data_4ED1
# 
_entry.id   4ED1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ED1         
NDB   NA1711       
RCSB  RCSB071463   
WWPDB D_1000071463 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ED1 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ED1 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ED1 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ?                                     ? 
4 non-polymer syn 'SODIUM ION'                                         22.990    1   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 water       nat water                                                18.015    387 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ED1       4ED1   2 ? ? ? 
3 PDB 4ED1       4ED1   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ED1 A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ED1 T 1 ? 12  ? 4ED1   1 ? 12  ? 1 12  
3 3 4ED1 P 1 ? 8   ? 4ED1   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ED1 GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ED1 PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ED1 HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
NA  non-polymer         . 'SODIUM ION'                         ?                               'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ED1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-08-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ED1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   40987 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        12.1 
_reflns.B_iso_Wilson_estimate        19.370 
_reflns.pdbx_redundancy              2.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.80 
_reflns_shell.d_res_low                   1.83 
_reflns_shell.percent_possible_all        96.2 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.679 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.pdbx_redundancy             2.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ED1 
_refine.ls_number_reflns_obs                     38257 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.06 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.697 
_refine.ls_d_res_high                            1.806 
_refine.ls_percent_reflns_obs                    91.10 
_refine.ls_R_factor_obs                          0.1715 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1696 
_refine.ls_R_factor_R_free                       0.2068 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.09 
_refine.ls_number_reflns_R_free                  1947 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               27.3364 
_refine.aniso_B[1][1]                            0.8857 
_refine.aniso_B[2][2]                            0.8857 
_refine.aniso_B[3][3]                            -1.7714 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.341 
_refine.solvent_model_param_bsol                 39.550 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_FOM_work_R_set                   0.8639 
_refine.B_iso_max                                99.700 
_refine.B_iso_min                                8.210 
_refine.pdbx_overall_phase_error                 21.1900 
_refine.occupancy_max                            1.200 
_refine.occupancy_min                            0.300 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             387 
_refine_hist.number_atoms_total               4190 
_refine_hist.d_res_high                       1.806 
_refine_hist.d_res_low                        24.697 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4004 0.007  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5505 1.129  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     616  0.071  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      634  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1577 18.487 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.8055 1.8506  14 75.0000  2118 . 0.2408 0.3247 . 115 . 2233 . 'X-RAY DIFFRACTION' . 
1.8506 1.9007  14 79.0000  2233 . 0.2293 0.3287 . 137 . 2370 . 'X-RAY DIFFRACTION' . 
1.9007 1.9566  14 81.0000  2281 . 0.2183 0.2498 . 131 . 2412 . 'X-RAY DIFFRACTION' . 
1.9566 2.0197  14 85.0000  2423 . 0.1898 0.2740 . 120 . 2543 . 'X-RAY DIFFRACTION' . 
2.0197 2.0918  14 87.0000  2456 . 0.1819 0.2076 . 120 . 2576 . 'X-RAY DIFFRACTION' . 
2.0918 2.1755  14 92.0000  2605 . 0.1795 0.2263 . 148 . 2753 . 'X-RAY DIFFRACTION' . 
2.1755 2.2745  14 93.0000  2644 . 0.1706 0.2337 . 137 . 2781 . 'X-RAY DIFFRACTION' . 
2.2745 2.3943  14 95.0000  2715 . 0.1657 0.2147 . 137 . 2852 . 'X-RAY DIFFRACTION' . 
2.3943 2.5442  14 96.0000  2731 . 0.1828 0.2388 . 137 . 2868 . 'X-RAY DIFFRACTION' . 
2.5442 2.7404  14 97.0000  2771 . 0.1856 0.2231 . 142 . 2913 . 'X-RAY DIFFRACTION' . 
2.7404 3.0157  14 98.0000  2787 . 0.1800 0.2123 . 145 . 2932 . 'X-RAY DIFFRACTION' . 
3.0157 3.4511  14 99.0000  2845 . 0.1586 0.1682 . 137 . 2982 . 'X-RAY DIFFRACTION' . 
3.4511 4.3442  14 100.0000 2853 . 0.1299 0.1702 . 169 . 3022 . 'X-RAY DIFFRACTION' . 
4.3442 24.6988 14 99.0000  2848 . 0.1534 0.1637 . 172 . 3020 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ED1 
_struct.title                     'Human DNA polymerase eta - DNA ternary complex: AT crystal at pH 7.0 (Na+ MES) with 1 Ca2+ ion' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ED1 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D NA  . NA  B ? A ASP 115 A NA  501 1_555 ? ? ? ? ? ? ?            2.259 ? 
metalc2  metalc ? ? I DTP .   O1B   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc3  metalc ? ? I DTP .   O3G   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc4  metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D NA  . NA  B ? P DT  8   A NA  501 1_555 ? ? ? ? ? ? ?            2.371 ? 
metalc5  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  ? ? A MET 14  A CA  503 1_555 ? ? ? ? ? ? ?            2.376 ? 
metalc6  metalc ? ? D NA  .   NA    B ? ? 1_555 I DTP . O2A ? ? A NA  501 P DTP 502 1_555 ? ? ? ? ? ? ?            2.394 ? 
metalc7  metalc ? ? A GLU 119 OE1   B ? ? 1_555 D NA  . NA  B ? A GLU 116 A NA  501 1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc8  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA  ? ? A ASP 115 A CA  503 1_555 ? ? ? ? ? ? ?            2.413 ? 
metalc9  metalc ? ? I DTP .   O2A   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.437 ? 
metalc10 metalc ? ? A ASP 16  OD2   B ? ? 1_555 D NA  . NA  B ? A ASP 13  A NA  501 1_555 ? ? ? ? ? ? ?            2.471 ? 
metalc11 metalc ? ? A ASP 16  OD2   B ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.554 ? 
metalc12 metalc ? ? A ASP 16  OD2   A ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.634 ? 
metalc13 metalc ? ? A ASP 16  OD1   B ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.659 ? 
metalc14 metalc ? ? D NA  .   NA    B ? ? 1_555 J HOH . O   ? ? A NA  501 A HOH 664 1_555 ? ? ? ? ? ? ?            3.064 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 3.52  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -0.06 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -7.39 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE NA A 501'  
AC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE DTP P 502' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 503'  
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 504' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 505' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  SER A 116 ? SER A 113 . ? 1_555 ? 
3  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
4  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
5  AC1 8  CA  E .   ? CA  A 503 . ? 1_555 ? 
6  AC1 8  HOH J .   ? HOH A 664 . ? 1_555 ? 
7  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8  AC1 8  DTP I .   ? DTP P 502 . ? 1_555 ? 
9  AC2 27 ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 27 MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 27 ASP A 18  ? ASP A 15  . ? 1_555 ? 
12 AC2 27 CYS A 19  ? CYS A 16  . ? 1_555 ? 
13 AC2 27 PHE A 20  ? PHE A 17  . ? 1_555 ? 
14 AC2 27 PHE A 21  ? PHE A 18  . ? 1_555 ? 
15 AC2 27 ILE A 51  ? ILE A 48  . ? 1_555 ? 
16 AC2 27 ALA A 52  ? ALA A 49  . ? 1_555 ? 
17 AC2 27 TYR A 55  ? TYR A 52  . ? 1_555 ? 
18 AC2 27 ARG A 58  ? ARG A 55  . ? 1_555 ? 
19 AC2 27 ARG A 64  ? ARG A 61  . ? 1_555 ? 
20 AC2 27 ASP A 118 ? ASP A 115 . ? 1_555 ? 
21 AC2 27 LYS A 234 ? LYS A 231 . ? 1_555 ? 
22 AC2 27 NA  D .   ? NA  A 501 . ? 1_555 ? 
23 AC2 27 CA  E .   ? CA  A 503 . ? 1_555 ? 
24 AC2 27 HOH J .   ? HOH A 601 . ? 1_555 ? 
25 AC2 27 HOH J .   ? HOH A 607 . ? 1_555 ? 
26 AC2 27 HOH J .   ? HOH A 639 . ? 1_555 ? 
27 AC2 27 HOH J .   ? HOH A 648 . ? 1_555 ? 
28 AC2 27 HOH J .   ? HOH A 664 . ? 1_555 ? 
29 AC2 27 HOH J .   ? HOH A 720 . ? 1_555 ? 
30 AC2 27 HOH J .   ? HOH A 778 . ? 1_555 ? 
31 AC2 27 HOH J .   ? HOH A 803 . ? 1_555 ? 
32 AC2 27 DT  C 8   ? DT  P 8   . ? 1_555 ? 
33 AC2 27 DT  B 3   ? DT  T 3   . ? 1_555 ? 
34 AC2 27 DT  B 4   ? DT  T 4   . ? 1_555 ? 
35 AC2 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
36 AC3 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
37 AC3 5  MET A 17  ? MET A 14  . ? 1_555 ? 
38 AC3 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
39 AC3 5  NA  D .   ? NA  A 501 . ? 1_555 ? 
40 AC3 5  DTP I .   ? DTP P 502 . ? 1_555 ? 
41 AC4 9  ARG A 27  ? ARG A 24  . ? 6_545 ? 
42 AC4 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
43 AC4 9  PHE A 250 ? PHE A 247 . ? 1_555 ? 
44 AC4 9  SER A 251 ? SER A 248 . ? 1_555 ? 
45 AC4 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
46 AC4 9  GLU A 280 ? GLU A 277 . ? 1_555 ? 
47 AC4 9  HOH J .   ? HOH A 603 . ? 1_555 ? 
48 AC4 9  HOH J .   ? HOH A 672 . ? 1_555 ? 
49 AC4 9  HOH J .   ? HOH A 942 . ? 1_555 ? 
50 AC5 9  GLU A 97  ? GLU A 94  . ? 1_555 ? 
51 AC5 9  ALA A 98  ? ALA A 95  . ? 1_555 ? 
52 AC5 9  GLU A 101 ? GLU A 98  . ? 1_555 ? 
53 AC5 9  ARG A 306 ? ARG A 303 . ? 5_664 ? 
54 AC5 9  HOH J .   ? HOH A 621 . ? 1_555 ? 
55 AC5 9  HOH J .   ? HOH A 655 . ? 1_555 ? 
56 AC5 9  HOH J .   ? HOH A 828 . ? 5_664 ? 
57 AC5 9  HOH J .   ? HOH A 831 . ? 5_664 ? 
58 AC5 9  HOH J .   ? HOH A 881 . ? 1_555 ? 
59 AC6 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
60 AC6 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
61 AC6 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
62 AC6 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
63 AC6 10 ILE A 275 ? ILE A 272 . ? 5_664 ? 
64 AC6 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
65 AC6 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
66 AC6 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
67 AC6 10 HOH J .   ? HOH A 819 . ? 1_555 ? 
68 AC6 10 HOH J .   ? HOH A 862 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ED1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ED1 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.723 -34.158 -3.488  1.00 47.24 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.121 -34.265 -3.869  1.00 53.97 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.570 -33.259 -4.921  1.00 55.88 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.364 -32.052 -4.766  1.00 50.44 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.201 -33.757 -5.998  1.00 56.86 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.698 -32.937 -7.115  1.00 55.37 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.594 -32.313 -7.984  1.00 57.71 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.867 -31.373 -8.738  1.00 62.29 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.532 -33.932 -7.938  1.00 55.10 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.979 -35.279 -7.587  1.00 49.65 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.563 -35.179 -6.147  1.00 47.99 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.370 -32.825 -7.879  1.00 51.37 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.257 -32.334 -8.692  1.00 56.94 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.306 -31.444 -7.892  1.00 58.88 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.324 -30.930 -8.433  1.00 46.98 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.484 -33.509 -9.304  1.00 51.30 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.361 -34.530 -9.955  1.00 45.35 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.905 -34.355 -11.209 1.00 46.07 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.802 -35.735 -9.519  1.00 43.33 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.638 -35.409 -11.521 1.00 44.74 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.596 -36.259 -10.511 1.00 36.67 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.602 -31.265 -6.607  1.00 55.58 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.739 -30.489 -5.717  1.00 64.47 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.966 -28.982 -5.869  1.00 58.86 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.924 -28.434 -5.319  1.00 55.12 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.967 -30.903 -4.262  1.00 69.42 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.830 -30.522 -3.330  1.00 72.03 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.402 -31.600 -3.548  1.00 86.15 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 62.013 -33.120 -2.818  1.00 72.88 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 63.078 -28.322 -6.610  1.00 59.24 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.200 -26.887 -6.866  1.00 55.16 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.141 -26.079 -5.574  1.00 51.69 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.353 -26.378 -4.676  1.00 51.41 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 62.132 -26.422 -7.838  1.00 53.58 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.978 -25.050 -5.490  1.00 41.41 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.172 -24.331 -4.239  1.00 37.44 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.649 -22.897 -4.285  1.00 30.13 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.798 -22.152 -3.317  1.00 33.01 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.659 -24.309 -3.839  1.00 35.70 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.430 -23.746 -4.909  1.00 34.05 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.153 -25.722 -3.544  1.00 36.97 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.041 -22.518 -5.408  1.00 30.32 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.487 -21.183 -5.558  1.00 28.22 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.541 -20.109 -5.392  1.00 32.06 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.363 -19.157 -4.622  1.00 28.84 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.645 -20.275 -6.114  1.00 23.02 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.790 -19.376 -6.018  1.00 21.71 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.171 -18.820 -7.379  1.00 24.07 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.262 -18.292 -7.540  1.00 20.62 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.991 -20.110 -5.421  1.00 21.66 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.894 -20.338 -3.912  1.00 24.55 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.109 -21.071 -3.378  1.00 21.13 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.261 -22.272 -3.598  1.00 26.97 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.986 -20.352 -2.688  1.00 25.80 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.250 -18.934 -8.337  1.00 24.43 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.449 -18.523 -9.730  1.00 26.05 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.385 -17.011 -10.006 1.00 29.60 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.883 -16.551 -11.028 1.00 26.91 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.409 -19.228 -10.621 1.00 29.10 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.981 -19.129 -10.058 1.00 41.36 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.772 -19.468 -8.866  1.00 36.86 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 62.063 -18.704 -10.800 1.00 43.12 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.756 -16.250 -9.117  1.00 22.00 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.506 -14.828 -9.343  1.00 20.76 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.097 -13.989 -8.229  1.00 17.23 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.290 -14.480 -7.116  1.00 15.53 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.996 -14.558 -9.336  1.00 18.45 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.203 -15.181 -10.470 1.00 23.57 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.723 -14.792 -10.337 1.00 20.08 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.080 -15.438 -9.188  1.00 19.97 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 59.008 -14.960 -8.555  1.00 14.45 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.483 -15.622 -7.531  1.00 15.02 ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.450 -13.820 -8.948  1.00 19.11 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.349 -12.713 -8.512  1.00 15.44 ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.627 -11.735 -7.458  1.00 10.77 ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.482 -10.720 -7.456  1.00 17.68 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.235 -10.060 -8.466  1.00 13.86 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.982 -11.011 -7.667  1.00 14.14 ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.240 -10.018 -6.549  1.00 15.21 ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.130 -12.011 -7.755  1.00 17.23 ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.779 -10.602 -6.330  1.00 13.46 ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.625 -9.699  -6.249  1.00 12.29 ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.822 -8.732  -5.095  1.00 16.90 ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.300 -9.122  -4.032  1.00 16.70 ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.328 -10.476 -6.032  1.00 10.83 ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.157 -9.523  -5.832  1.00 16.76 ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.076 -11.426 -7.200  1.00 17.67 ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.460 -7.470  -5.298  1.00 13.94 ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.532 -6.496  -4.214  1.00 14.17 ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.155 -5.897  -3.988  1.00 15.01 ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.325 -5.881  -4.892  1.00 14.75 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.563 -5.407  -4.530  1.00 13.72 ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.898 -5.452  -2.763  1.00 11.75 ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.705 -4.686  -2.459  1.00 12.88 ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.183 -3.391  -1.820  1.00 19.49 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.856 -3.412  -0.783  1.00 17.93 ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.768 -5.458  -1.528  1.00 10.75 ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.417 -4.869  -1.060  1.00 18.54 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.609 -3.864  0.084   1.00 17.41 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.611 -4.224  -2.225  1.00 16.57 ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.872 -2.271  -2.468  1.00 14.43 ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.256 -0.966  -1.940  1.00 14.97 ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 59.022 -0.272  -1.400  1.00 17.94 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.995 -0.189  -2.068  1.00 17.54 ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.912 -0.105  -2.999  1.00 15.34 ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.256 1.290   -2.431  1.00 16.01 ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 62.164 -0.807  -3.530  1.00 16.36 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.128 0.224   -0.172  1.00 15.17 ? 13  ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 57.993 0.815   0.517   0.30 16.67 ? 13  ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 57.995 0.836   0.502   0.70 16.63 ? 13  ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.407 2.120   1.211   1.00 16.46 ? 13  ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.331 2.119   2.010   1.00 15.38 ? 13  ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.467 -0.211  1.519   0.30 19.35 ? 13  ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.420 -0.143  1.515   0.70 19.39 ? 13  ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.611 0.401   2.587   0.30 20.26 ? 13  ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.393 0.495   2.401   0.70 20.01 ? 13  ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 55.441 -0.012  2.718   0.30 20.81 ? 13  ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 56.681 0.670   3.599   0.70 25.69 ? 13  ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 57.116 1.276   3.316   0.30 20.15 ? 13  ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 55.310 0.853   1.898   0.70 20.49 ? 13  ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.725 3.229   0.913   1.00 11.98 ? 14  MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 58.086 4.533   1.498   1.00 14.37 ? 14  MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.802 4.555   3.003   1.00 15.99 ? 14  MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.795 4.032   3.457   1.00 14.16 ? 14  MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.288 5.673   0.842   1.00 13.83 ? 14  MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.296 5.656   -0.687  1.00 19.30 ? 14  MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.973 5.615   -1.351  1.00 22.65 ? 14  MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.601 7.194   -0.877  1.00 21.86 ? 14  MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.683 5.161   3.778   1.00 14.20 ? 15  ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.458 5.265   5.219   1.00 14.89 ? 15  ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.376 6.307   5.504   1.00 16.91 ? 15  ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.379 7.393   4.900   1.00 12.16 ? 15  ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.755 5.640   5.930   1.00 15.04 ? 15  ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.849 4.585   5.754   1.00 17.50 ? 15  ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.522 3.397   5.574   1.00 16.12 ? 15  ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 62.040 4.943   5.826   1.00 17.55 ? 15  ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.463 5.972   6.421   1.00 13.33 ? 16  CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.345 6.852   6.801   1.00 14.65 ? 16  CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.968 7.842   5.700   1.00 12.26 ? 16  CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.150 9.044   5.842   1.00 12.41 ? 16  CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.615 7.573   8.133   1.00 11.81 ? 16  CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.142 8.530   8.269   1.00 18.87 ? 16  CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.418 7.324   4.609   1.00 14.23 ? 17  PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.416 8.063   3.348   1.00 12.88 ? 17  PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.689 9.413   3.377   1.00 13.51 ? 17  PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.289 10.427  3.032   1.00 10.52 ? 17  PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.889 7.190   2.203   1.00 10.80 ? 17  PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 53.910 7.868   0.866   1.00 14.54 ? 17  PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.053 8.480   0.408   1.00 14.31 ? 17  PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.779 7.883   0.067   1.00 17.55 ? 17  PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.078 9.109   -0.834  1.00 14.53 ? 17  PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.794 8.496   -1.176  1.00 19.03 ? 17  PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 53.940 9.111   -1.627  1.00 14.00 ? 17  PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.423 9.449   3.794   1.00 9.53  ? 18  PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.695 10.727  3.732   1.00 10.79 ? 18  PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.345 11.775  4.648   1.00 13.77 ? 18  PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.314 12.972  4.352   1.00 13.22 ? 18  PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.204 10.601  4.094   1.00 9.20  ? 18  PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.374 9.853   3.083   1.00 13.55 ? 18  PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 49.958 9.095   2.080   1.00 11.42 ? 18  PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 47.991 9.929   3.137   1.00 16.53 ? 18  PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.179 8.417   1.158   1.00 16.73 ? 18  PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.202 9.246   2.215   1.00 15.85 ? 18  PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.802 8.488   1.227   1.00 16.11 ? 18  PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.910 11.331  5.772   1.00 13.38 ? 19  VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.688 12.228  6.624   1.00 11.58 ? 19  VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.911 12.854  5.910   1.00 13.06 ? 19  VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.150 14.077  6.004   1.00 10.21 ? 19  VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.136 11.533  7.925   1.00 8.21  ? 19  VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.182 12.384  8.656   1.00 11.67 ? 19  VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.949 11.286  8.816   1.00 11.40 ? 19  VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.699 12.037  5.210   1.00 11.66 ? 20  GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.842 12.599  4.478   1.00 11.74 ? 20  GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.396 13.587  3.413   1.00 11.92 ? 20  GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.116 14.560  3.162   1.00 12.58 ? 20  GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.697 11.535  3.791   1.00 10.23 ? 20  GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.507 10.653  4.722   1.00 18.30 ? 20  GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.604 9.938   3.954   1.00 16.95 ? 20  GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.694 10.477  3.778   1.00 17.07 ? 20  GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.312 8.722   3.468   1.00 19.04 ? 20  GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.270 13.316  2.745   1.00 10.61 ? 21  VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.763 14.261  1.746   1.00 10.90 ? 21  VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.519 15.627  2.405   1.00 11.58 ? 21  VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.922 16.663  1.869   1.00 12.06 ? 21  VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.452 13.769  1.022   1.00 10.21 ? 21  VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.912 14.852  0.062   1.00 11.38 ? 21  VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.710 12.480  0.218   1.00 8.92  ? 21  VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.869 15.616  3.567   1.00 12.47 ? 22  GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.549 16.858  4.281   1.00 13.23 ? 22  GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.806 17.522  4.887   1.00 11.03 ? 22  GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.894 18.744  4.948   1.00 12.08 ? 22  GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.497 16.612  5.385   1.00 8.62  ? 22  GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.154 16.120  4.880   1.00 10.15 ? 22  GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.429 17.149  4.015   1.00 17.39 ? 22  GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.643 18.365  4.212   1.00 16.38 ? 22  GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.642 16.736  3.143   1.00 19.86 ? 22  GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.767 16.719  5.331   1.00 10.29 ? 23  GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.029 17.259  5.861   1.00 11.08 ? 23  GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.920 17.873  4.788   1.00 13.14 ? 23  GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.621 18.849  5.042   1.00 11.67 ? 23  GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.831 16.178  6.597   1.00 11.13 ? 23  GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.260 15.791  7.955   1.00 13.79 ? 23  GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.952 14.570  8.537   1.00 15.82 ? 23  GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.315 13.639  7.804   1.00 15.81 ? 23  GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.145 14.563  9.857   1.00 17.14 ? 23  GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.916 17.298  3.591   1.00 12.53 ? 24  ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.669 17.908  2.499   1.00 13.27 ? 24  ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.099 19.301  2.240   1.00 17.19 ? 24  ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.849 20.267  2.067   1.00 13.00 ? 24  ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.609 17.050  1.227   1.00 13.53 ? 24  ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.459 17.609  0.068   1.00 14.82 ? 24  ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.454 16.679  -1.161  1.00 14.39 ? 24  ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.161 16.667  -1.842  1.00 16.37 ? 24  ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 57.932 16.071  -3.007  1.00 13.26 ? 24  ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 58.914 15.422  -3.639  1.00 12.74 ? 24  ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.722 16.128  -3.550  1.00 13.25 ? 24  ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.770 19.397  2.228   1.00 11.01 ? 25  GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.093 20.658  1.905   1.00 14.53 ? 25  GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.274 21.713  2.993   1.00 14.19 ? 25  GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.413 22.914  2.709   1.00 15.26 ? 25  GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.598 20.410  1.662   1.00 13.70 ? 25  GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.773 21.666  1.340   1.00 18.38 ? 25  GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.276 21.374  1.195   1.00 26.21 ? 25  GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 51.883 20.398  0.562   1.00 23.12 ? 25  GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.443 22.217  1.795   1.00 28.71 ? 25  GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.241 21.266  4.240   1.00 12.00 ? 26  ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.305 22.156  5.392   1.00 16.36 ? 26  ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.444 21.754  6.327   1.00 16.73 ? 26  ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.276 20.900  7.193   1.00 13.93 ? 26  ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.964 22.146  6.158   1.00 14.61 ? 26  ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.972 23.102  7.363   1.00 17.99 ? 26  ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 56.008 23.686  7.700   1.00 16.90 ? 26  ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.822 23.248  8.021   1.00 21.25 ? 26  ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.620 22.372  6.147   1.00 16.09 ? 27  PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.842 22.083  6.908   1.00 16.47 ? 27  PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.646 22.098  8.436   1.00 17.79 ? 27  PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.387 21.425  9.151   1.00 16.10 ? 27  PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.779 23.220  6.498   1.00 20.24 ? 27  PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.326 23.591  5.108   1.00 17.29 ? 27  PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.830 23.390  5.100   1.00 14.08 ? 27  PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.679 22.865  8.922   1.00 16.10 ? 28  HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.384 22.925  10.359  1.00 23.84 ? 28  HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.981 21.567  10.942  1.00 21.24 ? 28  HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 58.071 21.353  12.150  1.00 19.55 ? 28  HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.260 23.930  10.639  1.00 23.70 ? 28  HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.697 25.362  10.610  1.00 33.79 ? 28  HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 56.903 26.371  10.107  1.00 37.22 ? 28  HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.834 25.957  11.040  1.00 28.03 ? 28  HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.535 27.525  10.219  1.00 36.32 ? 28  HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.710 27.303  10.781  1.00 32.60 ? 28  HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.515 20.655  10.095  1.00 20.67 ? 29  LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 57.076 19.341  10.566  1.00 16.76 ? 29  LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.208 18.307  10.553  1.00 18.38 ? 29  LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 58.047 17.201  11.072  1.00 17.93 ? 29  LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.913 18.819  9.712   1.00 13.37 ? 29  LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.689 19.726  9.577   1.00 15.74 ? 29  LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.678 19.140  8.587   1.00 14.79 ? 29  LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 54.059 19.994  10.936  1.00 18.85 ? 29  LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.344 18.659  9.956   1.00 15.87 ? 30  ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.437 17.707  9.789   1.00 15.45 ? 30  ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 61.074 17.331  11.117  1.00 15.82 ? 30  ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.275 18.185  11.976  1.00 15.21 ? 30  ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.497 18.243  8.821   1.00 16.98 ? 30  ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 60.973 18.526  7.429   1.00 13.71 ? 30  ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 62.056 19.067  6.526   1.00 19.09 ? 30  ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.541 19.383  5.190   1.00 17.44 ? 30  ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.275 19.913  4.214   1.00 22.81 ? 30  ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.558 20.190  4.418   1.00 19.73 ? 30  ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.727 20.168  3.034   1.00 17.55 ? 30  ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.361 16.037  11.275  1.00 19.55 ? 31  ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.957 15.498  12.503  1.00 24.69 ? 31  ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.170 15.799  13.777  1.00 23.56 ? 31  ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.759 16.077  14.829  1.00 24.11 ? 31  ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.402 15.988  12.671  1.00 24.95 ? 31  ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.225 15.787  11.427  1.00 26.76 ? 31  ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.458 14.654  10.995  1.00 35.31 ? 31  ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.667 16.886  10.831  1.00 29.32 ? 31  ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.844 15.759  13.673  1.00 15.95 ? 32  LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.950 16.004  14.796  1.00 19.13 ? 32  LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.955 14.859  14.884  1.00 18.43 ? 32  LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.694 14.203  13.878  1.00 18.45 ? 32  LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.142 17.281  14.554  1.00 17.41 ? 32  LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 58.954 18.553  14.439  1.00 22.62 ? 32  LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 59.287 19.097  15.785  1.00 31.04 ? 32  LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 59.919 20.475  15.664  1.00 40.47 ? 32  LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 59.989 21.118  17.005  1.00 36.28 ? 32  LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.384 14.628  16.079  1.00 17.94 ? 33  PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.206 13.758  16.192  1.00 14.24 ? 33  PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.044 14.425  15.444  1.00 18.13 ? 33  PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.589 15.515  15.810  1.00 15.57 ? 33  PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.939 13.710  17.704  1.00 17.97 ? 33  PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.617 14.917  18.262  1.00 23.15 ? 33  PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.812 15.158  17.388  1.00 23.08 ? 33  PRO A CD    1 
ATOM   294  N  N     A CYS A 1 37  ? 54.590 13.793  14.378  0.50 14.25 ? 34  CYS A N     1 
ATOM   295  N  N     B CYS A 1 37  ? 54.581 13.755  14.392  0.50 14.25 ? 34  CYS A N     1 
ATOM   296  C  CA    A CYS A 1 37  ? 53.481 14.352  13.636  0.50 14.06 ? 34  CYS A CA    1 
ATOM   297  C  CA    B CYS A 1 37  ? 53.647 14.329  13.429  0.50 14.18 ? 34  CYS A CA    1 
ATOM   298  C  C     A CYS A 1 37  ? 52.683 13.253  12.971  0.50 14.63 ? 34  CYS A C     1 
ATOM   299  C  C     B CYS A 1 37  ? 52.700 13.236  12.937  0.50 14.63 ? 34  CYS A C     1 
ATOM   300  O  O     A CYS A 1 37  ? 53.129 12.108  12.868  0.50 15.53 ? 34  CYS A O     1 
ATOM   301  O  O     B CYS A 1 37  ? 53.063 12.058  12.933  0.50 15.49 ? 34  CYS A O     1 
ATOM   302  C  CB    A CYS A 1 37  ? 53.962 15.399  12.625  0.50 16.35 ? 34  CYS A CB    1 
ATOM   303  C  CB    B CYS A 1 37  ? 54.446 14.917  12.254  0.50 16.32 ? 34  CYS A CB    1 
ATOM   304  S  SG    A CYS A 1 37  ? 55.066 14.786  11.323  0.50 13.75 ? 34  CYS A SG    1 
ATOM   305  S  SG    B CYS A 1 37  ? 53.496 15.789  10.966  0.50 18.00 ? 34  CYS A SG    1 
ATOM   306  N  N     . ALA A 1 38  ? 51.487 13.612  12.540  1.00 11.37 ? 35  ALA A N     1 
ATOM   307  C  CA    . ALA A 1 38  ? 50.550 12.657  11.954  1.00 11.89 ? 35  ALA A CA    1 
ATOM   308  C  C     . ALA A 1 38  ? 49.739 13.364  10.895  1.00 16.75 ? 35  ALA A C     1 
ATOM   309  O  O     . ALA A 1 38  ? 49.623 14.597  10.912  1.00 14.15 ? 35  ALA A O     1 
ATOM   310  C  CB    . ALA A 1 38  ? 49.622 12.077  13.012  1.00 15.16 ? 35  ALA A CB    1 
ATOM   311  N  N     . VAL A 1 39  ? 49.179 12.585  9.974   1.00 12.51 ? 36  VAL A N     1 
ATOM   312  C  CA    . VAL A 1 39  ? 48.255 13.125  8.994   1.00 12.78 ? 36  VAL A CA    1 
ATOM   313  C  C     . VAL A 1 39  ? 46.851 12.681  9.366   1.00 14.57 ? 36  VAL A C     1 
ATOM   314  O  O     . VAL A 1 39  ? 46.631 11.510  9.697   1.00 15.21 ? 36  VAL A O     1 
ATOM   315  C  CB    . VAL A 1 39  ? 48.603 12.647  7.566   1.00 12.35 ? 36  VAL A CB    1 
ATOM   316  C  CG1   . VAL A 1 39  ? 47.546 13.130  6.559   1.00 13.88 ? 36  VAL A CG1   1 
ATOM   317  C  CG2   . VAL A 1 39  ? 50.000 13.115  7.164   1.00 13.52 ? 36  VAL A CG2   1 
ATOM   318  N  N     . VAL A 1 40  ? 45.902 13.615  9.308   1.00 13.90 ? 37  VAL A N     1 
ATOM   319  C  CA    . VAL A 1 40  ? 44.544 13.363  9.774   1.00 14.12 ? 37  VAL A CA    1 
ATOM   320  C  C     . VAL A 1 40  ? 43.537 13.735  8.690   1.00 16.53 ? 37  VAL A C     1 
ATOM   321  O  O     . VAL A 1 40  ? 43.798 14.618  7.862   1.00 17.14 ? 37  VAL A O     1 
ATOM   322  C  CB    . VAL A 1 40  ? 44.231 14.221  11.035  1.00 18.06 ? 37  VAL A CB    1 
ATOM   323  C  CG1   A VAL A 1 40  ? 45.166 13.859  12.181  0.50 14.61 ? 37  VAL A CG1   1 
ATOM   324  C  CG1   B VAL A 1 40  ? 44.278 15.694  10.687  0.50 16.11 ? 37  VAL A CG1   1 
ATOM   325  C  CG2   A VAL A 1 40  ? 44.321 15.694  10.704  0.50 16.10 ? 37  VAL A CG2   1 
ATOM   326  C  CG2   B VAL A 1 40  ? 42.904 13.868  11.619  0.50 17.56 ? 37  VAL A CG2   1 
ATOM   327  N  N     . GLN A 1 41  ? 42.382 13.075  8.684   1.00 18.15 ? 38  GLN A N     1 
ATOM   328  C  CA    . GLN A 1 41  ? 41.326 13.534  7.793   1.00 15.70 ? 38  GLN A CA    1 
ATOM   329  C  C     . GLN A 1 41  ? 40.084 13.943  8.574   1.00 21.34 ? 38  GLN A C     1 
ATOM   330  O  O     . GLN A 1 41  ? 39.702 13.286  9.553   1.00 15.73 ? 38  GLN A O     1 
ATOM   331  C  CB    . GLN A 1 41  ? 41.030 12.541  6.656   1.00 19.24 ? 38  GLN A CB    1 
ATOM   332  C  CG    . GLN A 1 41  ? 40.537 11.195  7.054   1.00 21.25 ? 38  GLN A CG    1 
ATOM   333  C  CD    . GLN A 1 41  ? 40.661 10.188  5.914   1.00 22.09 ? 38  GLN A CD    1 
ATOM   334  O  OE1   . GLN A 1 41  ? 41.054 10.534  4.790   1.00 24.90 ? 38  GLN A OE1   1 
ATOM   335  N  NE2   . GLN A 1 41  ? 40.344 8.940   6.204   1.00 27.22 ? 38  GLN A NE2   1 
ATOM   336  N  N     . TYR A 1 42  ? 39.485 15.051  8.138   1.00 17.09 ? 39  TYR A N     1 
ATOM   337  C  CA    . TYR A 1 42  ? 38.355 15.665  8.818   1.00 20.36 ? 39  TYR A CA    1 
ATOM   338  C  C     . TYR A 1 42  ? 38.851 16.141  10.190  1.00 28.47 ? 39  TYR A C     1 
ATOM   339  O  O     . TYR A 1 42  ? 39.950 15.785  10.609  1.00 36.93 ? 39  TYR A O     1 
ATOM   340  C  CB    . TYR A 1 42  ? 37.157 14.707  8.877   1.00 16.95 ? 39  TYR A CB    1 
ATOM   341  C  CG    . TYR A 1 42  ? 36.770 14.166  7.496   1.00 19.00 ? 39  TYR A CG    1 
ATOM   342  C  CD1   . TYR A 1 42  ? 36.400 15.033  6.472   1.00 22.84 ? 39  TYR A CD1   1 
ATOM   343  C  CD2   . TYR A 1 42  ? 36.799 12.793  7.216   1.00 19.17 ? 39  TYR A CD2   1 
ATOM   344  C  CE1   . TYR A 1 42  ? 36.061 14.559  5.204   1.00 20.09 ? 39  TYR A CE1   1 
ATOM   345  C  CE2   . TYR A 1 42  ? 36.460 12.302  5.940   1.00 17.34 ? 39  TYR A CE2   1 
ATOM   346  C  CZ    . TYR A 1 42  ? 36.084 13.197  4.947   1.00 19.80 ? 39  TYR A CZ    1 
ATOM   347  O  OH    . TYR A 1 42  ? 35.738 12.747  3.691   1.00 19.64 ? 39  TYR A OH    1 
ATOM   348  N  N     . LYS A 1 43  ? 38.088 16.978  10.869  1.00 30.66 ? 40  LYS A N     1 
ATOM   349  C  CA    . LYS A 1 43  ? 38.614 17.627  12.069  1.00 31.26 ? 40  LYS A CA    1 
ATOM   350  C  C     . LYS A 1 43  ? 37.532 17.734  13.123  1.00 31.16 ? 40  LYS A C     1 
ATOM   351  O  O     . LYS A 1 43  ? 37.812 17.743  14.327  1.00 34.42 ? 40  LYS A O     1 
ATOM   352  C  CB    . LYS A 1 43  ? 39.160 19.016  11.728  1.00 36.70 ? 40  LYS A CB    1 
ATOM   353  C  CG    . LYS A 1 43  ? 40.332 19.483  12.603  1.00 45.04 ? 40  LYS A CG    1 
ATOM   354  C  CD    . LYS A 1 43  ? 41.639 18.785  12.210  1.00 42.57 ? 40  LYS A CD    1 
ATOM   355  C  CE    . LYS A 1 43  ? 42.830 19.311  13.004  1.00 36.19 ? 40  LYS A CE    1 
ATOM   356  N  NZ    . LYS A 1 43  ? 42.795 18.893  14.437  1.00 33.76 ? 40  LYS A NZ    1 
ATOM   357  N  N     . SER A 1 44  ? 36.290 17.785  12.653  1.00 27.37 ? 41  SER A N     1 
ATOM   358  C  CA    . SER A 1 44  ? 35.137 18.033  13.504  1.00 30.06 ? 41  SER A CA    1 
ATOM   359  C  C     . SER A 1 44  ? 34.864 16.887  14.460  1.00 32.22 ? 41  SER A C     1 
ATOM   360  O  O     . SER A 1 44  ? 34.478 17.106  15.608  1.00 35.27 ? 41  SER A O     1 
ATOM   361  C  CB    . SER A 1 44  ? 33.903 18.275  12.638  1.00 39.80 ? 41  SER A CB    1 
ATOM   362  O  OG    . SER A 1 44  ? 34.198 19.208  11.618  1.00 50.47 ? 41  SER A OG    1 
ATOM   363  N  N     . TRP A 1 45  ? 35.052 15.659  13.988  1.00 28.29 ? 42  TRP A N     1 
ATOM   364  C  CA    . TRP A 1 45  ? 34.793 14.507  14.840  1.00 30.96 ? 42  TRP A CA    1 
ATOM   365  C  C     . TRP A 1 45  ? 36.083 14.068  15.519  1.00 26.24 ? 42  TRP A C     1 
ATOM   366  O  O     . TRP A 1 45  ? 36.952 13.442  14.895  1.00 19.66 ? 42  TRP A O     1 
ATOM   367  C  CB    . TRP A 1 45  ? 34.144 13.357  14.061  1.00 33.24 ? 42  TRP A CB    1 
ATOM   368  C  CG    . TRP A 1 45  ? 33.738 12.186  14.924  1.00 37.51 ? 42  TRP A CG    1 
ATOM   369  C  CD1   . TRP A 1 45  ? 34.495 11.091  15.229  1.00 32.74 ? 42  TRP A CD1   1 
ATOM   370  C  CD2   . TRP A 1 45  ? 32.479 11.995  15.580  1.00 37.00 ? 42  TRP A CD2   1 
ATOM   371  N  NE1   . TRP A 1 45  ? 33.788 10.235  16.035  1.00 35.42 ? 42  TRP A NE1   1 
ATOM   372  C  CE2   . TRP A 1 45  ? 32.546 10.766  16.265  1.00 37.53 ? 42  TRP A CE2   1 
ATOM   373  C  CE3   . TRP A 1 45  ? 31.300 12.743  15.653  1.00 43.89 ? 42  TRP A CE3   1 
ATOM   374  C  CZ2   . TRP A 1 45  ? 31.483 10.269  17.018  1.00 46.09 ? 42  TRP A CZ2   1 
ATOM   375  C  CZ3   . TRP A 1 45  ? 30.241 12.247  16.401  1.00 48.26 ? 42  TRP A CZ3   1 
ATOM   376  C  CH2   . TRP A 1 45  ? 30.341 11.021  17.072  1.00 44.01 ? 42  TRP A CH2   1 
ATOM   377  N  N     . LYS A 1 46  ? 36.197 14.456  16.790  1.00 34.12 ? 43  LYS A N     1 
ATOM   378  C  CA    . LYS A 1 46  ? 37.273 14.048  17.690  1.00 25.63 ? 43  LYS A CA    1 
ATOM   379  C  C     . LYS A 1 46  ? 38.662 14.423  17.191  1.00 24.21 ? 43  LYS A C     1 
ATOM   380  O  O     . LYS A 1 46  ? 39.639 13.723  17.451  1.00 22.72 ? 43  LYS A O     1 
ATOM   381  C  CB    . LYS A 1 46  ? 37.189 12.548  17.975  1.00 32.88 ? 43  LYS A CB    1 
ATOM   382  C  CG    . LYS A 1 46  ? 35.873 12.106  18.616  1.00 40.08 ? 43  LYS A CG    1 
ATOM   383  C  CD    . LYS A 1 46  ? 35.893 10.614  18.929  1.00 38.40 ? 43  LYS A CD    1 
ATOM   384  C  CE    . LYS A 1 46  ? 34.562 10.148  19.497  1.00 46.20 ? 43  LYS A CE    1 
ATOM   385  N  NZ    . LYS A 1 46  ? 34.472 8.663   19.514  1.00 46.40 ? 43  LYS A NZ    1 
ATOM   386  N  N     . GLY A 1 47  ? 38.735 15.532  16.468  1.00 20.74 ? 44  GLY A N     1 
ATOM   387  C  CA    . GLY A 1 47  ? 39.995 16.081  16.018  1.00 20.86 ? 44  GLY A CA    1 
ATOM   388  C  C     . GLY A 1 47  ? 40.440 15.525  14.682  1.00 18.22 ? 44  GLY A C     1 
ATOM   389  O  O     . GLY A 1 47  ? 41.475 15.930  14.157  1.00 19.33 ? 44  GLY A O     1 
ATOM   390  N  N     . GLY A 1 48  ? 39.657 14.595  14.141  1.00 21.99 ? 45  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 48  ? 39.983 13.953  12.881  1.00 21.09 ? 45  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 48  ? 40.564 12.559  13.065  1.00 20.14 ? 45  GLY A C     1 
ATOM   393  O  O     . GLY A 1 48  ? 41.071 12.224  14.133  1.00 20.20 ? 45  GLY A O     1 
ATOM   394  N  N     . GLY A 1 49  ? 40.509 11.741  12.017  1.00 14.47 ? 46  GLY A N     1 
ATOM   395  C  CA    . GLY A 1 49  ? 41.000 10.374  12.108  1.00 12.94 ? 46  GLY A CA    1 
ATOM   396  C  C     . GLY A 1 49  ? 42.421 10.305  11.576  1.00 17.18 ? 46  GLY A C     1 
ATOM   397  O  O     . GLY A 1 49  ? 42.705 10.844  10.509  1.00 18.36 ? 46  GLY A O     1 
ATOM   398  N  N     . ILE A 1 50  ? 43.323 9.660   12.310  1.00 16.20 ? 47  ILE A N     1 
ATOM   399  C  CA    . ILE A 1 50  ? 44.726 9.574   11.880  1.00 13.60 ? 47  ILE A CA    1 
ATOM   400  C  C     . ILE A 1 50  ? 44.944 8.520   10.781  1.00 14.28 ? 47  ILE A C     1 
ATOM   401  O  O     . ILE A 1 50  ? 44.503 7.387   10.913  1.00 15.49 ? 47  ILE A O     1 
ATOM   402  C  CB    . ILE A 1 50  ? 45.666 9.306   13.087  1.00 14.20 ? 47  ILE A CB    1 
ATOM   403  C  CG1   . ILE A 1 50  ? 45.686 10.514  14.016  1.00 22.11 ? 47  ILE A CG1   1 
ATOM   404  C  CG2   . ILE A 1 50  ? 47.098 8.996   12.631  1.00 16.86 ? 47  ILE A CG2   1 
ATOM   405  C  CD1   . ILE A 1 50  ? 46.560 10.299  15.252  1.00 22.66 ? 47  ILE A CD1   1 
ATOM   406  N  N     . ILE A 1 51  ? 45.614 8.898   9.690   1.00 11.22 ? 48  ILE A N     1 
ATOM   407  C  CA    . ILE A 1 51  ? 45.890 7.923   8.633   1.00 13.29 ? 48  ILE A CA    1 
ATOM   408  C  C     . ILE A 1 51  ? 47.376 7.602   8.399   1.00 16.60 ? 48  ILE A C     1 
ATOM   409  O  O     . ILE A 1 51  ? 47.682 6.617   7.729   1.00 16.35 ? 48  ILE A O     1 
ATOM   410  C  CB    . ILE A 1 51  ? 45.182 8.265   7.300   1.00 15.80 ? 48  ILE A CB    1 
ATOM   411  C  CG1   . ILE A 1 51  ? 45.586 9.641   6.777   1.00 18.04 ? 48  ILE A CG1   1 
ATOM   412  C  CG2   . ILE A 1 51  ? 43.648 8.189   7.461   1.00 20.85 ? 48  ILE A CG2   1 
ATOM   413  C  CD1   . ILE A 1 51  ? 45.154 9.862   5.337   1.00 25.12 ? 48  ILE A CD1   1 
ATOM   414  N  N     . ALA A 1 52  ? 48.272 8.413   8.972   1.00 15.55 ? 49  ALA A N     1 
ATOM   415  C  CA    . ALA A 1 52  ? 49.730 8.197   8.894   1.00 11.46 ? 49  ALA A CA    1 
ATOM   416  C  C     . ALA A 1 52  ? 50.450 8.840   10.081  1.00 16.68 ? 49  ALA A C     1 
ATOM   417  O  O     . ALA A 1 52  ? 50.043 9.902   10.558  1.00 13.70 ? 49  ALA A O     1 
ATOM   418  C  CB    . ALA A 1 52  ? 50.299 8.750   7.567   1.00 9.92  ? 49  ALA A CB    1 
ATOM   419  N  N     . VAL A 1 53  ? 51.544 8.223   10.529  1.00 12.42 ? 50  VAL A N     1 
ATOM   420  C  CA    . VAL A 1 53  ? 52.187 8.600   11.792  1.00 9.94  ? 50  VAL A CA    1 
ATOM   421  C  C     . VAL A 1 53  ? 53.710 8.593   11.646  1.00 10.56 ? 50  VAL A C     1 
ATOM   422  O  O     . VAL A 1 53  ? 54.278 7.596   11.197  1.00 11.44 ? 50  VAL A O     1 
ATOM   423  C  CB    . VAL A 1 53  ? 51.809 7.595   12.905  1.00 14.65 ? 50  VAL A CB    1 
ATOM   424  C  CG1   . VAL A 1 53  ? 52.360 8.043   14.248  1.00 12.96 ? 50  VAL A CG1   1 
ATOM   425  C  CG2   . VAL A 1 53  ? 50.306 7.427   12.985  1.00 17.15 ? 50  VAL A CG2   1 
ATOM   426  N  N     . SER A 1 54  ? 54.383 9.677   12.033  1.00 9.58  ? 51  SER A N     1 
ATOM   427  C  CA    . SER A 1 54  ? 55.847 9.688   11.920  1.00 12.77 ? 51  SER A CA    1 
ATOM   428  C  C     . SER A 1 54  ? 56.441 8.764   12.990  1.00 11.86 ? 51  SER A C     1 
ATOM   429  O  O     . SER A 1 54  ? 55.808 8.503   14.015  1.00 14.66 ? 51  SER A O     1 
ATOM   430  C  CB    . SER A 1 54  ? 56.436 11.099  12.044  1.00 14.15 ? 51  SER A CB    1 
ATOM   431  O  OG    . SER A 1 54  ? 56.441 11.537  13.403  1.00 14.39 ? 51  SER A OG    1 
ATOM   432  N  N     . TYR A 1 55  ? 57.648 8.263   12.737  1.00 13.22 ? 52  TYR A N     1 
ATOM   433  C  CA    . TYR A 1 55  ? 58.316 7.381   13.694  1.00 12.02 ? 52  TYR A CA    1 
ATOM   434  C  C     . TYR A 1 55  ? 58.543 8.031   15.059  1.00 18.50 ? 52  TYR A C     1 
ATOM   435  O  O     . TYR A 1 55  ? 58.465 7.358   16.080  1.00 17.55 ? 52  TYR A O     1 
ATOM   436  C  CB    . TYR A 1 55  ? 59.602 6.807   13.092  1.00 13.81 ? 52  TYR A CB    1 
ATOM   437  C  CG    . TYR A 1 55  ? 59.257 5.734   12.090  1.00 17.39 ? 52  TYR A CG    1 
ATOM   438  C  CD1   . TYR A 1 55  ? 58.839 6.067   10.807  1.00 18.54 ? 52  TYR A CD1   1 
ATOM   439  C  CD2   . TYR A 1 55  ? 59.278 4.394   12.446  1.00 20.99 ? 52  TYR A CD2   1 
ATOM   440  C  CE1   . TYR A 1 55  ? 58.472 5.088   9.900   1.00 15.67 ? 52  TYR A CE1   1 
ATOM   441  C  CE2   . TYR A 1 55  ? 58.927 3.407   11.543  1.00 15.90 ? 52  TYR A CE2   1 
ATOM   442  C  CZ    . TYR A 1 55  ? 58.521 3.758   10.270  1.00 21.11 ? 52  TYR A CZ    1 
ATOM   443  O  OH    . TYR A 1 55  ? 58.165 2.769   9.372   1.00 19.48 ? 52  TYR A OH    1 
ATOM   444  N  N     . GLU A 1 56  ? 58.787 9.340   15.084  1.00 18.54 ? 53  GLU A N     1 
ATOM   445  C  CA    . GLU A 1 56  ? 58.879 10.057  16.357  1.00 19.08 ? 53  GLU A CA    1 
ATOM   446  C  C     . GLU A 1 56  ? 57.576 9.952   17.156  1.00 17.46 ? 53  GLU A C     1 
