 13.01 ? 6    DC  P "C5'" 1 
ATOM   3770 C  "C4'" . DC  C 3 6   ? 43.188 -11.099 2.503   1.00 15.26 ? 6    DC  P "C4'" 1 
ATOM   3771 O  "O4'" . DC  C 3 6   ? 42.223 -10.218 1.871   1.00 14.98 ? 6    DC  P "O4'" 1 
ATOM   3772 C  "C3'" . DC  C 3 6   ? 43.745 -10.332 3.704   1.00 13.31 ? 6    DC  P "C3'" 1 
ATOM   3773 O  "O3'" . DC  C 3 6   ? 45.172 -10.566 3.709   1.00 11.78 ? 6    DC  P "O3'" 1 
ATOM   3774 C  "C2'" . DC  C 3 6   ? 43.343 -8.875  3.416   1.00 14.65 ? 6    DC  P "C2'" 1 
ATOM   3775 C  "C1'" . DC  C 3 6   ? 42.735 -8.923  2.013   1.00 12.26 ? 6    DC  P "C1'" 1 
ATOM   3776 N  N1    . DC  C 3 6   ? 41.638 -7.944  1.843   1.00 12.04 ? 6    DC  P N1    1 
ATOM   3777 C  C2    . DC  C 3 6   ? 41.762 -6.995  0.826   1.00 11.57 ? 6    DC  P C2    1 
ATOM   3778 O  O2    . DC  C 3 6   ? 42.758 -7.028  0.086   1.00 13.93 ? 6    DC  P O2    1 
ATOM   3779 N  N3    . DC  C 3 6   ? 40.763 -6.090  0.678   1.00 12.51 ? 6    DC  P N3    1 
ATOM   3780 C  C4    . DC  C 3 6   ? 39.707 -6.104  1.496   1.00 13.26 ? 6    DC  P C4    1 
ATOM   3781 N  N4    . DC  C 3 6   ? 38.770 -5.173  1.298   1.00 13.12 ? 6    DC  P N4    1 
ATOM   3782 C  C5    . DC  C 3 6   ? 39.566 -7.050  2.550   1.00 13.85 ? 6    DC  P C5    1 
ATOM   3783 C  C6    . DC  C 3 6   ? 40.554 -7.951  2.682   1.00 13.40 ? 6    DC  P C6    1 
ATOM   3784 P  P     . DA  C 3 7   ? 46.144 -9.780  4.724   1.00 12.36 ? 7    DA  P P     1 
ATOM   3785 O  OP1   . DA  C 3 7   ? 47.376 -10.587 4.881   1.00 14.72 ? 7    DA  P OP1   1 
ATOM   3786 O  OP2   . DA  C 3 7   ? 45.363 -9.396  5.913   1.00 14.18 ? 7    DA  P OP2   1 
ATOM   3787 O  "O5'" A DA  C 3 7   ? 46.455 -8.400  3.965   0.50 15.76 ? 7    DA  P "O5'" 1 
ATOM   3788 O  "O5'" B DA  C 3 7   ? 46.460 -8.403  3.958   0.50 15.75 ? 7    DA  P "O5'" 1 
ATOM   3789 C  "C5'" A DA  C 3 7   ? 47.135 -8.327  2.723   0.50 18.52 ? 7    DA  P "C5'" 1 
ATOM   3790 C  "C5'" B DA  C 3 7   ? 47.105 -8.351  2.690   0.50 18.51 ? 7    DA  P "C5'" 1 
ATOM   3791 C  "C4'" A DA  C 3 7   ? 47.056 -6.896  2.212   0.50 21.17 ? 7    DA  P "C4'" 1 
ATOM   3792 C  "C4'" B DA  C 3 7   ? 47.058 -6.925  2.163   0.50 21.15 ? 7    DA  P "C4'" 1 
ATOM   3793 O  "O4'" A DA  C 3 7   ? 45.689 -6.579  1.854   0.50 18.75 ? 7    DA  P "O4'" 1 
ATOM   3794 O  "O4'" B DA  C 3 7   ? 45.707 -6.576  1.766   0.50 18.78 ? 7    DA  P "O4'" 1 
ATOM   3795 C  "C3'" A DA  C 3 7   ? 47.372 -5.798  3.227   0.50 18.58 ? 7    DA  P "C3'" 1 
ATOM   3796 C  "C3'" B DA  C 3 7   ? 47.350 -5.839  3.195   0.50 18.56 ? 7    DA  P "C3'" 1 
ATOM   3797 O  "O3'" A DA  C 3 7   ? 48.760 -5.534  3.361   0.50 27.99 ? 7    DA  P "O3'" 1 
ATOM   3798 O  "O3'" B DA  C 3 7   ? 48.725 -5.839  3.697   0.50 28.18 ? 7    DA  P "O3'" 1 
ATOM   3799 C  "C2'" A DA  C 3 7   ? 46.686 -4.573  2.641   0.50 20.00 ? 7    DA  P "C2'" 1 
ATOM   3800 C  "C2'" B DA  C 3 7   ? 46.810 -4.587  2.509   0.50 20.07 ? 7    DA  P "C2'" 1 
ATOM   3801 C  "C1'" A DA  C 3 7   ? 45.593 -5.168  1.777   0.50 19.69 ? 7    DA  P "C1'" 1 
ATOM   3802 C  "C1'" B DA  C 3 7   ? 45.608 -5.156  1.753   0.50 19.68 ? 7    DA  P "C1'" 1 
ATOM   3803 N  N9    . DA  C 3 7   ? 44.287 -4.723  2.232   1.00 14.16 ? 7    DA  P N9    1 
ATOM   3804 C  C8    . DA  C 3 7   ? 43.479 -5.291  3.182   1.00 14.79 ? 7    DA  P C8    1 
ATOM   3805 N  N7    . DA  C 3 7   ? 42.352 -4.644  3.370   1.00 15.37 ? 7    DA  P N7    1 
ATOM   3806 C  C5    . DA  C 3 7   ? 42.426 -3.578  2.480   1.00 15.47 ? 7    DA  P C5    1 
ATOM   3807 C  C6    . DA  C 3 7   ? 41.552 -2.516  2.182   1.00 16.15 ? 7    DA  P C6    1 
ATOM   3808 N  N6    . DA  C 3 7   ? 40.373 -2.368  2.781   1.00 14.13 ? 7    DA  P N6    1 
ATOM   3809 N  N1    . DA  C 3 7   ? 41.945 -1.622  1.243   1.00 11.86 ? 7    DA  P N1    1 
ATOM   3810 C  C2    . DA  C 3 7   ? 43.135 -1.794  0.652   1.00 14.76 ? 7    DA  P C2    1 
ATOM   3811 N  N3    . DA  C 3 7   ? 44.043 -2.750  0.850   1.00 12.77 ? 7    DA  P N3    1 
ATOM   3812 C  C4    . DA  C 3 7   ? 43.613 -3.613  1.781   1.00 13.57 ? 7    DA  P C4    1 
ATOM   3813 P  P     A DT  C 3 8   ? 49.265 -4.265  4.217   0.50 18.44 ? 8    DT  P P     1 
ATOM   3814 P  P     B DT  C 3 8   ? 49.889 -4.970  2.988   0.50 32.26 ? 8    DT  P P     1 
ATOM   3815 O  OP1   A DT  C 3 8   ? 50.724 -4.395  4.405   0.50 23.33 ? 8    DT  P OP1   1 
ATOM   3816 O  OP1   B DT  C 3 8   ? 50.171 -5.553  1.672   0.50 15.38 ? 8    DT  P OP1   1 
ATOM   3817 O  OP2   A DT  C 3 8   ? 48.384 -4.124  5.405   0.50 17.12 ? 8    DT  P OP2   1 
ATOM   3818 O  OP2   B DT  C 3 8   ? 50.969 -4.766  3.977   0.50 25.29 ? 8    DT  P OP2   1 
ATOM   3819 O  "O5'" A DT  C 3 8   ? 48.991 -3.017  3.248   0.50 23.99 ? 8    DT  P "O5'" 1 
ATOM   3820 O  "O5'" B DT  C 3 8   ? 49.221 -3.555  2.711   0.50 25.66 ? 8    DT  P "O5'" 1 
ATOM   3821 C  "C5'" A DT  C 3 8   ? 49.641 -2.856  1.964   0.50 20.06 ? 8    DT  P "C5'" 1 
ATOM   3822 C  "C5'" B DT  C 3 8   ? 49.796 -2.893  1.606   0.50 19.14 ? 8    DT  P "C5'" 1 
ATOM   3823 C  "C4'" . DT  C 3 8   ? 49.353 -1.449  1.458   1.00 17.41 ? 8    DT  P "C4'" 1 
ATOM   3824 O  "O4'" . DT  C 3 8   ? 47.920 -1.314  1.511   1.00 15.67 ? 8    DT  P "O4'" 1 
ATOM   3825 C  "C3'" . DT  C 3 8   ? 49.928 -0.394  2.402   1.00 16.61 ? 8    DT  P "C3'" 1 
ATOM   3826 O  "O3'" . DT  C 3 8   ? 50.514 0.636   1.626   1.00 16.35 ? 8    DT  P "O3'" 1 
ATOM   3827 C  "C2'" . DT  C 3 8   ? 48.710 0.121   3.171   1.00 18.83 ? 8    DT  P "C2'" 1 
ATOM   3828 C  "C1'" . DT  C 3 8   ? 47.574 -0.119  2.181   1.00 20.62 ? 8    DT  P "C1'" 1 
ATOM   3829 N  N1    . DT  C 3 8   ? 46.266 -0.293  2.869   1.00 15.02 ? 8    DT  P N1    1 
ATOM   3830 C  C2    . DT  C 3 8   ? 45.262 0.625   2.644   1.00 12.15 ? 8    DT  P C2    1 
ATOM   3831 O  O2    . DT  C 3 8   ? 45.390 1.570   1.892   1.00 17.12 ? 8    DT  P O2    1 
ATOM   3832 N  N3    . DT  C 3 8   ? 44.099 0.388   3.322   1.00 14.79 ? 8    DT  P N3    1 
ATOM   3833 C  C4    . DT  C 3 8   ? 43.841 -0.643  4.199   1.00 10.90 ? 8    DT  P C4    1 
ATOM   3834 O  O4    . DT  C 3 8   ? 42.775 -0.792  4.782   1.00 15.46 ? 8    DT  P O4    1 
ATOM   3835 C  C5    . DT  C 3 8   ? 44.932 -1.560  4.396   1.00 14.90 ? 8    DT  P C5    1 
ATOM   3836 C  C7    . DT  C 3 8   ? 44.752 -2.715  5.330   1.00 14.55 ? 8    DT  P C7    1 
ATOM   3837 C  C6    . DT  C 3 8   ? 46.074 -1.347  3.733   1.00 15.36 ? 8    DT  P C6    1 
HETATM 3838 NA NA    B NA  D 4 .   ? 52.931 0.560   1.677   0.60 13.79 ? 501  NA  A NA    1 
HETATM 3839 CA CA    . CA  E 5 .   ? 54.875 2.635   3.659   1.00 9.75  ? 503  CA  A CA    1 
HETATM 3840 C  C1    . GOL F 6 .   ? 60.688 -25.038 12.210  1.00 13.46 ? 504  GOL A C1    1 
HETATM 3841 O  O1    . GOL F 6 .   ? 59.291 -24.973 12.295  1.00 14.97 ? 504  GOL A O1    1 
HETATM 3842 C  C2    . GOL F 6 .   ? 61.202 -24.477 10.877  1.00 17.41 ? 504  GOL A C2    1 
HETATM 3843 O  O2    . GOL F 6 .   ? 60.715 -23.183 10.614  1.00 13.35 ? 504  GOL A O2    1 
HETATM 3844 C  C3    . GOL F 6 .   ? 60.908 -25.386 9.683   1.00 18.99 ? 504  GOL A C3    1 
HETATM 3845 O  O3    . GOL F 6 .   ? 61.686 -24.932 8.584   1.00 16.83 ? 504  GOL A O3    1 
HETATM 3846 C  C1    . GOL G 6 .   ? 54.263 16.699  -7.109  1.00 31.45 ? 505  GOL A C1    1 
HETATM 3847 O  O1    . GOL G 6 .   ? 54.031 15.351  -6.765  1.00 15.42 ? 505  GOL A O1    1 
HETATM 3848 C  C2    . GOL G 6 .   ? 54.892 16.745  -8.498  1.00 29.59 ? 505  GOL A C2    1 
HETATM 3849 O  O2    . GOL G 6 .   ? 54.001 16.167  -9.428  1.00 26.09 ? 505  GOL A O2    1 
HETATM 3850 C  C3    . GOL G 6 .   ? 55.159 18.192  -8.897  1.00 28.22 ? 505  GOL A C3    1 
HETATM 3851 O  O3    . GOL G 6 .   ? 55.815 18.199  -10.148 1.00 35.05 ? 505  GOL A O3    1 
HETATM 3852 C  C1    . GOL H 6 .   ? 54.686 28.317  4.709   1.00 25.29 ? 506  GOL A C1    1 
HETATM 3853 O  O1    . GOL H 6 .   ? 53.426 27.915  4.216   1.00 26.52 ? 506  GOL A O1    1 
HETATM 3854 C  C2    . GOL H 6 .   ? 55.159 27.329  5.775   1.00 34.67 ? 506  GOL A C2    1 
HETATM 3855 O  O2    . GOL H 6 .   ? 54.480 26.096  5.646   1.00 36.37 ? 506  GOL A O2    1 
HETATM 3856 C  C3    . GOL H 6 .   ? 56.662 27.110  5.636   1.00 29.14 ? 506  GOL A C3    1 
HETATM 3857 O  O3    . GOL H 6 .   ? 57.116 26.082  6.498   1.00 18.98 ? 506  GOL A O3    1 
HETATM 3858 P  PG    . DTP I 7 .   ? 55.310 2.644   7.196   1.00 9.77  ? 502  DTP P PG    1 
HETATM 3859 O  O1G   . DTP I 7 .   ? 55.001 1.754   8.379   1.00 10.15 ? 502  DTP P O1G   1 
HETATM 3860 O  O2G   . DTP I 7 .   ? 56.578 3.437   7.365   1.00 8.98  ? 502  DTP P O2G   1 
HETATM 3861 O  O3G   . DTP I 7 .   ? 55.198 1.941   5.875   1.00 9.85  ? 502  DTP P O3G   1 
HETATM 3862 P  PB    . DTP I 7 .   ? 53.132 4.209   6.082   1.00 9.38  ? 502  DTP P PB    1 
HETATM 3863 O  O1B   . DTP I 7 .   ? 53.827 4.412   4.754   1.00 8.37  ? 502  DTP P O1B   1 
HETATM 3864 O  O2B   . DTP I 7 .   ? 52.353 5.390   6.611   1.00 9.08  ? 502  DTP P O2B   1 
HETATM 3865 O  O3B   . DTP I 7 .   ? 54.118 3.755   7.279   1.00 9.80  ? 502  DTP P O3B   1 
HETATM 3866 P  PA    . DTP I 7 .   ? 51.611 2.080   4.784   1.00 10.37 ? 502  DTP P PA    1 
HETATM 3867 O  O1A   . DTP I 7 .   ? 50.755 0.988   5.403   1.00 15.07 ? 502  DTP P O1A   1 
HETATM 3868 O  O2A   . DTP I 7 .   ? 52.746 1.652   3.927   1.00 10.59 ? 502  DTP P O2A   1 
HETATM 3869 O  O3A   . DTP I 7 .   ? 52.134 2.933   6.069   1.00 10.33 ? 502  DTP P O3A   1 
HETATM 3870 O  "O5'" . DTP I 7 .   ? 50.608 3.076   4.031   1.00 9.79  ? 502  DTP P "O5'" 1 
HETATM 3871 C  "C5'" . DTP I 7 .   ? 51.031 3.993   3.025   1.00 8.99  ? 502  DTP P "C5'" 1 
HETATM 3872 C  "C4'" . DTP I 7 .   ? 50.105 5.202   3.038   1.00 10.04 ? 502  DTP P "C4'" 1 
HETATM 3873 O  "O4'" . DTP I 7 .   ? 48.774 4.819   2.663   1.00 11.61 ? 502  DTP P "O4'" 1 
HETATM 3874 C  "C3'" . DTP I 7 .   ? 49.986 5.811   4.430   1.00 8.11  ? 502  DTP P "C3'" 1 
HETATM 3875 O  "O3'" . DTP I 7 .   ? 50.989 6.816   4.619   1.00 9.07  ? 502  DTP P "O3'" 1 
HETATM 3876 C  "C2'" . DTP I 7 .   ? 48.579 6.396   4.434   1.00 9.25  ? 502  DTP P "C2'" 1 
HETATM 3877 C  "C1'" . DTP I 7 .   ? 47.807 5.456   3.510   1.00 10.24 ? 502  DTP P "C1'" 1 
HETATM 3878 N  N9    . DTP I 7 .   ? 47.075 4.420   4.274   1.00 11.79 ? 502  DTP P N9    1 
HETATM 3879 C  C8    . DTP I 7 .   ? 47.554 3.253   4.725   1.00 9.50  ? 502  DTP P C8    1 
HETATM 3880 N  N7    . DTP I 7 .   ? 46.558 2.597   5.366   1.00 10.94 ? 502  DTP P N7    1 
HETATM 3881 C  C5    . DTP I 7 .   ? 45.451 3.366   5.292   1.00 12.67 ? 502  DTP P C5    1 
HETATM 3882 C  C6    . DTP I 7 .   ? 44.147 3.232   5.742   1.00 14.88 ? 502  DTP P C6    1 
HETATM 3883 N  N6    . DTP I 7 .   ? 43.771 2.133   6.433   1.00 13.62 ? 502  DTP P N6    1 
HETATM 3884 N  N1    . DTP I 7 .   ? 43.260 4.222   5.501   1.00 12.35 ? 502  DTP P N1    1 