ATOM   447  O  O     . GLU A 1 56  ? 57.603 9.745   18.365  1.00 18.76 ? 53  GLU A O     1 
ATOM   448  C  CB    . GLU A 1 56  ? 59.245 11.532  16.136  1.00 18.86 ? 53  GLU A CB    1 
ATOM   449  C  CG    . GLU A 1 56  ? 60.644 11.772  15.550  1.00 25.40 ? 53  GLU A CG    1 
ATOM   450  C  CD    . GLU A 1 56  ? 60.726 11.666  14.020  1.00 33.43 ? 53  GLU A CD    1 
ATOM   451  O  OE1   . GLU A 1 56  ? 59.763 11.198  13.363  1.00 23.58 ? 53  GLU A OE1   1 
ATOM   452  O  OE2   . GLU A 1 56  ? 61.781 12.056  13.471  1.00 35.96 ? 53  GLU A OE2   1 
ATOM   453  N  N     . ALA A 1 57  ? 56.434 10.111  16.490  1.00 15.30 ? 54  ALA A N     1 
ATOM   454  C  CA    . ALA A 1 57  ? 55.141 10.004  17.173  1.00 14.09 ? 54  ALA A CA    1 
ATOM   455  C  C     . ALA A 1 57  ? 54.787 8.565   17.574  1.00 13.03 ? 54  ALA A C     1 
ATOM   456  O  O     . ALA A 1 57  ? 54.108 8.356   18.575  1.00 15.29 ? 54  ALA A O     1 
ATOM   457  C  CB    . ALA A 1 57  ? 54.009 10.599  16.305  1.00 15.69 ? 54  ALA A CB    1 
ATOM   458  N  N     . ARG A 1 58  ? 55.224 7.579   16.790  1.00 15.53 ? 55  ARG A N     1 
ATOM   459  C  CA    . ARG A 1 58  ? 54.984 6.171   17.153  1.00 15.60 ? 55  ARG A CA    1 
ATOM   460  C  C     . ARG A 1 58  ? 55.617 5.817   18.511  1.00 18.53 ? 55  ARG A C     1 
ATOM   461  O  O     . ARG A 1 58  ? 55.079 4.993   19.262  1.00 17.14 ? 55  ARG A O     1 
ATOM   462  C  CB    . ARG A 1 58  ? 55.487 5.226   16.064  1.00 13.66 ? 55  ARG A CB    1 
ATOM   463  C  CG    . ARG A 1 58  ? 54.797 5.416   14.725  1.00 16.12 ? 55  ARG A CG    1 
ATOM   464  C  CD    . ARG A 1 58  ? 55.385 4.523   13.654  1.00 17.93 ? 55  ARG A CD    1 
ATOM   465  N  NE    . ARG A 1 58  ? 54.973 4.984   12.327  1.00 17.42 ? 55  ARG A NE    1 
ATOM   466  C  CZ    . ARG A 1 58  ? 55.032 4.255   11.220  1.00 19.11 ? 55  ARG A CZ    1 
ATOM   467  N  NH1   . ARG A 1 58  ? 55.487 3.007   11.260  1.00 16.14 ? 55  ARG A NH1   1 
ATOM   468  N  NH2   . ARG A 1 58  ? 54.629 4.780   10.067  1.00 16.85 ? 55  ARG A NH2   1 
ATOM   469  N  N     . ALA A 1 59  ? 56.744 6.451   18.828  1.00 17.05 ? 56  ALA A N     1 
ATOM   470  C  CA    . ALA A 1 59  ? 57.419 6.209   20.108  1.00 19.60 ? 56  ALA A CA    1 
ATOM   471  C  C     . ALA A 1 59  ? 56.542 6.539   21.314  1.00 25.09 ? 56  ALA A C     1 
ATOM   472  O  O     . ALA A 1 59  ? 56.784 6.039   22.411  1.00 26.90 ? 56  ALA A O     1 
ATOM   473  C  CB    . ALA A 1 59  ? 58.729 6.978   20.186  1.00 20.41 ? 56  ALA A CB    1 
ATOM   474  N  N     . PHE A 1 60  ? 55.541 7.395   21.110  1.00 12.90 ? 57  PHE A N     1 
ATOM   475  C  CA    . PHE A 1 60  ? 54.583 7.772   22.147  1.00 17.73 ? 57  PHE A CA    1 
ATOM   476  C  C     . PHE A 1 60  ? 53.345 6.888   22.145  1.00 18.56 ? 57  PHE A C     1 
ATOM   477  O  O     . PHE A 1 60  ? 52.478 7.020   23.018  1.00 21.00 ? 57  PHE A O     1 
ATOM   478  C  CB    . PHE A 1 60  ? 54.130 9.219   21.948  1.00 18.00 ? 57  PHE A CB    1 
ATOM   479  C  CG    . PHE A 1 60  ? 55.194 10.252  22.231  1.00 19.73 ? 57  PHE A CG    1 
ATOM   480  C  CD1   . PHE A 1 60  ? 55.301 10.827  23.487  1.00 29.02 ? 57  PHE A CD1   1 
ATOM   481  C  CD2   . PHE A 1 60  ? 56.059 10.674  21.231  1.00 18.26 ? 57  PHE A CD2   1 
ATOM   482  C  CE1   . PHE A 1 60  ? 56.258 11.799  23.750  1.00 30.40 ? 57  PHE A CE1   1 
ATOM   483  C  CE2   . PHE A 1 60  ? 57.019 11.647  21.477  1.00 22.20 ? 57  PHE A CE2   1 
ATOM   484  C  CZ    . PHE A 1 60  ? 57.126 12.208  22.743  1.00 27.80 ? 57  PHE A CZ    1 
ATOM   485  N  N     . GLY A 1 61  ? 53.241 5.997   21.163  1.00 17.97 ? 58  GLY A N     1 
ATOM   486  C  CA    . GLY A 1 61  ? 52.105 5.083   21.072  1.00 17.23 ? 58  GLY A CA    1 
ATOM   487  C  C     . GLY A 1 61  ? 51.031 5.513   20.075  1.00 19.31 ? 58  GLY A C     1 
ATOM   488  O  O     . GLY A 1 61  ? 49.953 4.918   20.010  1.00 17.74 ? 58  GLY A O     1 
ATOM   489  N  N     . VAL A 1 62  ? 51.316 6.550   19.292  1.00 14.70 ? 59  VAL A N     1 
ATOM   490  C  CA    . VAL A 1 62  ? 50.343 7.058   18.327  1.00 15.30 ? 59  VAL A CA    1 
ATOM   491  C  C     . VAL A 1 62  ? 50.253 6.062   17.180  1.00 16.38 ? 59  VAL A C     1 
ATOM   492  O  O     . VAL A 1 62  ? 51.285 5.605   16.675  1.00 14.70 ? 59  VAL A O     1 
ATOM   493  C  CB    . VAL A 1 62  ? 50.732 8.477   17.793  1.00 13.17 ? 59  VAL A CB    1 
ATOM   494  C  CG1   . VAL A 1 62  ? 49.725 8.957   16.775  1.00 16.21 ? 59  VAL A CG1   1 
ATOM   495  C  CG2   . VAL A 1 62  ? 50.769 9.468   18.928  1.00 13.88 ? 59  VAL A CG2   1 
ATOM   496  N  N     . THR A 1 63  ? 49.024 5.713   16.786  1.00 17.52 ? 60  THR A N     1 
ATOM   497  C  CA    . THR A 1 63  ? 48.791 4.756   15.705  1.00 18.74 ? 60  THR A CA    1 
ATOM   498  C  C     . THR A 1 63  ? 47.746 5.241   14.700  1.00 18.34 ? 60  THR A C     1 
ATOM   499  O  O     . THR A 1 63  ? 46.945 6.120   14.993  1.00 21.63 ? 60  THR A O     1 
ATOM   500  C  CB    . THR A 1 63  ? 48.307 3.383   16.251  1.00 22.13 ? 60  THR A CB    1 
ATOM   501  O  OG1   . THR A 1 63  ? 47.047 3.544   16.918  1.00 23.98 ? 60  THR A OG1   1 
ATOM   502  C  CG2   . THR A 1 63  ? 49.308 2.821   17.227  1.00 19.64 ? 60  THR A CG2   1 
ATOM   503  N  N     . ARG A 1 64  ? 47.757 4.648   13.511  1.00 16.85 ? 61  ARG A N     1 
ATOM   504  C  CA    . ARG A 1 64  ? 46.659 4.803   12.557  1.00 19.85 ? 61  ARG A CA    1 
ATOM   505  C  C     . ARG A 1 64  ? 45.302 4.363   13.157  1.00 24.99 ? 61  ARG A C     1 
ATOM   506  O  O     . ARG A 1 64  ? 45.245 3.474   14.004  1.00 20.91 ? 61  ARG A O     1 
ATOM   507  C  CB    . ARG A 1 64  ? 46.996 4.025   11.274  1.00 20.97 ? 61  ARG A CB    1 
ATOM   508  C  CG    . ARG A 1 64  ? 45.871 3.843   10.274  1.00 29.07 ? 61  ARG A CG    1 
ATOM   509  C  CD    . ARG A 1 64  ? 46.403 3.120   9.022   1.00 26.66 ? 61  ARG A CD    1 
ATOM   510  N  NE    . ARG A 1 64  ? 47.489 3.880   8.419   1.00 23.26 ? 61  ARG A NE    1 
ATOM   511  C  CZ    . ARG A 1 64  ? 48.682 3.385   8.094   1.00 28.68 ? 61  ARG A CZ    1 
ATOM   512  N  NH1   . ARG A 1 64  ? 48.960 2.102   8.289   1.00 30.10 ? 61  ARG A NH1   1 
ATOM   513  N  NH2   . ARG A 1 64  ? 49.599 4.185   7.559   1.00 19.77 ? 61  ARG A NH2   1 
ATOM   514  N  N     . SER A 1 65  ? 44.223 5.003   12.713  1.00 22.62 ? 62  SER A N     1 
ATOM   515  C  CA    . SER A 1 65  ? 42.851 4.720   13.157  1.00 30.63 ? 62  SER A CA    1 
ATOM   516  C  C     . SER A 1 65  ? 42.496 5.380   14.494  1.00 27.39 ? 62  SER A C     1 
ATOM   517  O  O     . SER A 1 65  ? 41.342 5.402   14.903  1.00 42.21 ? 62  SER A O     1 
ATOM   518  C  CB    . SER A 1 65  ? 42.581 3.220   13.231  1.00 34.86 ? 62  SER A CB    1 
ATOM   519  O  OG    . SER A 1 65  ? 42.789 2.738   14.545  1.00 42.10 ? 62  SER A OG    1 
ATOM   520  N  N     . MET A 1 66  ? 43.504 5.903   15.168  1.00 22.57 ? 63  MET A N     1 
ATOM   521  C  CA    . MET A 1 66  ? 43.325 6.653   16.406  1.00 21.43 ? 63  MET A CA    1 
ATOM   522  C  C     . MET A 1 66  ? 42.712 8.017   16.066  1.00 20.93 ? 63  MET A C     1 
ATOM   523  O  O     . MET A 1 66  ? 43.064 8.606   15.045  1.00 19.36 ? 63  MET A O     1 
ATOM   524  C  CB    . MET A 1 66  ? 44.711 6.820   17.026  1.00 23.13 ? 63  MET A CB    1 
ATOM   525  C  CG    . MET A 1 66  ? 44.783 7.342   18.425  1.00 25.28 ? 63  MET A CG    1 
ATOM   526  S  SD    . MET A 1 66  ? 46.407 6.929   19.127  1.00 24.57 ? 63  MET A SD    1 
ATOM   527  C  CE    . MET A 1 66  ? 46.188 5.224   19.596  1.00 24.29 ? 63  MET A CE    1 
ATOM   528  N  N     . TRP A 1 67  ? 41.780 8.506   16.888  1.00 19.10 ? 64  TRP A N     1 
ATOM   529  C  CA    . TRP A 1 67  ? 41.277 9.879   16.736  1.00 21.09 ? 64  TRP A CA    1 
ATOM   530  C  C     . TRP A 1 67  ? 42.348 10.854  17.202  1.00 20.85 ? 64  TRP A C     1 
ATOM   531  O  O     . TRP A 1 67  ? 43.037 10.591  18.178  1.00 18.16 ? 64  TRP A O     1 
ATOM   532  C  CB    . TRP A 1 67  ? 40.008 10.109  17.562  1.00 21.58 ? 64  TRP A CB    1 
ATOM   533  C  CG    . TRP A 1 67  ? 38.877 9.221   17.173  1.00 22.19 ? 64  TRP A CG    1 
ATOM   534  C  CD1   . TRP A 1 67  ? 38.295 8.250   17.933  1.00 28.69 ? 64  TRP A CD1   1 
ATOM   535  C  CD2   . TRP A 1 67  ? 38.202 9.203   15.909  1.00 29.34 ? 64  TRP A CD2   1 
ATOM   536  N  NE1   . TRP A 1 67  ? 37.290 7.633   17.222  1.00 33.44 ? 64  TRP A NE1   1 
ATOM   537  C  CE2   . TRP A 1 67  ? 37.215 8.199   15.976  1.00 35.63 ? 64  TRP A CE2   1 
ATOM   538  C  CE3   . TRP A 1 67  ? 38.336 9.942   14.727  1.00 22.57 ? 64  TRP A CE3   1 
ATOM   539  C  CZ2   . TRP A 1 67  ? 36.364 7.911   14.905  1.00 38.97 ? 64  TRP A CZ2   1 
ATOM   540  C  CZ3   . TRP A 1 67  ? 37.489 9.657   13.664  1.00 27.68 ? 64  TRP A CZ3   1 
ATOM   541  C  CH2   . TRP A 1 67  ? 36.516 8.649   13.761  1.00 21.56 ? 64  TRP A CH2   1 
ATOM   542  N  N     . ALA A 1 68  ? 42.480 11.989  16.525  1.00 19.91 ? 65  ALA A N     1 
ATOM   543  C  CA    . ALA A 1 68  ? 43.510 12.955  16.904  1.00 20.05 ? 65  ALA A CA    1 
ATOM   544  C  C     . ALA A 1 68  ? 43.382 13.418  18.350  1.00 18.86 ? 65  ALA A C     1 
ATOM   545  O  O     . ALA A 1 68  ? 44.392 13.663  18.999  1.00 16.92 ? 65  ALA A O     1 
ATOM   546  C  CB    . ALA A 1 68  ? 43.506 14.150  15.968  1.00 20.38 ? 65  ALA A CB    1 
ATOM   547  N  N     . ASP A 1 69  ? 42.157 13.546  18.863  1.00 20.97 ? 66  ASP A N     1 
ATOM   548  C  CA    . ASP A 1 69  ? 41.998 14.001  20.254  1.00 19.60 ? 66  ASP A CA    1 
ATOM   549  C  C     . ASP A 1 69  ? 42.621 12.989  21.215  1.00 20.30 ? 66  ASP A C     1 
ATOM   550  O  O     . ASP A 1 69  ? 43.159 13.355  22.265  1.00 18.54 ? 66  ASP A O     1 
ATOM   551  C  CB    . ASP A 1 69  ? 40.531 14.206  20.627  1.00 22.65 ? 66  ASP A CB    1 
ATOM   552  C  CG    . ASP A 1 69  ? 39.919 15.451  19.993  1.00 27.17 ? 66  ASP A CG    1 
ATOM   553  O  OD1   . ASP A 1 69  ? 40.661 16.339  19.502  1.00 27.86 ? 66  ASP A OD1   1 
ATOM   554  O  OD2   . ASP A 1 69  ? 38.676 15.544  20.007  1.00 28.96 ? 66  ASP A OD2   1 
ATOM   555  N  N     . ASP A 1 70  ? 42.531 11.711  20.861  1.00 13.53 ? 67  ASP A N     1 
ATOM   556  C  CA    . ASP A 1 70  ? 43.062 10.648  21.710  1.00 16.67 ? 67  ASP A CA    1 
ATOM   557  C  C     . ASP A 1 70  ? 44.570 10.552  21.576  1.00 18.76 ? 67  ASP A C     1 
ATOM   558  O  O     . ASP A 1 70  ? 45.283 10.370  22.560  1.00 17.78 ? 67  ASP A O     1 
ATOM   559  C  CB    . ASP A 1 70  ? 42.403 9.316   21.344  1.00 18.79 ? 67  ASP A CB    1 
ATOM   560  C  CG    . ASP A 1 70  ? 40.902 9.324   21.604  1.00 31.63 ? 67  ASP A CG    1 
ATOM   561  O  OD1   . ASP A 1 70  ? 40.462 10.053  22.526  1.00 28.42 ? 67  ASP A OD1   1 
ATOM   562  O  OD2   . ASP A 1 70  ? 40.161 8.608   20.892  1.00 24.69 ? 67  ASP A OD2   1 
ATOM   563  N  N     . ALA A 1 71  ? 45.056 10.682  20.345  1.00 15.62 ? 68  ALA A N     1 
ATOM   564  C  CA    . ALA A 1 71  ? 46.496 10.746  20.094  1.00 15.44 ? 68  ALA A CA    1 
ATOM   565  C  C     . ALA A 1 71  ? 47.184 11.854  20.901  1.00 16.27 ? 68  ALA A C     1 
ATOM   566  O  O     . ALA A 1 71  ? 48.299 11.673  21.393  1.00 16.96 ? 68  ALA A O     1 
ATOM   567  C  CB    . ALA A 1 71  ? 46.776 10.936  18.570  1.00 16.81 ? 68  ALA A CB    1 
ATOM   568  N  N     . LYS A 1 72  ? 46.531 13.007  21.007  1.00 12.77 ? 69  LYS A N     1 
ATOM   569  C  CA    . LYS A 1 72  ? 47.070 14.145  21.762  1.00 17.18 ? 69  LYS A CA    1 
ATOM   570  C  C     . LYS A 1 72  ? 47.209 13.828  23.247  1.00 19.91 ? 69  LYS A C     1 
ATOM   571  O  O     . LYS A 1 72  ? 48.016 14.438  23.943  1.00 18.20 ? 69  LYS A O     1 
ATOM   572  C  CB    . LYS A 1 72  ? 46.185 15.386  21.579  1.00 18.25 ? 69  LYS A CB    1 
ATOM   573  C  CG    . LYS A 1 72  ? 46.506 16.211  20.329  1.00 24.62 ? 69  LYS A CG    1 
ATOM   574  C  CD    . LYS A 1 72  ? 47.825 16.949  20.495  1.00 26.66 ? 69  LYS A CD    1 
ATOM   575  C  CE    . LYS A 1 72  ? 47.949 18.113  19.534  1.00 27.54 ? 69  LYS A CE    1 
ATOM   576  N  NZ    . LYS A 1 72  ? 49.238 18.831  19.750  1.00 23.01 ? 69  LYS A NZ    1 
ATOM   577  N  N     . LYS A 1 73  ? 46.424 12.865  23.728  1.00 20.65 ? 70  LYS A N     1 
ATOM   578  C  CA    . LYS A 1 73  ? 46.527 12.442  25.121  1.00 16.79 ? 70  LYS A CA    1 
ATOM   579  C  C     . LYS A 1 73  ? 47.810 11.631  25.347  1.00 20.30 ? 70  LYS A C     1 
ATOM   580  O  O     . LYS A 1 73  ? 48.390 11.677  26.427  1.00 22.18 ? 70  LYS A O     1 
ATOM   581  C  CB    . LYS A 1 73  ? 45.276 11.661  25.546  1.00 12.05 ? 70  LYS A CB    1 
ATOM   582  C  CG    . LYS A 1 73  ? 43.958 12.373  25.255  1.00 12.85 ? 70  LYS A CG    1 
ATOM   583  C  CD    . LYS A 1 73  ? 42.771 11.463  25.554  1.00 16.18 ? 70  LYS A CD    1 
ATOM   584  C  CE    . LYS A 1 73  ? 41.438 12.106  25.119  1.00 20.08 ? 70  LYS A CE    1 
ATOM   585  N  NZ    . LYS A 1 73  ? 40.307 11.120  25.222  1.00 25.07 ? 70  LYS A NZ    1 
ATOM   586  N  N     . LEU A 1 74  ? 48.265 10.909  24.320  1.00 17.00 ? 71  LEU A N     1 
ATOM   587  C  CA    . LEU A 1 74  ? 49.528 10.166  24.409  1.00 18.98 ? 71  LEU A CA    1 
ATOM   588  C  C     . LEU A 1 74  ? 50.729 11.062  24.121  1.00 25.89 ? 71  LEU A C     1 
ATOM   589  O  O     . LEU A 1 74  ? 51.830 10.845  24.643  1.00 18.61 ? 71  LEU A O     1 
ATOM   590  C  CB    . LEU A 1 74  ? 49.542 9.009   23.404  1.00 14.19 ? 71  LEU A CB    1 
ATOM   591  C  CG    . LEU A 1 74  ? 48.490 7.923   23.622  1.00 23.97 ? 71  LEU A CG    1 
ATOM   592  C  CD1   . LEU A 1 74  ? 48.645 6.853   22.566  1.00 20.29 ? 71  LEU A CD1   1 
ATOM   593  C  CD2   . LEU A 1 74  ? 48.637 7.319   25.002  1.00 16.55 ? 71  LEU A CD2   1 
ATOM   594  N  N     . CYS A 1 75  ? 50.503 12.056  23.264  1.00 18.63 ? 72  CYS A N     1 
ATOM   595  C  CA    . CYS A 1 75  ? 51.566 12.900  22.742  1.00 18.35 ? 72  CYS A CA    1 
ATOM   596  C  C     . CYS A 1 75  ? 51.050 14.337  22.608  1.00 21.05 ? 72  CYS A C     1 
ATOM   597  O  O     . CYS A 1 75  ? 50.580 14.743  21.545  1.00 19.85 ? 72  CYS A O     1 
ATOM   598  C  CB    . CYS A 1 75  ? 52.002 12.350  21.383  1.00 20.02 ? 72  CYS A CB    1 
ATOM   599  S  SG    . CYS A 1 75  ? 53.358 13.239  20.634  1.00 24.87 ? 72  CYS A SG    1 
ATOM   600  N  N     . PRO A 1 76  ? 51.120 15.115  23.702  1.00 18.79 ? 73  PRO A N     1 
ATOM   601  C  CA    . PRO A 1 76  ? 50.530 16.458  23.727  1.00 22.38 ? 73  PRO A CA    1 
ATOM   602  C  C     . PRO A 1 76  ? 51.164 17.406  22.702  1.00 18.24 ? 73  PRO A C     1 
ATOM   603  O  O     . PRO A 1 76  ? 50.486 18.332  22.248  1.00 23.75 ? 73  PRO A O     1 
ATOM   604  C  CB    . PRO A 1 76  ? 50.811 16.940  25.161  1.00 24.70 ? 73  PRO A CB    1 
ATOM   605  C  CG    . PRO A 1 76  ? 50.963 15.668  25.953  1.00 27.18 ? 73  PRO A CG    1 
ATOM   606  C  CD    . PRO A 1 76  ? 51.633 14.703  25.020  1.00 26.09 ? 73  PRO A CD    1 
ATOM   607  N  N     . ASP A 1 77  ? 52.423 17.175  22.342  1.00 19.74 ? 74  ASP A N     1 
ATOM   608  C  CA    . ASP A 1 77  ? 53.100 18.024  21.356  1.00 21.11 ? 74  ASP A CA    1 
ATOM   609  C  C     . ASP A 1 77  ? 52.988 17.522  19.908  1.00 25.03 ? 74  ASP A C     1 
ATOM   610  O  O     . ASP A 1 77  ? 53.662 18.046  19.006  1.00 22.08 ? 74  ASP A O     1 
ATOM   611  C  CB    . ASP A 1 77  ? 54.577 18.199  21.712  1.00 24.31 ? 74  ASP A CB    1 
ATOM   612  C  CG    . ASP A 1 77  ? 54.777 18.984  22.989  1.00 42.28 ? 74  ASP A CG    1 
ATOM   613  O  OD1   . ASP A 1 77  ? 55.534 18.505  23.863  1.00 41.85 ? 74  ASP A OD1   1 
ATOM   614  O  OD2   . ASP A 1 77  ? 54.181 20.078  23.116  1.00 40.93 ? 74  ASP A OD2   1 
ATOM   615  N  N     . LEU A 1 78  ? 52.145 16.518  19.682  1.00 18.51 ? 75  LEU A N     1 
ATOM   616  C  CA    . LEU A 1 78  ? 51.949 15.973  18.334  1.00 15.21 ? 75  LEU A CA    1 
ATOM   617  C  C     . LEU A 1 78  ? 51.582 17.084  17.350  1.00 19.08 ? 75  LEU A C     1 
ATOM   618  O  O     . LEU A 1 78  ? 50.713 17.890  17.640  1.00 17.41 ? 75  LEU A O     1 
ATOM   619  C  CB    . LEU A 1 78  ? 50.829 14.930  18.362  1.00 18.29 ? 75  LEU A CB    1 
ATOM   620  C  CG    . LEU A 1 78  ? 50.462 14.233  17.050  1.00 15.03 ? 75  LEU A CG    1 
ATOM   621  C  CD1   . LEU A 1 78  ? 51.596 13.316  16.583  1.00 13.55 ? 75  LEU A CD1   1 
ATOM   622  C  CD2   . LEU A 1 78  ? 49.188 13.446  17.244  1.00 15.57 ? 75  LEU A CD2   1 
ATOM   623  N  N     . LEU A 1 79  ? 52.250 17.138  16.200  1.00 12.23 ? 76  LEU A N     1 
ATOM   624  C  CA    . LEU A 1 79  ? 51.865 18.084  15.151  1.00 11.09 ? 76  LEU A CA    1 
ATOM   625  C  C     . LEU A 1 79  ? 50.967 17.376  14.143  1.00 15.11 ? 76  LEU A C     1 
ATOM   626  O  O     . LEU A 1 79  ? 51.107 16.182  13.922  1.00 15.45 ? 76  LEU A O     1 
ATOM   627  C  CB    . LEU A 1 79  ? 53.107 18.639  14.447  1.00 9.19  ? 76  LEU A CB    1 
ATOM   628  C  CG    . LEU A 1 79  ? 54.043 19.384  15.407  1.00 14.06 ? 76  LEU A CG    1 
ATOM   629  C  CD1   . LEU A 1 79  ? 55.266 19.968  14.690  1.00 17.94 ? 76  LEU A CD1   1 
ATOM   630  C  CD2   . LEU A 1 79  ? 53.309 20.461  16.182  1.00 14.69 ? 76  LEU A CD2   1 
ATOM   631  N  N     . LEU A 1 80  ? 50.048 18.112  13.530  1.00 19.91 ? 77  LEU A N     1 
ATOM   632  C  CA    . LEU A 1 80  ? 49.130 17.505  12.578  1.00 19.05 ? 77  LEU A CA    1 
ATOM   633  C  C     . LEU A 1 80  ? 49.094 18.235  11.238  1.00 20.11 ? 77  LEU A C     1 
ATOM   634  O  O     . LEU A 1 80  ? 49.193 19.459  11.178  1.00 23.97 ? 77  LEU A O     1 
ATOM   635  C  CB    . LEU A 1 80  ? 47.718 17.456  13.157  1.00 13.39 ? 77  LEU A CB    1 
ATOM   636  C  CG    . LEU A 1 80  ? 47.551 16.787  14.508  1.00 15.38 ? 77  LEU A CG    1 
ATOM   637  C  CD1   . LEU A 1 80  ? 46.120 16.970  14.984  1.00 20.41 ? 77  LEU A CD1   1 
ATOM   638  C  CD2   . LEU A 1 80  ? 47.915 15.310  14.402  1.00 17.80 ? 77  LEU A CD2   1 
ATOM   639  N  N     . ALA A 1 81  ? 48.953 17.469  10.164  1.00 15.35 ? 78  ALA A N     1 
ATOM   640  C  CA    . ALA A 1 81  ? 48.638 18.034  8.857   1.00 17.15 ? 78  ALA A CA    1 
ATOM   641  C  C     . ALA A 1 81  ? 47.317 17.429  8.385   1.00 16.33 ? 78  ALA A C     1 
ATOM   642  O  O     . ALA A 1 81  ? 47.065 16.244  8.584   1.00 15.77 ? 78  ALA A O     1 
ATOM   643  C  CB    . ALA A 1 81  ? 49.767 17.755  7.864   1.00 16.46 ? 78  ALA A CB    1 
ATOM   644  N  N     . GLN A 1 82  ? 46.453 18.242  7.790   1.00 16.83 ? 79  GLN A N     1 
ATOM   645  C  CA    . GLN A 1 82  ? 45.146 17.750  7.359   1.00 21.62 ? 79  GLN A CA    1 
ATOM   646  C  C     . GLN A 1 82  ? 45.124 17.427  5.879   1.00 16.40 ? 79  GLN A C     1 
ATOM   647  O  O     . GLN A 1 82  ? 45.691 18.160  5.064   1.00 16.55 ? 79  GLN A O     1 
ATOM   648  C  CB    . GLN A 1 82  ? 44.065 18.802  7.599   1.00 22.64 ? 79  GLN A CB    1 
ATOM   649  C  CG    . GLN A 1 82  ? 43.893 19.253  9.010   1.00 32.37 ? 79  GLN A CG    1 
ATOM   650  C  CD    . GLN A 1 82  ? 42.814 20.304  9.101   1.00 39.93 ? 79  GLN A CD    1 
ATOM   651  O  OE1   . GLN A 1 82  ? 43.067 21.430  9.513   1.00 39.42 ? 79  GLN A OE1   1 
ATOM   652  N  NE2   . GLN A 1 82  ? 41.601 19.947  8.685   1.00 42.89 ? 79  GLN A NE2   1 
ATOM   653  N  N     . VAL A 1 83  ? 44.428 16.348  5.533   1.00 16.74 ? 80  VAL A N     1 
ATOM   654  C  CA    . VAL A 1 83  ? 44.164 16.014  4.145   1.00 17.85 ? 80  VAL A CA    1 
ATOM   655  C  C     . VAL A 1 83  ? 43.262 17.101  3.576   1.00 15.34 ? 80  VAL A C     1 
ATOM   656  O  O     . VAL A 1 83  ? 42.344 17.584  4.238   1.00 14.43 ? 80  VAL A O     1 
ATOM   657  C  CB    . VAL A 1 83  ? 43.469 14.637  4.012   1.00 15.85 ? 80  VAL A CB    1 
ATOM   658  C  CG1   . VAL A 1 83  ? 43.064 14.357  2.575   1.00 16.32 ? 80  VAL A CG1   1 
ATOM   659  C  CG2   . VAL A 1 83  ? 44.372 13.513  4.553   1.00 16.16 ? 80  VAL A CG2   1 
ATOM   660  N  N     . ARG A 1 84  ? 43.558 17.494  2.349   1.00 16.04 ? 81  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 84  ? 42.791 18.515  1.654   1.00 18.59 ? 81  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 84  ? 41.348 18.064  1.494   1.00 18.74 ? 81  ARG A C     1 
ATOM   663  O  O     . ARG A 1 84  ? 41.074 16.877  1.308   1.00 16.11 ? 81  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 84  ? 43.418 18.768  0.286   1.00 23.54 ? 81  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 84  ? 42.587 19.620  -0.660  1.00 26.91 ? 81  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 84  ? 43.245 19.632  -2.036  1.00 39.46 ? 81  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 84  ? 42.417 20.264  -3.060  1.00 51.54 ? 81  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 84  ? 42.698 20.237  -4.360  1.00 55.54 ? 81  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 84  ? 43.784 19.604  -4.791  1.00 43.12 ? 81  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 84  ? 41.895 20.837  -5.230  1.00 51.75 ? 81  ARG A NH2   1 
ATOM   671  N  N     . GLU A 1 85  ? 40.425 19.016  1.564   1.00 18.17 ? 82  GLU A N     1 
ATOM   672  C  CA    . GLU A 1 85  ? 39.017 18.723  1.313   1.00 21.79 ? 82  GLU A CA    1 
ATOM   673  C  C     . GLU A 1 85  ? 38.579 19.480  0.079   1.00 21.35 ? 82  GLU A C     1 
ATOM   674  O  O     . GLU A 1 85  ? 38.881 20.661  -0.056  1.00 20.63 ? 82  GLU A O     1 
ATOM   675  C  CB    . GLU A 1 85  ? 38.141 19.125  2.502   1.00 26.37 ? 82  GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 85  ? 37.919 18.006  3.515   1.00 34.18 ? 82  GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 85  ? 37.280 18.504  4.815   1.00 46.02 ? 82  GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 85  ? 36.042 18.735  4.848   1.00 32.27 ? 82  GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 85  ? 38.029 18.668  5.803   1.00 46.24 ? 82  GLU A OE2   1 
ATOM   680  N  N     . SER A 1 86  ? 37.869 18.790  -0.812  1.00 21.07 ? 83  SER A N     1 
ATOM   681  C  CA    . SER A 1 86  ? 37.306 19.385  -2.016  1.00 18.27 ? 83  SER A CA    1 
ATOM   682  C  C     . SER A 1 86  ? 35.926 18.804  -2.277  1.00 23.69 ? 83  SER A C     1 
ATOM   683  O  O     . SER A 1 86  ? 35.715 17.612  -2.109  1.00 20.79 ? 83  SER A O     1 
ATOM   684  C  CB    . SER A 1 86  ? 38.192 19.113  -3.225  1.00 19.56 ? 83  SER A CB    1 
ATOM   685  O  OG    . SER A 1 86  ? 39.448 19.736  -3.062  1.00 37.63 ? 83  SER A OG    1 
ATOM   686  N  N     . ARG A 1 87  ? 34.995 19.651  -2.703  1.00 24.03 ? 84  ARG A N     1 
ATOM   687  C  CA    . ARG A 1 87  ? 33.613 19.233  -2.938  1.00 25.85 ? 84  ARG A CA    1 
ATOM   688  C  C     . ARG A 1 87  ? 33.009 18.468  -1.765  1.00 20.83 ? 84  ARG A C     1 
ATOM   689  O  O     . ARG A 1 87  ? 32.245 17.511  -1.958  1.00 26.35 ? 84  ARG A O     1 
ATOM   690  C  CB    . ARG A 1 87  ? 33.497 18.417  -4.230  1.00 28.55 ? 84  ARG A CB    1 
ATOM   691  C  CG    . ARG A 1 87  ? 33.915 19.179  -5.471  1.00 32.33 ? 84  ARG A CG    1 
ATOM   692  C  CD    . ARG A 1 87  ? 33.738 18.338  -6.724  1.00 32.60 ? 84  ARG A CD    1 
ATOM   693  N  NE    . ARG A 1 87  ? 34.998 18.204  -7.446  1.00 37.00 ? 84  ARG A NE    1 
ATOM   694  C  CZ    . ARG A 1 87  ? 35.381 19.007  -8.431  1.00 45.76 ? 84  ARG A CZ    1 
ATOM   695  N  NH1   . ARG A 1 87  ? 34.587 19.996  -8.830  1.00 49.91 ? 84  ARG A NH1   1 
ATOM   696  N  NH2   . ARG A 1 87  ? 36.554 18.818  -9.023  1.00 44.71 ? 84  ARG A NH2   1 
ATOM   697  N  N     . GLY A 1 88  ? 33.340 18.888  -0.549  1.00 17.84 ? 85  GLY A N     1 
ATOM   698  C  CA    . GLY A 1 88  ? 32.790 18.268  0.647   1.00 19.67 ? 85  GLY A CA    1 
ATOM   699  C  C     . GLY A 1 88  ? 33.448 16.973  1.118   1.00 24.11 ? 85  GLY A C     1 
ATOM   700  O  O     . GLY A 1 88  ? 32.986 16.351  2.084   1.00 22.37 ? 85  GLY A O     1 
ATOM   701  N  N     . LYS A 1 89  ? 34.534 16.562  0.467   1.00 16.80 ? 86  LYS A N     1 
ATOM   702  C  CA    . LYS A 1 89  ? 35.173 15.298  0.821   1.00 14.01 ? 86  LYS A CA    1 
ATOM   703  C  C     . LYS A 1 89  ? 36.703 15.342  0.830   1.00 17.32 ? 86  LYS A C     1 
ATOM   704  O  O     . LYS A 1 89  ? 37.329 16.250  0.269   1.00 17.27 ? 86  LYS A O     1 
ATOM   705  C  CB    . LYS A 1 89  ? 34.702 14.181  -0.115  1.00 19.80 ? 86  LYS A CB    1 
ATOM   706  C  CG    . LYS A 1 89  ? 35.295 14.255  -1.523  1.00 21.46 ? 86  LYS A CG    1 
ATOM   707  C  CD    . LYS A 1 89  ? 34.752 13.159  -2.445  1.00 22.83 ? 86  LYS A CD    1 
ATOM   708  C  CE    . LYS A 1 89  ? 35.359 11.799  -2.146  1.00 18.28 ? 86  LYS A CE    1 
ATOM   709  N  NZ    . LYS A 1 89  ? 36.848 11.813  -2.243  1.00 18.17 ? 86  LYS A NZ    1 
ATOM   710  N  N     . ALA A 1 90  ? 37.298 14.338  1.466   1.00 19.29 ? 87  ALA A N     1 
ATOM   711  C  CA    . ALA A 1 90  ? 38.744 14.201  1.488   1.00 18.84 ? 87  ALA A CA    1 
ATOM   712  C  C     . ALA A 1 90  ? 39.223 13.977  0.074   1.00 19.68 ? 87  ALA A C     1 
ATOM   713  O  O     . ALA A 1 90  ? 38.586 13.263  -0.705  1.00 22.97 ? 87  ALA A O     1 
ATOM   714  C  CB    . ALA A 1 90  ? 39.165 13.052  2.389   1.00 21.61 ? 87  ALA A CB    1 
ATOM   715  N  N     . ASN A 1 91  ? 40.337 14.614  -0.264  1.00 15.75 ? 88  ASN A N     1 
ATOM   716  C  CA    . ASN A 1 91  ? 40.887 14.536  -1.610  1.00 19.21 ? 88  ASN A CA    1 
ATOM   717  C  C     . ASN A 1 91  ? 42.374 14.175  -1.543  1.00 16.26 ? 88  ASN A C     1 
ATOM   718  O  O     . ASN A 1 91  ? 43.183 14.937  -1.007  1.00 18.79 ? 88  ASN A O     1 
ATOM   719  C  CB    . ASN A 1 91  ? 40.677 15.878  -2.312  1.00 18.12 ? 88  ASN A CB    1 
ATOM   720  C  CG    . ASN A 1 91  ? 41.165 15.874  -3.749  1.00 30.64 ? 88  ASN A CG    1 
ATOM   721  O  OD1   . ASN A 1 91  ? 42.223 15.334  -4.058  1.00 20.77 ? 88  ASN A OD1   1 
ATOM   722  N  ND2   . ASN A 1 91  ? 40.383 16.476  -4.638  1.00 36.59 ? 88  ASN A ND2   1 
ATOM   723  N  N     . LEU A 1 92  ? 42.725 13.006  -2.073  1.00 18.41 ? 89  LEU A N     1 
ATOM   724  C  CA    . LEU A 1 92  ? 44.069 12.445  -1.893  1.00 19.03 ? 89  LEU A CA    1 
ATOM   725  C  C     . LEU A 1 92  ? 45.027 12.750  -3.043  1.00 18.62 ? 89  LEU A C     1 
ATOM   726  O  O     . LEU A 1 92  ? 46.079 12.118  -3.172  1.00 17.05 ? 89  LEU A O     1 
ATOM   727  C  CB    . LEU A 1 92  ? 43.973 10.927  -1.701  1.00 17.16 ? 89  LEU A CB    1 
ATOM   728  C  CG    . LEU A 1 92  ? 43.035 10.495  -0.575  1.00 15.09 ? 89  LEU A CG    1 
ATOM   729  C  CD1   . LEU A 1 92  ? 42.995 8.982   -0.447  1.00 18.07 ? 89  LEU A CD1   1 
ATOM   730  C  CD2   . LEU A 1 92  ? 43.483 11.135  0.750   1.00 17.77 ? 89  LEU A CD2   1 
ATOM   731  N  N     . THR A 1 93  ? 44.678 13.732  -3.862  1.00 15.32 ? 90  THR A N     1 
ATOM   732  C  CA    . THR A 1 93  ? 45.464 14.029  -5.061  1.00 16.58 ? 90  THR A CA    1 
ATOM   733  C  C     . THR A 1 93  ? 46.952 14.253  -4.805  1.00 20.59 ? 90  THR A C     1 
ATOM   734  O  O     . THR A 1 93  ? 47.809 13.722  -5.532  1.00 16.62 ? 90  THR A O     1 
ATOM   735  C  CB    . THR A 1 93  ? 44.860 15.211  -5.843  1.00 26.64 ? 90  THR A CB    1 
ATOM   736  O  OG1   . THR A 1 93  ? 43.529 14.861  -6.248  1.00 24.88 ? 90  THR A OG1   1 
ATOM   737  C  CG2   . THR A 1 93  ? 45.697 15.526  -7.078  1.00 18.71 ? 90  THR A CG2   1 
ATOM   738  N  N     . LYS A 1 94  ? 47.270 15.025  -3.772  1.00 16.74 ? 91  LYS A N     1 
ATOM   739  C  CA    . LYS A 1 94  ? 48.661 15.340  -3.481  1.00 18.08 ? 91  LYS A CA    1 
ATOM   740  C  C     . LYS A 1 94  ? 49.515 14.086  -3.264  1.00 16.91 ? 91  LYS A C     1 
ATOM   741  O  O     . LYS A 1 94  ? 50.686 14.042  -3.662  1.00 15.43 ? 91  LYS A O     1 
ATOM   742  C  CB    . LYS A 1 94  ? 48.748 16.248  -2.257  1.00 17.58 ? 91  LYS A CB    1 
ATOM   743  C  CG    . LYS A 1 94  ? 50.139 16.760  -1.955  1.00 16.07 ? 91  LYS A CG    1 
ATOM   744  C  CD    . LYS A 1 94  ? 50.239 17.245  -0.513  1.00 21.14 ? 91  LYS A CD    1 
ATOM   745  C  CE    . LYS A 1 94  ? 49.408 18.488  -0.274  1.00 25.59 ? 91  LYS A CE    1 
ATOM   746  N  NZ    . LYS A 1 94  ? 49.438 18.872  1.165   1.00 17.62 ? 91  LYS A NZ    1 
ATOM   747  N  N     . TYR A 1 95  ? 48.929 13.069  -2.642  1.00 15.19 ? 92  TYR A N     1 
ATOM   748  C  CA    . TYR A 1 95  ? 49.673 11.860  -2.306  1.00 13.51 ? 92  TYR A CA    1 
ATOM   749  C  C     . TYR A 1 95  ? 49.765 10.948  -3.521  1.00 14.74 ? 92  TYR A C     1 
ATOM   750  O  O     . TYR A 1 95  ? 50.780 10.270  -3.730  1.00 14.08 ? 92  TYR A O     1 
ATOM   751  C  CB    . TYR A 1 95  ? 49.042 11.131  -1.106  1.00 11.53 ? 92  TYR A CB    1 
ATOM   752  C  CG    . TYR A 1 95  ? 48.720 12.101  -0.001  1.00 12.35 ? 92  TYR A CG    1 
ATOM   753  C  CD1   . TYR A 1 95  ? 47.415 12.500  0.230   1.00 17.78 ? 92  TYR A CD1   1 
ATOM   754  C  CD2   . TYR A 1 95  ? 49.734 12.686  0.757   1.00 13.58 ? 92  TYR A CD2   1 
ATOM   755  C  CE1   . TYR A 1 95  ? 47.115 13.421  1.206   1.00 16.88 ? 92  TYR A CE1   1 
ATOM   756  C  CE2   . TYR A 1 95  ? 49.443 13.608  1.729   1.00 15.54 ? 92  TYR A CE2   1 
ATOM   757  C  CZ    . TYR A 1 95  ? 48.127 13.979  1.941   1.00 14.96 ? 92  TYR A CZ    1 
ATOM   758  O  OH    . TYR A 1 95  ? 47.815 14.913  2.916   1.00 17.77 ? 92  TYR A OH    1 
ATOM   759  N  N     . ARG A 1 96  ? 48.714 10.945  -4.334  1.00 15.90 ? 93  ARG A N     1 
ATOM   760  C  CA    . ARG A 1 96  ? 48.765 10.252  -5.627  1.00 19.01 ? 93  ARG A CA    1 
ATOM   761  C  C     . ARG A 1 96  ? 49.844 10.822  -6.567  1.00 19.42 ? 93  ARG A C     1 
ATOM   762  O  O     . ARG A 1 96  ? 50.520 10.074  -7.279  1.00 17.92 ? 93  ARG A O     1 
ATOM   763  C  CB    . ARG A 1 96  ? 47.391 10.253  -6.311  1.00 17.88 ? 93  ARG A CB    1 
ATOM   764  C  CG    . ARG A 1 96  ? 46.365 9.351   -5.628  1.00 17.48 ? 93  ARG A CG    1 
ATOM   765  C  CD    . ARG A 1 96  ? 45.116 9.126   -6.484  1.00 20.26 ? 93  ARG A CD    1 
ATOM   766  N  NE    . ARG A 1 96  ? 44.065 8.468   -5.712  1.00 29.54 ? 93  ARG A NE    1 
ATOM   767  C  CZ    . ARG A 1 96  ? 43.015 9.086   -5.170  1.00 19.29 ? 93  ARG A CZ    1 
ATOM   768  N  NH1   . ARG A 1 96  ? 42.134 8.378   -4.468  1.00 19.67 ? 93  ARG A NH1   1 
ATOM   769  N  NH2   . ARG A 1 96  ? 42.835 10.400  -5.334  1.00 18.73 ? 93  ARG A NH2   1 
ATOM   770  N  N     . GLU A 1 97  ? 50.009 12.140  -6.570  1.00 16.52 ? 94  GLU A N     1 
ATOM   771  C  CA    . GLU A 1 97  ? 51.030 12.760  -7.415  1.00 21.22 ? 94  GLU A CA    1 
ATOM   772  C  C     . GLU A 1 97  ? 52.441 12.500  -6.877  1.00 20.37 ? 94  GLU A C     1 
ATOM   773  O  O     . GLU A 1 97  ? 53.381 12.268  -7.654  1.00 16.10 ? 94  GLU A O     1 
ATOM   774  C  CB    . GLU A 1 97  ? 50.755 14.251  -7.588  1.00 19.07 ? 94  GLU A CB    1 
ATOM   775  C  CG    . GLU A 1 97  ? 49.426 14.522  -8.273  1.00 30.80 ? 94  GLU A CG    1 
ATOM   776  C  CD    . GLU A 1 97  ? 49.167 15.994  -8.550  1.00 42.65 ? 94  GLU A CD    1 
ATOM   777  O  OE1   . GLU A 1 97  ? 49.839 16.858  -7.944  1.00 45.45 ? 94  GLU A OE1   1 
ATOM   778  O  OE2   . GLU A 1 97  ? 48.280 16.285  -9.386  1.00 38.97 ? 94  GLU A OE2   1 
ATOM   779  N  N     . ALA A 1 98  ? 52.585 12.501  -5.551  1.00 16.87 ? 95  ALA A N     1 
ATOM   780  C  CA    . ALA A 1 98  ? 53.862 12.159  -4.952  1.00 16.01 ? 95  ALA A CA    1 
ATOM   781  C  C     . ALA A 1 98  ? 54.239 10.706  -5.280  1.00 13.44 ? 95  ALA A C     1 
ATOM   782  O  O     . ALA A 1 98  ? 55.411 10.397  -5.506  1.00 15.96 ? 95  ALA A O     1 
ATOM   783  C  CB    . ALA A 1 98  ? 53.840 12.404  -3.424  1.00 12.03 ? 95  ALA A CB    1 
ATOM   784  N  N     . SER A 1 99  ? 53.236 9.828   -5.314  1.00 12.32 ? 96  SER A N     1 
ATOM   785  C  CA    . SER A 1 99  ? 53.408 8.408   -5.659  1.00 17.39 ? 96  SER A CA    1 
ATOM   786  C  C     . SER A 1 99  ? 53.962 8.227   -7.078  1.00 17.99 ? 96  SER A C     1 
ATOM   787  O  O     . SER A 1 99  ? 54.944 7.505   -7.304  1.00 14.32 ? 96  SER A O     1 
ATOM   788  C  CB    . SER A 1 99  ? 52.060 7.692   -5.529  1.00 18.15 ? 96  SER A CB    1 
ATOM   789  O  OG    . SER A 1 99  ? 52.141 6.342   -5.925  1.00 18.76 ? 96  SER A OG    1 
ATOM   790  N  N     . VAL A 1 100 ? 53.325 8.887   -8.036  1.00 15.32 ? 97  VAL A N     1 
ATOM   791  C  CA    . VAL A 1 100 ? 53.838 8.898   -9.410  1.00 16.06 ? 97  VAL A CA    1 
ATOM   792  C  C     . VAL A 1 100 ? 55.318 9.309   -9.459  1.00 17.19 ? 97  VAL A C     1 
ATOM   793  O  O     . VAL A 1 100 ? 56.105 8.683   -10.167 1.00 20.35 ? 97  VAL A O     1 
ATOM   794  C  CB    . VAL A 1 100 ? 52.976 9.798   -10.318 1.00 19.89 ? 97  VAL A CB    1 
ATOM   795  C  CG1   . VAL A 1 100 ? 53.640 9.983   -11.683 1.00 22.22 ? 97  VAL A CG1   1 
ATOM   796  C  CG2   . VAL A 1 100 ? 51.577 9.191   -10.469 1.00 22.34 ? 97  VAL A CG2   1 
ATOM   797  N  N     . GLU A 1 101 ? 55.710 10.320  -8.680  1.00 14.30 ? 98  GLU A N     1 
ATOM   798  C  CA    . GLU A 1 101 ? 57.122 10.746  -8.637  1.00 17.48 ? 98  GLU A CA    1 
ATOM   799  C  C     . GLU A 1 101 ? 58.045 9.585   -8.311  1.00 16.80 ? 98  GLU A C     1 
ATOM   800  O  O     . GLU A 1 101 ? 59.105 9.409   -8.930  1.00 17.55 ? 98  GLU A O     1 
ATOM   801  C  CB    . GLU A 1 101 ? 57.388 11.813  -7.558  1.00 16.14 ? 98  GLU A CB    1 
ATOM   802  C  CG    . GLU A 1 101 ? 56.917 13.225  -7.855  1.00 23.34 ? 98  GLU A CG    1 
ATOM   803  C  CD    . GLU A 1 101 ? 57.277 14.177  -6.721  1.00 22.81 ? 98  GLU A CD    1 
ATOM   804  O  OE1   . GLU A 1 101 ? 58.468 14.528  -6.583  1.00 18.73 ? 98  GLU A OE1   1 
ATOM   805  O  OE2   . GLU A 1 101 ? 56.370 14.556  -5.950  1.00 23.09 ? 98  GLU A OE2   1 
ATOM   806  N  N     . VAL A 1 102 ? 57.663 8.813   -7.299  1.00 13.68 ? 99  VAL A N     1 
ATOM   807  C  CA    . VAL A 1 102 ? 58.488 7.697   -6.885  1.00 16.13 ? 99  VAL A CA    1 
ATOM   808  C  C     . VAL A 1 102 ? 58.449 6.551   -7.891  1.00 16.08 ? 99  VAL A C     1 
ATOM   809  O  O     . VAL A 1 102 ? 59.488 5.974   -8.212  1.00 16.62 ? 99  VAL A O     1 
ATOM   810  C  CB    . VAL A 1 102 ? 58.078 7.186   -5.498  1.00 14.66 ? 99  VAL A CB    1 
ATOM   811  C  CG1   . VAL A 1 102 ? 58.840 5.908   -5.163  1.00 20.39 ? 99  VAL A CG1   1 
ATOM   812  C  CG2   . VAL A 1 102 ? 58.341 8.279   -4.456  1.00 18.17 ? 99  VAL A CG2   1 
ATOM   813  N  N     . MET A 1 103 ? 57.264 6.232   -8.399  1.00 15.71 ? 100 MET A N     1 
ATOM   814  C  CA    . MET A 1 103 ? 57.129 5.098   -9.327  1.00 14.61 ? 100 MET A CA    1 
ATOM   815  C  C     . MET A 1 103 ? 57.940 5.329   -10.602 1.00 24.06 ? 100 MET A C     1 
ATOM   816  O  O     . MET A 1 103 ? 58.506 4.390   -11.167 1.00 17.66 ? 100 MET A O     1 
ATOM   817  C  CB    . MET A 1 103 ? 55.661 4.835   -9.673  1.00 23.90 ? 100 MET A CB    1 
ATOM   818  C  CG    . MET A 1 103 ? 54.771 4.579   -8.462  1.00 25.56 ? 100 MET A CG    1 
ATOM   819  S  SD    . MET A 1 103 ? 55.105 2.972   -7.722  1.00 24.62 ? 100 MET A SD    1 
ATOM   820  C  CE    . MET A 1 103 ? 54.206 3.072   -6.164  1.00 26.16 ? 100 MET A CE    1 
ATOM   821  N  N     . GLU A 1 104 ? 58.002 6.579   -11.053 1.00 17.31 ? 101 GLU A N     1 
ATOM   822  C  CA    . GLU A 1 104 ? 58.744 6.893   -12.267 1.00 20.23 ? 101 GLU A CA    1 
ATOM   823  C  C     . GLU A 1 104 ? 60.256 6.703   -12.089 1.00 22.72 ? 101 GLU A C     1 
ATOM   824  O  O     . GLU A 1 104 ? 60.937 6.239   -13.001 1.00 17.30 ? 101 GLU A O     1 
ATOM   825  C  CB    . GLU A 1 104 ? 58.386 8.296   -12.785 1.00 21.18 ? 101 GLU A CB    1 
ATOM   826  C  CG    . GLU A 1 104 ? 56.960 8.363   -13.359 1.00 24.95 ? 101 GLU A CG    1 
ATOM   827  C  CD    . GLU A 1 104 ? 56.612 9.709   -13.999 1.00 45.17 ? 101 GLU A CD    1 
ATOM   828  O  OE1   . GLU A 1 104 ? 57.377 10.689  -13.830 1.00 44.70 ? 101 GLU A OE1   1 
ATOM   829  O  OE2   . GLU A 1 104 ? 55.558 9.785   -14.672 1.00 42.52 ? 101 GLU A OE2   1 
ATOM   830  N  N     . ILE A 1 105 ? 60.771 7.034   -10.910 1.00 17.22 ? 102 ILE A N     1 
ATOM   831  C  CA    . ILE A 1 105 ? 62.181 6.796   -10.598 1.00 16.75 ? 102 ILE A CA    1 
ATOM   832  C  C     . ILE A 1 105 ? 62.490 5.296   -10.567 1.00 17.12 ? 102 ILE A C     1 
ATOM   833  O  O     . ILE A 1 105 ? 63.435 4.832   -11.216 1.00 20.61 ? 102 ILE A O     1 
ATOM   834  C  CB    . ILE A 1 105 ? 62.582 7.455   -9.261  1.00 17.98 ? 102 ILE A CB    1 
ATOM   835  C  CG1   . ILE A 1 105 ? 62.475 8.971   -9.365  1.00 17.67 ? 102 ILE A CG1   1 
ATOM   836  C  CG2   . ILE A 1 105 ? 64.005 7.064   -8.861  1.00 20.91 ? 102 ILE A CG2   1 
ATOM   837  C  CD1   . ILE A 1 105 ? 62.425 9.665   -8.019  1.00 18.06 ? 102 ILE A CD1   1 
ATOM   838  N  N     . MET A 1 106 ? 61.684 4.531   -9.838  1.00 16.74 ? 103 MET A N     1 
ATOM   839  C  CA    . MET A 1 106 ? 61.893 3.083   -9.775  1.00 20.45 ? 103 MET A CA    1 
ATOM   840  C  C     . MET A 1 106 ? 61.877 2.436   -11.161 1.00 16.76 ? 103 MET A C     1 
ATOM   841  O  O     . MET A 1 106 ? 62.640 1.510   -11.440 1.00 16.28 ? 103 MET A O     1 
ATOM   842  C  CB    . MET A 1 106 ? 60.852 2.423   -8.855  1.00 17.69 ? 103 MET A CB    1 
ATOM   843  C  CG    . MET A 1 106 ? 61.065 2.766   -7.385  1.00 20.73 ? 103 MET A CG    1 
ATOM   844  S  SD    . MET A 1 106 ? 59.932 1.859   -6.306  1.00 25.33 ? 103 MET A SD    1 
ATOM   845  C  CE    . MET A 1 106 ? 58.374 2.567   -6.805  1.00 27.32 ? 103 MET A CE    1 
ATOM   846  N  N     . SER A 1 107 ? 61.003 2.928   -12.030 1.00 15.82 ? 104 SER A N     1 
ATOM   847  C  CA    . SER A 1 107 ? 60.867 2.373   -13.364 1.00 21.99 ? 104 SER A CA    1 
ATOM   848  C  C     . SER A 1 107 ? 62.125 2.500   -14.228 1.00 21.15 ? 104 SER A C     1 
ATOM   849  O  O     . SER A 1 107 ? 62.240 1.803   -15.226 1.00 18.33 ? 104 SER A O     1 
ATOM   850  C  CB    . SER A 1 107 ? 59.667 3.000   -14.080 1.00 23.35 ? 104 SER A CB    1 
ATOM   851  O  OG    . SER A 1 107 ? 58.458 2.504   -13.537 1.00 30.50 ? 104 SER A OG    1 
ATOM   852  N  N     . ARG A 1 108 ? 63.057 3.380   -13.858 1.00 19.95 ? 105 ARG A N     1 
ATOM   853  C  CA    . ARG A 1 108 ? 64.314 3.518   -14.609 1.00 20.75 ? 105 ARG A CA    1 
ATOM   854  C  C     . ARG A 1 108 ? 65.226 2.305   -14.400 1.00 24.33 ? 105 ARG A C     1 
ATOM   855  O  O     . ARG A 1 108 ? 66.068 1.994   -15.245 1.00 22.61 ? 105 ARG A O     1 
ATOM   856  C  CB    . ARG A 1 108 ? 65.092 4.784   -14.207 1.00 23.24 ? 105 ARG A CB    1 
ATOM   857  C  CG    . ARG A 1 108 ? 64.358 6.097   -14.419 1.00 25.91 ? 105 ARG A CG    1 
ATOM   858  C  CD    . ARG A 1 108 ? 65.334 7.252   -14.582 1.00 28.81 ? 105 ARG A CD    1 
ATOM   859  N  NE    . ARG A 1 108 ? 66.290 7.330   -13.485 1.00 31.60 ? 105 ARG A NE    1 
ATOM   860  C  CZ    . ARG A 1 108 ? 66.201 8.193   -12.477 1.00 29.20 ? 105 ARG A CZ    1 
ATOM   861  N  NH1   . ARG A 1 108 ? 67.116 8.183   -11.525 1.00 26.55 ? 105 ARG A NH1   1 
ATOM   862  N  NH2   . ARG A 1 108 ? 65.199 9.064   -12.420 1.00 24.16 ? 105 ARG A NH2   1 
ATOM   863  N  N     . PHE A 1 109 ? 65.062 1.628   -13.269 1.00 20.59 ? 106 PHE A N     1 
ATOM   864  C  CA    . PHE A 1 109 ? 65.926 0.498   -12.928 1.00 22.12 ? 106 PHE A CA    1 
ATOM   865  C  C     . PHE A 1 109 ? 65.384 -0.835  -13.417 1.00 25.66 ? 106 PHE A C     1 
ATOM   866  O  O     . PHE A 1 109 ? 66.155 -1.724  -13.786 1.00 28.10 ? 106 PHE A O     1 
ATOM   867  C  CB    . PHE A 1 109 ? 66.158 0.439   -11.421 1.00 19.32 ? 106 PHE A CB    1 
ATOM   868  C  CG    . PHE A 1 109 ? 66.865 1.640   -10.876 1.00 24.12 ? 106 PHE A CG    1 
ATOM   869  C  CD1   . PHE A 1 109 ? 66.184 2.839   -10.696 1.00 16.03 ? 106 PHE A CD1   1 
ATOM   870  C  CD2   . PHE A 1 109 ? 68.209 1.575   -10.538 1.00 19.94 ? 106 PHE A CD2   1 
ATOM   871  C  CE1   . PHE A 1 109 ? 66.833 3.948   -10.192 1.00 18.66 ? 106 PHE A CE1   1 
ATOM   872  C  CE2   . PHE A 1 109 ? 68.868 2.682   -10.034 1.00 22.64 ? 106 PHE A CE2   1 
ATOM   873  C  CZ    . PHE A 1 109 ? 68.184 3.871   -9.857  1.00 22.29 ? 106 PHE A CZ    1 
ATOM   874  N  N     . ALA A 1 110 ? 64.063 -0.975  -13.419 1.00 23.66 ? 107 ALA A N     1 
ATOM   875  C  CA    . ALA A 1 110 ? 63.442 -2.253  -13.741 1.00 25.45 ? 107 ALA A CA    1 
ATOM   876  C  C     . ALA A 1 110 ? 61.934 -2.155  -13.856 1.00 27.42 ? 107 ALA A C     1 
ATOM   877  O  O     . ALA A 1 110 ? 61.321 -1.190  -13.398 1.00 31.45 ? 107 ALA A O     1 
ATOM   878  C  CB    . ALA A 1 110 ? 63.798 -3.292  -12.689 1.00 25.92 ? 107 ALA A CB    1 
ATOM   879  N  N     . VAL A 1 111 ? 61.352 -3.177  -14.475 1.00 32.06 ? 108 VAL A N     1 
ATOM   880  C  CA    . VAL A 1 111 ? 59.911 -3.374  -14.511 1.00 36.28 ? 108 VAL A CA    1 
ATOM   881  C  C     . VAL A 1 111 ? 59.354 -3.414  -13.094 1.00 28.79 ? 108 VAL A C     1 
ATOM   882  O  O     . VAL A 1 111 ? 59.861 -4.164  -12.247 1.00 30.75 ? 108 VAL A O     1 
ATOM   883  C  CB    . VAL A 1 111 ? 59.573 -4.712  -15.189 1.00 35.38 ? 108 VAL A CB    1 
ATOM   884  C  CG1   . VAL A 1 111 ? 58.175 -5.187  -14.787 1.00 34.84 ? 108 VAL A CG1   1 
ATOM   885  C  CG2   . VAL A 1 111 ? 59.713 -4.588  -16.698 1.00 45.88 ? 108 VAL A CG2   1 
ATOM   886  N  N     . ILE A 1 112 ? 58.324 -2.610  -12.832 1.00 28.31 ? 109 ILE A N     1 
ATOM   887  C  CA    . ILE A 1 112 ? 57.710 -2.587  -11.502 1.00 25.08 ? 109 ILE A CA    1 
ATOM   888  C  C     . ILE A 1 112 ? 56.231 -2.965  -11.507 1.00 19.66 ? 109 ILE A C     1 
ATOM   889  O  O     . ILE A 1 112 ? 55.523 -2.801  -12.520 1.00 17.22 ? 109 ILE A O     1 
ATOM   890  C  CB    . ILE A 1 112 ? 57.896 -1.212  -10.787 1.00 25.09 ? 109 ILE A CB    1 
ATOM   891  C  CG1   . ILE A 1 112 ? 56.897 -0.180  -11.305 1.00 27.30 ? 109 ILE A CG1   1 
ATOM   892  C  CG2   . ILE A 1 112 ? 59.334 -0.728  -10.923 1.00 21.34 ? 109 ILE A CG2   1 
ATOM   893  C  CD1   . ILE A 1 112 ? 56.962 1.162   -10.586 1.00 31.65 ? 109 ILE A CD1   1 
ATOM   894  N  N     . GLU A 1 113 ? 55.788 -3.516  -10.378 1.00 15.55 ? 110 GLU A N     1 
ATOM   895  C  CA    . GLU A 1 113 ? 54.374 -3.740  -10.107 1.00 20.91 ? 110 GLU A CA    1 
ATOM   896  C  C     . GLU A 1 113 ? 53.931 -2.812  -8.990  1.00 16.91 ? 110 GLU A C     1 
ATOM   897  O  O     . GLU A 1 113 ? 54.403 -2.919  -7.855  1.00 15.65 ? 110 GLU A O     1 
ATOM   898  C  CB    . GLU A 1 113 ? 54.088 -5.200  -9.702  1.00 19.46 ? 110 GLU A CB    1 
ATOM   899  C  CG    . GLU A 1 113 ? 52.643 -5.433  -9.292  1.00 16.18 ? 110 GLU A CG    1 
ATOM   900  C  CD    . GLU A 1 113 ? 52.365 -6.860  -8.822  1.00 26.95 ? 110 GLU A CD    1 
ATOM   901  O  OE1   . GLU A 1 113 ? 51.303 -7.087  -8.203  1.00 31.17 ? 110 GLU A OE1   1 
ATOM   902  O  OE2   . GLU A 1 113 ? 53.197 -7.757  -9.073  1.00 18.52 ? 110 GLU A OE2   1 
ATOM   903  N  N     . ARG A 1 114 ? 53.025 -1.897  -9.307  1.00 19.68 ? 111 ARG A N     1 
ATOM   904  C  CA    . ARG A 1 114 ? 52.492 -0.983  -8.299  1.00 19.74 ? 111 ARG A CA    1 
ATOM   905  C  C     . ARG A 1 114 ? 51.576 -1.779  -7.375  1.00 20.24 ? 111 ARG A C     1 
ATOM   906  O  O     . ARG A 1 114 ? 50.541 -2.273  -7.810  1.00 22.15 ? 111 ARG A O     1 
ATOM   907  C  CB    . ARG A 1 114 ? 51.699 0.148   -8.973  1.00 22.86 ? 111 ARG A CB    1 
ATOM   908  C  CG    . ARG A 1 114 ? 51.280 1.300   -8.031  1.00 24.40 ? 111 ARG A CG    1 
ATOM   909  C  CD    . ARG A 1 114 ? 49.965 1.922   -8.497  1.00 26.81 ? 111 ARG A CD    1 
ATOM   910  N  NE    . ARG A 1 114 ? 49.649 3.192   -7.842  1.00 29.55 ? 111 ARG A NE    1 
ATOM   911  C  CZ    . ARG A 1 114 ? 48.709 3.355   -6.911  1.00 31.36 ? 111 ARG A CZ    1 
ATOM   912  N  NH1   . ARG A 1 114 ? 47.979 2.320   -6.496  1.00 31.12 ? 111 ARG A NH1   1 
ATOM   913  N  NH2   . ARG A 1 114 ? 48.501 4.562   -6.387  1.00 27.95 ? 111 ARG A NH2   1 
ATOM   914  N  N     . ALA A 1 115 ? 51.951 -1.908  -6.104  1.00 17.94 ? 112 ALA A N     1 
ATOM   915  C  CA    . ALA A 1 115 ? 51.176 -2.712  -5.170  1.00 17.92 ? 112 ALA A CA    1 
ATOM   916  C  C     . ALA A 1 115 ? 50.279 -1.861  -4.271  1.00 19.99 ? 112 ALA A C     1 
ATOM   917  O  O     . ALA A 1 115 ? 49.322 -2.361  -3.691  1.00 20.23 ? 112 ALA A O     1 
ATOM   918  C  CB    . ALA A 1 115 ? 52.091 -3.575  -4.315  1.00 19.49 ? 112 ALA A CB    1 
ATOM   919  N  N     . SER A 1 116 ? 50.607 -0.585  -4.140  1.00 15.20 ? 113 SER A N     1 
ATOM   920  C  CA    . SER A 1 116 ? 49.781 0.337   -3.360  1.00 16.25 ? 113 SER A CA    1 
ATOM   921  C  C     . SER A 1 116 ? 50.228 1.751   -3.680  1.00 17.85 ? 113 SER A C     1 
ATOM   922  O  O     . SER A 1 116 ? 51.149 1.931   -4.464  1.00 17.81 ? 113 SER A O     1 
ATOM   923  C  CB    . SER A 1 116 ? 49.944 0.064   -1.863  1.00 21.42 ? 113 SER A CB    1 
ATOM   924  O  OG    A SER A 1 116 ? 51.212 0.495   -1.400  0.50 17.45 ? 113 SER A OG    1 
ATOM   925  O  OG    B SER A 1 116 ? 49.222 1.000   -1.081  0.50 20.28 ? 113 SER A OG    1 
ATOM   926  N  N     . ILE A 1 117 ? 49.602 2.753   -3.062  1.00 14.72 ? 114 ILE A N     1 
ATOM   927  C  CA    . ILE A 1 117 ? 50.000 4.137   -3.320  1.00 16.05 ? 114 ILE A CA    1 
ATOM   928  C  C     . ILE A 1 117 ? 51.493 4.375   -3.055  1.00 17.82 ? 114 ILE A C     1 
ATOM   929  O  O     . ILE A 1 117 ? 52.115 5.264   -3.662  1.00 16.75 ? 114 ILE A O     1 
ATOM   930  C  CB    . ILE A 1 117 ? 49.155 5.146   -2.486  1.00 15.89 ? 114 ILE A CB    1 
ATOM   931  C  CG1   . ILE A 1 117 ? 49.331 6.570   -3.020  1.00 20.21 ? 114 ILE A CG1   1 
ATOM   932  C  CG2   . ILE A 1 117 ? 49.508 5.071   -1.006  1.00 18.35 ? 114 ILE A CG2   1 
ATOM   933  C  CD1   . ILE A 1 117 ? 48.213 7.511   -2.575  1.00 27.22 ? 114 ILE A CD1   1 
ATOM   934  N  N     . ASP A 1 118 ? 52.082 3.602   -2.147  1.00 14.87 ? 115 ASP A N     1 
ATOM   935  C  CA    . ASP A 1 118 ? 53.471 3.881   -1.800  1.00 19.77 ? 115 ASP A CA    1 
ATOM   936  C  C     . ASP A 1 118 ? 54.435 2.685   -1.850  1.00 22.64 ? 115 ASP A C     1 
ATOM   937  O  O     . ASP A 1 118 ? 55.541 2.755   -1.293  1.00 18.81 ? 115 ASP A O     1 
ATOM   938  C  CB    . ASP A 1 118 ? 53.538 4.535   -0.425  1.00 17.66 ? 115 ASP A CB    1 
ATOM   939  C  CG    . ASP A 1 118 ? 53.524 3.529   0.682   1.00 17.57 ? 115 ASP A CG    1 
ATOM   940  O  OD1   . ASP A 1 118 ? 54.181 3.804   1.694   1.00 17.12 ? 115 ASP A OD1   1 
ATOM   941  O  OD2   . ASP A 1 118 ? 52.879 2.459   0.544   1.00 20.02 ? 115 ASP A OD2   1 
ATOM   942  N  N     . GLU A 1 119 ? 54.043 1.601   -2.513  1.00 19.70 ? 116 GLU A N     1 
ATOM   943  C  CA    A GLU A 1 119 ? 54.858 0.381   -2.591  0.30 18.79 ? 116 GLU A CA    1 
ATOM   944  C  CA    B GLU A 1 119 ? 54.979 0.497   -2.653  0.70 18.65 ? 116 GLU A CA    1 
ATOM   945  C  C     . GLU A 1 119 ? 54.932 -0.166  -4.019  1.00 18.80 ? 116 GLU A C     1 
ATOM   946  O  O     . GLU A 1 119 ? 53.927 -0.124  -4.739  1.00 14.85 ? 116 GLU A O     1 
ATOM   947  C  CB    A GLU A 1 119 ? 54.256 -0.740  -1.726  0.30 20.72 ? 116 GLU A CB    1 
ATOM   948  C  CB    B GLU A 1 119 ? 54.816 -0.529  -1.530  0.70 21.66 ? 116 GLU A CB    1 
ATOM   949  C  CG    A GLU A 1 119 ? 53.877 -0.396  -0.298  0.30 23.72 ? 116 GLU A CG    1 
ATOM   950  C  CG    B GLU A 1 119 ? 53.611 -1.405  -1.676  0.70 21.33 ? 116 GLU A CG    1 
ATOM   951  C  CD    A GLU A 1 119 ? 53.353 -1.614  0.446   0.30 26.87 ? 116 GLU A CD    1 
ATOM   952  C  CD    B GLU A 1 119 ? 53.154 -1.960  -0.352  0.70 30.04 ? 116 GLU A CD    1 
ATOM   953  O  OE1   A GLU A 1 119 ? 53.603 -2.745  -0.027  0.30 32.64 ? 116 GLU A OE1   1 
ATOM   954  O  OE1   B GLU A 1 119 ? 52.338 -1.290  0.312   0.70 26.77 ? 116 GLU A OE1   1 
ATOM   955  O  OE2   A GLU A 1 119 ? 52.688 -1.455  1.491   0.30 28.14 ? 116 GLU A OE2   1 
ATOM   956  O  OE2   B GLU A 1 119 ? 53.605 -3.063  0.027   0.70 34.07 ? 116 GLU A OE2   1 
ATOM   957  N  N     . ALA A 1 120 ? 56.071 -0.748  -4.380  1.00 14.96 ? 117 ALA A N     1 
ATOM   958  C  CA    . ALA A 1 120 ? 56.216 -1.419  -5.660  1.00 13.98 ? 117 ALA A CA    1 
ATOM   959  C  C     . ALA A 1 120 ? 57.140 -2.625  -5.554  1.00 16.12 ? 117 ALA A C     1 
ATOM   960  O  O     . ALA A 1 120 ? 58.166 -2.566  -4.885  1.00 14.61 ? 117 ALA A O     1 
ATOM   961  C  CB    . ALA A 1 120 ? 56.755 -0.455  -6.711  1.00 16.44 ? 117 ALA A CB    1 
ATOM   962  N  N     . TYR A 1 121 ? 56.790 -3.708  -6.245  1.00 15.64 ? 118 TYR A N     1 
ATOM   963  C  CA    . TYR A 1 121 ? 57.720 -4.820  -6.415  1.00 12.35 ? 118 TYR A CA    1 
ATOM   964  C  C     . TYR A 1 121 ? 58.554 -4.600  -7.651  1.00 17.79 ? 118 TYR A C     1 
ATOM   965  O  O     . TYR A 1 121 ? 58.114 -3.941  -8.588  1.00 16.29 ? 118 TYR A O     1 
ATOM   966  C  CB    . TYR A 1 121 ? 56.963 -6.138  -6.547  1.00 12.49 ? 118 TYR A CB    1 
ATOM   967  C  CG    . TYR A 1 121 ? 56.212 -6.513  -5.287  1.00 12.64 ? 118 TYR A CG    1 
ATOM   968  C  CD1   . TYR A 1 121 ? 54.885 -6.147  -5.108  1.00 20.01 ? 118 TYR A CD1   1 
ATOM   969  C  CD2   . TYR A 1 121 ? 56.849 -7.211  -4.261  1.00 14.41 ? 118 TYR A CD2   1 
ATOM   970  C  CE1   . TYR A 1 121 ? 54.197 -6.482  -3.944  1.00 18.77 ? 118 TYR A CE1   1 
ATOM   971  C  CE2   . TYR A 1 121 ? 56.168 -7.564  -3.105  1.00 17.20 ? 118 TYR A CE2   1 
ATOM   972  C  CZ    . TYR A 1 121 ? 54.847 -7.192  -2.949  1.00 25.04 ? 118 TYR A CZ    1 
ATOM   973  O  OH    . TYR A 1 121 ? 54.179 -7.543  -1.797  1.00 24.55 ? 118 TYR A OH    1 
ATOM   974  N  N     . VAL A 1 122 ? 59.747 -5.188  -7.649  1.00 15.18 ? 119 VAL A N     1 
ATOM   975  C  CA    . VAL A 1 122 ? 60.723 -5.006  -8.704  1.00 15.72 ? 119 VAL A CA    1 
ATOM   976  C  C     . VAL A 1 122 ? 61.272 -6.377  -9.024  1.00 16.61 ? 119 VAL A C     1 
ATOM   977  O  O     . VAL A 1 122 ? 61.704 -7.066  -8.118  1.00 16.70 ? 119 VAL A O     1 
ATOM   978  C  CB    . VAL A 1 122 ? 61.906 -4.143  -8.184  1.00 22.13 ? 119 VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 122 ? 62.719 -3.622  -9.334  1.00 29.43 ? 119 VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 122 ? 61.394 -2.985  -7.328  1.00 28.17 ? 119 VAL A CG2   1 
ATOM   981  N  N     . ASP A 1 123 ? 61.258 -6.791  -10.290 1.00 19.38 ? 120 ASP A N     1 
ATOM   982  C  CA    . ASP A 1 123 ? 61.968 -8.016  -10.667 1.00 19.22 ? 120 ASP A CA    1 
ATOM   983  C  C     . ASP A 1 123 ? 63.372 -7.649  -11.149 1.00 20.40 ? 120 ASP A C     1 
ATOM   984  O  O     . ASP A 1 123 ? 63.550 -7.092  -12.234 1.00 21.15 ? 120 ASP A O     1 
ATOM   985  C  CB    . ASP A 1 123 ? 61.194 -8.827  -11.717 1.00 24.58 ? 120 ASP A CB    1 
ATOM   986  C  CG    . ASP A 1 123 ? 61.767 -10.232 -11.922 1.00 30.72 ? 120 ASP A CG    1 
ATOM   987  O  OD1   . ASP A 1 123 ? 62.999 -10.376 -12.031 1.00 23.23 ? 120 ASP A OD1   1 
ATOM   988  O  OD2   . ASP A 1 123 ? 60.985 -11.208 -11.980 1.00 38.34 ? 120 ASP A OD2   1 
ATOM   989  N  N     . LEU A 1 124 ? 64.366 -7.958  -10.327 1.00 19.13 ? 121 LEU A N     1 
ATOM   990  C  CA    . LEU A 1 124 ? 65.749 -7.544  -10.574 1.00 16.93 ? 121 LEU A CA    1 
ATOM   991  C  C     . LEU A 1 124 ? 66.604 -8.635  -11.218 1.00 14.34 ? 121 LEU A C     1 
ATOM   992  O  O     . LEU A 1 124 ? 67.813 -8.459  -11.376 1.00 15.46 ? 121 LEU A O     1 
ATOM   993  C  CB    . LEU A 1 124 ? 66.407 -7.117  -9.255  1.00 16.63 ? 121 LEU A CB    1 
ATOM   994  C  CG    . LEU A 1 124 ? 65.833 -5.866  -8.582  1.00 18.78 ? 121 LEU A CG    1 
ATOM   995  C  CD1   . LEU A 1 124 ? 66.350 -5.723  -7.168  1.00 25.52 ? 121 LEU A CD1   1 
ATOM   996  C  CD2   . LEU A 1 124 ? 66.163 -4.624  -9.412  1.00 22.27 ? 121 LEU A CD2   1 
ATOM   997  N  N     . THR A 1 125 ? 65.987 -9.763  -11.569 1.00 16.60 ? 122 THR A N     1 
ATOM   998  C  CA    . THR A 1 125 ? 66.760 -10.902 -12.053 1.00 18.68 ? 122 THR A CA    1 
ATOM   999  C  C     . THR A 1 125 ? 67.703 -10.512 -13.198 1.00 23.04 ? 122 THR A C     1 
ATOM   1000 O  O     . THR A 1 125 ? 68.905 -10.789 -13.143 1.00 21.37 ? 122 THR A O     1 
ATOM   1001 C  CB    . THR A 1 125 ? 65.847 -12.059 -12.478 1.00 19.55 ? 122 THR A CB    1 
ATOM   1002 O  OG1   . THR A 1 125 ? 64.947 -12.350 -11.411 1.00 18.92 ? 122 THR A OG1   1 
ATOM   1003 C  CG2   . THR A 1 125 ? 66.663 -13.317 -12.800 1.00 20.69 ? 122 THR A CG2   1 
ATOM   1004 N  N     A SER A 1 126 ? 67.161 -9.861  -14.223 0.50 21.97 ? 123 SER A N     1 
ATOM   1005 N  N     B SER A 1 126 ? 67.161 -9.855  -14.219 0.50 21.97 ? 123 SER A N     1 
ATOM   1006 C  CA    A SER A 1 126 ? 67.961 -9.489  -15.389 0.50 22.22 ? 123 SER A CA    1 
ATOM   1007 C  CA    B SER A 1 126 ? 67.956 -9.491  -15.391 0.50 22.22 ? 123 SER A CA    1 
ATOM   1008 C  C     A SER A 1 126 ? 69.010 -8.420  -15.073 0.50 22.75 ? 123 SER A C     1 
ATOM   1009 C  C     B SER A 1 126 ? 69.002 -8.412  -15.089 0.50 22.75 ? 123 SER A C     1 
ATOM   1010 O  O     A SER A 1 126 ? 70.151 -8.507  -15.523 0.50 23.98 ? 123 SER A O     1 
ATOM   1011 O  O     B SER A 1 126 ? 70.134 -8.487  -15.561 0.50 23.98 ? 123 SER A O     1 
ATOM   1012 C  CB    A SER A 1 126 ? 67.066 -9.026  -16.536 0.50 24.61 ? 123 SER A CB    1 
ATOM   1013 C  CB    B SER A 1 126 ? 67.051 -9.049  -16.540 0.50 24.61 ? 123 SER A CB    1 
ATOM   1014 O  OG    A SER A 1 126 ? 66.291 -10.099 -17.035 0.50 24.12 ? 123 SER A OG    1 
ATOM   1015 O  OG    B SER A 1 126 ? 66.243 -7.951  -16.158 0.50 25.25 ? 123 SER A OG    1 
ATOM   1016 N  N     . ALA A 1 127 ? 68.617 -7.409  -14.310 1.00 20.16 ? 124 ALA A N     1 
ATOM   1017 C  CA    . ALA A 1 127 ? 69.549 -6.364  -13.905 1.00 21.87 ? 124 ALA A CA    1 
ATOM   1018 C  C     . ALA A 1 127 ? 70.730 -6.949  -13.125 1.00 24.15 ? 124 ALA A C     1 
ATOM   1019 O  O     . ALA A 1 127 ? 71.867 -6.506  -13.289 1.00 20.77 ? 124 ALA A O     1 
ATOM   1020 C  CB    . ALA A 1 127 ? 68.831 -5.280  -13.092 1.00 17.84 ? 124 ALA A CB    1 
ATOM   1021 N  N     . VAL A 1 128 ? 70.460 -7.949  -12.282 1.00 18.45 ? 125 VAL A N     1 
ATOM   1022 C  CA    . VAL A 1 128 ? 71.511 -8.626  -11.523 1.00 19.91 ? 125 VAL A CA    1 
ATOM   1023 C  C     . VAL A 1 128 ? 72.525 -9.343  -12.420 1.00 21.70 ? 125 VAL A C     1 
ATOM   1024 O  O     . VAL A 1 128 ? 73.727 -9.184  -12.233 1.00 21.94 ? 125 VAL A O     1 
ATOM   1025 C  CB    . VAL A 1 128 ? 70.928 -9.625  -10.482 1.00 20.78 ? 125 VAL A CB    1 
ATOM   1026 C  CG1   . VAL A 1 128 ? 71.989 -10.626 -10.037 1.00 17.42 ? 125 VAL A CG1   1 
ATOM   1027 C  CG2   . VAL A 1 128 ? 70.381 -8.864  -9.287  1.00 17.01 ? 125 VAL A CG2   1 
ATOM   1028 N  N     . GLN A 1 129 ? 72.038 -10.119 -13.387 1.00 22.27 ? 126 GLN A N     1 
ATOM   1029 C  CA    . GLN A 1 129 ? 72.910 -10.770 -14.365 1.00 30.15 ? 126 GLN A CA    1 
ATOM   1030 C  C     . GLN A 1 129 ? 73.839 -9.762  -15.041 1.00 32.75 ? 126 GLN A C     1 
ATOM   1031 O  O     . GLN A 1 129 ? 75.036 -10.000 -15.177 1.00 31.78 ? 126 GLN A O     1 
ATOM   1032 C  CB    . GLN A 1 129 ? 72.088 -11.502 -15.429 1.00 28.59 ? 126 GLN A CB    1 
ATOM   1033 C  CG    . GLN A 1 129 ? 71.236 -12.648 -14.900 1.00 36.33 ? 126 GLN A CG    1 
ATOM   1034 C  CD    . GLN A 1 129 ? 72.068 -13.793 -14.344 1.00 54.97 ? 126 GLN A CD    1 
ATOM   1035 O  OE1   . GLN A 1 129 ? 72.076 -14.043 -13.137 1.00 55.63 ? 126 GLN A OE1   1 
ATOM   1036 N  NE2   . GLN A 1 129 ? 72.771 -14.499 -15.225 1.00 60.12 ? 126 GLN A NE2   1 
ATOM   1037 N  N     . GLU A 1 130 ? 73.281 -8.627  -15.455 1.00 29.50 ? 127 GLU A N     1 
ATOM   1038 C  CA    . GLU A 1 130 ? 74.065 -7.592  -16.119 1.00 33.10 ? 127 GLU A CA    1 
ATOM   1039 C  C     . GLU A 1 130 ? 75.151 -7.016  -15.217 1.00 36.96 ? 127 GLU A C     1 
ATOM   1040 O  O     . GLU A 1 130 ? 76.283 -6.792  -15.654 1.00 39.90 ? 127 GLU A O     1 
ATOM   1041 C  CB    . GLU A 1 130 ? 73.160 -6.458  -16.597 1.00 39.99 ? 127 GLU A CB    1 
ATOM   1042 C  CG    . GLU A 1 130 ? 72.243 -6.828  -17.739 1.00 38.74 ? 127 GLU A CG    1 
ATOM   1043 C  CD    . GLU A 1 130 ? 71.457 -5.629  -18.241 1.00 69.73 ? 127 GLU A CD    1 
ATOM   1044 O  OE1   . GLU A 1 130 ? 71.771 -4.492  -17.820 1.00 68.78 ? 127 GLU A OE1   1 
ATOM   1045 O  OE2   . GLU A 1 130 ? 70.524 -5.823  -19.051 1.00 76.80 ? 127 GLU A OE2   1 
ATOM   1046 N  N     . ARG A 1 131 ? 74.800 -6.753  -13.964 1.00 23.69 ? 128 ARG A N     1 
ATOM   1047 C  CA    . ARG A 1 131 ? 75.758 -6.186  -13.033 1.00 28.69 ? 128 ARG A CA    1 
ATOM   1048 C  C     . ARG A 1 131 ? 76.835 -7.223  -12.732 1.00 27.95 ? 128 ARG A C     1 
ATOM   1049 O  O     . ARG A 1 131 ? 78.009 -6.880  -12.573 1.00 31.26 ? 128 ARG A O     1 
ATOM   1050 C  CB    . ARG A 1 131 ? 75.055 -5.708  -11.759 1.00 23.26 ? 128 ARG A CB    1 
ATOM   1051 C  CG    A ARG A 1 131 ? 75.936 -4.945  -10.772 0.50 27.59 ? 128 ARG A CG    1 
ATOM   1052 C  CG    B ARG A 1 131 ? 75.974 -4.987  -10.780 0.50 27.60 ? 128 ARG A CG    1 
ATOM   1053 C  CD    A ARG A 1 131 ? 76.372 -3.585  -11.311 0.50 29.53 ? 128 ARG A CD    1 
ATOM   1054 C  CD    B ARG A 1 131 ? 76.588 -3.744  -11.417 0.50 30.01 ? 128 ARG A CD    1 
ATOM   1055 N  NE    A ARG A 1 131 ? 77.113 -2.837  -10.301 0.50 29.19 ? 128 ARG A NE    1 
ATOM   1056 N  NE    B ARG A 1 131 ? 75.560 -2.774  -11.772 0.50 22.60 ? 128 ARG A NE    1 
ATOM   1057 C  CZ    A ARG A 1 131 ? 76.553 -1.987  -9.444  0.50 27.68 ? 128 ARG A CZ    1 
ATOM   1058 C  CZ    B ARG A 1 131 ? 75.081 -1.868  -10.927 0.50 27.31 ? 128 ARG A CZ    1 
ATOM   1059 N  NH1   A ARG A 1 131 ? 77.295 -1.350  -8.546  0.50 20.13 ? 128 ARG A NH1   1 
ATOM   1060 N  NH1   B ARG A 1 131 ? 74.139 -1.021  -11.316 0.50 32.37 ? 128 ARG A NH1   1 
ATOM   1061 N  NH2   A ARG A 1 131 ? 75.247 -1.772  -9.492  0.50 30.91 ? 128 ARG A NH2   1 
ATOM   1062 N  NH2   B ARG A 1 131 ? 75.550 -1.809  -9.689  0.50 30.00 ? 128 ARG A NH2   1 
ATOM   1063 N  N     . LEU A 1 132 ? 76.439 -8.494  -12.676 1.00 32.55 ? 129 LEU A N     1 
ATOM   1064 C  CA    . LEU A 1 132 ? 77.391 -9.581  -12.436 1.00 29.95 ? 129 LEU A CA    1 
ATOM   1065 C  C     . LEU A 1 132 ? 78.453 -9.662  -13.526 1.00 45.08 ? 129 LEU A C     1 
ATOM   1066 O  O     . LEU A 1 132 ? 79.604 -9.997  -13.247 1.00 38.02 ? 129 LEU A O     1 
ATOM   1067 C  CB    . LEU A 1 132 ? 76.678 -10.929 -12.285 1.00 30.87 ? 129 LEU A CB    1 
ATOM   1068 C  CG    . LEU A 1 132 ? 76.210 -11.215 -10.848 1.00 31.30 ? 129 LEU A CG    1 
ATOM   1069 C  CD1   . LEU A 1 132 ? 75.325 -12.457 -10.759 1.00 25.43 ? 129 LEU A CD1   1 
ATOM   1070 C  CD2   . LEU A 1 132 ? 77.403 -11.338 -9.910  1.00 29.15 ? 129 LEU A CD2   1 
ATOM   1071 N  N     . GLN A 1 133 ? 78.060 -9.355  -14.760 1.00 44.23 ? 130 GLN A N     1 
ATOM   1072 C  CA    . GLN A 1 133 ? 79.000 -9.315  -15.880 1.00 44.61 ? 130 GLN A CA    1 
ATOM   1073 C  C     . GLN A 1 133 ? 80.009 -8.184  -15.717 1.00 47.75 ? 130 GLN A C     1 
ATOM   1074 O  O     . GLN A 1 133 ? 81.208 -8.396  -15.867 1.00 55.35 ? 130 GLN A O     1 
ATOM   1075 C  CB    . GLN A 1 133 ? 78.259 -9.157  -17.209 1.00 46.92 ? 130 GLN A CB    1 
ATOM   1076 C  CG    . GLN A 1 133 ? 77.191 -10.216 -17.463 1.00 55.26 ? 130 GLN A CG    1 
ATOM   1077 C  CD    . GLN A 1 133 ? 77.755 -11.622 -17.536 1.00 66.70 ? 130 GLN A CD    1 
ATOM   1078 O  OE1   . GLN A 1 133 ? 78.972 -11.822 -17.498 1.00 69.00 ? 130 GLN A OE1   1 
ATOM   1079 N  NE2   . GLN A 1 133 ? 76.867 -12.608 -17.647 1.00 63.42 ? 130 GLN A NE2   1 
ATOM   1080 N  N     . LYS A 1 134 ? 79.526 -6.984  -15.406 1.00 49.29 ? 131 LYS A N     1 
ATOM   1081 C  CA    . LYS A 1 134 ? 80.417 -5.837  -15.223 1.00 48.36 ? 131 LYS A CA    1 
ATOM   1082 C  C     . LYS A 1 134 ? 81.452 -6.098  -14.137 1.00 57.49 ? 131 LYS A C     1 
ATOM   1083 O  O     . LYS A 1 134 ? 82.632 -5.797  -14.313 1.00 61.99 ? 131 LYS A O     1 
ATOM   1084 C  CB    . LYS A 1 134 ? 79.631 -4.564  -14.891 1.00 52.34 ? 131 LYS A CB    1 
ATOM   1085 C  CG    . LYS A 1 134 ? 78.852 -3.984  -16.061 1.00 54.22 ? 131 LYS A CG    1 
ATOM   1086 C  CD    . LYS A 1 134 ? 78.449 -2.534  -15.800 1.00 58.64 ? 131 LYS A CD    1 
ATOM   1087 C  CE    . LYS A 1 134 ? 77.556 -2.400  -14.569 1.00 55.31 ? 131 LYS A CE    1 
ATOM   1088 N  NZ    . LYS A 1 134 ? 76.964 -1.029  -14.443 1.00 50.75 ? 131 LYS A NZ    1 
ATOM   1089 N  N     . LEU A 1 135 ? 81.004 -6.652  -13.014 1.00 54.94 ? 132 LEU A N     1 
ATOM   1090 C  CA    . LEU A 1 135 ? 81.887 -6.917  -11.882 1.00 57.29 ? 132 LEU A CA    1 
ATOM   1091 C  C     . LEU A 1 135 ? 83.060 -7.813  -12.266 1.00 66.32 ? 132 LEU A C     1 
ATOM   1092 O  O     . LEU A 1 135 ? 84.208 -7.541  -11.905 1.00 68.42 ? 132 LEU A O     1 
ATOM   1093 C  CB    . LEU A 1 135 ? 81.104 -7.545  -10.727 1.00 58.65 ? 132 LEU A CB    1 
ATOM   1094 C  CG    . LEU A 1 135 ? 80.636 -6.574  -9.641  1.00 54.34 ? 132 LEU A CG    1 
ATOM   1095 C  CD1   . LEU A 1 135 ? 80.287 -5.214  -10.238 1.00 53.76 ? 132 LEU A CD1   1 
ATOM   1096 C  CD2   . LEU A 1 135 ? 79.459 -7.156  -8.872  1.00 46.63 ? 132 LEU A CD2   1 
ATOM   1097 N  N     . GLN A 1 136 ? 82.759 -8.881  -12.998 1.00 65.82 ? 133 GLN A N     1 
ATOM   1098 C  CA    . GLN A 1 136 ? 83.768 -9.848  -13.419 1.00 67.36 ? 133 GLN A CA    1 
ATOM   1099 C  C     . GLN A 1 136 ? 84.536 -10.444 -12.242 1.00 66.73 ? 133 GLN A C     1 
ATOM   1100 O  O     . GLN A 1 136 ? 85.724 -10.174 -12.069 1.00 61.34 ? 133 GLN A O     1 
ATOM   1101 C  CB    . GLN A 1 136 ? 84.740 -9.224  -14.426 1.00 66.41 ? 133 GLN A CB    1 
ATOM   1102 C  CG    . GLN A 1 136 ? 84.114 -8.854  -15.772 1.00 70.99 ? 133 GLN A CG    1 
ATOM   1103 C  CD    . GLN A 1 136 ? 83.496 -10.047 -16.506 1.00 78.33 ? 133 GLN A CD    1 
ATOM   1104 O  OE1   . GLN A 1 136 ? 82.703 -10.806 -15.940 1.00 73.14 ? 133 GLN A OE1   1 
ATOM   1105 N  NE2   . GLN A 1 136 ? 83.853 -10.206 -17.776 1.00 76.61 ? 133 GLN A NE2   1 
ATOM   1106 N  N     . GLY A 1 137 ? 83.846 -11.252 -11.440 1.00 62.40 ? 134 GLY A N     1 
ATOM   1107 C  CA    . GLY A 1 137 ? 84.474 -11.999 -10.362 1.00 58.66 ? 134 GLY A CA    1 
ATOM   1108 C  C     . GLY A 1 137 ? 84.947 -11.163 -9.189  1.00 58.45 ? 134 GLY A C     1 
ATOM   1109 O  O     . GLY A 1 137 ? 85.252 -11.696 -8.121  1.00 68.12 ? 134 GLY A O     1 
ATOM   1110 N  N     . GLN A 1 138 ? 85.012 -9.850  -9.388  1.00 51.75 ? 135 GLN A N     1 
ATOM   1111 C  CA    . GLN A 1 138 ? 85.429 -8.922  -8.344  1.00 55.06 ? 135 GLN A CA    1 
ATOM   1112 C  C     . GLN A 1 138 ? 84.458 -8.924  -7.160  1.00 54.98 ? 135 GLN A C     1 
ATOM   1113 O  O     . GLN A 1 138 ? 83.241 -8.842  -7.344  1.00 53.80 ? 135 GLN A O     1 
ATOM   1114 C  CB    . GLN A 1 138 ? 85.555 -7.518  -8.932  1.00 60.30 ? 135 GLN A CB    1 
ATOM   1115 C  CG    . GLN A 1 138 ? 85.630 -6.399  -7.917  1.00 60.71 ? 135 GLN A CG    1 
ATOM   1116 C  CD    . GLN A 1 138 ? 85.512 -5.038  -8.576  1.00 68.06 ? 135 GLN A CD    1 
ATOM   1117 O  OE1   . GLN A 1 138 ? 85.533 -4.931  -9.804  1.00 68.67 ? 135 GLN A OE1   1 
ATOM   1118 N  NE2   . GLN A 1 138 ? 85.379 -3.992  -7.767  1.00 57.86 ? 135 GLN A NE2   1 
ATOM   1119 N  N     . PRO A 1 139 ? 85.003 -9.008  -5.937  1.00 51.47 ? 136 PRO A N     1 
ATOM   1120 C  CA    . PRO A 1 139 ? 84.245 -9.114  -4.686  1.00 50.17 ? 136 PRO A CA    1 
ATOM   1121 C  C     . PRO A 1 139 ? 83.365 -7.897  -4.431  1.00 41.95 ? 136 PRO A C     1 
ATOM   1122 O  O     . PRO A 1 139 ? 83.573 -6.845  -5.026  1.00 39.02 ? 136 PRO A O     1 
ATOM   1123 C  CB    . PRO A 1 139 ? 85.345 -9.181  -3.624  1.00 48.41 ? 136 PRO A CB    1 
ATOM   1124 C  CG    . PRO A 1 139 ? 86.494 -8.477  -4.241  1.00 50.71 ? 136 PRO A CG    1 
ATOM   1125 C  CD    . PRO A 1 139 ? 86.447 -8.863  -5.687  1.00 56.16 ? 136 PRO A CD    1 
ATOM   1126 N  N     . ILE A 1 140 ? 82.390 -8.050  -3.543  1.00 42.69 ? 137 ILE A N     1 
ATOM   1127 C  CA    . ILE A 1 140 ? 81.475 -6.967  -3.214  1.00 34.79 ? 137 ILE A CA    1 
ATOM   1128 C  C     . ILE A 1 140 ? 81.843 -6.403  -1.858  1.00 27.95 ? 137 ILE A C     1 
ATOM   1129 O  O     . ILE A 1 140 ? 81.853 -7.121  -0.861  1.00 31.67 ? 137 ILE A O     1 
ATOM   1130 C  CB    . ILE A 1 140 ? 80.021 -7.464  -3.210  1.00 33.52 ? 137 ILE A CB    1 
ATOM   1131 C  CG1   . ILE A 1 140 ? 79.672 -8.030  -4.590  1.00 39.67 ? 137 ILE A CG1   1 
ATOM   1132 C  CG2   . ILE A 1 140 ? 79.063 -6.345  -2.819  1.00 24.02 ? 137 ILE A CG2   1 
ATOM   1133 C  CD1   . ILE A 1 140 ? 78.339 -8.723  -4.656  1.00 39.56 ? 137 ILE A CD1   1 
ATOM   1134 N  N     . SER A 1 141 ? 82.160 -5.115  -1.815  1.00 29.25 ? 138 SER A N     1 
ATOM   1135 C  CA    . SER A 1 141 ? 82.602 -4.504  -0.565  1.00 29.81 ? 138 SER A CA    1 
ATOM   1136 C  C     . SER A 1 141 ? 81.406 -4.027  0.263   1.00 24.94 ? 138 SER A C     1 
ATOM   1137 O  O     . SER A 1 141 ? 80.357 -3.682  -0.289  1.00 25.37 ? 138 SER A O     1 
ATOM   1138 C  CB    . SER A 1 141 ? 83.588 -3.357  -0.840  1.00 30.35 ? 138 SER A CB    1 
ATOM   1139 O  OG    . SER A 1 141 ? 83.010 -2.079  -0.613  1.00 37.43 ? 138 SER A OG    1 
ATOM   1140 N  N     . ALA A 1 142 ? 81.567 -4.006  1.583   1.00 22.04 ? 139 ALA A N     1 
ATOM   1141 C  CA    . ALA A 1 142 ? 80.492 -3.564  2.472   1.00 21.67 ? 139 ALA A CA    1 
ATOM   1142 C  C     . ALA A 1 142 ? 80.078 -2.116  2.197   1.00 25.71 ? 139 ALA A C     1 
ATOM   1143 O  O     . ALA A 1 142 ? 78.959 -1.706  2.524   1.00 22.91 ? 139 ALA A O     1 
ATOM   1144 C  CB    . ALA A 1 142 ? 80.896 -3.737  3.927   1.00 20.50 ? 139 ALA A CB    1 
ATOM   1145 N  N     . ASP A 1 143 ? 80.983 -1.349  1.597   1.00 28.11 ? 140 ASP A N     1 
ATOM   1146 C  CA    . ASP A 1 143 ? 80.712 0.047   1.298   1.00 30.72 ? 140 ASP A CA    1 
ATOM   1147 C  C     . ASP A 1 143 ? 79.590 0.200   0.288   1.00 29.84 ? 140 ASP A C     1 
ATOM   1148 O  O     . ASP A 1 143 ? 78.963 1.254   0.217   1.00 30.60 ? 140 ASP A O     1 
ATOM   1149 C  CB    . ASP A 1 143 ? 81.965 0.748   0.783   1.00 29.44 ? 140 ASP A CB    1 
ATOM   1150 C  CG    . ASP A 1 143 ? 83.052 0.843   1.840   1.00 49.08 ? 140 ASP A CG    1 
ATOM   1151 O  OD1   . ASP A 1 143 ? 82.763 0.549   3.022   1.00 44.99 ? 140 ASP A OD1   1 
ATOM   1152 O  OD2   . ASP A 1 143 ? 84.192 1.222   1.491   1.00 62.92 ? 140 ASP A OD2   1 
ATOM   1153 N  N     . LEU A 1 144 ? 79.347 -0.843  -0.500  1.00 20.14 ? 141 LEU A N     1 
ATOM   1154 C  CA    . LEU A 1 144 ? 78.262 -0.802  -1.466  1.00 24.47 ? 141 LEU A CA    1 
ATOM   1155 C  C     . LEU A 1 144 ? 76.912 -1.109  -0.816  1.00 21.26 ? 141 LEU A C     1 
ATOM   1156 O  O     . LEU A 1 144 ? 75.872 -0.955  -1.442  1.00 20.64 ? 141 LEU A O     1 
ATOM   1157 C  CB    . LEU A 1 144 ? 78.528 -1.762  -2.613  1.00 21.79 ? 141 LEU A CB    1 
ATOM   1158 C  CG    . LEU A 1 144 ? 79.783 -1.407  -3.407  1.00 22.96 ? 141 LEU A CG    1 
ATOM   1159 C  CD1   . LEU A 1 144 ? 79.934 -2.325  -4.589  1.00 31.28 ? 141 LEU A CD1   1 
ATOM   1160 C  CD2   . LEU A 1 144 ? 79.677 0.038   -3.853  1.00 33.40 ? 141 LEU A CD2   1 
ATOM   1161 N  N     . LEU A 1 145 ? 76.942 -1.537  0.439   1.00 20.04 ? 142 LEU A N     1 
ATOM   1162 C  CA    . LEU A 1 145 ? 75.730 -1.956  1.142   1.00 16.12 ? 142 LEU A CA    1 
ATOM   1163 C  C     . LEU A 1 145 ? 75.574 -1.207  2.472   1.00 20.78 ? 142 LEU A C     1 
ATOM   1164 O  O     . LEU A 1 145 ? 75.419 -1.811  3.533   1.00 19.32 ? 142 LEU A O     1 
ATOM   1165 C  CB    . LEU A 1 145 ? 75.776 -3.476  1.357   1.00 15.62 ? 142 LEU A CB    1 
ATOM   1166 C  CG    . LEU A 1 145 ? 75.731 -4.322  0.083   1.00 15.89 ? 142 LEU A CG    1 
ATOM   1167 C  CD1   . LEU A 1 145 ? 76.056 -5.804  0.346   1.00 18.89 ? 142 LEU A CD1   1 
ATOM   1168 C  CD2   . LEU A 1 145 ? 74.366 -4.207  -0.565  1.00 18.55 ? 142 LEU A CD2   1 
ATOM   1169 N  N     . PRO A 1 146 ? 75.607 0.133   2.418   1.00 24.42 ? 143 PRO A N     1 
ATOM   1170 C  CA    . PRO A 1 146 ? 75.676 0.924   3.654   1.00 23.66 ? 143 PRO A CA    1 
ATOM   1171 C  C     . PRO A 1 146 ? 74.427 0.918   4.537   1.00 22.39 ? 143 PRO A C     1 
ATOM   1172 O  O     . PRO A 1 146 ? 74.521 1.368   5.675   1.00 20.14 ? 143 PRO A O     1 
ATOM   1173 C  CB    . PRO A 1 146 ? 75.925 2.343   3.134   1.00 27.19 ? 143 PRO A CB    1 
ATOM   1174 C  CG    . PRO A 1 146 ? 75.299 2.350   1.779   1.00 25.49 ? 143 PRO A CG    1 
ATOM   1175 C  CD    . PRO A 1 146 ? 75.617 0.990   1.216   1.00 18.75 ? 143 PRO A CD    1 
ATOM   1176 N  N     . SER A 1 147 ? 73.285 0.442   4.044   1.00 20.49 ? 144 SER A N     1 
ATOM   1177 C  CA    . SER A 1 147 ? 72.084 0.435   4.877   1.00 17.07 ? 144 SER A CA    1 
ATOM   1178 C  C     . SER A 1 147 ? 71.371 -0.923  4.873   1.00 14.36 ? 144 SER A C     1 
ATOM   1179 O  O     . SER A 1 147 ? 70.181 -1.016  5.173   1.00 16.00 ? 144 SER A O     1 
ATOM   1180 C  CB    . SER A 1 147 ? 71.127 1.567   4.458   1.00 19.50 ? 144 SER A CB    1 
ATOM   1181 O  OG    . SER A 1 147 ? 70.635 1.367   3.147   1.00 18.24 ? 144 SER A OG    1 
ATOM   1182 N  N     . THR A 1 148 ? 72.133 -1.980  4.603   1.00 14.51 ? 145 THR A N     1 
ATOM   1183 C  CA    . THR A 1 148 ? 71.588 -3.319  4.416   1.00 16.39 ? 145 THR A CA    1 
ATOM   1184 C  C     . THR A 1 148 ? 71.760 -4.192  5.666   1.00 15.87 ? 145 THR A C     1 
ATOM   1185 O  O     . THR A 1 148 ? 72.830 -4.189  6.281   1.00 19.01 ? 145 THR A O     1 
ATOM   1186 C  CB    . THR A 1 148 ? 72.307 -4.004  3.227   1.00 15.34 ? 145 THR A CB    1 
ATOM   1187 O  OG1   . THR A 1 148 ? 71.983 -3.321  2.018   1.00 13.06 ? 145 THR A OG1   1 
ATOM   1188 C  CG2   . THR A 1 148 ? 71.899 -5.456  3.095   1.00 14.93 ? 145 THR A CG2   1 
ATOM   1189 N  N     . TYR A 1 149 ? 70.699 -4.913  6.037   1.00 14.66 ? 146 TYR A N     1 
ATOM   1190 C  CA    . TYR A 1 149 ? 70.749 -5.947  7.077   1.00 15.99 ? 146 TYR A CA    1 
ATOM   1191 C  C     . TYR A 1 149 ? 70.675 -7.292  6.405   1.00 19.87 ? 146 TYR A C     1 
ATOM   1192 O  O     . TYR A 1 149 ? 69.908 -7.458  5.462   1.00 16.55 ? 146 TYR A O     1 
ATOM   1193 C  CB    . TYR A 1 149 ? 69.551 -5.835  8.023   1.00 12.85 ? 146 TYR A CB    1 
ATOM   1194 C  CG    . TYR A 1 149 ? 69.737 -4.764  9.074   1.00 11.40 ? 146 TYR A CG    1 
ATOM   1195 C  CD1   . TYR A 1 149 ? 70.136 -5.106  10.362  1.00 16.40 ? 146 TYR A CD1   1 
ATOM   1196 C  CD2   . TYR A 1 149 ? 69.519 -3.414  8.778   1.00 19.00 ? 146 TYR A CD2   1 
ATOM   1197 C  CE1   . TYR A 1 149 ? 70.323 -4.145  11.325  1.00 19.94 ? 146 TYR A CE1   1 
ATOM   1198 C  CE2   . TYR A 1 149 ? 69.702 -2.435  9.743   1.00 21.81 ? 146 TYR A CE2   1 
ATOM   1199 C  CZ    . TYR A 1 149 ? 70.106 -2.812  11.017  1.00 21.36 ? 146 TYR A CZ    1 
ATOM   1200 O  OH    . TYR A 1 149 ? 70.293 -1.870  12.006  1.00 30.81 ? 146 TYR A OH    1 
ATOM   1201 N  N     . ILE A 1 150 ? 71.462 -8.251  6.883   1.00 17.62 ? 147 ILE A N     1 
ATOM   1202 C  CA    . ILE A 1 150 ? 71.306 -9.641  6.451   1.00 17.04 ? 147 ILE A CA    1 
ATOM   1203 C  C     . ILE A 1 150 ? 70.540 -10.408 7.532   1.00 16.24 ? 147 ILE A C     1 
ATOM   1204 O  O     . ILE A 1 150 ? 71.048 -10.598 8.641   1.00 19.25 ? 147 ILE A O     1 
ATOM   1205 C  CB    . ILE A 1 150 ? 72.659 -10.339 6.219   1.00 15.44 ? 147 ILE A CB    1 
ATOM   1206 C  CG1   . ILE A 1 150 ? 73.574 -9.514  5.302   1.00 14.50 ? 147 ILE A CG1   1 
ATOM   1207 C  CG2   . ILE A 1 150 ? 72.434 -11.731 5.639   1.00 17.06 ? 147 ILE A CG2   1 
ATOM   1208 C  CD1   . ILE A 1 150 ? 73.043 -9.302  3.857   1.00 16.50 ? 147 ILE A CD1   1 
ATOM   1209 N  N     . GLU A 1 151 ? 69.307 -10.814 7.231   1.00 14.57 ? 148 GLU A N     1 
ATOM   1210 C  CA    . GLU A 1 151 ? 68.463 -11.448 8.232   1.00 12.55 ? 148 GLU A CA    1 
ATOM   1211 C  C     . GLU A 1 151 ? 69.111 -12.731 8.727   1.00 19.78 ? 148 GLU A C     1 
ATOM   1212 O  O     . GLU A 1 151 ? 69.565 -13.544 7.926   1.00 15.82 ? 148 GLU A O     1 
ATOM   1213 C  CB    . GLU A 1 151 ? 67.079 -11.779 7.665   1.00 17.82 ? 148 GLU A CB    1 
ATOM   1214 C  CG    . GLU A 1 151 ? 66.183 -12.557 8.653   1.00 19.48 ? 148 GLU A CG    1 
ATOM   1215 C  CD    . GLU A 1 151 ? 65.924 -11.819 9.962   1.00 26.13 ? 148 GLU A CD    1 
ATOM   1216 O  OE1   . GLU A 1 151 ? 65.639 -12.476 10.992  1.00 25.81 ? 148 GLU A OE1   1 
ATOM   1217 O  OE2   . GLU A 1 151 ? 65.992 -10.577 9.967   1.00 26.25 ? 148 GLU A OE2   1 
ATOM   1218 N  N     . GLY A 1 152 ? 69.153 -12.905 10.043  1.00 17.48 ? 149 GLY A N     1 
ATOM   1219 C  CA    . GLY A 1 152 ? 69.718 -14.108 10.634  1.00 19.19 ? 149 GLY A CA    1 
ATOM   1220 C  C     . GLY A 1 152 ? 71.164 -13.956 11.076  1.00 23.76 ? 149 GLY A C     1 
ATOM   1221 O  O     . GLY A 1 152 ? 71.702 -14.818 11.771  1.00 23.31 ? 149 GLY A O     1 
ATOM   1222 N  N     . LEU A 1 153 ? 71.796 -12.857 10.675  1.00 20.62 ? 150 LEU A N     1 
ATOM   1223 C  CA    . LEU A 1 153 ? 73.182 -12.588 11.056  1.00 20.33 ? 150 LEU A CA    1 
ATOM   1224 C  C     . LEU A 1 153 ? 73.285 -11.278 11.850  1.00 22.74 ? 150 LEU A C     1 
ATOM   1225 O  O     . LEU A 1 153 ? 72.473 -10.377 11.667  1.00 18.79 ? 150 LEU A O     1 
ATOM   1226 C  CB    . LEU A 1 153 ? 74.071 -12.542 9.810   1.00 15.16 ? 150 LEU A CB    1 
ATOM   1227 C  CG    . LEU A 1 153 ? 74.125 -13.802 8.950   1.00 17.28 ? 150 LEU A CG    1 
ATOM   1228 C  CD1   . LEU A 1 153 ? 75.070 -13.583 7.775   1.00 14.84 ? 150 LEU A CD1   1 
ATOM   1229 C  CD2   . LEU A 1 153 ? 74.551 -15.018 9.792   1.00 19.17 ? 150 LEU A CD2   1 
ATOM   1230 N  N     . PRO A 1 154 ? 74.302 -11.162 12.731  1.00 20.63 ? 151 PRO A N     1 
ATOM   1231 C  CA    . PRO A 1 154 ? 75.368 -12.147 12.952  1.00 20.03 ? 151 PRO A CA    1 
ATOM   1232 C  C     . PRO A 1 154 ? 74.931 -13.314 13.826  1.00 18.51 ? 151 PRO A C     1 
ATOM   1233 O  O     . PRO A 1 154 ? 73.937 -13.227 14.541  1.00 21.84 ? 151 PRO A O     1 
ATOM   1234 C  CB    . PRO A 1 154 ? 76.442 -11.331 13.689  1.00 22.03 ? 151 PRO A CB    1 
ATOM   1235 C  CG    . PRO A 1 154 ? 75.661 -10.311 14.437  1.00 21.54 ? 151 PRO A CG    1 
ATOM   1236 C  CD    . PRO A 1 154 ? 74.527 -9.932  13.507  1.00 20.67 ? 151 PRO A CD    1 
ATOM   1237 N  N     . GLN A 1 155 ? 75.680 -14.408 13.752  1.00 26.29 ? 152 GLN A N     1 
ATOM   1238 C  CA    . GLN A 1 155 ? 75.409 -15.596 14.546  1.00 29.33 ? 152 GLN A CA    1 
ATOM   1239 C  C     . GLN A 1 155 ? 76.731 -16.270 14.880  1.00 43.62 ? 152 GLN A C     1 
ATOM   1240 O  O     . GLN A 1 155 ? 77.759 -15.972 14.263  1.00 39.82 ? 152 GLN A O     1 
ATOM   1241 C  CB    . GLN A 1 155 ? 74.535 -16.575 13.757  1.00 30.80 ? 152 GLN A CB    1 
ATOM   1242 C  CG    . GLN A 1 155 ? 74.935 -18.028 13.940  1.00 45.09 ? 152 GLN A CG    1 
ATOM   1243 C  CD    . GLN A 1 155 ? 74.946 -18.802 12.638  1.00 42.92 ? 152 GLN A CD    1 
ATOM   1244 O  OE1   . GLN A 1 155 ? 73.892 -19.122 12.091  1.00 44.42 ? 152 GLN A OE1   1 
ATOM   1245 N  NE2   . GLN A 1 155 ? 76.139 -19.105 12.131  1.00 33.16 ? 152 GLN A NE2   1 
ATOM   1246 N  N     . GLY A 1 156 ? 76.699 -17.172 15.858  1.00 46.77 ? 153 GLY A N     1 
ATOM   1247 C  CA    . GLY A 1 156 ? 77.833 -18.034 16.143  1.00 52.00 ? 153 GLY A CA    1 
ATOM   1248 C  C     . GLY A 1 156 ? 78.815 -17.462 17.146  1.00 58.94 ? 153 GLY A C     1 
ATOM   1249 O  O     . GLY A 1 156 ? 78.565 -16.411 17.742  1.00 58.34 ? 153 GLY A O     1 
ATOM   1250 N  N     . PRO A 1 157 ? 79.943 -18.166 17.342  1.00 63.17 ? 154 PRO A N     1 
ATOM   1251 C  CA    . PRO A 1 157 ? 81.020 -17.762 18.253  1.00 54.95 ? 154 PRO A CA    1 
ATOM   1252 C  C     . PRO A 1 157 ? 81.901 -16.668 17.649  1.00 50.99 ? 154 PRO A C     1 
ATOM   1253 O  O     . PRO A 1 157 ? 81.793 -16.394 16.450  1.00 54.26 ? 154 PRO A O     1 
ATOM   1254 C  CB    . PRO A 1 157 ? 81.819 -19.056 18.432  1.00 43.20 ? 154 PRO A CB    1 
ATOM   1255 C  CG    . PRO A 1 157 ? 81.620 -19.789 17.149  1.00 32.90 ? 154 PRO A CG    1 
ATOM   1256 C  CD    . PRO A 1 157 ? 80.215 -19.469 16.706  1.00 50.12 ? 154 PRO A CD    1 
ATOM   1257 N  N     . THR A 1 163 ? 80.129 -5.808  20.523  1.00 60.48 ? 160 THR A N     1 
ATOM   1258 C  CA    . THR A 1 163 ? 79.415 -4.553  20.305  1.00 61.78 ? 160 THR A CA    1 
ATOM   1259 C  C     . THR A 1 163 ? 77.972 -4.647  20.797  1.00 58.69 ? 160 THR A C     1 
ATOM   1260 O  O     . THR A 1 163 ? 77.322 -5.687  20.664  1.00 56.09 ? 160 THR A O     1 
ATOM   1261 C  CB    . THR A 1 163 ? 79.426 -4.136  18.815  1.00 58.43 ? 160 THR A CB    1 
ATOM   1262 O  OG1   . THR A 1 163 ? 78.817 -2.845  18.668  1.00 57.94 ? 160 THR A OG1   1 
ATOM   1263 C  CG2   . THR A 1 163 ? 78.669 -5.149  17.969  1.00 56.33 ? 160 THR A CG2   1 
ATOM   1264 N  N     . VAL A 1 164 ? 77.475 -3.554  21.365  1.00 53.36 ? 161 VAL A N     1 
ATOM   1265 C  CA    . VAL A 1 164 ? 76.138 -3.540  21.941  1.00 51.45 ? 161 VAL A CA    1 
ATOM   1266 C  C     . VAL A 1 164 ? 75.245 -2.481  21.286  1.00 55.82 ? 161 VAL A C     1 
ATOM   1267 O  O     . VAL A 1 164 ? 74.201 -2.115  21.834  1.00 53.10 ? 161 VAL A O     1 
ATOM   1268 C  CB    . VAL A 1 164 ? 76.197 -3.300  23.469  1.00 56.08 ? 161 VAL A CB    1 
ATOM   1269 C  CG1   . VAL A 1 164 ? 77.030 -4.386  24.150  1.00 43.85 ? 161 VAL A CG1   1 
ATOM   1270 C  CG2   . VAL A 1 164 ? 76.764 -1.917  23.775  1.00 44.49 ? 161 VAL A CG2   1 
ATOM   1271 N  N     . GLN A 1 165 ? 75.658 -2.008  20.110  1.00 43.60 ? 162 GLN A N     1 
ATOM   1272 C  CA    . GLN A 1 165 ? 74.961 -0.935  19.397  1.00 43.95 ? 162 GLN A CA    1 
ATOM   1273 C  C     . GLN A 1 165 ? 74.365 -1.430  18.075  1.00 41.64 ? 162 GLN A C     1 
ATOM   1274 O  O     . GLN A 1 165 ? 74.858 -2.389  17.481  1.00 31.78 ? 162 GLN A O     1 
ATOM   1275 C  CB    . GLN A 1 165 ? 75.924 0.215   19.114  1.00 50.51 ? 162 GLN A CB    1 
ATOM   1276 C  CG    . GLN A 1 165 ? 77.099 -0.199  18.238  1.00 56.91 ? 162 GLN A CG    1 
ATOM   1277 C  CD    . GLN A 1 165 ? 78.076 0.932   17.986  1.00 68.81 ? 162 GLN A CD    1 
ATOM   1278 O  OE1   . GLN A 1 165 ? 78.096 1.926   18.715  1.00 81.31 ? 162 GLN A OE1   1 
ATOM   1279 N  NE2   . GLN A 1 165 ? 78.891 0.788   16.945  1.00 59.93 ? 162 GLN A NE2   1 
ATOM   1280 N  N     . LYS A 1 166 ? 73.319 -0.758  17.608  1.00 31.86 ? 163 LYS A N     1 
ATOM   1281 C  CA    . LYS A 1 166 ? 72.562 -1.237  16.455  1.00 36.56 ? 163 LYS A CA    1 
ATOM   1282 C  C     . LYS A 1 166 ? 73.390 -1.300  15.166  1.00 27.64 ? 163 LYS A C     1 
ATOM   1283 O  O     . LYS A 1 166 ? 73.397 -2.322  14.467  1.00 26.48 ? 163 LYS A O     1 
ATOM   1284 C  CB    . LYS A 1 166 ? 71.299 -0.386  16.254  1.00 33.52 ? 163 LYS A CB    1 
ATOM   1285 C  CG    . LYS A 1 166 ? 70.346 -0.911  15.187  1.00 44.59 ? 163 LYS A CG    1 
ATOM   1286 C  CD    . LYS A 1 166 ? 69.114 -0.014  15.050  1.00 61.67 ? 163 LYS A CD    1 
ATOM   1287 C  CE    . LYS A 1 166 ? 69.493 1.430   14.715  1.00 63.53 ? 163 LYS A CE    1 
ATOM   1288 N  NZ    . LYS A 1 166 ? 68.299 2.322   14.587  1.00 58.89 ? 163 LYS A NZ    1 
ATOM   1289 N  N     . GLU A 1 167 ? 74.076 -0.210  14.841  1.00 26.74 ? 164 GLU A N     1 
ATOM   1290 C  CA    . GLU A 1 167 ? 74.855 -0.165  13.607  1.00 33.48 ? 164 GLU A CA    1 
ATOM   1291 C  C     . GLU A 1 167 ? 76.026 -1.146  13.648  1.00 29.85 ? 164 GLU A C     1 
ATOM   1292 O  O     . GLU A 1 167 ? 76.467 -1.646  12.616  1.00 30.85 ? 164 GLU A O     1 
ATOM   1293 C  CB    . GLU A 1 167 ? 75.339 1.259   13.313  1.00 34.06 ? 164 GLU A CB    1 
ATOM   1294 C  CG    . GLU A 1 167 ? 76.318 1.369   12.142  1.00 25.88 ? 164 GLU A CG    1 
ATOM   1295 C  CD    . GLU A 1 167 ? 75.679 1.083   10.776  1.00 38.62 ? 164 GLU A CD    1 
ATOM   1296 O  OE1   . GLU A 1 167 ? 76.425 1.066   9.771   1.00 38.13 ? 164 GLU A OE1   1 
ATOM   1297 O  OE2   . GLU A 1 167 ? 74.443 0.888   10.700  1.00 33.29 ? 164 GLU A OE2   1 
ATOM   1298 N  N     . GLY A 1 168 ? 76.528 -1.422  14.846  1.00 34.23 ? 165 GLY A N     1 
ATOM   1299 C  CA    . GLY A 1 168 ? 77.607 -2.377  15.006  1.00 33.45 ? 165 GLY A CA    1 
ATOM   1300 C  C     . GLY A 1 168 ? 77.170 -3.792  14.673  1.00 27.63 ? 165 GLY A C     1 
ATOM   1301 O  O     . GLY A 1 168 ? 77.886 -4.527  13.994  1.00 28.52 ? 165 GLY A O     1 
ATOM   1302 N  N     . MET A 1 169 ? 75.995 -4.178  15.156  1.00 29.83 ? 166 MET A N     1 
ATOM   1303 C  CA    . MET A 1 169 ? 75.432 -5.484  14.841  1.00 23.16 ? 166 MET A CA    1 
ATOM   1304 C  C     . MET A 1 169 ? 75.180 -5.593  13.348  1.00 22.88 ? 166 MET A C     1 
ATOM   1305 O  O     . MET A 1 169 ? 75.476 -6.620  12.741  1.00 24.40 ? 166 MET A O     1 
ATOM   1306 C  CB    . MET A 1 169 ? 74.123 -5.713  15.600  1.00 28.21 ? 166 MET A CB    1 
ATOM   1307 C  CG    . MET A 1 169 ? 74.293 -5.896  17.107  1.00 48.69 ? 166 MET A CG    1 
ATOM   1308 S  SD    . MET A 1 169 ? 74.873 -7.554  17.550  1.00 57.01 ? 166 MET A SD    1 
ATOM   1309 C  CE    . MET A 1 169 ? 73.500 -8.558  16.961  1.00 35.86 ? 166 MET A CE    1 
ATOM   1310 N  N     . ARG A 1 170 ? 74.634 -4.539  12.744  1.00 21.02 ? 167 ARG A N     1 
ATOM   1311 C  CA    . ARG A 1 170 ? 74.332 -4.592  11.309  1.00 17.63 ? 167 ARG A CA    1 
ATOM   1312 C  C     . ARG A 1 170 ? 75.590 -4.904  10.527  1.00 19.88 ? 167 ARG A C     1 
ATOM   1313 O  O     . ARG A 1 170 ? 75.587 -5.766  9.657   1.00 20.04 ? 167 ARG A O     1 
ATOM   1314 C  CB    . ARG A 1 170 ? 73.734 -3.270  10.807  1.00 22.59 ? 167 ARG A CB    1 
ATOM   1315 C  CG    . ARG A 1 170 ? 73.380 -3.286  9.303   1.00 21.06 ? 167 ARG A CG    1 
ATOM   1316 C  CD    . ARG A 1 170 ? 73.181 -1.883  8.732   1.00 18.81 ? 167 ARG A CD    1 
ATOM   1317 N  NE    . ARG A 1 170 ? 74.455 -1.194  8.516   1.00 22.51 ? 167 ARG A NE    1 
ATOM   1318 C  CZ    . ARG A 1 170 ? 75.246 -1.400  7.468   1.00 23.32 ? 167 ARG A CZ    1 
ATOM   1319 N  NH1   . ARG A 1 170 ? 74.907 -2.281  6.538   1.00 18.64 ? 167 ARG A NH1   1 
ATOM   1320 N  NH2   . ARG A 1 170 ? 76.383 -0.732  7.350   1.00 27.48 ? 167 ARG A NH2   1 
ATOM   1321 N  N     . LYS A 1 171 ? 76.663 -4.182  10.838  1.00 18.49 ? 168 LYS A N     1 
ATOM   1322 C  CA    . LYS A 1 171 ? 77.943 -4.366  10.167  1.00 19.26 ? 168 LYS A CA    1 
ATOM   1323 C  C     . LYS A 1 171 ? 78.558 -5.747  10.411  1.00 19.06 ? 168 LYS A C     1 
ATOM   1324 O  O     . LYS A 1 171 ? 79.080 -6.373  9.479   1.00 21.69 ? 168 LYS A O     1 
ATOM   1325 C  CB    . LYS A 1 171 ? 78.930 -3.271  10.576  1.00 28.22 ? 168 LYS A CB    1 
ATOM   1326 C  CG    . LYS A 1 171 ? 78.720 -1.940  9.871   1.00 37.51 ? 168 LYS A CG    1 
ATOM   1327 C  CD    . LYS A 1 171 ? 79.992 -1.098  9.962   1.00 48.97 ? 168 LYS A CD    1 
ATOM   1328 C  CE    . LYS A 1 171 ? 79.812 0.298   9.377   1.00 59.81 ? 168 LYS A CE    1 
ATOM   1329 N  NZ    . LYS A 1 171 ? 79.127 1.235   10.321  1.00 55.30 ? 168 LYS A NZ    1 
ATOM   1330 N  N     . GLN A 1 172 ? 78.500 -6.230  11.649  1.00 24.27 ? 169 GLN A N     1 
ATOM   1331 C  CA    . GLN A 1 172 ? 78.995 -7.573  11.946  1.00 21.22 ? 169 GLN A CA    1 
ATOM   1332 C  C     . GLN A 1 172 ? 78.296 -8.606  11.077  1.00 22.89 ? 169 GLN A C     1 
ATOM   1333 O  O     . GLN A 1 172 ? 78.932 -9.495  10.518  1.00 21.87 ? 169 GLN A O     1 
ATOM   1334 C  CB    . GLN A 1 172 ? 78.790 -7.938  13.415  1.00 23.06 ? 169 GLN A CB    1 
ATOM   1335 C  CG    . GLN A 1 172 ? 79.688 -7.205  14.386  1.00 47.57 ? 169 GLN A CG    1 
ATOM   1336 C  CD    . GLN A 1 172 ? 79.713 -7.870  15.750  1.00 69.09 ? 169 GLN A CD    1 
ATOM   1337 O  OE1   . GLN A 1 172 ? 79.033 -8.877  15.977  1.00 65.67 ? 169 GLN A OE1   1 
ATOM   1338 N  NE2   . GLN A 1 172 ? 80.504 -7.315  16.666  1.00 68.74 ? 169 GLN A NE2   1 
ATOM   1339 N  N     . GLY A 1 173 ? 76.974 -8.495  10.976  1.00 23.90 ? 170 GLY A N     1 
ATOM   1340 C  CA    . GLY A 1 173 ? 76.214 -9.421  10.157  1.00 17.06 ? 170 GLY A CA    1 
ATOM   1341 C  C     . GLY A 1 173 ? 76.563 -9.316  8.690   1.00 20.31 ? 170 GLY A C     1 
ATOM   1342 O  O     . GLY A 1 173 ? 76.696 -10.332 8.007   1.00 17.91 ? 170 GLY A O     1 
ATOM   1343 N  N     . LEU A 1 174 ? 76.697 -8.086  8.196   1.00 20.85 ? 171 LEU A N     1 
ATOM   1344 C  CA    . LEU A 1 174 ? 77.072 -7.870  6.802   1.00 19.08 ? 171 LEU A CA    1 
ATOM   1345 C  C     . LEU A 1 174 ? 78.446 -8.473  6.528   1.00 22.45 ? 171 LEU A C     1 
ATOM   1346 O  O     . LEU A 1 174 ? 78.671 -9.079  5.484   1.00 18.13 ? 171 LEU A O     1 
ATOM   1347 C  CB    . LEU A 1 174 ? 77.083 -6.374  6.457   1.00 16.21 ? 171 LEU A CB    1 
ATOM   1348 C  CG    . LEU A 1 174 ? 77.383 -6.035  4.995   1.00 17.31 ? 171 LEU A CG    1 
ATOM   1349 C  CD1   . LEU A 1 174 ? 76.430 -6.799  4.092   1.00 15.20 ? 171 LEU A CD1   1 
ATOM   1350 C  CD2   . LEU A 1 174 ? 77.276 -4.533  4.733   1.00 21.94 ? 171 LEU A CD2   1 
ATOM   1351 N  N     . PHE A 1 175 ? 79.367 -8.318  7.475   1.00 18.92 ? 172 PHE A N     1 
ATOM   1352 C  CA    . PHE A 1 175 ? 80.714 -8.842  7.273   1.00 25.58 ? 172 PHE A CA    1 
ATOM   1353 C  C     . PHE A 1 175 ? 80.723 -10.373 7.201   1.00 24.00 ? 172 PHE A C     1 
ATOM   1354 O  O     . PHE A 1 175 ? 81.413 -10.953 6.360   1.00 26.06 ? 172 PHE A O     1 
ATOM   1355 C  CB    . PHE A 1 175 ? 81.660 -8.355  8.368   1.00 18.82 ? 172 PHE A CB    1 
ATOM   1356 C  CG    . PHE A 1 175 ? 82.036 -6.908  8.248   1.00 41.60 ? 172 PHE A CG    1 
ATOM   1357 C  CD1   . PHE A 1 175 ? 82.016 -6.273  7.018   1.00 49.30 ? 172 PHE A CD1   1 
ATOM   1358 C  CD2   . PHE A 1 175 ? 82.407 -6.180  9.367   1.00 47.53 ? 172 PHE A CD2   1 
ATOM   1359 C  CE1   . PHE A 1 175 ? 82.360 -4.940  6.904   1.00 50.48 ? 172 PHE A CE1   1 
ATOM   1360 C  CE2   . PHE A 1 175 ? 82.757 -4.844  9.262   1.00 53.78 ? 172 PHE A CE2   1 
ATOM   1361 C  CZ    . PHE A 1 175 ? 82.731 -4.224  8.027   1.00 57.29 ? 172 PHE A CZ    1 
ATOM   1362 N  N     . GLN A 1 176 ? 79.976 -11.026 8.090   1.00 23.81 ? 173 GLN A N     1 
ATOM   1363 C  CA    . GLN A 1 176 ? 79.917 -12.488 8.095   1.00 22.75 ? 173 GLN A CA    1 
ATOM   1364 C  C     . GLN A 1 176 ? 79.382 -12.973 6.766   1.00 24.51 ? 173 GLN A C     1 
ATOM   1365 O  O     . GLN A 1 176 ? 79.882 -13.946 6.198   1.00 21.26 ? 173 GLN A O     1 
ATOM   1366 C  CB    . GLN A 1 176 ? 79.046 -13.020 9.243   1.00 21.01 ? 173 GLN A CB    1 
ATOM   1367 C  CG    . GLN A 1 176 ? 79.637 -12.775 10.619  1.00 22.40 ? 173 GLN A CG    1 
ATOM   1368 C  CD    . GLN A 1 176 ? 78.829 -13.416 11.719  1.00 26.30 ? 173 GLN A CD    1 
ATOM   1369 O  OE1   . GLN A 1 176 ? 77.761 -13.969 11.477  1.00 23.51 ? 173 GLN A OE1   1 
ATOM   1370 N  NE2   . GLN A 1 176 ? 79.335 -13.345 12.942  1.00 27.89 ? 173 GLN A NE2   1 
ATOM   1371 N  N     . TRP A 1 177 ? 78.370 -12.269 6.266   1.00 19.84 ? 174 TRP A N     1 
ATOM   1372 C  CA    . TRP A 1 177 ? 77.726 -12.608 5.002   1.00 18.65 ? 174 TRP A CA    1 
ATOM   1373 C  C     . TRP A 1 177 ? 78.685 -12.462 3.825   1.00 19.48 ? 174 TRP A C     1 
ATOM   1374 O  O     . TRP A 1 177 ? 78.851 -13.387 3.023   1.00 19.25 ? 174 TRP A O     1 
ATOM   1375 C  CB    . TRP A 1 177 ? 76.481 -11.730 4.790   1.00 15.71 ? 174 TRP A CB    1 
ATOM   1376 C  CG    . TRP A 1 177 ? 75.804 -11.908 3.442   1.00 18.93 ? 174 TRP A CG    1 
ATOM   1377 C  CD1   . TRP A 1 177 ? 75.895 -11.076 2.368   1.00 23.04 ? 174 TRP A CD1   1 
ATOM   1378 C  CD2   . TRP A 1 177 ? 74.915 -12.971 3.047   1.00 19.07 ? 174 TRP A CD2   1 
ATOM   1379 N  NE1   . TRP A 1 177 ? 75.128 -11.549 1.330   1.00 19.33 ? 174 TRP A NE1   1 
ATOM   1380 C  CE2   . TRP A 1 177 ? 74.522 -12.713 1.716   1.00 23.12 ? 174 TRP A CE2   1 
ATOM   1381 C  CE3   . TRP A 1 177 ? 74.421 -14.113 3.687   1.00 19.81 ? 174 TRP A CE3   1 
ATOM   1382 C  CZ2   . TRP A 1 177 ? 73.661 -13.555 1.010   1.00 18.81 ? 174 TRP A CZ2   1 
ATOM   1383 C  CZ3   . TRP A 1 177 ? 73.566 -14.946 2.990   1.00 22.56 ? 174 TRP A CZ3   1 
ATOM   1384 C  CH2   . TRP A 1 177 ? 73.193 -14.663 1.663   1.00 24.43 ? 174 TRP A CH2   1 
ATOM   1385 N  N     . LEU A 1 178 ? 79.320 -11.301 3.726   1.00 20.88 ? 175 LEU A N     1 
ATOM   1386 C  CA    . LEU A 1 178 ? 80.243 -11.050 2.620   1.00 20.34 ? 175 LEU A CA    1 
ATOM   1387 C  C     . LEU A 1 178 ? 81.457 -11.971 2.707   1.00 32.93 ? 175 LEU A C     1 
ATOM   1388 O  O     . LEU A 1 178 ? 82.020 -12.356 1.688   1.00 28.52 ? 175 LEU A O     1 
ATOM   1389 C  CB    . LEU A 1 178 ? 80.703 -9.592  2.613   1.00 23.80 ? 175 LEU A CB    1 
ATOM   1390 C  CG    . LEU A 1 178 ? 79.597 -8.575  2.339   1.00 17.43 ? 175 LEU A CG    1 
ATOM   1391 C  CD1   . LEU A 1 178 ? 80.128 -7.151  2.470   1.00 23.35 ? 175 LEU A CD1   1 
ATOM   1392 C  CD2   . LEU A 1 178 ? 78.994 -8.826  0.951   1.00 25.32 ? 175 LEU A CD2   1 
ATOM   1393 N  N     . ASP A 1 179 ? 81.854 -12.313 3.929   1.00 24.64 ? 176 ASP A N     1 
ATOM   1394 C  CA    . ASP A 1 179 ? 83.000 -13.201 4.138   1.00 33.14 ? 176 ASP A CA    1 
ATOM   1395 C  C     . ASP A 1 179 ? 82.726 -14.567 3.545   1.00 34.99 ? 176 ASP A C     1 
ATOM   1396 O  O     . ASP A 1 179 ? 83.642 -15.249 3.078   1.00 34.47 ? 176 ASP A O     1 
ATOM   1397 C  CB    . ASP A 1 179 ? 83.314 -13.356 5.633   1.00 31.98 ? 176 ASP A CB    1 
ATOM   1398 C  CG    . ASP A 1 179 ? 84.187 -12.244 6.160   1.00 46.87 ? 176 ASP A CG    1 
ATOM   1399 O  OD1   . ASP A 1 179 ? 84.953 -11.662 5.360   1.00 55.71 ? 176 ASP A OD1   1 
ATOM   1400 O  OD2   . ASP A 1 179 ? 84.111 -11.952 7.377   1.00 54.83 ? 176 ASP A OD2   1 
ATOM   1401 N  N     . SER A 1 180 ? 81.455 -14.957 3.564   1.00 26.39 ? 177 SER A N     1 
ATOM   1402 C  CA    . SER A 1 180 ? 81.057 -16.293 3.143   1.00 28.81 ? 177 SER A CA    1 
ATOM   1403 C  C     . SER A 1 180 ? 80.791 -16.436 1.650   1.00 36.44 ? 177 SER A C     1 
ATOM   1404 O  O     . SER A 1 180 ? 80.746 -17.553 1.133   1.00 40.12 ? 177 SER A O     1 
ATOM   1405 C  CB    . SER A 1 180 ? 79.818 -16.741 3.926   1.00 27.50 ? 177 SER A CB    1 
ATOM   1406 O  OG    . SER A 1 180 ? 80.110 -16.809 5.307   1.00 41.00 ? 177 SER A OG    1 
ATOM   1407 N  N     . LEU A 1 181 ? 80.600 -15.315 0.965   1.00 25.66 ? 178 LEU A N     1 
ATOM   1408 C  CA    . LEU A 1 181 ? 80.130 -15.337 -0.425  1.00 25.78 ? 178 LEU A CA    1 
ATOM   1409 C  C     . LEU A 1 181 ? 81.079 -16.025 -1.407  1.00 40.93 ? 178 LEU A C     1 
ATOM   1410 O  O     . LEU A 1 181 ? 82.291 -15.850 -1.325  1.00 45.29 ? 178 LEU A O     1 
ATOM   1411 C  CB    . LEU A 1 181 ? 79.863 -13.911 -0.919  1.00 31.79 ? 178 LEU A CB    1 
ATOM   1412 C  CG    . LEU A 1 181 ? 78.450 -13.358 -0.773  1.00 37.34 ? 178 LEU A CG    1 
ATOM   1413 C  CD1   . LEU A 1 181 ? 78.320 -12.020 -1.523  1.00 20.89 ? 178 LEU A CD1   1 
ATOM   1414 C  CD2   . LEU A 1 181 ? 77.442 -14.372 -1.296  1.00 27.06 ? 178 LEU A CD2   1 
ATOM   1415 N  N     . GLN A 1 182 ? 80.527 -16.791 -2.347  1.00 42.33 ? 179 GLN A N     1 
ATOM   1416 C  CA    . GLN A 1 182 ? 81.328 -17.291 -3.468  1.00 52.73 ? 179 GLN A CA    1 
ATOM   1417 C  C     . GLN A 1 182 ? 81.095 -16.467 -4.734  1.00 55.81 ? 179 GLN A C     1 
ATOM   1418 O  O     . GLN A 1 182 ? 80.173 -16.754 -5.504  1.00 55.50 ? 179 GLN A O     1 
ATOM   1419 C  CB    . GLN A 1 182 ? 81.050 -18.771 -3.748  1.00 53.88 ? 179 GLN A CB    1 
ATOM   1420 C  CG    . GLN A 1 182 ? 81.880 -19.350 -4.903  1.00 66.04 ? 179 GLN A CG    1 
ATOM   1421 C  CD    . GLN A 1 182 ? 83.382 -19.120 -4.738  1.00 71.67 ? 179 GLN A CD    1 
ATOM   1422 O  OE1   . GLN A 1 182 ? 83.919 -18.095 -5.168  1.00 64.52 ? 179 GLN A OE1   1 
ATOM   1423 N  NE2   . GLN A 1 182 ? 84.065 -20.077 -4.114  1.00 70.00 ? 179 GLN A NE2   1 
ATOM   1424 N  N     . ILE A 1 183 ? 81.941 -15.458 -4.950  1.00 46.38 ? 180 ILE A N     1 
ATOM   1425 C  CA    . ILE A 1 183 ? 81.781 -14.535 -6.079  1.00 60.16 ? 180 ILE A CA    1 
ATOM   1426 C  C     . ILE A 1 183 ? 82.264 -15.102 -7.419  1.00 61.27 ? 180 ILE A C     1 
ATOM   1427 O  O     . ILE A 1 183 ? 82.076 -14.487 -8.474  1.00 53.58 ? 180 ILE A O     1 
ATOM   1428 C  CB    . ILE A 1 183 ? 82.458 -13.167 -5.809  1.00 51.33 ? 180 ILE A CB    1 
ATOM   1429 C  CG1   . ILE A 1 183 ? 83.828 -13.355 -5.154  1.00 51.64 ? 180 ILE A CG1   1 
ATOM   1430 C  CG2   . ILE A 1 183 ? 81.576 -12.305 -4.919  1.00 50.18 ? 180 ILE A CG2   1 
ATOM   1431 C  CD1   . ILE A 1 183 ? 84.866 -13.970 -6.054  1.00 54.91 ? 180 ILE A CD1   1 
ATOM   1432 N  N     . ASP A 1 184 ? 82.883 -16.277 -7.363  1.00 61.98 ? 181 ASP A N     1 
ATOM   1433 C  CA    . ASP A 1 184 ? 83.374 -16.962 -8.553  1.00 64.77 ? 181 ASP A CA    1 
ATOM   1434 C  C     . ASP A 1 184 ? 82.223 -17.608 -9.320  1.00 63.46 ? 181 ASP A C     1 
ATOM   1435 O  O     . ASP A 1 184 ? 82.334 -17.882 -10.516 1.00 62.03 ? 181 ASP A O     1 
ATOM   1436 C  CB    . ASP A 1 184 ? 84.398 -18.026 -8.150  1.00 70.61 ? 181 ASP A CB    1 
ATOM   1437 C  CG    . ASP A 1 184 ? 84.931 -18.807 -9.336  1.00 95.54 ? 181 ASP A CG    1 
ATOM   1438 O  OD1   . ASP A 1 184 ? 85.100 -18.208 -10.421 1.00 99.70 ? 181 ASP A OD1   1 
ATOM   1439 O  OD2   . ASP A 1 184 ? 85.183 -20.022 -9.179  1.00 99.48 ? 181 ASP A OD2   1 
ATOM   1440 N  N     . ASN A 1 185 ? 81.118 -17.848 -8.622  1.00 59.12 ? 182 ASN A N     1 
ATOM   1441 C  CA    . ASN A 1 185 ? 79.957 -18.497 -9.220  1.00 58.74 ? 182 ASN A CA    1 
ATOM   1442 C  C     . ASN A 1 185 ? 78.835 -17.513 -9.552  1.00 52.86 ? 182 ASN A C     1 
ATOM   1443 O  O     . ASN A 1 185 ? 78.106 -17.067 -8.666  1.00 48.15 ? 182 ASN A O     1 
ATOM   1444 C  CB    . ASN A 1 185 ? 79.436 -19.602 -8.301  1.00 47.39 ? 182 ASN A CB    1 
ATOM   1445 C  CG    . ASN A 1 185 ? 78.239 -20.322 -8.880  1.00 53.22 ? 182 ASN A CG    1 
ATOM   1446 O  OD1   . ASN A 1 185 ? 77.942 -20.203 -10.074 1.00 50.71 ? 182 ASN A OD1   1 
ATOM   1447 N  ND2   . ASN A 1 185 ? 77.540 -21.078 -8.037  1.00 52.75 ? 182 ASN A ND2   1 
ATOM   1448 N  N     . LEU A 1 186 ? 78.698 -17.190 -10.835 1.00 52.98 ? 183 LEU A N     1 
ATOM   1449 C  CA    . LEU A 1 186 ? 77.677 -16.251 -11.292 1.00 51.39 ? 183 LEU A CA    1 
ATOM   1450 C  C     . LEU A 1 186 ? 76.254 -16.766 -11.067 1.00 46.57 ? 183 LEU A C     1 
ATOM   1451 O  O     . LEU A 1 186 ? 75.292 -16.002 -11.158 1.00 48.61 ? 183 LEU A O     1 
ATOM   1452 C  CB    . LEU A 1 186 ? 77.884 -15.901 -12.771 1.00 48.61 ? 183 LEU A CB    1 
ATOM   1453 C  CG    . LEU A 1 186 ? 78.836 -14.745 -13.100 1.00 57.81 ? 183 LEU A CG    1 
ATOM   1454 C  CD1   . LEU A 1 186 ? 80.251 -15.021 -12.604 1.00 59.24 ? 183 LEU A CD1   1 
ATOM   1455 C  CD2   . LEU A 1 186 ? 78.837 -14.460 -14.594 1.00 48.21 ? 183 LEU A CD2   1 
ATOM   1456 N  N     . THR A 1 187 ? 76.124 -18.057 -10.773 1.00 48.73 ? 184 THR A N     1 
ATOM   1457 C  CA    . THR A 1 187 ? 74.806 -18.661 -10.570 1.00 50.23 ? 184 THR A CA    1 
ATOM   1458 C  C     . THR A 1 187 ? 74.450 -18.931 -9.101  1.00 36.23 ? 184 THR A C     1 
ATOM   1459 O  O     . THR A 1 187 ? 73.411 -19.528 -8.819  1.00 37.27 ? 184 THR A O     1 
ATOM   1460 C  CB    . THR A 1 187 ? 74.641 -19.981 -11.368 1.00 52.62 ? 184 THR A CB    1 
ATOM   1461 O  OG1   . THR A 1 187 ? 75.550 -20.971 -10.863 1.00 50.96 ? 184 THR A OG1   1 
ATOM   1462 C  CG2   . THR A 1 187 ? 74.901 -19.750 -12.854 1.00 63.49 ? 184 THR A CG2   1 
ATOM   1463 N  N     . SER A 1 188 ? 75.301 -18.519 -8.165  1.00 35.64 ? 185 SER A N     1 
ATOM   1464 C  CA    . SER A 1 188 ? 74.937 -18.655 -6.753  1.00 29.76 ? 185 SER A CA    1 
ATOM   1465 C  C     . SER A 1 188 ? 73.770 -17.732 -6.419  1.00 23.56 ? 185 SER A C     1 
ATOM   1466 O  O     . SER A 1 188 ? 73.855 -16.520 -6.605  1.00 19.50 ? 185 SER A O     1 
ATOM   1467 C  CB    . SER A 1 188 ? 76.116 -18.357 -5.827  1.00 33.14 ? 185 SER A CB    1 
ATOM   1468 O  OG    . SER A 1 188 ? 75.680 -18.285 -4.472  1.00 33.34 ? 185 SER A OG    1 
ATOM   1469 N  N     . PRO A 1 189 ? 72.666 -18.310 -5.939  1.00 21.26 ? 186 PRO A N     1 
ATOM   1470 C  CA    . PRO A 1 189 ? 71.501 -17.526 -5.509  1.00 17.11 ? 186 PRO A CA    1 
ATOM   1471 C  C     . PRO A 1 189 ? 71.861 -16.476 -4.462  1.00 19.25 ? 186 PRO A C     1 
ATOM   1472 O  O     . PRO A 1 189 ? 71.317 -15.373 -4.528  1.00 17.18 ? 186 PRO A O     1 
ATOM   1473 C  CB    . PRO A 1 189 ? 70.584 -18.584 -4.904  1.00 18.66 ? 186 PRO A CB    1 
ATOM   1474 C  CG    . PRO A 1 189 ? 70.924 -19.838 -5.665  1.00 22.13 ? 186 PRO A CG    1 
ATOM   1475 C  CD    . PRO A 1 189 ? 72.418 -19.759 -5.873  1.00 22.31 ? 186 PRO A CD    1 
ATOM   1476 N  N     . ASP A 1 190 ? 72.736 -16.802 -3.507  1.00 18.47 ? 187 ASP A N     1 
ATOM   1477 C  CA    . ASP A 1 190 ? 73.102 -15.833 -2.474  1.00 17.02 ? 187 ASP A CA    1 
ATOM   1478 C  C     . ASP A 1 190 ? 73.873 -14.659 -3.073  1.00 16.05 ? 187 ASP A C     1 
ATOM   1479 O  O     . ASP A 1 190 ? 73.714 -13.514 -2.645  1.00 18.19 ? 187 ASP A O     1 
ATOM   1480 C  CB    . ASP A 1 190 ? 73.947 -16.471 -1.361  1.00 21.14 ? 187 ASP A CB    1 
ATOM   1481 C  CG    . ASP A 1 190 ? 73.168 -17.464 -0.515  1.00 26.20 ? 187 ASP A CG    1 
ATOM   1482 O  OD1   . ASP A 1 190 ? 71.924 -17.367 -0.442  1.00 20.32 ? 187 ASP A OD1   1 
ATOM   1483 O  OD2   . ASP A 1 190 ? 73.816 -18.334 0.103   1.00 30.84 ? 187 ASP A OD2   1 
ATOM   1484 N  N     . LEU A 1 191 ? 74.731 -14.947 -4.045  1.00 12.16 ? 188 LEU A N     1 
ATOM   1485 C  CA    . LEU A 1 191 ? 75.456 -13.898 -4.732  1.00 20.48 ? 188 LEU A CA    1 
ATOM   1486 C  C     . LEU A 1 191 ? 74.468 -13.015 -5.484  1.00 18.55 ? 188 LEU A C     1 
ATOM   1487 O  O     . LEU A 1 191 ? 74.585 -11.792 -5.471  1.00 16.30 ? 188 LEU A O     1 
ATOM   1488 C  CB    . LEU A 1 191 ? 76.479 -14.498 -5.703  1.00 17.62 ? 188 LEU A CB    1 
ATOM   1489 C  CG    . LEU A 1 191 ? 77.294 -13.488 -6.519  1.00 23.23 ? 188 LEU A CG    1 
ATOM   1490 C  CD1   . LEU A 1 191 ? 78.006 -12.498 -5.609  1.00 21.83 ? 188 LEU A CD1   1 
ATOM   1491 C  CD2   . LEU A 1 191 ? 78.298 -14.220 -7.403  1.00 26.90 ? 188 LEU A CD2   1 
ATOM   1492 N  N     . GLN A 1 192 ? 73.498 -13.646 -6.136  1.00 14.75 ? 189 GLN A N     1 
ATOM   1493 C  CA    . GLN A 1 192 ? 72.506 -12.915 -6.917  1.00 16.69 ? 189 GLN A CA    1 
ATOM   1494 C  C     . GLN A 1 192 ? 71.695 -11.964 -6.046  1.00 14.31 ? 189 GLN A C     1 
ATOM   1495 O  O     . GLN A 1 192 ? 71.510 -10.804 -6.401  1.00 15.17 ? 189 GLN A O     1 
ATOM   1496 C  CB    . GLN A 1 192 ? 71.611 -13.887 -7.682  1.00 18.35 ? 189 GLN A CB    1 
ATOM   1497 C  CG    . GLN A 1 192 ? 72.341 -14.507 -8.882  1.00 25.71 ? 189 GLN A CG    1 
ATOM   1498 C  CD    . GLN A 1 192 ? 71.616 -15.688 -9.473  1.00 38.24 ? 189 GLN A CD    1 
ATOM   1499 O  OE1   . GLN A 1 192 ? 70.493 -16.005 -9.081  1.00 38.04 ? 189 GLN A OE1   1 
ATOM   1500 N  NE2   . GLN A 1 192 ? 72.262 -16.359 -10.425 1.00 48.67 ? 189 GLN A NE2   1 
ATOM   1501 N  N     . LEU A 1 193 ? 71.248 -12.455 -4.889  1.00 13.41 ? 190 LEU A N     1 
ATOM   1502 C  CA    . LEU A 1 193 ? 70.567 -11.622 -3.904  1.00 12.61 ? 190 LEU A CA    1 
ATOM   1503 C  C     . LEU A 1 193 ? 71.428 -10.431 -3.469  1.00 14.81 ? 190 LEU A C     1 
ATOM   1504 O  O     . LEU A 1 193 ? 70.924 -9.323  -3.287  1.00 14.74 ? 190 LEU A O     1 
ATOM   1505 C  CB    . LEU A 1 193 ? 70.164 -12.444 -2.670  1.00 12.47 ? 190 LEU A CB    1 
ATOM   1506 C  CG    . LEU A 1 193 ? 69.035 -13.482 -2.780  1.00 15.41 ? 190 LEU A CG    1 
ATOM   1507 C  CD1   . LEU A 1 193 ? 68.751 -14.092 -1.395  1.00 15.70 ? 190 LEU A CD1   1 
ATOM   1508 C  CD2   . LEU A 1 193 ? 67.755 -12.896 -3.357  1.00 14.55 ? 190 LEU A CD2   1 
ATOM   1509 N  N     . THR A 1 194 ? 72.716 -10.668 -3.259  1.00 13.65 ? 191 THR A N     1 
ATOM   1510 C  CA    . THR A 1 194 ? 73.610 -9.623  -2.785  1.00 12.46 ? 191 THR A CA    1 
ATOM   1511 C  C     . THR A 1 194 ? 73.741 -8.514  -3.819  1.00 17.47 ? 191 THR A C     1 
ATOM   1512 O  O     . THR A 1 194 ? 73.719 -7.327  -3.481  1.00 16.45 ? 191 THR A O     1 
ATOM   1513 C  CB    . THR A 1 194 ? 75.006 -10.174 -2.504  1.00 15.19 ? 191 THR A CB    1 
ATOM   1514 O  OG1   . THR A 1 194 ? 74.917 -11.192 -1.502  1.00 20.51 ? 191 THR A OG1   1 
ATOM   1515 C  CG2   . THR A 1 194 ? 75.910 -9.061  -2.018  1.00 16.12 ? 191 THR A CG2   1 
ATOM   1516 N  N     . VAL A 1 195 ? 73.888 -8.900  -5.080  1.00 18.05 ? 192 VAL A N     1 
ATOM   1517 C  CA    . VAL A 1 195 ? 73.962 -7.905  -6.136  1.00 17.94 ? 192 VAL A CA    1 
ATOM   1518 C  C     . VAL A 1 195 ? 72.614 -7.185  -6.223  1.00 13.49 ? 192 VAL A C     1 
ATOM   1519 O  O     . VAL A 1 195 ? 72.557 -5.964  -6.411  1.00 19.23 ? 192 VAL A O     1 
ATOM   1520 C  CB    . VAL A 1 195 ? 74.373 -8.534  -7.481  1.00 15.14 ? 192 VAL A CB    1 
ATOM   1521 C  CG1   . VAL A 1 195 ? 74.207 -7.535  -8.629  1.00 18.74 ? 192 VAL A CG1   1 
ATOM   1522 C  CG2   . VAL A 1 195 ? 75.818 -9.032  -7.408  1.00 16.17 ? 192 VAL A CG2   1 
ATOM   1523 N  N     . GLY A 1 196 ? 71.528 -7.933  -6.055  1.00 14.98 ? 193 GLY A N     1 
ATOM   1524 C  CA    . GLY A 1 196 ? 70.213 -7.317  -5.991  1.00 13.82 ? 193 GLY A CA    1 
ATOM   1525 C  C     . GLY A 1 196 ? 70.194 -6.204  -4.960  1.00 18.58 ? 193 GLY A C     1 
ATOM   1526 O  O     . GLY A 1 196 ? 69.693 -5.099  -5.221  1.00 16.81 ? 193 GLY A O     1 
ATOM   1527 N  N     . ALA A 1 197 ? 70.754 -6.486  -3.784  1.00 15.51 ? 194 ALA A N     1 
ATOM   1528 C  CA    . ALA A 1 197 ? 70.762 -5.523  -2.700  1.00 12.44 ? 194 ALA A CA    1 
ATOM   1529 C  C     . ALA A 1 197 ? 71.597 -4.288  -3.035  1.00 14.06 ? 194 ALA A C     1 
ATOM   1530 O  O     . ALA A 1 197 ? 71.257 -3.180  -2.627  1.00 13.74 ? 194 ALA A O     1 
ATOM   1531 C  CB    . ALA A 1 197 ? 71.244 -6.172  -1.389  1.00 14.11 ? 194 ALA A CB    1 
ATOM   1532 N  N     . VAL A 1 198 ? 72.694 -4.483  -3.764  1.00 12.24 ? 195 VAL A N     1 
ATOM   1533 C  CA    . VAL A 1 198 ? 73.517 -3.358  -4.224  1.00 14.58 ? 195 VAL A CA    1 
ATOM   1534 C  C     . VAL A 1 198 ? 72.697 -2.430  -5.116  1.00 18.25 ? 195 VAL A C     1 
ATOM   1535 O  O     . VAL A 1 198 ? 72.739 -1.196  -4.966  1.00 17.94 ? 195 VAL A O     1 
ATOM   1536 C  CB    . VAL A 1 198 ? 74.778 -3.844  -4.979  1.00 17.03 ? 195 VAL A CB    1 
ATOM   1537 C  CG1   . VAL A 1 198 ? 75.525 -2.662  -5.618  1.00 18.51 ? 195 VAL A CG1   1 
ATOM   1538 C  CG2   . VAL A 1 198 ? 75.698 -4.609  -4.029  1.00 16.72 ? 195 VAL A CG2   1 
ATOM   1539 N  N     . ILE A 1 199 ? 71.925 -3.029  -6.019  1.00 12.10 ? 196 ILE A N     1 
ATOM   1540 C  CA    . ILE A 1 199 ? 71.075 -2.267  -6.934  1.00 16.53 ? 196 ILE A CA    1 
ATOM   1541 C  C     . ILE A 1 199 ? 69.984 -1.520  -6.173  1.00 17.99 ? 196 ILE A C     1 
ATOM   1542 O  O     . ILE A 1 199 ? 69.703 -0.364  -6.467  1.00 14.73 ? 196 ILE A O     1 
ATOM   1543 C  CB    . ILE A 1 199 ? 70.467 -3.159  -8.029  1.00 14.08 ? 196 ILE A CB    1 
ATOM   1544 C  CG1   . ILE A 1 199 ? 71.572 -3.675  -8.964  1.00 15.55 ? 196 ILE A CG1   1 
ATOM   1545 C  CG2   . ILE A 1 199 ? 69.412 -2.400  -8.844  1.00 18.56 ? 196 ILE A CG2   1 
ATOM   1546 C  CD1   . ILE A 1 199 ? 71.122 -4.762  -9.929  1.00 20.09 ? 196 ILE A CD1   1 
ATOM   1547 N  N     . VAL A 1 200 ? 69.387 -2.175  -5.181  1.00 15.58 ? 197 VAL A N     1 
ATOM   1548 C  CA    . VAL A 1 200 ? 68.359 -1.537  -4.367  1.00 14.24 ? 197 VAL A CA    1 
ATOM   1549 C  C     . VAL A 1 200 ? 68.883 -0.359  -3.544  1.00 13.82 ? 197 VAL A C     1 
ATOM   1550 O  O     . VAL A 1 200 ? 68.191 0.664   -3.396  1.00 15.35 ? 197 VAL A O     1 
ATOM   1551 C  CB    . VAL A 1 200 ? 67.598 -2.570  -3.513  1.00 12.28 ? 197 VAL A CB    1 
ATOM   1552 C  CG1   . VAL A 1 200 ? 66.604 -1.875  -2.589  1.00 17.71 ? 197 VAL A CG1   1 
ATOM   1553 C  CG2   . VAL A 1 200 ? 66.857 -3.521  -4.439  1.00 16.86 ? 197 VAL A CG2   1 
ATOM   1554 N  N     . GLU A 1 201 ? 70.115 -0.458  -3.051  1.00 14.68 ? 198 GLU A N     1 
ATOM   1555 C  CA    . GLU A 1 201 ? 70.745 0.693   -2.411  1.00 17.12 ? 198 GLU A CA    1 
ATOM   1556 C  C     . GLU A 1 201 ? 70.772 1.891   -3.379  1.00 14.89 ? 198 GLU A C     1 
ATOM   1557 O  O     . GLU A 1 201 ? 70.510 3.034   -2.985  1.00 17.16 ? 198 GLU A O     1 
ATOM   1558 C  CB    . GLU A 1 201 ? 72.177 0.377   -1.935  1.00 15.53 ? 198 GLU A CB    1 