HETATM 3885 C  C2    . DTP I 7 .   ? 43.608 5.329   4.827   1.00 10.79 ? 502  DTP P C2    1 
HETATM 3886 N  N3    . DTP I 7 .   ? 44.867 5.479   4.376   1.00 12.77 ? 502  DTP P N3    1 
HETATM 3887 C  C4    . DTP I 7 .   ? 45.785 4.507   4.599   1.00 10.57 ? 502  DTP P C4    1 
HETATM 3888 O  O     . HOH J 8 .   ? 57.965 -23.570 14.155  1.00 9.09  ? 601  HOH A O     1 
HETATM 3889 O  O     . HOH J 8 .   ? 56.485 -13.994 -5.876  1.00 10.31 ? 602  HOH A O     1 
HETATM 3890 O  O     . HOH J 8 .   ? 43.917 -14.546 5.659   1.00 11.88 ? 603  HOH A O     1 
HETATM 3891 O  O     . HOH J 8 .   ? 67.487 -20.681 8.794   1.00 11.33 ? 604  HOH A O     1 
HETATM 3892 O  O     . HOH J 8 .   ? 64.162 -3.375  6.006   1.00 10.22 ? 605  HOH A O     1 
HETATM 3893 O  O     . HOH J 8 .   ? 51.888 5.810   9.254   1.00 10.37 ? 606  HOH A O     1 
HETATM 3894 O  O     . HOH J 8 .   ? 53.917 -28.550 4.093   1.00 12.36 ? 607  HOH A O     1 
HETATM 3895 O  O     . HOH J 8 .   ? 40.783 11.438  -3.568  1.00 12.90 ? 608  HOH A O     1 
HETATM 3896 O  O     . HOH J 8 .   ? 69.182 -17.616 -1.309  1.00 10.12 ? 609  HOH A O     1 
HETATM 3897 O  O     . HOH J 8 .   ? 73.224 -7.354  8.935   1.00 12.72 ? 610  HOH A O     1 
HETATM 3898 O  O     . HOH J 8 .   ? 60.519 -18.511 -4.665  1.00 10.24 ? 611  HOH A O     1 
HETATM 3899 O  O     . HOH J 8 .   ? 69.263 -13.493 5.035   1.00 9.76  ? 612  HOH A O     1 
HETATM 3900 O  O     . HOH J 8 .   ? 46.279 16.727  1.145   1.00 10.68 ? 613  HOH A O     1 
HETATM 3901 O  O     . HOH J 8 .   ? 55.555 17.466  -0.666  1.00 11.06 ? 614  HOH A O     1 
HETATM 3902 O  O     . HOH J 8 .   ? 67.270 -16.655 9.683   1.00 12.43 ? 615  HOH A O     1 
HETATM 3903 O  O     . HOH J 8 .   ? 59.524 9.619   10.734  1.00 10.82 ? 616  HOH A O     1 
HETATM 3904 O  O     . HOH J 8 .   ? 68.896 16.376  -4.038  1.00 13.95 ? 617  HOH A O     1 
HETATM 3905 O  O     . HOH J 8 .   ? 45.600 15.997  -1.599  1.00 12.60 ? 618  HOH A O     1 
HETATM 3906 O  O     . HOH J 8 .   ? 65.715 -22.951 3.271   1.00 11.70 ? 619  HOH A O     1 
HETATM 3907 O  O     . HOH J 8 .   ? 43.482 -33.242 -0.452  1.00 14.57 ? 620  HOH A O     1 
HETATM 3908 O  O     . HOH J 8 .   ? 43.620 12.126  -7.299  1.00 13.65 ? 621  HOH A O     1 
HETATM 3909 O  O     . HOH J 8 .   ? 62.524 7.438   7.096   1.00 11.77 ? 622  HOH A O     1 
HETATM 3910 O  O     . HOH J 8 .   ? 52.663 1.318   9.611   1.00 13.85 ? 623  HOH A O     1 
HETATM 3911 O  O     . HOH J 8 .   ? 60.855 -23.432 6.315   1.00 15.91 ? 624  HOH A O     1 
HETATM 3912 O  O     . HOH J 8 .   ? 58.638 -12.148 -11.490 1.00 12.51 ? 625  HOH A O     1 
HETATM 3913 O  O     . HOH J 8 .   ? 35.183 5.681   1.953   1.00 13.64 ? 626  HOH A O     1 
HETATM 3914 O  O     . HOH J 8 .   ? 54.747 -11.445 3.462   1.00 12.97 ? 627  HOH A O     1 
HETATM 3915 O  O     . HOH J 8 .   ? 53.766 -20.397 -2.567  1.00 13.56 ? 628  HOH A O     1 
HETATM 3916 O  O     . HOH J 8 .   ? 59.379 11.078  8.503   1.00 14.71 ? 629  HOH A O     1 
HETATM 3917 O  O     . HOH J 8 .   ? 70.726 -19.082 1.316   1.00 14.07 ? 630  HOH A O     1 
HETATM 3918 O  O     . HOH J 8 .   ? 50.254 -17.313 15.539  1.00 13.50 ? 631  HOH A O     1 
HETATM 3919 O  O     . HOH J 8 .   ? 49.160 -15.612 13.603  1.00 14.60 ? 632  HOH A O     1 
HETATM 3920 O  O     . HOH J 8 .   ? 60.010 11.541  -10.437 1.00 16.91 ? 633  HOH A O     1 
HETATM 3921 O  O     . HOH J 8 .   ? 42.240 -22.611 -2.600  1.00 14.34 ? 634  HOH A O     1 
HETATM 3922 O  O     . HOH J 8 .   ? 44.116 -15.086 1.380   1.00 19.17 ? 635  HOH A O     1 
HETATM 3923 O  O     . HOH J 8 .   ? 41.203 6.949   19.111  1.00 15.55 ? 636  HOH A O     1 
HETATM 3924 O  O     . HOH J 8 .   ? 52.317 15.774  -4.721  1.00 15.50 ? 637  HOH A O     1 
HETATM 3925 O  O     . HOH J 8 .   ? 70.767 -16.036 7.702   1.00 17.64 ? 638  HOH A O     1 
HETATM 3926 O  O     . HOH J 8 .   ? 53.692 13.572  -10.014 1.00 17.53 ? 639  HOH A O     1 
HETATM 3927 O  O     . HOH J 8 .   ? 42.067 8.203   3.302   1.00 15.72 ? 640  HOH A O     1 
HETATM 3928 O  O     . HOH J 8 .   ? 52.352 20.153  4.940   1.00 15.74 ? 641  HOH A O     1 
HETATM 3929 O  O     . HOH J 8 .   ? 62.691 14.845  -9.190  1.00 10.82 ? 642  HOH A O     1 
HETATM 3930 O  O     . HOH J 8 .   ? 68.385 -15.808 -7.687  1.00 21.78 ? 643  HOH A O     1 
HETATM 3931 O  O     . HOH J 8 .   ? 33.166 10.691  5.546   1.00 22.86 ? 644  HOH A O     1 
HETATM 3932 O  O     . HOH J 8 .   ? 65.783 -6.603  -13.917 1.00 15.78 ? 645  HOH A O     1 
HETATM 3933 O  O     . HOH J 8 .   ? 49.921 -3.187  -17.381 1.00 18.58 ? 646  HOH A O     1 
HETATM 3934 O  O     . HOH J 8 .   ? 53.960 17.333  -3.222  1.00 18.55 ? 647  HOH A O     1 
HETATM 3935 O  O     . HOH J 8 .   ? 54.298 -9.556  5.328   1.00 14.68 ? 648  HOH A O     1 
HETATM 3936 O  O     . HOH J 8 .   ? 71.180 3.544   -0.282  1.00 15.29 ? 649  HOH A O     1 
HETATM 3937 O  O     . HOH J 8 .   ? 51.402 5.535   -8.419  1.00 18.62 ? 650  HOH A O     1 
HETATM 3938 O  O     . HOH J 8 .   ? 49.992 2.957   12.875  1.00 17.81 ? 651  HOH A O     1 
HETATM 3939 O  O     . HOH J 8 .   ? 44.526 7.308   2.350   1.00 14.60 ? 652  HOH A O     1 
HETATM 3940 O  O     . HOH J 8 .   ? 53.215 -33.439 -0.268  1.00 21.03 ? 653  HOH A O     1 
HETATM 3941 O  O     . HOH J 8 .   ? 64.084 -9.488  -14.460 1.00 17.86 ? 654  HOH A O     1 
HETATM 3942 O  O     . HOH J 8 .   ? 41.199 7.728   -18.614 1.00 13.80 ? 655  HOH A O     1 
HETATM 3943 O  O     . HOH J 8 .   ? 53.483 -28.243 15.213  1.00 16.42 ? 656  HOH A O     1 
HETATM 3944 O  O     . HOH J 8 .   ? 65.948 -15.234 11.784  1.00 16.69 ? 657  HOH A O     1 
HETATM 3945 O  O     . HOH J 8 .   ? 50.671 -34.791 -0.779  1.00 17.93 ? 658  HOH A O     1 
HETATM 3946 O  O     . HOH J 8 .   ? 60.401 -17.750 -7.362  1.00 21.68 ? 659  HOH A O     1 
HETATM 3947 O  O     . HOH J 8 .   ? 51.211 3.509   10.463  1.00 16.11 ? 660  HOH A O     1 
HETATM 3948 O  O     . HOH J 8 .   ? 37.092 16.073  -4.239  1.00 23.75 ? 661  HOH A O     1 
HETATM 3949 O  O     . HOH J 8 .   ? 48.941 6.820   -11.840 1.00 20.04 ? 662  HOH A O     1 
HETATM 3950 O  O     . HOH J 8 .   ? 63.199 -26.645 6.987   1.00 16.59 ? 663  HOH A O     1 
HETATM 3951 O  O     . HOH J 8 .   ? 41.763 -30.543 -6.480  1.00 19.05 ? 664  HOH A O     1 
HETATM 3952 O  O     . HOH J 8 .   ? 45.070 -14.329 10.452  1.00 14.36 ? 665  HOH A O     1 
HETATM 3953 O  O     . HOH J 8 .   ? 71.595 6.078   -7.343  1.00 19.05 ? 666  HOH A O     1 
HETATM 3954 O  O     . HOH J 8 .   ? 41.431 17.034  -14.886 1.00 21.20 ? 667  HOH A O     1 
HETATM 3955 O  O     . HOH J 8 .   ? 45.099 7.386   -10.475 1.00 17.21 ? 668  HOH A O     1 
HETATM 3956 O  O     . HOH J 8 .   ? 44.087 11.019  -12.510 1.00 19.12 ? 669  HOH A O     1 
HETATM 3957 O  O     . HOH J 8 .   ? 46.781 -0.261  -15.227 1.00 18.00 ? 670  HOH A O     1 
HETATM 3958 O  O     . HOH J 8 .   ? 40.578 16.745  5.931   1.00 20.35 ? 671  HOH A O     1 
HETATM 3959 O  O     . HOH J 8 .   ? 59.888 10.489  19.786  1.00 17.78 ? 672  HOH A O     1 
HETATM 3960 O  O     . HOH J 8 .   ? 49.391 8.496   -13.654 1.00 22.25 ? 673  HOH A O     1 
HETATM 3961 O  O     . HOH J 8 .   ? 58.487 -18.022 19.849  1.00 19.43 ? 674  HOH A O     1 
HETATM 3962 O  O     . HOH J 8 .   ? 61.581 8.035   9.848   1.00 18.93 ? 675  HOH A O     1 
HETATM 3963 O  O     . HOH J 8 .   ? 49.228 7.454   -7.719  1.00 20.88 ? 676  HOH A O     1 
HETATM 3964 O  O     . HOH J 8 .   ? 43.700 9.794   -10.110 1.00 18.53 ? 677  HOH A O     1 
HETATM 3965 O  O     . HOH J 8 .   ? 48.673 -22.164 -5.618  1.00 18.99 ? 678  HOH A O     1 
HETATM 3966 O  O     . HOH J 8 .   ? 78.190 -0.939  5.271   1.00 19.77 ? 679  HOH A O     1 
HETATM 3967 O  O     . HOH J 8 .   ? 51.532 5.185   -11.039 1.00 20.08 ? 680  HOH A O     1 
HETATM 3968 O  O     . HOH J 8 .   ? 69.527 4.508   3.864   1.00 20.72 ? 681  HOH A O     1 
HETATM 3969 O  O     . HOH J 8 .   ? 60.004 14.126  -8.773  1.00 16.90 ? 682  HOH A O     1 
HETATM 3970 O  O     . HOH J 8 .   ? 42.676 15.621  23.761  1.00 20.56 ? 683  HOH A O     1 
HETATM 3971 O  O     . HOH J 8 .   ? 41.385 -23.904 -5.056  1.00 23.02 ? 684  HOH A O     1 
HETATM 3972 O  O     . HOH J 8 .   ? 48.963 2.776   21.177  1.00 20.25 ? 685  HOH A O     1 
HETATM 3973 O  O     . HOH J 8 .   ? 72.183 -3.820  -13.901 1.00 22.42 ? 686  HOH A O     1 
HETATM 3974 O  O     . HOH J 8 .   ? 41.541 15.817  -23.015 1.00 21.91 ? 687  HOH A O     1 
HETATM 3975 O  O     . HOH J 8 .   ? 47.925 10.569  -9.811  1.00 23.36 ? 688  HOH A O     1 
HETATM 3976 O  O     . HOH J 8 .   ? 65.643 5.756   2.217   1.00 20.85 ? 689  HOH A O     1 
HETATM 3977 O  O     . HOH J 8 .   ? 48.576 -36.842 2.606   1.00 22.83 ? 690  HOH A O     1 
HETATM 3978 O  O     . HOH J 8 .   ? 48.909 -9.510  10.368  1.00 21.77 ? 691  HOH A O     1 
HETATM 3979 O  O     . HOH J 8 .   ? 59.374 4.958   16.679  1.00 20.40 ? 692  HOH A O     1 
HETATM 3980 O  O     . HOH J 8 .   ? 58.262 -27.506 11.267  1.00 15.58 ? 693  HOH A O     1 
HETATM 3981 O  O     . HOH J 8 .   ? 47.809 -27.038 -7.199  1.00 23.48 ? 694  HOH A O     1 
HETATM 3982 O  O     . HOH J 8 .   ? 57.953 -14.326 -13.043 1.00 19.29 ? 695  HOH A O     1 
HETATM 3983 O  O     . HOH J 8 .   ? 58.014 -7.594  8.189   1.00 20.03 ? 696  HOH A O     1 
HETATM 3984 O  O     . HOH J 8 .   ? 58.413 -8.997  -14.194 1.00 19.98 ? 697  HOH A O     1 
HETATM 3985 O  O     . HOH J 8 .   ? 63.381 -18.963 -1.527  1.00 16.75 ? 698  HOH A O     1 
HETATM 3986 O  O     . HOH J 8 .   ? 68.203 -14.620 -10.178 1.00 22.96 ? 699  HOH A O     1 
HETATM 3987 O  O     . HOH J 8 .   ? 61.567 14.642  8.758   1.00 21.16 ? 700  HOH A O     1 
HETATM 3988 O  O     . HOH J 8 .   ? 70.895 0.554   11.386  1.00 29.64 ? 701  HOH A O     1 
HETATM 3989 O  O     . HOH J 8 .   ? 42.364 -18.981 14.870  1.00 20.43 ? 702  HOH A O     1 
HETATM 3990 O  O     . HOH J 8 .   ? 49.018 13.752  28.362  1.00 24.81 ? 703  HOH A O     1 
HETATM 3991 O  O     . HOH J 8 .   ? 47.524 -20.080 18.518  1.00 23.67 ? 704  HOH A O     1 
HETATM 3992 O  O     . HOH J 8 .   ? 73.473 -19.548 -2.833  1.00 21.61 ? 705  HOH A O     1 
HETATM 3993 O  O     . HOH J 8 .   ? 51.247 -8.892  -5.198  1.00 23.59 ? 706  HOH A O     1 
HETATM 3994 O  O     . HOH J 8 .   ? 54.872 -0.790  5.751   1.00 22.73 ? 707  HOH A O     1 
HETATM 3995 O  O     . HOH J 8 .   ? 63.525 12.851  -10.836 1.00 23.66 ? 708  HOH A O     1 
HETATM 3996 O  O     . HOH J 8 .   ? 48.330 -17.827 17.358  1.00 23.63 ? 709  HOH A O     1 
HETATM 3997 O  O     . HOH J 8 .   ? 51.749 -8.450  4.806   1.00 25.74 ? 710  HOH A O     1 
HETATM 3998 O  O     . HOH J 8 .   ? 49.767 -9.246  -8.433  1.00 26.90 ? 711  HOH A O     1 
HETATM 3999 O  O     . HOH J 8 .   ? 84.014 -5.275  2.480   1.00 29.06 ? 712  HOH A O     1 