ATOM   1559 C  CG    . GLU A 1 201 ? 72.318 -0.601  -0.745  1.00 15.73 ? 198 GLU A CG    1 
ATOM   1560 C  CD    . GLU A 1 201 ? 72.249 0.042   0.635   1.00 21.69 ? 198 GLU A CD    1 
ATOM   1561 O  OE1   . GLU A 1 201 ? 71.912 1.243   0.751   1.00 22.18 ? 198 GLU A OE1   1 
ATOM   1562 O  OE2   . GLU A 1 201 ? 72.521 -0.671  1.627   1.00 20.81 ? 198 GLU A OE2   1 
ATOM   1563 N  N     . GLU A 1 202 ? 71.099 1.620   -4.638  1.00 16.06 ? 199 GLU A N     1 
ATOM   1564 C  CA    . GLU A 1 202 ? 71.231 2.669   -5.640  1.00 16.82 ? 199 GLU A CA    1 
ATOM   1565 C  C     . GLU A 1 202 ? 69.845 3.247   -5.953  1.00 17.38 ? 199 GLU A C     1 
ATOM   1566 O  O     . GLU A 1 202 ? 69.677 4.466   -6.072  1.00 13.99 ? 199 GLU A O     1 
ATOM   1567 C  CB    . GLU A 1 202 ? 71.912 2.125   -6.906  1.00 20.88 ? 199 GLU A CB    1 
ATOM   1568 C  CG    . GLU A 1 202 ? 73.382 1.755   -6.690  1.00 25.71 ? 199 GLU A CG    1 
ATOM   1569 C  CD    . GLU A 1 202 ? 73.963 0.841   -7.774  1.00 31.06 ? 199 GLU A CD    1 
ATOM   1570 O  OE1   . GLU A 1 202 ? 75.184 0.562   -7.725  1.00 31.88 ? 199 GLU A OE1   1 
ATOM   1571 O  OE2   . GLU A 1 202 ? 73.209 0.394   -8.664  1.00 32.99 ? 199 GLU A OE2   1 
ATOM   1572 N  N     . MET A 1 203 ? 68.854 2.368   -6.066  1.00 16.11 ? 200 MET A N     1 
ATOM   1573 C  CA    . MET A 1 203 ? 67.468 2.797   -6.273  1.00 13.94 ? 200 MET A CA    1 
ATOM   1574 C  C     . MET A 1 203 ? 66.977 3.682   -5.136  1.00 13.76 ? 200 MET A C     1 
ATOM   1575 O  O     . MET A 1 203 ? 66.333 4.717   -5.375  1.00 13.64 ? 200 MET A O     1 
ATOM   1576 C  CB    . MET A 1 203 ? 66.530 1.591   -6.390  1.00 15.93 ? 200 MET A CB    1 
ATOM   1577 C  CG    A MET A 1 203 ? 65.085 1.978   -6.656  0.50 18.77 ? 200 MET A CG    1 
ATOM   1578 C  CG    B MET A 1 203 ? 66.830 0.634   -7.537  0.50 16.25 ? 200 MET A CG    1 
ATOM   1579 S  SD    A MET A 1 203 ? 63.965 0.583   -6.883  0.50 32.48 ? 200 MET A SD    1 
ATOM   1580 S  SD    B MET A 1 203 ? 65.653 -0.741  -7.620  0.50 17.72 ? 200 MET A SD    1 
ATOM   1581 C  CE    A MET A 1 203 ? 64.716 -0.271  -8.262  0.50 22.75 ? 200 MET A CE    1 
ATOM   1582 C  CE    B MET A 1 203 ? 64.122 0.152   -7.875  0.50 20.56 ? 200 MET A CE    1 
ATOM   1583 N  N     . ARG A 1 204 ? 67.269 3.275   -3.900  1.00 13.54 ? 201 ARG A N     1 
ATOM   1584 C  CA    . ARG A 1 204 ? 66.820 4.014   -2.724  1.00 14.37 ? 201 ARG A CA    1 
ATOM   1585 C  C     . ARG A 1 204 ? 67.528 5.367   -2.611  1.00 16.41 ? 201 ARG A C     1 
ATOM   1586 O  O     . ARG A 1 204 ? 66.904 6.372   -2.255  1.00 15.16 ? 201 ARG A O     1 
ATOM   1587 C  CB    . ARG A 1 204 ? 66.962 3.173   -1.455  1.00 14.40 ? 201 ARG A CB    1 
ATOM   1588 C  CG    . ARG A 1 204 ? 65.987 1.987   -1.454  1.00 14.87 ? 201 ARG A CG    1 
ATOM   1589 C  CD    . ARG A 1 204 ? 66.124 1.137   -0.216  1.00 19.21 ? 201 ARG A CD    1 
ATOM   1590 N  NE    . ARG A 1 204 ? 66.132 1.952   0.988   1.00 14.12 ? 201 ARG A NE    1 
ATOM   1591 C  CZ    . ARG A 1 204 ? 67.171 2.066   1.807   1.00 17.77 ? 201 ARG A CZ    1 
ATOM   1592 N  NH1   . ARG A 1 204 ? 67.086 2.835   2.882   1.00 18.15 ? 201 ARG A NH1   1 
ATOM   1593 N  NH2   . ARG A 1 204 ? 68.294 1.406   1.555   1.00 17.55 ? 201 ARG A NH2   1 
ATOM   1594 N  N     . ALA A 1 205 ? 68.818 5.399   -2.948  1.00 15.86 ? 202 ALA A N     1 
ATOM   1595 C  CA    . ALA A 1 205 ? 69.552 6.671   -2.997  1.00 17.84 ? 202 ALA A CA    1 
ATOM   1596 C  C     . ALA A 1 205 ? 68.958 7.636   -4.040  1.00 14.99 ? 202 ALA A C     1 
ATOM   1597 O  O     . ALA A 1 205 ? 68.833 8.838   -3.784  1.00 14.68 ? 202 ALA A O     1 
ATOM   1598 C  CB    . ALA A 1 205 ? 71.032 6.424   -3.302  1.00 15.43 ? 202 ALA A CB    1 
ATOM   1599 N  N     . ALA A 1 206 ? 68.617 7.112   -5.216  1.00 15.31 ? 203 ALA A N     1 
ATOM   1600 C  CA    . ALA A 1 206 ? 68.040 7.937   -6.270  1.00 17.31 ? 203 ALA A CA    1 
ATOM   1601 C  C     . ALA A 1 206 ? 66.684 8.489   -5.840  1.00 14.49 ? 203 ALA A C     1 
ATOM   1602 O  O     . ALA A 1 206 ? 66.357 9.645   -6.101  1.00 16.09 ? 203 ALA A O     1 
ATOM   1603 C  CB    . ALA A 1 206 ? 67.901 7.146   -7.563  1.00 17.22 ? 203 ALA A CB    1 
ATOM   1604 N  N     . ILE A 1 207 ? 65.884 7.657   -5.190  1.00 10.34 ? 204 ILE A N     1 
ATOM   1605 C  CA    . ILE A 1 207 ? 64.586 8.130   -4.717  1.00 14.83 ? 204 ILE A CA    1 
ATOM   1606 C  C     . ILE A 1 207 ? 64.759 9.262   -3.719  1.00 15.55 ? 204 ILE A C     1 
ATOM   1607 O  O     . ILE A 1 207 ? 64.053 10.280  -3.787  1.00 13.87 ? 204 ILE A O     1 
ATOM   1608 C  CB    . ILE A 1 207 ? 63.762 7.009   -4.067  1.00 11.70 ? 204 ILE A CB    1 
ATOM   1609 C  CG1   . ILE A 1 207 ? 63.343 5.994   -5.122  1.00 11.58 ? 204 ILE A CG1   1 
ATOM   1610 C  CG2   . ILE A 1 207 ? 62.544 7.578   -3.345  1.00 12.79 ? 204 ILE A CG2   1 
ATOM   1611 C  CD1   . ILE A 1 207 ? 62.603 4.780   -4.521  1.00 17.17 ? 204 ILE A CD1   1 
ATOM   1612 N  N     . GLU A 1 208 ? 65.682 9.095   -2.778  1.00 15.96 ? 205 GLU A N     1 
ATOM   1613 C  CA    . GLU A 1 208 ? 65.855 10.126  -1.760  1.00 15.22 ? 205 GLU A CA    1 
ATOM   1614 C  C     . GLU A 1 208 ? 66.445 11.390  -2.365  1.00 15.56 ? 205 GLU A C     1 
ATOM   1615 O  O     . GLU A 1 208 ? 66.009 12.495  -2.036  1.00 13.68 ? 205 GLU A O     1 
ATOM   1616 C  CB    . GLU A 1 208 ? 66.722 9.656   -0.586  1.00 19.37 ? 205 GLU A CB    1 
ATOM   1617 C  CG    . GLU A 1 208 ? 66.692 10.672  0.581   1.00 19.70 ? 205 GLU A CG    1 
ATOM   1618 C  CD    . GLU A 1 208 ? 67.534 10.254  1.774   1.00 24.79 ? 205 GLU A CD    1 
ATOM   1619 O  OE1   . GLU A 1 208 ? 67.562 11.009  2.772   1.00 25.20 ? 205 GLU A OE1   1 
ATOM   1620 O  OE2   . GLU A 1 208 ? 68.173 9.182   1.717   1.00 24.01 ? 205 GLU A OE2   1 
ATOM   1621 N  N     . ARG A 1 209 ? 67.421 11.232  -3.257  1.00 18.15 ? 206 ARG A N     1 
ATOM   1622 C  CA    . ARG A 1 209 ? 68.027 12.393  -3.920  1.00 19.72 ? 206 ARG A CA    1 
ATOM   1623 C  C     . ARG A 1 209 ? 67.004 13.192  -4.715  1.00 17.94 ? 206 ARG A C     1 
ATOM   1624 O  O     . ARG A 1 209 ? 66.969 14.421  -4.645  1.00 17.01 ? 206 ARG A O     1 
ATOM   1625 C  CB    . ARG A 1 209 ? 69.179 11.987  -4.866  1.00 19.09 ? 206 ARG A CB    1 
ATOM   1626 C  CG    . ARG A 1 209 ? 69.934 13.215  -5.423  1.00 24.09 ? 206 ARG A CG    1 
ATOM   1627 C  CD    . ARG A 1 209 ? 71.002 12.902  -6.490  1.00 26.74 ? 206 ARG A CD    1 
ATOM   1628 N  NE    . ARG A 1 209 ? 70.468 12.609  -7.831  1.00 31.62 ? 206 ARG A NE    1 
ATOM   1629 C  CZ    . ARG A 1 209 ? 70.061 13.523  -8.717  1.00 33.08 ? 206 ARG A CZ    1 
ATOM   1630 N  NH1   . ARG A 1 209 ? 69.614 13.143  -9.916  1.00 26.34 ? 206 ARG A NH1   1 
ATOM   1631 N  NH2   . ARG A 1 209 ? 70.094 14.814  -8.416  1.00 23.84 ? 206 ARG A NH2   1 
ATOM   1632 N  N     . GLU A 1 210 ? 66.178 12.491  -5.480  1.00 15.20 ? 207 GLU A N     1 
ATOM   1633 C  CA    . GLU A 1 210 ? 65.299 13.145  -6.439  1.00 14.94 ? 207 GLU A CA    1 
ATOM   1634 C  C     . GLU A 1 210 ? 63.920 13.556  -5.902  1.00 16.60 ? 207 GLU A C     1 
ATOM   1635 O  O     . GLU A 1 210 ? 63.187 14.300  -6.573  1.00 13.82 ? 207 GLU A O     1 
ATOM   1636 C  CB    . GLU A 1 210 ? 65.176 12.293  -7.697  1.00 16.91 ? 207 GLU A CB    1 
ATOM   1637 C  CG    . GLU A 1 210 ? 66.533 12.000  -8.325  1.00 18.68 ? 207 GLU A CG    1 
ATOM   1638 C  CD    . GLU A 1 210 ? 66.438 11.105  -9.540  1.00 23.50 ? 207 GLU A CD    1 
ATOM   1639 O  OE1   . GLU A 1 210 ? 65.400 11.145  -10.236 1.00 28.53 ? 207 GLU A OE1   1 
ATOM   1640 O  OE2   . GLU A 1 210 ? 67.408 10.354  -9.802  1.00 28.04 ? 207 GLU A OE2   1 
ATOM   1641 N  N     . THR A 1 211 ? 63.559 13.099  -4.699  1.00 14.12 ? 208 THR A N     1 
ATOM   1642 C  CA    . THR A 1 211 ? 62.238 13.432  -4.171  1.00 15.09 ? 208 THR A CA    1 
ATOM   1643 C  C     . THR A 1 211 ? 62.288 13.947  -2.758  1.00 16.02 ? 208 THR A C     1 
ATOM   1644 O  O     . THR A 1 211 ? 61.364 14.610  -2.318  1.00 17.48 ? 208 THR A O     1 
ATOM   1645 C  CB    . THR A 1 211 ? 61.268 12.224  -4.162  1.00 15.63 ? 208 THR A CB    1 
ATOM   1646 O  OG1   . THR A 1 211 ? 61.691 11.269  -3.183  1.00 14.85 ? 208 THR A OG1   1 
ATOM   1647 C  CG2   . THR A 1 211 ? 61.183 11.571  -5.541  1.00 16.28 ? 208 THR A CG2   1 
ATOM   1648 N  N     . GLY A 1 212 ? 63.351 13.612  -2.039  1.00 15.56 ? 209 GLY A N     1 
ATOM   1649 C  CA    . GLY A 1 212 ? 63.406 13.881  -0.615  1.00 18.48 ? 209 GLY A CA    1 
ATOM   1650 C  C     . GLY A 1 212 ? 62.846 12.784  0.286   1.00 18.88 ? 209 GLY A C     1 
ATOM   1651 O  O     . GLY A 1 212 ? 62.991 12.861  1.497   1.00 21.56 ? 209 GLY A O     1 
ATOM   1652 N  N     . PHE A 1 213 ? 62.211 11.767  -0.291  1.00 17.55 ? 210 PHE A N     1 
ATOM   1653 C  CA    . PHE A 1 213 ? 61.514 10.755  0.507   1.00 13.78 ? 210 PHE A CA    1 
ATOM   1654 C  C     . PHE A 1 213 ? 62.442 9.574   0.826   1.00 15.77 ? 210 PHE A C     1 
ATOM   1655 O  O     . PHE A 1 213 ? 63.118 9.072   -0.060  1.00 16.80 ? 210 PHE A O     1 
ATOM   1656 C  CB    . PHE A 1 213 ? 60.269 10.244  -0.229  1.00 12.79 ? 210 PHE A CB    1 
ATOM   1657 C  CG    . PHE A 1 213 ? 59.282 11.316  -0.604  1.00 14.06 ? 210 PHE A CG    1 
ATOM   1658 C  CD1   . PHE A 1 213 ? 58.609 11.257  -1.814  1.00 16.06 ? 210 PHE A CD1   1 
ATOM   1659 C  CD2   . PHE A 1 213 ? 59.000 12.360  0.261   1.00 18.38 ? 210 PHE A CD2   1 
ATOM   1660 C  CE1   . PHE A 1 213 ? 57.691 12.234  -2.165  1.00 14.48 ? 210 PHE A CE1   1 
ATOM   1661 C  CE2   . PHE A 1 213 ? 58.072 13.335  -0.087  1.00 15.16 ? 210 PHE A CE2   1 
ATOM   1662 C  CZ    . PHE A 1 213 ? 57.431 13.273  -1.307  1.00 11.54 ? 210 PHE A CZ    1 
ATOM   1663 N  N     . GLN A 1 214 ? 62.480 9.158   2.095   1.00 13.58 ? 211 GLN A N     1 
ATOM   1664 C  CA    . GLN A 1 214 ? 63.158 7.931   2.509   1.00 15.99 ? 211 GLN A CA    1 
ATOM   1665 C  C     . GLN A 1 214 ? 62.255 6.704   2.420   1.00 16.34 ? 211 GLN A C     1 
ATOM   1666 O  O     . GLN A 1 214 ? 61.034 6.805   2.544   1.00 13.96 ? 211 GLN A O     1 
ATOM   1667 C  CB    . GLN A 1 214 ? 63.679 8.070   3.939   1.00 15.26 ? 211 GLN A CB    1 
ATOM   1668 C  CG    . GLN A 1 214 ? 64.788 9.104   4.038   1.00 20.85 ? 211 GLN A CG    1 
ATOM   1669 C  CD    . GLN A 1 214 ? 65.353 9.226   5.426   1.00 21.07 ? 211 GLN A CD    1 
ATOM   1670 O  OE1   . GLN A 1 214 ? 64.777 8.732   6.389   1.00 18.75 ? 211 GLN A OE1   1 
ATOM   1671 N  NE2   . GLN A 1 214 ? 66.504 9.885   5.534   1.00 24.02 ? 211 GLN A NE2   1 
ATOM   1672 N  N     . CYS A 1 215 ? 62.860 5.540   2.217   1.00 18.95 ? 212 CYS A N     1 
ATOM   1673 C  CA    . CYS A 1 215 ? 62.087 4.308   2.127   1.00 14.08 ? 212 CYS A CA    1 
ATOM   1674 C  C     . CYS A 1 215 ? 62.871 3.136   2.685   1.00 13.24 ? 212 CYS A C     1 
ATOM   1675 O  O     . CYS A 1 215 ? 64.078 3.232   2.924   1.00 15.98 ? 212 CYS A O     1 
ATOM   1676 C  CB    . CYS A 1 215 ? 61.710 4.006   0.672   1.00 18.09 ? 212 CYS A CB    1 
ATOM   1677 S  SG    . CYS A 1 215 ? 63.124 3.867   -0.451  1.00 27.77 ? 212 CYS A SG    1 
ATOM   1678 N  N     . SER A 1 216 ? 62.163 2.034   2.891   1.00 14.26 ? 213 SER A N     1 
ATOM   1679 C  CA    . SER A 1 216 ? 62.791 0.773   3.251   1.00 15.19 ? 213 SER A CA    1 
ATOM   1680 C  C     . SER A 1 216 ? 62.599 -0.211  2.110   1.00 16.53 ? 213 SER A C     1 
ATOM   1681 O  O     . SER A 1 216 ? 61.805 0.041   1.199   1.00 16.26 ? 213 SER A O     1 
ATOM   1682 C  CB    . SER A 1 216 ? 62.163 0.232   4.527   1.00 18.37 ? 213 SER A CB    1 
ATOM   1683 O  OG    . SER A 1 216 ? 62.396 1.154   5.585   1.00 20.15 ? 213 SER A OG    1 
ATOM   1684 N  N     . ALA A 1 217 ? 63.324 -1.327  2.147   1.00 15.08 ? 214 ALA A N     1 
ATOM   1685 C  CA    . ALA A 1 217 ? 63.148 -2.342  1.105   1.00 10.60 ? 214 ALA A CA    1 
ATOM   1686 C  C     . ALA A 1 217 ? 63.483 -3.746  1.591   1.00 12.47 ? 214 ALA A C     1 
ATOM   1687 O  O     . ALA A 1 217 ? 64.268 -3.909  2.531   1.00 13.11 ? 214 ALA A O     1 
ATOM   1688 C  CB    . ALA A 1 217 ? 63.991 -1.992  -0.118  1.00 12.53 ? 214 ALA A CB    1 
ATOM   1689 N  N     . GLY A 1 218 ? 62.849 -4.746  0.980   1.00 12.84 ? 215 GLY A N     1 
ATOM   1690 C  CA    . GLY A 1 218 ? 63.218 -6.140  1.163   1.00 8.70  ? 215 GLY A CA    1 
ATOM   1691 C  C     . GLY A 1 218 ? 63.738 -6.725  -0.137  1.00 13.13 ? 215 GLY A C     1 
ATOM   1692 O  O     . GLY A 1 218 ? 63.212 -6.429  -1.211  1.00 12.21 ? 215 GLY A O     1 
ATOM   1693 N  N     . ILE A 1 219 ? 64.790 -7.536  -0.046  1.00 12.67 ? 216 ILE A N     1 
ATOM   1694 C  CA    . ILE A 1 219 ? 65.308 -8.255  -1.205  1.00 12.64 ? 216 ILE A CA    1 
ATOM   1695 C  C     . ILE A 1 219 ? 65.295 -9.747  -0.906  1.00 16.63 ? 216 ILE A C     1 
ATOM   1696 O  O     . ILE A 1 219 ? 65.875 -10.186 0.091   1.00 15.70 ? 216 ILE A O     1 
ATOM   1697 C  CB    . ILE A 1 219 ? 66.764 -7.826  -1.517  1.00 14.76 ? 216 ILE A CB    1 
ATOM   1698 C  CG1   . ILE A 1 219 ? 66.869 -6.300  -1.689  1.00 14.73 ? 216 ILE A CG1   1 
ATOM   1699 C  CG2   . ILE A 1 219 ? 67.282 -8.552  -2.755  1.00 15.92 ? 216 ILE A CG2   1 
ATOM   1700 C  CD1   . ILE A 1 219 ? 67.218 -5.514  -0.400  1.00 16.69 ? 216 ILE A CD1   1 
ATOM   1701 N  N     . SER A 1 220 ? 64.628 -10.527 -1.751  1.00 12.10 ? 217 SER A N     1 
ATOM   1702 C  CA    . SER A 1 220 ? 64.595 -11.983 -1.578  1.00 11.98 ? 217 SER A CA    1 
ATOM   1703 C  C     . SER A 1 220 ? 64.335 -12.657 -2.927  1.00 13.16 ? 217 SER A C     1 
ATOM   1704 O  O     . SER A 1 220 ? 64.580 -12.056 -3.966  1.00 15.03 ? 217 SER A O     1 
ATOM   1705 C  CB    . SER A 1 220 ? 63.523 -12.379 -0.566  1.00 15.99 ? 217 SER A CB    1 
ATOM   1706 O  OG    . SER A 1 220 ? 63.699 -13.721 -0.142  1.00 14.63 ? 217 SER A OG    1 
ATOM   1707 N  N     . HIS A 1 221 ? 63.859 -13.901 -2.908  1.00 15.27 ? 218 HIS A N     1 
ATOM   1708 C  CA    . HIS A 1 221 ? 63.614 -14.639 -4.150  1.00 14.52 ? 218 HIS A CA    1 
ATOM   1709 C  C     . HIS A 1 221 ? 62.165 -14.576 -4.651  1.00 13.77 ? 218 HIS A C     1 
ATOM   1710 O  O     . HIS A 1 221 ? 61.857 -15.089 -5.723  1.00 14.17 ? 218 HIS A O     1 
ATOM   1711 C  CB    . HIS A 1 221 ? 64.054 -16.102 -3.995  1.00 13.16 ? 218 HIS A CB    1 
ATOM   1712 C  CG    . HIS A 1 221 ? 65.536 -16.279 -3.874  1.00 18.18 ? 218 HIS A CG    1 
ATOM   1713 N  ND1   . HIS A 1 221 ? 66.409 -15.943 -4.884  1.00 16.06 ? 218 HIS A ND1   1 
ATOM   1714 C  CD2   . HIS A 1 221 ? 66.297 -16.777 -2.865  1.00 16.52 ? 218 HIS A CD2   1 
ATOM   1715 C  CE1   . HIS A 1 221 ? 67.648 -16.217 -4.503  1.00 18.03 ? 218 HIS A CE1   1 
ATOM   1716 N  NE2   . HIS A 1 221 ? 67.605 -16.721 -3.281  1.00 17.11 ? 218 HIS A NE2   1 
ATOM   1717 N  N     . ASN A 1 222 ? 61.279 -13.940 -3.892  1.00 11.34 ? 219 ASN A N     1 
ATOM   1718 C  CA    . ASN A 1 222 ? 59.872 -13.820 -4.297  1.00 10.18 ? 219 ASN A CA    1 
ATOM   1719 C  C     . ASN A 1 222 ? 59.182 -12.651 -3.578  1.00 11.82 ? 219 ASN A C     1 
ATOM   1720 O  O     . ASN A 1 222 ? 59.746 -12.053 -2.657  1.00 16.01 ? 219 ASN A O     1 
ATOM   1721 C  CB    . ASN A 1 222 ? 59.106 -15.136 -4.039  1.00 13.27 ? 219 ASN A CB    1 
ATOM   1722 C  CG    . ASN A 1 222 ? 59.210 -15.599 -2.588  1.00 18.07 ? 219 ASN A CG    1 
ATOM   1723 O  OD1   . ASN A 1 222 ? 58.690 -14.953 -1.689  1.00 14.29 ? 219 ASN A OD1   1 
ATOM   1724 N  ND2   . ASN A 1 222 ? 59.879 -16.727 -2.362  1.00 19.12 ? 219 ASN A ND2   1 
ATOM   1725 N  N     . LYS A 1 223 ? 57.975 -12.319 -4.010  1.00 14.63 ? 220 LYS A N     1 
ATOM   1726 C  CA    . LYS A 1 223 ? 57.244 -11.179 -3.453  1.00 11.94 ? 220 LYS A CA    1 
ATOM   1727 C  C     . LYS A 1 223 ? 56.917 -11.315 -1.962  1.00 13.43 ? 220 LYS A C     1 
ATOM   1728 O  O     . LYS A 1 223 ? 57.019 -10.337 -1.209  1.00 13.37 ? 220 LYS A O     1 
ATOM   1729 C  CB    . LYS A 1 223 ? 55.958 -10.950 -4.263  1.00 13.22 ? 220 LYS A CB    1 
ATOM   1730 C  CG    . LYS A 1 223 ? 56.233 -10.662 -5.754  1.00 15.88 ? 220 LYS A CG    1 
ATOM   1731 C  CD    . LYS A 1 223 ? 54.993 -10.887 -6.641  1.00 22.83 ? 220 LYS A CD    1 
ATOM   1732 C  CE    . LYS A 1 223 ? 53.870 -9.940  -6.312  1.00 26.16 ? 220 LYS A CE    1 
ATOM   1733 N  NZ    . LYS A 1 223 ? 52.811 -9.971  -7.372  1.00 25.53 ? 220 LYS A NZ    1 
ATOM   1734 N  N     . VAL A 1 224 ? 56.492 -12.502 -1.523  1.00 12.85 ? 221 VAL A N     1 
ATOM   1735 C  CA    . VAL A 1 224 ? 56.074 -12.645 -0.115  1.00 10.26 ? 221 VAL A CA    1 
ATOM   1736 C  C     . VAL A 1 224 ? 57.244 -12.448 0.854   1.00 14.52 ? 221 VAL A C     1 
ATOM   1737 O  O     . VAL A 1 224 ? 57.108 -11.746 1.869   1.00 16.53 ? 221 VAL A O     1 
ATOM   1738 C  CB    . VAL A 1 224 ? 55.342 -13.987 0.181   1.00 14.51 ? 221 VAL A CB    1 
ATOM   1739 C  CG1   . VAL A 1 224 ? 55.217 -14.211 1.674   1.00 15.91 ? 221 VAL A CG1   1 
ATOM   1740 C  CG2   . VAL A 1 224 ? 53.971 -13.977 -0.447  1.00 19.10 ? 221 VAL A CG2   1 
ATOM   1741 N  N     . LEU A 1 225 ? 58.386 -13.059 0.546   1.00 14.84 ? 222 LEU A N     1 
ATOM   1742 C  CA    . LEU A 1 225 ? 59.572 -12.880 1.385   1.00 15.42 ? 222 LEU A CA    1 
ATOM   1743 C  C     . LEU A 1 225 ? 60.134 -11.470 1.271   1.00 14.25 ? 222 LEU A C     1 
ATOM   1744 O  O     . LEU A 1 225 ? 60.641 -10.933 2.240   1.00 13.83 ? 222 LEU A O     1 
ATOM   1745 C  CB    . LEU A 1 225 ? 60.662 -13.896 1.053   1.00 12.77 ? 222 LEU A CB    1 
ATOM   1746 C  CG    . LEU A 1 225 ? 60.367 -15.345 1.458   1.00 11.91 ? 222 LEU A CG    1 
ATOM   1747 C  CD1   . LEU A 1 225 ? 61.561 -16.230 1.130   1.00 18.33 ? 222 LEU A CD1   1 
ATOM   1748 C  CD2   . LEU A 1 225 ? 60.068 -15.401 2.934   1.00 18.46 ? 222 LEU A CD2   1 
ATOM   1749 N  N     . ALA A 1 226 ? 60.046 -10.875 0.086   1.00 12.64 ? 223 ALA A N     1 
ATOM   1750 C  CA    . ALA A 1 226 ? 60.529 -9.513  -0.085  1.00 11.92 ? 223 ALA A CA    1 
ATOM   1751 C  C     . ALA A 1 226 ? 59.718 -8.541  0.764   1.00 13.71 ? 223 ALA A C     1 
ATOM   1752 O  O     . ALA A 1 226 ? 60.281 -7.621  1.354   1.00 12.44 ? 223 ALA A O     1 
ATOM   1753 C  CB    . ALA A 1 226 ? 60.489 -9.091  -1.559  1.00 13.89 ? 223 ALA A CB    1 
ATOM   1754 N  N     . LYS A 1 227 ? 58.398 -8.727  0.788   1.00 14.43 ? 224 LYS A N     1 
ATOM   1755 C  CA    . LYS A 1 227 ? 57.497 -7.895  1.592   1.00 15.62 ? 224 LYS A CA    1 
ATOM   1756 C  C     . LYS A 1 227 ? 57.758 -8.087  3.087   1.00 15.87 ? 224 LYS A C     1 
ATOM   1757 O  O     . LYS A 1 227 ? 57.878 -7.117  3.844   1.00 14.22 ? 224 LYS A O     1 
ATOM   1758 C  CB    . LYS A 1 227 ? 56.034 -8.232  1.272   1.00 15.03 ? 224 LYS A CB    1 
ATOM   1759 C  CG    . LYS A 1 227 ? 54.994 -7.520  2.172   1.00 19.80 ? 224 LYS A CG    1 
ATOM   1760 C  CD    . LYS A 1 227 ? 55.005 -6.007  1.955   1.00 25.71 ? 224 LYS A CD    1 
ATOM   1761 C  CE    . LYS A 1 227 ? 53.925 -5.318  2.785   1.00 33.70 ? 224 LYS A CE    1 
ATOM   1762 N  NZ    . LYS A 1 227 ? 54.134 -3.839  2.823   1.00 33.81 ? 224 LYS A NZ    1 
ATOM   1763 N  N     . LEU A 1 228 ? 57.843 -9.341  3.514   1.00 17.32 ? 225 LEU A N     1 
ATOM   1764 C  CA    . LEU A 1 228 ? 58.177 -9.633  4.901   1.00 14.51 ? 225 LEU A CA    1 
ATOM   1765 C  C     . LEU A 1 228 ? 59.516 -9.001  5.309   1.00 21.05 ? 225 LEU A C     1 
ATOM   1766 O  O     . LEU A 1 228 ? 59.604 -8.324  6.340   1.00 17.11 ? 225 LEU A O     1 
ATOM   1767 C  CB    . LEU A 1 228 ? 58.200 -11.140 5.125   1.00 18.90 ? 225 LEU A CB    1 
ATOM   1768 C  CG    . LEU A 1 228 ? 58.380 -11.558 6.581   1.00 22.86 ? 225 LEU A CG    1 
ATOM   1769 C  CD1   . LEU A 1 228 ? 57.175 -11.113 7.421   1.00 19.31 ? 225 LEU A CD1   1 
ATOM   1770 C  CD2   . LEU A 1 228 ? 58.613 -13.067 6.675   1.00 18.50 ? 225 LEU A CD2   1 
ATOM   1771 N  N     . ALA A 1 229 ? 60.551 -9.214  4.497   1.00 17.50 ? 226 ALA A N     1 
ATOM   1772 C  CA    . ALA A 1 229 ? 61.863 -8.606  4.736   1.00 15.11 ? 226 ALA A CA    1 
ATOM   1773 C  C     . ALA A 1 229 ? 61.808 -7.089  4.908   1.00 17.54 ? 226 ALA A C     1 
ATOM   1774 O  O     . ALA A 1 229 ? 62.451 -6.536  5.802   1.00 16.95 ? 226 ALA A O     1 
ATOM   1775 C  CB    . ALA A 1 229 ? 62.843 -8.963  3.597   1.00 13.44 ? 226 ALA A CB    1 
ATOM   1776 N  N     . CYS A 1 230 ? 61.062 -6.414  4.036   1.00 11.75 ? 227 CYS A N     1 
ATOM   1777 C  CA    . CYS A 1 230 ? 61.032 -4.953  4.052   1.00 14.05 ? 227 CYS A CA    1 
ATOM   1778 C  C     . CYS A 1 230 ? 60.693 -4.410  5.448   1.00 16.46 ? 227 CYS A C     1 
ATOM   1779 O  O     . CYS A 1 230 ? 61.283 -3.426  5.908   1.00 20.10 ? 227 CYS A O     1 
ATOM   1780 C  CB    . CYS A 1 230 ? 60.043 -4.431  3.002   1.00 13.70 ? 227 CYS A CB    1 
ATOM   1781 S  SG    . CYS A 1 230 ? 59.917 -2.638  2.937   1.00 17.93 ? 227 CYS A SG    1 
ATOM   1782 N  N     . GLY A 1 231 ? 59.761 -5.073  6.122   1.00 14.41 ? 228 GLY A N     1 
ATOM   1783 C  CA    . GLY A 1 231 ? 59.296 -4.641  7.428   1.00 16.28 ? 228 GLY A CA    1 
ATOM   1784 C  C     . GLY A 1 231 ? 60.203 -4.969  8.606   1.00 19.05 ? 228 GLY A C     1 
ATOM   1785 O  O     . GLY A 1 231 ? 59.958 -4.497  9.712   1.00 21.43 ? 228 GLY A O     1 
ATOM   1786 N  N     . LEU A 1 232 ? 61.257 -5.750  8.387   1.00 14.08 ? 229 LEU A N     1 
ATOM   1787 C  CA    . LEU A 1 232 ? 62.069 -6.238  9.506   1.00 16.30 ? 229 LEU A CA    1 
ATOM   1788 C  C     . LEU A 1 232 ? 62.945 -5.154  10.123  1.00 22.08 ? 229 LEU A C     1 
ATOM   1789 O  O     . LEU A 1 232 ? 63.225 -5.177  11.324  1.00 19.43 ? 229 LEU A O     1 
ATOM   1790 C  CB    . LEU A 1 232 ? 62.941 -7.418  9.062   1.00 18.67 ? 229 LEU A CB    1 
ATOM   1791 C  CG    . LEU A 1 232 ? 62.122 -8.668  8.728   1.00 19.94 ? 229 LEU A CG    1 
ATOM   1792 C  CD1   . LEU A 1 232 ? 63.028 -9.832  8.314   1.00 17.81 ? 229 LEU A CD1   1 
ATOM   1793 C  CD2   . LEU A 1 232 ? 61.229 -9.043  9.916   1.00 21.84 ? 229 LEU A CD2   1 
ATOM   1794 N  N     . ASN A 1 233 ? 63.398 -4.223  9.292   1.00 12.98 ? 230 ASN A N     1 
ATOM   1795 C  CA    . ASN A 1 233 ? 64.217 -3.108  9.746   1.00 19.30 ? 230 ASN A CA    1 
ATOM   1796 C  C     . ASN A 1 233 ? 63.725 -1.823  9.092   1.00 20.50 ? 230 ASN A C     1 
ATOM   1797 O  O     . ASN A 1 233 ? 64.171 -1.459  8.011   1.00 33.02 ? 230 ASN A O     1 
ATOM   1798 C  CB    . ASN A 1 233 ? 65.692 -3.336  9.392   1.00 14.83 ? 230 ASN A CB    1 
ATOM   1799 C  CG    . ASN A 1 233 ? 66.285 -4.550  10.092  1.00 19.31 ? 230 ASN A CG    1 
ATOM   1800 O  OD1   . ASN A 1 233 ? 66.717 -4.456  11.239  1.00 16.19 ? 230 ASN A OD1   1 
ATOM   1801 N  ND2   . ASN A 1 233 ? 66.324 -5.689  9.401   1.00 13.78 ? 230 ASN A ND2   1 
ATOM   1802 N  N     . LYS A 1 234 ? 62.758 -1.176  9.727   1.00 26.07 ? 231 LYS A N     1 
ATOM   1803 C  CA    . LYS A 1 234 ? 62.229 0.101   9.261   1.00 24.04 ? 231 LYS A CA    1 
ATOM   1804 C  C     . LYS A 1 234 ? 62.494 1.076   10.387  1.00 20.59 ? 231 LYS A C     1 
ATOM   1805 O  O     . LYS A 1 234 ? 62.519 0.674   11.546  1.00 25.34 ? 231 LYS A O     1 
ATOM   1806 C  CB    . LYS A 1 234 ? 60.719 0.002   9.024   1.00 27.03 ? 231 LYS A CB    1 
ATOM   1807 C  CG    . LYS A 1 234 ? 60.297 -0.308  7.599   1.00 27.01 ? 231 LYS A CG    1 
ATOM   1808 C  CD    . LYS A 1 234 ? 58.818 0.070   7.386   1.00 27.70 ? 231 LYS A CD    1 
ATOM   1809 C  CE    . LYS A 1 234 ? 58.442 0.159   5.903   1.00 30.94 ? 231 LYS A CE    1 
ATOM   1810 N  NZ    . LYS A 1 234 ? 58.477 1.572   5.365   1.00 20.46 ? 231 LYS A NZ    1 
ATOM   1811 N  N     . PRO A 1 235 ? 62.676 2.367   10.076  1.00 16.34 ? 232 PRO A N     1 
ATOM   1812 C  CA    . PRO A 1 235 ? 62.663 3.028   8.770   1.00 17.39 ? 232 PRO A CA    1 
ATOM   1813 C  C     . PRO A 1 235 ? 64.046 3.155   8.146   1.00 17.56 ? 232 PRO A C     1 
ATOM   1814 O  O     . PRO A 1 235 ? 65.063 2.919   8.808   1.00 14.90 ? 232 PRO A O     1 
ATOM   1815 C  CB    . PRO A 1 235 ? 62.153 4.429   9.118   1.00 18.62 ? 232 PRO A CB    1 
ATOM   1816 C  CG    . PRO A 1 235 ? 62.754 4.683   10.487  1.00 20.26 ? 232 PRO A CG    1 
ATOM   1817 C  CD    . PRO A 1 235 ? 62.783 3.340   11.179  1.00 16.90 ? 232 PRO A CD    1 
ATOM   1818 N  N     . ASN A 1 236 ? 64.064 3.535   6.869   1.00 13.17 ? 233 ASN A N     1 
ATOM   1819 C  CA    . ASN A 1 236 ? 65.288 3.914   6.172   1.00 14.87 ? 233 ASN A CA    1 
ATOM   1820 C  C     . ASN A 1 236 ? 66.378 2.838   6.121   1.00 12.35 ? 233 ASN A C     1 
ATOM   1821 O  O     . ASN A 1 236 ? 67.565 3.161   6.166   1.00 14.83 ? 233 ASN A O     1 
ATOM   1822 C  CB    . ASN A 1 236 ? 65.853 5.221   6.750   1.00 16.10 ? 233 ASN A CB    1 
ATOM   1823 C  CG    . ASN A 1 236 ? 66.832 5.913   5.803   1.00 23.92 ? 233 ASN A CG    1 
ATOM   1824 O  OD1   . ASN A 1 236 ? 66.678 5.868   4.584   1.00 20.23 ? 233 ASN A OD1   1 
ATOM   1825 N  ND2   . ASN A 1 236 ? 67.838 6.556   6.366   1.00 24.32 ? 233 ASN A ND2   1 
ATOM   1826 N  N     . ARG A 1 237 ? 65.979 1.571   6.022   1.00 13.45 ? 234 ARG A N     1 
ATOM   1827 C  CA    . ARG A 1 237 ? 66.942 0.467   5.957   1.00 15.18 ? 234 ARG A CA    1 
ATOM   1828 C  C     . ARG A 1 237 ? 66.423 -0.551  4.968   1.00 12.57 ? 234 ARG A C     1 
ATOM   1829 O  O     . ARG A 1 237 ? 65.262 -0.499  4.594   1.00 14.13 ? 234 ARG A O     1 
ATOM   1830 C  CB    . ARG A 1 237 ? 67.106 -0.204  7.329   1.00 12.34 ? 234 ARG A CB    1 
ATOM   1831 C  CG    . ARG A 1 237 ? 67.758 0.680   8.383   1.00 15.64 ? 234 ARG A CG    1 
ATOM   1832 C  CD    . ARG A 1 237 ? 69.184 1.031   7.977   1.00 27.94 ? 234 ARG A CD    1 
ATOM   1833 N  NE    . ARG A 1 237 ? 69.890 1.787   9.010   1.00 25.12 ? 234 ARG A NE    1 
ATOM   1834 C  CZ    . ARG A 1 237 ? 69.979 3.115   9.034   1.00 28.24 ? 234 ARG A CZ    1 
ATOM   1835 N  NH1   . ARG A 1 237 ? 69.412 3.840   8.077   1.00 24.79 ? 234 ARG A NH1   1 
ATOM   1836 N  NH2   . ARG A 1 237 ? 70.641 3.719   10.012  1.00 27.42 ? 234 ARG A NH2   1 
ATOM   1837 N  N     . GLN A 1 238 ? 67.274 -1.468  4.522   1.00 13.67 ? 235 GLN A N     1 
ATOM   1838 C  CA    . GLN A 1 238 ? 66.796 -2.524  3.638   1.00 12.46 ? 235 GLN A CA    1 
ATOM   1839 C  C     . GLN A 1 238 ? 67.308 -3.854  4.162   1.00 14.59 ? 235 GLN A C     1 
ATOM   1840 O  O     . GLN A 1 238 ? 68.359 -3.896  4.786   1.00 16.32 ? 235 GLN A O     1 
ATOM   1841 C  CB    . GLN A 1 238 ? 67.237 -2.302  2.190   1.00 11.17 ? 235 GLN A CB    1 
ATOM   1842 C  CG    . GLN A 1 238 ? 68.756 -2.178  1.994   1.00 14.26 ? 235 GLN A CG    1 
ATOM   1843 C  CD    . GLN A 1 238 ? 69.133 -1.910  0.539   1.00 13.92 ? 235 GLN A CD    1 
ATOM   1844 O  OE1   . GLN A 1 238 ? 68.757 -0.886  -0.040  1.00 17.85 ? 235 GLN A OE1   1 
ATOM   1845 N  NE2   . GLN A 1 238 ? 69.869 -2.832  -0.055  1.00 13.75 ? 235 GLN A NE2   1 
ATOM   1846 N  N     . THR A 1 239 ? 66.552 -4.922  3.915   1.00 12.31 ? 236 THR A N     1 
ATOM   1847 C  CA    . THR A 1 239 ? 66.869 -6.228  4.483   1.00 15.68 ? 236 THR A CA    1 
ATOM   1848 C  C     . THR A 1 239 ? 66.899 -7.320  3.428   1.00 16.24 ? 236 THR A C     1 
ATOM   1849 O  O     . THR A 1 239 ? 65.989 -7.433  2.597   1.00 14.54 ? 236 THR A O     1 
ATOM   1850 C  CB    . THR A 1 239 ? 65.870 -6.600  5.585   1.00 13.46 ? 236 THR A CB    1 
ATOM   1851 O  OG1   . THR A 1 239 ? 65.859 -5.569  6.574   1.00 13.77 ? 236 THR A OG1   1 
ATOM   1852 C  CG2   . THR A 1 239 ? 66.255 -7.912  6.282   1.00 18.97 ? 236 THR A CG2   1 
ATOM   1853 N  N     . LEU A 1 240 ? 67.963 -8.122  3.472   1.00 14.13 ? 237 LEU A N     1 
ATOM   1854 C  CA    . LEU A 1 240 ? 68.124 -9.262  2.578   1.00 14.83 ? 237 LEU A CA    1 
ATOM   1855 C  C     . LEU A 1 240 ? 67.725 -10.542 3.312   1.00 15.09 ? 237 LEU A C     1 
ATOM   1856 O  O     . LEU A 1 240 ? 68.288 -10.873 4.364   1.00 13.96 ? 237 LEU A O     1 
ATOM   1857 C  CB    . LEU A 1 240 ? 69.573 -9.331  2.063   1.00 14.10 ? 237 LEU A CB    1 
ATOM   1858 C  CG    . LEU A 1 240 ? 69.962 -10.380 1.007   1.00 15.02 ? 237 LEU A CG    1 
ATOM   1859 C  CD1   . LEU A 1 240 ? 71.307 -10.020 0.334   1.00 10.96 ? 237 LEU A CD1   1 
ATOM   1860 C  CD2   . LEU A 1 240 ? 70.001 -11.795 1.571   1.00 15.83 ? 237 LEU A CD2   1 
ATOM   1861 N  N     . VAL A 1 241 ? 66.725 -11.237 2.773   1.00 13.38 ? 238 VAL A N     1 
ATOM   1862 C  CA    . VAL A 1 241 ? 66.286 -12.517 3.329   1.00 15.62 ? 238 VAL A CA    1 
ATOM   1863 C  C     . VAL A 1 241 ? 66.653 -13.632 2.358   1.00 16.12 ? 238 VAL A C     1 
ATOM   1864 O  O     . VAL A 1 241 ? 66.048 -13.753 1.294   1.00 13.60 ? 238 VAL A O     1 
ATOM   1865 C  CB    . VAL A 1 241 ? 64.766 -12.526 3.575   1.00 13.28 ? 238 VAL A CB    1 
ATOM   1866 C  CG1   . VAL A 1 241 ? 64.244 -13.960 3.766   1.00 13.14 ? 238 VAL A CG1   1 
ATOM   1867 C  CG2   . VAL A 1 241 ? 64.430 -11.652 4.782   1.00 11.78 ? 238 VAL A CG2   1 
ATOM   1868 N  N     . SER A 1 242 ? 67.661 -14.429 2.707   1.00 12.95 ? 239 SER A N     1 
ATOM   1869 C  CA    . SER A 1 242 ? 68.111 -15.486 1.803   1.00 14.88 ? 239 SER A CA    1 
ATOM   1870 C  C     . SER A 1 242 ? 67.268 -16.752 1.962   1.00 11.19 ? 239 SER A C     1 
ATOM   1871 O  O     . SER A 1 242 ? 66.532 -16.903 2.929   1.00 12.78 ? 239 SER A O     1 
ATOM   1872 C  CB    . SER A 1 242 ? 69.585 -15.815 2.056   1.00 15.99 ? 239 SER A CB    1 
ATOM   1873 O  OG    . SER A 1 242 ? 69.738 -16.246 3.396   1.00 17.86 ? 239 SER A OG    1 
ATOM   1874 N  N     . HIS A 1 243 ? 67.383 -17.666 1.011   1.00 13.23 ? 240 HIS A N     1 
ATOM   1875 C  CA    . HIS A 1 243 ? 66.662 -18.923 1.113   1.00 13.93 ? 240 HIS A CA    1 
ATOM   1876 C  C     . HIS A 1 243 ? 67.039 -19.646 2.405   1.00 15.09 ? 240 HIS A C     1 
ATOM   1877 O  O     . HIS A 1 243 ? 66.181 -20.199 3.096   1.00 13.56 ? 240 HIS A O     1 
ATOM   1878 C  CB    . HIS A 1 243 ? 66.973 -19.810 -0.092  1.00 16.92 ? 240 HIS A CB    1 
ATOM   1879 C  CG    . HIS A 1 243 ? 66.190 -21.081 -0.113  1.00 20.85 ? 240 HIS A CG    1 
ATOM   1880 N  ND1   . HIS A 1 243 ? 64.835 -21.112 -0.351  1.00 20.99 ? 240 HIS A ND1   1 
ATOM   1881 C  CD2   . HIS A 1 243 ? 66.567 -22.364 0.107   1.00 21.40 ? 240 HIS A CD2   1 
ATOM   1882 C  CE1   . HIS A 1 243 ? 64.411 -22.363 -0.299  1.00 24.71 ? 240 HIS A CE1   1 
ATOM   1883 N  NE2   . HIS A 1 243 ? 65.442 -23.141 -0.017  1.00 21.15 ? 240 HIS A NE2   1 
ATOM   1884 N  N     . GLY A 1 244 ? 68.331 -19.613 2.723   1.00 15.44 ? 241 GLY A N     1 
ATOM   1885 C  CA    . GLY A 1 244 ? 68.873 -20.287 3.897   1.00 14.00 ? 241 GLY A CA    1 
ATOM   1886 C  C     . GLY A 1 244 ? 68.332 -19.768 5.212   1.00 15.93 ? 241 GLY A C     1 
ATOM   1887 O  O     . GLY A 1 244 ? 68.246 -20.523 6.179   1.00 16.57 ? 241 GLY A O     1 
ATOM   1888 N  N     . SER A 1 245 ? 67.973 -18.484 5.253   1.00 15.28 ? 242 SER A N     1 
ATOM   1889 C  CA    . SER A 1 245 ? 67.471 -17.866 6.480   1.00 14.52 ? 242 SER A CA    1 
ATOM   1890 C  C     . SER A 1 245 ? 66.047 -18.285 6.804   1.00 14.35 ? 242 SER A C     1 
ATOM   1891 O  O     . SER A 1 245 ? 65.565 -18.048 7.908   1.00 12.90 ? 242 SER A O     1 
ATOM   1892 C  CB    . SER A 1 245 ? 67.545 -16.334 6.393   1.00 11.30 ? 242 SER A CB    1 
ATOM   1893 O  OG    . SER A 1 245 ? 66.525 -15.810 5.552   1.00 14.81 ? 242 SER A OG    1 
ATOM   1894 N  N     . VAL A 1 246 ? 65.372 -18.928 5.859   1.00 13.45 ? 243 VAL A N     1 
ATOM   1895 C  CA    . VAL A 1 246 ? 63.939 -19.181 6.039   1.00 12.17 ? 243 VAL A CA    1 
ATOM   1896 C  C     . VAL A 1 246 ? 63.567 -20.098 7.219   1.00 15.31 ? 243 VAL A C     1 
ATOM   1897 O  O     . VAL A 1 246 ? 62.702 -19.752 8.024   1.00 12.73 ? 243 VAL A O     1 
ATOM   1898 C  CB    . VAL A 1 246 ? 63.275 -19.640 4.739   1.00 12.63 ? 243 VAL A CB    1 
ATOM   1899 C  CG1   . VAL A 1 246 ? 61.812 -20.098 5.001   1.00 14.00 ? 243 VAL A CG1   1 
ATOM   1900 C  CG2   . VAL A 1 246 ? 63.319 -18.502 3.734   1.00 14.78 ? 243 VAL A CG2   1 
ATOM   1901 N  N     . PRO A 1 247 ? 64.223 -21.262 7.339   1.00 16.25 ? 244 PRO A N     1 
ATOM   1902 C  CA    . PRO A 1 247 ? 63.831 -22.119 8.465   1.00 14.48 ? 244 PRO A CA    1 
ATOM   1903 C  C     . PRO A 1 247 ? 63.861 -21.419 9.832   1.00 17.73 ? 244 PRO A C     1 
ATOM   1904 O  O     . PRO A 1 247 ? 62.902 -21.552 10.599  1.00 12.66 ? 244 PRO A O     1 
ATOM   1905 C  CB    . PRO A 1 247 ? 64.852 -23.269 8.407   1.00 15.22 ? 244 PRO A CB    1 
ATOM   1906 C  CG    . PRO A 1 247 ? 65.239 -23.339 6.927   1.00 18.32 ? 244 PRO A CG    1 
ATOM   1907 C  CD    . PRO A 1 247 ? 65.267 -21.883 6.493   1.00 13.54 ? 244 PRO A CD    1 
ATOM   1908 N  N     . GLN A 1 248 ? 64.927 -20.688 10.140  1.00 14.25 ? 245 GLN A N     1 
ATOM   1909 C  CA    . GLN A 1 248 ? 64.992 -20.013 11.437  1.00 17.85 ? 245 GLN A CA    1 
ATOM   1910 C  C     . GLN A 1 248 ? 63.992 -18.852 11.532  1.00 18.92 ? 245 GLN A C     1 
ATOM   1911 O  O     . GLN A 1 248 ? 63.314 -18.690 12.549  1.00 15.52 ? 245 GLN A O     1 
ATOM   1912 C  CB    . GLN A 1 248 ? 66.416 -19.540 11.746  1.00 15.96 ? 245 GLN A CB    1 
ATOM   1913 C  CG    . GLN A 1 248 ? 67.399 -20.694 11.967  1.00 21.51 ? 245 GLN A CG    1 
ATOM   1914 C  CD    . GLN A 1 248 ? 68.457 -20.386 13.026  1.00 39.56 ? 245 GLN A CD    1 
ATOM   1915 O  OE1   . GLN A 1 248 ? 68.149 -20.298 14.219  1.00 45.69 ? 245 GLN A OE1   1 
ATOM   1916 N  NE2   . GLN A 1 248 ? 69.712 -20.233 12.594  1.00 30.44 ? 245 GLN A NE2   1 
ATOM   1917 N  N     . LEU A 1 249 ? 63.896 -18.061 10.466  1.00 12.41 ? 246 LEU A N     1 
ATOM   1918 C  CA    . LEU A 1 249 ? 62.945 -16.940 10.440  1.00 13.08 ? 246 LEU A CA    1 
ATOM   1919 C  C     . LEU A 1 249 ? 61.511 -17.416 10.667  1.00 13.36 ? 246 LEU A C     1 
ATOM   1920 O  O     . LEU A 1 249 ? 60.759 -16.847 11.465  1.00 13.37 ? 246 LEU A O     1 
ATOM   1921 C  CB    . LEU A 1 249 ? 63.053 -16.191 9.104   1.00 14.15 ? 246 LEU A CB    1 
ATOM   1922 C  CG    . LEU A 1 249 ? 62.184 -14.950 8.921   1.00 17.14 ? 246 LEU A CG    1 
ATOM   1923 C  CD1   . LEU A 1 249 ? 62.562 -13.917 9.966   1.00 18.15 ? 246 LEU A CD1   1 
ATOM   1924 C  CD2   . LEU A 1 249 ? 62.305 -14.366 7.493   1.00 19.21 ? 246 LEU A CD2   1 
ATOM   1925 N  N     . PHE A 1 250 ? 61.135 -18.484 9.975   1.00 14.07 ? 247 PHE A N     1 
ATOM   1926 C  CA    . PHE A 1 250 ? 59.765 -18.971 10.042  1.00 13.80 ? 247 PHE A CA    1 
ATOM   1927 C  C     . PHE A 1 250 ? 59.449 -19.735 11.316  1.00 14.01 ? 247 PHE A C     1 
ATOM   1928 O  O     . PHE A 1 250 ? 58.278 -19.893 11.668  1.00 13.90 ? 247 PHE A O     1 
ATOM   1929 C  CB    . PHE A 1 250 ? 59.449 -19.843 8.821   1.00 11.89 ? 247 PHE A CB    1 
ATOM   1930 C  CG    . PHE A 1 250 ? 59.018 -19.061 7.616   1.00 13.45 ? 247 PHE A CG    1 
ATOM   1931 C  CD1   . PHE A 1 250 ? 58.491 -19.713 6.509   1.00 14.26 ? 247 PHE A CD1   1 
ATOM   1932 C  CD2   . PHE A 1 250 ? 59.131 -17.675 7.594   1.00 18.98 ? 247 PHE A CD2   1 
ATOM   1933 C  CE1   . PHE A 1 250 ? 58.073 -19.004 5.400   1.00 14.47 ? 247 PHE A CE1   1 
ATOM   1934 C  CE2   . PHE A 1 250 ? 58.721 -16.947 6.492   1.00 16.73 ? 247 PHE A CE2   1 
ATOM   1935 C  CZ    . PHE A 1 250 ? 58.186 -17.609 5.389   1.00 12.32 ? 247 PHE A CZ    1 
ATOM   1936 N  N     . SER A 1 251 ? 60.483 -20.223 12.001  1.00 12.55 ? 248 SER A N     1 
ATOM   1937 C  CA    . SER A 1 251 ? 60.268 -21.064 13.179  1.00 13.15 ? 248 SER A CA    1 
ATOM   1938 C  C     . SER A 1 251 ? 59.545 -20.320 14.307  1.00 14.67 ? 248 SER A C     1 
ATOM   1939 O  O     . SER A 1 251 ? 58.877 -20.939 15.136  1.00 13.62 ? 248 SER A O     1 
ATOM   1940 C  CB    . SER A 1 251 ? 61.596 -21.665 13.685  1.00 16.54 ? 248 SER A CB    1 
ATOM   1941 O  OG    . SER A 1 251 ? 62.351 -20.720 14.415  1.00 14.21 ? 248 SER A OG    1 
ATOM   1942 N  N     . GLN A 1 252 ? 59.665 -18.995 14.348  1.00 12.36 ? 249 GLN A N     1 
ATOM   1943 C  CA    . GLN A 1 252 ? 58.889 -18.249 15.329  1.00 13.45 ? 249 GLN A CA    1 
ATOM   1944 C  C     . GLN A 1 252 ? 58.057 -17.132 14.700  1.00 17.74 ? 249 GLN A C     1 
ATOM   1945 O  O     . GLN A 1 252 ? 57.755 -16.145 15.362  1.00 20.14 ? 249 GLN A O     1 
ATOM   1946 C  CB    . GLN A 1 252 ? 59.814 -17.620 16.376  1.00 16.64 ? 249 GLN A CB    1 
ATOM   1947 C  CG    . GLN A 1 252 ? 60.685 -18.593 17.113  1.00 19.08 ? 249 GLN A CG    1 
ATOM   1948 C  CD    . GLN A 1 252 ? 61.473 -17.875 18.181  1.00 28.06 ? 249 GLN A CD    1 
ATOM   1949 O  OE1   . GLN A 1 252 ? 60.975 -17.627 19.284  1.00 28.27 ? 249 GLN A OE1   1 
ATOM   1950 N  NE2   . GLN A 1 252 ? 62.691 -17.489 17.844  1.00 25.00 ? 249 GLN A NE2   1 
ATOM   1951 N  N     . MET A 1 253 ? 57.696 -17.283 13.432  1.00 12.24 ? 250 MET A N     1 
ATOM   1952 C  CA    . MET A 1 253 ? 56.953 -16.240 12.733  1.00 18.49 ? 250 MET A CA    1 
ATOM   1953 C  C     . MET A 1 253 ? 55.464 -16.563 12.789  1.00 12.72 ? 250 MET A C     1 
ATOM   1954 O  O     . MET A 1 253 ? 55.027 -17.560 12.233  1.00 16.28 ? 250 MET A O     1 
ATOM   1955 C  CB    . MET A 1 253 ? 57.441 -16.158 11.275  1.00 15.82 ? 250 MET A CB    1 
ATOM   1956 C  CG    . MET A 1 253 ? 56.776 -15.077 10.417  1.00 20.87 ? 250 MET A CG    1 
ATOM   1957 S  SD    . MET A 1 253 ? 57.158 -13.405 10.972  1.00 24.44 ? 250 MET A SD    1 
ATOM   1958 C  CE    . MET A 1 253 ? 58.944 -13.285 10.740  1.00 18.85 ? 250 MET A CE    1 
ATOM   1959 N  N     . PRO A 1 254 ? 54.672 -15.715 13.460  1.00 16.54 ? 251 PRO A N     1 
ATOM   1960 C  CA    . PRO A 1 254 ? 53.229 -15.975 13.508  1.00 16.77 ? 251 PRO A CA    1 
ATOM   1961 C  C     . PRO A 1 254 ? 52.651 -15.989 12.101  1.00 15.35 ? 251 PRO A C     1 
ATOM   1962 O  O     . PRO A 1 254 ? 53.057 -15.207 11.249  1.00 13.26 ? 251 PRO A O     1 
ATOM   1963 C  CB    . PRO A 1 254 ? 52.676 -14.781 14.306  1.00 16.60 ? 251 PRO A CB    1 
ATOM   1964 C  CG    . PRO A 1 254 ? 53.851 -14.300 15.104  1.00 16.85 ? 251 PRO A CG    1 
ATOM   1965 C  CD    . PRO A 1 254 ? 55.033 -14.484 14.174  1.00 17.34 ? 251 PRO A CD    1 
ATOM   1966 N  N     . ILE A 1 255 ? 51.705 -16.884 11.870  1.00 16.22 ? 252 ILE A N     1 
ATOM   1967 C  CA    . ILE A 1 255 ? 51.140 -17.087 10.549  1.00 15.15 ? 252 ILE A CA    1 
ATOM   1968 C  C     . ILE A 1 255 ? 50.536 -15.801 9.969   1.00 17.98 ? 252 ILE A C     1 
ATOM   1969 O  O     . ILE A 1 255 ? 50.666 -15.538 8.770   1.00 13.87 ? 252 ILE A O     1 
ATOM   1970 C  CB    . ILE A 1 255 ? 50.163 -18.287 10.569  1.00 20.80 ? 252 ILE A CB    1 
ATOM   1971 C  CG1   . ILE A 1 255 ? 50.980 -19.589 10.539  1.00 21.11 ? 252 ILE A CG1   1 
ATOM   1972 C  CG2   . ILE A 1 255 ? 49.188 -18.249 9.385   1.00 19.10 ? 252 ILE A CG2   1 
ATOM   1973 C  CD1   . ILE A 1 255 ? 50.316 -20.742 11.223  1.00 20.33 ? 252 ILE A CD1   1 
ATOM   1974 N  N     . ARG A 1 256 ? 49.937 -14.973 10.827  1.00 15.36 ? 253 ARG A N     1 
ATOM   1975 C  CA    . ARG A 1 256 ? 49.273 -13.755 10.377  1.00 17.08 ? 253 ARG A CA    1 
ATOM   1976 C  C     . ARG A 1 256 ? 50.213 -12.694 9.783   1.00 20.48 ? 253 ARG A C     1 
ATOM   1977 O  O     . ARG A 1 256 ? 49.751 -11.740 9.150   1.00 18.37 ? 253 ARG A O     1 
ATOM   1978 C  CB    . ARG A 1 256 ? 48.470 -13.136 11.528  1.00 17.17 ? 253 ARG A CB    1 
ATOM   1979 C  CG    . ARG A 1 256 ? 49.359 -12.530 12.597  1.00 19.13 ? 253 ARG A CG    1 
ATOM   1980 C  CD    . ARG A 1 256 ? 48.556 -11.922 13.744  1.00 23.96 ? 253 ARG A CD    1 
ATOM   1981 N  NE    . ARG A 1 256 ? 49.437 -11.449 14.817  1.00 21.35 ? 253 ARG A NE    1 
ATOM   1982 C  CZ    . ARG A 1 256 ? 49.844 -12.194 15.842  1.00 27.07 ? 253 ARG A CZ    1 
ATOM   1983 N  NH1   . ARG A 1 256 ? 49.452 -13.459 15.948  1.00 23.98 ? 253 ARG A NH1   1 
ATOM   1984 N  NH2   . ARG A 1 256 ? 50.648 -11.675 16.763  1.00 23.68 ? 253 ARG A NH2   1 
ATOM   1985 N  N     . LYS A 1 257 ? 51.522 -12.834 9.990   1.00 18.62 ? 254 LYS A N     1 
ATOM   1986 C  CA    . LYS A 1 257 ? 52.453 -11.836 9.452   1.00 18.26 ? 254 LYS A CA    1 
ATOM   1987 C  C     . LYS A 1 257 ? 52.703 -11.976 7.960   1.00 21.44 ? 254 LYS A C     1 
ATOM   1988 O  O     . LYS A 1 257 ? 53.200 -11.039 7.322   1.00 18.53 ? 254 LYS A O     1 
ATOM   1989 C  CB    . LYS A 1 257 ? 53.798 -11.863 10.181  1.00 17.88 ? 254 LYS A CB    1 
ATOM   1990 C  CG    . LYS A 1 257 ? 53.681 -11.650 11.669  1.00 22.85 ? 254 LYS A CG    1 
ATOM   1991 C  CD    . LYS A 1 257 ? 52.956 -10.373 12.010  1.00 24.03 ? 254 LYS A CD    1 
ATOM   1992 C  CE    . LYS A 1 257 ? 52.994 -10.162 13.526  1.00 39.12 ? 254 LYS A CE    1 
ATOM   1993 N  NZ    . LYS A 1 257 ? 52.537 -8.815  13.959  1.00 31.96 ? 254 LYS A NZ    1 
ATOM   1994 N  N     . ILE A 1 258 ? 52.378 -13.142 7.406   1.00 13.69 ? 255 ILE A N     1 
ATOM   1995 C  CA    . ILE A 1 258 ? 52.610 -13.389 5.984   1.00 13.95 ? 255 ILE A CA    1 
ATOM   1996 C  C     . ILE A 1 258 ? 51.472 -12.810 5.147   1.00 19.77 ? 255 ILE A C     1 
ATOM   1997 O  O     . ILE A 1 258 ? 50.291 -12.998 5.463   1.00 19.14 ? 255 ILE A O     1 
ATOM   1998 C  CB    . ILE A 1 258 ? 52.773 -14.896 5.704   1.00 21.59 ? 255 ILE A CB    1 
ATOM   1999 C  CG1   . ILE A 1 258 ? 54.160 -15.361 6.145   1.00 23.42 ? 255 ILE A CG1   1 
ATOM   2000 C  CG2   . ILE A 1 258 ? 52.576 -15.211 4.231   1.00 20.64 ? 255 ILE A CG2   1 
ATOM   2001 C  CD1   . ILE A 1 258 ? 54.409 -15.198 7.614   1.00 28.05 ? 255 ILE A CD1   1 
ATOM   2002 N  N     . ARG A 1 259 ? 51.823 -12.098 4.085   1.00 18.31 ? 256 ARG A N     1 
ATOM   2003 C  CA    . ARG A 1 259 ? 50.804 -11.439 3.259   1.00 21.33 ? 256 ARG A CA    1 
ATOM   2004 C  C     . ARG A 1 259 ? 49.754 -12.429 2.745   1.00 21.94 ? 256 ARG A C     1 
ATOM   2005 O  O     . ARG A 1 259 ? 50.092 -13.449 2.146   1.00 19.20 ? 256 ARG A O     1 
ATOM   2006 C  CB    . ARG A 1 259 ? 51.432 -10.698 2.081   1.00 20.60 ? 256 ARG A CB    1 
ATOM   2007 C  CG    . ARG A 1 259 ? 50.431 -9.841  1.333   1.00 21.35 ? 256 ARG A CG    1 
ATOM   2008 C  CD    . ARG A 1 259 ? 51.029 -9.164  0.103   1.00 32.10 ? 256 ARG A CD    1 
ATOM   2009 N  NE    . ARG A 1 259 ? 50.104 -8.162  -0.434  1.00 34.05 ? 256 ARG A NE    1 
ATOM   2010 C  CZ    . ARG A 1 259 ? 49.180 -8.418  -1.357  1.00 45.02 ? 256 ARG A CZ    1 
ATOM   2011 N  NH1   . ARG A 1 259 ? 49.069 -9.642  -1.863  1.00 46.88 ? 256 ARG A NH1   1 
ATOM   2012 N  NH2   . ARG A 1 259 ? 48.370 -7.453  -1.779  1.00 40.72 ? 256 ARG A NH2   1 
ATOM   2013 N  N     . SER A 1 260 ? 48.489 -12.097 2.992   1.00 18.47 ? 257 SER A N     1 
ATOM   2014 C  CA    . SER A 1 260 ? 47.315 -12.882 2.596   1.00 19.22 ? 257 SER A CA    1 
ATOM   2015 C  C     . SER A 1 260 ? 46.814 -13.812 3.711   1.00 22.00 ? 257 SER A C     1 
ATOM   2016 O  O     . SER A 1 260 ? 45.716 -14.362 3.613   1.00 16.85 ? 257 SER A O     1 
ATOM   2017 C  CB    . SER A 1 260 ? 47.526 -13.646 1.272   1.00 23.58 ? 257 SER A CB    1 
ATOM   2018 O  OG    . SER A 1 260 ? 48.099 -14.935 1.482   1.00 22.94 ? 257 SER A OG    1 
ATOM   2019 N  N     . LEU A 1 261 ? 47.611 -13.976 4.769   1.00 12.57 ? 258 LEU A N     1 
ATOM   2020 C  CA    . LEU A 1 261 ? 47.197 -14.802 5.909   1.00 16.33 ? 258 LEU A CA    1 
ATOM   2021 C  C     . LEU A 1 261 ? 46.798 -13.972 7.137   1.00 16.90 ? 258 LEU A C     1 
ATOM   2022 O  O     . LEU A 1 261 ? 46.698 -14.499 8.247   1.00 16.62 ? 258 LEU A O     1 
ATOM   2023 C  CB    . LEU A 1 261 ? 48.298 -15.815 6.264   1.00 16.75 ? 258 LEU A CB    1 
ATOM   2024 C  CG    . LEU A 1 261 ? 48.761 -16.733 5.120   1.00 19.13 ? 258 LEU A CG    1 
ATOM   2025 C  CD1   . LEU A 1 261 ? 49.902 -17.628 5.561   1.00 16.38 ? 258 LEU A CD1   1 
ATOM   2026 C  CD2   . LEU A 1 261 ? 47.613 -17.592 4.568   1.00 20.81 ? 258 LEU A CD2   1 
ATOM   2027 N  N     . GLY A 1 262 ? 46.550 -12.679 6.936   1.00 18.51 ? 259 GLY A N     1 
ATOM   2028 C  CA    . GLY A 1 262 ? 46.266 -11.783 8.049   1.00 16.43 ? 259 GLY A CA    1 
ATOM   2029 C  C     . GLY A 1 262 ? 44.807 -11.779 8.474   1.00 22.82 ? 259 GLY A C     1 
ATOM   2030 O  O     . GLY A 1 262 ? 44.440 -11.126 9.450   1.00 22.56 ? 259 GLY A O     1 
ATOM   2031 N  N     . GLY A 1 263 ? 43.979 -12.518 7.742   1.00 19.11 ? 260 GLY A N     1 
ATOM   2032 C  CA    . GLY A 1 263 ? 42.543 -12.530 7.961   1.00 18.93 ? 260 GLY A CA    1 
ATOM   2033 C  C     . GLY A 1 263 ? 41.968 -13.899 8.306   1.00 26.50 ? 260 GLY A C     1 
ATOM   2034 O  O     . GLY A 1 263 ? 42.573 -14.673 9.064   1.00 18.36 ? 260 GLY A O     1 
ATOM   2035 N  N     . LYS A 1 264 ? 40.793 -14.205 7.753   1.00 18.54 ? 261 LYS A N     1 
ATOM   2036 C  CA    . LYS A 1 264 ? 40.070 -15.434 8.099   1.00 20.35 ? 261 LYS A CA    1 
ATOM   2037 C  C     . LYS A 1 264 ? 40.788 -16.738 7.729   1.00 17.36 ? 261 LYS A C     1 
ATOM   2038 O  O     . LYS A 1 264 ? 40.718 -17.708 8.486   1.00 19.68 ? 261 LYS A O     1 
ATOM   2039 C  CB    . LYS A 1 264 ? 38.659 -15.437 7.484   1.00 20.94 ? 261 LYS A CB    1 
ATOM   2040 C  CG    . LYS A 1 264 ? 37.708 -14.445 8.142   1.00 26.14 ? 261 LYS A CG    1 
ATOM   2041 C  CD    . LYS A 1 264 ? 36.407 -14.288 7.331   1.00 28.23 ? 261 LYS A CD    1 
ATOM   2042 C  CE    . LYS A 1 264 ? 35.491 -13.238 7.959   1.00 45.69 ? 261 LYS A CE    1 
ATOM   2043 N  NZ    . LYS A 1 264 ? 34.266 -12.997 7.142   1.00 43.48 ? 261 LYS A NZ    1 
ATOM   2044 N  N     . LEU A 1 265 ? 41.426 -16.781 6.562   1.00 14.20 ? 262 LEU A N     1 
ATOM   2045 C  CA    . LEU A 1 265 ? 42.165 -17.982 6.153   1.00 16.04 ? 262 LEU A CA    1 
ATOM   2046 C  C     . LEU A 1 265 ? 43.262 -18.294 7.165   1.00 18.47 ? 262 LEU A C     1 
ATOM   2047 O  O     . LEU A 1 265 ? 43.440 -19.449 7.568   1.00 19.20 ? 262 LEU A O     1 
ATOM   2048 C  CB    . LEU A 1 265 ? 42.798 -17.795 4.778   1.00 15.60 ? 262 LEU A CB    1 
ATOM   2049 C  CG    . LEU A 1 265 ? 43.668 -18.931 4.228   1.00 15.48 ? 262 LEU A CG    1 
ATOM   2050 C  CD1   . LEU A 1 265 ? 42.841 -20.217 4.116   1.00 19.83 ? 262 LEU A CD1   1 
ATOM   2051 C  CD2   . LEU A 1 265 ? 44.254 -18.535 2.865   1.00 17.48 ? 262 LEU A CD2   1 
ATOM   2052 N  N     . GLY A 1 266 ? 44.000 -17.260 7.563   1.00 19.54 ? 263 GLY A N     1 
ATOM   2053 C  CA    . GLY A 1 266 ? 45.099 -17.422 8.505   1.00 20.95 ? 263 GLY A CA    1 
ATOM   2054 C  C     . GLY A 1 266 ? 44.603 -17.909 9.847   1.00 19.29 ? 263 GLY A C     1 
ATOM   2055 O  O     . GLY A 1 266 ? 45.236 -18.742 10.507  1.00 17.09 ? 263 GLY A O     1 
ATOM   2056 N  N     . ALA A 1 267 ? 43.446 -17.398 10.256  1.00 18.16 ? 264 ALA A N     1 
ATOM   2057 C  CA    . ALA A 1 267 ? 42.865 -17.816 11.517  1.00 17.98 ? 264 ALA A CA    1 
ATOM   2058 C  C     . ALA A 1 267 ? 42.425 -19.276 11.413  1.00 18.06 ? 264 ALA A C     1 
ATOM   2059 O  O     . ALA A 1 267 ? 42.547 -20.039 12.364  1.00 20.51 ? 264 ALA A O     1 
ATOM   2060 C  CB    . ALA A 1 267 ? 41.688 -16.913 11.890  1.00 20.16 ? 264 ALA A CB    1 
ATOM   2061 N  N     . SER A 1 268 ? 41.930 -19.671 10.245  1.00 18.09 ? 265 SER A N     1 
ATOM   2062 C  CA    . SER A 1 268 ? 41.513 -21.057 10.059  1.00 19.19 ? 265 SER A CA    1 
ATOM   2063 C  C     . SER A 1 268 ? 42.717 -22.010 10.012  1.00 20.32 ? 265 SER A C     1 
ATOM   2064 O  O     . SER A 1 268 ? 42.628 -23.143 10.474  1.00 18.00 ? 265 SER A O     1 
ATOM   2065 C  CB    . SER A 1 268 ? 40.625 -21.210 8.818   1.00 20.65 ? 265 SER A CB    1 
ATOM   2066 O  OG    . SER A 1 268 ? 41.380 -21.173 7.621   1.00 25.14 ? 265 SER A OG    1 
ATOM   2067 N  N     . VAL A 1 269 ? 43.838 -21.553 9.457   1.00 18.67 ? 266 VAL A N     1 
ATOM   2068 C  CA    . VAL A 1 269 ? 45.062 -22.369 9.470   1.00 18.36 ? 266 VAL A CA    1 
ATOM   2069 C  C     . VAL A 1 269 ? 45.447 -22.660 10.926  1.00 18.29 ? 266 VAL A C     1 
ATOM   2070 O  O     . VAL A 1 269 ? 45.703 -23.809 11.318  1.00 19.07 ? 266 VAL A O     1 
ATOM   2071 C  CB    . VAL A 1 269 ? 46.232 -21.672 8.724   1.00 17.27 ? 266 VAL A CB    1 
ATOM   2072 C  CG1   . VAL A 1 269 ? 47.544 -22.424 8.948   1.00 19.89 ? 266 VAL A CG1   1 
ATOM   2073 C  CG2   . VAL A 1 269 ? 45.942 -21.569 7.220   1.00 17.95 ? 266 VAL A CG2   1 
ATOM   2074 N  N     . ILE A 1 270 ? 45.451 -21.612 11.740  1.00 15.39 ? 267 ILE A N     1 
ATOM   2075 C  CA    . ILE A 1 270 ? 45.812 -21.728 13.147  1.00 13.63 ? 267 ILE A CA    1 
ATOM   2076 C  C     . ILE A 1 270 ? 44.855 -22.653 13.876  1.00 18.15 ? 267 ILE A C     1 
ATOM   2077 O  O     . ILE A 1 270 ? 45.286 -23.557 14.601  1.00 20.00 ? 267 ILE A O     1 
ATOM   2078 C  CB    . ILE A 1 270 ? 45.803 -20.354 13.819  1.00 15.07 ? 267 ILE A CB    1 
ATOM   2079 C  CG1   . ILE A 1 270 ? 47.012 -19.535 13.347  1.00 19.53 ? 267 ILE A CG1   1 
ATOM   2080 C  CG2   . ILE A 1 270 ? 45.775 -20.495 15.333  1.00 21.97 ? 267 ILE A CG2   1 
ATOM   2081 C  CD1   . ILE A 1 270 ? 46.924 -18.075 13.699  1.00 25.95 ? 267 ILE A CD1   1 
ATOM   2082 N  N     . GLU A 1 271 ? 43.552 -22.437 13.673  1.00 20.54 ? 268 GLU A N     1 
ATOM   2083 C  CA    . GLU A 1 271 ? 42.548 -23.187 14.411  1.00 24.30 ? 268 GLU A CA    1 
ATOM   2084 C  C     . GLU A 1 271 ? 42.485 -24.647 13.991  1.00 21.66 ? 268 GLU A C     1 
ATOM   2085 O  O     . GLU A 1 271 ? 42.518 -25.540 14.839  1.00 23.52 ? 268 GLU A O     1 
ATOM   2086 C  CB    . GLU A 1 271 ? 41.169 -22.535 14.288  1.00 28.20 ? 268 GLU A CB    1 
ATOM   2087 C  CG    . GLU A 1 271 ? 40.031 -23.419 14.780  1.00 45.84 ? 268 GLU A CG    1 
ATOM   2088 C  CD    . GLU A 1 271 ? 38.865 -22.620 15.337  1.00 58.89 ? 268 GLU A CD    1 
ATOM   2089 O  OE1   . GLU A 1 271 ? 37.706 -23.056 15.167  1.00 65.37 ? 268 GLU A OE1   1 
ATOM   2090 O  OE2   . GLU A 1 271 ? 39.111 -21.560 15.956  1.00 68.79 ? 268 GLU A OE2   1 
ATOM   2091 N  N     . ILE A 1 272 ? 42.400 -24.888 12.686  1.00 20.32 ? 269 ILE A N     1 
ATOM   2092 C  CA    . ILE A 1 272 ? 42.250 -26.246 12.177  1.00 15.86 ? 269 ILE A CA    1 
ATOM   2093 C  C     . ILE A 1 272 ? 43.481 -27.120 12.425  1.00 22.58 ? 269 ILE A C     1 
ATOM   2094 O  O     . ILE A 1 272 ? 43.364 -28.305 12.776  1.00 22.31 ? 269 ILE A O     1 
ATOM   2095 C  CB    . ILE A 1 272 ? 41.897 -26.245 10.668  1.00 20.71 ? 269 ILE A CB    1 
ATOM   2096 C  CG1   . ILE A 1 272 ? 40.451 -25.782 10.471  1.00 26.36 ? 269 ILE A CG1   1 
ATOM   2097 C  CG2   . ILE A 1 272 ? 42.101 -27.638 10.074  1.00 23.92 ? 269 ILE A CG2   1 
ATOM   2098 C  CD1   . ILE A 1 272 ? 40.079 -25.511 9.026   1.00 31.85 ? 269 ILE A CD1   1 
ATOM   2099 N  N     . LEU A 1 273 ? 44.670 -26.549 12.259  1.00 20.01 ? 270 LEU A N     1 
ATOM   2100 C  CA    . LEU A 1 273 ? 45.883 -27.357 12.380  1.00 17.78 ? 270 LEU A CA    1 
ATOM   2101 C  C     . LEU A 1 273 ? 46.478 -27.346 13.786  1.00 21.38 ? 270 LEU A C     1 
ATOM   2102 O  O     . LEU A 1 273 ? 47.332 -28.174 14.111  1.00 20.88 ? 270 LEU A O     1 
ATOM   2103 C  CB    . LEU A 1 273 ? 46.924 -26.915 11.357  1.00 18.70 ? 270 LEU A CB    1 
ATOM   2104 C  CG    . LEU A 1 273 ? 46.551 -27.049 9.884   1.00 20.32 ? 270 LEU A CG    1 
ATOM   2105 C  CD1   . LEU A 1 273 ? 47.720 -26.549 9.027   1.00 20.05 ? 270 LEU A CD1   1 
ATOM   2106 C  CD2   . LEU A 1 273 ? 46.212 -28.489 9.530   1.00 23.82 ? 270 LEU A CD2   1 
ATOM   2107 N  N     . GLY A 1 274 ? 46.031 -26.408 14.617  1.00 19.32 ? 271 GLY A N     1 
ATOM   2108 C  CA    . GLY A 1 274 ? 46.512 -26.303 15.981  1.00 18.90 ? 271 GLY A CA    1 
ATOM   2109 C  C     . GLY A 1 274 ? 47.956 -25.843 16.068  1.00 22.63 ? 271 GLY A C     1 
ATOM   2110 O  O     . GLY A 1 274 ? 48.709 -26.310 16.918  1.00 25.35 ? 271 GLY A O     1 
ATOM   2111 N  N     . ILE A 1 275 ? 48.343 -24.921 15.191  1.00 17.79 ? 272 ILE A N     1 
ATOM   2112 C  CA    . ILE A 1 275 ? 49.714 -24.401 15.166  1.00 15.22 ? 272 ILE A CA    1 
ATOM   2113 C  C     . ILE A 1 275 ? 49.732 -22.879 15.323  1.00 19.04 ? 272 ILE A C     1 
ATOM   2114 O  O     . ILE A 1 275 ? 48.674 -22.243 15.307  1.00 21.61 ? 272 ILE A O     1 
ATOM   2115 C  CB    . ILE A 1 275 ? 50.448 -24.804 13.853  1.00 18.29 ? 272 ILE A CB    1 
ATOM   2116 C  CG1   . ILE A 1 275 ? 49.741 -24.208 12.625  1.00 18.11 ? 272 ILE A CG1   1 
ATOM   2117 C  CG2   . ILE A 1 275 ? 50.541 -26.317 13.744  1.00 17.06 ? 272 ILE A CG2   1 
ATOM   2118 C  CD1   . ILE A 1 275 ? 50.434 -24.541 11.286  1.00 14.14 ? 272 ILE A CD1   1 
ATOM   2119 N  N     . GLU A 1 276 ? 50.926 -22.299 15.490  1.00 17.02 ? 273 GLU A N     1 
ATOM   2120 C  CA    . GLU A 1 276 ? 51.072 -20.837 15.631  1.00 16.92 ? 273 GLU A CA    1 
ATOM   2121 C  C     . GLU A 1 276 ? 52.021 -20.190 14.611  1.00 18.91 ? 273 GLU A C     1 
ATOM   2122 O  O     . GLU A 1 276 ? 51.842 -19.027 14.257  1.00 18.70 ? 273 GLU A O     1 
ATOM   2123 C  CB    . GLU A 1 276 ? 51.577 -20.467 17.033  1.00 20.30 ? 273 GLU A CB    1 
ATOM   2124 C  CG    . GLU A 1 276 ? 50.718 -20.985 18.172  1.00 32.50 ? 273 GLU A CG    1 
ATOM   2125 C  CD    . GLU A 1 276 ? 51.359 -20.783 19.544  1.00 45.38 ? 273 GLU A CD    1 
ATOM   2126 O  OE1   . GLU A 1 276 ? 51.177 -21.662 20.413  1.00 52.93 ? 273 GLU A OE1   1 
ATOM   2127 O  OE2   . GLU A 1 276 ? 52.032 -19.747 19.758  1.00 45.72 ? 273 GLU A OE2   1 
ATOM   2128 N  N     . TYR A 1 277 ? 53.046 -20.921 14.180  1.00 17.40 ? 274 TYR A N     1 
ATOM   2129 C  CA    . TYR A 1 277 ? 54.127 -20.332 13.388  1.00 14.49 ? 274 TYR A CA    1 
ATOM   2130 C  C     . TYR A 1 277 ? 54.203 -20.899 11.980  1.00 15.49 ? 274 TYR A C     1 
ATOM   2131 O  O     . TYR A 1 277 ? 53.883 -22.072 11.747  1.00 17.12 ? 274 TYR A O     1 
ATOM   2132 C  CB    . TYR A 1 277 ? 55.474 -20.526 14.086  1.00 14.06 ? 274 TYR A CB    1 
ATOM   2133 C  CG    . TYR A 1 277 ? 55.465 -20.026 15.502  1.00 15.00 ? 274 TYR A CG    1 
ATOM   2134 C  CD1   . TYR A 1 277 ? 55.687 -20.886 16.570  1.00 17.27 ? 274 TYR A CD1   1 
ATOM   2135 C  CD2   . TYR A 1 277 ? 55.203 -18.693 15.775  1.00 18.45 ? 274 TYR A CD2   1 
ATOM   2136 C  CE1   . TYR A 1 277 ? 55.668 -20.424 17.888  1.00 17.05 ? 274 TYR A CE1   1 
ATOM   2137 C  CE2   . TYR A 1 277 ? 55.177 -18.222 17.077  1.00 20.60 ? 274 TYR A CE2   1 
ATOM   2138 C  CZ    . TYR A 1 277 ? 55.408 -19.088 18.126  1.00 25.49 ? 274 TYR A CZ    1 
ATOM   2139 O  OH    . TYR A 1 277 ? 55.378 -18.608 19.416  1.00 18.42 ? 274 TYR A OH    1 
ATOM   2140 N  N     . MET A 1 278 ? 54.645 -20.068 11.045  1.00 10.05 ? 275 MET A N     1 
ATOM   2141 C  CA    . MET A 1 278 ? 54.771 -20.495 9.646   1.00 14.55 ? 275 MET A CA    1 
ATOM   2142 C  C     . MET A 1 278 ? 55.556 -21.794 9.492   1.00 15.35 ? 275 MET A C     1 
ATOM   2143 O  O     . MET A 1 278 ? 55.196 -22.651 8.694   1.00 13.54 ? 275 MET A O     1 
ATOM   2144 C  CB    . MET A 1 278 ? 55.446 -19.411 8.806   1.00 16.88 ? 275 MET A CB    1 
ATOM   2145 C  CG    . MET A 1 278 ? 54.496 -18.367 8.281   1.00 29.91 ? 275 MET A CG    1 
ATOM   2146 S  SD    . MET A 1 278 ? 53.250 -19.030 7.147   1.00 25.81 ? 275 MET A SD    1 
ATOM   2147 C  CE    . MET A 1 278 ? 54.257 -19.847 5.920   1.00 28.89 ? 275 MET A CE    1 
ATOM   2148 N  N     . GLY A 1 279 ? 56.644 -21.930 10.239  1.00 13.60 ? 276 GLY A N     1 
ATOM   2149 C  CA    . GLY A 1 279 ? 57.495 -23.096 10.072  1.00 13.33 ? 276 GLY A CA    1 
ATOM   2150 C  C     . GLY A 1 279 ? 56.784 -24.403 10.373  1.00 21.31 ? 276 GLY A C     1 
ATOM   2151 O  O     . GLY A 1 279 ? 57.133 -25.442 9.822   1.00 19.35 ? 276 GLY A O     1 
ATOM   2152 N  N     . GLU A 1 280 ? 55.791 -24.359 11.260  1.00 12.91 ? 277 GLU A N     1 
ATOM   2153 C  CA    . GLU A 1 280 ? 55.061 -25.565 11.632  1.00 16.52 ? 277 GLU A CA    1 
ATOM   2154 C  C     . GLU A 1 280 ? 54.290 -26.160 10.452  1.00 15.58 ? 277 GLU A C     1 
ATOM   2155 O  O     . GLU A 1 280 ? 53.911 -27.328 10.475  1.00 14.90 ? 277 GLU A O     1 
ATOM   2156 C  CB    . GLU A 1 280 ? 54.110 -25.292 12.802  1.00 15.46 ? 277 GLU A CB    1 
ATOM   2157 C  CG    . GLU A 1 280 ? 54.802 -25.020 14.123  1.00 18.28 ? 277 GLU A CG    1 
ATOM   2158 C  CD    . GLU A 1 280 ? 53.805 -24.689 15.227  1.00 22.31 ? 277 GLU A CD    1 
ATOM   2159 O  OE1   . GLU A 1 280 ? 53.463 -23.500 15.386  1.00 20.84 ? 277 GLU A OE1   1 
ATOM   2160 O  OE2   . GLU A 1 280 ? 53.351 -25.619 15.926  1.00 21.45 ? 277 GLU A OE2   1 
ATOM   2161 N  N     . LEU A 1 281 ? 54.060 -25.371 9.412   1.00 15.67 ? 278 LEU A N     1 
ATOM   2162 C  CA    . LEU A 1 281 ? 53.340 -25.896 8.254   1.00 14.99 ? 278 LEU A CA    1 
ATOM   2163 C  C     . LEU A 1 281 ? 54.081 -27.015 7.518   1.00 13.56 ? 278 LEU A C     1 
ATOM   2164 O  O     . LEU A 1 281 ? 53.451 -27.796 6.809   1.00 15.30 ? 278 LEU A O     1 
ATOM   2165 C  CB    . LEU A 1 281 ? 52.965 -24.776 7.278   1.00 15.13 ? 278 LEU A CB    1 
ATOM   2166 C  CG    . LEU A 1 281 ? 51.768 -23.924 7.707   1.00 20.58 ? 278 LEU A CG    1 
ATOM   2167 C  CD1   . LEU A 1 281 ? 51.753 -22.586 6.953   1.00 21.23 ? 278 LEU A CD1   1 
ATOM   2168 C  CD2   . LEU A 1 281 ? 50.473 -24.702 7.482   1.00 13.59 ? 278 LEU A CD2   1 
ATOM   2169 N  N     . THR A 1 282 ? 55.403 -27.090 7.669   1.00 16.42 ? 279 THR A N     1 
ATOM   2170 C  CA    . THR A 1 282 ? 56.198 -28.022 6.854   1.00 17.38 ? 279 THR A CA    1 
ATOM   2171 C  C     . THR A 1 282 ? 55.860 -29.479 7.158   1.00 17.37 ? 279 THR A C     1 
ATOM   2172 O  O     . THR A 1 282 ? 56.194 -30.363 6.382   1.00 18.17 ? 279 THR A O     1 
ATOM   2173 C  CB    . THR A 1 282 ? 57.729 -27.835 7.048   1.00 19.18 ? 279 THR A CB    1 
ATOM   2174 O  OG1   . THR A 1 282 ? 58.079 -28.143 8.403   1.00 17.66 ? 279 THR A OG1   1 
ATOM   2175 C  CG2   . THR A 1 282 ? 58.165 -26.407 6.707   1.00 15.08 ? 279 THR A CG2   1 
ATOM   2176 N  N     . GLN A 1 283 ? 55.216 -29.729 8.293   1.00 14.77 ? 280 GLN A N     1 
ATOM   2177 C  CA    . GLN A 1 283 ? 54.954 -31.101 8.723   1.00 18.13 ? 280 GLN A CA    1 
ATOM   2178 C  C     . GLN A 1 283 ? 53.679 -31.703 8.123   1.00 22.68 ? 280 GLN A C     1 
ATOM   2179 O  O     . GLN A 1 283 ? 53.307 -32.832 8.442   1.00 26.98 ? 280 GLN A O     1 
ATOM   2180 C  CB    . GLN A 1 283 ? 54.914 -31.168 10.249  1.00 18.64 ? 280 GLN A CB    1 
ATOM   2181 C  CG    A GLN A 1 283 ? 56.269 -30.880 10.855  0.50 18.80 ? 280 GLN A CG    1 
ATOM   2182 C  CG    B GLN A 1 283 ? 53.736 -30.468 10.852  0.50 18.76 ? 280 GLN A CG    1 
ATOM   2183 C  CD    A GLN A 1 283 ? 57.354 -31.644 10.124  0.50 22.90 ? 280 GLN A CD    1 
ATOM   2184 C  CD    B GLN A 1 283 ? 53.883 -30.275 12.348  0.50 27.41 ? 280 GLN A CD    1 
ATOM   2185 O  OE1   A GLN A 1 283 ? 57.337 -32.875 10.092  0.50 25.56 ? 280 GLN A OE1   1 
ATOM   2186 O  OE1   B GLN A 1 283 ? 54.356 -31.164 13.062  0.50 28.80 ? 280 GLN A OE1   1 
ATOM   2187 N  NE2   A GLN A 1 283 ? 58.283 -30.920 9.499   0.50 16.51 ? 280 GLN A NE2   1 
ATOM   2188 N  NE2   B GLN A 1 283 ? 53.473 -29.110 12.832  0.50 13.88 ? 280 GLN A NE2   1 
ATOM   2189 N  N     . PHE A 1 284 ? 53.013 -30.964 7.243   1.00 12.70 ? 281 PHE A N     1 
ATOM   2190 C  CA    . PHE A 1 284 ? 51.799 -31.463 6.620   1.00 14.76 ? 281 PHE A CA    1 
ATOM   2191 C  C     . PHE A 1 284 ? 52.089 -31.791 5.154   1.00 23.26 ? 281 PHE A C     1 
ATOM   2192 O  O     . PHE A 1 284 ? 52.976 -31.193 4.558   1.00 22.76 ? 281 PHE A O     1 
ATOM   2193 C  CB    . PHE A 1 284 ? 50.676 -30.442 6.762   1.00 18.57 ? 281 PHE A CB    1 
ATOM   2194 C  CG    . PHE A 1 284 ? 50.315 -30.160 8.192   1.00 15.71 ? 281 PHE A CG    1 
ATOM   2195 C  CD1   . PHE A 1 284 ? 49.335 -30.902 8.836   1.00 22.21 ? 281 PHE A CD1   1 
ATOM   2196 C  CD2   . PHE A 1 284 ? 50.991 -29.183 8.907   1.00 17.95 ? 281 PHE A CD2   1 
ATOM   2197 C  CE1   . PHE A 1 284 ? 49.011 -30.649 10.173  1.00 22.90 ? 281 PHE A CE1   1 
ATOM   2198 C  CE2   . PHE A 1 284 ? 50.683 -28.925 10.231  1.00 18.22 ? 281 PHE A CE2   1 
ATOM   2199 C  CZ    . PHE A 1 284 ? 49.694 -29.665 10.873  1.00 23.00 ? 281 PHE A CZ    1 
ATOM   2200 N  N     . THR A 1 285 ? 51.377 -32.750 4.571   1.00 16.84 ? 282 THR A N     1 
ATOM   2201 C  CA    . THR A 1 285 ? 51.593 -33.019 3.145   1.00 19.73 ? 282 THR A CA    1 
ATOM   2202 C  C     . THR A 1 285 ? 50.837 -31.983 2.326   1.00 14.57 ? 282 THR A C     1 
ATOM   2203 O  O     . THR A 1 285 ? 49.945 -31.326 2.837   1.00 16.65 ? 282 THR A O     1 
ATOM   2204 C  CB    . THR A 1 285 ? 51.112 -34.413 2.726   1.00 18.12 ? 282 THR A CB    1 
ATOM   2205 O  OG1   . THR A 1 285 ? 49.687 -34.454 2.817   1.00 17.84 ? 282 THR A OG1   1 
ATOM   2206 C  CG2   . THR A 1 285 ? 51.712 -35.478 3.637   1.00 21.39 ? 282 THR A CG2   1 
ATOM   2207 N  N     . GLU A 1 286 ? 51.195 -31.836 1.055   1.00 14.23 ? 283 GLU A N     1 
ATOM   2208 C  CA    . GLU A 1 286 ? 50.485 -30.911 0.183   1.00 19.13 ? 283 GLU A CA    1 
ATOM   2209 C  C     . GLU A 1 286 ? 48.998 -31.281 0.133   1.00 18.52 ? 283 GLU A C     1 
ATOM   2210 O  O     . GLU A 1 286 ? 48.131 -30.408 0.265   1.00 18.01 ? 283 GLU A O     1 
ATOM   2211 C  CB    . GLU A 1 286 ? 51.104 -30.892 -1.216  1.00 17.18 ? 283 GLU A CB    1 
ATOM   2212 C  CG    . GLU A 1 286 ? 50.546 -29.788 -2.106  1.00 20.31 ? 283 GLU A CG    1 
ATOM   2213 C  CD    . GLU A 1 286 ? 51.214 -29.724 -3.473  1.00 29.23 ? 283 GLU A CD    1 
ATOM   2214 O  OE1   . GLU A 1 286 ? 52.099 -30.556 -3.758  1.00 28.47 ? 283 GLU A OE1   1 
ATOM   2215 O  OE2   . GLU A 1 286 ? 50.856 -28.828 -4.263  1.00 24.74 ? 283 GLU A OE2   1 
ATOM   2216 N  N     . SER A 1 287 ? 48.705 -32.575 -0.020  1.00 17.82 ? 284 SER A N     1 
ATOM   2217 C  CA    . SER A 1 287 ? 47.312 -33.034 -0.046  1.00 20.67 ? 284 SER A CA    1 
ATOM   2218 C  C     . SER A 1 287 ? 46.567 -32.697 1.251   1.00 18.99 ? 284 SER A C     1 
ATOM   2219 O  O     . SER A 1 287 ? 45.405 -32.297 1.213   1.00 18.00 ? 284 SER A O     1 
ATOM   2220 C  CB    . SER A 1 287 ? 47.204 -34.539 -0.355  1.00 19.92 ? 284 SER A CB    1 
ATOM   2221 O  OG    A SER A 1 287 ? 47.743 -34.848 -1.625  0.50 18.62 ? 284 SER A OG    1 
ATOM   2222 O  OG    B SER A 1 287 ? 47.916 -35.325 0.577   0.50 24.22 ? 284 SER A OG    1 
ATOM   2223 N  N     . GLN A 1 288 ? 47.232 -32.844 2.396   1.00 17.90 ? 285 GLN A N     1 
ATOM   2224 C  CA    . GLN A 1 288 ? 46.590 -32.509 3.652   1.00 14.84 ? 285 GLN A CA    1 
ATOM   2225 C  C     . GLN A 1 288 ? 46.193 -31.031 3.647   1.00 18.99 ? 285 GLN A C     1 
ATOM   2226 O  O     . GLN A 1 288 ? 45.060 -30.670 3.985   1.00 16.42 ? 285 GLN A O     1 
ATOM   2227 C  CB    . GLN A 1 288 ? 47.502 -32.815 4.846   1.00 15.26 ? 285 GLN A CB    1 
ATOM   2228 C  CG    . GLN A 1 288 ? 47.613 -34.277 5.203   1.00 27.74 ? 285 GLN A CG    1 
ATOM   2229 C  CD    . GLN A 1 288 ? 48.537 -34.495 6.386   1.00 31.08 ? 285 GLN A CD    1 
ATOM   2230 O  OE1   . GLN A 1 288 ? 49.641 -33.951 6.434   1.00 20.43 ? 285 GLN A OE1   1 
ATOM   2231 N  NE2   . GLN A 1 288 ? 48.078 -35.271 7.360   1.00 34.03 ? 285 GLN A NE2   1 
ATOM   2232 N  N     . LEU A 1 289 ? 47.116 -30.166 3.243   1.00 17.77 ? 286 LEU A N     1 
ATOM   2233 C  CA    . LEU A 1 289 ? 46.808 -28.735 3.206   1.00 13.38 ? 286 LEU A CA    1 
ATOM   2234 C  C     . LEU A 1 289 ? 45.668 -28.412 2.220   1.00 14.60 ? 286 LEU A C     1 
ATOM   2235 O  O     . LEU A 1 289 ? 44.765 -27.633 2.530   1.00 17.55 ? 286 LEU A O     1 
ATOM   2236 C  CB    . LEU A 1 289 ? 48.064 -27.911 2.904   1.00 14.09 ? 286 LEU A CB    1 
ATOM   2237 C  CG    . LEU A 1 289 ? 49.200 -27.968 3.945   1.00 14.73 ? 286 LEU A CG    1 
ATOM   2238 C  CD1   . LEU A 1 289 ? 50.431 -27.190 3.487   1.00 16.09 ? 286 LEU A CD1   1 
ATOM   2239 C  CD2   . LEU A 1 289 ? 48.735 -27.505 5.326   1.00 15.39 ? 286 LEU A CD2   1 
ATOM   2240 N  N     . GLN A 1 290 ? 45.709 -29.019 1.039   1.00 16.75 ? 287 GLN A N     1 
ATOM   2241 C  CA    . GLN A 1 290 ? 44.637 -28.847 0.070   1.00 17.49 ? 287 GLN A CA    1 
ATOM   2242 C  C     . GLN A 1 290 ? 43.268 -29.305 0.596   1.00 19.78 ? 287 GLN A C     1 
ATOM   2243 O  O     . GLN A 1 290 ? 42.237 -28.684 0.302   1.00 21.19 ? 287 GLN A O     1 
ATOM   2244 C  CB    . GLN A 1 290 ? 44.988 -29.576 -1.226  1.00 16.17 ? 287 GLN A CB    1 
ATOM   2245 C  CG    . GLN A 1 290 ? 46.143 -28.920 -2.014  1.00 18.65 ? 287 GLN A CG    1 
ATOM   2246 C  CD    . GLN A 1 290 ? 46.514 -29.734 -3.228  1.00 22.84 ? 287 GLN A CD    1 
ATOM   2247 O  OE1   . GLN A 1 290 ? 46.551 -30.965 -3.161  1.00 23.20 ? 287 GLN A OE1   1 
ATOM   2248 N  NE2   . GLN A 1 290 ? 46.779 -29.059 -4.353  1.00 18.98 ? 287 GLN A NE2   1 
ATOM   2249 N  N     . SER A 1 291 ? 43.250 -30.381 1.376   1.00 21.70 ? 288 SER A N     1 
ATOM   2250 C  CA    . SER A 1 291 ? 41.993 -30.881 1.942   1.00 18.63 ? 288 SER A CA    1 
ATOM   2251 C  C     . SER A 1 291 ? 41.307 -29.849 2.836   1.00 26.56 ? 288 SER A C     1 
ATOM   2252 O  O     . SER A 1 291 ? 40.085 -29.735 2.822   1.00 26.58 ? 288 SER A O     1 
ATOM   2253 C  CB    . SER A 1 291 ? 42.183 -32.219 2.692   1.00 21.36 ? 288 SER A CB    1 
ATOM   2254 O  OG    . SER A 1 291 ? 42.870 -32.047 3.934   1.00 28.18 ? 288 SER A OG    1 
ATOM   2255 N  N     . HIS A 1 292 ? 42.090 -29.090 3.597   1.00 21.07 ? 289 HIS A N     1 
ATOM   2256 C  CA    . HIS A 1 292 ? 41.522 -28.094 4.504   1.00 24.78 ? 289 HIS A CA    1 
ATOM   2257 C  C     . HIS A 1 292 ? 41.251 -26.733 3.868   1.00 24.16 ? 289 HIS A C     1 
ATOM   2258 O  O     . HIS A 1 292 ? 40.261 -26.072 4.190   1.00 28.17 ? 289 HIS A O     1 
ATOM   2259 C  CB    . HIS A 1 292 ? 42.438 -27.875 5.707   1.00 22.08 ? 289 HIS A CB    1 
ATOM   2260 C  CG    . HIS A 1 292 ? 42.560 -29.064 6.606   1.00 24.50 ? 289 HIS A CG    1 
ATOM   2261 N  ND1   . HIS A 1 292 ? 41.492 -29.579 7.310   1.00 30.86 ? 289 HIS A ND1   1 
ATOM   2262 C  CD2   . HIS A 1 292 ? 43.631 -29.827 6.932   1.00 27.34 ? 289 HIS A CD2   1 
ATOM   2263 C  CE1   . HIS A 1 292 ? 41.898 -30.615 8.023   1.00 25.99 ? 289 HIS A CE1   1 
ATOM   2264 N  NE2   . HIS A 1 292 ? 43.193 -30.783 7.817   1.00 29.04 ? 289 HIS A NE2   1 
ATOM   2265 N  N     . PHE A 1 293 ? 42.151 -26.294 2.998   1.00 20.15 ? 290 PHE A N     1 
ATOM   2266 C  CA    . PHE A 1 293 ? 42.147 -24.901 2.555   1.00 20.79 ? 290 PHE A CA    1 
ATOM   2267 C  C     . PHE A 1 293 ? 41.908 -24.755 1.058   1.00 23.62 ? 290 PHE A C     1 
ATOM   2268 O  O     . PHE A 1 293 ? 41.917 -23.643 0.515   1.00 23.05 ? 290 PHE A O     1 
ATOM   2269 C  CB    . PHE A 1 293 ? 43.457 -24.229 2.985   1.00 19.77 ? 290 PHE A CB    1 
ATOM   2270 C  CG    . PHE A 1 293 ? 43.814 -24.505 4.420   1.00 18.89 ? 290 PHE A CG    1 
ATOM   2271 C  CD1   . PHE A 1 293 ? 42.999 -24.049 5.451   1.00 21.17 ? 290 PHE A CD1   1 
ATOM   2272 C  CD2   . PHE A 1 293 ? 44.934 -25.254 4.742   1.00 15.96 ? 290 PHE A CD2   1 
ATOM   2273 C  CE1   . PHE A 1 293 ? 43.301 -24.322 6.770   1.00 17.90 ? 290 PHE A CE1   1 
ATOM   2274 C  CE2   . PHE A 1 293 ? 45.242 -25.528 6.063   1.00 17.96 ? 290 PHE A CE2   1 
ATOM   2275 C  CZ    . PHE A 1 293 ? 44.423 -25.066 7.076   1.00 20.54 ? 290 PHE A CZ    1 
ATOM   2276 N  N     . GLY A 1 294 ? 41.697 -25.879 0.386   1.00 20.47 ? 291 GLY A N     1 
ATOM   2277 C  CA    . GLY A 1 294 ? 41.411 -25.838 -1.035  1.00 22.14 ? 291 GLY A CA    1 
ATOM   2278 C  C     . GLY A 1 294 ? 42.656 -26.060 -1.852  1.00 18.76 ? 291 GLY A C     1 
ATOM   2279 O  O     . GLY A 1 294 ? 43.773 -25.919 -1.349  1.00 20.83 ? 291 GLY A O     1 
ATOM   2280 N  N     . GLU A 1 295 ? 42.462 -26.412 -3.121  1.00 20.23 ? 292 GLU A N     1 
ATOM   2281 C  CA    . GLU A 1 295 ? 43.550 -26.788 -4.007  1.00 19.49 ? 292 GLU A CA    1 
ATOM   2282 C  C     . GLU A 1 295 ? 44.606 -25.682 -4.171  1.00 19.59 ? 292 GLU A C     1 
ATOM   2283 O  O     . GLU A 1 295 ? 45.788 -25.926 -4.026  1.00 16.85 ? 292 GLU A O     1 
ATOM   2284 C  CB    . GLU A 1 295 ? 42.974 -27.181 -5.370  1.00 23.77 ? 292 GLU A CB    1 
ATOM   2285 C  CG    . GLU A 1 295 ? 44.000 -27.529 -6.410  1.00 25.51 ? 292 GLU A CG    1 
ATOM   2286 C  CD    . GLU A 1 295 ? 43.375 -27.794 -7.773  1.00 47.50 ? 292 GLU A CD    1 
ATOM   2287 O  OE1   . GLU A 1 295 ? 43.972 -27.382 -8.793  1.00 52.16 ? 292 GLU A OE1   1 
ATOM   2288 O  OE2   . GLU A 1 295 ? 42.289 -28.413 -7.824  1.00 39.67 ? 292 GLU A OE2   1 
ATOM   2289 N  N     . LYS A 1 296 ? 44.166 -24.466 -4.474  1.00 18.03 ? 293 LYS A N     1 
ATOM   2290 C  CA    . LYS A 1 296 ? 45.085 -23.347 -4.689  1.00 17.05 ? 293 LYS A CA    1 
ATOM   2291 C  C     . LYS A 1 296 ? 45.798 -22.920 -3.390  1.00 17.34 ? 293 LYS A C     1 
ATOM   2292 O  O     . LYS A 1 296 ? 47.033 -22.845 -3.334  1.00 18.88 ? 293 LYS A O     1 
ATOM   2293 C  CB    . LYS A 1 296 ? 44.323 -22.164 -5.307  1.00 22.36 ? 293 LYS A CB    1 
ATOM   2294 C  CG    . LYS A 1 296 ? 45.178 -21.001 -5.751  1.00 33.87 ? 293 LYS A CG    1 
ATOM   2295 C  CD    . LYS A 1 296 ? 44.349 -19.999 -6.554  1.00 44.79 ? 293 LYS A CD    1 
ATOM   2296 C  CE    . LYS A 1 296 ? 45.132 -18.729 -6.864  1.00 49.67 ? 293 LYS A CE    1 
ATOM   2297 N  NZ    . LYS A 1 296 ? 44.309 -17.734 -7.616  1.00 54.89 ? 293 LYS A NZ    1 
ATOM   2298 N  N     . ASN A 1 297 ? 45.027 -22.655 -2.343  1.00 17.46 ? 294 ASN A N     1 
ATOM   2299 C  CA    . ASN A 1 297 ? 45.614 -22.258 -1.065  1.00 17.89 ? 294 ASN A CA    1 
ATOM   2300 C  C     . ASN A 1 297 ? 46.549 -23.337 -0.506  1.00 18.62 ? 294 ASN A C     1 
ATOM   2301 O  O     . ASN A 1 297 ? 47.590 -23.022 0.051   1.00 17.93 ? 294 ASN A O     1 
ATOM   2302 C  CB    . ASN A 1 297 ? 44.530 -21.956 -0.031  1.00 23.95 ? 294 ASN A CB    1 
ATOM   2303 C  CG    . ASN A 1 297 ? 43.755 -20.698 -0.335  1.00 23.05 ? 294 ASN A CG    1 
ATOM   2304 O  OD1   . ASN A 1 297 ? 44.268 -19.768 -0.960  1.00 24.87 ? 294 ASN A OD1   1 
ATOM   2305 N  ND2   . ASN A 1 297 ? 42.504 -20.654 0.128   1.00 25.11 ? 294 ASN A ND2   1 
ATOM   2306 N  N     . GLY A 1 298 ? 46.172 -24.607 -0.639  1.00 18.68 ? 295 GLY A N     1 
ATOM   2307 C  CA    . GLY A 1 298 ? 47.002 -25.696 -0.133  1.00 20.14 ? 295 GLY A CA    1 
ATOM   2308 C  C     . GLY A 1 298 ? 48.373 -25.807 -0.796  1.00 16.01 ? 295 GLY A C     1 
ATOM   2309 O  O     . GLY A 1 298 ? 49.397 -25.953 -0.117  1.00 18.69 ? 295 GLY A O     1 
ATOM   2310 N  N     . SER A 1 299 ? 48.396 -25.757 -2.128  1.00 13.56 ? 296 SER A N     1 
ATOM   2311 C  CA    . SER A 1 299 ? 49.648 -25.753 -2.867  1.00 16.98 ? 296 SER A CA    1 
ATOM   2312 C  C     . SER A 1 299 ? 50.477 -24.529 -2.496  1.00 15.34 ? 296 SER A C     1 
ATOM   2313 O  O     . SER A 1 299 ? 51.698 -24.617 -2.333  1.00 15.42 ? 296 SER A O     1 
ATOM   2314 C  CB    . SER A 1 299 ? 49.386 -25.769 -4.378  1.00 16.66 ? 296 SER A CB    1 
ATOM   2315 O  OG    . SER A 1 299 ? 48.975 -27.059 -4.787  1.00 25.71 ? 296 SER A OG    1 
ATOM   2316 N  N     . TRP A 1 300 ? 49.815 -23.387 -2.364  1.00 17.56 ? 297 TRP A N     1 
ATOM   2317 C  CA    . TRP A 1 300 ? 50.528 -22.155 -2.059  1.00 17.16 ? 297 TRP A CA    1 
ATOM   2318 C  C     . TRP A 1 300 ? 51.184 -22.256 -0.686  1.00 19.33 ? 297 TRP A C     1 
ATOM   2319 O  O     . TRP A 1 300 ? 52.362 -21.911 -0.525  1.00 18.13 ? 297 TRP A O     1 
ATOM   2320 C  CB    . TRP A 1 300 ? 49.570 -20.967 -2.118  1.00 18.13 ? 297 TRP A CB    1 
ATOM   2321 C  CG    . TRP A 1 300 ? 50.227 -19.638 -1.917  1.00 22.49 ? 297 TRP A CG    1 
ATOM   2322 C  CD1   . TRP A 1 300 ? 50.814 -18.862 -2.872  1.00 25.04 ? 297 TRP A CD1   1 
ATOM   2323 C  CD2   . TRP A 1 300 ? 50.332 -18.906 -0.682  1.00 17.93 ? 297 TRP A CD2   1 
ATOM   2324 N  NE1   . TRP A 1 300 ? 51.289 -17.698 -2.307  1.00 21.61 ? 297 TRP A NE1   1 
ATOM   2325 C  CE2   . TRP A 1 300 ? 51.004 -17.703 -0.965  1.00 21.79 ? 297 TRP A CE2   1 
ATOM   2326 C  CE3   . TRP A 1 300 ? 49.922 -19.156 0.630   1.00 22.94 ? 297 TRP A CE3   1 
ATOM   2327 C  CZ2   . TRP A 1 300 ? 51.277 -16.747 0.020   1.00 19.73 ? 297 TRP A CZ2   1 
ATOM   2328 C  CZ3   . TRP A 1 300 ? 50.196 -18.207 1.604   1.00 22.38 ? 297 TRP A CZ3   1 
ATOM   2329 C  CH2   . TRP A 1 300 ? 50.874 -17.023 1.293   1.00 18.11 ? 297 TRP A CH2   1 
ATOM   2330 N  N     . LEU A 1 301 ? 50.421 -22.747 0.293   1.00 18.11 ? 298 LEU A N     1 
ATOM   2331 C  CA    . LEU A 1 301 ? 50.931 -22.925 1.654   1.00 16.28 ? 298 LEU A CA    1 
ATOM   2332 C  C     . LEU A 1 301 ? 52.084 -23.916 1.728   1.00 17.26 ? 298 LEU A C     1 
ATOM   2333 O  O     . LEU A 1 301 ? 53.073 -23.681 2.425   1.00 15.44 ? 298 LEU A O     1 
ATOM   2334 C  CB    . LEU A 1 301 ? 49.809 -23.350 2.607   1.00 12.11 ? 298 LEU A CB    1 
ATOM   2335 C  CG    . LEU A 1 301 ? 48.773 -22.252 2.914   1.00 18.27 ? 298 LEU A CG    1 
ATOM   2336 C  CD1   . LEU A 1 301 ? 47.507 -22.829 3.538   1.00 14.99 ? 298 LEU A CD1   1 
ATOM   2337 C  CD2   . LEU A 1 301 ? 49.390 -21.183 3.824   1.00 15.71 ? 298 LEU A CD2   1 
ATOM   2338 N  N     . TYR A 1 302 ? 51.961 -25.018 1.001   1.00 13.53 ? 299 TYR A N     1 
ATOM   2339 C  CA    . TYR A 1 302 ? 52.977 -26.067 1.042   1.00 13.84 ? 299 TYR A CA    1 
ATOM   2340 C  C     . TYR A 1 302 ? 54.336 -25.526 0.600   1.00 17.43 ? 299 TYR A C     1 
ATOM   2341 O  O     . TYR A 1 302 ? 55.372 -25.784 1.240   1.00 14.75 ? 299 TYR A O     1 
ATOM   2342 C  CB    . TYR A 1 302 ? 52.553 -27.251 0.159   1.00 19.16 ? 299 TYR A CB    1 
ATOM   2343 C  CG    . TYR A 1 302 ? 53.542 -28.392 0.170   1.00 15.76 ? 299 TYR A CG    1 
ATOM   2344 C  CD1   . TYR A 1 302 ? 53.495 -29.375 1.161   1.00 16.14 ? 299 TYR A CD1   1 
ATOM   2345 C  CD2   . TYR A 1 302 ? 54.532 -28.482 -0.793  1.00 21.48 ? 299 TYR A CD2   1 
ATOM   2346 C  CE1   . TYR A 1 302 ? 54.403 -30.420 1.177   1.00 20.94 ? 299 TYR A CE1   1 
ATOM   2347 C  CE2   . TYR A 1 302 ? 55.451 -29.520 -0.776  1.00 24.67 ? 299 TYR A CE2   1 
ATOM   2348 C  CZ    . TYR A 1 302 ? 55.372 -30.488 0.208   1.00 23.86 ? 299 TYR A CZ    1 
ATOM   2349 O  OH    . TYR A 1 302 ? 56.288 -31.519 0.217   1.00 32.91 ? 299 TYR A OH    1 
ATOM   2350 N  N     . ALA A 1 303 ? 54.325 -24.764 -0.490  1.00 15.16 ? 300 ALA A N     1 
ATOM   2351 C  CA    . ALA A 1 303 ? 55.525 -24.120 -1.001  1.00 16.06 ? 300 ALA A CA    1 
ATOM   2352 C  C     . ALA A 1 303 ? 55.956 -22.922 -0.149  1.00 14.79 ? 300 ALA A C     1 
ATOM   2353 O  O     . ALA A 1 303 ? 57.149 -22.743 0.121   1.00 13.78 ? 300 ALA A O     1 
ATOM   2354 C  CB    . ALA A 1 303 ? 55.314 -23.682 -2.460  1.00 16.29 ? 300 ALA A CB    1 
ATOM   2355 N  N     . MET A 1 304 ? 54.999 -22.099 0.270   1.00 13.06 ? 301 MET A N     1 
ATOM   2356 C  CA    . MET A 1 304 ? 55.346 -20.866 0.998   1.00 14.70 ? 301 MET A CA    1 
ATOM   2357 C  C     . MET A 1 304 ? 56.037 -21.120 2.335   1.00 15.56 ? 301 MET A C     1 
ATOM   2358 O  O     . MET A 1 304 ? 56.975 -20.401 2.700   1.00 15.32 ? 301 MET A O     1 
ATOM   2359 C  CB    . MET A 1 304 ? 54.113 -19.982 1.206   1.00 16.01 ? 301 MET A CB    1 
ATOM   2360 C  CG    . MET A 1 304 ? 54.427 -18.548 1.667   1.00 17.71 ? 301 MET A CG    1 
ATOM   2361 S  SD    . MET A 1 304 ? 55.235 -17.591 0.358   1.00 22.69 ? 301 MET A SD    1 
ATOM   2362 C  CE    . MET A 1 304 ? 56.937 -17.553 0.953   1.00 15.77 ? 301 MET A CE    1 
ATOM   2363 N  N     . CYS A 1 305 ? 55.590 -22.134 3.072   1.00 12.65 ? 302 CYS A N     1 
ATOM   2364 C  CA    . CYS A 1 305 ? 56.259 -22.462 4.339   1.00 16.78 ? 302 CYS A CA    1 
ATOM   2365 C  C     . CYS A 1 305 ? 57.708 -22.962 4.177   1.00 13.81 ? 302 CYS A C     1 
ATOM   2366 O  O     . CYS A 1 305 ? 58.467 -22.992 5.152   1.00 16.32 ? 302 CYS A O     1 
ATOM   2367 C  CB    . CYS A 1 305 ? 55.438 -23.466 5.166   1.00 15.09 ? 302 CYS A CB    1 
ATOM   2368 S  SG    . CYS A 1 305 ? 55.434 -25.139 4.495   1.00 14.42 ? 302 CYS A SG    1 
ATOM   2369 N  N     . ARG A 1 306 ? 58.083 -23.330 2.956   1.00 12.64 ? 303 ARG A N     1 
ATOM   2370 C  CA    . ARG A 1 306 ? 59.469 -23.661 2.603   1.00 14.21 ? 303 ARG A CA    1 
ATOM   2371 C  C     . ARG A 1 306 ? 60.218 -22.472 1.953   1.00 16.75 ? 303 ARG A C     1 
ATOM   2372 O  O     . ARG A 1 306 ? 61.373 -22.601 1.536   1.00 15.89 ? 303 ARG A O     1 
ATOM   2373 C  CB    . ARG A 1 306 ? 59.503 -24.898 1.693   1.00 17.99 ? 303 ARG A CB    1 
ATOM   2374 C  CG    . ARG A 1 306 ? 58.881 -26.120 2.360   1.00 18.62 ? 303 ARG A CG    1 
ATOM   2375 C  CD    . ARG A 1 306 ? 58.681 -27.300 1.412   1.00 20.27 ? 303 ARG A CD    1 
ATOM   2376 N  NE    . ARG A 1 306 ? 58.499 -28.521 2.192   1.00 22.51 ? 303 ARG A NE    1 
ATOM   2377 C  CZ    . ARG A 1 306 ? 57.398 -28.802 2.878   1.00 19.05 ? 303 ARG A CZ    1 
ATOM   2378 N  NH1   . ARG A 1 306 ? 57.317 -29.930 3.579   1.00 17.74 ? 303 ARG A NH1   1 
ATOM   2379 N  NH2   . ARG A 1 306 ? 56.376 -27.956 2.855   1.00 15.55 ? 303 ARG A NH2   1 
ATOM   2380 N  N     . GLY A 1 307 ? 59.565 -21.316 1.891   1.00 13.16 ? 304 GLY A N     1 
ATOM   2381 C  CA    . GLY A 1 307 ? 60.199 -20.105 1.391   1.00 15.76 ? 304 GLY A CA    1 
ATOM   2382 C  C     . GLY A 1 307 ? 60.030 -19.955 -0.116  1.00 15.48 ? 304 GLY A C     1 
ATOM   2383 O  O     . GLY A 1 307 ? 60.735 -19.174 -0.756  1.00 15.46 ? 304 GLY A O     1 
ATOM   2384 N  N     . ILE A 1 308 ? 59.091 -20.701 -0.683  1.00 14.54 ? 305 ILE A N     1 
ATOM   2385 C  CA    . ILE A 1 308 ? 58.946 -20.769 -2.142  1.00 15.78 ? 305 ILE A CA    1 
ATOM   2386 C  C     . ILE A 1 308 ? 57.589 -20.248 -2.608  1.00 18.54 ? 305 ILE A C     1 
ATOM   2387 O  O     . ILE A 1 308 ? 56.556 -20.669 -2.109  1.00 18.04 ? 305 ILE A O     1 
ATOM   2388 C  CB    . ILE A 1 308 ? 59.107 -22.214 -2.640  1.00 21.79 ? 305 ILE A CB    1 
ATOM   2389 C  CG1   . ILE A 1 308 ? 60.487 -22.757 -2.258  1.00 18.93 ? 305 ILE A CG1   1 
ATOM   2390 C  CG2   . ILE A 1 308 ? 58.874 -22.298 -4.145  1.00 19.72 ? 305 ILE A CG2   1 
ATOM   2391 C  CD1   . ILE A 1 308 ? 60.666 -24.230 -2.597  1.00 26.85 ? 305 ILE A CD1   1 
ATOM   2392 N  N     . GLU A 1 309 ? 57.598 -19.345 -3.584  1.00 16.72 ? 306 GLU A N     1 
ATOM   2393 C  CA    . GLU A 1 309 ? 56.362 -18.786 -4.111  1.00 21.29 ? 306 GLU A CA    1 
ATOM   2394 C  C     . GLU A 1 309 ? 56.605 -18.333 -5.547  1.00 25.50 ? 306 GLU A C     1 
ATOM   2395 O  O     . GLU A 1 309 ? 57.674 -17.823 -5.865  1.00 21.41 ? 306 GLU A O     1 
ATOM   2396 C  CB    . GLU A 1 309 ? 55.913 -17.605 -3.264  1.00 21.45 ? 306 GLU A CB    1 
ATOM   2397 C  CG    . GLU A 1 309 ? 54.459 -17.299 -3.430  1.00 30.45 ? 306 GLU A CG    1 
ATOM   2398 C  CD    . GLU A 1 309 ? 54.168 -15.824 -3.542  1.00 30.23 ? 306 GLU A CD    1 
ATOM   2399 O  OE1   . GLU A 1 309 ? 55.118 -15.006 -3.657  1.00 29.32 ? 306 GLU A OE1   1 
ATOM   2400 O  OE2   . GLU A 1 309 ? 52.967 -15.488 -3.518  1.00 30.43 ? 306 GLU A OE2   1 
ATOM   2401 N  N     . HIS A 1 310 ? 55.619 -18.510 -6.417  1.00 23.28 ? 307 HIS A N     1 
ATOM   2402 C  CA    . HIS A 1 310 ? 55.867 -18.288 -7.840  1.00 23.23 ? 307 HIS A CA    1 
ATOM   2403 C  C     . HIS A 1 310 ? 55.144 -17.103 -8.474  1.00 21.90 ? 307 HIS A C     1 
ATOM   2404 O  O     . HIS A 1 310 ? 55.298 -16.869 -9.671  1.00 22.99 ? 307 HIS A O     1 
ATOM   2405 C  CB    . HIS A 1 310 ? 55.606 -19.570 -8.643  1.00 33.70 ? 307 HIS A CB    1 
ATOM   2406 C  CG    . HIS A 1 310 ? 56.549 -20.684 -8.304  1.00 38.10 ? 307 HIS A CG    1 
ATOM   2407 N  ND1   . HIS A 1 310 ? 57.920 -20.528 -8.320  1.00 38.71 ? 307 HIS A ND1   1 
ATOM   2408 C  CD2   . HIS A 1 310 ? 56.320 -21.960 -7.914  1.00 33.70 ? 307 HIS A CD2   1 
ATOM   2409 C  CE1   . HIS A 1 310 ? 58.495 -21.664 -7.966  1.00 38.99 ? 307 HIS A CE1   1 
ATOM   2410 N  NE2   . HIS A 1 310 ? 57.547 -22.549 -7.717  1.00 40.48 ? 307 HIS A NE2   1 
ATOM   2411 N  N     . ASP A 1 311 ? 54.380 -16.358 -7.683  1.00 22.30 ? 308 ASP A N     1 
ATOM   2412 C  CA    . ASP A 1 311 ? 53.615 -15.228 -8.215  1.00 21.87 ? 308 ASP A CA    1 
ATOM   2413 C  C     . ASP A 1 311 ? 54.539 -14.226 -8.920  1.00 19.73 ? 308 ASP A C     1 
ATOM   2414 O  O     . ASP A 1 311 ? 55.513 -13.764 -8.337  1.00 16.22 ? 308 ASP A O     1 
ATOM   2415 C  CB    . ASP A 1 311 ? 52.835 -14.538 -7.099  1.00 19.02 ? 308 ASP A CB    1 
ATOM   2416 C  CG    . ASP A 1 311 ? 51.864 -13.478 -7.632  1.00 30.38 ? 308 ASP A CG    1 
ATOM   2417 O  OD1   . ASP A 1 311 ? 51.750 -12.400 -7.020  1.00 28.76 ? 308 ASP A OD1   1 
ATOM   2418 O  OD2   . ASP A 1 311 ? 51.207 -13.725 -8.664  1.00 38.83 ? 308 ASP A OD2   1 
ATOM   2419 N  N     . PRO A 1 312 ? 54.239 -13.889 -10.186 1.00 19.13 ? 309 PRO A N     1 
ATOM   2420 C  CA    . PRO A 1 312 ? 55.156 -12.956 -10.845 1.00 15.06 ? 309 PRO A CA    1 
ATOM   2421 C  C     . PRO A 1 312 ? 54.967 -11.498 -10.454 1.00 15.68 ? 309 PRO A C     1 
ATOM   2422 O  O     . PRO A 1 312 ? 53.892 -11.068 -10.035 1.00 17.02 ? 309 PRO A O     1 
ATOM   2423 C  CB    . PRO A 1 312 ? 54.862 -13.164 -12.342 1.00 18.45 ? 309 PRO A CB    1 
ATOM   2424 C  CG    . PRO A 1 312 ? 53.450 -13.677 -12.383 1.00 19.52 ? 309 PRO A CG    1 
ATOM   2425 C  CD    . PRO A 1 312 ? 53.285 -14.503 -11.131 1.00 18.93 ? 309 PRO A CD    1 
ATOM   2426 N  N     . VAL A 1 313 ? 56.056 -10.745 -10.571 1.00 14.05 ? 310 VAL A N     1 
ATOM   2427 C  CA    . VAL A 1 313 ? 56.009 -9.298  -10.508 1.00 16.61 ? 310 VAL A CA    1 
ATOM   2428 C  C     . VAL A 1 313 ? 55.331 -8.888  -11.799 1.00 20.09 ? 310 VAL A C     1 
ATOM   2429 O  O     . VAL A 1 313 ? 55.893 -9.066  -12.873 1.00 19.00 ? 310 VAL A O     1 
ATOM   2430 C  CB    . VAL A 1 313 ? 57.418 -8.703  -10.485 1.00 16.91 ? 310 VAL A CB    1 
ATOM   2431 C  CG1   . VAL A 1 313 ? 57.354 -7.163  -10.468 1.00 15.72 ? 310 VAL A CG1   1 
ATOM   2432 C  CG2   . VAL A 1 313 ? 58.170 -9.228  -9.263  1.00 14.83 ? 310 VAL A CG2   1 
ATOM   2433 N  N     . LYS A 1 314 ? 54.106 -8.385  -11.706 1.00 15.60 ? 311 LYS A N     1 
ATOM   2434 C  CA    . LYS A 1 314 ? 53.371 -8.045  -12.917 1.00 17.72 ? 311 LYS A CA    1 
ATOM   2435 C  C     . LYS A 1 314 ? 53.807 -6.688  -13.437 1.00 18.29 ? 311 LYS A C     1 
ATOM   2436 O  O     . LYS A 1 314 ? 53.998 -5.756  -12.654 1.00 17.74 ? 311 LYS A O     1 
ATOM   2437 C  CB    . LYS A 1 314 ? 51.868 -8.061  -12.641 1.00 17.62 ? 311 LYS A CB    1 
ATOM   2438 C  CG    . LYS A 1 314 ? 51.380 -9.456  -12.286 1.00 24.48 ? 311 LYS A CG    1 
ATOM   2439 C  CD    . LYS A 1 314 ? 49.990 -9.457  -11.685 1.00 34.32 ? 311 LYS A CD    1 
ATOM   2440 C  CE    . LYS A 1 314 ? 49.635 -10.872 -11.212 1.00 44.51 ? 311 LYS A CE    1 
ATOM   2441 N  NZ    . LYS A 1 314 ? 50.717 -11.493 -10.360 1.00 39.31 ? 311 LYS A NZ    1 
ATOM   2442 N  N     . PRO A 1 315 ? 53.966 -6.571  -14.762 1.00 13.70 ? 312 PRO A N     1 
ATOM   2443 C  CA    . PRO A 1 315 ? 54.331 -5.290  -15.372 1.00 13.64 ? 312 PRO A CA    1 
ATOM   2444 C  C     . PRO A 1 315 ? 53.142 -4.337  -15.404 1.00 20.53 ? 312 PRO A C     1 
ATOM   2445 O  O     . PRO A 1 315 ? 52.389 -4.261  -16.389 1.00 19.92 ? 312 PRO A O     1 
ATOM   2446 C  CB    . PRO A 1 315 ? 54.733 -5.693  -16.790 1.00 21.12 ? 312 PRO A CB    1 
ATOM   2447 C  CG    . PRO A 1 315 ? 53.886 -6.902  -17.071 1.00 19.76 ? 312 PRO A CG    1 
ATOM   2448 C  CD    . PRO A 1 315 ? 53.800 -7.639  -15.768 1.00 18.08 ? 312 PRO A CD    1 
ATOM   2449 N  N     . ARG A 1 316 ? 52.969 -3.596  -14.318 1.00 16.87 ? 313 ARG A N     1 
ATOM   2450 C  CA    . ARG A 1 316 ? 51.833 -2.688  -14.202 1.00 17.37 ? 313 ARG A CA    1 
ATOM   2451 C  C     . ARG A 1 316 ? 52.166 -1.575  -13.223 1.00 20.55 ? 313 ARG A C     1 
ATOM   2452 O  O     . ARG A 1 316 ? 52.256 -1.803  -12.028 1.00 19.98 ? 313 ARG A O     1 
ATOM   2453 C  CB    . ARG A 1 316 ? 50.592 -3.439  -13.717 1.00 25.57 ? 313 ARG A CB    1 
ATOM   2454 C  CG    A ARG A 1 316 ? 49.348 -2.591  -13.537 0.50 24.08 ? 313 ARG A CG    1 
ATOM   2455 C  CG    B ARG A 1 316 ? 49.355 -2.547  -13.669 0.50 24.06 ? 313 ARG A CG    1 
ATOM   2456 C  CD    A ARG A 1 316 ? 48.263 -3.375  -12.798 0.50 23.57 ? 313 ARG A CD    1 
ATOM   2457 C  CD    B ARG A 1 316 ? 48.153 -3.244  -13.048 0.50 23.20 ? 313 ARG A CD    1 
ATOM   2458 N  NE    A ARG A 1 316 ? 48.627 -3.629  -11.402 0.50 24.83 ? 313 ARG A NE    1 
ATOM   2459 N  NE    B ARG A 1 316 ? 48.427 -3.697  -11.687 0.50 25.35 ? 313 ARG A NE    1 
ATOM   2460 C  CZ    A ARG A 1 316 ? 48.851 -4.836  -10.885 0.50 28.72 ? 313 ARG A CZ    1 
ATOM   2461 C  CZ    B ARG A 1 316 ? 48.432 -2.914  -10.612 0.50 26.12 ? 313 ARG A CZ    1 
ATOM   2462 N  NH1   A ARG A 1 316 ? 49.177 -4.960  -9.603  0.50 28.91 ? 313 ARG A NH1   1 
ATOM   2463 N  NH1   B ARG A 1 316 ? 48.696 -3.440  -9.420  0.50 23.18 ? 313 ARG A NH1   1 
ATOM   2464 N  NH2   A ARG A 1 316 ? 48.741 -5.920  -11.643 0.50 30.86 ? 313 ARG A NH2   1 
ATOM   2465 N  NH2   B ARG A 1 316 ? 48.178 -1.610  -10.720 0.50 15.80 ? 313 ARG A NH2   1 
ATOM   2466 N  N     . GLN A 1 317 ? 52.318 -0.368  -13.745 1.00 21.51 ? 314 GLN A N     1 
ATOM   2467 C  CA    . GLN A 1 317 ? 52.723 0.784   -12.959 1.00 24.03 ? 314 GLN A CA    1 
ATOM   2468 C  C     . GLN A 1 317 ? 51.523 1.680   -12.633 1.00 28.01 ? 314 GLN A C     1 
ATOM   2469 O  O     . GLN A 1 317 ? 51.593 2.540   -11.752 1.00 26.74 ? 314 GLN A O     1 
ATOM   2470 C  CB    . GLN A 1 317 ? 53.759 1.567   -13.761 1.00 29.52 ? 314 GLN A CB    1 
ATOM   2471 C  CG    . GLN A 1 317 ? 54.441 2.687   -13.027 1.00 42.10 ? 314 GLN A CG    1 
ATOM   2472 C  CD    . GLN A 1 317 ? 55.436 3.410   -13.910 1.00 37.27 ? 314 GLN A CD    1 
ATOM   2473 O  OE1   . GLN A 1 317 ? 55.810 2.911   -14.978 1.00 44.00 ? 314 GLN A OE1   1 
ATOM   2474 N  NE2   . GLN A 1 317 ? 55.868 4.596   -13.477 1.00 33.54 ? 314 GLN A NE2   1 
ATOM   2475 N  N     . LEU A 1 318 ? 50.424 1.477   -13.350 1.00 23.45 ? 315 LEU A N     1 
ATOM   2476 C  CA    . LEU A 1 318 ? 49.228 2.309   -13.196 1.00 25.04 ? 315 LEU A CA    1 
ATOM   2477 C  C     . LEU A 1 318 ? 48.074 1.553   -12.530 1.00 21.43 ? 315 LEU A C     1 
ATOM   2478 O  O     . LEU A 1 318 ? 47.863 0.366   -12.792 1.00 23.54 ? 315 LEU A O     1 
ATOM   2479 C  CB    . LEU A 1 318 ? 48.746 2.800   -14.567 1.00 23.44 ? 315 LEU A CB    1 
ATOM   2480 C  CG    . LEU A 1 318 ? 49.669 3.647   -15.444 1.00 18.66 ? 315 LEU A CG    1 
ATOM   2481 C  CD1   . LEU A 1 318 ? 48.992 3.908   -16.794 1.00 26.95 ? 315 LEU A CD1   1 
ATOM   2482 C  CD2   . LEU A 1 318 ? 50.049 4.970   -14.767 1.00 21.44 ? 315 LEU A CD2   1 
ATOM   2483 N  N     . PRO A 1 319 ? 47.290 2.252   -11.694 1.00 19.20 ? 316 PRO A N     1 
ATOM   2484 C  CA    . PRO A 1 319 ? 46.086 1.623   -11.122 1.00 22.22 ? 316 PRO A CA    1 
ATOM   2485 C  C     . PRO A 1 319 ? 45.111 1.130   -12.208 1.00 24.06 ? 316 PRO A C     1 
ATOM   2486 O  O     . PRO A 1 319 ? 45.066 1.735   -13.270 1.00 22.45 ? 316 PRO A O     1 
ATOM   2487 C  CB    . PRO A 1 319 ? 45.466 2.742   -10.274 1.00 24.60 ? 316 PRO A CB    1 
ATOM   2488 C  CG    . PRO A 1 319 ? 46.116 4.016   -10.749 1.00 36.41 ? 316 PRO A CG    1 
ATOM   2489 C  CD    . PRO A 1 319 ? 47.467 3.651   -11.266 1.00 18.77 ? 316 PRO A CD    1 
ATOM   2490 N  N     . LYS A 1 320 ? 44.372 0.048   -11.938 1.00 22.47 ? 317 LYS A N     1 
ATOM   2491 C  CA    . LYS A 1 320 ? 43.407 -0.552  -12.875 1.00 25.00 ? 317 LYS A CA    1 
ATOM   2492 C  C     . LYS A 1 320 ? 42.018 0.061   -12.779 1.00 27.04 ? 317 LYS A C     1 
ATOM   2493 O  O     . LYS A 1 320 ? 41.175 -0.144  -13.651 1.00 22.10 ? 317 LYS A O     1 
ATOM   2494 C  CB    . LYS A 1 320 ? 43.193 -2.033  -12.547 1.00 32.19 ? 317 LYS A CB    1 
ATOM   2495 C  CG    . LYS A 1 320 ? 44.377 -2.939  -12.677 1.00 29.47 ? 317 LYS A CG    1 
ATOM   2496 C  CD    . LYS A 1 320 ? 43.897 -4.382  -12.693 1.00 28.84 ? 317 LYS A CD    1 
ATOM   2497 C  CE    . LYS A 1 320 ? 45.024 -5.310  -13.112 1.00 42.34 ? 317 LYS A CE    1 
ATOM   2498 N  NZ    . LYS A 1 320 ? 44.582 -6.723  -13.273 1.00 48.44 ? 317 LYS A NZ    1 
ATOM   2499 N  N     . THR A 1 321 ? 41.756 0.735   -11.668 1.00 25.56 ? 318 THR A N     1 
ATOM   2500 C  CA    . THR A 1 321 ? 40.467 1.362   -11.432 1.00 21.52 ? 318 THR A CA    1 
ATOM   2501 C  C     . THR A 1 321 ? 40.750 2.733   -10.856 1.00 23.53 ? 318 THR A C     1 
ATOM   2502 O  O     . THR A 1 321 ? 41.805 2.953   -10.265 1.00 25.90 ? 318 THR A O     1 
ATOM   2503 C  CB    . THR A 1 321 ? 39.602 0.545   -10.432 1.00 25.91 ? 318 THR A CB    1 
ATOM   2504 O  OG1   . THR A 1 321 ? 40.301 0.401   -9.189  1.00 26.65 ? 318 THR A OG1   1 
ATOM   2505 C  CG2   . THR A 1 321 ? 39.292 -0.837  -10.976 1.00 26.14 ? 318 THR A CG2   1 
ATOM   2506 N  N     . ILE A 1 322 ? 39.821 3.660   -11.055 1.00 17.93 ? 319 ILE A N     1 
ATOM   2507 C  CA    . ILE A 1 322 ? 39.887 4.978   -10.445 1.00 20.75 ? 319 ILE A CA    1 
ATOM   2508 C  C     . ILE A 1 322 ? 38.553 5.226   -9.744  1.00 21.33 ? 319 ILE A C     1 
ATOM   2509 O  O     . ILE A 1 322 ? 37.512 5.267   -10.395 1.00 20.71 ? 319 ILE A O     1 
ATOM   2510 C  CB    . ILE A 1 322 ? 40.136 6.064   -11.505 1.00 20.32 ? 319 ILE A CB    1 
ATOM   2511 C  CG1   . ILE A 1 322 ? 41.545 5.900   -12.102 1.00 22.98 ? 319 ILE A CG1   1 
ATOM   2512 C  CG2   . ILE A 1 322 ? 39.943 7.461   -10.910 1.00 22.45 ? 319 ILE A CG2   1 
ATOM   2513 C  CD1   . ILE A 1 322 ? 41.876 6.891   -13.194 1.00 23.39 ? 319 ILE A CD1   1 
ATOM   2514 N  N     . GLY A 1 323 ? 38.583 5.376   -8.421  1.00 18.41 ? 320 GLY A N     1 
ATOM   2515 C  CA    . GLY A 1 323 ? 37.353 5.432   -7.644  1.00 22.08 ? 320 GLY A CA    1 
ATOM   2516 C  C     . GLY A 1 323 ? 37.265 6.583   -6.662  1.00 24.20 ? 320 GLY A C     1 
ATOM   2517 O  O     . GLY A 1 323 ? 38.275 7.186   -6.306  1.00 20.04 ? 320 GLY A O     1 
ATOM   2518 N  N     . CYS A 1 324 ? 36.038 6.867   -6.225  1.00 16.11 ? 321 CYS A N     1 
ATOM   2519 C  CA    . CYS A 1 324 ? 35.726 7.990   -5.346  1.00 19.47 ? 321 CYS A CA    1 
ATOM   2520 C  C     . CYS A 1 324 ? 34.683 7.494   -4.349  1.00 17.76 ? 321 CYS A C     1 
ATOM   2521 O  O     . CYS A 1 324 ? 33.644 6.966   -4.757  1.00 17.45 ? 321 CYS A O     1 
ATOM   2522 C  CB    . CYS A 1 324 ? 35.117 9.127   -6.187  1.00 22.72 ? 321 CYS A CB    1 
ATOM   2523 S  SG    A CYS A 1 324 ? 35.396 10.773  -5.565  0.40 27.17 ? 321 CYS A SG    1 
ATOM   2524 S  SG    B CYS A 1 324 ? 36.275 10.010  -7.257  0.60 22.68 ? 321 CYS A SG    1 
ATOM   2525 N  N     . SER A 1 325 ? 34.934 7.652   -3.051  1.00 17.33 ? 322 SER A N     1 
ATOM   2526 C  CA    . SER A 1 325 ? 34.036 7.078   -2.050  1.00 24.05 ? 322 SER A CA    1 
ATOM   2527 C  C     . SER A 1 325 ? 33.881 7.970   -0.821  1.00 21.24 ? 322 SER A C     1 
ATOM   2528 O  O     . SER A 1 325 ? 34.823 8.648   -0.414  1.00 19.51 ? 322 SER A O     1 
ATOM   2529 C  CB    . SER A 1 325 ? 34.528 5.681   -1.638  1.00 22.75 ? 322 SER A CB    1 
ATOM   2530 O  OG    A SER A 1 325 ? 35.715 5.756   -0.883  0.50 19.07 ? 322 SER A OG    1 
ATOM   2531 O  OG    B SER A 1 325 ? 33.844 5.169   -0.515  0.50 21.39 ? 322 SER A OG    1 
ATOM   2532 N  N     . LYS A 1 326 ? 32.689 7.958   -0.230  1.00 19.82 ? 323 LYS A N     1 
ATOM   2533 C  CA    . LYS A 1 326 ? 32.450 8.701   1.004   1.00 16.66 ? 323 LYS A CA    1 
ATOM   2534 C  C     . LYS A 1 326 ? 31.470 7.997   1.927   1.00 18.63 ? 323 LYS A C     1 
ATOM   2535 O  O     . LYS A 1 326 ? 30.434 7.495   1.486   1.00 17.67 ? 323 LYS A O     1 
ATOM   2536 C  CB    . LYS A 1 326 ? 31.971 10.126  0.706   1.00 17.89 ? 323 LYS A CB    1 
ATOM   2537 C  CG    . LYS A 1 326 ? 31.710 10.927  1.995   1.00 20.19 ? 323 LYS A CG    1 
ATOM   2538 C  CD    . LYS A 1 326 ? 31.666 12.417  1.711   1.00 23.61 ? 323 LYS A CD    1 
ATOM   2539 C  CE    . LYS A 1 326 ? 31.421 13.203  2.991   1.00 26.99 ? 323 LYS A CE    1 
ATOM   2540 N  NZ    . LYS A 1 326 ? 32.422 12.842  4.012   1.00 30.83 ? 323 LYS A NZ    1 
ATOM   2541 N  N     . ASN A 1 327 ? 31.824 7.938   3.208   1.00 19.21 ? 324 ASN A N     1 
ATOM   2542 C  CA    . ASN A 1 327 ? 30.945 7.442   4.253   1.00 24.65 ? 324 ASN A CA    1 
ATOM   2543 C  C     . ASN A 1 327 ? 30.101 8.567   4.814   1.00 21.30 ? 324 ASN A C     1 
ATOM   2544 O  O     . ASN A 1 327 ? 30.519 9.721   4.808   1.00 20.00 ? 324 ASN A O     1 
ATOM   2545 C  CB    . ASN A 1 327 ? 31.747 6.861   5.421   1.00 21.46 ? 324 ASN A CB    1 
ATOM   2546 C  CG    . ASN A 1 327 ? 32.364 5.529   5.103   1.00 28.83 ? 324 ASN A CG    1 
ATOM   2547 O  OD1   . ASN A 1 327 ? 32.225 5.004   3.995   1.00 30.80 ? 324 ASN A OD1   1 
ATOM   2548 N  ND2   . ASN A 1 327 ? 33.068 4.968   6.079   1.00 30.82 ? 324 ASN A ND2   1 
ATOM   2549 N  N     . PHE A 1 328 ? 28.927 8.206   5.329   1.00 23.25 ? 325 PHE A N     1 
ATOM   2550 C  CA    . PHE A 1 328 ? 27.993 9.145   5.938   1.00 24.96 ? 325 PHE A CA    1 
ATOM   2551 C  C     . PHE A 1 328 ? 27.501 8.493   7.217   1.00 30.60 ? 325 PHE A C     1 
ATOM   2552 O  O     . PHE A 1 328 ? 26.402 7.938   7.262   1.00 25.97 ? 325 PHE A O     1 
ATOM   2553 C  CB    . PHE A 1 328 ? 26.825 9.423   4.992   1.00 25.02 ? 325 PHE A CB    1 
ATOM   2554 C  CG    . PHE A 1 328 ? 27.246 9.957   3.662   1.00 21.73 ? 325 PHE A CG    1 
ATOM   2555 C  CD1   . PHE A 1 328 ? 27.443 9.102   2.590   1.00 21.39 ? 325 PHE A CD1   1 
ATOM   2556 C  CD2   . PHE A 1 328 ? 27.486 11.305  3.486   1.00 20.11 ? 325 PHE A CD2   1 
ATOM   2557 C  CE1   . PHE A 1 328 ? 27.844 9.586   1.366   1.00 19.96 ? 325 PHE A CE1   1 
ATOM   2558 C  CE2   . PHE A 1 328 ? 27.886 11.795  2.263   1.00 22.58 ? 325 PHE A CE2   1 
ATOM   2559 C  CZ    . PHE A 1 328 ? 28.073 10.930  1.198   1.00 21.36 ? 325 PHE A CZ    1 
ATOM   2560 N  N     . PRO A 1 329 ? 28.337 8.542   8.260   1.00 31.14 ? 326 PRO A N     1 
ATOM   2561 C  CA    . PRO A 1 329 ? 28.167 7.770   9.495   1.00 39.45 ? 326 PRO A CA    1 
ATOM   2562 C  C     . PRO A 1 329 ? 27.051 8.266   10.400  1.00 34.88 ? 326 PRO A C     1 
ATOM   2563 O  O     . PRO A 1 329 ? 26.707 9.451   10.407  1.00 28.79 ? 326 PRO A O     1 
ATOM   2564 C  CB    . PRO A 1 329 ? 29.519 7.935   10.198  1.00 41.00 ? 326 PRO A CB    1 
ATOM   2565 C  CG    . PRO A 1 329 ? 30.041 9.234   9.698   1.00 36.44 ? 326 PRO A CG    1 
ATOM   2566 C  CD    . PRO A 1 329 ? 29.591 9.317   8.260   1.00 33.19 ? 326 PRO A CD    1 
ATOM   2567 N  N     . GLY A 1 330 ? 26.498 7.329   11.161  1.00 49.31 ? 327 GLY A N     1 
ATOM   2568 C  CA    . GLY A 1 330 ? 25.495 7.626   12.161  1.00 51.81 ? 327 GLY A CA    1 
ATOM   2569 C  C     . GLY A 1 330 ? 24.430 8.591   11.694  1.00 45.70 ? 327 GLY A C     1 
ATOM   2570 O  O     . GLY A 1 330 ? 23.588 8.257   10.860  1.00 42.61 ? 327 GLY A O     1 
ATOM   2571 N  N     . LYS A 1 331 ? 24.485 9.803   12.233  1.00 42.40 ? 328 LYS A N     1 
ATOM   2572 C  CA    . LYS A 1 331 ? 23.414 10.770  12.061  1.00 43.67 ? 328 LYS A CA    1 
ATOM   2573 C  C     . LYS A 1 331 ? 23.459 11.475  10.709  1.00 35.75 ? 328 LYS A C     1 
ATOM   2574 O  O     . LYS A 1 331 ? 22.444 11.988  10.247  1.00 45.51 ? 328 LYS A O     1 
ATOM   2575 C  CB    . LYS A 1 331 ? 23.451 11.782  13.212  1.00 54.45 ? 328 LYS A CB    1 
ATOM   2576 C  CG    . LYS A 1 331 ? 22.317 12.788  13.222  1.00 68.80 ? 328 LYS A CG    1 
ATOM   2577 C  CD    . LYS A 1 331 ? 22.270 13.542  14.547  1.00 75.48 ? 328 LYS A CD    1 
ATOM   2578 C  CE    . LYS A 1 331 ? 21.481 14.839  14.424  1.00 70.73 ? 328 LYS A CE    1 
ATOM   2579 N  NZ    . LYS A 1 331 ? 22.136 15.791  13.478  1.00 60.99 ? 328 LYS A NZ    1 
ATOM   2580 N  N     . THR A 1 332 ? 24.625 11.492  10.070  1.00 38.32 ? 329 THR A N     1 
ATOM   2581 C  CA    . THR A 1 332 ? 24.785 12.195  8.792   1.00 35.36 ? 329 THR A CA    1 
ATOM   2582 C  C     . THR A 1 332 ? 24.328 11.383  7.571   1.00 28.25 ? 329 THR A C     1 
ATOM   2583 O  O     . THR A 1 332 ? 24.465 11.843  6.436   1.00 32.20 ? 329 THR A O     1 
ATOM   2584 C  CB    . THR A 1 332 ? 26.244 12.629  8.557   1.00 32.59 ? 329 THR A CB    1 
ATOM   2585 O  OG1   . THR A 1 332 ? 27.058 11.469  8.341   1.00 31.18 ? 329 THR A OG1   1 
ATOM   2586 C  CG2   . THR A 1 332 ? 26.777 13.406  9.755   1.00 37.03 ? 329 THR A CG2   1 
ATOM   2587 N  N     . ALA A 1 333 ? 23.796 10.185  7.803   1.00 31.63 ? 330 ALA A N     1 
ATOM   2588 C  CA    . ALA A 1 333 ? 23.300 9.341   6.714   1.00 28.75 ? 330 ALA A CA    1 
ATOM   2589 C  C     . ALA A 1 333 ? 22.315 10.091  5.826   1.00 35.16 ? 330 ALA A C     1 
ATOM   2590 O  O     . ALA A 1 333 ? 21.547 10.922  6.307   1.00 32.31 ? 330 ALA A O     1 
ATOM   2591 C  CB    . ALA A 1 333 ? 22.666 8.071   7.271   1.00 32.72 ? 330 ALA A CB    1 
ATOM   2592 N  N     . LEU A 1 334 ? 22.337 9.797   4.528   1.00 27.60 ? 331 LEU A N     1 
ATOM   2593 C  CA    . LEU A 1 334 ? 21.538 10.547  3.563   1.00 33.63 ? 331 LEU A CA    1 
ATOM   2594 C  C     . LEU A 1 334 ? 20.100 10.022  3.525   1.00 33.72 ? 331 LEU A C     1 
ATOM   2595 O  O     . LEU A 1 334 ? 19.865 8.853   3.232   1.00 32.59 ? 331 LEU A O     1 
ATOM   2596 C  CB    . LEU A 1 334 ? 22.165 10.472  2.170   1.00 30.72 ? 331 LEU A CB    1 
ATOM   2597 C  CG    . LEU A 1 334 ? 23.677 10.673  2.055   1.00 26.25 ? 331 LEU A CG    1 
ATOM   2598 C  CD1   . LEU A 1 334 ? 24.075 10.757  0.581   1.00 21.57 ? 331 LEU A CD1   1 
ATOM   2599 C  CD2   . LEU A 1 334 ? 24.128 11.917  2.830   1.00 29.68 ? 331 LEU A CD2   1 
ATOM   2600 N  N     . ALA A 1 335 ? 19.139 10.891  3.820   1.00 42.26 ? 332 ALA A N     1 
ATOM   2601 C  CA    . ALA A 1 335 ? 17.760 10.444  4.004   1.00 40.04 ? 332 ALA A CA    1 
ATOM   2602 C  C     . ALA A 1 335 ? 16.777 11.122  3.053   1.00 40.25 ? 332 ALA A C     1 
ATOM   2603 O  O     . ALA A 1 335 ? 15.571 10.887  3.129   1.00 40.07 ? 332 ALA A O     1 
ATOM   2604 C  CB    . ALA A 1 335 ? 17.331 10.646  5.452   1.00 34.35 ? 332 ALA A CB    1 
ATOM   2605 N  N     . THR A 1 336 ? 17.294 11.966  2.167   1.00 30.91 ? 333 THR A N     1 
ATOM   2606 C  CA    . THR A 1 336 ? 16.455 12.627  1.179   1.00 39.41 ? 333 THR A CA    1 
ATOM   2607 C  C     . THR A 1 336 ? 16.993 12.423  -0.235  1.00 45.84 ? 333 THR A C     1 
ATOM   2608 O  O     . THR A 1 336 ? 18.199 12.307  -0.439  1.00 38.08 ? 333 THR A O     1 
ATOM   2609 C  CB    . THR A 1 336 ? 16.317 14.135  1.458   1.00 42.19 ? 333 THR A CB    1 
ATOM   2610 O  OG1   . THR A 1 336 ? 17.461 14.837  0.951   1.00 37.23 ? 333 THR A OG1   1 
ATOM   2611 C  CG2   . THR A 1 336 ? 16.162 14.395  2.957   1.00 41.76 ? 333 THR A CG2   1 
ATOM   2612 N  N     . ARG A 1 337 ? 16.088 12.380  -1.207  1.00 48.48 ? 334 ARG A N     1 
ATOM   2613 C  CA    . ARG A 1 337 ? 16.472 12.202  -2.599  1.00 42.02 ? 334 ARG A CA    1 
ATOM   2614 C  C     . ARG A 1 337 ? 17.436 13.300  -3.031  1.00 43.86 ? 334 ARG A C     1 
ATOM   2615 O  O     . ARG A 1 337 ? 18.426 13.031  -3.707  1.00 42.94 ? 334 ARG A O     1 
ATOM   2616 C  CB    . ARG A 1 337 ? 15.233 12.193  -3.503  1.00 51.21 ? 334 ARG A CB    1 
ATOM   2617 C  CG    . ARG A 1 337 ? 15.544 12.035  -4.989  1.00 61.58 ? 334 ARG A CG    1 
ATOM   2618 C  CD    . ARG A 1 337 ? 14.279 12.031  -5.853  1.00 57.98 ? 334 ARG A CD    1 
ATOM   2619 N  NE    . ARG A 1 337 ? 13.423 13.191  -5.602  1.00 68.72 ? 334 ARG A NE    1 
ATOM   2620 C  CZ    . ARG A 1 337 ? 13.775 14.451  -5.845  1.00 67.95 ? 334 ARG A CZ    1 
ATOM   2621 N  NH1   . ARG A 1 337 ? 14.975 14.725  -6.338  1.00 66.20 ? 334 ARG A NH1   1 
ATOM   2622 N  NH2   . ARG A 1 337 ? 12.930 15.441  -5.587  1.00 70.00 ? 334 ARG A NH2   1 
ATOM   2623 N  N     . GLU A 1 338 ? 17.144 14.536  -2.639  1.00 42.53 ? 335 GLU A N     1 
ATOM   2624 C  CA    . GLU A 1 338 ? 18.005 15.667  -2.969  1.00 39.74 ? 335 GLU A CA    1 
ATOM   2625 C  C     . GLU A 1 338 ? 19.417 15.483  -2.420  1.00 38.60 ? 335 GLU A C     1 
ATOM   2626 O  O     . GLU A 1 338 ? 20.401 15.896  -3.035  1.00 32.30 ? 335 GLU A O     1 
ATOM   2627 C  CB    . GLU A 1 338 ? 17.420 16.964  -2.408  1.00 40.65 ? 335 GLU A CB    1 
ATOM   2628 C  CG    . GLU A 1 338 ? 16.170 17.452  -3.120  1.00 59.07 ? 335 GLU A CG    1 
ATOM   2629 C  CD    . GLU A 1 338 ? 16.459 17.979  -4.515  1.00 68.49 ? 335 GLU A CD    1 
ATOM   2630 O  OE1   . GLU A 1 338 ? 17.609 17.837  -4.983  1.00 61.68 ? 335 GLU A OE1   1 
ATOM   2631 O  OE2   . GLU A 1 338 ? 15.534 18.539  -5.143  1.00 71.90 ? 335 GLU A OE2   1 
ATOM   2632 N  N     . GLN A 1 339 ? 19.511 14.881  -1.244  1.00 34.22 ? 336 GLN A N     1 
ATOM   2633 C  CA    . GLN A 1 339 ? 20.809 14.682  -0.620  1.00 37.91 ? 336 GLN A CA    1 
ATOM   2634 C  C     . GLN A 1 339 ? 21.621 13.697  -1.445  1.00 34.79 ? 336 GLN A C     1 
ATOM   2635 O  O     . GLN A 1 339 ? 22.774 13.951  -1.782  1.00 29.02 ? 336 GLN A O     1 
ATOM   2636 C  CB    . GLN A 1 339 ? 20.640 14.136  0.790   1.00 36.78 ? 336 GLN A CB    1 
ATOM   2637 C  CG    . GLN A 1 339 ? 20.891 15.136  1.886   1.00 31.65 ? 336 GLN A CG    1 
ATOM   2638 C  CD    . GLN A 1 339 ? 20.936 14.465  3.233   1.00 29.44 ? 336 GLN A CD    1 
ATOM   2639 O  OE1   . GLN A 1 339 ? 20.088 13.631  3.553   1.00 33.61 ? 336 GLN A OE1   1 
ATOM   2640 N  NE2   . GLN A 1 339 ? 21.942 14.805  4.028   1.00 31.66 ? 336 GLN A NE2   1 
ATOM   2641 N  N     . VAL A 1 340 ? 20.996 12.573  -1.770  1.00 30.50 ? 337 VAL A N     1 
ATOM   2642 C  CA    . VAL A 1 340 ? 21.658 11.509  -2.504  1.00 31.14 ? 337 VAL A CA    1 
ATOM   2643 C  C     . VAL A 1 340 ? 22.176 12.012  -3.846  1.00 30.29 ? 337 VAL A C     1 
ATOM   2644 O  O     . VAL A 1 340 ? 23.262 11.634  -4.283  1.00 33.71 ? 337 VAL A O     1 
ATOM   2645 C  CB    . VAL A 1 340 ? 20.719 10.301  -2.666  1.00 29.42 ? 337 VAL A CB    1 
ATOM   2646 C  CG1   . VAL A 1 340 ? 21.340 9.237   -3.554  1.00 21.67 ? 337 VAL A CG1   1 
ATOM   2647 C  CG2   . VAL A 1 340 ? 20.405 9.729   -1.306  1.00 24.66 ? 337 VAL A CG2   1 
ATOM   2648 N  N     . GLN A 1 341 ? 21.418 12.900  -4.475  1.00 30.95 ? 338 GLN A N     1 
ATOM   2649 C  CA    . GLN A 1 341 ? 21.755 13.384  -5.806  1.00 32.90 ? 338 GLN A CA    1 
ATOM   2650 C  C     . GLN A 1 341 ? 22.845 14.430  -5.754  1.00 30.97 ? 338 GLN A C     1 
ATOM   2651 O  O     . GLN A 1 341 ? 23.646 14.556  -6.672  1.00 32.03 ? 338 GLN A O     1 
ATOM   2652 C  CB    . GLN A 1 341 ? 20.511 13.948  -6.502  1.00 32.36 ? 338 GLN A CB    1 
ATOM   2653 C  CG    . GLN A 1 341 ? 19.415 12.906  -6.685  1.00 41.06 ? 338 GLN A CG    1 
ATOM   2654 C  CD    . GLN A 1 341 ? 18.214 13.443  -7.437  1.00 49.50 ? 338 GLN A CD    1 
ATOM   2655 O  OE1   . GLN A 1 341 ? 17.882 14.627  -7.342  1.00 49.58 ? 338 GLN A OE1   1 
ATOM   2656 N  NE2   . GLN A 1 341 ? 17.560 12.573  -8.201  1.00 46.32 ? 338 GLN A NE2   1 
ATOM   2657 N  N     . TRP A 1 342 ? 22.877 15.189  -4.673  1.00 28.71 ? 339 TRP A N     1 
ATOM   2658 C  CA    . TRP A 1 342 ? 23.900 16.202  -4.536  1.00 28.42 ? 339 TRP A CA    1 
ATOM   2659 C  C     . TRP A 1 342 ? 25.263 15.549  -4.293  1.00 21.32 ? 339 TRP A C     1 
ATOM   2660 O  O     . TRP A 1 342 ? 26.280 15.988  -4.831  1.00 22.70 ? 339 TRP A O     1 
ATOM   2661 C  CB    . TRP A 1 342 ? 23.546 17.164  -3.407  1.00 22.29 ? 339 TRP A CB    1 
ATOM   2662 C  CG    . TRP A 1 342 ? 24.492 18.300  -3.321  1.00 27.24 ? 339 TRP A CG    1 
ATOM   2663 C  CD1   . TRP A 1 342 ? 24.469 19.451  -4.055  1.00 29.35 ? 339 TRP A CD1   1 
ATOM   2664 C  CD2   . TRP A 1 342 ? 25.620 18.393  -2.462  1.00 23.36 ? 339 TRP A CD2   1 
ATOM   2665 N  NE1   . TRP A 1 342 ? 25.513 20.261  -3.695  1.00 31.76 ? 339 TRP A NE1   1 
ATOM   2666 C  CE2   . TRP A 1 342 ? 26.237 19.633  -2.716  1.00 25.87 ? 339 TRP A CE2   1 
ATOM   2667 C  CE3   . TRP A 1 342 ? 26.172 17.546  -1.499  1.00 22.09 ? 339 TRP A CE3   1 
ATOM   2668 C  CZ2   . TRP A 1 342 ? 27.377 20.047  -2.045  1.00 30.43 ? 339 TRP A CZ2   1 
ATOM   2669 C  CZ3   . TRP A 1 342 ? 27.300 17.960  -0.828  1.00 26.96 ? 339 TRP A CZ3   1 
ATOM   2670 C  CH2   . TRP A 1 342 ? 27.893 19.201  -1.104  1.00 27.78 ? 339 TRP A CH2   1 