HETATM 4000 O  O     . HOH J 8 .   ? 65.824 -4.291  -15.324 1.00 24.15 ? 713  HOH A O     1 
HETATM 4001 O  O     . HOH J 8 .   ? 45.069 0.571   -18.639 1.00 22.78 ? 714  HOH A O     1 
HETATM 4002 O  O     . HOH J 8 .   ? 33.360 2.484   -0.311  1.00 24.38 ? 715  HOH A O     1 
HETATM 4003 O  O     . HOH J 8 .   ? 29.098 8.318   -19.013 1.00 24.60 ? 716  HOH A O     1 
HETATM 4004 O  O     . HOH J 8 .   ? 35.547 20.884  0.487   1.00 23.66 ? 717  HOH A O     1 
HETATM 4005 O  O     . HOH J 8 .   ? 23.316 14.230  -9.145  1.00 28.27 ? 718  HOH A O     1 
HETATM 4006 O  O     . HOH J 8 .   ? 58.697 15.408  -10.738 1.00 24.84 ? 719  HOH A O     1 
HETATM 4007 O  O     . HOH J 8 .   ? 52.994 -26.320 -3.971  1.00 21.90 ? 720  HOH A O     1 
HETATM 4008 O  O     . HOH J 8 .   ? 58.871 4.628   23.137  1.00 27.33 ? 721  HOH A O     1 
HETATM 4009 O  O     . HOH J 8 .   ? 61.181 21.033  11.908  1.00 23.63 ? 722  HOH A O     1 
HETATM 4010 O  O     . HOH J 8 .   ? 53.276 -20.251 -5.073  1.00 22.36 ? 723  HOH A O     1 
HETATM 4011 O  O     . HOH J 8 .   ? 51.227 0.564   -16.201 1.00 24.42 ? 724  HOH A O     1 
HETATM 4012 O  O     . HOH J 8 .   ? 47.963 16.745  28.143  1.00 23.99 ? 725  HOH A O     1 
HETATM 4013 O  O     . HOH J 8 .   ? 62.270 11.811  5.454   1.00 24.80 ? 726  HOH A O     1 
HETATM 4014 O  O     . HOH J 8 .   ? 46.237 -9.733  10.992  1.00 28.52 ? 727  HOH A O     1 
HETATM 4015 O  O     . HOH J 8 .   ? 57.346 -16.499 -11.381 1.00 22.64 ? 728  HOH A O     1 
HETATM 4016 O  O     . HOH J 8 .   ? 47.686 7.923   -9.705  1.00 22.35 ? 729  HOH A O     1 
HETATM 4017 O  O     . HOH J 8 .   ? 36.964 12.975  11.993  1.00 25.36 ? 730  HOH A O     1 
HETATM 4018 O  O     . HOH J 8 .   ? 34.724 19.884  -16.178 1.00 26.46 ? 731  HOH A O     1 
HETATM 4019 O  O     . HOH J 8 .   ? 51.438 6.426   -19.012 1.00 28.07 ? 732  HOH A O     1 
HETATM 4020 O  O     . HOH J 8 .   ? 59.817 13.052  11.347  1.00 20.68 ? 733  HOH A O     1 
HETATM 4021 O  O     . HOH J 8 .   ? 46.914 -14.811 14.851  1.00 29.75 ? 734  HOH A O     1 
HETATM 4022 O  O     . HOH J 8 .   ? 51.445 8.783   -15.534 1.00 27.09 ? 735  HOH A O     1 
HETATM 4023 O  O     . HOH J 8 .   ? 69.704 -12.983 -11.472 1.00 23.82 ? 736  HOH A O     1 
HETATM 4024 O  O     . HOH J 8 .   ? 45.620 17.995  -3.687  1.00 28.06 ? 737  HOH A O     1 
HETATM 4025 O  O     . HOH J 8 .   ? 64.608 6.650   -0.540  1.00 18.23 ? 738  HOH A O     1 
HETATM 4026 O  O     . HOH J 8 .   ? 67.510 -6.370  12.869  1.00 21.41 ? 739  HOH A O     1 
HETATM 4027 O  O     . HOH J 8 .   ? 50.875 17.654  -5.970  1.00 28.59 ? 740  HOH A O     1 
HETATM 4028 O  O     . HOH J 8 .   ? 48.962 14.827  -22.703 1.00 24.22 ? 741  HOH A O     1 
HETATM 4029 O  O     . HOH J 8 .   ? 62.901 -17.132 -7.269  1.00 22.33 ? 742  HOH A O     1 
HETATM 4030 O  O     . HOH J 8 .   ? 52.596 3.691   17.893  1.00 23.61 ? 743  HOH A O     1 
HETATM 4031 O  O     . HOH J 8 .   ? 47.175 2.427   -1.446  1.00 24.90 ? 744  HOH A O     1 
HETATM 4032 O  O     . HOH J 8 .   ? 53.442 24.280  4.055   1.00 27.60 ? 745  HOH A O     1 
HETATM 4033 O  O     . HOH J 8 .   ? 46.830 19.499  1.406   1.00 21.58 ? 746  HOH A O     1 
HETATM 4034 O  O     . HOH J 8 .   ? 44.579 10.355  -24.663 1.00 27.80 ? 747  HOH A O     1 
HETATM 4035 O  O     . HOH J 8 .   ? 51.383 4.834   24.934  1.00 24.74 ? 748  HOH A O     1 
HETATM 4036 O  O     . HOH J 8 .   ? 47.162 16.388  25.681  1.00 24.39 ? 749  HOH A O     1 
HETATM 4037 O  O     . HOH J 8 .   ? 56.248 18.801  18.215  1.00 19.56 ? 750  HOH A O     1 
HETATM 4038 O  O     . HOH J 8 .   ? 53.092 -19.696 22.135  1.00 23.66 ? 751  HOH A O     1 
HETATM 4039 O  O     . HOH J 8 .   ? 56.818 21.503  18.040  1.00 27.68 ? 752  HOH A O     1 
HETATM 4040 O  O     . HOH J 8 .   ? 55.567 -7.430  6.511   1.00 27.58 ? 753  HOH A O     1 
HETATM 4041 O  O     . HOH J 8 .   ? 79.187 3.407   1.928   1.00 31.88 ? 754  HOH A O     1 
HETATM 4042 O  O     . HOH J 8 .   ? 41.507 20.274  4.857   1.00 23.65 ? 755  HOH A O     1 
HETATM 4043 O  O     . HOH J 8 .   ? 39.924 7.306   13.508  1.00 27.13 ? 756  HOH A O     1 
HETATM 4044 O  O     . HOH J 8 .   ? 53.655 5.968   -12.448 1.00 22.43 ? 757  HOH A O     1 
HETATM 4045 O  O     . HOH J 8 .   ? 65.462 13.009  2.914   1.00 28.25 ? 758  HOH A O     1 
HETATM 4046 O  O     . HOH J 8 .   ? 48.370 19.862  4.453   1.00 23.82 ? 759  HOH A O     1 
HETATM 4047 O  O     . HOH J 8 .   ? 55.801 -32.821 5.069   1.00 28.51 ? 760  HOH A O     1 
HETATM 4048 O  O     . HOH J 8 .   ? 67.398 -8.325  9.920   1.00 23.86 ? 761  HOH A O     1 
HETATM 4049 O  O     . HOH J 8 .   ? 58.391 18.961  -8.806  1.00 26.52 ? 762  HOH A O     1 
HETATM 4050 O  O     . HOH J 8 .   ? 57.476 -18.972 22.145  1.00 25.07 ? 763  HOH A O     1 
HETATM 4051 O  O     . HOH J 8 .   ? 76.536 2.582   6.854   1.00 28.04 ? 764  HOH A O     1 
HETATM 4052 O  O     . HOH J 8 .   ? 62.944 9.430   -13.539 1.00 31.64 ? 765  HOH A O     1 
HETATM 4053 O  O     . HOH J 8 .   ? 42.243 -9.084  9.603   1.00 30.72 ? 766  HOH A O     1 
HETATM 4054 O  O     . HOH J 8 .   ? 29.523 3.700   6.526   1.00 31.43 ? 767  HOH A O     1 
HETATM 4055 O  O     . HOH J 8 .   ? 34.614 17.584  -12.765 1.00 27.74 ? 768  HOH A O     1 
HETATM 4056 O  O     . HOH J 8 .   ? 38.321 10.525  9.613   1.00 22.72 ? 769  HOH A O     1 
HETATM 4057 O  O     . HOH J 8 .   ? 53.727 -8.508  8.747   1.00 27.33 ? 770  HOH A O     1 
HETATM 4058 O  O     . HOH J 8 .   ? 41.050 -1.769  -16.582 1.00 27.41 ? 771  HOH A O     1 
HETATM 4059 O  O     . HOH J 8 .   ? 62.198 -13.295 -13.675 1.00 30.54 ? 772  HOH A O     1 
HETATM 4060 O  O     . HOH J 8 .   ? 50.063 -8.977  12.981  1.00 22.57 ? 773  HOH A O     1 
HETATM 4061 O  O     . HOH J 8 .   ? 38.842 -19.892 12.324  1.00 32.93 ? 774  HOH A O     1 
HETATM 4062 O  O     . HOH J 8 .   ? 43.730 -28.879 15.739  1.00 33.18 ? 775  HOH A O     1 
HETATM 4063 O  O     . HOH J 8 .   ? 21.701 13.901  6.856   1.00 30.77 ? 776  HOH A O     1 
HETATM 4064 O  O     . HOH J 8 .   ? 44.659 -17.004 -0.464  1.00 25.97 ? 777  HOH A O     1 
HETATM 4065 O  O     . HOH J 8 .   ? 37.319 17.515  -6.712  1.00 32.11 ? 778  HOH A O     1 
HETATM 4066 O  O     . HOH J 8 .   ? 27.688 6.718   -17.049 1.00 23.99 ? 779  HOH A O     1 
HETATM 4067 O  O     . HOH J 8 .   ? 20.147 10.293  8.851   1.00 32.74 ? 780  HOH A O     1 
HETATM 4068 O  O     . HOH J 8 .   ? 42.483 13.032  -24.013 1.00 26.76 ? 781  HOH A O     1 
HETATM 4069 O  O     . HOH J 8 .   ? 70.404 -17.151 12.422  1.00 28.77 ? 782  HOH A O     1 
HETATM 4070 O  O     . HOH J 8 .   ? 19.325 -3.524  -8.832  1.00 38.19 ? 783  HOH A O     1 
HETATM 4071 O  O     . HOH J 8 .   ? 57.547 -35.037 8.353   1.00 27.67 ? 784  HOH A O     1 
HETATM 4072 O  O     . HOH J 8 .   ? 63.050 -23.628 3.494   1.00 23.85 ? 785  HOH A O     1 
HETATM 4073 O  O     . HOH J 8 .   ? 51.357 21.769  7.050   1.00 25.18 ? 786  HOH A O     1 
HETATM 4074 O  O     . HOH J 8 .   ? 71.449 -11.957 14.233  1.00 29.92 ? 787  HOH A O     1 
HETATM 4075 O  O     . HOH J 8 .   ? 65.711 8.615   8.910   1.00 26.02 ? 788  HOH A O     1 
HETATM 4076 O  O     . HOH J 8 .   ? 43.530 -16.091 -2.825  1.00 30.32 ? 789  HOH A O     1 
HETATM 4077 O  O     . HOH J 8 .   ? 76.532 -17.823 0.626   1.00 31.34 ? 790  HOH A O     1 
HETATM 4078 O  O     . HOH J 8 .   ? 43.369 5.429   -9.141  1.00 20.06 ? 791  HOH A O     1 
HETATM 4079 O  O     . HOH J 8 .   ? 46.263 0.391   6.883   1.00 23.46 ? 792  HOH A O     1 
HETATM 4080 O  O     . HOH J 8 .   ? 52.448 -5.540  -0.985  1.00 20.25 ? 793  HOH A O     1 
HETATM 4081 O  O     . HOH J 8 .   ? 59.147 -18.296 -10.321 1.00 31.97 ? 794  HOH A O     1 
HETATM 4082 O  O     . HOH J 8 .   ? 72.311 -7.777  11.745  1.00 16.77 ? 795  HOH A O     1 
HETATM 4083 O  O     . HOH J 8 .   ? 34.419 5.816   -21.995 1.00 27.32 ? 796  HOH A O     1 
HETATM 4084 O  O     . HOH J 8 .   ? 44.378 15.646  26.222  1.00 26.35 ? 797  HOH A O     1 
HETATM 4085 O  O     . HOH J 8 .   ? 34.699 15.085  11.435  1.00 21.31 ? 798  HOH A O     1 
HETATM 4086 O  O     . HOH J 8 .   ? 38.580 -17.978 10.216  1.00 22.78 ? 799  HOH A O     1 
HETATM 4087 O  O     . HOH J 8 .   ? 71.882 -18.963 14.097  1.00 31.23 ? 800  HOH A O     1 
HETATM 4088 O  O     . HOH J 8 .   ? 53.498 19.372  -1.559  1.00 21.12 ? 801  HOH A O     1 
HETATM 4089 O  O     . HOH J 8 .   ? 54.390 15.494  23.423  1.00 29.93 ? 802  HOH A O     1 
HETATM 4090 O  O     . HOH J 8 .   ? 39.431 18.754  18.219  1.00 25.46 ? 803  HOH A O     1 
HETATM 4091 O  O     . HOH J 8 .   ? 51.212 -22.713 -5.629  1.00 28.39 ? 804  HOH A O     1 
HETATM 4092 O  O     . HOH J 8 .   ? 46.687 -18.768 -2.399  1.00 33.36 ? 805  HOH A O     1 
HETATM 4093 O  O     . HOH J 8 .   ? 45.086 20.633  3.671   1.00 27.68 ? 806  HOH A O     1 
HETATM 4094 O  O     . HOH J 8 .   ? 47.751 16.051  -17.715 1.00 30.03 ? 807  HOH A O     1 
HETATM 4095 O  O     . HOH J 8 .   ? 69.068 -10.850 12.209  1.00 28.56 ? 808  HOH A O     1 
HETATM 4096 O  O     . HOH J 8 .   ? 55.982 13.666  -11.543 1.00 24.57 ? 809  HOH A O     1 
HETATM 4097 O  O     . HOH J 8 .   ? 49.215 12.149  -11.643 1.00 28.30 ? 810  HOH A O     1 
HETATM 4098 O  O     . HOH J 8 .   ? 52.524 8.224   25.432  1.00 27.90 ? 811  HOH A O     1 
HETATM 4099 O  O     . HOH J 8 .   ? 59.714 -31.596 3.898   1.00 27.85 ? 812  HOH A O     1 
HETATM 4100 O  O     . HOH J 8 .   ? 66.589 -2.378  12.758  1.00 28.52 ? 813  HOH A O     1 
HETATM 4101 O  O     . HOH J 8 .   ? 60.635 -28.424 8.408   1.00 25.86 ? 814  HOH A O     1 
HETATM 4102 O  O     . HOH J 8 .   ? 39.451 -2.211  -14.419 1.00 26.53 ? 815  HOH A O     1 
HETATM 4103 O  O     . HOH J 8 .   ? 54.694 -35.110 1.077   1.00 35.77 ? 816  HOH A O     1 
HETATM 4104 O  O     . HOH J 8 .   ? 19.013 14.164  6.530   1.00 39.41 ? 817  HOH A O     1 
HETATM 4105 O  O     . HOH J 8 .   ? 45.987 7.400   -13.043 1.00 25.16 ? 818  HOH A O     1 
HETATM 4106 O  O     . HOH J 8 .   ? 70.785 -6.790  13.797  1.00 28.23 ? 819  HOH A O     1 
HETATM 4107 O  O     . HOH J 8 .   ? 45.016 16.976  -18.154 1.00 27.63 ? 820  HOH A O     1 
HETATM 4108 O  O     . HOH J 8 .   ? 63.280 -4.748  -15.910 1.00 32.95 ? 821  HOH A O     1 
HETATM 4109 O  O     . HOH J 8 .   ? 52.840 -12.649 -4.015  1.00 24.85 ? 822  HOH A O     1 
HETATM 4110 O  O     . HOH J 8 .   ? 73.784 4.282   -1.467  1.00 29.37 ? 823  HOH A O     1 
HETATM 4111 O  O     . HOH J 8 .   ? 60.469 13.823  6.261   1.00 26.35 ? 824  HOH A O     1 
HETATM 4112 O  O     . HOH J 8 .   ? 41.327 -3.104  -22.936 1.00 24.87 ? 825  HOH A O     1 
HETATM 4113 O  O     . HOH J 8 .   ? 46.870 -8.685  -4.509  1.00 26.84 ? 826  HOH A O     1 
HETATM 4114 O  O     . HOH J 8 .   ? 61.999 -18.874 21.856  1.00 33.46 ? 827  HOH A O     1 