ATOM   2671 N  N     . TRP A 1 343 ? 25.273 14.491  -3.494  1.00 21.58 ? 340 TRP A N     1 
ATOM   2672 C  CA    . TRP A 1 343 ? 26.521 13.811  -3.184  1.00 22.85 ? 340 TRP A CA    1 
ATOM   2673 C  C     . TRP A 1 343 ? 26.999 12.943  -4.344  1.00 22.01 ? 340 TRP A C     1 
ATOM   2674 O  O     . TRP A 1 343 ? 28.194 12.788  -4.537  1.00 19.29 ? 340 TRP A O     1 
ATOM   2675 C  CB    . TRP A 1 343 ? 26.406 12.995  -1.896  1.00 20.75 ? 340 TRP A CB    1 
ATOM   2676 C  CG    . TRP A 1 343 ? 26.540 13.837  -0.658  1.00 21.73 ? 340 TRP A CG    1 
ATOM   2677 C  CD1   . TRP A 1 343 ? 25.556 14.151  0.236   1.00 28.24 ? 340 TRP A CD1   1 
ATOM   2678 C  CD2   . TRP A 1 343 ? 27.733 14.479  -0.186  1.00 19.92 ? 340 TRP A CD2   1 
ATOM   2679 N  NE1   . TRP A 1 343 ? 26.068 14.941  1.245   1.00 25.09 ? 340 TRP A NE1   1 
ATOM   2680 C  CE2   . TRP A 1 343 ? 27.399 15.162  1.003   1.00 26.43 ? 340 TRP A CE2   1 
ATOM   2681 C  CE3   . TRP A 1 343 ? 29.049 14.539  -0.650  1.00 23.31 ? 340 TRP A CE3   1 
ATOM   2682 C  CZ2   . TRP A 1 343 ? 28.337 15.889  1.737   1.00 26.33 ? 340 TRP A CZ2   1 
ATOM   2683 C  CZ3   . TRP A 1 343 ? 29.975 15.271  0.074   1.00 25.21 ? 340 TRP A CZ3   1 
ATOM   2684 C  CH2   . TRP A 1 343 ? 29.615 15.934  1.255   1.00 29.29 ? 340 TRP A CH2   1 
ATOM   2685 N  N     . LEU A 1 344 ? 26.082 12.377  -5.121  1.00 20.25 ? 341 LEU A N     1 
ATOM   2686 C  CA    . LEU A 1 344 ? 26.514 11.647  -6.312  1.00 24.10 ? 341 LEU A CA    1 
ATOM   2687 C  C     . LEU A 1 344 ? 27.213 12.608  -7.248  1.00 22.08 ? 341 LEU A C     1 
ATOM   2688 O  O     . LEU A 1 344 ? 28.222 12.265  -7.868  1.00 24.04 ? 341 LEU A O     1 
ATOM   2689 C  CB    . LEU A 1 344 ? 25.351 10.941  -7.024  1.00 17.18 ? 341 LEU A CB    1 
ATOM   2690 C  CG    . LEU A 1 344 ? 24.792 9.680   -6.348  1.00 30.92 ? 341 LEU A CG    1 
ATOM   2691 C  CD1   . LEU A 1 344 ? 23.515 9.218   -7.026  1.00 31.19 ? 341 LEU A CD1   1 
ATOM   2692 C  CD2   . LEU A 1 344 ? 25.816 8.551   -6.304  1.00 26.35 ? 341 LEU A CD2   1 
ATOM   2693 N  N     . LEU A 1 345 ? 26.692 13.827  -7.340  1.00 17.58 ? 342 LEU A N     1 
ATOM   2694 C  CA    . LEU A 1 345 ? 27.290 14.826  -8.211  1.00 22.26 ? 342 LEU A CA    1 
ATOM   2695 C  C     . LEU A 1 345 ? 28.684 15.243  -7.733  1.00 22.65 ? 342 LEU A C     1 
ATOM   2696 O  O     . LEU A 1 345 ? 29.592 15.417  -8.543  1.00 22.06 ? 342 LEU A O     1 
ATOM   2697 C  CB    . LEU A 1 345 ? 26.373 16.049  -8.359  1.00 23.79 ? 342 LEU A CB    1 
ATOM   2698 C  CG    . LEU A 1 345 ? 26.873 17.124  -9.321  1.00 27.77 ? 342 LEU A CG    1 
ATOM   2699 C  CD1   . LEU A 1 345 ? 27.089 16.532  -10.723 1.00 28.88 ? 342 LEU A CD1   1 
ATOM   2700 C  CD2   . LEU A 1 345 ? 25.914 18.310  -9.383  1.00 34.97 ? 342 LEU A CD2   1 
ATOM   2701 N  N     . GLN A 1 346 ? 28.852 15.404  -6.422  1.00 19.67 ? 343 GLN A N     1 
ATOM   2702 C  CA    . GLN A 1 346 ? 30.156 15.765  -5.875  1.00 20.37 ? 343 GLN A CA    1 
ATOM   2703 C  C     . GLN A 1 346 ? 31.173 14.667  -6.195  1.00 18.27 ? 343 GLN A C     1 
ATOM   2704 O  O     . GLN A 1 346 ? 32.293 14.961  -6.610  1.00 18.19 ? 343 GLN A O     1 
ATOM   2705 C  CB    . GLN A 1 346 ? 30.099 15.960  -4.348  1.00 24.40 ? 343 GLN A CB    1 
ATOM   2706 C  CG    . GLN A 1 346 ? 29.138 17.052  -3.868  1.00 26.12 ? 343 GLN A CG    1 
ATOM   2707 C  CD    . GLN A 1 346 ? 29.149 18.290  -4.745  1.00 26.23 ? 343 GLN A CD    1 
ATOM   2708 O  OE1   . GLN A 1 346 ? 30.135 19.029  -4.802  1.00 26.98 ? 343 GLN A OE1   1 
ATOM   2709 N  NE2   . GLN A 1 346 ? 28.040 18.521  -5.442  1.00 26.18 ? 343 GLN A NE2   1 
ATOM   2710 N  N     . LEU A 1 347 ? 30.784 13.413  -5.972  1.00 20.73 ? 344 LEU A N     1 
ATOM   2711 C  CA    . LEU A 1 347 ? 31.674 12.285  -6.257  1.00 22.91 ? 344 LEU A CA    1 
ATOM   2712 C  C     . LEU A 1 347 ? 31.964 12.209  -7.753  1.00 23.09 ? 344 LEU A C     1 
ATOM   2713 O  O     . LEU A 1 347 ? 33.104 11.983  -8.158  1.00 18.99 ? 344 LEU A O     1 
ATOM   2714 C  CB    . LEU A 1 347 ? 31.079 10.958  -5.771  1.00 18.82 ? 344 LEU A CB    1 
ATOM   2715 C  CG    . LEU A 1 347 ? 31.213 10.636  -4.283  1.00 23.63 ? 344 LEU A CG    1 
ATOM   2716 C  CD1   . LEU A 1 347 ? 30.512 9.322   -3.943  1.00 26.86 ? 344 LEU A CD1   1 
ATOM   2717 C  CD2   . LEU A 1 347 ? 32.665 10.565  -3.893  1.00 25.61 ? 344 LEU A CD2   1 
ATOM   2718 N  N     . ALA A 1 348 ? 30.924 12.393  -8.563  1.00 21.12 ? 345 ALA A N     1 
ATOM   2719 C  CA    . ALA A 1 348 ? 31.043 12.339  -10.013 1.00 19.76 ? 345 ALA A CA    1 
ATOM   2720 C  C     . ALA A 1 348 ? 31.961 13.426  -10.549 1.00 22.20 ? 345 ALA A C     1 
ATOM   2721 O  O     . ALA A 1 348 ? 32.652 13.233  -11.550 1.00 22.17 ? 345 ALA A O     1 
ATOM   2722 C  CB    . ALA A 1 348 ? 29.658 12.453  -10.660 1.00 15.04 ? 345 ALA A CB    1 
ATOM   2723 N  N     . GLN A 1 349 ? 31.962 14.576  -9.886  1.00 20.50 ? 346 GLN A N     1 
ATOM   2724 C  CA    . GLN A 1 349 ? 32.824 15.674  -10.283 1.00 17.92 ? 346 GLN A CA    1 
ATOM   2725 C  C     . GLN A 1 349 ? 34.300 15.436  -9.980  1.00 18.20 ? 346 GLN A C     1 
ATOM   2726 O  O     . GLN A 1 349 ? 35.158 15.773  -10.791 1.00 19.35 ? 346 GLN A O     1 
ATOM   2727 C  CB    . GLN A 1 349 ? 32.341 16.987  -9.677  1.00 22.50 ? 346 GLN A CB    1 
ATOM   2728 C  CG    . GLN A 1 349 ? 31.078 17.502  -10.378 1.00 28.40 ? 346 GLN A CG    1 
ATOM   2729 C  CD    . GLN A 1 349 ? 30.562 18.801  -9.790  1.00 36.80 ? 346 GLN A CD    1 
ATOM   2730 O  OE1   . GLN A 1 349 ? 30.980 19.217  -8.711  1.00 32.73 ? 346 GLN A OE1   1 
ATOM   2731 N  NE2   . GLN A 1 349 ? 29.645 19.447  -10.501 1.00 42.11 ? 346 GLN A NE2   1 
ATOM   2732 N  N     . GLU A 1 350 ? 34.601 14.852  -8.826  1.00 18.43 ? 347 GLU A N     1 
ATOM   2733 C  CA    . GLU A 1 350 ? 35.987 14.498  -8.546  1.00 16.56 ? 347 GLU A CA    1 
ATOM   2734 C  C     . GLU A 1 350 ? 36.443 13.417  -9.532  1.00 17.24 ? 347 GLU A C     1 
ATOM   2735 O  O     . GLU A 1 350 ? 37.557 13.479  -10.050 1.00 19.17 ? 347 GLU A O     1 
ATOM   2736 C  CB    . GLU A 1 350 ? 36.202 14.033  -7.095  1.00 16.38 ? 347 GLU A CB    1 
ATOM   2737 C  CG    . GLU A 1 350 ? 37.690 13.707  -6.798  1.00 26.76 ? 347 GLU A CG    1 
ATOM   2738 C  CD    . GLU A 1 350 ? 37.939 13.055  -5.437  1.00 31.51 ? 347 GLU A CD    1 
ATOM   2739 O  OE1   . GLU A 1 350 ? 37.295 13.441  -4.435  1.00 29.11 ? 347 GLU A OE1   1 
ATOM   2740 O  OE2   . GLU A 1 350 ? 38.798 12.148  -5.373  1.00 25.55 ? 347 GLU A OE2   1 
ATOM   2741 N  N     . LEU A 1 351 ? 35.574 12.437  -9.776  1.00 15.57 ? 348 LEU A N     1 
ATOM   2742 C  CA    . LEU A 1 351 ? 35.885 11.319  -10.675 1.00 16.87 ? 348 LEU A CA    1 
ATOM   2743 C  C     . LEU A 1 351 ? 36.141 11.818  -12.095 1.00 21.59 ? 348 LEU A C     1 
ATOM   2744 O  O     . LEU A 1 351 ? 37.120 11.425  -12.724 1.00 17.91 ? 348 LEU A O     1 
ATOM   2745 C  CB    . LEU A 1 351 ? 34.767 10.280  -10.672 1.00 22.66 ? 348 LEU A CB    1 
ATOM   2746 C  CG    . LEU A 1 351 ? 35.018 8.968   -11.431 1.00 28.94 ? 348 LEU A CG    1 
ATOM   2747 C  CD1   . LEU A 1 351 ? 36.272 8.271   -10.884 1.00 25.79 ? 348 LEU A CD1   1 
ATOM   2748 C  CD2   . LEU A 1 351 ? 33.798 8.029   -11.384 1.00 24.35 ? 348 LEU A CD2   1 
ATOM   2749 N  N     . GLU A 1 352 ? 35.268 12.688  -12.599 1.00 18.35 ? 349 GLU A N     1 
ATOM   2750 C  CA    . GLU A 1 352 ? 35.478 13.283  -13.925 1.00 20.65 ? 349 GLU A CA    1 
ATOM   2751 C  C     . GLU A 1 352 ? 36.840 13.942  -14.056 1.00 22.52 ? 349 GLU A C     1 
ATOM   2752 O  O     . GLU A 1 352 ? 37.542 13.783  -15.064 1.00 20.72 ? 349 GLU A O     1 
ATOM   2753 C  CB    . GLU A 1 352 ? 34.400 14.324  -14.251 1.00 22.56 ? 349 GLU A CB    1 
ATOM   2754 C  CG    . GLU A 1 352 ? 34.698 15.064  -15.543 1.00 24.04 ? 349 GLU A CG    1 
ATOM   2755 C  CD    . GLU A 1 352 ? 33.673 16.134  -15.888 1.00 51.21 ? 349 GLU A CD    1 
ATOM   2756 O  OE1   . GLU A 1 352 ? 34.059 17.115  -16.561 1.00 59.71 ? 349 GLU A OE1   1 
ATOM   2757 O  OE2   . GLU A 1 352 ? 32.488 15.996  -15.505 1.00 42.59 ? 349 GLU A OE2   1 
ATOM   2758 N  N     . GLU A 1 353 ? 37.209 14.698  -13.032 1.00 21.67 ? 350 GLU A N     1 
ATOM   2759 C  CA    . GLU A 1 353 ? 38.476 15.412  -13.027 1.00 17.71 ? 350 GLU A CA    1 
ATOM   2760 C  C     . GLU A 1 353 ? 39.674 14.439  -13.064 1.00 16.50 ? 350 GLU A C     1 
ATOM   2761 O  O     . GLU A 1 353 ? 40.654 14.647  -13.803 1.00 18.58 ? 350 GLU A O     1 
ATOM   2762 C  CB    . GLU A 1 353 ? 38.514 16.296  -11.785 1.00 28.07 ? 350 GLU A CB    1 
ATOM   2763 C  CG    . GLU A 1 353 ? 39.749 17.136  -11.600 1.00 32.59 ? 350 GLU A CG    1 
ATOM   2764 C  CD    . GLU A 1 353 ? 39.636 18.004  -10.354 1.00 53.24 ? 350 GLU A CD    1 
ATOM   2765 O  OE1   . GLU A 1 353 ? 39.580 17.438  -9.237  1.00 52.96 ? 350 GLU A OE1   1 
ATOM   2766 O  OE2   . GLU A 1 353 ? 39.572 19.245  -10.495 1.00 50.07 ? 350 GLU A OE2   1 
ATOM   2767 N  N     . ARG A 1 354 ? 39.601 13.376  -12.272 1.00 18.03 ? 351 ARG A N     1 
ATOM   2768 C  CA    . ARG A 1 354 ? 40.679 12.386  -12.274 1.00 19.27 ? 351 ARG A CA    1 
ATOM   2769 C  C     . ARG A 1 354 ? 40.751 11.575  -13.574 1.00 18.86 ? 351 ARG A C     1 
ATOM   2770 O  O     . ARG A 1 354 ? 41.846 11.297  -14.075 1.00 20.11 ? 351 ARG A O     1 
ATOM   2771 C  CB    . ARG A 1 354 ? 40.578 11.478  -11.049 1.00 18.66 ? 351 ARG A CB    1 
ATOM   2772 C  CG    . ARG A 1 354 ? 40.986 12.206  -9.780  1.00 20.69 ? 351 ARG A CG    1 
ATOM   2773 C  CD    . ARG A 1 354 ? 40.578 11.441  -8.564  1.00 26.31 ? 351 ARG A CD    1 
ATOM   2774 N  NE    . ARG A 1 354 ? 41.176 10.118  -8.514  1.00 21.19 ? 351 ARG A NE    1 
ATOM   2775 C  CZ    . ARG A 1 354 ? 40.776 9.183   -7.660  1.00 23.49 ? 351 ARG A CZ    1 
ATOM   2776 N  NH1   . ARG A 1 354 ? 39.783 9.444   -6.805  1.00 28.09 ? 351 ARG A NH1   1 
ATOM   2777 N  NH2   . ARG A 1 354 ? 41.360 7.994   -7.657  1.00 20.44 ? 351 ARG A NH2   1 
ATOM   2778 N  N     . LEU A 1 355 ? 39.590 11.217  -14.121 1.00 17.86 ? 352 LEU A N     1 
ATOM   2779 C  CA    . LEU A 1 355 ? 39.521 10.476  -15.383 1.00 20.63 ? 352 LEU A CA    1 
ATOM   2780 C  C     . LEU A 1 355 ? 40.088 11.269  -16.558 1.00 19.88 ? 352 LEU A C     1 
ATOM   2781 O  O     . LEU A 1 355 ? 40.794 10.720  -17.407 1.00 20.38 ? 352 LEU A O     1 
ATOM   2782 C  CB    . LEU A 1 355 ? 38.083 10.051  -15.692 1.00 16.34 ? 352 LEU A CB    1 
ATOM   2783 C  CG    . LEU A 1 355 ? 37.532 8.850   -14.933 1.00 21.58 ? 352 LEU A CG    1 
ATOM   2784 C  CD1   . LEU A 1 355 ? 36.053 8.710   -15.207 1.00 18.03 ? 352 LEU A CD1   1 
ATOM   2785 C  CD2   . LEU A 1 355 ? 38.275 7.556   -15.311 1.00 21.46 ? 352 LEU A CD2   1 
ATOM   2786 N  N     . THR A 1 356 ? 39.760 12.556  -16.620 1.00 22.88 ? 353 THR A N     1 
ATOM   2787 C  CA    . THR A 1 356 ? 40.242 13.411  -17.699 1.00 23.23 ? 353 THR A CA    1 
ATOM   2788 C  C     . THR A 1 356 ? 41.764 13.548  -17.649 1.00 26.37 ? 353 THR A C     1 
ATOM   2789 O  O     . THR A 1 356 ? 42.445 13.472  -18.674 1.00 21.20 ? 353 THR A O     1 
ATOM   2790 C  CB    . THR A 1 356 ? 39.557 14.802  -17.663 1.00 24.84 ? 353 THR A CB    1 
ATOM   2791 O  OG1   . THR A 1 356 ? 38.149 14.631  -17.844 1.00 23.91 ? 353 THR A OG1   1 
ATOM   2792 C  CG2   . THR A 1 356 ? 40.078 15.688  -18.759 1.00 23.03 ? 353 THR A CG2   1 
ATOM   2793 N  N     . LYS A 1 357 ? 42.293 13.739  -16.446 1.00 23.11 ? 354 LYS A N     1 
ATOM   2794 C  CA    . LYS A 1 357 ? 43.732 13.787  -16.247 1.00 19.76 ? 354 LYS A CA    1 
ATOM   2795 C  C     . LYS A 1 357 ? 44.342 12.447  -16.645 1.00 18.78 ? 354 LYS A C     1 
ATOM   2796 O  O     . LYS A 1 357 ? 45.390 12.393  -17.304 1.00 20.77 ? 354 LYS A O     1 
ATOM   2797 C  CB    . LYS A 1 357 ? 44.050 14.099  -14.785 1.00 23.63 ? 354 LYS A CB    1 
ATOM   2798 C  CG    . LYS A 1 357 ? 45.533 14.051  -14.434 1.00 27.81 ? 354 LYS A CG    1 
ATOM   2799 C  CD    . LYS A 1 357 ? 46.272 15.219  -15.067 1.00 46.03 ? 354 LYS A CD    1 
ATOM   2800 C  CE    . LYS A 1 357 ? 47.350 15.789  -14.140 1.00 49.28 ? 354 LYS A CE    1 
ATOM   2801 N  NZ    . LYS A 1 357 ? 48.563 14.925  -14.058 1.00 53.26 ? 354 LYS A NZ    1 
ATOM   2802 N  N     . ASP A 1 358 ? 43.681 11.360  -16.262 1.00 21.85 ? 355 ASP A N     1 
ATOM   2803 C  CA    . ASP A 1 358 ? 44.193 10.029  -16.583 1.00 20.87 ? 355 ASP A CA    1 
ATOM   2804 C  C     . ASP A 1 358 ? 44.214 9.802   -18.087 1.00 21.92 ? 355 ASP A C     1 
ATOM   2805 O  O     . ASP A 1 358 ? 45.169 9.235   -18.617 1.00 25.25 ? 355 ASP A O     1 
ATOM   2806 C  CB    . ASP A 1 358 ? 43.380 8.925   -15.895 1.00 18.47 ? 355 ASP A CB    1 
ATOM   2807 C  CG    . ASP A 1 358 ? 43.912 7.525   -16.204 1.00 24.57 ? 355 ASP A CG    1 
ATOM   2808 O  OD1   . ASP A 1 358 ? 44.883 7.101   -15.549 1.00 23.68 ? 355 ASP A OD1   1 
ATOM   2809 O  OD2   . ASP A 1 358 ? 43.363 6.844   -17.095 1.00 26.04 ? 355 ASP A OD2   1 
ATOM   2810 N  N     . ARG A 1 359 ? 43.168 10.241  -18.780 1.00 17.56 ? 356 ARG A N     1 
ATOM   2811 C  CA    . ARG A 1 359 ? 43.120 10.065  -20.231 1.00 20.38 ? 356 ARG A CA    1 
ATOM   2812 C  C     . ARG A 1 359 ? 44.250 10.811  -20.957 1.00 20.57 ? 356 ARG A C     1 
ATOM   2813 O  O     . ARG A 1 359 ? 44.842 10.285  -21.905 1.00 22.21 ? 356 ARG A O     1 
ATOM   2814 C  CB    . ARG A 1 359 ? 41.752 10.467  -20.793 1.00 28.28 ? 356 ARG A CB    1 
ATOM   2815 C  CG    . ARG A 1 359 ? 41.602 10.223  -22.304 1.00 28.13 ? 356 ARG A CG    1 
ATOM   2816 C  CD    . ARG A 1 359 ? 40.202 10.599  -22.784 1.00 29.24 ? 356 ARG A CD    1 
ATOM   2817 N  NE    . ARG A 1 359 ? 39.924 12.020  -22.568 1.00 29.70 ? 356 ARG A NE    1 
ATOM   2818 C  CZ    . ARG A 1 359 ? 38.709 12.535  -22.396 1.00 34.18 ? 356 ARG A CZ    1 
ATOM   2819 N  NH1   . ARG A 1 359 ? 37.642 11.742  -22.404 1.00 32.01 ? 356 ARG A NH1   1 
ATOM   2820 N  NH2   . ARG A 1 359 ? 38.565 13.843  -22.215 1.00 32.91 ? 356 ARG A NH2   1 
ATOM   2821 N  N     . ASN A 1 360 ? 44.575 12.020  -20.507 1.00 25.28 ? 357 ASN A N     1 
ATOM   2822 C  CA    . ASN A 1 360 ? 45.663 12.784  -21.127 1.00 20.02 ? 357 ASN A CA    1 
ATOM   2823 C  C     . ASN A 1 360 ? 47.054 12.219  -20.835 1.00 24.91 ? 357 ASN A C     1 
ATOM   2824 O  O     . ASN A 1 360 ? 47.933 12.203  -21.701 1.00 26.14 ? 357 ASN A O     1 
ATOM   2825 C  CB    . ASN A 1 360 ? 45.618 14.243  -20.681 1.00 26.48 ? 357 ASN A CB    1 
ATOM   2826 C  CG    . ASN A 1 360 ? 44.480 15.011  -21.317 1.00 29.82 ? 357 ASN A CG    1 
ATOM   2827 O  OD1   . ASN A 1 360 ? 44.062 14.710  -22.434 1.00 31.43 ? 357 ASN A OD1   1 
ATOM   2828 N  ND2   . ASN A 1 360 ? 43.974 16.008  -20.608 1.00 26.32 ? 357 ASN A ND2   1 
ATOM   2829 N  N     . ASP A 1 361 ? 47.255 11.780  -19.599 1.00 20.74 ? 358 ASP A N     1 
ATOM   2830 C  CA    . ASP A 1 361 ? 48.555 11.282  -19.161 1.00 29.28 ? 358 ASP A CA    1 
ATOM   2831 C  C     . ASP A 1 361 ? 48.858 9.895   -19.693 1.00 23.11 ? 358 ASP A C     1 
ATOM   2832 O  O     . ASP A 1 361 ? 49.991 9.598   -20.060 1.00 21.52 ? 358 ASP A O     1 
ATOM   2833 C  CB    . ASP A 1 361 ? 48.631 11.242  -17.625 1.00 29.53 ? 358 ASP A CB    1 
ATOM   2834 C  CG    . ASP A 1 361 ? 48.768 12.620  -17.011 1.00 43.05 ? 358 ASP A CG    1 
ATOM   2835 O  OD1   . ASP A 1 361 ? 48.988 13.588  -17.774 1.00 33.26 ? 358 ASP A OD1   1 
ATOM   2836 O  OD2   . ASP A 1 361 ? 48.668 12.726  -15.765 1.00 40.83 ? 358 ASP A OD2   1 
ATOM   2837 N  N     . ASN A 1 362 ? 47.837 9.047   -19.725 1.00 25.04 ? 359 ASN A N     1 
ATOM   2838 C  CA    . ASN A 1 362 ? 48.059 7.609   -19.836 1.00 28.34 ? 359 ASN A CA    1 
ATOM   2839 C  C     . ASN A 1 362 ? 47.477 6.969   -21.093 1.00 27.86 ? 359 ASN A C     1 
ATOM   2840 O  O     . ASN A 1 362 ? 47.603 5.763   -21.293 1.00 26.77 ? 359 ASN A O     1 
ATOM   2841 C  CB    . ASN A 1 362 ? 47.592 6.902   -18.549 1.00 20.79 ? 359 ASN A CB    1 
ATOM   2842 C  CG    . ASN A 1 362 ? 48.411 7.329   -17.324 1.00 25.33 ? 359 ASN A CG    1 
ATOM   2843 O  OD1   . ASN A 1 362 ? 49.631 7.417   -17.393 1.00 24.19 ? 359 ASN A OD1   1 
ATOM   2844 N  ND2   . ASN A 1 362 ? 47.738 7.600   -16.207 1.00 23.84 ? 359 ASN A ND2   1 
ATOM   2845 N  N     . ASP A 1 363 ? 46.851 7.781   -21.943 1.00 23.35 ? 360 ASP A N     1 
ATOM   2846 C  CA    . ASP A 1 363 ? 46.357 7.306   -23.239 1.00 23.06 ? 360 ASP A CA    1 
ATOM   2847 C  C     . ASP A 1 363 ? 45.356 6.171   -23.126 1.00 29.49 ? 360 ASP A C     1 
ATOM   2848 O  O     . ASP A 1 363 ? 45.488 5.157   -23.811 1.00 30.46 ? 360 ASP A O     1 
ATOM   2849 C  CB    . ASP A 1 363 ? 47.521 6.843   -24.124 1.00 26.32 ? 360 ASP A CB    1 
ATOM   2850 C  CG    . ASP A 1 363 ? 48.432 7.985   -24.536 1.00 39.73 ? 360 ASP A CG    1 
ATOM   2851 O  OD1   . ASP A 1 363 ? 47.917 9.069   -24.902 1.00 31.65 ? 360 ASP A OD1   1 
ATOM   2852 O  OD2   . ASP A 1 363 ? 49.667 7.793   -24.492 1.00 44.65 ? 360 ASP A OD2   1 
ATOM   2853 N  N     . ARG A 1 364 ? 44.347 6.335   -22.277 1.00 31.28 ? 361 ARG A N     1 
ATOM   2854 C  CA    . ARG A 1 364 ? 43.346 5.288   -22.090 1.00 27.07 ? 361 ARG A CA    1 
ATOM   2855 C  C     . ARG A 1 364 ? 42.029 5.895   -21.635 1.00 18.17 ? 361 ARG A C     1 
ATOM   2856 O  O     . ARG A 1 364 ? 41.991 7.035   -21.168 1.00 25.31 ? 361 ARG A O     1 
ATOM   2857 C  CB    . ARG A 1 364 ? 43.830 4.263   -21.059 1.00 28.57 ? 361 ARG A CB    1 
ATOM   2858 C  CG    . ARG A 1 364 ? 44.162 4.870   -19.706 1.00 23.85 ? 361 ARG A CG    1 
ATOM   2859 C  CD    . ARG A 1 364 ? 44.680 3.824   -18.734 1.00 19.92 ? 361 ARG A CD    1 
ATOM   2860 N  NE    . ARG A 1 364 ? 44.773 4.331   -17.367 1.00 20.68 ? 361 ARG A NE    1 
ATOM   2861 C  CZ    . ARG A 1 364 ? 44.908 3.548   -16.301 1.00 26.25 ? 361 ARG A CZ    1 
ATOM   2862 N  NH1   . ARG A 1 364 ? 44.985 4.072   -15.078 1.00 25.51 ? 361 ARG A NH1   1 
ATOM   2863 N  NH2   . ARG A 1 364 ? 44.977 2.237   -16.462 1.00 25.62 ? 361 ARG A NH2   1 
ATOM   2864 N  N     . VAL A 1 365 ? 40.954 5.134   -21.788 1.00 20.63 ? 362 VAL A N     1 
ATOM   2865 C  CA    . VAL A 1 365 ? 39.615 5.570   -21.405 1.00 25.53 ? 362 VAL A CA    1 
ATOM   2866 C  C     . VAL A 1 365 ? 38.876 4.453   -20.679 1.00 25.30 ? 362 VAL A C     1 
ATOM   2867 O  O     . VAL A 1 365 ? 38.885 3.302   -21.120 1.00 21.44 ? 362 VAL A O     1 
ATOM   2868 C  CB    . VAL A 1 365 ? 38.791 5.989   -22.639 1.00 31.45 ? 362 VAL A CB    1 
ATOM   2869 C  CG1   . VAL A 1 365 ? 39.207 7.372   -23.114 1.00 34.47 ? 362 VAL A CG1   1 
ATOM   2870 C  CG2   . VAL A 1 365 ? 38.964 4.973   -23.762 1.00 32.29 ? 362 VAL A CG2   1 
ATOM   2871 N  N     . ALA A 1 366 ? 38.230 4.797   -19.568 1.00 20.01 ? 363 ALA A N     1 
ATOM   2872 C  CA    . ALA A 1 366 ? 37.410 3.844   -18.823 1.00 21.44 ? 363 ALA A CA    1 
ATOM   2873 C  C     . ALA A 1 366 ? 36.086 3.606   -19.541 1.00 23.58 ? 363 ALA A C     1 
ATOM   2874 O  O     . ALA A 1 366 ? 35.526 4.524   -20.140 1.00 29.45 ? 363 ALA A O     1 
ATOM   2875 C  CB    . ALA A 1 366 ? 37.152 4.372   -17.426 1.00 17.95 ? 363 ALA A CB    1 
ATOM   2876 N  N     . THR A 1 367 ? 35.567 2.386   -19.461 1.00 23.70 ? 364 THR A N     1 
ATOM   2877 C  CA    . THR A 1 367 ? 34.362 2.056   -20.207 1.00 28.35 ? 364 THR A CA    1 
ATOM   2878 C  C     . THR A 1 367 ? 33.208 1.563   -19.339 1.00 25.05 ? 364 THR A C     1 
ATOM   2879 O  O     . THR A 1 367 ? 32.101 1.371   -19.829 1.00 22.45 ? 364 THR A O     1 
ATOM   2880 C  CB    . THR A 1 367 ? 34.656 1.016   -21.312 1.00 23.78 ? 364 THR A CB    1 
ATOM   2881 O  OG1   . THR A 1 367 ? 34.972 -0.246  -20.712 1.00 24.92 ? 364 THR A OG1   1 
ATOM   2882 C  CG2   . THR A 1 367 ? 35.841 1.478   -22.165 1.00 25.61 ? 364 THR A CG2   1 
ATOM   2883 N  N     . GLN A 1 368 ? 33.468 1.347   -18.057 1.00 23.45 ? 365 GLN A N     1 
ATOM   2884 C  CA    . GLN A 1 368 ? 32.418 0.899   -17.150 1.00 24.50 ? 365 GLN A CA    1 
ATOM   2885 C  C     . GLN A 1 368 ? 32.407 1.743   -15.885 1.00 27.72 ? 365 GLN A C     1 
ATOM   2886 O  O     . GLN A 1 368 ? 33.458 2.093   -15.354 1.00 20.66 ? 365 GLN A O     1 
ATOM   2887 C  CB    . GLN A 1 368 ? 32.606 -0.562  -16.768 1.00 23.23 ? 365 GLN A CB    1 
ATOM   2888 C  CG    . GLN A 1 368 ? 31.377 -1.181  -16.158 1.00 36.73 ? 365 GLN A CG    1 
ATOM   2889 C  CD    . GLN A 1 368 ? 31.560 -2.648  -15.870 1.00 37.83 ? 365 GLN A CD    1 
ATOM   2890 O  OE1   . GLN A 1 368 ? 32.479 -3.040  -15.154 1.00 43.48 ? 365 GLN A OE1   1 
ATOM   2891 N  NE2   . GLN A 1 368 ? 30.692 -3.473  -16.436 1.00 43.99 ? 365 GLN A NE2   1 
ATOM   2892 N  N     . LEU A 1 369 ? 31.211 2.064   -15.414 1.00 26.76 ? 366 LEU A N     1 
ATOM   2893 C  CA    . LEU A 1 369 ? 31.037 2.781   -14.152 1.00 27.39 ? 366 LEU A CA    1 
ATOM   2894 C  C     . LEU A 1 369 ? 30.372 1.853   -13.148 1.00 22.67 ? 366 LEU A C     1 
ATOM   2895 O  O     . LEU A 1 369 ? 29.292 1.323   -13.406 1.00 28.26 ? 366 LEU A O     1 
ATOM   2896 C  CB    . LEU A 1 369 ? 30.162 4.017   -14.375 1.00 26.02 ? 366 LEU A CB    1 
ATOM   2897 C  CG    . LEU A 1 369 ? 29.787 4.879   -13.171 1.00 25.42 ? 366 LEU A CG    1 
ATOM   2898 C  CD1   . LEU A 1 369 ? 31.014 5.638   -12.670 1.00 23.15 ? 366 LEU A CD1   1 
ATOM   2899 C  CD2   . LEU A 1 369 ? 28.651 5.844   -13.546 1.00 28.86 ? 366 LEU A CD2   1 
ATOM   2900 N  N     . VAL A 1 370 ? 31.022 1.631   -12.013 1.00 20.78 ? 367 VAL A N     1 
ATOM   2901 C  CA    . VAL A 1 370 ? 30.443 0.807   -10.960 1.00 19.94 ? 367 VAL A CA    1 
ATOM   2902 C  C     . VAL A 1 370 ? 29.910 1.694   -9.835  1.00 26.72 ? 367 VAL A C     1 
ATOM   2903 O  O     . VAL A 1 370 ? 30.589 2.629   -9.414  1.00 21.73 ? 367 VAL A O     1 
ATOM   2904 C  CB    . VAL A 1 370 ? 31.491 -0.159  -10.390 1.00 22.73 ? 367 VAL A CB    1 
ATOM   2905 C  CG1   . VAL A 1 370 ? 30.954 -0.857  -9.148  1.00 30.38 ? 367 VAL A CG1   1 
ATOM   2906 C  CG2   . VAL A 1 370 ? 31.902 -1.164  -11.454 1.00 26.71 ? 367 VAL A CG2   1 
ATOM   2907 N  N     . VAL A 1 371 ? 28.699 1.406   -9.356  1.00 22.57 ? 368 VAL A N     1 
ATOM   2908 C  CA    . VAL A 1 371 ? 28.084 2.212   -8.303  1.00 20.88 ? 368 VAL A CA    1 
ATOM   2909 C  C     . VAL A 1 371 ? 27.792 1.322   -7.126  1.00 24.29 ? 368 VAL A C     1 
ATOM   2910 O  O     . VAL A 1 371 ? 27.238 0.235   -7.276  1.00 25.12 ? 368 VAL A O     1 
ATOM   2911 C  CB    . VAL A 1 371 ? 26.777 2.881   -8.775  1.00 25.77 ? 368 VAL A CB    1 
ATOM   2912 C  CG1   . VAL A 1 371 ? 26.244 3.836   -7.699  1.00 23.63 ? 368 VAL A CG1   1 
ATOM   2913 C  CG2   . VAL A 1 371 ? 27.012 3.622   -10.080 1.00 24.83 ? 368 VAL A CG2   1 
ATOM   2914 N  N     . SER A 1 372 ? 28.197 1.759   -5.946  1.00 21.74 ? 369 SER A N     1 
ATOM   2915 C  CA    . SER A 1 372 ? 28.036 0.936   -4.765  1.00 22.46 ? 369 SER A CA    1 
ATOM   2916 C  C     . SER A 1 372 ? 27.545 1.792   -3.611  1.00 20.86 ? 369 SER A C     1 
ATOM   2917 O  O     . SER A 1 372 ? 27.941 2.951   -3.475  1.00 24.99 ? 369 SER A O     1 
ATOM   2918 C  CB    . SER A 1 372 ? 29.364 0.272   -4.400  1.00 25.71 ? 369 SER A CB    1 
ATOM   2919 O  OG    . SER A 1 372 ? 29.271 -0.371  -3.142  1.00 35.00 ? 369 SER A OG    1 
ATOM   2920 N  N     . ILE A 1 373 ? 26.660 1.231   -2.802  1.00 22.37 ? 370 ILE A N     1 
ATOM   2921 C  CA    . ILE A 1 373 ? 26.130 1.947   -1.651  1.00 25.46 ? 370 ILE A CA    1 
ATOM   2922 C  C     . ILE A 1 373 ? 26.113 1.041   -0.437  1.00 29.80 ? 370 ILE A C     1 
ATOM   2923 O  O     . ILE A 1 373 ? 26.260 -0.181  -0.539  1.00 25.98 ? 370 ILE A O     1 
ATOM   2924 C  CB    . ILE A 1 373 ? 24.684 2.484   -1.879  1.00 23.85 ? 370 ILE A CB    1 
ATOM   2925 C  CG1   . ILE A 1 373 ? 23.679 1.331   -1.946  1.00 30.09 ? 370 ILE A CG1   1 
ATOM   2926 C  CG2   . ILE A 1 373 ? 24.602 3.419   -3.105  1.00 18.64 ? 370 ILE A CG2   1 
ATOM   2927 C  CD1   . ILE A 1 373 ? 22.257 1.783   -2.193  1.00 39.44 ? 370 ILE A CD1   1 
ATOM   2928 N  N     . ARG A 1 374 ? 25.956 1.656   0.724   1.00 29.70 ? 371 ARG A N     1 
ATOM   2929 C  CA    . ARG A 1 374 ? 25.696 0.908   1.935   1.00 30.07 ? 371 ARG A CA    1 
ATOM   2930 C  C     . ARG A 1 374 ? 24.456 1.543   2.541   1.00 33.33 ? 371 ARG A C     1 
ATOM   2931 O  O     . ARG A 1 374 ? 24.252 2.755   2.410   1.00 27.01 ? 371 ARG A O     1 
ATOM   2932 C  CB    . ARG A 1 374 ? 26.886 0.980   2.886   1.00 36.16 ? 371 ARG A CB    1 
ATOM   2933 C  CG    . ARG A 1 374 ? 26.833 -0.017  4.027   1.00 36.30 ? 371 ARG A CG    1 
ATOM   2934 C  CD    . ARG A 1 374 ? 27.974 0.235   4.988   1.00 43.65 ? 371 ARG A CD    1 
ATOM   2935 N  NE    . ARG A 1 374 ? 27.944 -0.649  6.148   1.00 55.82 ? 371 ARG A NE    1 
ATOM   2936 C  CZ    . ARG A 1 374 ? 28.777 -0.544  7.179   1.00 62.45 ? 371 ARG A CZ    1 
ATOM   2937 N  NH1   . ARG A 1 374 ? 29.699 0.413   7.194   1.00 54.90 ? 371 ARG A NH1   1 
ATOM   2938 N  NH2   . ARG A 1 374 ? 28.688 -1.387  8.198   1.00 66.28 ? 371 ARG A NH2   1 
ATOM   2939 N  N     . VAL A 1 375 ? 23.601 0.715   3.134   1.00 38.82 ? 372 VAL A N     1 
ATOM   2940 C  CA    . VAL A 1 375 ? 22.413 1.204   3.824   1.00 42.24 ? 372 VAL A CA    1 
ATOM   2941 C  C     . VAL A 1 375 ? 22.583 1.011   5.324   1.00 33.77 ? 372 VAL A C     1 
ATOM   2942 O  O     . VAL A 1 375 ? 23.321 0.125   5.770   1.00 33.50 ? 372 VAL A O     1 
ATOM   2943 C  CB    . VAL A 1 375 ? 21.143 0.480   3.360   1.00 42.99 ? 372 VAL A CB    1 
ATOM   2944 C  CG1   . VAL A 1 375 ? 20.899 0.742   1.888   1.00 43.61 ? 372 VAL A CG1   1 
ATOM   2945 C  CG2   . VAL A 1 375 ? 21.262 -1.006  3.629   1.00 48.64 ? 372 VAL A CG2   1 
ATOM   2946 N  N     . GLN A 1 376 ? 21.909 1.848   6.104   1.00 39.97 ? 373 GLN A N     1 
ATOM   2947 C  CA    . GLN A 1 376 ? 22.043 1.787   7.555   1.00 38.99 ? 373 GLN A CA    1 
ATOM   2948 C  C     . GLN A 1 376 ? 21.610 0.436   8.112   1.00 40.62 ? 373 GLN A C     1 
ATOM   2949 O  O     . GLN A 1 376 ? 20.503 -0.025  7.850   1.00 49.51 ? 373 GLN A O     1 
ATOM   2950 C  CB    . GLN A 1 376 ? 21.242 2.906   8.207   1.00 36.45 ? 373 GLN A CB    1 
ATOM   2951 C  CG    . GLN A 1 376 ? 21.741 3.264   9.597   1.00 51.15 ? 373 GLN A CG    1 
ATOM   2952 C  CD    . GLN A 1 376 ? 21.630 4.746   9.873   1.00 53.84 ? 373 GLN A CD    1 
ATOM   2953 O  OE1   . GLN A 1 376 ? 20.547 5.325   9.762   1.00 51.00 ? 373 GLN A OE1   1 
ATOM   2954 N  NE2   . GLN A 1 376 ? 22.757 5.379   10.212  1.00 49.52 ? 373 GLN A NE2   1 
ATOM   2955 N  N     . GLY A 1 377 ? 22.490 -0.203  8.874   1.00 44.77 ? 374 GLY A N     1 
ATOM   2956 C  CA    . GLY A 1 377 ? 22.170 -1.483  9.480   1.00 53.39 ? 374 GLY A CA    1 
ATOM   2957 C  C     . GLY A 1 377 ? 23.095 -2.618  9.072   1.00 63.65 ? 374 GLY A C     1 
ATOM   2958 O  O     . GLY A 1 377 ? 23.421 -3.486  9.886   1.00 56.79 ? 374 GLY A O     1 
ATOM   2959 N  N     . ASP A 1 378 ? 23.523 -2.612  7.814   1.00 52.31 ? 375 ASP A N     1 
ATOM   2960 C  CA    . ASP A 1 378 ? 24.340 -3.695  7.279   1.00 50.55 ? 375 ASP A CA    1 
ATOM   2961 C  C     . ASP A 1 378 ? 25.750 -3.707  7.867   1.00 61.04 ? 375 ASP A C     1 
ATOM   2962 O  O     . ASP A 1 378 ? 26.455 -2.699  7.827   1.00 58.21 ? 375 ASP A O     1 
ATOM   2963 C  CB    . ASP A 1 378 ? 24.418 -3.583  5.756   1.00 54.71 ? 375 ASP A CB    1 
ATOM   2964 C  CG    . ASP A 1 378 ? 25.000 -4.824  5.108   1.00 54.45 ? 375 ASP A CG    1 
ATOM   2965 O  OD1   . ASP A 1 378 ? 25.580 -5.668  5.824   1.00 49.84 ? 375 ASP A OD1   1 
ATOM   2966 O  OD2   . ASP A 1 378 ? 24.875 -4.952  3.875   1.00 56.16 ? 375 ASP A OD2   1 
ATOM   2967 N  N     . LYS A 1 379 ? 26.164 -4.854  8.401   1.00 62.77 ? 376 LYS A N     1 
ATOM   2968 C  CA    . LYS A 1 379 ? 27.520 -4.991  8.930   1.00 75.78 ? 376 LYS A CA    1 
ATOM   2969 C  C     . LYS A 1 379 ? 28.558 -4.967  7.810   1.00 71.23 ? 376 LYS A C     1 
ATOM   2970 O  O     . LYS A 1 379 ? 29.728 -4.647  8.037   1.00 70.28 ? 376 LYS A O     1 
ATOM   2971 C  CB    . LYS A 1 379 ? 27.672 -6.274  9.754   1.00 74.57 ? 376 LYS A CB    1 
ATOM   2972 C  CG    . LYS A 1 379 ? 29.065 -6.440  10.356  1.00 76.48 ? 376 LYS A CG    1 
ATOM   2973 C  CD    . LYS A 1 379 ? 29.204 -7.732  11.146  1.00 80.01 ? 376 LYS A CD    1 
ATOM   2974 C  CE    . LYS A 1 379 ? 30.630 -7.910  11.657  1.00 73.01 ? 376 LYS A CE    1 
ATOM   2975 N  NZ    . LYS A 1 379 ? 31.626 -7.860  10.546  1.00 73.13 ? 376 LYS A NZ    1 
ATOM   2976 N  N     . ARG A 1 380 ? 28.123 -5.307  6.601   1.00 61.73 ? 377 ARG A N     1 
ATOM   2977 C  CA    . ARG A 1 380 ? 29.014 -5.342  5.446   1.00 66.00 ? 377 ARG A CA    1 
ATOM   2978 C  C     . ARG A 1 380 ? 29.405 -3.940  5.005   1.00 64.90 ? 377 ARG A C     1 
ATOM   2979 O  O     . ARG A 1 380 ? 28.617 -3.002  5.131   1.00 64.23 ? 377 ARG A O     1 
ATOM   2980 C  CB    . ARG A 1 380 ? 28.344 -6.068  4.280   1.00 60.16 ? 377 ARG A CB    1 
ATOM   2981 C  CG    . ARG A 1 380 ? 27.984 -7.509  4.571   1.00 56.14 ? 377 ARG A CG    1 
ATOM   2982 C  CD    . ARG A 1 380 ? 27.184 -8.091  3.427   1.00 53.01 ? 377 ARG A CD    1 
ATOM   2983 N  NE    . ARG A 1 380 ? 25.906 -7.408  3.261   1.00 49.95 ? 377 ARG A NE    1 
ATOM   2984 C  CZ    . ARG A 1 380 ? 25.099 -7.586  2.221   1.00 45.27 ? 377 ARG A CZ    1 
ATOM   2985 N  NH1   . ARG A 1 380 ? 25.442 -8.422  1.255   1.00 44.52 ? 377 ARG A NH1   1 
ATOM   2986 N  NH2   . ARG A 1 380 ? 23.953 -6.926  2.142   1.00 47.48 ? 377 ARG A NH2   1 
ATOM   2987 N  N     . LEU A 1 381 ? 30.619 -3.801  4.484   1.00 60.87 ? 378 LEU A N     1 
ATOM   2988 C  CA    . LEU A 1 381 ? 31.071 -2.518  3.966   1.00 58.23 ? 378 LEU A CA    1 
ATOM   2989 C  C     . LEU A 1 381 ? 30.246 -2.084  2.754   1.00 59.90 ? 378 LEU A C     1 
ATOM   2990 O  O     . LEU A 1 381 ? 29.856 -0.921  2.646   1.00 59.78 ? 378 LEU A O     1 
ATOM   2991 C  CB    . LEU A 1 381 ? 32.563 -2.554  3.632   1.00 65.61 ? 378 LEU A CB    1 
ATOM   2992 C  CG    . LEU A 1 381 ? 33.499 -1.967  4.697   1.00 70.63 ? 378 LEU A CG    1 
ATOM   2993 C  CD1   . LEU A 1 381 ? 33.322 -2.666  6.044   1.00 61.72 ? 378 LEU A CD1   1 
ATOM   2994 C  CD2   . LEU A 1 381 ? 34.960 -2.018  4.239   1.00 62.61 ? 378 LEU A CD2   1 
ATOM   2995 N  N     . SER A 1 382 ? 29.980 -3.015  1.842   1.00 55.14 ? 379 SER A N     1 
ATOM   2996 C  CA    . SER A 1 382 ? 29.103 -2.725  0.710   1.00 51.67 ? 379 SER A CA    1 
ATOM   2997 C  C     . SER A 1 382 ? 27.828 -3.532  0.785   1.00 40.16 ? 379 SER A C     1 
ATOM   2998 O  O     . SER A 1 382 ? 27.859 -4.726  1.079   1.00 49.64 ? 379 SER A O     1 
ATOM   2999 C  CB    . SER A 1 382 ? 29.779 -3.013  -0.628  1.00 43.57 ? 379 SER A CB    1 
ATOM   3000 O  OG    . SER A 1 382 ? 28.816 -2.993  -1.675  1.00 44.50 ? 379 SER A OG    1 
ATOM   3001 N  N     . SER A 1 383 ? 26.710 -2.875  0.493   1.00 43.02 ? 380 SER A N     1 
ATOM   3002 C  CA    . SER A 1 383 ? 25.409 -3.528  0.503   1.00 44.90 ? 380 SER A CA    1 
ATOM   3003 C  C     . SER A 1 383 ? 24.999 -3.938  -0.903  1.00 53.47 ? 380 SER A C     1 
ATOM   3004 O  O     . SER A 1 383 ? 24.505 -5.045  -1.110  1.00 46.56 ? 380 SER A O     1 
ATOM   3005 C  CB    . SER A 1 383 ? 24.340 -2.604  1.104   1.00 47.79 ? 380 SER A CB    1 
ATOM   3006 O  OG    . SER A 1 383 ? 24.578 -2.360  2.485   1.00 38.39 ? 380 SER A OG    1 
ATOM   3007 N  N     . LEU A 1 384 ? 25.211 -3.040  -1.863  1.00 49.76 ? 381 LEU A N     1 
ATOM   3008 C  CA    . LEU A 1 384 ? 24.757 -3.249  -3.235  1.00 39.58 ? 381 LEU A CA    1 
ATOM   3009 C  C     . LEU A 1 384 ? 25.687 -2.609  -4.272  1.00 40.25 ? 381 LEU A C     1 
ATOM   3010 O  O     . LEU A 1 384 ? 26.069 -1.445  -4.153  1.00 28.31 ? 381 LEU A O     1 
ATOM   3011 C  CB    . LEU A 1 384 ? 23.342 -2.700  -3.397  1.00 42.07 ? 381 LEU A CB    1 
ATOM   3012 C  CG    . LEU A 1 384 ? 22.737 -2.760  -4.796  1.00 45.01 ? 381 LEU A CG    1 
ATOM   3013 C  CD1   . LEU A 1 384 ? 21.343 -3.359  -4.737  1.00 49.32 ? 381 LEU A CD1   1 
ATOM   3014 C  CD2   . LEU A 1 384 ? 22.714 -1.384  -5.443  1.00 35.05 ? 381 LEU A CD2   1 
ATOM   3015 N  N     . ARG A 1 385 ? 26.034 -3.377  -5.300  1.00 31.64 ? 382 ARG A N     1 
ATOM   3016 C  CA    . ARG A 1 385 ? 26.926 -2.903  -6.348  1.00 26.92 ? 382 ARG A CA    1 
ATOM   3017 C  C     . ARG A 1 385 ? 26.287 -3.166  -7.698  1.00 31.59 ? 382 ARG A C     1 
ATOM   3018 O  O     . ARG A 1 385 ? 25.857 -4.284  -7.985  1.00 37.27 ? 382 ARG A O     1 
ATOM   3019 C  CB    . ARG A 1 385 ? 28.268 -3.632  -6.271  1.00 35.84 ? 382 ARG A CB    1 
ATOM   3020 C  CG    . ARG A 1 385 ? 29.423 -2.850  -6.864  1.00 40.22 ? 382 ARG A CG    1 
ATOM   3021 C  CD    . ARG A 1 385 ? 30.506 -3.764  -7.414  1.00 51.17 ? 382 ARG A CD    1 
ATOM   3022 N  NE    . ARG A 1 385 ? 30.123 -4.348  -8.699  1.00 55.12 ? 382 ARG A NE    1 
ATOM   3023 C  CZ    . ARG A 1 385 ? 30.985 -4.732  -9.638  1.00 51.18 ? 382 ARG A CZ    1 
ATOM   3024 N  NH1   . ARG A 1 385 ? 30.539 -5.251  -10.774 1.00 48.57 ? 382 ARG A NH1   1 
ATOM   3025 N  NH2   . ARG A 1 385 ? 32.293 -4.589  -9.447  1.00 51.65 ? 382 ARG A NH2   1 
ATOM   3026 N  N     . ARG A 1 386 ? 26.204 -2.132  -8.522  1.00 22.57 ? 383 ARG A N     1 
ATOM   3027 C  CA    . ARG A 1 386 ? 25.615 -2.264  -9.843  1.00 27.11 ? 383 ARG A CA    1 
ATOM   3028 C  C     . ARG A 1 386 ? 26.499 -1.532  -10.832 1.00 27.44 ? 383 ARG A C     1 
ATOM   3029 O  O     . ARG A 1 386 ? 27.063 -0.491  -10.509 1.00 23.31 ? 383 ARG A O     1 
ATOM   3030 C  CB    . ARG A 1 386 ? 24.214 -1.657  -9.860  1.00 29.89 ? 383 ARG A CB    1 
ATOM   3031 C  CG    . ARG A 1 386 ? 23.224 -2.349  -8.949  1.00 36.69 ? 383 ARG A CG    1 
ATOM   3032 C  CD    . ARG A 1 386 ? 22.767 -3.652  -9.563  1.00 32.00 ? 383 ARG A CD    1 
ATOM   3033 N  NE    . ARG A 1 386 ? 21.620 -4.216  -8.867  1.00 28.11 ? 383 ARG A NE    1 
ATOM   3034 C  CZ    . ARG A 1 386 ? 21.702 -5.103  -7.882  1.00 40.05 ? 383 ARG A CZ    1 
ATOM   3035 N  NH1   . ARG A 1 386 ? 22.887 -5.533  -7.463  1.00 37.34 ? 383 ARG A NH1   1 
ATOM   3036 N  NH2   . ARG A 1 386 ? 20.592 -5.566  -7.316  1.00 46.55 ? 383 ARG A NH2   1 
ATOM   3037 N  N     . CYS A 1 387 ? 26.634 -2.072  -12.034 1.00 32.74 ? 384 CYS A N     1 
ATOM   3038 C  CA    . CYS A 1 387 ? 27.447 -1.408  -13.047 1.00 29.45 ? 384 CYS A CA    1 
ATOM   3039 C  C     . CYS A 1 387 ? 26.588 -0.846  -14.180 1.00 32.39 ? 384 CYS A C     1 
ATOM   3040 O  O     . CYS A 1 387 ? 25.469 -1.295  -14.405 1.00 31.64 ? 384 CYS A O     1 
ATOM   3041 C  CB    . CYS A 1 387 ? 28.532 -2.358  -13.582 1.00 30.01 ? 384 CYS A CB    1 
ATOM   3042 S  SG    . CYS A 1 387 ? 27.905 -3.787  -14.506 1.00 48.14 ? 384 CYS A SG    1 
ATOM   3043 N  N     . CYS A 1 388 ? 27.109 0.154   -14.879 1.00 34.45 ? 385 CYS A N     1 
ATOM   3044 C  CA    . CYS A 1 388 ? 26.470 0.642   -16.095 1.00 40.36 ? 385 CYS A CA    1 
ATOM   3045 C  C     . CYS A 1 388 ? 27.544 1.102   -17.073 1.00 37.20 ? 385 CYS A C     1 
ATOM   3046 O  O     . CYS A 1 388 ? 28.728 1.108   -16.734 1.00 34.26 ? 385 CYS A O     1 
ATOM   3047 C  CB    . CYS A 1 388 ? 25.468 1.762   -15.792 1.00 35.03 ? 385 CYS A CB    1 
ATOM   3048 S  SG    . CYS A 1 388 ? 26.177 3.307   -15.179 1.00 39.30 ? 385 CYS A SG    1 
ATOM   3049 N  N     . ALA A 1 389 ? 27.141 1.474   -18.285 1.00 31.14 ? 386 ALA A N     1 
ATOM   3050 C  CA    . ALA A 1 389 ? 28.101 1.918   -19.290 1.00 30.82 ? 386 ALA A CA    1 
ATOM   3051 C  C     . ALA A 1 389 ? 28.648 3.296   -18.965 1.00 30.29 ? 386 ALA A C     1 
ATOM   3052 O  O     . ALA A 1 389 ? 27.902 4.190   -18.570 1.00 35.18 ? 386 ALA A O     1 
ATOM   3053 C  CB    . ALA A 1 389 ? 27.465 1.927   -20.677 1.00 28.85 ? 386 ALA A CB    1 
ATOM   3054 N  N     . LEU A 1 390 ? 29.953 3.467   -19.133 1.00 25.61 ? 387 LEU A N     1 
ATOM   3055 C  CA    . LEU A 1 390 ? 30.571 4.778   -18.996 1.00 26.52 ? 387 LEU A CA    1 
ATOM   3056 C  C     . LEU A 1 390 ? 30.998 5.245   -20.382 1.00 31.12 ? 387 LEU A C     1 
ATOM   3057 O  O     . LEU A 1 390 ? 32.053 4.857   -20.878 1.00 30.05 ? 387 LEU A O     1 
ATOM   3058 C  CB    . LEU A 1 390 ? 31.775 4.702   -18.054 1.00 30.18 ? 387 LEU A CB    1 
ATOM   3059 C  CG    . LEU A 1 390 ? 32.219 5.974   -17.323 1.00 30.66 ? 387 LEU A CG    1 
ATOM   3060 C  CD1   . LEU A 1 390 ? 33.419 5.661   -16.431 1.00 26.08 ? 387 LEU A CD1   1 
ATOM   3061 C  CD2   . LEU A 1 390 ? 32.552 7.090   -18.283 1.00 31.22 ? 387 LEU A CD2   1 
ATOM   3062 N  N     . THR A 1 391 ? 30.177 6.083   -21.007 1.00 31.25 ? 388 THR A N     1 
ATOM   3063 C  CA    . THR A 1 391 ? 30.373 6.432   -22.412 1.00 34.62 ? 388 THR A CA    1 
ATOM   3064 C  C     . THR A 1 391 ? 30.931 7.839   -22.626 1.00 33.05 ? 388 THR A C     1 
ATOM   3065 O  O     . THR A 1 391 ? 31.446 8.142   -23.700 1.00 35.38 ? 388 THR A O     1 
ATOM   3066 C  CB    . THR A 1 391 ? 29.061 6.272   -23.218 1.00 37.74 ? 388 THR A CB    1 
ATOM   3067 O  OG1   . THR A 1 391 ? 28.103 7.248   -22.788 1.00 37.85 ? 388 THR A OG1   1 
ATOM   3068 C  CG2   . THR A 1 391 ? 28.477 4.880   -23.022 1.00 31.84 ? 388 THR A CG2   1 
ATOM   3069 N  N     . ARG A 1 392 ? 30.817 8.691   -21.606 1.00 31.23 ? 389 ARG A N     1 
ATOM   3070 C  CA    . ARG A 1 392 ? 31.325 10.060  -21.663 1.00 30.63 ? 389 ARG A CA    1 
ATOM   3071 C  C     . ARG A 1 392 ? 31.842 10.511  -20.301 1.00 28.31 ? 389 ARG A C     1 
ATOM   3072 O  O     . ARG A 1 392 ? 31.222 10.251  -19.274 1.00 31.85 ? 389 ARG A O     1 
ATOM   3073 C  CB    . ARG A 1 392 ? 30.234 11.026  -22.125 1.00 30.31 ? 389 ARG A CB    1 
ATOM   3074 C  CG    . ARG A 1 392 ? 29.760 10.795  -23.554 1.00 49.33 ? 389 ARG A CG    1 
ATOM   3075 C  CD    . ARG A 1 392 ? 28.730 11.834  -23.977 1.00 58.64 ? 389 ARG A CD    1 
ATOM   3076 N  NE    . ARG A 1 392 ? 29.242 13.192  -23.802 1.00 63.70 ? 389 ARG A NE    1 
ATOM   3077 C  CZ    . ARG A 1 392 ? 28.837 14.027  -22.849 1.00 71.97 ? 389 ARG A CZ    1 
ATOM   3078 N  NH1   . ARG A 1 392 ? 29.366 15.244  -22.759 1.00 68.60 ? 389 ARG A NH1   1 
ATOM   3079 N  NH2   . ARG A 1 392 ? 27.898 13.651  -21.989 1.00 69.20 ? 389 ARG A NH2   1 
ATOM   3080 N  N     . TYR A 1 393 ? 32.981 11.185  -20.302 1.00 26.12 ? 390 TYR A N     1 
ATOM   3081 C  CA    . TYR A 1 393 ? 33.519 11.769  -19.087 1.00 25.54 ? 390 TYR A CA    1 
ATOM   3082 C  C     . TYR A 1 393 ? 32.729 13.037  -18.749 1.00 33.05 ? 390 TYR A C     1 
ATOM   3083 O  O     . TYR A 1 393 ? 33.200 14.153  -18.968 1.00 26.94 ? 390 TYR A O     1 
ATOM   3084 C  CB    . TYR A 1 393 ? 35.009 12.079  -19.255 1.00 26.99 ? 390 TYR A CB    1 
ATOM   3085 C  CG    . TYR A 1 393 ? 35.926 10.858  -19.212 1.00 21.47 ? 390 TYR A CG    1 
ATOM   3086 C  CD1   . TYR A 1 393 ? 37.306 11.002  -19.274 1.00 20.16 ? 390 TYR A CD1   1 
ATOM   3087 C  CD2   . TYR A 1 393 ? 35.409 9.573   -19.109 1.00 27.72 ? 390 TYR A CD2   1 
ATOM   3088 C  CE1   . TYR A 1 393 ? 38.149 9.901   -19.227 1.00 18.57 ? 390 TYR A CE1   1 
ATOM   3089 C  CE2   . TYR A 1 393 ? 36.242 8.467   -19.059 1.00 27.85 ? 390 TYR A CE2   1 
ATOM   3090 C  CZ    . TYR A 1 393 ? 37.614 8.638   -19.117 1.00 24.56 ? 390 TYR A CZ    1 
ATOM   3091 O  OH    . TYR A 1 393 ? 38.445 7.535   -19.062 1.00 24.12 ? 390 TYR A OH    1 
ATOM   3092 N  N     . ASP A 1 394 ? 31.519 12.856  -18.229 1.00 27.38 ? 391 ASP A N     1 
ATOM   3093 C  CA    . ASP A 1 394 ? 30.667 13.989  -17.873 1.00 28.31 ? 391 ASP A CA    1 
ATOM   3094 C  C     . ASP A 1 394 ? 30.021 13.746  -16.516 1.00 19.74 ? 391 ASP A C     1 
ATOM   3095 O  O     . ASP A 1 394 ? 29.289 12.765  -16.346 1.00 24.40 ? 391 ASP A O     1 
ATOM   3096 C  CB    . ASP A 1 394 ? 29.593 14.192  -18.942 1.00 31.28 ? 391 ASP A CB    1 
ATOM   3097 C  CG    . ASP A 1 394 ? 28.831 15.487  -18.760 1.00 41.20 ? 391 ASP A CG    1 
ATOM   3098 O  OD1   . ASP A 1 394 ? 27.805 15.475  -18.050 1.00 36.40 ? 391 ASP A OD1   1 
ATOM   3099 O  OD2   . ASP A 1 394 ? 29.265 16.519  -19.315 1.00 54.98 ? 391 ASP A OD2   1 
ATOM   3100 N  N     . ALA A 1 395 ? 30.303 14.622  -15.554 1.00 25.25 ? 392 ALA A N     1 
ATOM   3101 C  CA    . ALA A 1 395 ? 29.882 14.399  -14.168 1.00 29.08 ? 392 ALA A CA    1 
ATOM   3102 C  C     . ALA A 1 395 ? 28.367 14.312  -14.005 1.00 23.19 ? 392 ALA A C     1 
ATOM   3103 O  O     . ALA A 1 395 ? 27.868 13.471  -13.263 1.00 23.90 ? 392 ALA A O     1 
ATOM   3104 C  CB    . ALA A 1 395 ? 30.475 15.462  -13.229 1.00 22.97 ? 392 ALA A CB    1 
ATOM   3105 N  N     . HIS A 1 396 ? 27.637 15.189  -14.688 1.00 30.88 ? 393 HIS A N     1 
ATOM   3106 C  CA    . HIS A 1 396 ? 26.183 15.184  -14.591 1.00 29.79 ? 393 HIS A CA    1 
ATOM   3107 C  C     . HIS A 1 396 ? 25.602 13.893  -15.135 1.00 25.31 ? 393 HIS A C     1 
ATOM   3108 O  O     . HIS A 1 396 ? 24.739 13.278  -14.506 1.00 30.18 ? 393 HIS A O     1 
ATOM   3109 C  CB    . HIS A 1 396 ? 25.588 16.412  -15.282 1.00 29.72 ? 393 HIS A CB    1 
ATOM   3110 C  CG    . HIS A 1 396 ? 25.797 17.679  -14.511 1.00 38.56 ? 393 HIS A CG    1 
ATOM   3111 N  ND1   . HIS A 1 396 ? 26.848 18.536  -14.758 1.00 44.62 ? 393 HIS A ND1   1 
ATOM   3112 C  CD2   . HIS A 1 396 ? 25.112 18.212  -13.471 1.00 47.68 ? 393 HIS A CD2   1 
ATOM   3113 C  CE1   . HIS A 1 396 ? 26.791 19.555  -13.916 1.00 43.75 ? 393 HIS A CE1   1 
ATOM   3114 N  NE2   . HIS A 1 396 ? 25.749 19.381  -13.124 1.00 41.43 ? 393 HIS A NE2   1 
ATOM   3115 N  N     . LYS A 1 397 ? 26.089 13.469  -16.298 1.00 28.06 ? 394 LYS A N     1 
ATOM   3116 C  CA    . LYS A 1 397 ? 25.659 12.190  -16.851 1.00 27.26 ? 394 LYS A CA    1 
ATOM   3117 C  C     . LYS A 1 397 ? 26.012 11.026  -15.934 1.00 24.14 ? 394 LYS A C     1 
ATOM   3118 O  O     . LYS A 1 397 ? 25.192 10.146  -15.681 1.00 30.01 ? 394 LYS A O     1 
ATOM   3119 C  CB    . LYS A 1 397 ? 26.249 11.946  -18.239 1.00 33.24 ? 394 LYS A CB    1 
ATOM   3120 C  CG    . LYS A 1 397 ? 25.855 10.582  -18.795 1.00 38.62 ? 394 LYS A CG    1 
ATOM   3121 C  CD    . LYS A 1 397 ? 26.354 10.349  -20.210 1.00 43.00 ? 394 LYS A CD    1 
ATOM   3122 C  CE    . LYS A 1 397 ? 26.042 8.923   -20.646 1.00 42.22 ? 394 LYS A CE    1 
ATOM   3123 N  NZ    . LYS A 1 397 ? 24.623 8.551   -20.359 1.00 47.84 ? 394 LYS A NZ    1 
ATOM   3124 N  N     . MET A 1 398 ? 27.241 11.009  -15.436 1.00 22.27 ? 395 MET A N     1 
ATOM   3125 C  CA    . MET A 1 398 ? 27.644 9.908   -14.573 1.00 28.40 ? 395 MET A CA    1 
ATOM   3126 C  C     . MET A 1 398 ? 26.808 9.853   -13.298 1.00 23.61 ? 395 MET A C     1 
ATOM   3127 O  O     . MET A 1 398 ? 26.413 8.770   -12.861 1.00 23.96 ? 395 MET A O     1 
ATOM   3128 C  CB    . MET A 1 398 ? 29.134 9.978   -14.249 1.00 25.75 ? 395 MET A CB    1 
ATOM   3129 C  CG    . MET A 1 398 ? 30.022 9.454   -15.364 1.00 23.01 ? 395 MET A CG    1 
ATOM   3130 S  SD    . MET A 1 398 ? 31.751 9.473   -14.863 1.00 36.32 ? 395 MET A SD    1 
ATOM   3131 C  CE    . MET A 1 398 ? 32.096 11.228  -14.988 1.00 26.24 ? 395 MET A CE    1 
ATOM   3132 N  N     . SER A 1 399 ? 26.528 11.014  -12.707 1.00 27.34 ? 396 SER A N     1 
ATOM   3133 C  CA    . SER A 1 399 ? 25.750 11.040  -11.468 1.00 25.66 ? 396 SER A CA    1 
ATOM   3134 C  C     . SER A 1 399 ? 24.286 10.698  -11.749 1.00 28.16 ? 396 SER A C     1 
ATOM   3135 O  O     . SER A 1 399 ? 23.620 10.047  -10.945 1.00 26.15 ? 396 SER A O     1 
ATOM   3136 C  CB    . SER A 1 399 ? 25.862 12.394  -10.754 1.00 28.57 ? 396 SER A CB    1 
ATOM   3137 O  OG    . SER A 1 399 ? 25.351 13.457  -11.547 1.00 33.25 ? 396 SER A OG    1 
ATOM   3138 N  N     . HIS A 1 400 ? 23.790 11.139  -12.896 1.00 28.01 ? 397 HIS A N     1 
ATOM   3139 C  CA    . HIS A 1 400 ? 22.432 10.791  -13.289 1.00 30.00 ? 397 HIS A CA    1 
ATOM   3140 C  C     . HIS A 1 400 ? 22.306 9.278   -13.492 1.00 28.72 ? 397 HIS A C     1 
ATOM   3141 O  O     . HIS A 1 400 ? 21.352 8.649   -13.027 1.00 29.17 ? 397 HIS A O     1 
ATOM   3142 C  CB    . HIS A 1 400 ? 22.033 11.543  -14.558 1.00 33.54 ? 397 HIS A CB    1 
ATOM   3143 C  CG    . HIS A 1 400 ? 20.624 11.283  -14.986 1.00 45.94 ? 397 HIS A CG    1 
ATOM   3144 N  ND1   . HIS A 1 400 ? 20.292 10.296  -15.889 1.00 50.12 ? 397 HIS A ND1   1 
ATOM   3145 C  CD2   . HIS A 1 400 ? 19.459 11.865  -14.618 1.00 51.74 ? 397 HIS A CD2   1 
ATOM   3146 C  CE1   . HIS A 1 400 ? 18.983 10.290  -16.069 1.00 49.70 ? 397 HIS A CE1   1 
ATOM   3147 N  NE2   . HIS A 1 400 ? 18.454 11.232  -15.309 1.00 55.04 ? 397 HIS A NE2   1 
ATOM   3148 N  N     . ASP A 1 401 ? 23.287 8.696   -14.178 1.00 32.04 ? 398 ASP A N     1 
ATOM   3149 C  CA    . ASP A 1 401 ? 23.322 7.254   -14.408 1.00 29.34 ? 398 ASP A CA    1 
ATOM   3150 C  C     . ASP A 1 401 ? 23.442 6.458   -13.121 1.00 28.15 ? 398 ASP A C     1 
ATOM   3151 O  O     . ASP A 1 401 ? 22.800 5.420   -12.964 1.00 31.37 ? 398 ASP A O     1 
ATOM   3152 C  CB    . ASP A 1 401 ? 24.472 6.890   -15.349 1.00 27.92 ? 398 ASP A CB    1 
ATOM   3153 C  CG    . ASP A 1 401 ? 24.238 7.389   -16.758 1.00 40.06 ? 398 ASP A CG    1 
ATOM   3154 O  OD1   . ASP A 1 401 ? 23.081 7.750   -17.062 1.00 33.83 ? 398 ASP A OD1   1 
ATOM   3155 O  OD2   . ASP A 1 401 ? 25.199 7.419   -17.557 1.00 36.83 ? 398 ASP A OD2   1 
ATOM   3156 N  N     . ALA A 1 402 ? 24.269 6.938   -12.198 1.00 26.94 ? 399 ALA A N     1 
ATOM   3157 C  CA    . ALA A 1 402 ? 24.437 6.252   -10.921 1.00 24.09 ? 399 ALA A CA    1 
ATOM   3158 C  C     . ALA A 1 402 ? 23.119 6.234   -10.170 1.00 24.92 ? 399 ALA A C     1 
ATOM   3159 O  O     . ALA A 1 402 ? 22.757 5.228   -9.565  1.00 24.79 ? 399 ALA A O     1 
ATOM   3160 C  CB    . ALA A 1 402 ? 25.520 6.927   -10.083 1.00 28.39 ? 399 ALA A CB    1 
ATOM   3161 N  N     . PHE A 1 403 ? 22.396 7.348   -10.220 1.00 28.86 ? 400 PHE A N     1 
ATOM   3162 C  CA    . PHE A 1 403 ? 21.124 7.448   -9.510  1.00 34.39 ? 400 PHE A CA    1 
ATOM   3163 C  C     . PHE A 1 403 ? 20.115 6.477   -10.101 1.00 30.75 ? 400 PHE A C     1 
ATOM   3164 O  O     . PHE A 1 403 ? 19.410 5.773   -9.380  1.00 34.62 ? 400 PHE A O     1 
ATOM   3165 C  CB    . PHE A 1 403 ? 20.573 8.871   -9.573  1.00 35.36 ? 400 PHE A CB    1 
ATOM   3166 C  CG    . PHE A 1 403 ? 19.320 9.070   -8.764  1.00 48.43 ? 400 PHE A CG    1 
ATOM   3167 C  CD1   . PHE A 1 403 ? 18.078 9.131   -9.382  1.00 53.60 ? 400 PHE A CD1   1 
ATOM   3168 C  CD2   . PHE A 1 403 ? 19.383 9.188   -7.382  1.00 40.27 ? 400 PHE A CD2   1 
ATOM   3169 C  CE1   . PHE A 1 403 ? 16.921 9.314   -8.635  1.00 51.57 ? 400 PHE A CE1   1 
ATOM   3170 C  CE2   . PHE A 1 403 ? 18.231 9.370   -6.629  1.00 52.56 ? 400 PHE A CE2   1 
ATOM   3171 C  CZ    . PHE A 1 403 ? 17.001 9.434   -7.256  1.00 53.60 ? 400 PHE A CZ    1 
ATOM   3172 N  N     . THR A 1 404 ? 20.055 6.444   -11.421 1.00 34.88 ? 401 THR A N     1 
ATOM   3173 C  CA    . THR A 1 404 ? 19.177 5.511   -12.104 1.00 32.32 ? 401 THR A CA    1 
ATOM   3174 C  C     . THR A 1 404 ? 19.394 4.060   -11.675 1.00 33.69 ? 401 THR A C     1 
ATOM   3175 O  O     . THR A 1 404 ? 18.429 3.319   -11.514 1.00 37.22 ? 401 THR A O     1 
ATOM   3176 C  CB    . THR A 1 404 ? 19.317 5.635   -13.630 1.00 28.04 ? 401 THR A CB    1 
ATOM   3177 O  OG1   . THR A 1 404 ? 18.934 6.956   -14.032 1.00 32.93 ? 401 THR A OG1   1 
ATOM   3178 C  CG2   . THR A 1 404 ? 18.442 4.611   -14.342 1.00 34.94 ? 401 THR A CG2   1 
ATOM   3179 N  N     . VAL A 1 405 ? 20.642 3.639   -11.480 1.00 27.54 ? 402 VAL A N     1 
ATOM   3180 C  CA    . VAL A 1 405 ? 20.882 2.221   -11.197 1.00 29.82 ? 402 VAL A CA    1 
ATOM   3181 C  C     . VAL A 1 405 ? 20.682 1.847   -9.731  1.00 30.56 ? 402 VAL A C     1 
ATOM   3182 O  O     . VAL A 1 405 ? 20.597 0.664   -9.413  1.00 38.00 ? 402 VAL A O     1 
ATOM   3183 C  CB    . VAL A 1 405 ? 22.266 1.716   -11.683 1.00 37.71 ? 402 VAL A CB    1 
ATOM   3184 C  CG1   . VAL A 1 405 ? 22.528 2.158   -13.118 1.00 35.62 ? 402 VAL A CG1   1 
ATOM   3185 C  CG2   . VAL A 1 405 ? 23.370 2.187   -10.764 1.00 39.52 ? 402 VAL A CG2   1 
ATOM   3186 N  N     . ILE A 1 406 ? 20.596 2.846   -8.849  1.00 34.71 ? 403 ILE A N     1 
ATOM   3187 C  CA    . ILE A 1 406 ? 20.381 2.599   -7.418  1.00 41.49 ? 403 ILE A CA    1 
ATOM   3188 C  C     . ILE A 1 406 ? 19.016 3.066   -6.911  1.00 33.59 ? 403 ILE A C     1 
ATOM   3189 O  O     . ILE A 1 406 ? 18.610 2.713   -5.802  1.00 41.84 ? 403 ILE A O     1 
ATOM   3190 C  CB    . ILE A 1 406 ? 21.432 3.314   -6.528  1.00 35.39 ? 403 ILE A CB    1 
ATOM   3191 C  CG1   . ILE A 1 406 ? 21.188 4.830   -6.538  1.00 35.84 ? 403 ILE A CG1   1 
ATOM   3192 C  CG2   . ILE A 1 406 ? 22.839 2.936   -6.941  1.00 36.70 ? 403 ILE A CG2   1 
ATOM   3193 C  CD1   . ILE A 1 406 ? 21.890 5.576   -5.422  1.00 36.25 ? 403 ILE A CD1   1 
ATOM   3194 N  N     . LYS A 1 407 ? 18.323 3.878   -7.699  1.00 35.55 ? 404 LYS A N     1 
ATOM   3195 C  CA    . LYS A 1 407 ? 17.111 4.531   -7.211  1.00 43.09 ? 404 LYS A CA    1 
ATOM   3196 C  C     . LYS A 1 407 ? 16.052 3.549   -6.699  1.00 47.98 ? 404 LYS A C     1 
ATOM   3197 O  O     . LYS A 1 407 ? 15.236 3.896   -5.845  1.00 53.38 ? 404 LYS A O     1 
ATOM   3198 C  CB    . LYS A 1 407 ? 16.516 5.461   -8.274  1.00 38.82 ? 404 LYS A CB    1 
ATOM   3199 C  CG    . LYS A 1 407 ? 15.900 4.756   -9.474  1.00 38.31 ? 404 LYS A CG    1 
ATOM   3200 C  CD    . LYS A 1 407 ? 15.485 5.774   -10.534 1.00 44.46 ? 404 LYS A CD    1 
ATOM   3201 C  CE    . LYS A 1 407 ? 14.744 5.121   -11.696 1.00 46.64 ? 404 LYS A CE    1 
ATOM   3202 N  NZ    . LYS A 1 407 ? 15.609 4.174   -12.456 1.00 56.63 ? 404 LYS A NZ    1 
ATOM   3203 N  N     . ASN A 1 408 ? 16.072 2.324   -7.211  1.00 42.80 ? 405 ASN A N     1 
ATOM   3204 C  CA    . ASN A 1 408 ? 15.067 1.335   -6.832  1.00 52.65 ? 405 ASN A CA    1 
ATOM   3205 C  C     . ASN A 1 408 ? 15.340 0.721   -5.464  1.00 51.77 ? 405 ASN A C     1 
ATOM   3206 O  O     . ASN A 1 408 ? 14.546 -0.073  -4.962  1.00 51.22 ? 405 ASN A O     1 
ATOM   3207 C  CB    . ASN A 1 408 ? 14.987 0.232   -7.882  1.00 47.58 ? 405 ASN A CB    1 
ATOM   3208 C  CG    . ASN A 1 408 ? 16.180 -0.701  -7.827  1.00 64.53 ? 405 ASN A CG    1 
ATOM   3209 O  OD1   . ASN A 1 408 ? 17.319 -0.292  -8.085  1.00 53.15 ? 405 ASN A OD1   1 
ATOM   3210 N  ND2   . ASN A 1 408 ? 15.928 -1.962  -7.487  1.00 63.26 ? 405 ASN A ND2   1 
ATOM   3211 N  N     . CYS A 1 409 ? 16.471 1.078   -4.868  1.00 49.66 ? 406 CYS A N     1 
ATOM   3212 C  CA    . CYS A 1 409 ? 16.809 0.578   -3.542  1.00 52.01 ? 406 CYS A CA    1 
ATOM   3213 C  C     . CYS A 1 409 ? 15.955 1.281   -2.506  1.00 49.70 ? 406 CYS A C     1 
ATOM   3214 O  O     . CYS A 1 409 ? 15.794 0.804   -1.386  1.00 54.33 ? 406 CYS A O     1 
ATOM   3215 C  CB    . CYS A 1 409 ? 18.286 0.816   -3.229  1.00 52.46 ? 406 CYS A CB    1 
ATOM   3216 S  SG    . CYS A 1 409 ? 19.392 -0.443  -3.860  1.00 70.69 ? 406 CYS A SG    1 
ATOM   3217 N  N     . ASN A 1 410 ? 15.411 2.427   -2.894  1.00 49.64 ? 407 ASN A N     1 
ATOM   3218 C  CA    . ASN A 1 410 ? 14.649 3.254   -1.976  1.00 48.21 ? 407 ASN A CA    1 
ATOM   3219 C  C     . ASN A 1 410 ? 13.345 2.591   -1.516  1.00 56.86 ? 407 ASN A C     1 
ATOM   3220 O  O     . ASN A 1 410 ? 12.357 2.551   -2.250  1.00 55.56 ? 407 ASN A O     1 
ATOM   3221 C  CB    . ASN A 1 410 ? 14.386 4.624   -2.604  1.00 43.74 ? 407 ASN A CB    1 
ATOM   3222 C  CG    . ASN A 1 410 ? 13.749 5.588   -1.639  1.00 42.19 ? 407 ASN A CG    1 
ATOM   3223 O  OD1   . ASN A 1 410 ? 13.554 5.266   -0.466  1.00 45.00 ? 407 ASN A OD1   1 
ATOM   3224 N  ND2   . ASN A 1 410 ? 13.423 6.785   -2.122  1.00 43.09 ? 407 ASN A ND2   1 
ATOM   3225 N  N     . THR A 1 411 ? 13.370 2.067   -0.294  1.00 57.93 ? 408 THR A N     1 
ATOM   3226 C  CA    . THR A 1 411 ? 12.214 1.437   0.341   1.00 57.35 ? 408 THR A CA    1 
ATOM   3227 C  C     . THR A 1 411 ? 11.056 2.409   0.530   1.00 56.63 ? 408 THR A C     1 