HETATM 4115 O  O     . HOH J 8 .   ? 47.139 -22.728 17.508  1.00 20.33 ? 828  HOH A O     1 
HETATM 4116 O  O     . HOH J 8 .   ? 65.535 -22.343 -7.911  1.00 26.34 ? 829  HOH A O     1 
HETATM 4117 O  O     . HOH J 8 .   ? 46.493 -30.927 12.995  1.00 36.89 ? 830  HOH A O     1 
HETATM 4118 O  O     . HOH J 8 .   ? 60.052 -6.405  -12.924 1.00 24.01 ? 831  HOH A O     1 
HETATM 4119 O  O     . HOH J 8 .   ? 37.232 18.715  16.777  1.00 30.61 ? 832  HOH A O     1 
HETATM 4120 O  O     . HOH J 8 .   ? 55.483 -20.633 21.318  1.00 21.51 ? 833  HOH A O     1 
HETATM 4121 O  O     . HOH J 8 .   ? 39.886 -27.145 15.545  1.00 33.80 ? 834  HOH A O     1 
HETATM 4122 O  O     . HOH J 8 .   ? 69.089 1.929   -15.772 1.00 39.32 ? 835  HOH A O     1 
HETATM 4123 O  O     . HOH J 8 .   ? 48.141 0.058   9.851   1.00 38.41 ? 836  HOH A O     1 
HETATM 4124 O  O     . HOH J 8 .   ? 65.236 19.655  1.919   1.00 22.47 ? 837  HOH A O     1 
HETATM 4125 O  O     . HOH J 8 .   ? 81.366 -11.125 -8.498  1.00 36.82 ? 838  HOH A O     1 
HETATM 4126 O  O     . HOH J 8 .   ? 44.064 0.498   -21.324 1.00 30.39 ? 839  HOH A O     1 
HETATM 4127 O  O     . HOH J 8 .   ? 50.628 -12.938 -0.801  1.00 23.93 ? 840  HOH A O     1 
HETATM 4128 O  O     . HOH J 8 .   ? 43.226 -2.689  -20.160 1.00 28.06 ? 841  HOH A O     1 
HETATM 4129 O  O     . HOH J 8 .   ? 47.453 -16.732 -0.738  1.00 28.52 ? 842  HOH A O     1 
HETATM 4130 O  O     . HOH J 8 .   ? 63.630 -17.237 15.059  1.00 28.39 ? 843  HOH A O     1 
HETATM 4131 O  O     . HOH J 8 .   ? 61.682 -31.472 -10.718 1.00 32.06 ? 844  HOH A O     1 
HETATM 4132 O  O     . HOH J 8 .   ? 33.610 7.707   17.525  1.00 32.72 ? 845  HOH A O     1 
HETATM 4133 O  O     . HOH J 8 .   ? 60.007 14.354  3.294   1.00 26.22 ? 846  HOH A O     1 
HETATM 4134 O  O     . HOH J 8 .   ? 80.571 -13.854 -10.710 1.00 44.03 ? 847  HOH A O     1 
HETATM 4135 O  O     . HOH J 8 .   ? 34.562 8.130   23.059  1.00 38.40 ? 848  HOH A O     1 
HETATM 4136 O  O     . HOH J 8 .   ? 41.259 21.721  2.104   1.00 22.04 ? 849  HOH A O     1 
HETATM 4137 O  O     . HOH J 8 .   ? 35.801 11.062  10.441  1.00 28.64 ? 850  HOH A O     1 
HETATM 4138 O  O     . HOH J 8 .   ? 40.169 -18.261 -1.652  1.00 31.68 ? 851  HOH A O     1 
HETATM 4139 O  O     . HOH J 8 .   ? 53.871 -32.472 -2.834  1.00 31.95 ? 852  HOH A O     1 
HETATM 4140 O  O     . HOH J 8 .   ? 66.057 -26.136 0.436   1.00 34.27 ? 853  HOH A O     1 
HETATM 4141 O  O     . HOH J 8 .   ? 55.376 -1.145  -14.816 1.00 25.44 ? 854  HOH A O     1 
HETATM 4142 O  O     . HOH J 8 .   ? 51.577 13.453  -11.572 1.00 25.63 ? 855  HOH A O     1 
HETATM 4143 O  O     . HOH J 8 .   ? 56.661 -4.602  4.980   1.00 28.74 ? 856  HOH A O     1 
HETATM 4144 O  O     . HOH J 8 .   ? 44.395 13.284  -10.381 1.00 32.86 ? 857  HOH A O     1 
HETATM 4145 O  O     . HOH J 8 .   ? 38.143 -25.303 2.500   1.00 36.70 ? 858  HOH A O     1 
HETATM 4146 O  O     . HOH J 8 .   ? 34.106 15.593  18.617  1.00 35.42 ? 859  HOH A O     1 
HETATM 4147 O  O     . HOH J 8 .   ? 73.220 2.136   8.206   1.00 31.13 ? 860  HOH A O     1 
HETATM 4148 O  O     . HOH J 8 .   ? 71.696 -21.203 -1.860  1.00 33.56 ? 861  HOH A O     1 
HETATM 4149 O  O     . HOH J 8 .   ? 41.024 -29.671 13.165  1.00 26.32 ? 862  HOH A O     1 
HETATM 4150 O  O     . HOH J 8 .   ? 65.211 20.052  6.684   1.00 30.73 ? 863  HOH A O     1 
HETATM 4151 O  O     . HOH J 8 .   ? 75.389 0.435   -3.728  1.00 28.43 ? 864  HOH A O     1 
HETATM 4152 O  O     . HOH J 8 .   ? 76.695 1.142   -5.897  1.00 29.78 ? 865  HOH A O     1 
HETATM 4153 O  O     . HOH J 8 .   ? 39.571 -22.636 5.859   1.00 30.31 ? 866  HOH A O     1 
HETATM 4154 O  O     . HOH J 8 .   ? 69.813 -8.853  10.613  1.00 24.54 ? 867  HOH A O     1 
HETATM 4155 O  O     . HOH J 8 .   ? 57.799 0.184   -14.761 1.00 27.44 ? 868  HOH A O     1 
HETATM 4156 O  O     . HOH J 8 .   ? 56.361 1.144   13.024  1.00 23.99 ? 869  HOH A O     1 
HETATM 4157 O  O     . HOH J 8 .   ? 48.350 3.534   -20.394 1.00 34.81 ? 870  HOH A O     1 
HETATM 4158 O  O     . HOH J 8 .   ? 50.806 -6.437  -5.495  1.00 30.48 ? 871  HOH A O     1 
HETATM 4159 O  O     . HOH J 8 .   ? 50.960 5.635   -23.157 1.00 31.91 ? 872  HOH A O     1 
HETATM 4160 O  O     . HOH J 8 .   ? 47.918 0.952   -19.017 1.00 29.10 ? 873  HOH A O     1 
HETATM 4161 O  O     . HOH J 8 .   ? 61.277 10.016  6.996   1.00 25.18 ? 874  HOH A O     1 
HETATM 4162 O  O     . HOH J 8 .   ? 28.613 14.389  4.964   1.00 34.60 ? 875  HOH A O     1 
HETATM 4163 O  O     . HOH J 8 .   ? 53.545 7.289   -14.782 1.00 28.47 ? 876  HOH A O     1 
HETATM 4164 O  O     . HOH J 8 .   ? 59.054 -30.673 -1.037  1.00 36.40 ? 877  HOH A O     1 
HETATM 4165 O  O     . HOH J 8 .   ? 60.154 9.684   22.276  1.00 28.34 ? 878  HOH A O     1 
HETATM 4166 O  O     . HOH J 8 .   ? 48.894 -34.622 10.369  1.00 35.03 ? 879  HOH A O     1 
HETATM 4167 O  O     . HOH J 8 .   ? 61.949 16.078  2.302   1.00 28.33 ? 880  HOH A O     1 
HETATM 4168 O  O     . HOH J 8 .   ? 29.372 17.970  -15.661 1.00 35.70 ? 881  HOH A O     1 
HETATM 4169 O  O     . HOH J 8 .   ? 38.915 23.084  2.325   1.00 31.61 ? 882  HOH A O     1 
HETATM 4170 O  O     . HOH J 8 .   ? 80.713 -18.315 -12.565 1.00 43.35 ? 883  HOH A O     1 
HETATM 4171 O  O     . HOH J 8 .   ? 61.435 16.022  4.838   1.00 29.65 ? 884  HOH A O     1 
HETATM 4172 O  O     . HOH J 8 .   ? 81.678 -11.544 13.657  1.00 42.57 ? 885  HOH A O     1 
HETATM 4173 O  O     . HOH J 8 .   ? 51.494 -33.763 10.808  1.00 39.84 ? 886  HOH A O     1 
HETATM 4174 O  O     . HOH J 8 .   ? 34.074 3.007   2.733   1.00 26.47 ? 887  HOH A O     1 
HETATM 4175 O  O     . HOH J 8 .   ? 68.836 -1.337  -13.517 1.00 34.47 ? 888  HOH A O     1 
HETATM 4176 O  O     . HOH J 8 .   ? 65.204 -34.728 -6.040  1.00 29.58 ? 889  HOH A O     1 
HETATM 4177 O  O     . HOH J 8 .   ? 51.771 -16.139 17.348  1.00 24.34 ? 890  HOH A O     1 
HETATM 4178 O  O     . HOH J 8 .   ? 61.090 -15.731 13.644  1.00 26.13 ? 891  HOH A O     1 
HETATM 4179 O  O     . HOH J 8 .   ? 44.921 -33.220 -2.894  1.00 26.54 ? 892  HOH A O     1 
HETATM 4180 O  O     . HOH J 8 .   ? 67.577 6.506   0.682   1.00 27.80 ? 893  HOH A O     1 
HETATM 4181 O  O     . HOH J 8 .   ? 46.716 18.835  24.484  1.00 30.65 ? 894  HOH A O     1 
HETATM 4182 O  O     . HOH J 8 .   ? 57.815 23.399  14.144  1.00 28.17 ? 895  HOH A O     1 
HETATM 4183 O  O     . HOH J 8 .   ? 39.980 -22.656 3.169   1.00 25.71 ? 896  HOH A O     1 
HETATM 4184 O  O     . HOH J 8 .   ? 66.310 3.433   -17.585 1.00 32.66 ? 897  HOH A O     1 
HETATM 4185 O  O     . HOH J 8 .   ? 67.996 1.890   12.253  1.00 36.04 ? 898  HOH A O     1 
HETATM 4186 O  O     . HOH J 8 .   ? 73.569 -20.691 1.041   1.00 26.70 ? 899  HOH A O     1 
HETATM 4187 O  O     . HOH J 8 .   ? 50.613 14.133  -20.189 1.00 35.88 ? 900  HOH A O     1 
HETATM 4188 O  O     . HOH J 8 .   ? 68.541 4.548   -14.153 1.00 35.47 ? 901  HOH A O     1 
HETATM 4189 O  O     . HOH J 8 .   ? 81.072 -20.339 0.700   1.00 35.43 ? 902  HOH A O     1 
HETATM 4190 O  O     . HOH J 8 .   ? 73.873 0.535   22.435  1.00 38.35 ? 903  HOH A O     1 
HETATM 4191 O  O     . HOH J 8 .   ? 68.510 -26.281 -0.712  1.00 29.15 ? 904  HOH A O     1 
HETATM 4192 O  O     . HOH J 8 .   ? 48.357 -19.417 -5.836  1.00 30.74 ? 905  HOH A O     1 
HETATM 4193 O  O     . HOH J 8 .   ? 52.622 2.516   -17.469 1.00 34.86 ? 906  HOH A O     1 
HETATM 4194 O  O     . HOH J 8 .   ? 27.509 20.776  -6.926  1.00 33.24 ? 907  HOH A O     1 
HETATM 4195 O  O     . HOH J 8 .   ? 37.971 10.812  21.342  1.00 39.09 ? 908  HOH A O     1 
HETATM 4196 O  O     . HOH J 8 .   ? 80.494 -20.884 3.665   1.00 35.64 ? 909  HOH A O     1 
HETATM 4197 O  O     . HOH J 8 .   ? 48.855 21.919  2.946   1.00 34.02 ? 910  HOH A O     1 
HETATM 4198 O  O     . HOH J 8 .   ? 30.859 1.873   -22.131 1.00 29.64 ? 911  HOH A O     1 
HETATM 4199 O  O     . HOH J 8 .   ? 21.971 11.883  -9.478  1.00 28.00 ? 912  HOH A O     1 
HETATM 4200 O  O     . HOH J 8 .   ? 50.214 0.732   20.327  1.00 36.99 ? 913  HOH A O     1 
HETATM 4201 O  O     . HOH J 8 .   ? 60.594 6.308   -15.612 1.00 28.18 ? 914  HOH A O     1 
HETATM 4202 O  O     . HOH J 8 .   ? 25.575 14.750  5.241   1.00 29.64 ? 915  HOH A O     1 
HETATM 4203 O  O     . HOH J 8 .   ? 80.744 -11.185 -11.324 1.00 42.62 ? 916  HOH A O     1 
HETATM 4204 O  O     . HOH J 8 .   ? 53.148 0.140   12.052  1.00 20.47 ? 917  HOH A O     1 
HETATM 4205 O  O     . HOH J 8 .   ? 69.663 5.346   1.258   1.00 26.64 ? 918  HOH A O     1 
HETATM 4206 O  O     . HOH J 8 .   ? 56.407 -2.423  3.700   1.00 24.38 ? 919  HOH A O     1 
HETATM 4207 O  O     . HOH J 8 .   ? 71.432 9.151   -6.567  1.00 27.85 ? 920  HOH A O     1 
HETATM 4208 O  O     . HOH J 8 .   ? 59.854 3.507   20.844  1.00 23.45 ? 921  HOH A O     1 
HETATM 4209 O  O     . HOH J 8 .   ? 42.859 17.404  -16.971 1.00 29.27 ? 922  HOH A O     1 
HETATM 4210 O  O     . HOH J 8 .   ? 70.413 -21.800 0.715   1.00 26.64 ? 923  HOH A O     1 
HETATM 4211 O  O     . HOH J 8 .   ? 49.151 -23.721 19.235  1.00 32.48 ? 924  HOH A O     1 
HETATM 4212 O  O     . HOH J 8 .   ? 46.798 19.706  -2.550  1.00 28.46 ? 925  HOH A O     1 
HETATM 4213 O  O     . HOH J 8 .   ? 63.299 -7.412  12.845  1.00 29.03 ? 926  HOH A O     1 
HETATM 4214 O  O     . HOH J 8 .   ? 56.065 -33.159 2.249   1.00 30.10 ? 927  HOH A O     1 
HETATM 4215 O  O     . HOH J 8 .   ? 40.739 -29.443 -2.195  1.00 26.88 ? 928  HOH A O     1 
HETATM 4216 O  O     . HOH J 8 .   ? 42.833 -30.277 -4.122  1.00 28.75 ? 929  HOH A O     1 
HETATM 4217 O  O     . HOH J 8 .   ? 78.489 -21.356 2.023   1.00 31.89 ? 930  HOH A O     1 
HETATM 4218 O  O     . HOH J 8 .   ? 61.866 9.120   18.735  1.00 27.88 ? 931  HOH A O     1 
HETATM 4219 O  O     . HOH J 8 .   ? 61.765 11.559  -12.441 1.00 24.22 ? 932  HOH A O     1 
HETATM 4220 O  O     . HOH J 8 .   ? 57.560 0.089   10.512  1.00 29.17 ? 933  HOH A O     1 
HETATM 4221 O  O     . HOH J 8 .   ? 40.746 -18.355 0.911   1.00 32.20 ? 934  HOH A O     1 
HETATM 4222 O  O     . HOH J 8 .   ? 80.722 -15.916 7.671   1.00 28.49 ? 935  HOH A O     1 
HETATM 4223 O  O     . HOH J 8 .   ? 81.873 -21.386 -1.517  1.00 42.04 ? 936  HOH A O     1 
HETATM 4224 O  O     . HOH J 8 .   ? 38.854 21.394  5.827   1.00 33.18 ? 937  HOH A O     1 
HETATM 4225 O  O     . HOH J 8 .   ? 58.284 17.820  19.869  1.00 33.08 ? 938  HOH A O     1 
HETATM 4226 O  O     . HOH J 8 .   ? 52.840 -1.263  4.243   1.00 27.09 ? 939  HOH A O     1 
HETATM 4227 O  O     . HOH J 8 .   ? 80.832 -4.433  23.165  1.00 41.43 ? 940  HOH A O     1 
HETATM 4228 O  O     . HOH J 8 .   ? 83.251 -15.408 15.281  1.00 41.75 ? 941  HOH A O     1 
HETATM 4229 O  O     . HOH J 8 .   ? 59.520 -19.768 23.577  1.00 28.84 ? 942  HOH A O     1 