ATOM   3228 O  O     . THR A 1 411 ? 9.891  2.020   0.458   1.00 57.32 ? 408 THR A O     1 
ATOM   3229 C  CB    . THR A 1 411 ? 12.601 0.863   1.720   1.00 51.17 ? 408 THR A CB    1 
ATOM   3230 O  OG1   . THR A 1 411 ? 13.019 -0.499  1.573   1.00 70.09 ? 408 THR A OG1   1 
ATOM   3231 C  CG2   . THR A 1 411 ? 11.431 0.924   2.690   1.00 65.35 ? 408 THR A CG2   1 
ATOM   3232 N  N     . SER A 1 412 ? 11.386 3.672   0.776   1.00 58.37 ? 409 SER A N     1 
ATOM   3233 C  CA    . SER A 1 412 ? 10.388 4.699   1.058   1.00 56.85 ? 409 SER A CA    1 
ATOM   3234 C  C     . SER A 1 412 ? 9.220  4.673   0.084   1.00 61.39 ? 409 SER A C     1 
ATOM   3235 O  O     . SER A 1 412 ? 9.411  4.617   -1.130  1.00 66.35 ? 409 SER A O     1 
ATOM   3236 C  CB    . SER A 1 412 ? 11.031 6.087   1.037   1.00 55.72 ? 409 SER A CB    1 
ATOM   3237 O  OG    . SER A 1 412 ? 10.060 7.105   1.203   1.00 61.40 ? 409 SER A OG    1 
ATOM   3238 N  N     . GLY A 1 413 ? 8.007  4.714   0.623   1.00 65.78 ? 410 GLY A N     1 
ATOM   3239 C  CA    . GLY A 1 413 ? 6.829  4.869   -0.207  1.00 69.78 ? 410 GLY A CA    1 
ATOM   3240 C  C     . GLY A 1 413 ? 6.793  6.283   -0.755  1.00 68.74 ? 410 GLY A C     1 
ATOM   3241 O  O     . GLY A 1 413 ? 6.326  6.525   -1.868  1.00 66.46 ? 410 GLY A O     1 
ATOM   3242 N  N     . ILE A 1 414 ? 7.297  7.219   0.042   1.00 64.30 ? 411 ILE A N     1 
ATOM   3243 C  CA    . ILE A 1 414 ? 7.387  8.616   -0.360  1.00 66.06 ? 411 ILE A CA    1 
ATOM   3244 C  C     . ILE A 1 414 ? 8.518  8.786   -1.372  1.00 69.35 ? 411 ILE A C     1 
ATOM   3245 O  O     . ILE A 1 414 ? 9.608  8.239   -1.195  1.00 66.09 ? 411 ILE A O     1 
ATOM   3246 C  CB    . ILE A 1 414 ? 7.658  9.526   0.860   1.00 65.07 ? 411 ILE A CB    1 
ATOM   3247 C  CG1   . ILE A 1 414 ? 6.906  9.006   2.090   1.00 62.15 ? 411 ILE A CG1   1 
ATOM   3248 C  CG2   . ILE A 1 414 ? 7.295  10.973  0.545   1.00 54.22 ? 411 ILE A CG2   1 
ATOM   3249 C  CD1   . ILE A 1 414 ? 7.204  9.771   3.362   1.00 61.61 ? 411 ILE A CD1   1 
ATOM   3250 N  N     . GLN A 1 415 ? 8.256  9.549   -2.429  1.00 74.71 ? 412 GLN A N     1 
ATOM   3251 C  CA    . GLN A 1 415 ? 9.234  9.752   -3.496  1.00 72.30 ? 412 GLN A CA    1 
ATOM   3252 C  C     . GLN A 1 415 ? 10.453 10.533  -3.011  1.00 67.36 ? 412 GLN A C     1 
ATOM   3253 O  O     . GLN A 1 415 ? 11.596 10.183  -3.321  1.00 68.33 ? 412 GLN A O     1 
ATOM   3254 C  CB    . GLN A 1 415 ? 8.584  10.486  -4.675  1.00 75.09 ? 412 GLN A CB    1 
ATOM   3255 C  CG    . GLN A 1 415 ? 9.459  10.599  -5.919  1.00 70.17 ? 412 GLN A CG    1 
ATOM   3256 C  CD    . GLN A 1 415 ? 9.589  9.286   -6.675  1.00 81.34 ? 412 GLN A CD    1 
ATOM   3257 O  OE1   . GLN A 1 415 ? 9.721  8.217   -6.075  1.00 81.58 ? 412 GLN A OE1   1 
ATOM   3258 N  NE2   . GLN A 1 415 ? 9.546  9.363   -8.001  1.00 78.48 ? 412 GLN A NE2   1 
ATOM   3259 N  N     . THR A 1 416 ? 10.194 11.588  -2.244  1.00 63.51 ? 413 THR A N     1 
ATOM   3260 C  CA    . THR A 1 416 ? 11.226 12.525  -1.815  1.00 59.12 ? 413 THR A CA    1 
ATOM   3261 C  C     . THR A 1 416 ? 12.138 11.976  -0.721  1.00 57.09 ? 413 THR A C     1 
ATOM   3262 O  O     . THR A 1 416 ? 13.305 12.351  -0.633  1.00 56.74 ? 413 THR A O     1 
ATOM   3263 C  CB    . THR A 1 416 ? 10.590 13.832  -1.322  1.00 57.63 ? 413 THR A CB    1 
ATOM   3264 O  OG1   . THR A 1 416 ? 9.910  14.463  -2.413  1.00 61.47 ? 413 THR A OG1   1 
ATOM   3265 C  CG2   . THR A 1 416 ? 11.649 14.777  -0.775  1.00 64.28 ? 413 THR A CG2   1 
ATOM   3266 N  N     . GLU A 1 417 ? 11.602 11.095  0.115   1.00 53.94 ? 414 GLU A N     1 
ATOM   3267 C  CA    . GLU A 1 417 ? 12.380 10.523  1.203   1.00 50.38 ? 414 GLU A CA    1 
ATOM   3268 C  C     . GLU A 1 417 ? 13.217 9.348   0.728   1.00 55.05 ? 414 GLU A C     1 
ATOM   3269 O  O     . GLU A 1 417 ? 12.847 8.651   -0.218  1.00 55.68 ? 414 GLU A O     1 
ATOM   3270 C  CB    . GLU A 1 417 ? 11.467 10.081  2.348   1.00 52.02 ? 414 GLU A CB    1 
ATOM   3271 C  CG    . GLU A 1 417 ? 10.557 11.178  2.858   1.00 56.35 ? 414 GLU A CG    1 
ATOM   3272 C  CD    . GLU A 1 417 ? 11.275 12.503  2.983   1.00 56.67 ? 414 GLU A CD    1 
ATOM   3273 O  OE1   . GLU A 1 417 ? 12.022 12.684  3.969   1.00 50.89 ? 414 GLU A OE1   1 
ATOM   3274 O  OE2   . GLU A 1 417 ? 11.097 13.361  2.090   1.00 58.59 ? 414 GLU A OE2   1 
ATOM   3275 N  N     . TRP A 1 418 ? 14.353 9.136   1.384   1.00 38.44 ? 415 TRP A N     1 
ATOM   3276 C  CA    . TRP A 1 418 ? 15.161 7.961   1.111   1.00 38.57 ? 415 TRP A CA    1 
ATOM   3277 C  C     . TRP A 1 418 ? 15.260 7.069   2.334   1.00 43.15 ? 415 TRP A C     1 
ATOM   3278 O  O     . TRP A 1 418 ? 15.713 7.499   3.395   1.00 43.54 ? 415 TRP A O     1 
ATOM   3279 C  CB    . TRP A 1 418 ? 16.567 8.338   0.638   1.00 39.56 ? 415 TRP A CB    1 
ATOM   3280 C  CG    . TRP A 1 418 ? 17.239 7.172   -0.003  1.00 34.20 ? 415 TRP A CG    1 
ATOM   3281 C  CD1   . TRP A 1 418 ? 17.731 6.062   0.618   1.00 33.98 ? 415 TRP A CD1   1 
ATOM   3282 C  CD2   . TRP A 1 418 ? 17.447 6.977   -1.404  1.00 34.07 ? 415 TRP A CD2   1 
ATOM   3283 N  NE1   . TRP A 1 418 ? 18.244 5.188   -0.312  1.00 41.22 ? 415 TRP A NE1   1 
ATOM   3284 C  CE2   . TRP A 1 418 ? 18.086 5.729   -1.560  1.00 37.99 ? 415 TRP A CE2   1 
ATOM   3285 C  CE3   . TRP A 1 418 ? 17.169 7.744   -2.538  1.00 35.42 ? 415 TRP A CE3   1 
ATOM   3286 C  CZ2   . TRP A 1 418 ? 18.450 5.229   -2.812  1.00 39.69 ? 415 TRP A CZ2   1 
ATOM   3287 C  CZ3   . TRP A 1 418 ? 17.534 7.248   -3.783  1.00 36.73 ? 415 TRP A CZ3   1 
ATOM   3288 C  CH2   . TRP A 1 418 ? 18.165 6.003   -3.908  1.00 36.33 ? 415 TRP A CH2   1 
ATOM   3289 N  N     . SER A 1 419 ? 14.843 5.819   2.182   1.00 40.35 ? 416 SER A N     1 
ATOM   3290 C  CA    . SER A 1 419 ? 14.958 4.855   3.263   1.00 40.96 ? 416 SER A CA    1 
ATOM   3291 C  C     . SER A 1 419 ? 15.286 3.476   2.713   1.00 49.77 ? 416 SER A C     1 
ATOM   3292 O  O     . SER A 1 419 ? 14.831 3.115   1.627   1.00 47.85 ? 416 SER A O     1 
ATOM   3293 C  CB    . SER A 1 419 ? 13.671 4.810   4.091   1.00 57.30 ? 416 SER A CB    1 
ATOM   3294 O  OG    . SER A 1 419 ? 12.558 4.450   3.288   1.00 62.09 ? 416 SER A OG    1 
ATOM   3295 N  N     . PRO A 1 420 ? 16.115 2.718   3.447   1.00 48.13 ? 417 PRO A N     1 
ATOM   3296 C  CA    . PRO A 1 420 ? 16.795 3.261   4.627   1.00 52.96 ? 417 PRO A CA    1 
ATOM   3297 C  C     . PRO A 1 420 ? 17.855 4.269   4.198   1.00 45.38 ? 417 PRO A C     1 
ATOM   3298 O  O     . PRO A 1 420 ? 18.280 4.238   3.038   1.00 44.72 ? 417 PRO A O     1 
ATOM   3299 C  CB    . PRO A 1 420 ? 17.453 2.026   5.249   1.00 49.01 ? 417 PRO A CB    1 
ATOM   3300 C  CG    . PRO A 1 420 ? 17.627 1.081   4.108   1.00 55.57 ? 417 PRO A CG    1 
ATOM   3301 C  CD    . PRO A 1 420 ? 16.433 1.297   3.228   1.00 48.21 ? 417 PRO A CD    1 
ATOM   3302 N  N     . PRO A 1 421 ? 18.262 5.167   5.110   1.00 38.52 ? 418 PRO A N     1 
ATOM   3303 C  CA    . PRO A 1 421 ? 19.264 6.179   4.759   1.00 39.21 ? 418 PRO A CA    1 
ATOM   3304 C  C     . PRO A 1 421 ? 20.561 5.521   4.292   1.00 28.62 ? 418 PRO A C     1 
ATOM   3305 O  O     . PRO A 1 421 ? 20.867 4.401   4.707   1.00 31.01 ? 418 PRO A O     1 
ATOM   3306 C  CB    . PRO A 1 421 ? 19.491 6.927   6.078   1.00 34.78 ? 418 PRO A CB    1 
ATOM   3307 C  CG    . PRO A 1 421 ? 18.277 6.622   6.912   1.00 39.47 ? 418 PRO A CG    1 
ATOM   3308 C  CD    . PRO A 1 421 ? 17.855 5.250   6.523   1.00 38.34 ? 418 PRO A CD    1 
ATOM   3309 N  N     . LEU A 1 422 ? 21.298 6.212   3.428   1.00 38.18 ? 419 LEU A N     1 
ATOM   3310 C  CA    . LEU A 1 422 ? 22.551 5.690   2.886   1.00 29.95 ? 419 LEU A CA    1 
ATOM   3311 C  C     . LEU A 1 422 ? 23.744 6.113   3.739   1.00 25.96 ? 419 LEU A C     1 
ATOM   3312 O  O     . LEU A 1 422 ? 23.870 7.281   4.109   1.00 31.34 ? 419 LEU A O     1 
ATOM   3313 C  CB    . LEU A 1 422 ? 22.746 6.161   1.440   1.00 21.33 ? 419 LEU A CB    1 
ATOM   3314 C  CG    . LEU A 1 422 ? 21.644 5.764   0.451   1.00 29.93 ? 419 LEU A CG    1 
ATOM   3315 C  CD1   . LEU A 1 422 ? 22.043 6.131   -0.987  1.00 29.28 ? 419 LEU A CD1   1 
ATOM   3316 C  CD2   . LEU A 1 422 ? 21.335 4.288   0.564   1.00 29.80 ? 419 LEU A CD2   1 
ATOM   3317 N  N     . THR A 1 423 ? 24.625 5.163   4.032   1.00 27.24 ? 420 THR A N     1 
ATOM   3318 C  CA    . THR A 1 423 ? 25.774 5.435   4.892   1.00 29.57 ? 420 THR A CA    1 
ATOM   3319 C  C     . THR A 1 423 ? 27.106 5.370   4.139   1.00 28.63 ? 420 THR A C     1 
ATOM   3320 O  O     . THR A 1 423 ? 28.168 5.587   4.725   1.00 25.67 ? 420 THR A O     1 
ATOM   3321 C  CB    . THR A 1 423 ? 25.808 4.473   6.088   1.00 31.43 ? 420 THR A CB    1 
ATOM   3322 O  OG1   . THR A 1 423 ? 25.820 3.121   5.612   1.00 33.46 ? 420 THR A OG1   1 
ATOM   3323 C  CG2   . THR A 1 423 ? 24.578 4.694   6.983   1.00 33.81 ? 420 THR A CG2   1 
ATOM   3324 N  N     . MET A 1 424 ? 27.039 5.065   2.843   1.00 18.84 ? 421 MET A N     1 
ATOM   3325 C  CA    . MET A 1 424 ? 28.217 5.109   1.986   1.00 21.40 ? 421 MET A CA    1 
ATOM   3326 C  C     . MET A 1 424 ? 27.778 5.235   0.530   1.00 25.31 ? 421 MET A C     1 
ATOM   3327 O  O     . MET A 1 424 ? 26.771 4.646   0.126   1.00 20.92 ? 421 MET A O     1 
ATOM   3328 C  CB    . MET A 1 424 ? 29.083 3.860   2.206   1.00 23.84 ? 421 MET A CB    1 
ATOM   3329 C  CG    . MET A 1 424 ? 30.369 3.770   1.359   1.00 28.89 ? 421 MET A CG    1 
ATOM   3330 S  SD    . MET A 1 424 ? 30.083 3.176   -0.329  1.00 28.01 ? 421 MET A SD    1 
ATOM   3331 C  CE    . MET A 1 424 ? 29.529 1.493   -0.031  1.00 27.56 ? 421 MET A CE    1 
ATOM   3332 N  N     . LEU A 1 425 ? 28.505 6.041   -0.236  1.00 16.22 ? 422 LEU A N     1 
ATOM   3333 C  CA    . LEU A 1 425 ? 28.353 6.100   -1.683  1.00 17.37 ? 422 LEU A CA    1 
ATOM   3334 C  C     . LEU A 1 425 ? 29.732 5.844   -2.280  1.00 22.52 ? 422 LEU A C     1 
ATOM   3335 O  O     . LEU A 1 425 ? 30.745 6.202   -1.682  1.00 21.41 ? 422 LEU A O     1 
ATOM   3336 C  CB    . LEU A 1 425 ? 27.870 7.470   -2.144  1.00 21.20 ? 422 LEU A CB    1 
ATOM   3337 C  CG    . LEU A 1 425 ? 26.494 8.011   -1.744  1.00 22.98 ? 422 LEU A CG    1 
ATOM   3338 C  CD1   . LEU A 1 425 ? 26.294 9.385   -2.377  1.00 27.93 ? 422 LEU A CD1   1 
ATOM   3339 C  CD2   . LEU A 1 425 ? 25.369 7.053   -2.155  1.00 23.47 ? 422 LEU A CD2   1 
ATOM   3340 N  N     . PHE A 1 426 ? 29.765 5.240   -3.461  1.00 18.11 ? 423 PHE A N     1 
ATOM   3341 C  CA    . PHE A 1 426 ? 31.023 4.884   -4.108  1.00 18.20 ? 423 PHE A CA    1 
ATOM   3342 C  C     . PHE A 1 426 ? 30.826 4.830   -5.616  1.00 22.50 ? 423 PHE A C     1 
ATOM   3343 O  O     . PHE A 1 426 ? 29.918 4.150   -6.105  1.00 26.41 ? 423 PHE A O     1 
ATOM   3344 C  CB    . PHE A 1 426 ? 31.487 3.527   -3.577  1.00 22.33 ? 423 PHE A CB    1 
ATOM   3345 C  CG    . PHE A 1 426 ? 32.702 2.979   -4.263  1.00 34.08 ? 423 PHE A CG    1 
ATOM   3346 C  CD1   . PHE A 1 426 ? 32.627 1.804   -4.998  1.00 44.51 ? 423 PHE A CD1   1 
ATOM   3347 C  CD2   . PHE A 1 426 ? 33.921 3.632   -4.170  1.00 32.34 ? 423 PHE A CD2   1 
ATOM   3348 C  CE1   . PHE A 1 426 ? 33.749 1.287   -5.624  1.00 45.05 ? 423 PHE A CE1   1 
ATOM   3349 C  CE2   . PHE A 1 426 ? 35.050 3.127   -4.797  1.00 32.16 ? 423 PHE A CE2   1 
ATOM   3350 C  CZ    . PHE A 1 426 ? 34.964 1.950   -5.521  1.00 42.96 ? 423 PHE A CZ    1 
ATOM   3351 N  N     . LEU A 1 427 ? 31.645 5.578   -6.346  1.00 16.72 ? 424 LEU A N     1 
ATOM   3352 C  CA    . LEU A 1 427 ? 31.666 5.511   -7.810  1.00 19.19 ? 424 LEU A CA    1 
ATOM   3353 C  C     . LEU A 1 427 ? 33.040 5.064   -8.246  1.00 21.53 ? 424 LEU A C     1 
ATOM   3354 O  O     . LEU A 1 427 ? 34.032 5.618   -7.795  1.00 20.69 ? 424 LEU A O     1 
ATOM   3355 C  CB    . LEU A 1 427 ? 31.396 6.871   -8.438  1.00 21.42 ? 424 LEU A CB    1 
ATOM   3356 C  CG    . LEU A 1 427 ? 30.038 7.522   -8.214  1.00 22.90 ? 424 LEU A CG    1 
ATOM   3357 C  CD1   . LEU A 1 427 ? 29.997 8.898   -8.861  1.00 21.12 ? 424 LEU A CD1   1 
ATOM   3358 C  CD2   . LEU A 1 427 ? 28.901 6.633   -8.715  1.00 21.30 ? 424 LEU A CD2   1 
ATOM   3359 N  N     . CYS A 1 428 ? 33.107 4.078   -9.137  1.00 20.52 ? 425 CYS A N     1 
ATOM   3360 C  CA    . CYS A 1 428 ? 34.401 3.570   -9.597  1.00 19.14 ? 425 CYS A CA    1 
ATOM   3361 C  C     . CYS A 1 428 ? 34.421 3.371   -11.115 1.00 25.67 ? 425 CYS A C     1 
ATOM   3362 O  O     . CYS A 1 428 ? 33.546 2.700   -11.662 1.00 19.56 ? 425 CYS A O     1 
ATOM   3363 C  CB    . CYS A 1 428 ? 34.742 2.257   -8.895  1.00 28.28 ? 425 CYS A CB    1 
ATOM   3364 S  SG    . CYS A 1 428 ? 36.384 1.607   -9.313  1.00 33.99 ? 425 CYS A SG    1 
ATOM   3365 N  N     . ALA A 1 429 ? 35.408 3.967   -11.781 1.00 19.33 ? 426 ALA A N     1 
ATOM   3366 C  CA    . ALA A 1 429 ? 35.602 3.770   -13.213 1.00 21.15 ? 426 ALA A CA    1 
ATOM   3367 C  C     . ALA A 1 429 ? 36.539 2.587   -13.450 1.00 27.12 ? 426 ALA A C     1 
ATOM   3368 O  O     . ALA A 1 429 ? 37.605 2.483   -12.819 1.00 19.25 ? 426 ALA A O     1 
ATOM   3369 C  CB    . ALA A 1 429 ? 36.165 5.044   -13.870 1.00 17.85 ? 426 ALA A CB    1 
ATOM   3370 N  N     . THR A 1 430 ? 36.142 1.698   -14.360 1.00 22.76 ? 427 THR A N     1 
ATOM   3371 C  CA    . THR A 1 430 ? 36.874 0.465   -14.601 1.00 25.40 ? 427 THR A CA    1 
ATOM   3372 C  C     . THR A 1 430 ? 36.871 0.097   -16.087 1.00 24.08 ? 427 THR A C     1 
ATOM   3373 O  O     . THR A 1 430 ? 36.314 0.818   -16.916 1.00 21.38 ? 427 THR A O     1 
ATOM   3374 C  CB    . THR A 1 430 ? 36.264 -0.713  -13.804 1.00 24.11 ? 427 THR A CB    1 
ATOM   3375 O  OG1   . THR A 1 430 ? 34.936 -0.967  -14.274 1.00 33.37 ? 427 THR A OG1   1 
ATOM   3376 C  CG2   . THR A 1 430 ? 36.189 -0.391  -12.321 1.00 37.22 ? 427 THR A CG2   1 
ATOM   3377 N  N     . LYS A 1 431 ? 37.494 -1.036  -16.404 1.00 24.61 ? 428 LYS A N     1 
ATOM   3378 C  CA    . LYS A 1 431 ? 37.583 -1.555  -17.774 1.00 27.98 ? 428 LYS A CA    1 
ATOM   3379 C  C     . LYS A 1 431 ? 38.173 -0.562  -18.772 1.00 22.95 ? 428 LYS A C     1 
ATOM   3380 O  O     . LYS A 1 431 ? 37.499 -0.129  -19.714 1.00 22.13 ? 428 LYS A O     1 
ATOM   3381 C  CB    . LYS A 1 431 ? 36.224 -2.047  -18.268 1.00 26.53 ? 428 LYS A CB    1 
ATOM   3382 C  CG    . LYS A 1 431 ? 35.692 -3.227  -17.494 1.00 36.52 ? 428 LYS A CG    1 
ATOM   3383 C  CD    . LYS A 1 431 ? 34.480 -3.837  -18.179 1.00 44.28 ? 428 LYS A CD    1 
ATOM   3384 C  CE    . LYS A 1 431 ? 33.832 -4.886  -17.285 1.00 52.31 ? 428 LYS A CE    1 
ATOM   3385 N  NZ    . LYS A 1 431 ? 34.853 -5.731  -16.600 1.00 49.93 ? 428 LYS A NZ    1 
ATOM   3386 N  N     . PHE A 1 432 ? 39.439 -0.222  -18.565 1.00 21.82 ? 429 PHE A N     1 
ATOM   3387 C  CA    . PHE A 1 432 ? 40.145 0.709   -19.436 1.00 19.51 ? 429 PHE A CA    1 
ATOM   3388 C  C     . PHE A 1 432 ? 40.514 0.090   -20.778 1.00 31.12 ? 429 PHE A C     1 
ATOM   3389 O  O     . PHE A 1 432 ? 40.893 -1.089  -20.855 1.00 24.88 ? 429 PHE A O     1 
ATOM   3390 C  CB    . PHE A 1 432 ? 41.407 1.221   -18.738 1.00 21.68 ? 429 PHE A CB    1 
ATOM   3391 C  CG    . PHE A 1 432 ? 41.124 2.202   -17.637 1.00 22.70 ? 429 PHE A CG    1 
ATOM   3392 C  CD1   . PHE A 1 432 ? 41.118 3.557   -17.895 1.00 17.68 ? 429 PHE A CD1   1 
ATOM   3393 C  CD2   . PHE A 1 432 ? 40.850 1.768   -16.350 1.00 29.92 ? 429 PHE A CD2   1 
ATOM   3394 C  CE1   . PHE A 1 432 ? 40.853 4.468   -16.899 1.00 18.28 ? 429 PHE A CE1   1 
ATOM   3395 C  CE2   . PHE A 1 432 ? 40.583 2.678   -15.341 1.00 31.39 ? 429 PHE A CE2   1 
ATOM   3396 C  CZ    . PHE A 1 432 ? 40.588 4.030   -15.615 1.00 25.65 ? 429 PHE A CZ    1 
ATOM   3397 N  N     . SER A 1 433 ? 40.390 0.902   -21.827 1.00 24.63 ? 430 SER A N     1 
ATOM   3398 C  CA    . SER A 1 433 ? 40.832 0.544   -23.176 1.00 26.36 ? 430 SER A CA    1 
ATOM   3399 C  C     . SER A 1 433 ? 41.737 1.645   -23.717 1.00 27.23 ? 430 SER A C     1 
ATOM   3400 O  O     . SER A 1 433 ? 41.612 2.816   -23.334 1.00 23.93 ? 430 SER A O     1 
ATOM   3401 C  CB    . SER A 1 433 ? 39.632 0.362   -24.111 1.00 32.63 ? 430 SER A CB    1 
ATOM   3402 O  OG    . SER A 1 433 ? 38.699 -0.562  -23.579 1.00 43.93 ? 430 SER A OG    1 
ATOM   3403 N  N     . ALA A 1 434 ? 42.660 1.273   -24.599 1.00 26.20 ? 431 ALA A N     1 
ATOM   3404 C  CA    . ALA A 1 434 ? 43.614 2.236   -25.130 1.00 28.52 ? 431 ALA A CA    1 
ATOM   3405 C  C     . ALA A 1 434 ? 42.898 3.297   -25.951 1.00 35.40 ? 431 ALA A C     1 
ATOM   3406 O  O     . ALA A 1 434 ? 41.860 3.032   -26.568 1.00 37.92 ? 431 ALA A O     1 
ATOM   3407 C  CB    . ALA A 1 434 ? 44.681 1.534   -25.967 1.00 30.08 ? 431 ALA A CB    1 
ATOM   3408 N  N     . SER A 1 435 ? 43.452 4.503   -25.950 1.00 34.38 ? 432 SER A N     1 
ATOM   3409 C  CA    . SER A 1 435 ? 42.909 5.590   -26.752 1.00 39.11 ? 432 SER A CA    1 
ATOM   3410 C  C     . SER A 1 435 ? 44.022 6.572   -27.097 1.00 46.17 ? 432 SER A C     1 
ATOM   3411 O  O     . SER A 1 435 ? 43.805 7.570   -27.777 1.00 54.51 ? 432 SER A O     1 
ATOM   3412 C  CB    . SER A 1 435 ? 41.799 6.311   -25.996 1.00 38.84 ? 432 SER A CB    1 
ATOM   3413 O  OG    . SER A 1 435 ? 42.344 7.146   -24.989 1.00 51.05 ? 432 SER A OG    1 
ATOM   3414 O  OXT   . SER A 1 435 ? 45.171 6.390   -26.696 1.00 56.37 ? 432 SER A OXT   1 
ATOM   3415 O  "O3'" . DC  B 2 1   ? 27.874 4.725   11.696  1.00 59.29 ? 1   DC  T "O3'" 1 
ATOM   3416 P  P     . DA  B 2 2   ? 28.210 4.426   13.242  1.00 95.48 ? 2   DA  T P     1 
ATOM   3417 O  OP1   . DA  B 2 2   ? 28.266 2.952   13.422  1.00 71.91 ? 2   DA  T OP1   1 
ATOM   3418 O  OP2   . DA  B 2 2   ? 27.293 5.238   14.075  1.00 71.09 ? 2   DA  T OP2   1 
ATOM   3419 O  "O5'" . DA  B 2 2   ? 29.674 5.047   13.437  1.00 66.16 ? 2   DA  T "O5'" 1 
ATOM   3420 C  "C5'" . DA  B 2 2   ? 30.733 4.745   12.535  1.00 58.37 ? 2   DA  T "C5'" 1 
ATOM   3421 C  "C4'" . DA  B 2 2   ? 31.977 5.502   12.960  1.00 51.36 ? 2   DA  T "C4'" 1 
ATOM   3422 O  "O4'" . DA  B 2 2   ? 31.803 6.909   12.676  1.00 46.74 ? 2   DA  T "O4'" 1 
ATOM   3423 C  "C3'" . DA  B 2 2   ? 32.275 5.416   14.454  1.00 55.28 ? 2   DA  T "C3'" 1 
ATOM   3424 O  "O3'" . DA  B 2 2   ? 33.673 5.352   14.661  1.00 52.37 ? 2   DA  T "O3'" 1 
ATOM   3425 C  "C2'" . DA  B 2 2   ? 31.695 6.699   15.036  1.00 51.57 ? 2   DA  T "C2'" 1 
ATOM   3426 C  "C1'" . DA  B 2 2   ? 31.871 7.662   13.871  1.00 49.76 ? 2   DA  T "C1'" 1 
ATOM   3427 N  N9    . DA  B 2 2   ? 30.820 8.669   13.826  1.00 44.52 ? 2   DA  T N9    1 
ATOM   3428 C  C8    . DA  B 2 2   ? 29.557 8.589   14.349  1.00 42.84 ? 2   DA  T C8    1 
ATOM   3429 N  N7    . DA  B 2 2   ? 28.839 9.667   14.143  1.00 41.48 ? 2   DA  T N7    1 
ATOM   3430 C  C5    . DA  B 2 2   ? 29.696 10.503  13.442  1.00 41.14 ? 2   DA  T C5    1 
ATOM   3431 C  C6    . DA  B 2 2   ? 29.544 11.800  12.923  1.00 44.52 ? 2   DA  T C6    1 
ATOM   3432 N  N6    . DA  B 2 2   ? 28.416 12.510  13.038  1.00 49.83 ? 2   DA  T N6    1 
ATOM   3433 N  N1    . DA  B 2 2   ? 30.600 12.335  12.277  1.00 42.86 ? 2   DA  T N1    1 
ATOM   3434 C  C2    . DA  B 2 2   ? 31.730 11.625  12.157  1.00 37.83 ? 2   DA  T C2    1 
ATOM   3435 N  N3    . DA  B 2 2   ? 31.992 10.402  12.600  1.00 42.18 ? 2   DA  T N3    1 
ATOM   3436 C  C4    . DA  B 2 2   ? 30.921 9.903   13.242  1.00 36.50 ? 2   DA  T C4    1 
ATOM   3437 P  P     . DT  B 2 3   ? 34.345 3.991   15.184  1.00 51.51 ? 3   DT  T P     1 
ATOM   3438 O  OP1   . DT  B 2 3   ? 33.278 3.160   15.785  1.00 62.34 ? 3   DT  T OP1   1 
ATOM   3439 O  OP2   . DT  B 2 3   ? 35.547 4.349   15.973  1.00 57.14 ? 3   DT  T OP2   1 
ATOM   3440 O  "O5'" . DT  B 2 3   ? 34.805 3.259   13.839  1.00 57.89 ? 3   DT  T "O5'" 1 
ATOM   3441 C  "C5'" . DT  B 2 3   ? 36.128 3.417   13.352  1.00 51.02 ? 3   DT  T "C5'" 1 
ATOM   3442 C  "C4'" . DT  B 2 3   ? 36.257 4.674   12.518  1.00 53.05 ? 3   DT  T "C4'" 1 
ATOM   3443 O  "O4'" . DT  B 2 3   ? 37.662 4.915   12.260  1.00 51.14 ? 3   DT  T "O4'" 1 
ATOM   3444 C  "C3'" . DT  B 2 3   ? 35.565 4.620   11.159  1.00 50.85 ? 3   DT  T "C3'" 1 
ATOM   3445 O  "O3'" . DT  B 2 3   ? 34.875 5.836   10.935  1.00 42.91 ? 3   DT  T "O3'" 1 
ATOM   3446 C  "C2'" . DT  B 2 3   ? 36.708 4.421   10.165  1.00 43.57 ? 3   DT  T "C2'" 1 
ATOM   3447 C  "C1'" . DT  B 2 3   ? 37.882 5.088   10.872  1.00 47.30 ? 3   DT  T "C1'" 1 
ATOM   3448 N  N1    . DT  B 2 3   ? 39.215 4.476   10.574  1.00 53.16 ? 3   DT  T N1    1 
ATOM   3449 C  C2    . DT  B 2 3   ? 40.233 5.241   10.016  1.00 47.23 ? 3   DT  T C2    1 
ATOM   3450 O  O2    . DT  B 2 3   ? 40.122 6.423   9.727   1.00 53.45 ? 3   DT  T O2    1 
ATOM   3451 N  N3    . DT  B 2 3   ? 41.409 4.562   9.801   1.00 44.42 ? 3   DT  T N3    1 
ATOM   3452 C  C4    . DT  B 2 3   ? 41.664 3.227   10.087  1.00 48.64 ? 3   DT  T C4    1 
ATOM   3453 O  O4    . DT  B 2 3   ? 42.760 2.714   9.858   1.00 42.97 ? 3   DT  T O4    1 
ATOM   3454 C  C5    . DT  B 2 3   ? 40.560 2.488   10.671  1.00 48.48 ? 3   DT  T C5    1 
ATOM   3455 C  C7    . DT  B 2 3   ? 40.711 1.034   11.026  1.00 53.42 ? 3   DT  T C7    1 
ATOM   3456 C  C6    . DT  B 2 3   ? 39.406 3.141   10.890  1.00 41.92 ? 3   DT  T C6    1 
ATOM   3457 P  P     . DT  B 2 4   ? 34.150 6.099   9.532   1.00 57.09 ? 4   DT  T P     1 
ATOM   3458 O  OP1   . DT  B 2 4   ? 33.257 7.269   9.690   1.00 45.76 ? 4   DT  T OP1   1 
ATOM   3459 O  OP2   . DT  B 2 4   ? 33.615 4.810   9.051   1.00 53.68 ? 4   DT  T OP2   1 
ATOM   3460 O  "O5'" . DT  B 2 4   ? 35.352 6.506   8.558   1.00 41.59 ? 4   DT  T "O5'" 1 
ATOM   3461 C  "C5'" . DT  B 2 4   ? 35.902 7.817   8.622   1.00 31.55 ? 4   DT  T "C5'" 1 
ATOM   3462 C  "C4'" . DT  B 2 4   ? 36.629 8.116   7.324   1.00 25.90 ? 4   DT  T "C4'" 1 
ATOM   3463 O  "O4'" . DT  B 2 4   ? 37.845 7.336   7.252   1.00 24.87 ? 4   DT  T "O4'" 1 
ATOM   3464 C  "C3'" . DT  B 2 4   ? 35.853 7.791   6.055   1.00 25.56 ? 4   DT  T "C3'" 1 
ATOM   3465 O  "O3'" . DT  B 2 4   ? 36.149 8.853   5.188   1.00 21.95 ? 4   DT  T "O3'" 1 
ATOM   3466 C  "C2'" . DT  B 2 4   ? 36.442 6.452   5.604   1.00 21.70 ? 4   DT  T "C2'" 1 
ATOM   3467 C  "C1'" . DT  B 2 4   ? 37.895 6.611   6.036   1.00 29.19 ? 4   DT  T "C1'" 1 
ATOM   3468 N  N1    . DT  B 2 4   ? 38.666 5.361   6.340   1.00 21.01 ? 4   DT  T N1    1 
ATOM   3469 C  C2    . DT  B 2 4   ? 40.011 5.324   6.016   1.00 19.23 ? 4   DT  T C2    1 
ATOM   3470 O  O2    . DT  B 2 4   ? 40.614 6.233   5.475   1.00 21.96 ? 4   DT  T O2    1 
ATOM   3471 N  N3    . DT  B 2 4   ? 40.654 4.169   6.348   1.00 24.93 ? 4   DT  T N3    1 
ATOM   3472 C  C4    . DT  B 2 4   ? 40.124 3.059   6.959   1.00 26.74 ? 4   DT  T C4    1 
ATOM   3473 O  O4    . DT  B 2 4   ? 40.819 2.075   7.202   1.00 22.30 ? 4   DT  T O4    1 
ATOM   3474 C  C5    . DT  B 2 4   ? 38.720 3.149   7.288   1.00 31.83 ? 4   DT  T C5    1 
ATOM   3475 C  C7    . DT  B 2 4   ? 38.047 1.981   7.959   1.00 28.00 ? 4   DT  T C7    1 
ATOM   3476 C  C6    . DT  B 2 4   ? 38.064 4.285   6.974   1.00 29.23 ? 4   DT  T C6    1 
ATOM   3477 P  P     . DA  B 2 5   ? 35.590 8.866   3.685   1.00 20.32 ? 5   DA  T P     1 
ATOM   3478 O  OP1   . DA  B 2 5   ? 35.260 10.258  3.350   1.00 22.84 ? 5   DA  T OP1   1 
ATOM   3479 O  OP2   . DA  B 2 5   ? 34.565 7.802   3.561   1.00 20.53 ? 5   DA  T OP2   1 
ATOM   3480 O  "O5'" . DA  B 2 5   ? 36.848 8.383   2.825   1.00 19.26 ? 5   DA  T "O5'" 1 
ATOM   3481 C  "C5'" . DA  B 2 5   ? 37.983 9.230   2.646   1.00 19.93 ? 5   DA  T "C5'" 1 
ATOM   3482 C  "C4'" . DA  B 2 5   ? 38.925 8.609   1.632   1.00 17.01 ? 5   DA  T "C4'" 1 
ATOM   3483 O  "O4'" . DA  B 2 5   ? 39.546 7.429   2.214   1.00 21.19 ? 5   DA  T "O4'" 1 
ATOM   3484 C  "C3'" . DA  B 2 5   ? 38.274 8.163   0.322   1.00 21.51 ? 5   DA  T "C3'" 1 
ATOM   3485 O  "O3'" . DA  B 2 5   ? 39.187 8.455   -0.717  1.00 18.87 ? 5   DA  T "O3'" 1 
ATOM   3486 C  "C2'" . DA  B 2 5   ? 38.141 6.659   0.519   1.00 21.89 ? 5   DA  T "C2'" 1 
ATOM   3487 C  "C1'" . DA  B 2 5   ? 39.420 6.357   1.311   1.00 24.20 ? 5   DA  T "C1'" 1 
ATOM   3488 N  N9    . DA  B 2 5   ? 39.378 5.112   2.069   1.00 22.79 ? 5   DA  T N9    1 
ATOM   3489 C  C8    . DA  B 2 5   ? 38.293 4.594   2.718   1.00 25.36 ? 5   DA  T C8    1 
ATOM   3490 N  N7    . DA  B 2 5   ? 38.533 3.455   3.324   1.00 22.25 ? 5   DA  T N7    1 
ATOM   3491 C  C5    . DA  B 2 5   ? 39.870 3.208   3.060   1.00 20.75 ? 5   DA  T C5    1 
ATOM   3492 C  C6    . DA  B 2 5   ? 40.726 2.145   3.423   1.00 21.42 ? 5   DA  T C6    1 
ATOM   3493 N  N6    . DA  B 2 5   ? 40.337 1.104   4.162   1.00 17.83 ? 5   DA  T N6    1 
ATOM   3494 N  N1    . DA  B 2 5   ? 42.001 2.199   3.001   1.00 21.32 ? 5   DA  T N1    1 
ATOM   3495 C  C2    . DA  B 2 5   ? 42.386 3.245   2.259   1.00 18.73 ? 5   DA  T C2    1 
ATOM   3496 N  N3    . DA  B 2 5   ? 41.677 4.297   1.853   1.00 18.26 ? 5   DA  T N3    1 
ATOM   3497 C  C4    . DA  B 2 5   ? 40.409 4.221   2.296   1.00 19.19 ? 5   DA  T C4    1 
ATOM   3498 P  P     . DT  B 2 6   ? 38.720 8.437   -2.258  1.00 18.38 ? 6   DT  T P     1 
ATOM   3499 O  OP1   . DT  B 2 6   ? 39.878 8.856   -3.080  1.00 22.85 ? 6   DT  T OP1   1 
ATOM   3500 O  OP2   . DT  B 2 6   ? 37.440 9.158   -2.372  1.00 18.52 ? 6   DT  T OP2   1 
ATOM   3501 O  "O5'" . DT  B 2 6   ? 38.372 6.907   -2.517  1.00 22.20 ? 6   DT  T "O5'" 1 
ATOM   3502 C  "C5'" . DT  B 2 6   ? 39.116 6.143   -3.441  1.00 25.75 ? 6   DT  T "C5'" 1 
ATOM   3503 C  "C4'" . DT  B 2 6   ? 40.343 5.502   -2.826  1.00 22.04 ? 6   DT  T "C4'" 1 
ATOM   3504 O  "O4'" . DT  B 2 6   ? 40.004 4.816   -1.604  1.00 22.59 ? 6   DT  T "O4'" 1 
ATOM   3505 C  "C3'" . DT  B 2 6   ? 40.877 4.428   -3.760  1.00 30.85 ? 6   DT  T "C3'" 1 
ATOM   3506 O  "O3'" . DT  B 2 6   ? 41.902 5.006   -4.536  1.00 24.58 ? 6   DT  T "O3'" 1 
ATOM   3507 C  "C2'" . DT  B 2 6   ? 41.409 3.324   -2.849  1.00 27.34 ? 6   DT  T "C2'" 1 
ATOM   3508 C  "C1'" . DT  B 2 6   ? 40.898 3.725   -1.468  1.00 23.89 ? 6   DT  T "C1'" 1 
ATOM   3509 N  N1    . DT  B 2 6   ? 40.208 2.657   -0.723  1.00 21.34 ? 6   DT  T N1    1 
ATOM   3510 C  C2    . DT  B 2 6   ? 40.946 1.572   -0.302  1.00 20.56 ? 6   DT  T C2    1 
ATOM   3511 O  O2    . DT  B 2 6   ? 42.127 1.448   -0.538  1.00 21.01 ? 6   DT  T O2    1 
ATOM   3512 N  N3    . DT  B 2 6   ? 40.245 0.634   0.412   1.00 18.28 ? 6   DT  T N3    1 
ATOM   3513 C  C4    . DT  B 2 6   ? 38.912 0.688   0.745   1.00 22.55 ? 6   DT  T C4    1 
ATOM   3514 O  O4    . DT  B 2 6   ? 38.373 -0.196  1.393   1.00 20.83 ? 6   DT  T O4    1 
ATOM   3515 C  C5    . DT  B 2 6   ? 38.196 1.856   0.287   1.00 23.89 ? 6   DT  T C5    1 
ATOM   3516 C  C7    . DT  B 2 6   ? 36.737 1.994   0.600   1.00 28.11 ? 6   DT  T C7    1 
ATOM   3517 C  C6    . DT  B 2 6   ? 38.868 2.777   -0.417  1.00 23.48 ? 6   DT  T C6    1 
ATOM   3518 P  P     . DG  B 2 7   ? 42.092 4.582   -6.072  1.00 23.32 ? 7   DG  T P     1 
ATOM   3519 O  OP1   . DG  B 2 7   ? 43.286 5.288   -6.582  1.00 25.53 ? 7   DG  T OP1   1 
ATOM   3520 O  OP2   . DG  B 2 7   ? 40.801 4.742   -6.763  1.00 22.21 ? 7   DG  T OP2   1 
ATOM   3521 O  "O5'" . DG  B 2 7   ? 42.398 3.013   -5.998  1.00 26.93 ? 7   DG  T "O5'" 1 
ATOM   3522 C  "C5'" . DG  B 2 7   ? 43.731 2.550   -5.934  1.00 31.17 ? 7   DG  T "C5'" 1 
ATOM   3523 C  "C4'" . DG  B 2 7   ? 43.748 1.045   -5.740  1.00 19.25 ? 7   DG  T "C4'" 1 
ATOM   3524 O  "O4'" . DG  B 2 7   ? 43.014 0.695   -4.549  1.00 22.44 ? 7   DG  T "O4'" 1 
ATOM   3525 C  "C3'" . DG  B 2 7   ? 43.111 0.236   -6.870  1.00 27.01 ? 7   DG  T "C3'" 1 
ATOM   3526 O  "O3'" . DG  B 2 7   ? 44.152 -0.407  -7.575  1.00 26.54 ? 7   DG  T "O3'" 1 
ATOM   3527 C  "C2'" . DG  B 2 7   ? 42.211 -0.769  -6.160  1.00 28.86 ? 7   DG  T "C2'" 1 
ATOM   3528 C  "C1'" . DG  B 2 7   ? 42.646 -0.644  -4.706  1.00 22.14 ? 7   DG  T "C1'" 1 
ATOM   3529 N  N9    . DG  B 2 7   ? 41.562 -0.969  -3.790  1.00 25.08 ? 7   DG  T N9    1 
ATOM   3530 C  C8    . DG  B 2 7   ? 40.369 -0.311  -3.617  1.00 20.51 ? 7   DG  T C8    1 
ATOM   3531 N  N7    . DG  B 2 7   ? 39.599 -0.873  -2.722  1.00 22.35 ? 7   DG  T N7    1 
ATOM   3532 C  C5    . DG  B 2 7   ? 40.329 -1.984  -2.298  1.00 24.04 ? 7   DG  T C5    1 
ATOM   3533 C  C6    . DG  B 2 7   ? 40.029 -2.985  -1.341  1.00 21.72 ? 7   DG  T C6    1 
ATOM   3534 O  O6    . DG  B 2 7   ? 39.021 -3.125  -0.645  1.00 22.82 ? 7   DG  T O6    1 
ATOM   3535 N  N1    . DG  B 2 7   ? 41.057 -3.923  -1.236  1.00 18.83 ? 7   DG  T N1    1 
ATOM   3536 C  C2    . DG  B 2 7   ? 42.238 -3.900  -1.937  1.00 20.36 ? 7   DG  T C2    1 
ATOM   3537 N  N2    . DG  B 2 7   ? 43.100 -4.897  -1.677  1.00 21.46 ? 7   DG  T N2    1 
ATOM   3538 N  N3    . DG  B 2 7   ? 42.543 -2.967  -2.828  1.00 24.61 ? 7   DG  T N3    1 
ATOM   3539 C  C4    . DG  B 2 7   ? 41.540 -2.052  -2.951  1.00 21.25 ? 7   DG  T C4    1 
ATOM   3540 P  P     . DA  B 2 8   ? 43.829 -1.381  -8.814  1.00 25.08 ? 8   DA  T P     1 
ATOM   3541 O  OP1   . DA  B 2 8   ? 44.843 -1.153  -9.839  1.00 27.13 ? 8   DA  T OP1   1 
ATOM   3542 O  OP2   . DA  B 2 8   ? 42.379 -1.297  -9.121  1.00 30.78 ? 8   DA  T OP2   1 
ATOM   3543 O  "O5'" . DA  B 2 8   ? 44.084 -2.848  -8.204  1.00 26.63 ? 8   DA  T "O5'" 1 
ATOM   3544 C  "C5'" . DA  B 2 8   ? 45.327 -3.108  -7.555  1.00 21.17 ? 8   DA  T "C5'" 1 
ATOM   3545 C  "C4'" . DA  B 2 8   ? 45.447 -4.580  -7.212  1.00 25.95 ? 8   DA  T "C4'" 1 
ATOM   3546 O  "O4'" . DA  B 2 8   ? 44.615 -4.831  -6.053  1.00 29.05 ? 8   DA  T "O4'" 1 
ATOM   3547 C  "C3'" . DA  B 2 8   ? 44.992 -5.539  -8.319  1.00 26.60 ? 8   DA  T "C3'" 1 
ATOM   3548 O  "O3'" . DA  B 2 8   ? 45.856 -6.672  -8.392  1.00 26.74 ? 8   DA  T "O3'" 1 
ATOM   3549 C  "C2'" . DA  B 2 8   ? 43.588 -5.925  -7.875  1.00 22.83 ? 8   DA  T "C2'" 1 
ATOM   3550 C  "C1'" . DA  B 2 8   ? 43.672 -5.836  -6.355  1.00 31.23 ? 8   DA  T "C1'" 1 
ATOM   3551 N  N9    . DA  B 2 8   ? 42.378 -5.460  -5.799  1.00 28.64 ? 8   DA  T N9    1 
ATOM   3552 C  C8    . DA  B 2 8   ? 41.590 -4.422  -6.215  1.00 27.47 ? 8   DA  T C8    1 
ATOM   3553 N  N7    . DA  B 2 8   ? 40.461 -4.316  -5.552  1.00 21.52 ? 8   DA  T N7    1 
ATOM   3554 C  C5    . DA  B 2 8   ? 40.518 -5.354  -4.647  1.00 22.32 ? 8   DA  T C5    1 
ATOM   3555 C  C6    . DA  B 2 8   ? 39.614 -5.775  -3.660  1.00 20.62 ? 8   DA  T C6    1 
ATOM   3556 N  N6    . DA  B 2 8   ? 38.452 -5.149  -3.447  1.00 19.39 ? 8   DA  T N6    1 
ATOM   3557 N  N1    . DA  B 2 8   ? 39.956 -6.857  -2.915  1.00 22.57 ? 8   DA  T N1    1 
ATOM   3558 C  C2    . DA  B 2 8   ? 41.135 -7.448  -3.165  1.00 19.81 ? 8   DA  T C2    1 
ATOM   3559 N  N3    . DA  B 2 8   ? 42.066 -7.142  -4.071  1.00 20.12 ? 8   DA  T N3    1 
ATOM   3560 C  C4    . DA  B 2 8   ? 41.690 -6.074  -4.786  1.00 26.51 ? 8   DA  T C4    1 
ATOM   3561 P  P     . DC  B 2 9   ? 45.702 -7.751  -9.580  1.00 31.56 ? 9   DC  T P     1 
ATOM   3562 O  OP1   . DC  B 2 9   ? 47.054 -8.242  -9.917  1.00 33.65 ? 9   DC  T OP1   1 
ATOM   3563 O  OP2   . DC  B 2 9   ? 44.839 -7.174  -10.628 1.00 32.24 ? 9   DC  T OP2   1 
ATOM   3564 O  "O5'" . DC  B 2 9   ? 44.855 -8.927  -8.919  1.00 25.85 ? 9   DC  T "O5'" 1 
ATOM   3565 C  "C5'" . DC  B 2 9   ? 45.383 -9.575  -7.775  1.00 27.45 ? 9   DC  T "C5'" 1 
ATOM   3566 C  "C4'" . DC  B 2 9   ? 44.302 -10.423 -7.157  1.00 29.30 ? 9   DC  T "C4'" 1 
ATOM   3567 O  "O4'" . DC  B 2 9   ? 43.238 -9.580  -6.638  1.00 31.89 ? 9   DC  T "O4'" 1 
ATOM   3568 C  "C3'" . DC  B 2 9   ? 43.647 -11.389 -8.135  1.00 30.43 ? 9   DC  T "C3'" 1 
ATOM   3569 O  "O3'" . DC  B 2 9   ? 43.593 -12.635 -7.493  1.00 39.73 ? 9   DC  T "O3'" 1 
ATOM   3570 C  "C2'" . DC  B 2 9   ? 42.247 -10.819 -8.316  1.00 29.98 ? 9   DC  T "C2'" 1 
ATOM   3571 C  "C1'" . DC  B 2 9   ? 42.021 -10.224 -6.933  1.00 27.87 ? 9   DC  T "C1'" 1 
ATOM   3572 N  N1    . DC  B 2 9   ? 40.895 -9.255  -6.876  1.00 24.54 ? 9   DC  T N1    1 
ATOM   3573 C  C2    . DC  B 2 9   ? 39.988 -9.388  -5.830  1.00 25.65 ? 9   DC  T C2    1 
ATOM   3574 O  O2    . DC  B 2 9   ? 40.175 -10.293 -4.999  1.00 26.04 ? 9   DC  T O2    1 
ATOM   3575 N  N3    . DC  B 2 9   ? 38.944 -8.528  -5.757  1.00 26.48 ? 9   DC  T N3    1 
ATOM   3576 C  C4    . DC  B 2 9   ? 38.787 -7.573  -6.671  1.00 23.94 ? 9   DC  T C4    1 
ATOM   3577 N  N4    . DC  B 2 9   ? 37.732 -6.763  -6.529  1.00 22.81 ? 9   DC  T N4    1 
ATOM   3578 C  C5    . DC  B 2 9   ? 39.701 -7.422  -7.755  1.00 25.61 ? 9   DC  T C5    1 
ATOM   3579 C  C6    . DC  B 2 9   ? 40.738 -8.280  -7.819  1.00 25.13 ? 9   DC  T C6    1 
ATOM   3580 P  P     . DG  B 2 10  ? 43.360 -13.982 -8.336  1.00 37.08 ? 10  DG  T P     1 
ATOM   3581 O  OP1   . DG  B 2 10  ? 44.660 -14.662 -8.471  1.00 44.21 ? 10  DG  T OP1   1 
ATOM   3582 O  OP2   . DG  B 2 10  ? 42.571 -13.645 -9.541  1.00 33.22 ? 10  DG  T OP2   1 
ATOM   3583 O  "O5'" . DG  B 2 10  ? 42.404 -14.837 -7.394  1.00 33.88 ? 10  DG  T "O5'" 1 
ATOM   3584 C  "C5'" . DG  B 2 10  ? 42.509 -14.724 -5.986  1.00 31.49 ? 10  DG  T "C5'" 1 
ATOM   3585 C  "C4'" . DG  B 2 10  ? 41.305 -15.356 -5.317  1.00 29.21 ? 10  DG  T "C4'" 1 
ATOM   3586 O  "O4'" . DG  B 2 10  ? 40.267 -14.365 -5.115  1.00 32.96 ? 10  DG  T "O4'" 1 
ATOM   3587 C  "C3'" . DG  B 2 10  ? 40.658 -16.490 -6.104  1.00 37.56 ? 10  DG  T "C3'" 1 
ATOM   3588 O  "O3'" . DG  B 2 10  ? 40.183 -17.463 -5.169  1.00 42.85 ? 10  DG  T "O3'" 1 
ATOM   3589 C  "C2'" . DG  B 2 10  ? 39.543 -15.771 -6.864  1.00 29.59 ? 10  DG  T "C2'" 1 
ATOM   3590 C  "C1'" . DG  B 2 10  ? 39.123 -14.684 -5.880  1.00 28.24 ? 10  DG  T "C1'" 1 
ATOM   3591 N  N9    . DG  B 2 10  ? 38.612 -13.470 -6.525  1.00 29.65 ? 10  DG  T N9    1 
ATOM   3592 C  C8    . DG  B 2 10  ? 39.209 -12.688 -7.488  1.00 28.71 ? 10  DG  T C8    1 
ATOM   3593 N  N7    . DG  B 2 10  ? 38.483 -11.666 -7.861  1.00 24.24 ? 10  DG  T N7    1 
ATOM   3594 C  C5    . DG  B 2 10  ? 37.327 -11.778 -7.103  1.00 27.23 ? 10  DG  T C5    1 
ATOM   3595 C  C6    . DG  B 2 10  ? 36.167 -10.964 -7.063  1.00 24.31 ? 10  DG  T C6    1 
ATOM   3596 O  O6    . DG  B 2 10  ? 35.902 -9.940  -7.713  1.00 28.86 ? 10  DG  T O6    1 
ATOM   3597 N  N1    . DG  B 2 10  ? 35.243 -11.448 -6.140  1.00 30.86 ? 10  DG  T N1    1 
ATOM   3598 C  C2    . DG  B 2 10  ? 35.407 -12.570 -5.364  1.00 26.31 ? 10  DG  T C2    1 
ATOM   3599 N  N2    . DG  B 2 10  ? 34.399 -12.874 -4.536  1.00 29.92 ? 10  DG  T N2    1 
ATOM   3600 N  N3    . DG  B 2 10  ? 36.488 -13.344 -5.389  1.00 28.07 ? 10  DG  T N3    1 
ATOM   3601 C  C4    . DG  B 2 10  ? 37.400 -12.882 -6.276  1.00 22.72 ? 10  DG  T C4    1 
ATOM   3602 P  P     . DC  B 2 11  ? 39.440 -18.797 -5.683  1.00 41.84 ? 11  DC  T P     1 
ATOM   3603 O  OP1   . DC  B 2 11  ? 39.770 -19.888 -4.745  1.00 49.69 ? 11  DC  T OP1   1 
ATOM   3604 O  OP2   . DC  B 2 11  ? 39.722 -18.960 -7.120  1.00 31.88 ? 11  DC  T OP2   1 
ATOM   3605 O  "O5'" . DC  B 2 11  ? 37.891 -18.431 -5.551  1.00 34.57 ? 11  DC  T "O5'" 1 
ATOM   3606 C  "C5'" . DC  B 2 11  ? 37.307 -18.267 -4.275  1.00 33.64 ? 11  DC  T "C5'" 1 
ATOM   3607 C  "C4'" . DC  B 2 11  ? 35.798 -18.228 -4.421  1.00 35.85 ? 11  DC  T "C4'" 1 
ATOM   3608 O  "O4'" . DC  B 2 11  ? 35.367 -16.977 -5.022  1.00 29.11 ? 11  DC  T "O4'" 1 
ATOM   3609 C  "C3'" . DC  B 2 11  ? 35.207 -19.344 -5.284  1.00 22.62 ? 11  DC  T "C3'" 1 
ATOM   3610 O  "O3'" . DC  B 2 11  ? 34.093 -19.867 -4.557  1.00 26.10 ? 11  DC  T "O3'" 1 
ATOM   3611 C  "C2'" . DC  B 2 11  ? 34.811 -18.630 -6.584  1.00 23.11 ? 11  DC  T "C2'" 1 
ATOM   3612 C  "C1'" . DC  B 2 11  ? 34.474 -17.227 -6.094  1.00 27.51 ? 11  DC  T "C1'" 1 
ATOM   3613 N  N1    . DC  B 2 11  ? 34.673 -16.103 -7.072  1.00 21.09 ? 11  DC  T N1    1 
ATOM   3614 C  C2    . DC  B 2 11  ? 33.667 -15.141 -7.249  1.00 27.06 ? 11  DC  T C2    1 
ATOM   3615 O  O2    . DC  B 2 11  ? 32.600 -15.226 -6.623  1.00 22.70 ? 11  DC  T O2    1 
ATOM   3616 N  N3    . DC  B 2 11  ? 33.880 -14.123 -8.125  1.00 25.25 ? 11  DC  T N3    1 
ATOM   3617 C  C4    . DC  B 2 11  ? 35.031 -14.042 -8.801  1.00 24.88 ? 11  DC  T C4    1 
ATOM   3618 N  N4    . DC  B 2 11  ? 35.173 -13.011 -9.652  1.00 23.68 ? 11  DC  T N4    1 
ATOM   3619 C  C5    . DC  B 2 11  ? 36.071 -15.006 -8.628  1.00 24.61 ? 11  DC  T C5    1 
ATOM   3620 C  C6    . DC  B 2 11  ? 35.849 -16.013 -7.759  1.00 22.34 ? 11  DC  T C6    1 
ATOM   3621 P  P     . DT  B 2 12  ? 33.392 -21.239 -5.018  1.00 25.02 ? 12  DT  T P     1 
ATOM   3622 O  OP1   . DT  B 2 12  ? 32.888 -21.918 -3.803  1.00 26.15 ? 12  DT  T OP1   1 
ATOM   3623 O  OP2   . DT  B 2 12  ? 34.327 -21.957 -5.903  1.00 23.43 ? 12  DT  T OP2   1 
ATOM   3624 O  "O5'" . DT  B 2 12  ? 32.151 -20.739 -5.877  1.00 25.02 ? 12  DT  T "O5'" 1 
ATOM   3625 C  "C5'" . DT  B 2 12  ? 31.071 -20.140 -5.181  1.00 19.89 ? 12  DT  T "C5'" 1 
ATOM   3626 C  "C4'" . DT  B 2 12  ? 30.056 -19.656 -6.195  1.00 29.58 ? 12  DT  T "C4'" 1 
ATOM   3627 O  "O4'" . DT  B 2 12  ? 30.647 -18.553 -6.924  1.00 28.23 ? 12  DT  T "O4'" 1 
ATOM   3628 C  "C3'" . DT  B 2 12  ? 29.673 -20.707 -7.238  1.00 26.12 ? 12  DT  T "C3'" 1 
ATOM   3629 O  "O3'" . DT  B 2 12  ? 28.253 -20.723 -7.431  1.00 24.90 ? 12  DT  T "O3'" 1 
ATOM   3630 C  "C2'" . DT  B 2 12  ? 30.428 -20.257 -8.491  1.00 27.23 ? 12  DT  T "C2'" 1 
ATOM   3631 C  "C1'" . DT  B 2 12  ? 30.385 -18.745 -8.298  1.00 29.95 ? 12  DT  T "C1'" 1 
ATOM   3632 N  N1    . DT  B 2 12  ? 31.367 -17.942 -9.089  1.00 31.26 ? 12  DT  T N1    1 
ATOM   3633 C  C2    . DT  B 2 12  ? 31.005 -16.664 -9.443  1.00 21.09 ? 12  DT  T C2    1 
ATOM   3634 O  O2    . DT  B 2 12  ? 29.932 -16.164 -9.153  1.00 37.27 ? 12  DT  T O2    1 
ATOM   3635 N  N3    . DT  B 2 12  ? 31.938 -15.976 -10.155 1.00 29.54 ? 12  DT  T N3    1 
ATOM   3636 C  C4    . DT  B 2 12  ? 33.175 -16.428 -10.563 1.00 29.43 ? 12  DT  T C4    1 
ATOM   3637 O  O4    . DT  B 2 12  ? 33.918 -15.707 -11.221 1.00 27.45 ? 12  DT  T O4    1 
ATOM   3638 C  C5    . DT  B 2 12  ? 33.501 -17.776 -10.159 1.00 29.00 ? 12  DT  T C5    1 
ATOM   3639 C  C7    . DT  B 2 12  ? 34.822 -18.385 -10.524 1.00 22.64 ? 12  DT  T C7    1 
ATOM   3640 C  C6    . DT  B 2 12  ? 32.593 -18.462 -9.447  1.00 27.25 ? 12  DT  T C6    1 
ATOM   3641 O  "O5'" A DA  C 3 1   ? 28.746 -7.766  -15.555 0.50 32.81 ? 1   DA  P "O5'" 1 
ATOM   3642 O  "O5'" B DA  C 3 1   ? 29.259 -8.148  -15.855 0.50 33.24 ? 1   DA  P "O5'" 1 
ATOM   3643 C  "C5'" A DA  C 3 1   ? 27.365 -8.028  -15.792 0.50 33.04 ? 1   DA  P "C5'" 1 
ATOM   3644 C  "C5'" B DA  C 3 1   ? 27.858 -7.926  -15.875 0.50 33.04 ? 1   DA  P "C5'" 1 
ATOM   3645 C  "C4'" A DA  C 3 1   ? 26.743 -8.731  -14.605 0.50 32.76 ? 1   DA  P "C4'" 1 
ATOM   3646 C  "C4'" B DA  C 3 1   ? 27.209 -8.445  -14.605 0.50 33.05 ? 1   DA  P "C4'" 1 
ATOM   3647 O  "O4'" A DA  C 3 1   ? 27.453 -9.974  -14.394 0.50 34.74 ? 1   DA  P "O4'" 1 
ATOM   3648 O  "O4'" B DA  C 3 1   ? 27.576 -9.831  -14.422 0.50 34.65 ? 1   DA  P "O4'" 1 
ATOM   3649 C  "C3'" A DA  C 3 1   ? 26.791 -7.954  -13.291 0.50 30.67 ? 1   DA  P "C3'" 1 
ATOM   3650 C  "C3'" B DA  C 3 1   ? 27.566 -7.706  -13.316 0.50 30.30 ? 1   DA  P "C3'" 1 
ATOM   3651 O  "O3'" A DA  C 3 1   ? 25.482 -7.873  -12.715 0.50 25.57 ? 1   DA  P "O3'" 1 
ATOM   3652 O  "O3'" B DA  C 3 1   ? 26.406 -7.024  -12.909 0.50 32.68 ? 1   DA  P "O3'" 1 
ATOM   3653 C  "C2'" A DA  C 3 1   ? 27.787 -8.715  -12.405 0.50 28.78 ? 1   DA  P "C2'" 1 
ATOM   3654 C  "C2'" B DA  C 3 1   ? 27.891 -8.786  -12.292 0.50 28.81 ? 1   DA  P "C2'" 1 
ATOM   3655 C  "C1'" A DA  C 3 1   ? 27.929 -10.090 -13.067 0.50 33.23 ? 1   DA  P "C1'" 1 
ATOM   3656 C  "C1'" B DA  C 3 1   ? 27.950 -10.084 -13.084 0.50 33.23 ? 1   DA  P "C1'" 1 
ATOM   3657 N  N9    . DA  C 3 1   ? 29.292 -10.639 -13.129 1.00 30.84 ? 1   DA  P N9    1 
ATOM   3658 C  C8    . DA  C 3 1   ? 30.322 -10.225 -13.925 1.00 34.15 ? 1   DA  P C8    1 
ATOM   3659 N  N7    . DA  C 3 1   ? 31.429 -10.919 -13.758 1.00 35.96 ? 1   DA  P N7    1 
ATOM   3660 C  C5    . DA  C 3 1   ? 31.087 -11.849 -12.790 1.00 29.34 ? 1   DA  P C5    1 
ATOM   3661 C  C6    . DA  C 3 1   ? 31.819 -12.878 -12.173 1.00 30.31 ? 1   DA  P C6    1 
ATOM   3662 N  N6    . DA  C 3 1   ? 33.096 -13.130 -12.470 1.00 29.84 ? 1   DA  P N6    1 
ATOM   3663 N  N1    . DA  C 3 1   ? 31.191 -13.631 -11.248 1.00 31.38 ? 1   DA  P N1    1 
ATOM   3664 C  C2    . DA  C 3 1   ? 29.911 -13.366 -10.960 1.00 29.04 ? 1   DA  P C2    1 
ATOM   3665 N  N3    A DA  C 3 1   ? 29.127 -12.421 -11.469 0.50 27.66 ? 1   DA  P N3    1 
ATOM   3666 N  N3    B DA  C 3 1   ? 29.127 -12.419 -11.472 0.50 27.66 ? 1   DA  P N3    1 
ATOM   3667 C  C4    . DA  C 3 1   ? 29.780 -11.694 -12.391 1.00 29.56 ? 1   DA  P C4    1 
ATOM   3668 P  P     A DG  C 3 2   ? 25.071 -6.604  -11.817 0.50 24.46 ? 2   DG  P P     1 
ATOM   3669 P  P     B DG  C 3 2   ? 26.423 -6.078  -11.609 0.50 33.40 ? 2   DG  P P     1 
ATOM   3670 O  OP1   A DG  C 3 2   ? 23.607 -6.444  -11.887 0.50 23.37 ? 2   DG  P OP1   1 
ATOM   3671 O  OP1   B DG  C 3 2   ? 25.139 -5.337  -11.578 0.50 35.72 ? 2   DG  P OP1   1 
ATOM   3672 O  OP2   A DG  C 3 2   ? 25.946 -5.468  -12.202 0.50 30.41 ? 2   DG  P OP2   1 
ATOM   3673 O  OP2   B DG  C 3 2   ? 27.702 -5.334  -11.595 0.50 30.94 ? 2   DG  P OP2   1 
ATOM   3674 O  "O5'" A DG  C 3 2   ? 25.467 -7.055  -10.337 0.50 26.92 ? 2   DG  P "O5'" 1 
ATOM   3675 O  "O5'" B DG  C 3 2   ? 26.465 -7.114  -10.387 0.50 26.90 ? 2   DG  P "O5'" 1 
ATOM   3676 C  "C5'" A DG  C 3 2   ? 24.773 -8.142  -9.740  0.50 29.02 ? 2   DG  P "C5'" 1 
ATOM   3677 C  "C5'" B DG  C 3 2   ? 25.305 -7.820  -9.977  0.50 29.34 ? 2   DG  P "C5'" 1 
ATOM   3678 C  "C4'" A DG  C 3 2   ? 25.543 -8.692  -8.553  0.50 26.96 ? 2   DG  P "C4'" 1 
ATOM   3679 C  "C4'" B DG  C 3 2   ? 25.590 -8.549  -8.675  0.50 27.06 ? 2   DG  P "C4'" 1 
ATOM   3680 O  "O4'" A DG  C 3 2   ? 26.772 -9.322  -8.987  0.50 25.60 ? 2   DG  P "O4'" 1 
ATOM   3681 O  "O4'" B DG  C 3 2   ? 26.720 -9.435  -8.882  0.50 25.43 ? 2   DG  P "O4'" 1 
ATOM   3682 C  "C3'" A DG  C 3 2   ? 25.924 -7.678  -7.476  0.50 27.61 ? 2   DG  P "C3'" 1 
ATOM   3683 C  "C3'" B DG  C 3 2   ? 25.940 -7.648  -7.491  0.50 27.60 ? 2   DG  P "C3'" 1 
ATOM   3684 O  "O3'" A DG  C 3 2   ? 25.256 -8.137  -6.315  0.50 31.78 ? 2   DG  P "O3'" 1 
ATOM   3685 O  "O3'" B DG  C 3 2   ? 25.263 -8.133  -6.322  0.50 31.78 ? 2   DG  P "O3'" 1 
ATOM   3686 C  "C2'" A DG  C 3 2   ? 27.451 -7.755  -7.386  0.50 27.41 ? 2   DG  P "C2'" 1 
ATOM   3687 C  "C2'" B DG  C 3 2   ? 27.464 -7.741  -7.404  0.50 27.40 ? 2   DG  P "C2'" 1 
ATOM   3688 C  "C1'" A DG  C 3 2   ? 27.747 -9.125  -7.985  0.50 25.66 ? 2   DG  P "C1'" 1 
ATOM   3689 C  "C1'" B DG  C 3 2   ? 27.750 -9.132  -7.962  0.50 25.65 ? 2   DG  P "C1'" 1 
ATOM   3690 N  N9    . DG  C 3 2   ? 29.065 -9.264  -8.601  1.00 27.71 ? 2   DG  P N9    1 
ATOM   3691 C  C8    . DG  C 3 2   ? 29.704 -8.392  -9.454  1.00 29.91 ? 2   DG  P C8    1 
ATOM   3692 N  N7    . DG  C 3 2   ? 30.883 -8.809  -9.839  1.00 24.93 ? 2   DG  P N7    1 
ATOM   3693 C  C5    . DG  C 3 2   ? 31.040 -10.040 -9.204  1.00 25.82 ? 2   DG  P C5    1 
ATOM   3694 C  C6    . DG  C 3 2   ? 32.103 -10.977 -9.221  1.00 23.50 ? 2   DG  P C6    1 
ATOM   3695 O  O6    . DG  C 3 2   ? 33.181 -10.921 -9.836  1.00 21.86 ? 2   DG  P O6    1 
ATOM   3696 N  N1    . DG  C 3 2   ? 31.828 -12.091 -8.420  1.00 22.99 ? 2   DG  P N1    1 
ATOM   3697 C  C2    . DG  C 3 2   ? 30.672 -12.274 -7.702  1.00 23.20 ? 2   DG  P C2    1 
ATOM   3698 N  N2    . DG  C 3 2   ? 30.557 -13.399 -6.980  1.00 25.99 ? 2   DG  P N2    1 
ATOM   3699 N  N3    . DG  C 3 2   ? 29.680 -11.405 -7.681  1.00 28.21 ? 2   DG  P N3    1 
ATOM   3700 C  C4    . DG  C 3 2   ? 29.929 -10.322 -8.446  1.00 24.21 ? 2   DG  P C4    1 
ATOM   3701 P  P     . DC  C 3 3   ? 25.502 -7.441  -4.886  1.00 35.56 ? 3   DC  P P     1 
ATOM   3702 O  OP1   . DC  C 3 3   ? 24.248 -7.547  -4.115  1.00 34.26 ? 3   DC  P OP1   1 
ATOM   3703 O  OP2   . DC  C 3 3   ? 26.153 -6.135  -5.107  1.00 37.19 ? 3   DC  P OP2   1 
ATOM   3704 O  "O5'" . DC  C 3 3   ? 26.599 -8.379  -4.199  1.00 46.58 ? 3   DC  P "O5'" 1 
ATOM   3705 C  "C5'" . DC  C 3 3   ? 26.312 -9.752  -3.943  1.00 45.29 ? 3   DC  P "C5'" 1 
ATOM   3706 C  "C4'" . DC  C 3 3   ? 27.545 -10.469 -3.418  1.00 43.39 ? 3   DC  P "C4'" 1 
ATOM   3707 O  "O4'" . DC  C 3 3   ? 28.543 -10.488 -4.468  1.00 43.32 ? 3   DC  P "O4'" 1 
ATOM   3708 C  "C3'" . DC  C 3 3   ? 28.197 -9.831  -2.187  1.00 41.55 ? 3   DC  P "C3'" 1 
ATOM   3709 O  "O3'" . DC  C 3 3   ? 28.062 -10.686 -1.056  1.00 48.81 ? 3   DC  P "O3'" 1 
ATOM   3710 C  "C2'" . DC  C 3 3   ? 29.665 -9.644  -2.564  1.00 41.01 ? 3   DC  P "C2'" 1 
ATOM   3711 C  "C1'" . DC  C 3 3   ? 29.815 -10.423 -3.868  1.00 39.51 ? 3   DC  P "C1'" 1 
ATOM   3712 N  N1    . DC  C 3 3   ? 30.759 -9.744  -4.783  1.00 37.02 ? 3   DC  P N1    1 
ATOM   3713 C  C2    . DC  C 3 3   ? 31.934 -10.413 -5.106  1.00 25.39 ? 3   DC  P C2    1 
ATOM   3714 O  O2    . DC  C 3 3   ? 32.105 -11.535 -4.625  1.00 31.68 ? 3   DC  P O2    1 
ATOM   3715 N  N3    . DC  C 3 3   ? 32.835 -9.814  -5.922  1.00 31.08 ? 3   DC  P N3    1 
ATOM   3716 C  C4    . DC  C 3 3   ? 32.583 -8.599  -6.406  1.00 29.31 ? 3   DC  P C4    1 
ATOM   3717 N  N4    . DC  C 3 3   ? 33.504 -8.052  -7.208  1.00 27.35 ? 3   DC  P N4    1 
ATOM   3718 C  C5    . DC  C 3 3   ? 31.385 -7.895  -6.076  1.00 34.48 ? 3   DC  P C5    1 
ATOM   3719 C  C6    . DC  C 3 3   ? 30.507 -8.495  -5.261  1.00 28.41 ? 3   DC  P C6    1 
ATOM   3720 P  P     . DG  C 3 4   ? 28.554 -10.198 0.396   1.00 45.01 ? 4   DG  P P     1 
ATOM   3721 O  OP1   . DG  C 3 4   ? 27.729 -10.891 1.411   1.00 48.35 ? 4   DG  P OP1   1 
ATOM   3722 O  OP2   . DG  C 3 4   ? 28.641 -8.718  0.381   1.00 42.63 ? 4   DG  P OP2   1 
ATOM   3723 O  "O5'" . DG  C 3 4   ? 30.051 -10.756 0.491   1.00 40.85 ? 4   DG  P "O5'" 1 
ATOM   3724 C  "C5'" . DG  C 3 4   ? 30.269 -12.143 0.314   1.00 39.61 ? 4   DG  P "C5'" 1 
ATOM   3725 C  "C4'" . DG  C 3 4   ? 31.757 -12.427 0.312   1.00 49.97 ? 4   DG  P "C4'" 1 
ATOM   3726 O  "O4'" . DG  C 3 4   ? 32.376 -11.872 -0.882  1.00 42.24 ? 4   DG  P "O4'" 1 
ATOM   3727 C  "C3'" . DG  C 3 4   ? 32.489 -11.850 1.524   1.00 32.77 ? 4   DG  P "C3'" 1 
ATOM   3728 O  "O3'" . DG  C 3 4   ? 33.138 -12.925 2.188   1.00 46.37 ? 4   DG  P "O3'" 1 
ATOM   3729 C  "C2'" . DG  C 3 4   ? 33.459 -10.831 0.924   1.00 32.89 ? 4   DG  P "C2'" 1 
ATOM   3730 C  "C1'" . DG  C 3 4   ? 33.607 -11.280 -0.527  1.00 32.27 ? 4   DG  P "C1'" 1 
ATOM   3731 N  N9    . DG  C 3 4   ? 33.869 -10.169 -1.436  1.00 28.16 ? 4   DG  P N9    1 
ATOM   3732 C  C8    . DG  C 3 4   ? 33.074 -9.072  -1.678  1.00 32.09 ? 4   DG  P C8    1 
ATOM   3733 N  N7    . DG  C 3 4   ? 33.581 -8.242  -2.549  1.00 29.01 ? 4   DG  P N7    1 
ATOM   3734 C  C5    . DG  C 3 4   ? 34.794 -8.817  -2.901  1.00 24.42 ? 4   DG  P C5    1 
ATOM   3735 C  C6    . DG  C 3 4   ? 35.779 -8.378  -3.804  1.00 24.19 ? 4   DG  P C6    1 
ATOM   3736 O  O6    . DG  C 3 4   ? 35.785 -7.345  -4.489  1.00 30.10 ? 4   DG  P O6    1 
ATOM   3737 N  N1    . DG  C 3 4   ? 36.853 -9.268  -3.856  1.00 25.16 ? 4   DG  P N1    1 
ATOM   3738 C  C2    . DG  C 3 4   ? 36.945 -10.440 -3.133  1.00 23.59 ? 4   DG  P C2    1 
ATOM   3739 N  N2    . DG  C 3 4   ? 38.044 -11.190 -3.306  1.00 24.10 ? 4   DG  P N2    1 
ATOM   3740 N  N3    . DG  C 3 4   ? 36.021 -10.860 -2.289  1.00 29.56 ? 4   DG  P N3    1 
ATOM   3741 C  C4    . DG  C 3 4   ? 34.983 -10.000 -2.225  1.00 26.78 ? 4   DG  P C4    1 
ATOM   3742 P  P     . DT  C 3 5   ? 33.937 -12.671 3.560   1.00 46.42 ? 5   DT  P P     1 
ATOM   3743 O  OP1   . DT  C 3 5   ? 33.803 -13.880 4.391   1.00 38.20 ? 5   DT  P OP1   1 
ATOM   3744 O  OP2   . DT  C 3 5   ? 33.531 -11.352 4.092   1.00 35.05 ? 5   DT  P OP2   1 
ATOM   3745 O  "O5'" . DT  C 3 5   ? 35.459 -12.529 3.080   1.00 40.91 ? 5   DT  P "O5'" 1 
ATOM   3746 C  "C5'" . DT  C 3 5   ? 36.001 -13.469 2.166   1.00 32.85 ? 5   DT  P "C5'" 1 
ATOM   3747 C  "C4'" . DT  C 3 5   ? 37.466 -13.158 1.915   1.00 28.09 ? 5   DT  P "C4'" 1 
ATOM   3748 O  "O4'" . DT  C 3 5   ? 37.617 -12.159 0.871   1.00 26.82 ? 5   DT  P "O4'" 1 
ATOM   3749 C  "C3'" . DT  C 3 5   ? 38.255 -12.654 3.123   1.00 23.38 ? 5   DT  P "C3'" 1 
ATOM   3750 O  "O3'" . DT  C 3 5   ? 39.450 -13.420 3.161   1.00 27.16 ? 5   DT  P "O3'" 1 
ATOM   3751 C  "C2'" . DT  C 3 5   ? 38.509 -11.174 2.815   1.00 24.33 ? 5   DT  P "C2'" 1 
ATOM   3752 C  "C1'" . DT  C 3 5   ? 38.524 -11.143 1.294   1.00 25.15 ? 5   DT  P "C1'" 1 
ATOM   3753 N  N1    . DT  C 3 5   ? 38.077 -9.858  0.642   1.00 22.69 ? 5   DT  P N1    1 
ATOM   3754 C  C2    . DT  C 3 5   ? 38.866 -9.310  -0.341  1.00 21.19 ? 5   DT  P C2    1 
ATOM   3755 O  O2    . DT  C 3 5   ? 39.919 -9.804  -0.696  1.00 21.86 ? 5   DT  P O2    1 
ATOM   3756 N  N3    . DT  C 3 5   ? 38.377 -8.157  -0.897  1.00 23.00 ? 5   DT  P N3    1 
ATOM   3757 C  C4    . DT  C 3 5   ? 37.198 -7.510  -0.580  1.00 20.09 ? 5   DT  P C4    1 
ATOM   3758 O  O4    . DT  C 3 5   ? 36.846 -6.464  -1.137  1.00 22.52 ? 5   DT  P O4    1 
ATOM   3759 C  C5    . DT  C 3 5   ? 36.422 -8.130  0.465   1.00 24.03 ? 5   DT  P C5    1 
ATOM   3760 C  C7    . DT  C 3 5   ? 35.131 -7.507  0.905   1.00 24.93 ? 5   DT  P C7    1 
ATOM   3761 C  C6    . DT  C 3 5   ? 36.891 -9.257  1.023   1.00 21.73 ? 5   DT  P C6    1 
ATOM   3762 P  P     . DC  C 3 6   ? 40.462 -13.305 4.407   1.00 21.49 ? 6   DC  P P     1 
ATOM   3763 O  OP1   . DC  C 3 6   ? 41.189 -14.603 4.520   1.00 20.93 ? 6   DC  P OP1   1 
ATOM   3764 O  OP2   . DC  C 3 6   ? 39.731 -12.751 5.552   1.00 20.81 ? 6   DC  P OP2   1 
ATOM   3765 O  "O5'" . DC  C 3 6   ? 41.501 -12.185 3.943   1.00 19.15 ? 6   DC  P "O5'" 1 
ATOM   3766 C  "C5'" . DC  C 3 6   ? 42.385 -12.418 2.876   1.00 17.69 ? 6   DC  P "C5'" 1 
ATOM   3767 C  "C4'" . DC  C 3 6   ? 43.108 -11.123 2.576   1.00 20.37 ? 6   DC  P "C4'" 1 
ATOM   3768 O  "O4'" . DC  C 3 6   ? 42.221 -10.208 1.876   1.00 20.40 ? 6   DC  P "O4'" 1 
ATOM   3769 C  "C3'" . DC  C 3 6   ? 43.652 -10.368 3.795   1.00 17.06 ? 6   DC  P "C3'" 1 
ATOM   3770 O  "O3'" . DC  C 3 6   ? 45.079 -10.521 3.736   1.00 19.57 ? 6   DC  P "O3'" 1 
ATOM   3771 C  "C2'" . DC  C 3 6   ? 43.181 -8.926  3.581   1.00 18.13 ? 6   DC  P "C2'" 1 
ATOM   3772 C  "C1'" . DC  C 3 6   ? 42.690 -8.906  2.131   1.00 19.08 ? 6   DC  P "C1'" 1 
ATOM   3773 N  N1    . DC  C 3 6   ? 41.578 -7.921  1.914   1.00 18.98 ? 6   DC  P N1    1 
ATOM   3774 C  C2    . DC  C 3 6   ? 41.644 -7.015  0.849   1.00 19.58 ? 6   DC  P C2    1 
ATOM   3775 O  O2    . DC  C 3 6   ? 42.608 -7.067  0.069   1.00 17.77 ? 6   DC  P O2    1 
ATOM   3776 N  N3    . DC  C 3 6   ? 40.627 -6.124  0.683   1.00 20.49 ? 6   DC  P N3    1 
ATOM   3777 C  C4    . DC  C 3 6   ? 39.602 -6.108  1.540   1.00 20.63 ? 6   DC  P C4    1 
ATOM   3778 N  N4    . DC  C 3 6   ? 38.629 -5.212  1.343   1.00 22.03 ? 6   DC  P N4    1 
ATOM   3779 C  C5    . DC  C 3 6   ? 39.518 -7.012  2.637   1.00 19.98 ? 6   DC  P C5    1 
ATOM   3780 C  C6    . DC  C 3 6   ? 40.518 -7.891  2.785   1.00 24.81 ? 6   DC  P C6    1 
ATOM   3781 P  P     . DA  C 3 7   ? 46.038 -9.742  4.765   1.00 20.38 ? 7   DA  P P     1 
ATOM   3782 O  OP1   . DA  C 3 7   ? 47.294 -10.533 4.902   1.00 18.44 ? 7   DA  P OP1   1 
ATOM   3783 O  OP2   . DA  C 3 7   ? 45.246 -9.410  5.969   1.00 22.57 ? 7   DA  P OP2   1 