HETATM 4230 O  O     . HOH J 8 .   ? 46.558 2.628   -4.493  1.00 28.12 ? 943  HOH A O     1 
HETATM 4231 O  O     . HOH J 8 .   ? 49.020 -0.558  -16.766 1.00 29.95 ? 944  HOH A O     1 
HETATM 4232 O  O     . HOH J 8 .   ? 35.478 22.468  -3.269  1.00 33.96 ? 945  HOH A O     1 
HETATM 4233 O  O     . HOH J 8 .   ? 66.737 3.972   10.687  1.00 27.59 ? 946  HOH A O     1 
HETATM 4234 O  O     . HOH J 8 .   ? 64.527 -15.357 13.801  1.00 30.76 ? 947  HOH A O     1 
HETATM 4235 O  O     . HOH J 8 .   ? 50.238 -16.138 -9.389  1.00 35.46 ? 948  HOH A O     1 
HETATM 4236 O  O     . HOH J 8 .   ? 38.716 13.824  24.244  1.00 32.03 ? 949  HOH A O     1 
HETATM 4237 O  O     . HOH J 8 .   ? 51.830 -17.885 -6.249  1.00 33.68 ? 950  HOH A O     1 
HETATM 4238 O  O     . HOH J 8 .   ? 37.425 13.950  21.661  1.00 32.33 ? 951  HOH A O     1 
HETATM 4239 O  O     . HOH J 8 .   ? 82.753 -21.115 2.756   1.00 32.36 ? 952  HOH A O     1 
HETATM 4240 O  O     . HOH J 8 .   ? 44.617 -23.112 17.816  1.00 28.81 ? 953  HOH A O     1 
HETATM 4241 O  O     . HOH J 8 .   ? 55.673 5.431   24.974  1.00 32.79 ? 954  HOH A O     1 
HETATM 4242 O  O     . HOH J 8 .   ? 32.365 3.066   -23.931 1.00 39.23 ? 955  HOH A O     1 
HETATM 4243 O  O     . HOH J 8 .   ? 45.665 11.668  -9.105  1.00 30.35 ? 956  HOH A O     1 
HETATM 4244 O  O     . HOH J 8 .   ? 77.626 3.004   -1.756  1.00 28.88 ? 957  HOH A O     1 
HETATM 4245 O  O     . HOH J 8 .   ? 34.756 14.036  21.843  1.00 34.52 ? 958  HOH A O     1 
HETATM 4246 O  O     . HOH J 8 .   ? 51.619 29.113  5.273   1.00 29.75 ? 959  HOH A O     1 
HETATM 4247 O  O     . HOH J 8 .   ? 22.311 17.679  -6.883  1.00 33.47 ? 960  HOH A O     1 
HETATM 4248 O  O     . HOH J 8 .   ? 47.201 2.977   -23.852 1.00 36.04 ? 961  HOH A O     1 
HETATM 4249 O  O     . HOH J 8 .   ? 39.760 -18.809 14.386  1.00 32.78 ? 962  HOH A O     1 
HETATM 4250 O  O     . HOH J 8 .   ? 71.260 6.251   7.159   1.00 35.34 ? 963  HOH A O     1 
HETATM 4251 O  O     . HOH J 8 .   ? 67.525 6.536   9.647   1.00 26.80 ? 964  HOH A O     1 
HETATM 4252 O  O     . HOH J 8 .   ? 46.595 0.890   14.043  1.00 30.09 ? 965  HOH A O     1 
HETATM 4253 O  O     . HOH J 8 .   ? 37.738 7.663   21.697  1.00 34.30 ? 966  HOH A O     1 
HETATM 4254 O  O     . HOH J 8 .   ? 51.795 -35.504 7.579   1.00 32.69 ? 967  HOH A O     1 
HETATM 4255 O  O     . HOH J 8 .   ? 61.863 7.906   16.262  1.00 28.60 ? 968  HOH A O     1 
HETATM 4256 O  O     . HOH J 8 .   ? 45.823 18.079  29.807  1.00 29.47 ? 969  HOH A O     1 
HETATM 4257 O  O     . HOH J 8 .   ? 59.642 -28.292 -2.203  1.00 35.96 ? 970  HOH A O     1 
HETATM 4258 O  O     . HOH J 8 .   ? 53.440 5.258   -17.018 1.00 32.56 ? 971  HOH A O     1 
HETATM 4259 O  O     . HOH J 8 .   ? 39.224 0.224   -6.567  1.00 32.40 ? 972  HOH A O     1 
HETATM 4260 O  O     . HOH J 8 .   ? 69.843 10.042  -8.590  1.00 25.89 ? 973  HOH A O     1 
HETATM 4261 O  O     . HOH J 8 .   ? 55.764 -27.342 -4.017  1.00 32.82 ? 974  HOH A O     1 
HETATM 4262 O  O     . HOH J 8 .   ? 30.971 21.833  -3.539  1.00 33.61 ? 975  HOH A O     1 
HETATM 4263 O  O     . HOH J 8 .   ? 80.719 -4.120  13.945  1.00 36.29 ? 976  HOH A O     1 
HETATM 4264 O  O     . HOH J 8 .   ? 51.836 -22.888 22.266  1.00 35.93 ? 977  HOH A O     1 
HETATM 4265 O  O     . HOH J 8 .   ? 83.232 -10.838 9.380   1.00 37.87 ? 978  HOH A O     1 
HETATM 4266 O  O     . HOH J 8 .   ? 47.764 -24.027 -7.708  1.00 32.98 ? 979  HOH A O     1 
HETATM 4267 O  O     . HOH J 8 .   ? 58.287 8.787   23.790  1.00 31.65 ? 980  HOH A O     1 
HETATM 4268 O  O     . HOH J 8 .   ? 41.615 -29.192 18.384  1.00 37.60 ? 981  HOH A O     1 
HETATM 4269 O  O     . HOH J 8 .   ? 44.206 18.206  23.584  1.00 33.55 ? 982  HOH A O     1 
HETATM 4270 O  O     . HOH J 8 .   ? 68.431 -2.967  14.651  1.00 39.80 ? 983  HOH A O     1 
HETATM 4271 O  O     . HOH J 8 .   ? 68.076 10.313  7.936   1.00 35.68 ? 984  HOH A O     1 
HETATM 4272 O  O     . HOH J 8 .   ? 48.250 10.868  -13.822 1.00 30.61 ? 985  HOH A O     1 
HETATM 4273 O  O     . HOH J 8 .   ? 41.125 14.043  -6.311  1.00 30.92 ? 986  HOH A O     1 
HETATM 4274 O  O     . HOH J 8 .   ? 51.790 -18.400 -9.104  1.00 34.14 ? 987  HOH A O     1 
HETATM 4275 O  O     . HOH J 8 .   ? 75.882 -8.124  -19.748 1.00 44.67 ? 988  HOH A O     1 
HETATM 4276 O  O     . HOH J 8 .   ? 53.340 -37.721 1.387   1.00 32.73 ? 989  HOH A O     1 
HETATM 4277 O  O     . HOH J 8 .   ? 57.883 5.314   -15.984 1.00 30.40 ? 990  HOH A O     1 
HETATM 4278 O  O     . HOH J 8 .   ? 42.381 5.928   21.151  1.00 32.32 ? 991  HOH A O     1 
HETATM 4279 O  O     . HOH J 8 .   ? 69.806 -23.875 -1.857  1.00 33.84 ? 992  HOH A O     1 
HETATM 4280 O  O     . HOH J 8 .   ? 40.939 -29.415 15.862  1.00 40.34 ? 993  HOH A O     1 
HETATM 4281 O  O     . HOH J 8 .   ? 52.901 -2.127  8.790   1.00 35.55 ? 994  HOH A O     1 
HETATM 4282 O  O     . HOH J 8 .   ? 64.028 16.505  4.415   1.00 35.70 ? 995  HOH A O     1 
HETATM 4283 O  O     . HOH J 8 .   ? 49.532 17.650  -11.370 1.00 34.41 ? 996  HOH A O     1 
HETATM 4284 O  O     . HOH J 8 .   ? 69.831 -9.767  14.967  1.00 39.63 ? 997  HOH A O     1 
HETATM 4285 O  O     . HOH J 8 .   ? 52.006 1.836   14.076  1.00 35.14 ? 998  HOH A O     1 
HETATM 4286 O  O     . HOH J 8 .   ? 65.531 12.747  7.899   1.00 42.27 ? 999  HOH A O     1 
HETATM 4287 O  O     . HOH J 8 .   ? 25.322 3.752   10.653  1.00 39.74 ? 1000 HOH A O     1 
HETATM 4288 O  O     . HOH J 8 .   ? 62.537 -29.600 -12.556 1.00 33.03 ? 1001 HOH A O     1 
HETATM 4289 O  O     . HOH J 8 .   ? 40.757 7.631   24.229  1.00 29.19 ? 1002 HOH A O     1 
HETATM 4290 O  O     . HOH J 8 .   ? 64.231 -16.159 -13.479 1.00 30.49 ? 1003 HOH A O     1 
HETATM 4291 O  O     . HOH J 8 .   ? 85.276 -9.791  7.847   1.00 37.68 ? 1004 HOH A O     1 
HETATM 4292 O  O     . HOH J 8 .   ? 64.273 13.178  5.331   1.00 34.23 ? 1005 HOH A O     1 
HETATM 4293 O  O     . HOH J 8 .   ? 44.968 -33.853 8.096   1.00 35.97 ? 1006 HOH A O     1 
HETATM 4294 O  O     . HOH J 8 .   ? 42.487 9.454   -25.930 1.00 35.10 ? 1007 HOH A O     1 
HETATM 4295 O  O     . HOH J 8 .   ? 35.351 -1.623  -8.403  1.00 40.71 ? 1008 HOH A O     1 
HETATM 4296 O  O     . HOH J 8 .   ? 36.928 -0.878  -6.227  1.00 36.81 ? 1009 HOH A O     1 
HETATM 4297 O  O     . HOH J 8 .   ? 58.889 0.540   -17.102 1.00 26.71 ? 1010 HOH A O     1 
HETATM 4298 O  O     . HOH J 8 .   ? 61.559 -17.706 -13.103 1.00 38.12 ? 1011 HOH A O     1 
HETATM 4299 O  O     . HOH J 8 .   ? 79.254 1.765   4.554   1.00 40.21 ? 1012 HOH A O     1 
HETATM 4300 O  O     . HOH J 8 .   ? 20.357 17.893  -5.239  1.00 33.58 ? 1013 HOH A O     1 
HETATM 4301 O  O     . HOH J 8 .   ? 47.328 -3.596  -4.996  1.00 32.12 ? 1014 HOH A O     1 
HETATM 4302 O  O     . HOH J 8 .   ? 38.607 -15.489 11.894  1.00 35.73 ? 1015 HOH A O     1 
HETATM 4303 O  O     . HOH J 8 .   ? 39.535 -2.306  -26.220 1.00 31.64 ? 1016 HOH A O     1 
HETATM 4304 O  O     . HOH J 8 .   ? 61.790 1.812   14.056  1.00 32.88 ? 1017 HOH A O     1 
HETATM 4305 O  O     . HOH J 8 .   ? 51.423 -29.361 16.631  1.00 34.25 ? 1018 HOH A O     1 
HETATM 4306 O  O     . HOH J 8 .   ? 61.409 4.466   19.083  1.00 34.29 ? 1019 HOH A O     1 
HETATM 4307 O  O     . HOH J 8 .   ? 74.617 -18.710 17.140  1.00 38.11 ? 1020 HOH A O     1 
HETATM 4308 O  O     . HOH J 8 .   ? 79.630 -2.240  -11.262 1.00 39.79 ? 1021 HOH A O     1 
HETATM 4309 O  O     . HOH J 8 .   ? 43.442 17.556  27.969  1.00 34.21 ? 1022 HOH A O     1 
HETATM 4310 O  O     . HOH J 8 .   ? 83.789 -7.936  0.780   1.00 37.36 ? 1023 HOH A O     1 
HETATM 4311 O  O     . HOH J 8 .   ? 53.203 1.634   16.650  1.00 33.68 ? 1024 HOH A O     1 
HETATM 4312 O  O     . HOH J 8 .   ? 34.727 2.558   6.883   1.00 36.56 ? 1025 HOH A O     1 
HETATM 4313 O  O     . HOH J 8 .   ? 37.359 10.119  -23.414 1.00 35.59 ? 1026 HOH A O     1 
HETATM 4314 O  O     . HOH J 8 .   ? 46.664 -0.730  -4.669  1.00 28.59 ? 1027 HOH A O     1 
HETATM 4315 O  O     . HOH J 8 .   ? 76.913 -5.956  -18.095 1.00 37.30 ? 1028 HOH A O     1 
HETATM 4316 O  O     . HOH J 8 .   ? 40.131 -13.253 11.115  1.00 33.34 ? 1029 HOH A O     1 
HETATM 4317 O  O     . HOH J 8 .   ? 50.996 15.818  -12.246 1.00 42.11 ? 1030 HOH A O     1 
HETATM 4318 O  O     . HOH J 8 .   ? 33.525 22.541  -0.592  1.00 39.70 ? 1031 HOH A O     1 
HETATM 4319 O  O     . HOH J 8 .   ? 43.276 17.569  -12.731 1.00 33.78 ? 1032 HOH A O     1 
HETATM 4320 O  O     . HOH J 8 .   ? 50.955 -0.078  7.882   1.00 34.68 ? 1033 HOH A O     1 
HETATM 4321 O  O     . HOH J 8 .   ? 37.282 15.196  -20.518 1.00 32.04 ? 1034 HOH A O     1 
HETATM 4322 O  O     . HOH J 8 .   ? 39.714 22.435  -3.043  1.00 42.57 ? 1035 HOH A O     1 
HETATM 4323 O  O     . HOH J 8 .   ? 54.331 20.971  20.664  1.00 33.88 ? 1036 HOH A O     1 
HETATM 4324 O  O     . HOH J 8 .   ? 69.912 -18.832 -9.419  1.00 36.78 ? 1037 HOH A O     1 
HETATM 4325 O  O     . HOH J 8 .   ? 59.440 -15.313 -14.928 1.00 41.09 ? 1038 HOH A O     1 
HETATM 4326 O  O     . HOH J 8 .   ? 83.381 -0.622  -4.072  1.00 31.98 ? 1039 HOH A O     1 
HETATM 4327 O  O     . HOH J 8 .   ? 48.316 -33.248 -3.732  1.00 28.08 ? 1040 HOH A O     1 
HETATM 4328 O  O     . HOH J 8 .   ? 59.267 14.856  21.354  1.00 36.21 ? 1041 HOH A O     1 
HETATM 4329 O  O     . HOH J 8 .   ? 83.073 -3.270  -4.152  1.00 34.92 ? 1042 HOH A O     1 
HETATM 4330 O  O     . HOH J 8 .   ? 78.014 -17.260 9.265   1.00 35.90 ? 1043 HOH A O     1 
HETATM 4331 O  O     . HOH J 8 .   ? 50.185 21.181  8.967   1.00 32.99 ? 1044 HOH A O     1 
HETATM 4332 O  O     . HOH J 8 .   ? 43.637 19.340  20.782  1.00 28.82 ? 1045 HOH A O     1 
HETATM 4333 O  O     . HOH J 8 .   ? 30.886 1.413   3.347   1.00 40.43 ? 1046 HOH A O     1 
HETATM 4334 O  O     . HOH J 8 .   ? 65.842 -21.668 14.587  1.00 30.94 ? 1047 HOH A O     1 
HETATM 4335 O  O     . HOH J 8 .   ? 30.743 21.684  -0.797  1.00 36.25 ? 1048 HOH A O     1 
HETATM 4336 O  O     . HOH J 8 .   ? 43.334 -25.476 17.388  1.00 31.45 ? 1049 HOH A O     1 
HETATM 4337 O  O     . HOH J 8 .   ? 59.636 -18.545 26.069  1.00 33.16 ? 1050 HOH A O     1 
HETATM 4338 O  O     . HOH J 8 .   ? 82.657 -4.597  -6.234  1.00 40.81 ? 1051 HOH A O     1 
HETATM 4339 O  O     . HOH J 8 .   ? 63.042 4.910   14.217  1.00 36.07 ? 1052 HOH A O     1 
HETATM 4340 O  O     . HOH J 8 .   ? 44.627 -18.864 19.033  1.00 35.23 ? 1053 HOH A O     1 
HETATM 4341 O  O     . HOH J 8 .   ? 43.356 17.573  18.148  1.00 30.51 ? 1054 HOH A O     1 
HETATM 4342 O  O     . HOH J 8 .   ? 39.372 19.387  -7.313  1.00 41.98 ? 1055 HOH A O     1 
HETATM 4343 O  O     . HOH J 8 .   ? 45.656 2.011   18.257  1.00 31.32 ? 1056 HOH A O     1 
HETATM 4344 O  O     . HOH J 8 .   ? 67.479 5.782   -17.171 1.00 34.59 ? 1057 HOH A O     1 
HETATM 4345 O  O     . HOH J 8 .   ? 38.034 8.367   24.486  1.00 36.58 ? 1058 HOH A O     1 
HETATM 4346 O  O     . HOH J 8 .   ? 42.463 -20.702 16.931  1.00 35.02 ? 1059 HOH A O     1 
HETATM 4347 O  O     . HOH J 8 .   ? 60.785 18.426  19.064  1.00 40.96 ? 1060 HOH A O     1 
HETATM 4348 O  O     . HOH J 8 .   ? 68.393 -16.889 -11.830 1.00 33.81 ? 1061 HOH A O     1 
HETATM 4349 O  O     . HOH J 8 .   ? 65.567 -8.871  12.212  1.00 37.21 ? 1062 HOH A O     1 
HETATM 4350 O  O     . HOH J 8 .   ? 32.180 -1.297  -2.767  1.00 39.59 ? 1063 HOH A O     1 
HETATM 4351 O  O     . HOH J 8 .   ? 49.158 29.546  5.055   1.00 33.37 ? 1064 HOH A O     1 
HETATM 4352 O  O     . HOH J 8 .   ? 80.038 -10.772 15.554  1.00 38.94 ? 1065 HOH A O     1 
HETATM 4353 O  O     . HOH J 8 .   ? 44.046 -1.317  -16.507 1.00 33.77 ? 1066 HOH A O     1 
HETATM 4354 O  O     . HOH J 8 .   ? 44.680 6.582   -3.008  1.00 31.70 ? 1067 HOH A O     1 
HETATM 4355 O  O     . HOH J 8 .   ? 60.469 13.581  19.187  1.00 35.45 ? 1068 HOH A O     1 
HETATM 4356 O  O     . HOH J 8 .   ? 56.082 -36.323 -0.968  1.00 39.17 ? 1069 HOH A O     1 
HETATM 4357 O  O     . HOH J 8 .   ? 65.307 5.848   12.615  1.00 39.91 ? 1070 HOH A O     1 
HETATM 4358 O  O     . HOH J 8 .   ? 63.314 7.538   11.935  1.00 33.28 ? 1071 HOH A O     1 
HETATM 4359 O  O     . HOH J 8 .   ? 48.116 3.092   -26.454 1.00 37.41 ? 1072 HOH A O     1 
HETATM 4360 O  O     . HOH J 8 .   ? 81.906 -18.583 6.277   1.00 35.93 ? 1073 HOH A O     1 
HETATM 4361 O  O     . HOH J 8 .   ? 69.218 8.257   4.177   1.00 31.75 ? 1074 HOH A O     1 
HETATM 4362 O  O     . HOH J 8 .   ? 55.724 1.433   16.037  1.00 24.42 ? 1075 HOH A O     1 
HETATM 4363 O  O     . HOH J 8 .   ? 36.597 17.296  19.467  1.00 41.00 ? 1076 HOH A O     1 
HETATM 4364 O  O     . HOH J 8 .   ? 47.342 -0.252  -8.423  1.00 23.96 ? 1077 HOH A O     1 
HETATM 4365 O  O     . HOH J 8 .   ? 52.549 -9.945  -2.939  1.00 29.38 ? 1078 HOH A O     1 
HETATM 4366 O  O     . HOH J 8 .   ? 47.625 -30.595 -6.899  1.00 32.40 ? 1079 HOH A O     1 
HETATM 4367 O  O     . HOH J 8 .   ? 50.972 -25.269 -8.075  1.00 34.03 ? 1080 HOH A O     1 
HETATM 4368 O  O     . HOH J 8 .   ? 36.925 -3.057  -4.330  1.00 24.15 ? 1081 HOH A O     1 
HETATM 4369 O  O     . HOH K 8 .   ? 40.901 -3.628  -9.562  1.00 23.92 ? 101  HOH T O     1 
HETATM 4370 O  O     . HOH K 8 .   ? 42.080 -7.477  -10.559 1.00 28.63 ? 102  HOH T O     1 
HETATM 4371 O  O     . HOH K 8 .   ? 36.880 -23.143 -5.403  1.00 30.40 ? 103  HOH T O     1 
HETATM 4372 O  O     . HOH K 8 .   ? 36.043 10.968  0.641   1.00 19.41 ? 104  HOH T O     1 
HETATM 4373 O  O     . HOH K 8 .   ? 41.825 -20.104 -3.480  1.00 26.57 ? 105  HOH T O     1 
HETATM 4374 O  O     . HOH K 8 .   ? 36.340 2.300   4.495   1.00 26.43 ? 106  HOH T O     1 
HETATM 4375 O  O     . HOH K 8 .   ? 44.405 -8.762  -3.648  1.00 19.68 ? 107  HOH T O     1 
HETATM 4376 O  O     . HOH K 8 .   ? 45.564 -5.199  -3.406  1.00 28.63 ? 108  HOH T O     1 
HETATM 4377 O  O     . HOH K 8 .   ? 38.949 -2.443  -6.489  1.00 31.51 ? 109  HOH T O     1 
HETATM 4378 O  O     . HOH K 8 .   ? 39.272 2.569   -7.116  1.00 27.37 ? 110  HOH T O     1 
HETATM 4379 O  O     . HOH K 8 .   ? 35.282 5.797   18.052  1.00 37.08 ? 111  HOH T O     1 
HETATM 4380 O  O     . HOH K 8 .   ? 37.756 -12.915 -11.191 1.00 25.35 ? 112  HOH T O     1 
HETATM 4381 O  O     . HOH K 8 .   ? 31.357 -16.139 -4.391  1.00 24.43 ? 113  HOH T O     1 
HETATM 4382 O  O     . HOH K 8 .   ? 45.249 -2.415  -3.568  1.00 23.93 ? 114  HOH T O     1 
HETATM 4383 O  O     . HOH K 8 .   ? 37.633 -0.139  4.402   1.00 29.85 ? 115  HOH T O     1 
HETATM 4384 O  O     . HOH K 8 .   ? 39.613 4.908   18.282  1.00 31.67 ? 116  HOH T O     1 
HETATM 4385 O  O     . HOH K 8 .   ? 43.734 5.617   0.522   1.00 23.50 ? 117  HOH T O     1 
HETATM 4386 O  O     . HOH K 8 .   ? 33.978 9.078   11.701  1.00 30.46 ? 118  HOH T O     1 
HETATM 4387 O  O     . HOH K 8 .   ? 44.473 1.115   -2.019  1.00 30.62 ? 119  HOH T O     1 
HETATM 4388 O  O     . HOH K 8 .   ? 40.590 -22.165 -6.861  1.00 38.79 ? 120  HOH T O     1 
HETATM 4389 O  O     . HOH K 8 .   ? 38.031 -4.313  -8.445  1.00 34.71 ? 121  HOH T O     1 
HETATM 4390 O  O     . HOH K 8 .   ? 30.787 4.858   8.599   1.00 40.05 ? 122  HOH T O     1 
HETATM 4391 O  O     . HOH K 8 .   ? 32.062 14.158  10.846  1.00 31.71 ? 123  HOH T O     1 
HETATM 4392 O  O     . HOH K 8 .   ? 45.577 5.479   -4.988  1.00 29.11 ? 124  HOH T O     1 
HETATM 4393 O  O     . HOH K 8 .   ? 37.240 0.243   -3.135  1.00 30.18 ? 125  HOH T O     1 
HETATM 4394 O  O     . HOH K 8 .   ? 41.606 7.321   11.027  1.00 28.57 ? 126  HOH T O     1 
HETATM 4395 O  O     . HOH K 8 .   ? 40.208 -0.651  7.726   1.00 31.86 ? 127  HOH T O     1 
HETATM 4396 O  O     . HOH K 8 .   ? 39.088 -10.261 -10.131 1.00 27.83 ? 128  HOH T O     1 
HETATM 4397 O  O     . HOH K 8 .   ? 25.920 -19.281 -6.688  1.00 30.05 ? 129  HOH T O     1 
HETATM 4398 O  O     . HOH K 8 .   ? 39.207 4.398   13.649  1.00 37.49 ? 130  HOH T O     1 
HETATM 4399 O  O     . HOH K 8 .   ? 36.658 -2.167  -1.269  1.00 29.02 ? 131  HOH T O     1 
HETATM 4400 O  O     . HOH K 8 .   ? 44.865 -0.412  8.713   1.00 33.80 ? 132  HOH T O     1 
HETATM 4401 O  O     . HOH K 8 .   ? 38.093 -21.772 -3.082  1.00 29.97 ? 133  HOH T O     1 
HETATM 4402 O  O     . HOH K 8 .   ? 43.716 0.743   10.510  1.00 31.50 ? 134  HOH T O     1 
HETATM 4403 O  O     . HOH K 8 .   ? 42.608 -11.361 -3.684  1.00 26.00 ? 135  HOH T O     1 
HETATM 4404 O  O     . HOH K 8 .   ? 38.756 -16.371 -10.764 1.00 39.89 ? 136  HOH T O     1 
HETATM 4405 O  O     . HOH K 8 .   ? 31.796 12.525  8.636   1.00 34.01 ? 137  HOH T O     1 
HETATM 4406 O  O     . HOH K 8 .   ? 38.467 4.532   16.068  1.00 39.06 ? 138  HOH T O     1 
HETATM 4407 O  O     . HOH K 8 .   ? 45.293 -12.491 -4.313  1.00 34.16 ? 139  HOH T O     1 
HETATM 4408 O  O     . HOH K 8 .   ? 32.451 -17.355 -2.577  1.00 33.85 ? 140  HOH T O     1 
HETATM 4409 O  O     . HOH K 8 .   ? 37.719 -18.534 -8.707  1.00 31.43 ? 141  HOH T O     1 
HETATM 4410 O  O     . HOH K 8 .   ? 36.594 -8.599  -9.850  1.00 35.18 ? 142  HOH T O     1 
HETATM 4411 O  O     . HOH L 8 .   ? 48.959 2.475   1.021   0.30 9.81  ? 101  HOH P O     1 
HETATM 4412 O  O     . HOH L 8 .   ? 44.969 -8.299  -1.017  1.00 20.26 ? 102  HOH P O     1 
HETATM 4413 O  O     . HOH L 8 .   ? 42.900 -9.043  7.089   1.00 17.98 ? 103  HOH P O     1 
HETATM 4414 O  O     . HOH L 8 .   ? 45.962 -10.789 -0.153  1.00 21.24 ? 104  HOH P O     1 
HETATM 4415 O  O     . HOH L 8 .   ? 49.454 -10.121 6.697   1.00 19.11 ? 105  HOH P O     1 
HETATM 4416 O  O     . HOH L 8 .   ? 41.795 -11.834 -0.993  1.00 22.63 ? 106  HOH P O     1 
HETATM 4417 O  O     . HOH L 8 .   ? 41.595 -15.733 1.745   1.00 18.02 ? 107  HOH P O     1 
HETATM 4418 O  O     . HOH L 8 .   ? 46.242 -2.598  -0.730  1.00 21.71 ? 108  HOH P O     1 
HETATM 4419 O  O     . HOH L 8 .   ? 44.209 -12.873 -0.250  1.00 21.63 ? 109  HOH P O     1 
HETATM 4420 O  O     . HOH L 8 .   ? 40.724 -5.255  5.561   1.00 25.28 ? 110  HOH P O     1 
HETATM 4421 O  O     . HOH L 8 .   ? 46.428 3.844   0.938   1.00 28.16 ? 111  HOH P O     1 
HETATM 4422 O  O     . HOH L 8 .   ? 26.394 -12.803 -10.428 1.00 23.72 ? 112  HOH P O     1 
HETATM 4423 O  O     . HOH L 8 .   ? 35.144 -4.588  -1.128  1.00 25.65 ? 113  HOH P O     1 
HETATM 4424 O  O     . HOH L 8 .   ? 40.602 -9.089  5.781   1.00 23.92 ? 114  HOH P O     1 
HETATM 4425 O  O     . HOH L 8 .   ? 36.656 -4.589  3.183   1.00 22.43 ? 115  HOH P O     1 
HETATM 4426 O  O     . HOH L 8 .   ? 38.427 -10.723 6.432   1.00 29.59 ? 116  HOH P O     1 
HETATM 4427 O  O     . HOH L 8 .   ? 44.930 -6.437  5.894   1.00 27.82 ? 117  HOH P O     1 
HETATM 4428 O  O     . HOH L 8 .   ? 38.665 -3.917  4.764   1.00 27.15 ? 118  HOH P O     1 
HETATM 4429 O  O     . HOH L 8 .   ? 38.231 -1.878  6.285   1.00 32.11 ? 119  HOH P O     1 
HETATM 4430 O  O     . HOH L 8 .   ? 30.871 -6.381  -13.387 1.00 37.40 ? 120  HOH P O     1 
HETATM 4431 O  O     . HOH L 8 .   ? 32.573 -7.547  -11.650 1.00 35.71 ? 121  HOH P O     1 
HETATM 4432 O  O     . HOH L 8 .   ? 40.225 -14.313 -0.181  1.00 32.80 ? 122  HOH P O     1 
HETATM 4433 O  O     . HOH L 8 .   ? 39.045 -6.958  6.217   1.00 36.75 ? 123  HOH P O     1 
HETATM 4434 O  O     . HOH L 8 .   ? 48.053 -1.993  7.151   1.00 32.13 ? 124  HOH P O     1 
HETATM 4435 O  O     . HOH L 8 .   ? 31.807 -9.412  4.393   1.00 39.43 ? 125  HOH P O     1 
HETATM 4436 O  O     . HOH L 8 .   ? 36.196 -13.753 -1.958  1.00 29.71 ? 126  HOH P O     1 
HETATM 4437 O  O     . HOH L 8 .   ? 30.404 -10.515 6.675   1.00 47.20 ? 127  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NA  1   501  116 NA  NA  A . 
E 5 CA  1   503  502 CA  CA  A . 
F 6 GOL 1   504  436 GOL GOL A . 
G 6 GOL 1   505  437 GOL GOL A . 
H 6 GOL 1   506  438 GOL GOL A . 
I 7 DTP 1   502  9   DTP DTP P . 
J 8 HOH 1   601  2   HOH HOH A . 
J 8 HOH 2   602  3   HOH HOH A . 
J 8 HOH 3   603  4   HOH HOH A . 
J 8 HOH 4   604  5   HOH HOH A . 
J 8 HOH 5   605  6   HOH HOH A . 
J 8 HOH 6   606  7   HOH HOH A . 
J 8 HOH 7   607  8   HOH HOH A . 
J 8 HOH 8   608  9   HOH HOH A . 
J 8 HOH 9   609  10  HOH HOH A . 
J 8 HOH 10  610  11  HOH HOH A . 
J 8 HOH 11  611  12  HOH HOH A . 
J 8 HOH 12  612  13  HOH HOH A . 
J 8 HOH 13  613  14  HOH HOH A . 
J 8 HOH 14  614  15  HOH HOH A . 
J 8 HOH 15  615  16  HOH HOH A . 
J 8 HOH 16  616  17  HOH HOH A . 
J 8 HOH 17  617  18  HOH HOH A . 
J 8 HOH 18  618  19  HOH HOH A . 
J 8 HOH 19  619  20  HOH HOH A . 
J 8 HOH 20  620  21  HOH HOH A . 
J 8 HOH 21  621  22  HOH HOH A . 
J 8 HOH 22  622  23  HOH HOH A . 
J 8 HOH 23  623  24  HOH HOH A . 
J 8 HOH 24  624  25  HOH HOH A . 
J 8 HOH 25  625  26  HOH HOH A . 
J 8 HOH 26  626  27  HOH HOH A . 
J 8 HOH 27  627  28  HOH HOH A . 
J 8 HOH 28  628  29  HOH HOH A . 
J 8 HOH 29  629  30  HOH HOH A . 
J 8 HOH 30  630  31  HOH HOH A . 
J 8 HOH 31  631  32  HOH HOH A . 
J 8 HOH 32  632  33  HOH HOH A . 
J 8 HOH 33  633  34  HOH HOH A . 
J 8 HOH 34  634  35  HOH HOH A . 
J 8 HOH 35  635  37  HOH HOH A . 
J 8 HOH 36  636  38  HOH HOH A . 
J 8 HOH 37  637  39  HOH HOH A . 
J 8 HOH 38  638  40  HOH HOH A . 
J 8 HOH 39  639  41  HOH HOH A . 
J 8 HOH 40  640  42  HOH HOH A . 
J 8 HOH 41  641  43  HOH HOH A . 
J 8 HOH 42  642  44  HOH HOH A . 
J 8 HOH 43  643  45  HOH HOH A . 
J 8 HOH 44  644  46  HOH HOH A . 
J 8 HOH 45  645  47  HOH HOH A . 
J 8 HOH 46  646  48  HOH HOH A . 
J 8 HOH 47  647  49  HOH HOH A . 
J 8 HOH 48  648  50  HOH HOH A . 
J 8 HOH 49  649  51  HOH HOH A . 
J 8 HOH 50  650  52  HOH HOH A . 
J 8 HOH 51  651  53  HOH HOH A . 
J 8 HOH 52  652  54  HOH HOH A . 
J 8 HOH 53  653  55  HOH HOH A . 
J 8 HOH 54  654  56  HOH HOH A . 
J 8 HOH 55  655  57  HOH HOH A . 
J 8 HOH 56  656  58  HOH HOH A . 
J 8 HOH 57  657  59  HOH HOH A . 
J 8 HOH 58  658  60  HOH HOH A . 
J 8 HOH 59  659  61  HOH HOH A . 
J 8 HOH 60  660  62  HOH HOH A . 
J 8 HOH 61  661  63  HOH HOH A . 
J 8 HOH 62  662  64  HOH HOH A . 
J 8 HOH 63  663  65  HOH HOH A . 
J 8 HOH 64  664  68  HOH HOH A . 
J 8 HOH 65  665  70  HOH HOH A . 
J 8 HOH 66  666  71  HOH HOH A . 
J 8 HOH 67  667  72  HOH HOH A . 
J 8 HOH 68  668  73  HOH HOH A . 
J 8 HOH 69  669  74  HOH HOH A . 
J 8 HOH 70  670  75  HOH HOH A . 
J 8 HOH 71  671  76  HOH HOH A . 
J 8 HOH 72  672  77  HOH HOH A . 
J 8 HOH 73  673  78  HOH HOH A . 
J 8 HOH 74  674  79  HOH HOH A . 
J 8 HOH 75  675  80  HOH HOH A . 
J 8 HOH 76  676  81  HOH HOH A . 
J 8 HOH 77  677  82  HOH HOH A . 
J 8 HOH 78  678  84  HOH HOH A . 
J 8 HOH 79  679  85  HOH HOH A . 
J 8 HOH 80  680  86  HOH HOH A . 
J 8 HOH 81  681  87  HOH HOH A . 
J 8 HOH 82  682  88  HOH HOH A . 
J 8 HOH 83  683  89  HOH HOH A . 
J 8 HOH 84  684  90  HOH HOH A . 
J 8 HOH 85  685  91  HOH HOH A . 
J 8 HOH 86  686  92  HOH HOH A . 
J 8 HOH 87  687  94  HOH HOH A . 
J 8 HOH 88  688  95  HOH HOH A . 
J 8 HOH 89  689  96  HOH HOH A . 
J 8 HOH 90  690  97  HOH HOH A . 
J 8 HOH 91  691  98  HOH HOH A . 
J 8 HOH 92  692  99  HOH HOH A . 
J 8 HOH 93  693  100 HOH HOH A . 
J 8 HOH 94  694  102 HOH HOH A . 
J 8 HOH 95  695  103 HOH HOH A . 
J 8 HOH 96  696  104 HOH HOH A . 
J 8 HOH 97  697  105 HOH HOH A . 
J 8 HOH 98  698  106 HOH HOH A . 
J 8 HOH 99  699  107 HOH HOH A . 
J 8 HOH 100 700  108 HOH HOH A . 
J 8 HOH 101 701  110 HOH HOH A . 
J 8 HOH 102 702  111 HOH HOH A . 
J 8 HOH 103 703  112 HOH HOH A . 
J 8 HOH 104 704  113 HOH HOH A . 
J 8 HOH 105 705  115 HOH HOH A . 
J 8 HOH 106 706  118 HOH HOH A . 
J 8 HOH 107 707  120 HOH HOH A . 
J 8 HOH 108 708  121 HOH HOH A . 
J 8 HOH 109 709  122 HOH HOH A . 
J 8 HOH 110 710  124 HOH HOH A . 
J 8 HOH 111 711  125 HOH HOH A . 
J 8 HOH 112 712  126 HOH HOH A . 
J 8 HOH 113 713  127 HOH HOH A . 
J 8 HOH 114 714  128 HOH HOH A . 
J 8 HOH 115 715  129 HOH HOH A . 
J 8 HOH 116 716  131 HOH HOH A . 
J 8 HOH 117 717  132 HOH HOH A . 
J 8 HOH 118 718  133 HOH HOH A . 
J 8 HOH 119 719  134 HOH HOH A . 
J 8 HOH 120 720  135 HOH HOH A . 
J 8 HOH 121 721  136 HOH HOH A . 
J 8 HOH 122 722  137 HOH HOH A . 
J 8 HOH 123 723  138 HOH HOH A . 
J 8 HOH 124 724  140 HOH HOH A . 
J 8 HOH 125 725  141 HOH HOH A . 
J 8 HOH 126 726  143 HOH HOH A . 
J 8 HOH 127 727  144 HOH HOH A . 
J 8 HOH 128 728  145 HOH HOH A . 
J 8 HOH 129 729  146 HOH HOH A . 
J 8 HOH 130 730  147 HOH HOH A . 
J 8 HOH 131 731  148 HOH HOH A . 
J 8 HOH 132 732  149 HOH HOH A . 
J 8 HOH 133 733  150 HOH HOH A . 
J 8 HOH 134 734  151 HOH HOH A . 
J 8 HOH 135 735  153 HOH HOH A . 
J 8 HOH 136 736  155 HOH HOH A . 
J 8 HOH 137 737  156 HOH HOH A . 
J 8 HOH 138 738  157 HOH HOH A . 
J 8 HOH 139 739  158 HOH HOH A . 
J 8 HOH 140 740  159 HOH HOH A . 
J 8 HOH 141 741  160 HOH HOH A . 
J 8 HOH 142 742  161 HOH HOH A . 
J 8 HOH 143 743  162 HOH HOH A . 
J 8 HOH 144 744  163 HOH HOH A . 
J 8 HOH 145 745  164 HOH HOH A . 
J 8 HOH 146 746  165 HOH HOH A . 
J 8 HOH 147 747  168 HOH HOH A . 
J 8 HOH 148 748  170 HOH HOH A . 
J 8 HOH 149 749  171 HOH HOH A . 
J 8 HOH 150 750  172 HOH HOH A . 
J 8 HOH 151 751  173 HOH HOH A . 
J 8 HOH 152 752  174 HOH HOH A . 
J 8 HOH 153 753  175 HOH HOH A . 
J 8 HOH 154 754  176 HOH HOH A . 
J 8 HOH 155 755  177 HOH HOH A . 
J 8 HOH 156 756  178 HOH HOH A . 
J 8 HOH 157 757  179 HOH HOH A . 
J 8 HOH 158 758  180 HOH HOH A . 
J 8 HOH 159 759  181 HOH HOH A . 
J 8 HOH 160 760  182 HOH HOH A . 
J 8 HOH 161 761  183 HOH HOH A . 
J 8 HOH 162 762  184 HOH HOH A . 
J 8 HOH 163 763  185 HOH HOH A . 
J 8 HOH 164 764  187 HOH HOH A . 
J 8 HOH 165 765  188 HOH HOH A . 
J 8 HOH 166 766  189 HOH HOH A . 
J 8 HOH 167 767  190 HOH HOH A . 
J 8 HOH 168 768  191 HOH HOH A . 
J 8 HOH 169 769  192 HOH HOH A . 
J 8 HOH 170 770  193 HOH HOH A . 
J 8 HOH 171 771  194 HOH HOH A . 
J 8 HOH 172 772  195 HOH HOH A . 
J 8 HOH 173 773  198 HOH HOH A . 
J 8 HOH 174 774  199 HOH HOH A . 
J 8 HOH 175 775  200 HOH HOH A . 
J 8 HOH 176 776  201 HOH HOH A . 
J 8 HOH 177 777  202 HOH HOH A . 
J 8 HOH 178 778  203 HOH HOH A . 
J 8 HOH 179 779  204 HOH HOH A . 
J 8 HOH 180 780  205 HOH HOH A . 
J 8 HOH 181 781  206 HOH HOH A . 
J 8 HOH 182 782  207 HOH HOH A . 
J 8 HOH 183 783  208 HOH HOH A . 
J 8 HOH 184 784  209 HOH HOH A . 
J 8 HOH 185 785  211 HOH HOH A . 
J 8 HOH 186 786  212 HOH HOH A . 
J 8 HOH 187 787  213 HOH HOH A . 
J 8 HOH 188 788  214 HOH HOH A . 
J 8 HOH 189 789  215 HOH HOH A . 
J 8 HOH 190 790  216 HOH HOH A . 
J 8 HOH 191 791  217 HOH HOH A . 
J 8 HOH 192 792  218 HOH HOH A . 
J 8 HOH 193 793  219 HOH HOH A . 
J 8 HOH 194 794  220 HOH HOH A . 
J 8 HOH 195 795  221 HOH HOH A . 
J 8 HOH 196 796  222 HOH HOH A . 
J 8 HOH 197 797  223 HOH HOH A . 
J 8 HOH 198 798  224 HOH HOH A . 
J 8 HOH 199 799  225 HOH HOH A . 
J 8 HOH 200 800  226 HOH HOH A . 
J 8 HOH 201 801  228 HOH HOH A . 
J 8 HOH 202 802  229 HOH HOH A . 
J 8 HOH 203 803  231 HOH HOH A . 
J 8 HOH 204 804  232 HOH HOH A . 
J 8 HOH 205 805  233 HOH HOH A . 
J 8 HOH 206 806  234 HOH HOH A . 
J 8 HOH 207 807  235 HOH HOH A . 
J 8 HOH 208 808  236 HOH HOH A . 
J 8 HOH 209 809  237 HOH HOH A . 
J 8 HOH 210 810  238 HOH HOH A . 
J 8 HOH 211 811  240 HOH HOH A . 
J 8 HOH 212 812  243 HOH HOH A . 
J 8 HOH 213 813  244 HOH HOH A . 
J 8 HOH 214 814  245 HOH HOH A . 
J 8 HOH 215 815  246 HOH HOH A . 
J 8 HOH 216 816  247 HOH HOH A . 
J 8 HOH 217 817  248 HOH HOH A . 
J 8 HOH 218 818  249 HOH HOH A . 
J 8 HOH 219 819  250 HOH HOH A . 
J 8 HOH 220 820  251 HOH HOH A . 
J 8 HOH 221 821  252 HOH HOH A . 
J 8 HOH 222 822  253 HOH HOH A . 
J 8 HOH 223 823  254 HOH HOH A . 
J 8 HOH 224 824  255 HOH HOH A . 
J 8 HOH 225 825  256 HOH HOH A . 
J 8 HOH 226 826  257 HOH HOH A . 
J 8 HOH 227 827  258 HOH HOH A . 
J 8 HOH 228 828  259 HOH HOH A . 
J 8 HOH 229 829  260 HOH HOH A . 
J 8 HOH 230 830  261 HOH HOH A . 
J 8 HOH 231 831  262 HOH HOH A . 
J 8 HOH 232 832  263 HOH HOH A . 
J 8 HOH 233 833  265 HOH HOH A . 
J 8 HOH 234 834  266 HOH HOH A . 
J 8 HOH 235 835  267 HOH HOH A . 
J 8 HOH 236 836  269 HOH HOH A . 
J 8 HOH 237 837  270 HOH HOH A . 
J 8 HOH 238 838  273 HOH HOH A . 
J 8 HOH 239 839  274 HOH HOH A . 
J 8 HOH 240 840  275 HOH HOH A . 
J 8 HOH 241 841  276 HOH HOH A . 
J 8 HOH 242 842  277 HOH HOH A . 
J 8 HOH 243 843  278 HOH HOH A . 
J 8 HOH 244 844  280 HOH HOH A . 
J 8 HOH 245 845  281 HOH HOH A . 
J 8 HOH 246 846  283 HOH HOH A . 
J 8 HOH 247 847  284 HOH HOH A . 
J 8 HOH 248 848  285 HOH HOH A . 
J 8 HOH 249 849  286 HOH HOH A . 
J 8 HOH 250 850  289 HOH HOH A . 
J 8 HOH 251 851  290 HOH HOH A . 
J 8 HOH 252 852  291 HOH HOH A . 
J 8 HOH 253 853  292 HOH HOH A . 
J 8 HOH 254 854  293 HOH HOH A . 
J 8 HOH 255 855  294 HOH HOH A . 
J 8 HOH 256 856  295 HOH HOH A . 
J 8 HOH 257 857  296 HOH HOH A . 
J 8 HOH 258 858  298 HOH HOH A . 
J 8 HOH 259 859  299 HOH HOH A . 
J 8 HOH 260 860  300 HOH HOH A . 
J 8 HOH 261 861  301 HOH HOH A . 
J 8 HOH 262 862  302 HOH HOH A . 
J 8 HOH 263 863  303 HOH HOH A . 
J 8 HOH 264 864  304 HOH HOH A . 
J 8 HOH 265 865  305 HOH HOH A . 
J 8 HOH 266 866  306 HOH HOH A . 
J 8 HOH 267 867  307 HOH HOH A . 
J 8 HOH 268 868  308 HOH HOH A . 
J 8 HOH 269 869  309 HOH HOH A . 
J 8 HOH 270 870  310 HOH HOH A . 
J 8 HOH 271 871  311 HOH HOH A . 
J 8 HOH 272 872  312 HOH HOH A . 
J 8 HOH 273 873  313 HOH HOH A . 
J 8 HOH 274 874  315 HOH HOH A . 
J 8 HOH 275 875  316 HOH HOH A . 
J 8 HOH 276 876  317 HOH HOH A . 
J 8 HOH 277 877  318 HOH HOH A . 
J 8 HOH 278 878  319 HOH HOH A . 
J 8 HOH 279 879  322 HOH HOH A . 
J 8 HOH 280 880  323 HOH HOH A . 
J 8 HOH 281 881  324 HOH HOH A . 
J 8 HOH 282 882  325 HOH HOH A . 
J 8 HOH 283 883  326 HOH HOH A . 
J 8 HOH 284 884  327 HOH HOH A . 
J 8 HOH 285 885  328 HOH HOH A . 
J 8 HOH 286 886  329 HOH HOH A . 
J 8 HOH 287 887  330 HOH HOH A . 
J 8 HOH 288 888  331 HOH HOH A . 
J 8 HOH 289 889  332 HOH HOH A . 
J 8 HOH 290 890  334 HOH HOH A . 
J 8 HOH 291 891  335 HOH HOH A . 
J 8 HOH 292 892  336 HOH HOH A . 
J 8 HOH 293 893  337 HOH HOH A . 
J 8 HOH 294 894  338 HOH HOH A . 
J 8 HOH 295 895  340 HOH HOH A . 
J 8 HOH 296 896  343 HOH HOH A . 
J 8 HOH 297 897  344 HOH HOH A . 
J 8 HOH 298 898  345 HOH HOH A . 
J 8 HOH 299 899  346 HOH HOH A . 
J 8 HOH 300 900  347 HOH HOH A . 
J 8 HOH 301 901  348 HOH HOH A . 
J 8 HOH 302 902  349 HOH HOH A . 
J 8 HOH 303 903  350 HOH HOH A . 
J 8 HOH 304 904  351 HOH HOH A . 
J 8 HOH 305 905  352 HOH HOH A . 
J 8 HOH 306 906  354 HOH HOH A . 
J 8 HOH 307 907  355 HOH HOH A . 
J 8 HOH 308 908  356 HOH HOH A . 
J 8 HOH 309 909  357 HOH HOH A . 
J 8 HOH 310 910  358 HOH HOH A . 
J 8 HOH 311 911  359 HOH HOH A . 
J 8 HOH 312 912  360 HOH HOH A . 
J 8 HOH 313 913  363 HOH HOH A . 
J 8 HOH 314 914  364 HOH HOH A . 
J 8 HOH 315 915  366 HOH HOH A . 
J 8 HOH 316 916  367 HOH HOH A . 
J 8 HOH 317 917  368 HOH HOH A . 
J 8 HOH 318 918  369 HOH HOH A . 
J 8 HOH 319 919  370 HOH HOH A . 
J 8 HOH 320 920  371 HOH HOH A . 
J 8 HOH 321 921  372 HOH HOH A . 
J 8 HOH 322 922  373 HOH HOH A . 
J 8 HOH 323 923  374 HOH HOH A . 
J 8 HOH 324 924  375 HOH HOH A . 
J 8 HOH 325 925  376 HOH HOH A . 
J 8 HOH 326 926  377 HOH HOH A . 
J 8 HOH 327 927  378 HOH HOH A . 
J 8 HOH 328 928  379 HOH HOH A . 
J 8 HOH 329 929  380 HOH HOH A . 
J 8 HOH 330 930  382 HOH HOH A . 
J 8 HOH 331 931  383 HOH HOH A . 
J 8 HOH 332 932  384 HOH HOH A . 
J 8 HOH 333 933  385 HOH HOH A . 
J 8 HOH 334 934  387 HOH HOH A . 
J 8 HOH 335 935  388 HOH HOH A . 
J 8 HOH 336 936  389 HOH HOH A . 
J 8 HOH 337 937  390 HOH HOH A . 
J 8 HOH 338 938  391 HOH HOH A . 
J 8 HOH 339 939  392 HOH HOH A . 
J 8 HOH 340 940  393 HOH HOH A . 
J 8 HOH 341 941  394 HOH HOH A . 
J 8 HOH 342 942  395 HOH HOH A . 
J 8 HOH 343 943  396 HOH HOH A . 
J 8 HOH 344 944  397 HOH HOH A . 
J 8 HOH 345 945  398 HOH HOH A . 
J 8 HOH 346 946  399 HOH HOH A . 
J 8 HOH 347 947  400 HOH HOH A . 
J 8 HOH 348 948  401 HOH HOH A . 
J 8 HOH 349 949  402 HOH HOH A . 
J 8 HOH 350 950  403 HOH HOH A . 
J 8 HOH 351 951  404 HOH HOH A . 
J 8 HOH 352 952  405 HOH HOH A . 
J 8 HOH 353 953  406 HOH HOH A . 
J 8 HOH 354 954  407 HOH HOH A . 
J 8 HOH 355 955  408 HOH HOH A . 
J 8 HOH 356 956  409 HOH HOH A . 
J 8 HOH 357 957  410 HOH HOH A . 
J 8 HOH 358 958  413 HOH HOH A . 
J 8 HOH 359 959  414 HOH HOH A . 
J 8 HOH 360 960  416 HOH HOH A . 
J 8 HOH 361 961  417 HOH HOH A . 
J 8 HOH 362 962  418 HOH HOH A . 
J 8 HOH 363 963  419 HOH HOH A . 
J 8 HOH 364 964  420 HOH HOH A . 
J 8 HOH 365 965  421 HOH HOH A . 
J 8 HOH 366 966  422 HOH HOH A . 
J 8 HOH 367 967  423 HOH HOH A . 
J 8 HOH 368 968  424 HOH HOH A . 
J 8 HOH 369 969  425 HOH HOH A . 
J 8 HOH 370 970  426 HOH HOH A . 
J 8 HOH 371 971  427 HOH HOH A . 
J 8 HOH 372 972  428 HOH HOH A . 
J 8 HOH 373 973  429 HOH HOH A . 
J 8 HOH 374 974  430 HOH HOH A . 
J 8 HOH 375 975  431 HOH HOH A . 
J 8 HOH 376 976  432 HOH HOH A . 
J 8 HOH 377 977  434 HOH HOH A . 
J 8 HOH 378 978  435 HOH HOH A . 
J 8 HOH 379 979  436 HOH HOH A . 
J 8 HOH 380 980  437 HOH HOH A . 
J 8 HOH 381 981  438 HOH HOH A . 
J 8 HOH 382 982  439 HOH HOH A . 
J 8 HOH 383 983  440 HOH HOH A . 
J 8 HOH 384 984  441 HOH HOH A . 
J 8 HOH 385 985  442 HOH HOH A . 
J 8 HOH 386 986  443 HOH HOH A . 
J 8 HOH 387 987  445 HOH HOH A . 
J 8 HOH 388 988  446 HOH HOH A . 
J 8 HOH 389 989  447 HOH HOH A . 
J 8 HOH 390 990  448 HOH HOH A . 
J 8 HOH 391 991  449 HOH HOH A . 
J 8 HOH 392 992  451 HOH HOH A . 
J 8 HOH 393 993  453 HOH HOH A . 
J 8 HOH 394 994  457 HOH HOH A . 
J 8 HOH 395 995  458 HOH HOH A . 
J 8 HOH 396 996  459 HOH HOH A . 
J 8 HOH 397 997  460 HOH HOH A . 
J 8 HOH 398 998  461 HOH HOH A . 
J 8 HOH 399 999  462 HOH HOH A . 
J 8 HOH 400 1000 464 HOH HOH A . 
J 8 HOH 401 1001 465 HOH HOH A . 
J 8 HOH 402 1002 466 HOH HOH A . 
J 8 HOH 403 1003 467 HOH HOH A . 
J 8 HOH 404 1004 469 HOH HOH A . 
J 8 HOH 405 1005 470 HOH HOH A . 
J 8 HOH 406 1006 471 HOH HOH A . 
J 8 HOH 407 1007 472 HOH HOH A . 
J 8 HOH 408 1008 473 HOH HOH A . 
J 8 HOH 409 1009 474 HOH HOH A . 
J 8 HOH 410 1010 475 HOH HOH A . 
J 8 HOH 411 1011 476 HOH HOH A . 
J 8 HOH 412 1012 477 HOH HOH A . 
J 8 HOH 413 1013 478 HOH HOH A . 
J 8 HOH 414 1014 479 HOH HOH A . 
J 8 HOH 415 1015 480 HOH HOH A . 
J 8 HOH 416 1016 481 HOH HOH A . 
J 8 HOH 417 1017 482 HOH HOH A . 
J 8 HOH 418 1018 483 HOH HOH A . 
J 8 HOH 419 1019 484 HOH HOH A . 
J 8 HOH 420 1020 485 HOH HOH A . 
J 8 HOH 421 1021 486 HOH HOH A . 
J 8 HOH 422 1022 487 HOH HOH A . 
J 8 HOH 423 1023 489 HOH HOH A . 
J 8 HOH 424 1024 490 HOH HOH A . 
J 8 HOH 425 1025 491 HOH HOH A . 
J 8 HOH 426 1026 492 HOH HOH A . 
J 8 HOH 427 1027 493 HOH HOH A . 
J 8 HOH 428 1028 495 HOH HOH A . 
J 8 HOH 429 1029 497 HOH HOH A . 
J 8 HOH 430 1030 498 HOH HOH A . 
J 8 HOH 431 1031 499 HOH HOH A . 
J 8 HOH 432 1032 500 HOH HOH A . 
J 8 HOH 433 1033 501 HOH HOH A . 
J 8 HOH 434 1034 502 HOH HOH A . 
J 8 HOH 435 1035 503 HOH HOH A . 
J 8 HOH 436 1036 504 HOH HOH A . 
J 8 HOH 437 1037 505 HOH HOH A . 
J 8 HOH 438 1038 506 HOH HOH A . 
J 8 HOH 439 1039 507 HOH HOH A . 
J 8 HOH 440 1040 508 HOH HOH A . 
J 8 HOH 441 1041 509 HOH HOH A . 
J 8 HOH 442 1042 510 HOH HOH A . 
J 8 HOH 443 1043 511 HOH HOH A . 
J 8 HOH 444 1044 512 HOH HOH A . 
J 8 HOH 445 1045 513 HOH HOH A . 
J 8 HOH 446 1046 514 HOH HOH A . 
J 8 HOH 447 1047 515 HOH HOH A . 
J 8 HOH 448 1048 516 HOH HOH A . 
J 8 HOH 449 1049 517 HOH HOH A . 
J 8 HOH 450 1050 518 HOH HOH A . 
J 8 HOH 451 1051 519 HOH HOH A . 
J 8 HOH 452 1052 520 HOH HOH A . 
J 8 HOH 453 1053 521 HOH HOH A . 
J 8 HOH 454 1054 522 HOH HOH A . 
J 8 HOH 455 1055 523 HOH HOH A . 
J 8 HOH 456 1056 526 HOH HOH A . 
J 8 HOH 457 1057 527 HOH HOH A . 
J 8 HOH 458 1058 528 HOH HOH A . 
J 8 HOH 459 1059 529 HOH HOH A . 
J 8 HOH 460 1060 530 HOH HOH A . 
J 8 HOH 461 1061 531 HOH HOH A . 
J 8 HOH 462 1062 532 HOH HOH A . 
J 8 HOH 463 1063 533 HOH HOH A . 
J 8 HOH 464 1064 534 HOH HOH A . 
J 8 HOH 465 1065 536 HOH HOH A . 
J 8 HOH 466 1066 538 HOH HOH A . 
J 8 HOH 467 1067 539 HOH HOH A . 
J 8 HOH 468 1068 540 HOH HOH A . 
J 8 HOH 469 1069 541 HOH HOH A . 
J 8 HOH 470 1070 542 HOH HOH A . 
J 8 HOH 471 1071 543 HOH HOH A . 
J 8 HOH 472 1072 544 HOH HOH A . 
J 8 HOH 473 1073 545 HOH HOH A . 
J 8 HOH 474 1074 546 HOH HOH A . 
J 8 HOH 475 1075 547 HOH HOH A . 
J 8 HOH 476 1076 548 HOH HOH A . 
J 8 HOH 477 1077 549 HOH HOH A . 
J 8 HOH 478 1078 550 HOH HOH A . 
J 8 HOH 479 1079 551 HOH HOH A . 
J 8 HOH 480 1080 552 HOH HOH A . 
J 8 HOH 481 1081 169 HOH HOH A . 
K 8 HOH 1   101  66  HOH HOH T . 
K 8 HOH 2   102  93  HOH HOH T . 
K 8 HOH 3   103  114 HOH HOH T . 
K 8 HOH 4   104  117 HOH HOH T . 
K 8 HOH 5   105  142 HOH HOH T . 
K 8 HOH 6   106  154 HOH HOH T . 
K 8 HOH 7   107  166 HOH HOH T . 
K 8 HOH 8   108  186 HOH HOH T . 
K 8 HOH 9   109  196 HOH HOH T . 
K 8 HOH 10  110  227 HOH HOH T . 
K 8 HOH 11  111  230 HOH HOH T . 
K 8 HOH 12  112  239 HOH HOH T . 
K 8 HOH 13  113  242 HOH HOH T . 
K 8 HOH 14  114  264 HOH HOH T . 
K 8 HOH 15  115  268 HOH HOH T . 
K 8 HOH 16  116  271 HOH HOH T . 
K 8 HOH 17  117  279 HOH HOH T . 
K 8 HOH 18  118  282 HOH HOH T . 
K 8 HOH 19  119  287 HOH HOH T . 
K 8 HOH 20  120  288 HOH HOH T . 
K 8 HOH 21  121  297 HOH HOH T . 
K 8 HOH 22  122  320 HOH HOH T . 
K 8 HOH 23  123  333 HOH HOH T . 
K 8 HOH 24  124  339 HOH HOH T . 
K 8 HOH 25  125  341 HOH HOH T . 
K 8 HOH 26  126  342 HOH HOH T . 
K 8 HOH 27  127  353 HOH HOH T . 
K 8 HOH 28  128  362 HOH HOH T . 
K 8 HOH 29  129  365 HOH HOH T . 
K 8 HOH 30  130  386 HOH HOH T . 
K 8 HOH 31  131  411 HOH HOH T . 
K 8 HOH 32  132  412 HOH HOH T . 
K 8 HOH 33  133  415 HOH HOH T . 
K 8 HOH 34  134  433 HOH HOH T . 
K 8 HOH 35  135  444 HOH HOH T . 
K 8 HOH 36  136  450 HOH HOH T . 
K 8 HOH 37  137  452 HOH HOH T . 
K 8 HOH 38  138  455 HOH HOH T . 
K 8 HOH 39  139  463 HOH HOH T . 
K 8 HOH 40  140  468 HOH HOH T . 
K 8 HOH 41  141  488 HOH HOH T . 
K 8 HOH 42  142  496 HOH HOH T . 
L 8 HOH 1   101  1   HOH HOH P . 
L 8 HOH 2   102  36  HOH HOH P . 
L 8 HOH 3   103  67  HOH HOH P . 
L 8 HOH 4   104  69  HOH HOH P . 
L 8 HOH 5   105  83  HOH HOH P . 
L 8 HOH 6   106  101 HOH HOH P . 
L 8 HOH 7   107  109 HOH HOH P . 
L 8 HOH 8   108  116 HOH HOH P . 
L 8 HOH 9   109  119 HOH HOH P . 
L 8 HOH 10  110  123 HOH HOH P . 
L 8 HOH 11  111  130 HOH HOH P . 
L 8 HOH 12  112  139 HOH HOH P . 
L 8 HOH 13  113  152 HOH HOH P . 
L 8 HOH 14  114  167 HOH HOH P . 
L 8 HOH 15  115  210 HOH HOH P . 
L 8 HOH 16  116  241 HOH HOH P . 
L 8 HOH 17  117  272 HOH HOH P . 
L 8 HOH 18  118  314 HOH HOH P . 
L 8 HOH 19  119  321 HOH HOH P . 
L 8 HOH 20  120  361 HOH HOH P . 
L 8 HOH 21  121  381 HOH HOH P . 
L 8 HOH 22  122  454 HOH HOH P . 
L 8 HOH 23  123  456 HOH HOH P . 
L 8 HOH 24  124  494 HOH HOH P . 
L 8 HOH 25  125  524 HOH HOH P . 
L 8 HOH 26  126  525 HOH HOH P . 
L 8 HOH 27  127  535 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5730  ? 
1 MORE         -56   ? 
1 'SSA (A^2)'  22110 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OE1   B A GLU 119 ? A GLU 116 ? 1_555 114.9 ? 
2  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 87.6  ? 
3  OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 106.7 ? 
4  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 87.1  ? 
5  OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 82.2  ? 
6  OD2   B A ASP 16  ? A ASP 13  ? 1_555 NA B D NA . ? A NA 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 171.0 ? 
7  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 94.3  ? 
8  OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 147.7 ? 
9  OD2   B A ASP 16  ? A ASP 13  ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 87.0  ? 
10 "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 86.1  ? 
11 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 939 ? 1_555 155.5 ? 
12 OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 939 ? 1_555 88.8  ? 
13 OD2   B A ASP 16  ? A ASP 13  ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 939 ? 1_555 91.4  ? 
14 "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 939 ? 1_555 90.4  ? 
15 O2A   ? I DTP .   ? P DTP 502 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 939 ? 1_555 61.2  ? 
16 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O3G   ? I DTP .   ? P DTP 502 ? 1_555 81.0  ? 
17 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 88.9  ? 
18 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 97.8  ? 
19 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 81.9  ? 
20 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 83.9  ? 
21 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 170.3 ? 
22 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 82.4  ? 
23 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 163.3 ? 
24 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 83.6  ? 
25 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 92.1  ? 
26 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 147.6 ? 
27 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 81.7  ? 
28 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 66.6  ? 
29 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 123.1 ? 
30 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 113.7 ? 
31 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 158.5 ? 
32 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 115.2 ? 
33 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 102.0 ? 
34 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 85.8  ? 
35 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 80.6  ? 
36 OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 53.1  ? 
37 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 151.2 ? 
38 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 73.1  ? 
39 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 82.5  ? 
40 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 107.2 ? 
41 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 123.5 ? 
42 OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 16.8  ? 
43 OD2   B A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 49.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ED0 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;GLU A 116 HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS GLU 116 (OCCUPANCY 0.40), 
ALTERNATE B HAS GLU 116 (OCCUPANCY 0.60) + NA 501.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 7 ? ? "C1'" T DG 7 ? ? N9    T DG 7 ? ? 110.50 108.30 2.20  0.30 N 
2 1 "O4'" P DG 2 ? B "C1'" P DG 2 ? B N9    P DG 2 ? ? 110.37 108.30 2.07  0.30 N 
3 1 "O4'" P DA 7 ? A "C4'" P DA 7 ? A "C3'" P DA 7 ? A 101.66 104.50 -2.84 0.40 N 
4 1 "O4'" P DA 7 ? B "C4'" P DA 7 ? B "C3'" P DA 7 ? B 101.07 104.50 -3.43 0.40 N 
5 1 "O4'" P DA 7 ? A "C1'" P DA 7 ? A N9    P DA 7 ? ? 110.43 108.30 2.13  0.30 N 
6 1 "O4'" P DA 7 ? B "C1'" P DA 7 ? B N9    P DA 7 ? ? 110.69 108.30 2.39  0.30 N 
7 1 N3    P DT 8 ? ? C4    P DT 8 ? ? O4    P DT 8 ? ? 123.87 119.90 3.97  0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 25.00   64.79   
2 1 TYR A 39  ? ? 65.42   179.04  
3 1 LYS A 40  ? ? -157.66 -30.67  
4 1 SER A 62  ? ? 82.21   -13.42  
5 1 SER A 217 ? ? -153.12 -155.27 
6 1 SER A 257 ? ? 96.73   -11.10  
7 1 LYS A 428 ? ? 61.62   64.39   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ED0 'double helix'        
4ED0 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 6  1_555 C DA 7 1_555 0.109  -0.037 0.216  -1.718 -15.009 3.957  1 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.070 -0.124 -0.235 -6.313 -2.862  -1.399 2 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.090  -0.072 0.170  4.626  -3.750  0.929  3 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.311  -0.118 -0.278 11.055 -7.328  0.940  4 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.477 -0.192 -0.173 -5.749 -7.896  4.357  5 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.141  -0.090 0.201  -5.985 -2.884  0.253  6 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.149 -0.123 -0.135 15.950 -2.047  4.466  7 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.426 -1.153 3.397 4.901  9.132  28.996 -3.921 1.742  2.805 17.547 -9.416 
30.756 1 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.652 -0.486 3.148 -2.299 -0.228 34.136 -0.791 0.757  3.187 -0.389 3.911  
34.212 2 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.355  -0.631 3.238 3.764  1.361  32.275 -1.362 0.019  3.229 2.437  -6.739 
32.515 3 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.443 -0.643 3.786 -4.429 7.729  32.779 -2.522 -0.054 3.574 13.390 7.674  
33.936 4 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.686 -0.576 3.436 -3.742 -0.637 36.842 -0.816 0.547  3.496 -1.004 5.901  
37.031 5 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.258  0.192  2.967 -0.424 3.559  25.626 -0.470 -0.683 2.961 7.974  0.949  
25.871 6 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION'                        NA  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 water                               HOH 
#