ATOM   3784 O  "O5'" A DA  C 3 7   ? 46.346 -8.357  4.029   0.50 20.73 ? 7   DA  P "O5'" 1 
ATOM   3785 O  "O5'" B DA  C 3 7   ? 46.368 -8.371  4.014   0.50 20.72 ? 7   DA  P "O5'" 1 
ATOM   3786 C  "C5'" A DA  C 3 7   ? 47.032 -8.289  2.793   0.50 23.95 ? 7   DA  P "C5'" 1 
ATOM   3787 C  "C5'" B DA  C 3 7   ? 46.948 -8.352  2.720   0.50 23.92 ? 7   DA  P "C5'" 1 
ATOM   3788 C  "C4'" A DA  C 3 7   ? 46.971 -6.870  2.244   0.50 27.92 ? 7   DA  P "C4'" 1 
ATOM   3789 C  "C4'" B DA  C 3 7   ? 46.952 -6.933  2.181   0.50 27.93 ? 7   DA  P "C4'" 1 
ATOM   3790 O  "O4'" A DA  C 3 7   ? 45.615 -6.562  1.841   0.50 26.33 ? 7   DA  P "O4'" 1 
ATOM   3791 O  "O4'" B DA  C 3 7   ? 45.625 -6.563  1.730   0.50 26.32 ? 7   DA  P "O4'" 1 
ATOM   3792 C  "C3'" A DA  C 3 7   ? 47.299 -5.748  3.225   0.50 27.18 ? 7   DA  P "C3'" 1 
ATOM   3793 C  "C3'" B DA  C 3 7   ? 47.271 -5.847  3.201   0.50 27.15 ? 7   DA  P "C3'" 1 
ATOM   3794 O  "O3'" A DA  C 3 7   ? 48.704 -5.513  3.330   0.50 33.23 ? 7   DA  P "O3'" 1 
ATOM   3795 O  "O3'" B DA  C 3 7   ? 48.673 -5.848  3.635   0.50 33.52 ? 7   DA  P "O3'" 1 
ATOM   3796 C  "C2'" A DA  C 3 7   ? 46.629 -4.538  2.586   0.50 25.70 ? 7   DA  P "C2'" 1 
ATOM   3797 C  "C2'" B DA  C 3 7   ? 46.731 -4.589  2.513   0.50 25.73 ? 7   DA  P "C2'" 1 
ATOM   3798 C  "C1'" A DA  C 3 7   ? 45.511 -5.152  1.754   0.50 25.68 ? 7   DA  P "C1'" 1 
ATOM   3799 C  "C1'" B DA  C 3 7   ? 45.526 -5.143  1.736   0.50 25.67 ? 7   DA  P "C1'" 1 
ATOM   3800 N  N9    . DA  C 3 7   ? 44.201 -4.724  2.222   1.00 22.02 ? 7   DA  P N9    1 
ATOM   3801 C  C8    . DA  C 3 7   ? 43.412 -5.313  3.176   1.00 21.60 ? 7   DA  P C8    1 
ATOM   3802 N  N7    . DA  C 3 7   ? 42.271 -4.685  3.384   1.00 21.48 ? 7   DA  P N7    1 
ATOM   3803 C  C5    . DA  C 3 7   ? 42.325 -3.611  2.506   1.00 19.43 ? 7   DA  P C5    1 
ATOM   3804 C  C6    . DA  C 3 7   ? 41.429 -2.561  2.228   1.00 22.91 ? 7   DA  P C6    1 
ATOM   3805 N  N6    . DA  C 3 7   ? 40.257 -2.444  2.848   1.00 23.15 ? 7   DA  P N6    1 
ATOM   3806 N  N1    . DA  C 3 7   ? 41.791 -1.651  1.293   1.00 19.77 ? 7   DA  P N1    1 
ATOM   3807 C  C2    . DA  C 3 7   ? 42.975 -1.787  0.681   1.00 22.67 ? 7   DA  P C2    1 
ATOM   3808 N  N3    . DA  C 3 7   ? 43.902 -2.733  0.860   1.00 22.10 ? 7   DA  P N3    1 
ATOM   3809 C  C4    . DA  C 3 7   ? 43.505 -3.619  1.789   1.00 22.94 ? 7   DA  P C4    1 
ATOM   3810 P  P     A DT  C 3 8   ? 49.256 -4.298  4.230   0.50 25.23 ? 8   DT  P P     1 
ATOM   3811 P  P     B DT  C 3 8   ? 49.827 -5.145  2.752   0.50 32.03 ? 8   DT  P P     1 
ATOM   3812 O  OP1   A DT  C 3 8   ? 50.702 -4.521  4.464   0.50 21.24 ? 8   DT  P OP1   1 
ATOM   3813 O  OP1   B DT  C 3 8   ? 49.834 -5.765  1.415   0.50 26.07 ? 8   DT  P OP1   1 
ATOM   3814 O  OP2   A DT  C 3 8   ? 48.330 -4.117  5.379   0.50 22.04 ? 8   DT  P OP2   1 
ATOM   3815 O  OP2   B DT  C 3 8   ? 51.060 -5.110  3.566   0.50 31.93 ? 8   DT  P OP2   1 
ATOM   3816 O  "O5'" A DT  C 3 8   ? 49.071 -3.006  3.290   0.50 26.01 ? 8   DT  P "O5'" 1 
ATOM   3817 O  "O5'" B DT  C 3 8   ? 49.348 -3.627  2.636   0.50 28.97 ? 8   DT  P "O5'" 1 
ATOM   3818 C  "C5'" A DT  C 3 8   ? 49.569 -2.879  1.945   0.50 25.37 ? 8   DT  P "C5'" 1 
ATOM   3819 C  "C5'" B DT  C 3 8   ? 49.750 -2.899  1.498   0.50 24.11 ? 8   DT  P "C5'" 1 
ATOM   3820 C  "C4'" . DT  C 3 8   ? 49.258 -1.460  1.499   1.00 23.66 ? 8   DT  P "C4'" 1 
ATOM   3821 O  "O4'" . DT  C 3 8   ? 47.817 -1.328  1.568   1.00 23.47 ? 8   DT  P "O4'" 1 
ATOM   3822 C  "C3'" . DT  C 3 8   ? 49.834 -0.475  2.509   1.00 25.40 ? 8   DT  P "C3'" 1 
ATOM   3823 O  "O3'" . DT  C 3 8   ? 50.491 0.553   1.785   1.00 18.96 ? 8   DT  P "O3'" 1 
ATOM   3824 C  "C2'" . DT  C 3 8   ? 48.622 0.062   3.284   1.00 21.70 ? 8   DT  P "C2'" 1 
ATOM   3825 C  "C1'" . DT  C 3 8   ? 47.476 -0.165  2.300   1.00 24.47 ? 8   DT  P "C1'" 1 
ATOM   3826 N  N1    . DT  C 3 8   ? 46.184 -0.365  3.005   1.00 21.20 ? 8   DT  P N1    1 
ATOM   3827 C  C2    . DT  C 3 8   ? 45.167 0.532   2.758   1.00 23.46 ? 8   DT  P C2    1 
ATOM   3828 O  O2    . DT  C 3 8   ? 45.276 1.456   1.986   1.00 24.07 ? 8   DT  P O2    1 
ATOM   3829 N  N3    . DT  C 3 8   ? 44.011 0.309   3.444   1.00 18.26 ? 8   DT  P N3    1 
ATOM   3830 C  C4    . DT  C 3 8   ? 43.779 -0.714  4.340   1.00 18.93 ? 8   DT  P C4    1 
ATOM   3831 O  O4    . DT  C 3 8   ? 42.703 -0.836  4.907   1.00 23.61 ? 8   DT  P O4    1 
ATOM   3832 C  C5    . DT  C 3 8   ? 44.883 -1.615  4.565   1.00 20.67 ? 8   DT  P C5    1 
ATOM   3833 C  C7    . DT  C 3 8   ? 44.729 -2.763  5.524   1.00 20.95 ? 8   DT  P C7    1 
ATOM   3834 C  C6    . DT  C 3 8   ? 46.020 -1.398  3.898   1.00 19.34 ? 8   DT  P C6    1 
HETATM 3835 NA NA    B NA  D 4 .   ? 52.862 0.551   1.754   0.70 21.24 ? 501 NA  A NA    1 
HETATM 3836 CA CA    . CA  E 5 .   ? 54.888 2.632   3.681   1.00 17.72 ? 503 CA  A CA    1 
HETATM 3837 C  C1    . GOL F 6 .   ? 60.577 -24.843 12.279  1.00 20.29 ? 504 GOL A C1    1 
HETATM 3838 O  O1    . GOL F 6 .   ? 59.167 -24.889 12.359  1.00 18.86 ? 504 GOL A O1    1 
HETATM 3839 C  C2    . GOL F 6 .   ? 61.077 -24.329 10.916  1.00 26.20 ? 504 GOL A C2    1 
HETATM 3840 O  O2    . GOL F 6 .   ? 60.698 -22.986 10.682  1.00 18.26 ? 504 GOL A O2    1 
HETATM 3841 C  C3    . GOL F 6 .   ? 60.667 -25.221 9.745   1.00 25.01 ? 504 GOL A C3    1 
HETATM 3842 O  O3    . GOL F 6 .   ? 61.509 -24.946 8.631   1.00 21.85 ? 504 GOL A O3    1 
HETATM 3843 C  C1    . GOL G 6 .   ? 54.268 16.545  -7.053  1.00 34.68 ? 505 GOL A C1    1 
HETATM 3844 O  O1    . GOL G 6 .   ? 54.008 15.171  -6.859  1.00 29.72 ? 505 GOL A O1    1 
HETATM 3845 C  C2    . GOL G 6 .   ? 54.887 16.710  -8.440  1.00 44.83 ? 505 GOL A C2    1 
HETATM 3846 O  O2    . GOL G 6 .   ? 53.998 16.201  -9.407  1.00 37.98 ? 505 GOL A O2    1 
HETATM 3847 C  C3    . GOL G 6 .   ? 55.160 18.177  -8.745  1.00 36.89 ? 505 GOL A C3    1 
HETATM 3848 O  O3    . GOL G 6 .   ? 55.989 18.236  -9.885  1.00 46.42 ? 505 GOL A O3    1 
HETATM 3849 C  C1    . GOL H 6 .   ? 54.593 28.298  4.797   1.00 30.98 ? 506 GOL A C1    1 
HETATM 3850 O  O1    . GOL H 6 .   ? 53.357 27.957  4.200   1.00 34.87 ? 506 GOL A O1    1 
HETATM 3851 C  C2    . GOL H 6 .   ? 55.043 27.179  5.735   1.00 34.54 ? 506 GOL A C2    1 
HETATM 3852 O  O2    . GOL H 6 .   ? 54.668 25.930  5.195   1.00 44.36 ? 506 GOL A O2    1 
HETATM 3853 C  C3    . GOL H 6 .   ? 56.561 27.210  5.905   1.00 39.71 ? 506 GOL A C3    1 
HETATM 3854 O  O3    . GOL H 6 .   ? 56.995 26.145  6.737   1.00 31.98 ? 506 GOL A O3    1 
HETATM 3855 P  PG    . DTP I 7 .   ? 55.327 2.608   7.219   1.00 15.80 ? 502 DTP P PG    1 
HETATM 3856 O  O1G   . DTP I 7 .   ? 55.063 1.704   8.399   1.00 15.91 ? 502 DTP P O1G   1 
HETATM 3857 O  O2G   . DTP I 7 .   ? 56.611 3.384   7.400   1.00 14.10 ? 502 DTP P O2G   1 
HETATM 3858 O  O3G   . DTP I 7 .   ? 55.165 1.914   5.897   1.00 16.24 ? 502 DTP P O3G   1 
HETATM 3859 P  PB    . DTP I 7 .   ? 53.134 4.134   6.127   1.00 15.33 ? 502 DTP P PB    1 
HETATM 3860 O  O1B   . DTP I 7 .   ? 53.894 4.369   4.857   1.00 12.76 ? 502 DTP P O1B   1 
HETATM 3861 O  O2B   . DTP I 7 .   ? 52.351 5.319   6.643   1.00 15.90 ? 502 DTP P O2B   1 
HETATM 3862 O  O3B   . DTP I 7 .   ? 54.108 3.674   7.325   1.00 14.87 ? 502 DTP P O3B   1 
HETATM 3863 P  PA    . DTP I 7 .   ? 51.578 2.031   4.792   1.00 16.35 ? 502 DTP P PA    1 
HETATM 3864 O  O1A   . DTP I 7 .   ? 50.712 0.924   5.357   1.00 19.52 ? 502 DTP P O1A   1 
HETATM 3865 O  O2A   . DTP I 7 .   ? 52.700 1.584   3.908   1.00 15.14 ? 502 DTP P O2A   1 
HETATM 3866 O  O3A   . DTP I 7 .   ? 52.131 2.851   6.081   1.00 19.31 ? 502 DTP P O3A   1 
HETATM 3867 O  "O5'" . DTP I 7 .   ? 50.599 3.002   3.963   1.00 14.88 ? 502 DTP P "O5'" 1 
HETATM 3868 C  "C5'" . DTP I 7 .   ? 51.067 3.978   3.039   1.00 16.18 ? 502 DTP P "C5'" 1 
HETATM 3869 C  "C4'" . DTP I 7 .   ? 50.141 5.187   3.070   1.00 15.28 ? 502 DTP P "C4'" 1 
HETATM 3870 O  "O4'" . DTP I 7 .   ? 48.802 4.857   2.658   1.00 15.47 ? 502 DTP P "O4'" 1 
HETATM 3871 C  "C3'" . DTP I 7 .   ? 50.006 5.762   4.474   1.00 14.38 ? 502 DTP P "C3'" 1 
HETATM 3872 O  "O3'" . DTP I 7 .   ? 50.990 6.770   4.719   1.00 14.91 ? 502 DTP P "O3'" 1 
HETATM 3873 C  "C2'" . DTP I 7 .   ? 48.610 6.364   4.462   1.00 13.29 ? 502 DTP P "C2'" 1 
HETATM 3874 C  "C1'" . DTP I 7 .   ? 47.829 5.457   3.522   1.00 17.96 ? 502 DTP P "C1'" 1 
HETATM 3875 N  N9    . DTP I 7 .   ? 47.094 4.416   4.296   1.00 18.20 ? 502 DTP P N9    1 
HETATM 3876 C  C8    . DTP I 7 .   ? 47.576 3.260   4.770   1.00 16.98 ? 502 DTP P C8    1 
HETATM 3877 N  N7    . DTP I 7 .   ? 46.577 2.603   5.411   1.00 15.42 ? 502 DTP P N7    1 
HETATM 3878 C  C5    . DTP I 7 .   ? 45.457 3.360   5.313   1.00 17.94 ? 502 DTP P C5    1 
HETATM 3879 C  C6    . DTP I 7 .   ? 44.147 3.220   5.767   1.00 20.28 ? 502 DTP P C6    1 
HETATM 3880 N  N6    . DTP I 7 .   ? 43.777 2.111   6.458   1.00 19.75 ? 502 DTP P N6    1 
HETATM 3881 N  N1    . DTP I 7 .   ? 43.244 4.200   5.519   1.00 16.35 ? 502 DTP P N1    1 
HETATM 3882 C  C2    . DTP I 7 .   ? 43.601 5.293   4.831   1.00 17.72 ? 502 DTP P C2    1 
HETATM 3883 N  N3    . DTP I 7 .   ? 44.860 5.457   4.384   1.00 15.99 ? 502 DTP P N3    1 
HETATM 3884 C  C4    . DTP I 7 .   ? 45.798 4.501   4.616   1.00 16.38 ? 502 DTP P C4    1 
HETATM 3885 O  O     . HOH J 8 .   ? 48.945 2.561   0.904   0.35 12.95 ? 601 HOH A O     1 
HETATM 3886 O  O     . HOH J 8 .   ? 64.110 -3.402  6.075   1.00 15.30 ? 602 HOH A O     1 
HETATM 3887 O  O     . HOH J 8 .   ? 57.937 -23.607 14.249  1.00 14.39 ? 603 HOH A O     1 
HETATM 3888 O  O     . HOH J 8 .   ? 56.418 -13.948 -5.805  1.00 14.54 ? 604 HOH A O     1 
HETATM 3889 O  O     . HOH J 8 .   ? 69.237 -17.641 -1.339  1.00 13.05 ? 605 HOH A O     1 
HETATM 3890 O  O     . HOH J 8 .   ? 73.311 -7.345  8.975   1.00 17.89 ? 606 HOH A O     1 
HETATM 3891 O  O     . HOH J 8 .   ? 51.797 5.761   9.215   1.00 16.25 ? 607 HOH A O     1 
HETATM 3892 O  O     . HOH J 8 .   ? 67.143 -16.581 9.745   1.00 18.73 ? 608 HOH A O     1 
HETATM 3893 O  O     . HOH J 8 .   ? 54.004 -28.550 4.201   1.00 17.52 ? 609 HOH A O     1 
HETATM 3894 O  O     . HOH J 8 .   ? 68.886 16.323  -3.921  1.00 20.10 ? 610 HOH A O     1 
HETATM 3895 O  O     . HOH J 8 .   ? 69.392 -13.511 5.051   1.00 15.68 ? 611 HOH A O     1 
HETATM 3896 O  O     . HOH J 8 .   ? 53.773 -20.463 -2.423  1.00 19.11 ? 612 HOH A O     1 
HETATM 3897 O  O     . HOH J 8 .   ? 67.473 -20.716 8.854   1.00 17.95 ? 613 HOH A O     1 
HETATM 3898 O  O     . HOH J 8 .   ? 59.507 9.509   10.757  1.00 17.16 ? 614 HOH A O     1 
HETATM 3899 O  O     . HOH J 8 .   ? 62.605 7.479   7.244   1.00 18.02 ? 615 HOH A O     1 
HETATM 3900 O  O     . HOH J 8 .   ? 43.626 12.150  -7.245  1.00 21.06 ? 616 HOH A O     1 
HETATM 3901 O  O     . HOH J 8 .   ? 58.646 -12.331 -11.502 1.00 18.26 ? 617 HOH A O     1 
HETATM 3902 O  O     . HOH J 8 .   ? 46.160 16.822  1.169   1.00 18.14 ? 618 HOH A O     1 
HETATM 3903 O  O     . HOH J 8 .   ? 60.542 -18.513 -4.583  1.00 17.11 ? 619 HOH A O     1 
HETATM 3904 O  O     . HOH J 8 .   ? 43.381 -33.202 -0.485  1.00 20.27 ? 620 HOH A O     1 
HETATM 3905 O  O     . HOH J 8 .   ? 52.322 15.901  -4.675  1.00 17.84 ? 621 HOH A O     1 
HETATM 3906 O  O     . HOH J 8 .   ? 42.132 -22.656 -2.485  1.00 23.08 ? 622 HOH A O     1 
HETATM 3907 O  O     . HOH J 8 .   ? 65.955 -15.279 11.814  1.00 21.71 ? 623 HOH A O     1 
HETATM 3908 O  O     . HOH J 8 .   ? 55.528 17.428  -0.615  1.00 15.97 ? 624 HOH A O     1 
HETATM 3909 O  O     . HOH J 8 .   ? 59.260 11.108  8.545   1.00 19.90 ? 625 HOH A O     1 
HETATM 3910 O  O     . HOH J 8 .   ? 70.698 -16.083 7.704   1.00 19.97 ? 626 HOH A O     1 
HETATM 3911 O  O     . HOH J 8 .   ? 53.874 17.343  -3.155  1.00 23.84 ? 627 HOH A O     1 
HETATM 3912 O  O     . HOH J 8 .   ? 71.302 3.585   -0.259  1.00 21.30 ? 628 HOH A O     1 
HETATM 3913 O  O     . HOH J 8 .   ? 41.154 6.780   19.219  1.00 20.22 ? 629 HOH A O     1 
HETATM 3914 O  O     . HOH J 8 .   ? 49.157 -15.563 13.734  1.00 20.16 ? 630 HOH A O     1 
HETATM 3915 O  O     . HOH J 8 .   ? 49.994 -3.172  -17.192 1.00 22.62 ? 631 HOH A O     1 
HETATM 3916 O  O     . HOH J 8 .   ? 59.946 11.598  -10.341 1.00 19.71 ? 632 HOH A O     1 
HETATM 3917 O  O     . HOH J 8 .   ? 62.768 14.767  -9.256  1.00 18.97 ? 633 HOH A O     1 
HETATM 3918 O  O     . HOH J 8 .   ? 70.768 -19.099 1.343   1.00 23.87 ? 634 HOH A O     1 
HETATM 3919 O  O     . HOH J 8 .   ? 33.121 10.783  5.466   1.00 26.15 ? 635 HOH A O     1 
HETATM 3920 O  O     . HOH J 8 .   ? 50.139 -17.234 15.606  1.00 18.88 ? 636 HOH A O     1 
HETATM 3921 O  O     . HOH J 8 .   ? 49.032 6.785   -11.892 1.00 21.48 ? 637 HOH A O     1 
HETATM 3922 O  O     . HOH J 8 .   ? 65.852 5.713   2.299   1.00 28.76 ? 638 HOH A O     1 
HETATM 3923 O  O     . HOH J 8 .   ? 52.679 1.233   9.522   1.00 23.98 ? 639 HOH A O     1 
HETATM 3924 O  O     . HOH J 8 .   ? 52.423 20.256  5.007   1.00 19.15 ? 640 HOH A O     1 
HETATM 3925 O  O     . HOH J 8 .   ? 54.223 -9.530  5.345   1.00 21.90 ? 641 HOH A O     1 
HETATM 3926 O  O     . HOH J 8 .   ? 54.748 -11.394 3.516   1.00 18.17 ? 642 HOH A O     1 
HETATM 3927 O  O     . HOH J 8 .   ? 45.529 16.028  -1.557  1.00 20.32 ? 643 HOH A O     1 
HETATM 3928 O  O     . HOH J 8 .   ? 68.394 -16.021 -7.623  1.00 30.40 ? 644 HOH A O     1 
HETATM 3929 O  O     . HOH J 8 .   ? 51.316 5.539   -8.455  1.00 22.82 ? 645 HOH A O     1 
HETATM 3930 O  O     . HOH J 8 .   ? 44.162 10.720  -12.640 1.00 27.46 ? 646 HOH A O     1 
HETATM 3931 O  O     . HOH J 8 .   ? 65.758 -6.645  -13.843 1.00 19.62 ? 647 HOH A O     1 
HETATM 3932 O  O     . HOH J 8 .   ? 44.444 7.374   2.391   1.00 19.97 ? 648 HOH A O     1 
HETATM 3933 O  O     . HOH J 8 .   ? 78.346 -0.954  5.288   1.00 22.75 ? 649 HOH A O     1 
HETATM 3934 O  O     . HOH J 8 .   ? 51.340 3.439   10.621  1.00 24.02 ? 650 HOH A O     1 
HETATM 3935 O  O     . HOH J 8 .   ? 43.697 9.914   -10.010 1.00 25.07 ? 651 HOH A O     1 
HETATM 3936 O  O     . HOH J 8 .   ? 48.459 -36.892 2.622   1.00 26.47 ? 652 HOH A O     1 
HETATM 3937 O  O     . HOH J 8 .   ? 59.954 14.269  -8.612  1.00 22.14 ? 653 HOH A O     1 
HETATM 3938 O  O     . HOH J 8 .   ? 45.035 7.513   -10.468 1.00 23.53 ? 654 HOH A O     1 
HETATM 3939 O  O     . HOH J 8 .   ? 53.740 13.536  -10.057 1.00 25.88 ? 655 HOH A O     1 
HETATM 3940 O  O     . HOH J 8 .   ? 41.096 7.669   -18.522 1.00 21.73 ? 656 HOH A O     1 
HETATM 3941 O  O     . HOH J 8 .   ? 50.549 -34.734 -0.673  1.00 24.78 ? 657 HOH A O     1 
HETATM 3942 O  O     . HOH J 8 .   ? 53.302 -28.269 15.443  1.00 26.56 ? 658 HOH A O     1 
HETATM 3943 O  O     . HOH J 8 .   ? 36.871 16.181  -4.420  1.00 29.42 ? 659 HOH A O     1 
HETATM 3944 O  O     . HOH J 8 .   ? 41.760 -30.454 -6.373  1.00 26.98 ? 660 HOH A O     1 
HETATM 3945 O  O     . HOH J 8 .   ? 44.111 -15.129 1.388   1.00 25.50 ? 661 HOH A O     1 
HETATM 3946 O  O     . HOH J 8 .   ? 61.610 8.088   9.868   1.00 25.09 ? 662 HOH A O     1 
HETATM 3947 O  O     . HOH J 8 .   ? 71.624 6.020   -7.399  1.00 21.61 ? 663 HOH A O     1 
HETATM 3948 O  O     . HOH J 8 .   ? 52.641 -1.414  4.095   1.00 27.05 ? 664 HOH A O     1 
HETATM 3949 O  O     . HOH J 8 .   ? 40.511 16.697  5.963   1.00 25.43 ? 665 HOH A O     1 
HETATM 3950 O  O     . HOH J 8 .   ? 64.027 -9.317  -14.396 1.00 24.83 ? 666 HOH A O     1 
HETATM 3951 O  O     . HOH J 8 .   ? 46.796 -0.410  -15.130 1.00 22.70 ? 667 HOH A O     1 
HETATM 3952 O  O     . HOH J 8 .   ? 58.516 -8.947  -14.231 1.00 27.63 ? 668 HOH A O     1 
HETATM 3953 O  O     . HOH J 8 .   ? 41.389 -23.818 -5.077  1.00 24.39 ? 669 HOH A O     1 
HETATM 3954 O  O     . HOH J 8 .   ? 59.994 13.059  11.461  1.00 28.42 ? 670 HOH A O     1 
HETATM 3955 O  O     . HOH J 8 .   ? 51.336 8.744   -15.344 1.00 35.71 ? 671 HOH A O     1 
HETATM 3956 O  O     . HOH J 8 .   ? 63.230 -26.590 7.006   1.00 29.21 ? 672 HOH A O     1 
HETATM 3957 O  O     . HOH J 8 .   ? 53.287 -33.448 -0.173  1.00 26.96 ? 673 HOH A O     1 
HETATM 3958 O  O     . HOH J 8 .   ? 54.458 15.614  23.475  1.00 32.71 ? 674 HOH A O     1 
HETATM 3959 O  O     . HOH J 8 .   ? 59.988 10.324  19.756  1.00 24.10 ? 675 HOH A O     1 
HETATM 3960 O  O     . HOH J 8 .   ? 49.067 2.881   21.308  1.00 26.13 ? 676 HOH A O     1 
HETATM 3961 O  O     . HOH J 8 .   ? 50.042 2.795   12.860  1.00 28.18 ? 677 HOH A O     1 
HETATM 3962 O  O     . HOH J 8 .   ? 28.960 8.398   -19.251 1.00 31.47 ? 678 HOH A O     1 
HETATM 3963 O  O     . HOH J 8 .   ? 65.800 -22.966 3.288   1.00 20.94 ? 679 HOH A O     1 
HETATM 3964 O  O     . HOH J 8 .   ? 47.939 -27.055 -7.250  1.00 31.83 ? 680 HOH A O     1 
HETATM 3965 O  O     . HOH J 8 .   ? 45.086 0.458   -18.576 1.00 31.08 ? 681 HOH A O     1 
HETATM 3966 O  O     . HOH J 8 .   ? 46.905 -14.616 14.970  1.00 35.86 ? 682 HOH A O     1 
HETATM 3967 O  O     . HOH J 8 .   ? 42.800 15.662  23.681  1.00 25.96 ? 683 HOH A O     1 
HETATM 3968 O  O     . HOH J 8 .   ? 59.053 4.626   23.228  1.00 31.30 ? 684 HOH A O     1 
HETATM 3969 O  O     . HOH J 8 .   ? 51.198 -8.980  -5.188  1.00 32.43 ? 685 HOH A O     1 
HETATM 3970 O  O     . HOH J 8 .   ? 72.190 -4.003  -14.034 1.00 31.02 ? 686 HOH A O     1 
HETATM 3971 O  O     . HOH J 8 .   ? 60.514 -17.797 -7.402  1.00 29.68 ? 687 HOH A O     1 
HETATM 3972 O  O     . HOH J 8 .   ? 48.727 -22.221 -5.720  1.00 23.78 ? 688 HOH A O     1 
HETATM 3973 O  O     . HOH J 8 .   ? 44.964 -14.334 10.598  1.00 21.28 ? 689 HOH A O     1 
HETATM 3974 O  O     . HOH J 8 .   ? 70.987 0.693   11.372  1.00 28.79 ? 690 HOH A O     1 
HETATM 3975 O  O     . HOH J 8 .   ? 63.352 -18.875 -1.587  1.00 24.36 ? 691 HOH A O     1 
HETATM 3976 O  O     . HOH J 8 .   ? 49.419 8.436   -13.699 1.00 30.35 ? 692 HOH A O     1 
HETATM 3977 O  O     . HOH J 8 .   ? 24.114 16.194  3.239   1.00 30.63 ? 693 HOH A O     1 
HETATM 3978 O  O     . HOH J 8 .   ? 52.873 -12.686 -3.971  1.00 29.62 ? 694 HOH A O     1 
HETATM 3979 O  O     . HOH J 8 .   ? 59.401 4.784   16.718  1.00 24.56 ? 695 HOH A O     1 
HETATM 3980 O  O     . HOH J 8 .   ? 42.840 -1.431  -25.214 1.00 32.29 ? 696 HOH A O     1 
HETATM 3981 O  O     . HOH J 8 .   ? 61.699 14.510  8.820   1.00 26.93 ? 697 HOH A O     1 
HETATM 3982 O  O     . HOH J 8 .   ? 51.490 5.152   -11.137 1.00 25.60 ? 698 HOH A O     1 
HETATM 3983 O  O     . HOH J 8 .   ? 57.774 -7.491  8.129   1.00 25.30 ? 699 HOH A O     1 
HETATM 3984 O  O     . HOH J 8 .   ? 53.339 -20.348 -5.111  1.00 29.33 ? 700 HOH A O     1 
HETATM 3985 O  O     . HOH J 8 .   ? 42.281 -18.976 15.042  1.00 28.61 ? 701 HOH A O     1 
HETATM 3986 O  O     . HOH J 8 .   ? 23.303 14.188  -9.417  1.00 36.56 ? 702 HOH A O     1 
HETATM 3987 O  O     . HOH J 8 .   ? 58.155 -27.621 11.298  1.00 22.89 ? 703 HOH A O     1 
HETATM 3988 O  O     . HOH J 8 .   ? 64.843 6.738   -0.312  1.00 27.81 ? 704 HOH A O     1 
HETATM 3989 O  O     . HOH J 8 .   ? 47.269 -0.350  -8.399  1.00 29.83 ? 705 HOH A O     1 
HETATM 3990 O  O     . HOH J 8 .   ? 22.374 -4.570  3.829   1.00 40.02 ? 706 HOH A O     1 
HETATM 3991 O  O     . HOH J 8 .   ? 47.978 10.741  -9.591  1.00 33.17 ? 707 HOH A O     1 
HETATM 3992 O  O     . HOH J 8 .   ? 70.640 -6.973  13.756  1.00 30.43 ? 708 HOH A O     1 
HETATM 3993 O  O     . HOH J 8 .   ? 21.601 13.742  6.664   1.00 34.24 ? 709 HOH A O     1 
HETATM 3994 O  O     . HOH J 8 .   ? 61.288 20.906  12.005  1.00 30.70 ? 710 HOH A O     1 
HETATM 3995 O  O     . HOH J 8 .   ? 48.915 -9.501  10.487  1.00 29.97 ? 711 HOH A O     1 
HETATM 3996 O  O     . HOH J 8 .   ? 58.077 -14.496 -12.998 1.00 26.33 ? 712 HOH A O     1 
HETATM 3997 O  O     . HOH J 8 .   ? 52.957 -26.459 -4.028  1.00 25.80 ? 713 HOH A O     1 
HETATM 3998 O  O     . HOH J 8 .   ? 33.257 2.543   -0.280  1.00 34.73 ? 714 HOH A O     1 
HETATM 3999 O  O     . HOH J 8 .   ? 41.494 17.035  -14.977 1.00 25.84 ? 715 HOH A O     1 
HETATM 4000 O  O     . HOH J 8 .   ? 66.670 -2.455  12.792  1.00 34.45 ? 716 HOH A O     1 
HETATM 4001 O  O     . HOH J 8 .   ? 51.518 -8.500  5.082   1.00 38.00 ? 717 HOH A O     1 
HETATM 4002 O  O     . HOH J 8 .   ? 55.910 -32.940 5.047   1.00 35.49 ? 718 HOH A O     1 
HETATM 4003 O  O     . HOH J 8 .   ? 75.214 0.257   -3.800  1.00 28.32 ? 719 HOH A O     1 
HETATM 4004 O  O     . HOH J 8 .   ? 54.722 -0.778  5.660   1.00 30.68 ? 720 HOH A O     1 
HETATM 4005 O  O     . HOH J 8 .   ? 29.440 3.805   6.636   1.00 41.39 ? 721 HOH A O     1 
HETATM 4006 O  O     . HOH J 8 .   ? 57.161 -16.515 -11.456 1.00 29.85 ? 722 HOH A O     1 
HETATM 4007 O  O     . HOH J 8 .   ? 46.256 -9.746  11.215  1.00 36.06 ? 723 HOH A O     1 
HETATM 4008 O  O     . HOH J 8 .   ? 49.011 13.698  28.347  1.00 33.45 ? 724 HOH A O     1 
HETATM 4009 O  O     . HOH J 8 .   ? 47.674 15.788  -17.731 1.00 34.51 ? 725 HOH A O     1 
HETATM 4010 O  O     . HOH J 8 .   ? 72.022 -19.038 14.036  1.00 34.58 ? 726 HOH A O     1 
HETATM 4011 O  O     . HOH J 8 .   ? 47.205 2.393   -1.367  1.00 29.63 ? 727 HOH A O     1 
HETATM 4012 O  O     . HOH J 8 .   ? 45.934 7.641   -13.069 1.00 32.15 ? 728 HOH A O     1 
HETATM 4013 O  O     . HOH J 8 .   ? 43.312 -2.664  -20.278 1.00 29.02 ? 729 HOH A O     1 
HETATM 4014 O  O     . HOH J 8 .   ? 35.443 20.731  0.606   1.00 30.50 ? 730 HOH A O     1 
HETATM 4015 O  O     . HOH J 8 .   ? 68.921 -10.791 12.271  1.00 35.30 ? 731 HOH A O     1 
HETATM 4016 O  O     . HOH J 8 .   ? 65.839 8.514   9.005   1.00 29.23 ? 732 HOH A O     1 
HETATM 4017 O  O     . HOH J 8 .   ? 40.939 -1.682  -16.419 1.00 29.22 ? 733 HOH A O     1 
HETATM 4018 O  O     . HOH J 8 .   ? 58.338 -17.961 19.794  1.00 29.97 ? 734 HOH A O     1 
HETATM 4019 O  O     . HOH J 8 .   ? 56.353 -3.133  4.452   1.00 33.42 ? 735 HOH A O     1 
HETATM 4020 O  O     . HOH J 8 .   ? 67.365 -8.425  10.215  1.00 26.87 ? 736 HOH A O     1 
HETATM 4021 O  O     . HOH J 8 .   ? 37.369 17.647  -6.625  1.00 36.99 ? 737 HOH A O     1 
HETATM 4022 O  O     . HOH J 8 .   ? 49.307 7.353   -7.897  1.00 33.25 ? 738 HOH A O     1 
HETATM 4023 O  O     . HOH J 8 .   ? 46.665 -18.657 -2.449  1.00 35.51 ? 739 HOH A O     1 
HETATM 4024 O  O     . HOH J 8 .   ? 62.750 9.291   -13.425 1.00 41.34 ? 740 HOH A O     1 
HETATM 4025 O  O     . HOH J 8 .   ? 56.343 18.664  18.167  1.00 26.62 ? 741 HOH A O     1 
HETATM 4026 O  O     . HOH J 8 .   ? 52.930 -19.730 22.252  1.00 38.56 ? 742 HOH A O     1 
HETATM 4027 O  O     . HOH J 8 .   ? 46.840 19.602  1.438   1.00 28.27 ? 743 HOH A O     1 
HETATM 4028 O  O     . HOH J 8 .   ? 51.324 6.213   -19.009 1.00 38.33 ? 744 HOH A O     1 
HETATM 4029 O  O     . HOH J 8 .   ? 64.344 19.824  11.259  1.00 36.90 ? 745 HOH A O     1 
HETATM 4030 O  O     . HOH J 8 .   ? 47.296 -20.254 18.405  1.00 33.29 ? 746 HOH A O     1 
HETATM 4031 O  O     . HOH J 8 .   ? 18.908 14.222  6.628   1.00 38.15 ? 747 HOH A O     1 
HETATM 4032 O  O     . HOH J 8 .   ? 55.711 -7.336  6.487   1.00 31.38 ? 748 HOH A O     1 
HETATM 4033 O  O     . HOH J 8 .   ? 46.867 16.396  25.699  1.00 29.76 ? 749 HOH A O     1 
HETATM 4034 O  O     . HOH J 8 .   ? 67.606 -6.430  12.936  1.00 30.66 ? 750 HOH A O     1 
HETATM 4035 O  O     . HOH J 8 .   ? 73.726 4.648   -1.143  1.00 41.20 ? 751 HOH A O     1 
HETATM 4036 O  O     . HOH J 8 .   ? 63.488 12.869  -10.866 1.00 29.85 ? 752 HOH A O     1 
HETATM 4037 O  O     . HOH J 8 .   ? 49.697 -9.291  -8.312  1.00 31.96 ? 753 HOH A O     1 
HETATM 4038 O  O     . HOH J 8 .   ? 72.367 -7.722  11.703  1.00 22.04 ? 754 HOH A O     1 
HETATM 4039 O  O     . HOH J 8 .   ? 79.148 3.653   1.669   1.00 36.84 ? 755 HOH A O     1 
HETATM 4040 O  O     . HOH J 8 .   ? 34.520 5.900   -21.990 1.00 36.90 ? 756 HOH A O     1 
HETATM 4041 O  O     . HOH J 8 .   ? 47.257 3.082   -24.136 1.00 37.13 ? 757 HOH A O     1 
HETATM 4042 O  O     . HOH J 8 .   ? 69.513 4.639   3.905   1.00 29.76 ? 758 HOH A O     1 
HETATM 4043 O  O     . HOH J 8 .   ? 44.424 10.008  -24.539 1.00 36.65 ? 759 HOH A O     1 
HETATM 4044 O  O     . HOH J 8 .   ? 51.438 21.768  7.122   1.00 25.87 ? 760 HOH A O     1 
HETATM 4045 O  O     . HOH J 8 .   ? 73.311 2.089   8.090   1.00 30.32 ? 761 HOH A O     1 
HETATM 4046 O  O     . HOH J 8 .   ? 47.753 -19.004 -5.233  1.00 36.62 ? 762 HOH A O     1 
HETATM 4047 O  O     . HOH J 8 .   ? 48.437 -17.784 17.356  1.00 35.03 ? 763 HOH A O     1 
HETATM 4048 O  O     . HOH J 8 .   ? 68.308 -14.741 -10.172 1.00 31.32 ? 764 HOH A O     1 
HETATM 4049 O  O     . HOH J 8 .   ? 48.775 12.741  -11.350 1.00 41.62 ? 765 HOH A O     1 
HETATM 4050 O  O     . HOH J 8 .   ? 60.358 14.196  3.539   1.00 31.33 ? 766 HOH A O     1 
HETATM 4051 O  O     . HOH J 8 .   ? 65.853 -21.531 14.713  1.00 38.23 ? 767 HOH A O     1 
HETATM 4052 O  O     . HOH J 8 .   ? 76.545 2.649   6.707   1.00 36.26 ? 768 HOH A O     1 
HETATM 4053 O  O     . HOH J 8 .   ? 83.585 -18.480 -1.273  1.00 46.10 ? 769 HOH A O     1 
HETATM 4054 O  O     . HOH J 8 .   ? 48.454 19.882  4.693   1.00 33.44 ? 770 HOH A O     1 
HETATM 4055 O  O     . HOH J 8 .   ? 70.536 -17.387 12.460  1.00 36.35 ? 771 HOH A O     1 
HETATM 4056 O  O     . HOH J 8 .   ? 36.930 13.111  12.011  1.00 33.02 ? 772 HOH A O     1 
HETATM 4057 O  O     . HOH J 8 .   ? 46.167 -8.228  -15.542 1.00 33.57 ? 773 HOH A O     1 
HETATM 4058 O  O     . HOH J 8 .   ? 49.367 14.884  -22.551 1.00 40.23 ? 774 HOH A O     1 
HETATM 4059 O  O     . HOH J 8 .   ? 56.324 1.163   13.015  1.00 28.63 ? 775 HOH A O     1 
HETATM 4060 O  O     . HOH J 8 .   ? 47.636 7.965   -9.678  1.00 32.00 ? 776 HOH A O     1 
HETATM 4061 O  O     . HOH J 8 .   ? 81.659 -10.941 -8.343  1.00 44.52 ? 777 HOH A O     1 
HETATM 4062 O  O     . HOH J 8 .   ? 46.362 0.318   7.040   1.00 31.52 ? 778 HOH A O     1 
HETATM 4063 O  O     . HOH J 8 .   ? 46.594 -30.827 13.145  1.00 38.37 ? 779 HOH A O     1 
HETATM 4064 O  O     . HOH J 8 .   ? 55.742 13.577  -11.717 1.00 33.77 ? 780 HOH A O     1 
HETATM 4065 O  O     . HOH J 8 .   ? 39.815 7.027   13.460  1.00 34.88 ? 781 HOH A O     1 
HETATM 4066 O  O     . HOH J 8 .   ? 48.652 -33.280 -3.672  1.00 36.03 ? 782 HOH A O     1 
HETATM 4067 O  O     . HOH J 8 .   ? 40.781 13.928  -6.298  1.00 32.79 ? 783 HOH A O     1 
HETATM 4068 O  O     . HOH J 8 .   ? 63.514 -17.263 15.235  1.00 36.85 ? 784 HOH A O     1 
HETATM 4069 O  O     . HOH J 8 .   ? 43.629 -16.598 15.214  1.00 36.89 ? 785 HOH A O     1 
HETATM 4070 O  O     . HOH J 8 .   ? 36.064 10.991  0.533   1.00 28.40 ? 786 HOH A O     1 
HETATM 4071 O  O     . HOH J 8 .   ? 38.538 -18.083 10.450  1.00 26.92 ? 787 HOH A O     1 
HETATM 4072 O  O     . HOH J 8 .   ? 32.004 -1.379  -2.746  1.00 44.36 ? 788 HOH A O     1 
HETATM 4073 O  O     . HOH J 8 .   ? 34.690 17.586  -12.873 1.00 34.26 ? 789 HOH A O     1 
HETATM 4074 O  O     . HOH J 8 .   ? 50.492 -12.938 -0.878  1.00 26.79 ? 790 HOH A O     1 
HETATM 4075 O  O     . HOH J 8 .   ? 40.636 -28.748 -9.855  1.00 33.72 ? 791 HOH A O     1 
HETATM 4076 O  O     . HOH J 8 .   ? 49.892 -8.805  12.972  1.00 36.23 ? 792 HOH A O     1 
HETATM 4077 O  O     . HOH J 8 .   ? 70.030 -12.955 -11.610 1.00 36.91 ? 793 HOH A O     1 
HETATM 4078 O  O     . HOH J 8 .   ? 19.831 10.302  8.984   1.00 40.40 ? 794 HOH A O     1 
HETATM 4079 O  O     . HOH J 8 .   ? 69.968 -8.915  10.765  1.00 32.03 ? 795 HOH A O     1 
HETATM 4080 O  O     . HOH J 8 .   ? 75.540 -13.222 -15.338 1.00 45.48 ? 796 HOH A O     1 
HETATM 4081 O  O     . HOH J 8 .   ? 46.030 18.803  -3.136  1.00 35.98 ? 797 HOH A O     1 
HETATM 4082 O  O     . HOH J 8 .   ? 42.678 -30.208 -3.870  1.00 37.76 ? 798 HOH A O     1 
HETATM 4083 O  O     . HOH J 8 .   ? 58.845 15.459  -10.663 1.00 35.15 ? 799 HOH A O     1 
HETATM 4084 O  O     . HOH J 8 .   ? 65.601 12.946  2.915   1.00 36.12 ? 800 HOH A O     1 
HETATM 4085 O  O     . HOH J 8 .   ? 33.781 22.537  -0.711  1.00 43.14 ? 801 HOH A O     1 
HETATM 4086 O  O     . HOH J 8 .   ? 59.520 -32.720 7.939   1.00 37.59 ? 802 HOH A O     1 
HETATM 4087 O  O     . HOH J 8 .   ? 55.568 -0.862  8.715   1.00 36.65 ? 803 HOH A O     1 
HETATM 4088 O  O     . HOH J 8 .   ? 47.507 -16.654 -0.817  1.00 39.37 ? 804 HOH A O     1 
HETATM 4089 O  O     . HOH J 8 .   ? 62.874 -17.113 -7.319  1.00 28.55 ? 805 HOH A O     1 
HETATM 4090 O  O     . HOH J 8 .   ? 61.740 -31.506 -10.589 1.00 36.58 ? 806 HOH A O     1 
HETATM 4091 O  O     . HOH J 8 .   ? 51.071 -22.703 -5.651  1.00 36.19 ? 807 HOH A O     1 
HETATM 4092 O  O     . HOH J 8 .   ? 44.218 15.811  26.238  1.00 31.03 ? 808 HOH A O     1 
HETATM 4093 O  O     . HOH J 8 .   ? 51.886 -18.052 -6.159  1.00 36.18 ? 809 HOH A O     1 
HETATM 4094 O  O     . HOH J 8 .   ? 65.243 19.631  1.794   1.00 27.98 ? 810 HOH A O     1 
HETATM 4095 O  O     . HOH J 8 .   ? 33.973 15.415  18.784  1.00 43.21 ? 811 HOH A O     1 
HETATM 4096 O  O     . HOH J 8 .   ? 58.110 -0.172  -14.635 1.00 33.63 ? 812 HOH A O     1 
HETATM 4097 O  O     . HOH J 8 .   ? 47.225 15.979  -23.619 1.00 32.89 ? 813 HOH A O     1 
HETATM 4098 O  O     . HOH J 8 .   ? 53.899 6.080   -12.428 1.00 32.91 ? 814 HOH A O     1 
HETATM 4099 O  O     . HOH J 8 .   ? 41.423 20.316  4.793   1.00 28.40 ? 815 HOH A O     1 
HETATM 4100 O  O     . HOH J 8 .   ? 52.279 -5.586  -0.942  1.00 34.31 ? 816 HOH A O     1 
HETATM 4101 O  O     . HOH J 8 .   ? 62.144 16.127  2.602   1.00 35.51 ? 817 HOH A O     1 
HETATM 4102 O  O     . HOH J 8 .   ? 27.612 6.606   -17.059 1.00 29.71 ? 818 HOH A O     1 
HETATM 4103 O  O     . HOH J 8 .   ? 53.103 24.034  4.342   1.00 36.51 ? 819 HOH A O     1 
HETATM 4104 O  O     . HOH J 8 .   ? 81.151 -15.776 7.653   1.00 32.30 ? 820 HOH A O     1 
HETATM 4105 O  O     . HOH J 8 .   ? 58.603 18.087  19.452  1.00 38.20 ? 821 HOH A O     1 
HETATM 4106 O  O     . HOH J 8 .   ? 34.534 14.889  11.433  1.00 29.66 ? 822 HOH A O     1 
HETATM 4107 O  O     . HOH J 8 .   ? 73.350 -19.725 -2.715  1.00 22.53 ? 823 HOH A O     1 
HETATM 4108 O  O     . HOH J 8 .   ? 53.220 -0.116  11.975  1.00 33.06 ? 824 HOH A O     1 
HETATM 4109 O  O     . HOH J 8 .   ? 25.484 14.804  5.174   1.00 31.98 ? 825 HOH A O     1 
HETATM 4110 O  O     . HOH J 8 .   ? 55.493 -1.297  -14.767 1.00 33.07 ? 826 HOH A O     1 
HETATM 4111 O  O     . HOH J 8 .   ? 47.052 -38.314 4.403   1.00 32.39 ? 827 HOH A O     1 
HETATM 4112 O  O     . HOH J 8 .   ? 59.687 -31.567 3.773   1.00 34.70 ? 828 HOH A O     1 
HETATM 4113 O  O     . HOH J 8 .   ? 53.040 31.250  5.718   1.00 32.61 ? 829 HOH A O     1 
HETATM 4114 O  O     . HOH J 8 .   ? 76.757 -17.756 0.777   1.00 33.99 ? 830 HOH A O     1 
HETATM 4115 O  O     . HOH J 8 .   ? 62.182 -25.370 4.889   1.00 31.05 ? 831 HOH A O     1 
HETATM 4116 O  O     . HOH J 8 .   ? 33.934 3.091   2.903   1.00 30.43 ? 832 HOH A O     1 
HETATM 4117 O  O     . HOH J 8 .   ? 61.153 9.969   7.209   1.00 33.54 ? 833 HOH A O     1 
HETATM 4118 O  O     . HOH J 8 .   ? 38.178 10.430  9.657   1.00 31.02 ? 834 HOH A O     1 
HETATM 4119 O  O     . HOH J 8 .   ? 59.792 3.416   20.906  1.00 30.13 ? 835 HOH A O     1 
HETATM 4120 O  O     . HOH J 8 .   ? 67.657 6.422   0.539   1.00 31.28 ? 836 HOH A O     1 
HETATM 4121 O  O     . HOH J 8 .   ? 62.297 -13.235 -13.791 1.00 31.22 ? 837 HOH A O     1 
HETATM 4122 O  O     . HOH J 8 .   ? 50.570 -6.571  -5.308  1.00 39.22 ? 838 HOH A O     1 
HETATM 4123 O  O     . HOH J 8 .   ? 21.859 11.845  -9.655  1.00 30.72 ? 839 HOH A O     1 
HETATM 4124 O  O     . HOH J 8 .   ? 69.581 4.989   1.251   1.00 35.13 ? 840 HOH A O     1 
HETATM 4125 O  O     . HOH J 8 .   ? 38.890 -19.194 5.712   1.00 36.79 ? 841 HOH A O     1 
HETATM 4126 O  O     . HOH J 8 .   ? 51.733 11.694  -19.875 1.00 41.17 ? 842 HOH A O     1 
HETATM 4127 O  O     . HOH J 8 .   ? 50.738 0.194   -16.180 1.00 32.68 ? 843 HOH A O     1 
HETATM 4128 O  O     . HOH J 8 .   ? 47.868 0.055   10.076  1.00 37.15 ? 844 HOH A O     1 
HETATM 4129 O  O     . HOH J 8 .   ? 71.295 -12.130 14.505  1.00 36.60 ? 845 HOH A O     1 
HETATM 4130 O  O     . HOH J 8 .   ? 47.849 16.803  28.284  1.00 33.89 ? 846 HOH A O     1 
HETATM 4131 O  O     . HOH J 8 .   ? 57.562 3.104   18.037  1.00 29.08 ? 847 HOH A O     1 
HETATM 4132 O  O     . HOH J 8 .   ? 41.259 21.758  2.202   1.00 27.82 ? 848 HOH A O     1 
HETATM 4133 O  O     . HOH J 8 .   ? 33.193 10.814  8.768   1.00 40.14 ? 849 HOH A O     1 
HETATM 4134 O  O     . HOH J 8 .   ? 80.916 -4.611  23.016  1.00 47.82 ? 850 HOH A O     1 
HETATM 4135 O  O     . HOH J 8 .   ? 51.462 -29.487 16.422  1.00 36.94 ? 851 HOH A O     1 
HETATM 4136 O  O     . HOH J 8 .   ? 47.138 -22.777 17.368  1.00 30.64 ? 852 HOH A O     1 
HETATM 4137 O  O     . HOH J 8 .   ? 44.545 -16.950 -0.486  1.00 37.23 ? 853 HOH A O     1 
HETATM 4138 O  O     . HOH J 8 .   ? 61.958 7.807   15.908  1.00 33.76 ? 854 HOH A O     1 
HETATM 4139 O  O     . HOH J 8 .   ? 53.660 7.444   -14.734 1.00 36.58 ? 855 HOH A O     1 
HETATM 4140 O  O     . HOH J 8 .   ? 59.183 -29.705 12.286  1.00 28.76 ? 856 HOH A O     1 
HETATM 4141 O  O     . HOH J 8 .   ? 70.893 -21.610 0.861   1.00 32.42 ? 857 HOH A O     1 
HETATM 4142 O  O     . HOH J 8 .   ? 42.560 11.421  -25.653 1.00 41.02 ? 858 HOH A O     1 
HETATM 4143 O  O     . HOH J 8 .   ? 44.649 -23.395 17.807  1.00 35.35 ? 859 HOH A O     1 
HETATM 4144 O  O     . HOH J 8 .   ? 47.025 -8.704  -4.505  1.00 36.99 ? 860 HOH A O     1 
HETATM 4145 O  O     . HOH J 8 .   ? 63.081 -23.647 3.215   1.00 35.11 ? 861 HOH A O     1 
HETATM 4146 O  O     . HOH J 8 .   ? 59.226 27.059  7.717   1.00 35.43 ? 862 HOH A O     1 
HETATM 4147 O  O     . HOH J 8 .   ? 57.561 -19.152 22.158  1.00 33.60 ? 863 HOH A O     1 
HETATM 4148 O  O     . HOH J 8 .   ? 84.120 -8.093  0.706   1.00 41.97 ? 864 HOH A O     1 
HETATM 4149 O  O     . HOH J 8 .   ? 51.508 13.498  -11.503 1.00 31.40 ? 865 HOH A O     1 
HETATM 4150 O  O     . HOH J 8 .   ? 39.375 18.631  18.290  1.00 34.17 ? 866 HOH A O     1 
HETATM 4151 O  O     . HOH J 8 .   ? 82.536 -10.106 -0.753  1.00 37.93 ? 867 HOH A O     1 
HETATM 4152 O  O     . HOH J 8 .   ? 38.774 4.666   15.771  1.00 42.57 ? 868 HOH A O     1 
HETATM 4153 O  O     . HOH J 8 .   ? 29.572 12.749  6.971   1.00 37.81 ? 869 HOH A O     1 
HETATM 4154 O  O     . HOH J 8 .   ? 49.906 0.600   20.277  1.00 41.67 ? 870 HOH A O     1 
HETATM 4155 O  O     . HOH J 8 .   ? 43.164 -15.942 -2.633  1.00 40.87 ? 871 HOH A O     1 
HETATM 4156 O  O     . HOH J 8 .   ? 49.885 -16.097 -9.133  1.00 41.12 ? 872 HOH A O     1 
HETATM 4157 O  O     . HOH J 8 .   ? 59.794 15.224  -13.126 1.00 38.77 ? 873 HOH A O     1 
HETATM 4158 O  O     . HOH J 8 .   ? 67.469 6.572   9.831   1.00 34.24 ? 874 HOH A O     1 
HETATM 4159 O  O     . HOH J 8 .   ? 83.176 -13.848 -0.391  1.00 38.49 ? 875 HOH A O     1 
HETATM 4160 O  O     . HOH J 8 .   ? 51.895 -18.540 -9.032  1.00 36.64 ? 876 HOH A O     1 
HETATM 4161 O  O     . HOH J 8 .   ? 71.449 9.003   -6.449  1.00 33.74 ? 877 HOH A O     1 
HETATM 4162 O  O     . HOH J 8 .   ? 34.831 8.871   -22.217 1.00 40.03 ? 878 HOH A O     1 
HETATM 4163 O  O     . HOH J 8 .   ? 39.781 -22.652 3.006   1.00 38.66 ? 879 HOH A O     1 
HETATM 4164 O  O     . HOH J 8 .   ? 39.704 18.998  -15.125 1.00 32.12 ? 880 HOH A O     1 
HETATM 4165 O  O     . HOH J 8 .   ? 54.840 17.561  -12.021 1.00 40.83 ? 881 HOH A O     1 
HETATM 4166 O  O     . HOH J 8 .   ? 35.499 -1.714  -8.421  1.00 40.54 ? 882 HOH A O     1 
HETATM 4167 O  O     . HOH J 8 .   ? 51.837 -35.368 7.674   1.00 31.90 ? 883 HOH A O     1 
HETATM 4168 O  O     . HOH J 8 .   ? 60.307 9.686   22.474  1.00 40.01 ? 884 HOH A O     1 
HETATM 4169 O  O     . HOH J 8 .   ? 60.360 6.334   -15.721 1.00 34.45 ? 885 HOH A O     1 
HETATM 4170 O  O     . HOH J 8 .   ? 83.087 -4.518  -5.806  1.00 45.32 ? 886 HOH A O     1 
HETATM 4171 O  O     . HOH J 8 .   ? 69.926 -18.576 -10.065 1.00 42.45 ? 887 HOH A O     1 
HETATM 4172 O  O     . HOH J 8 .   ? 35.827 10.915  10.559  1.00 35.88 ? 888 HOH A O     1 
HETATM 4173 O  O     . HOH J 8 .   ? 39.769 4.707   18.266  1.00 42.42 ? 889 HOH A O     1 
HETATM 4174 O  O     . HOH J 8 .   ? 80.722 -4.098  13.898  1.00 42.64 ? 890 HOH A O     1 
HETATM 4175 O  O     . HOH J 8 .   ? 61.762 11.647  -12.280 1.00 37.92 ? 891 HOH A O     1 
HETATM 4176 O  O     . HOH J 8 .   ? 40.214 -18.128 -1.653  1.00 46.47 ? 892 HOH A O     1 
HETATM 4177 O  O     . HOH J 8 .   ? 59.421 -18.391 -10.105 1.00 44.21 ? 893 HOH A O     1 
HETATM 4178 O  O     . HOH J 8 .   ? 54.656 -33.914 12.784  1.00 34.15 ? 894 HOH A O     1 
HETATM 4179 O  O     . HOH J 8 .   ? 51.165 4.304   -20.533 1.00 42.27 ? 895 HOH A O     1 
HETATM 4180 O  O     . HOH J 8 .   ? 83.135 -11.044 9.661   1.00 41.13 ? 896 HOH A O     1 
HETATM 4181 O  O     . HOH J 8 .   ? 53.461 -8.370  8.747   1.00 31.52 ? 897 HOH A O     1 
HETATM 4182 O  O     . HOH J 8 .   ? 50.748 5.589   -23.193 1.00 41.07 ? 898 HOH A O     1 
HETATM 4183 O  O     . HOH J 8 .   ? 76.118 -19.881 -1.752  1.00 44.45 ? 899 HOH A O     1 
HETATM 4184 O  O     . HOH J 8 .   ? 64.461 -15.350 14.022  1.00 38.27 ? 900 HOH A O     1 
HETATM 4185 O  O     . HOH J 8 .   ? 40.947 -30.060 13.398  1.00 38.67 ? 901 HOH A O     1 
HETATM 4186 O  O     . HOH J 8 .   ? 40.822 -18.257 1.005   1.00 37.07 ? 902 HOH A O     1 
HETATM 4187 O  O     . HOH J 8 .   ? 61.959 8.893   18.712  1.00 36.57 ? 903 HOH A O     1 
HETATM 4188 O  O     . HOH J 8 .   ? 69.784 9.957   -8.862  1.00 31.96 ? 904 HOH A O     1 
HETATM 4189 O  O     . HOH J 8 .   ? 71.800 5.376   -10.332 1.00 39.77 ? 905 HOH A O     1 
HETATM 4190 O  O     . HOH J 8 .   ? 85.502 -19.675 -0.282  1.00 46.11 ? 906 HOH A O     1 
HETATM 4191 O  O     . HOH J 8 .   ? 44.851 6.559   -3.671  1.00 39.81 ? 907 HOH A O     1 
HETATM 4192 O  O     . HOH J 8 .   ? 48.274 -39.051 6.753   1.00 45.75 ? 908 HOH A O     1 
HETATM 4193 O  O     . HOH J 8 .   ? 37.181 18.714  16.828  1.00 41.21 ? 909 HOH A O     1 
HETATM 4194 O  O     . HOH J 8 .   ? 72.409 3.090   -11.122 1.00 33.85 ? 910 HOH A O     1 
HETATM 4195 O  O     . HOH J 8 .   ? 73.560 9.142   -4.408  1.00 41.31 ? 911 HOH A O     1 
HETATM 4196 O  O     . HOH J 8 .   ? 41.723 15.298  -23.221 1.00 32.95 ? 912 HOH A O     1 
HETATM 4197 O  O     . HOH J 8 .   ? 35.441 22.581  -3.253  1.00 40.73 ? 913 HOH A O     1 
HETATM 4198 O  O     . HOH J 8 .   ? 83.013 -3.086  -3.810  1.00 41.17 ? 914 HOH A O     1 
HETATM 4199 O  O     . HOH J 8 .   ? 60.195 -33.301 1.762   1.00 43.34 ? 915 HOH A O     1 
HETATM 4200 O  O     . HOH J 8 .   ? 69.264 7.741   3.772   1.00 39.10 ? 916 HOH A O     1 
HETATM 4201 O  O     . HOH J 8 .   ? 40.623 -29.415 -2.223  1.00 36.49 ? 917 HOH A O     1 
HETATM 4202 O  O     . HOH J 8 .   ? 52.669 3.500   17.806  1.00 31.90 ? 918 HOH A O     1 
HETATM 4203 O  O     . HOH J 8 .   ? 38.791 -19.965 12.670  1.00 36.28 ? 919 HOH A O     1 
HETATM 4204 O  O     . HOH J 8 .   ? 39.171 -2.032  -14.146 1.00 37.75 ? 920 HOH A O     1 
HETATM 4205 O  O     . HOH J 8 .   ? 31.062 21.885  -3.435  1.00 39.12 ? 921 HOH A O     1 
HETATM 4206 O  O     . HOH J 8 .   ? 20.240 17.805  -5.269  1.00 40.58 ? 922 HOH A O     1 
HETATM 4207 O  O     . HOH J 8 .   ? 70.097 6.991   -12.075 1.00 40.92 ? 923 HOH A O     1 
HETATM 4208 O  O     . HOH J 8 .   ? 44.826 -33.141 -3.015  1.00 35.39 ? 924 HOH A O     1 
HETATM 4209 O  O     . HOH J 8 .   ? 43.259 -25.672 17.491  1.00 38.80 ? 925 HOH A O     1 
HETATM 4210 O  O     . HOH J 8 .   ? 73.274 10.433  -7.318  1.00 39.87 ? 926 HOH A O     1 
HETATM 4211 O  O     . HOH J 8 .   ? 56.014 -33.321 2.392   1.00 43.90 ? 927 HOH A O     1 
HETATM 4212 O  O     . HOH J 8 .   ? 28.362 14.525  5.006   1.00 35.50 ? 928 HOH A O     1 
HETATM 4213 O  O     . HOH J 8 .   ? 85.383 -9.660  7.924   1.00 45.86 ? 929 HOH A O     1 
HETATM 4214 O  O     . HOH J 8 .   ? 17.762 -3.110  -6.152  1.00 50.32 ? 930 HOH A O     1 
HETATM 4215 O  O     . HOH J 8 .   ? 57.617 5.632   -15.685 1.00 40.39 ? 931 HOH A O     1 
HETATM 4216 O  O     . HOH J 8 .   ? 28.781 23.159  -4.687  1.00 41.35 ? 932 HOH A O     1 
HETATM 4217 O  O     . HOH J 8 .   ? 61.622 4.581   18.993  1.00 42.65 ? 933 HOH A O     1 
HETATM 4218 O  O     . HOH J 8 .   ? 47.445 -4.775  -16.232 1.00 32.79 ? 934 HOH A O     1 
HETATM 4219 O  O     . HOH J 8 .   ? 53.326 5.230   -17.164 1.00 41.93 ? 935 HOH A O     1 
HETATM 4220 O  O     . HOH J 8 .   ? 42.314 5.310   21.193  1.00 43.38 ? 936 HOH A O     1 
HETATM 4221 O  O     . HOH J 8 .   ? 65.895 -22.435 -7.984  1.00 35.92 ? 937 HOH A O     1 
HETATM 4222 O  O     . HOH J 8 .   ? 34.569 13.898  21.944  1.00 41.65 ? 938 HOH A O     1 
HETATM 4223 O  O     . HOH J 8 .   ? 65.966 -4.212  -15.352 1.00 29.53 ? 939 HOH A O     1 
HETATM 4224 O  O     . HOH J 8 .   ? 84.034 -5.164  2.522   1.00 32.49 ? 940 HOH A O     1 
HETATM 4225 O  O     . HOH J 8 .   ? 85.304 -18.238 2.008   1.00 49.99 ? 941 HOH A O     1 
HETATM 4226 O  O     . HOH J 8 .   ? 60.884 -23.391 6.467   1.00 24.47 ? 942 HOH A O     1 
HETATM 4227 O  O     . HOH J 8 .   ? 52.399 -10.007 -2.920  1.00 33.38 ? 943 HOH A O     1 
HETATM 4228 O  O     . HOH J 8 .   ? 49.415 -10.132 6.742   1.00 24.51 ? 944 HOH A O     1 
HETATM 4229 O  O     . HOH K 8 .   ? 40.697 11.410  -3.461  1.00 18.30 ? 101 HOH T O     1 
HETATM 4230 O  O     . HOH K 8 .   ? 35.146 5.512   2.035   1.00 21.32 ? 102 HOH T O     1 
HETATM 4231 O  O     . HOH K 8 .   ? 41.907 8.291   3.187   1.00 20.12 ? 103 HOH T O     1 
HETATM 4232 O  O     . HOH K 8 .   ? 40.873 -3.528  -9.377  1.00 27.94 ? 104 HOH T O     1 
HETATM 4233 O  O     . HOH K 8 .   ? 42.128 -7.263  -10.543 1.00 33.41 ? 105 HOH T O     1 
HETATM 4234 O  O     . HOH K 8 .   ? 38.581 -2.468  -6.635  1.00 33.89 ? 106 HOH T O     1 
HETATM 4235 O  O     . HOH K 8 .   ? 36.887 -23.042 -5.429  1.00 34.69 ? 107 HOH T O     1 
HETATM 4236 O  O     . HOH K 8 .   ? 37.485 -0.011  4.603   1.00 32.10 ? 108 HOH T O     1 
HETATM 4237 O  O     . HOH K 8 .   ? 41.793 -20.140 -3.546  1.00 34.99 ? 109 HOH T O     1 
HETATM 4238 O  O     . HOH K 8 .   ? 31.913 14.166  10.868  1.00 41.67 ? 110 HOH T O     1 
HETATM 4239 O  O     . HOH K 8 .   ? 36.258 2.433   4.769   1.00 29.83 ? 111 HOH T O     1 
HETATM 4240 O  O     . HOH K 8 .   ? 36.543 -1.916  -0.975  1.00 34.11 ? 112 HOH T O     1 
HETATM 4241 O  O     . HOH K 8 .   ? 43.474 5.335   -9.150  1.00 31.95 ? 113 HOH T O     1 
HETATM 4242 O  O     . HOH K 8 .   ? 44.309 -8.525  -3.679  1.00 30.58 ? 114 HOH T O     1 
HETATM 4243 O  O     . HOH K 8 .   ? 40.389 -0.561  8.004   1.00 39.48 ? 115 HOH T O     1 
HETATM 4244 O  O     . HOH K 8 .   ? 45.447 -5.178  -2.976  1.00 34.02 ? 116 HOH T O     1 
HETATM 4245 O  O     . HOH K 8 .   ? 38.969 2.272   -7.085  1.00 38.16 ? 117 HOH T O     1 
HETATM 4246 O  O     . HOH K 8 .   ? 43.642 5.672   0.324   1.00 28.85 ? 118 HOH T O     1 
HETATM 4247 O  O     . HOH K 8 .   ? 45.098 -2.605  -3.711  1.00 32.94 ? 119 HOH T O     1 
HETATM 4248 O  O     . HOH K 8 .   ? 37.670 -12.831 -11.164 1.00 33.89 ? 120 HOH T O     1 
HETATM 4249 O  O     . HOH K 8 .   ? 30.684 4.797   8.730   1.00 45.23 ? 121 HOH T O     1 
HETATM 4250 O  O     . HOH K 8 .   ? 38.897 -10.138 -10.231 1.00 32.94 ? 122 HOH T O     1 
HETATM 4251 O  O     . HOH K 8 .   ? 36.491 -3.040  -4.330  1.00 38.72 ? 123 HOH T O     1 
HETATM 4252 O  O     . HOH K 8 .   ? 34.749 6.028   17.854  1.00 45.12 ? 124 HOH T O     1 
HETATM 4253 O  O     . HOH K 8 .   ? 36.758 -8.569  -10.089 1.00 41.09 ? 125 HOH T O     1 
HETATM 4254 O  O     . HOH L 8 .   ? 43.680 -14.522 5.756   1.00 17.31 ? 101 HOH P O     1 
HETATM 4255 O  O     . HOH L 8 .   ? 46.327 3.675   1.014   1.00 31.89 ? 102 HOH P O     1 
HETATM 4256 O  O     . HOH L 8 .   ? 42.844 -9.043  7.138   1.00 23.91 ? 103 HOH P O     1 
HETATM 4257 O  O     . HOH L 8 .   ? 41.610 -15.708 1.907   1.00 28.09 ? 104 HOH P O     1 
HETATM 4258 O  O     . HOH L 8 .   ? 46.308 -2.493  -0.651  1.00 24.44 ? 105 HOH P O     1 
HETATM 4259 O  O     . HOH L 8 .   ? 45.974 -10.699 -0.164  1.00 29.34 ? 106 HOH P O     1 
HETATM 4260 O  O     . HOH L 8 .   ? 44.116 -12.908 -0.224  1.00 22.72 ? 107 HOH P O     1 
HETATM 4261 O  O     . HOH L 8 .   ? 41.812 -11.750 -0.979  1.00 26.59 ? 108 HOH P O     1 
HETATM 4262 O  O     . HOH L 8 .   ? 40.429 -5.282  5.684   1.00 29.54 ? 109 HOH P O     1 
HETATM 4263 O  O     . HOH L 8 .   ? 32.427 -7.346  -11.645 1.00 34.02 ? 110 HOH P O     1 
HETATM 4264 O  O     . HOH L 8 .   ? 40.301 -9.162  5.927   1.00 30.82 ? 111 HOH P O     1 
HETATM 4265 O  O     . HOH L 8 .   ? 34.926 -4.508  -1.018  1.00 32.86 ? 112 HOH P O     1 
HETATM 4266 O  O     . HOH L 8 .   ? 47.831 -2.056  7.303   1.00 31.13 ? 113 HOH P O     1 
HETATM 4267 O  O     . HOH L 8 .   ? 38.313 -10.816 6.503   1.00 34.28 ? 114 HOH P O     1 
HETATM 4268 O  O     . HOH L 8 .   ? 34.660 -9.238  -11.494 1.00 46.24 ? 115 HOH P O     1 
HETATM 4269 O  O     . HOH L 8 .   ? 36.517 -4.592  3.299   1.00 39.84 ? 116 HOH P O     1 
HETATM 4270 O  O     . HOH L 8 .   ? 40.137 -14.029 0.038   1.00 40.61 ? 117 HOH P O     1 
HETATM 4271 O  O     . HOH L 8 .   ? 44.825 -8.161  -0.963  1.00 27.95 ? 118 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NA  1   501 116 NA  NA  A . 
E 5 CA  1   503 502 CA  CA  A . 
F 6 GOL 1   504 436 GOL GOL A . 
G 6 GOL 1   505 437 GOL GOL A . 
H 6 GOL 1   506 438 GOL GOL A . 
I 7 DTP 1   502 9   DTP DTP P . 
J 8 HOH 1   601 1   HOH HOH A . 
J 8 HOH 2   602 3   HOH HOH A . 
J 8 HOH 3   603 4   HOH HOH A . 
J 8 HOH 4   604 5   HOH HOH A . 
J 8 HOH 5   605 6   HOH HOH A . 
J 8 HOH 6   606 7   HOH HOH A . 
J 8 HOH 7   607 8   HOH HOH A . 
J 8 HOH 8   608 9   HOH HOH A . 
J 8 HOH 9   609 10  HOH HOH A . 
J 8 HOH 10  610 12  HOH HOH A . 
J 8 HOH 11  611 13  HOH HOH A . 
J 8 HOH 12  612 14  HOH HOH A . 
J 8 HOH 13  613 15  HOH HOH A . 
J 8 HOH 14  614 16  HOH HOH A . 
J 8 HOH 15  615 17  HOH HOH A . 
J 8 HOH 16  616 18  HOH HOH A . 
J 8 HOH 17  617 19  HOH HOH A . 
J 8 HOH 18  618 20  HOH HOH A . 
J 8 HOH 19  619 21  HOH HOH A . 
J 8 HOH 20  620 22  HOH HOH A . 
J 8 HOH 21  621 23  HOH HOH A . 
J 8 HOH 22  622 24  HOH HOH A . 
J 8 HOH 23  623 25  HOH HOH A . 
J 8 HOH 24  624 26  HOH HOH A . 
J 8 HOH 25  625 28  HOH HOH A . 
J 8 HOH 26  626 30  HOH HOH A . 
J 8 HOH 27  627 31  HOH HOH A . 
J 8 HOH 28  628 32  HOH HOH A . 
J 8 HOH 29  629 33  HOH HOH A . 
J 8 HOH 30  630 34  HOH HOH A . 
J 8 HOH 31  631 35  HOH HOH A . 
J 8 HOH 32  632 37  HOH HOH A . 
J 8 HOH 33  633 38  HOH HOH A . 
J 8 HOH 34  634 39  HOH HOH A . 
J 8 HOH 35  635 40  HOH HOH A . 
J 8 HOH 36  636 41  HOH HOH A . 
J 8 HOH 37  637 42  HOH HOH A . 
J 8 HOH 38  638 43  HOH HOH A . 
J 8 HOH 39  639 44  HOH HOH A . 
J 8 HOH 40  640 45  HOH HOH A . 
J 8 HOH 41  641 46  HOH HOH A . 
J 8 HOH 42  642 47  HOH HOH A . 
J 8 HOH 43  643 48  HOH HOH A . 
J 8 HOH 44  644 49  HOH HOH A . 
J 8 HOH 45  645 50  HOH HOH A . 
J 8 HOH 46  646 51  HOH HOH A . 
J 8 HOH 47  647 52  HOH HOH A . 
J 8 HOH 48  648 53  HOH HOH A . 
J 8 HOH 49  649 54  HOH HOH A . 
J 8 HOH 50  650 55  HOH HOH A . 
J 8 HOH 51  651 56  HOH HOH A . 
J 8 HOH 52  652 57  HOH HOH A . 
J 8 HOH 53  653 58  HOH HOH A . 
J 8 HOH 54  654 59  HOH HOH A . 
J 8 HOH 55  655 60  HOH HOH A . 
J 8 HOH 56  656 61  HOH HOH A . 
J 8 HOH 57  657 62  HOH HOH A . 
J 8 HOH 58  658 63  HOH HOH A . 
J 8 HOH 59  659 64  HOH HOH A . 
J 8 HOH 60  660 66  HOH HOH A . 
J 8 HOH 61  661 67  HOH HOH A . 
J 8 HOH 62  662 68  HOH HOH A . 
J 8 HOH 63  663 70  HOH HOH A . 
J 8 HOH 64  664 71  HOH HOH A . 
J 8 HOH 65  665 72  HOH HOH A . 
J 8 HOH 66  666 73  HOH HOH A . 
J 8 HOH 67  667 75  HOH HOH A . 
J 8 HOH 68  668 76  HOH HOH A . 
J 8 HOH 69  669 77  HOH HOH A . 
J 8 HOH 70  670 78  HOH HOH A . 
J 8 HOH 71  671 80  HOH HOH A . 
J 8 HOH 72  672 81  HOH HOH A . 
J 8 HOH 73  673 82  HOH HOH A . 
J 8 HOH 74  674 83  HOH HOH A . 
J 8 HOH 75  675 84  HOH HOH A . 
J 8 HOH 76  676 85  HOH HOH A . 
J 8 HOH 77  677 87  HOH HOH A . 
J 8 HOH 78  678 88  HOH HOH A . 
J 8 HOH 79  679 89  HOH HOH A . 
J 8 HOH 80  680 90  HOH HOH A . 
J 8 HOH 81  681 91  HOH HOH A . 
J 8 HOH 82  682 92  HOH HOH A . 
J 8 HOH 83  683 93  HOH HOH A . 
J 8 HOH 84  684 94  HOH HOH A . 
J 8 HOH 85  685 95  HOH HOH A . 
J 8 HOH 86  686 96  HOH HOH A . 
J 8 HOH 87  687 97  HOH HOH A . 
J 8 HOH 88  688 98  HOH HOH A . 
J 8 HOH 89  689 99  HOH HOH A . 
J 8 HOH 90  690 100 HOH HOH A . 
J 8 HOH 91  691 101 HOH HOH A . 
J 8 HOH 92  692 102 HOH HOH A . 
J 8 HOH 93  693 103 HOH HOH A . 
J 8 HOH 94  694 104 HOH HOH A . 
J 8 HOH 95  695 105 HOH HOH A . 
J 8 HOH 96  696 106 HOH HOH A . 
J 8 HOH 97  697 107 HOH HOH A . 
J 8 HOH 98  698 108 HOH HOH A . 
J 8 HOH 99  699 109 HOH HOH A . 
J 8 HOH 100 700 110 HOH HOH A . 
J 8 HOH 101 701 111 HOH HOH A . 
J 8 HOH 102 702 113 HOH HOH A . 
J 8 HOH 103 703 114 HOH HOH A . 
J 8 HOH 104 704 115 HOH HOH A . 
J 8 HOH 105 705 116 HOH HOH A . 
J 8 HOH 106 706 117 HOH HOH A . 
J 8 HOH 107 707 120 HOH HOH A . 
J 8 HOH 108 708 121 HOH HOH A . 
J 8 HOH 109 709 122 HOH HOH A . 
J 8 HOH 110 710 124 HOH HOH A . 
J 8 HOH 111 711 125 HOH HOH A . 
J 8 HOH 112 712 127 HOH HOH A . 
J 8 HOH 113 713 128 HOH HOH A . 
J 8 HOH 114 714 129 HOH HOH A . 
J 8 HOH 115 715 130 HOH HOH A . 
J 8 HOH 116 716 131 HOH HOH A . 
J 8 HOH 117 717 132 HOH HOH A . 
J 8 HOH 118 718 134 HOH HOH A . 
J 8 HOH 119 719 135 HOH HOH A . 
J 8 HOH 120 720 136 HOH HOH A . 
J 8 HOH 121 721 137 HOH HOH A . 
J 8 HOH 122 722 138 HOH HOH A . 
J 8 HOH 123 723 140 HOH HOH A . 
J 8 HOH 124 724 141 HOH HOH A . 
J 8 HOH 125 725 142 HOH HOH A . 
J 8 HOH 126 726 143 HOH HOH A . 
J 8 HOH 127 727 144 HOH HOH A . 
J 8 HOH 128 728 145 HOH HOH A . 
J 8 HOH 129 729 146 HOH HOH A . 
J 8 HOH 130 730 147 HOH HOH A . 
J 8 HOH 131 731 148 HOH HOH A . 
J 8 HOH 132 732 149 HOH HOH A . 
J 8 HOH 133 733 150 HOH HOH A . 
J 8 HOH 134 734 151 HOH HOH A . 
J 8 HOH 135 735 153 HOH HOH A . 
J 8 HOH 136 736 155 HOH HOH A . 
J 8 HOH 137 737 156 HOH HOH A . 
J 8 HOH 138 738 157 HOH HOH A . 
J 8 HOH 139 739 158 HOH HOH A . 
J 8 HOH 140 740 159 HOH HOH A . 
J 8 HOH 141 741 160 HOH HOH A . 
J 8 HOH 142 742 161 HOH HOH A . 
J 8 HOH 143 743 162 HOH HOH A . 
J 8 HOH 144 744 164 HOH HOH A . 
J 8 HOH 145 745 165 HOH HOH A . 
J 8 HOH 146 746 167 HOH HOH A . 
J 8 HOH 147 747 168 HOH HOH A . 
J 8 HOH 148 748 171 HOH HOH A . 
J 8 HOH 149 749 172 HOH HOH A . 
J 8 HOH 150 750 173 HOH HOH A . 
J 8 HOH 151 751 174 HOH HOH A . 
J 8 HOH 152 752 175 HOH HOH A . 
J 8 HOH 153 753 176 HOH HOH A . 
J 8 HOH 154 754 177 HOH HOH A . 
J 8 HOH 155 755 178 HOH HOH A . 
J 8 HOH 156 756 179 HOH HOH A . 
J 8 HOH 157 757 182 HOH HOH A . 
J 8 HOH 158 758 183 HOH HOH A . 
J 8 HOH 159 759 184 HOH HOH A . 
J 8 HOH 160 760 185 HOH HOH A . 
J 8 HOH 161 761 186 HOH HOH A . 
J 8 HOH 162 762 188 HOH HOH A . 
J 8 HOH 163 763 189 HOH HOH A . 
J 8 HOH 164 764 190 HOH HOH A . 
J 8 HOH 165 765 191 HOH HOH A . 
J 8 HOH 166 766 192 HOH HOH A . 
J 8 HOH 167 767 193 HOH HOH A . 
J 8 HOH 168 768 194 HOH HOH A . 
J 8 HOH 169 769 195 HOH HOH A . 
J 8 HOH 170 770 196 HOH HOH A . 
J 8 HOH 171 771 197 HOH HOH A . 
J 8 HOH 172 772 198 HOH HOH A . 
J 8 HOH 173 773 199 HOH HOH A . 
J 8 HOH 174 774 200 HOH HOH A . 
J 8 HOH 175 775 201 HOH HOH A . 
J 8 HOH 176 776 202 HOH HOH A . 
J 8 HOH 177 777 204 HOH HOH A . 
J 8 HOH 178 778 205 HOH HOH A . 
J 8 HOH 179 779 206 HOH HOH A . 
J 8 HOH 180 780 207 HOH HOH A . 
J 8 HOH 181 781 208 HOH HOH A . 
J 8 HOH 182 782 209 HOH HOH A . 
J 8 HOH 183 783 210 HOH HOH A . 
J 8 HOH 184 784 211 HOH HOH A . 
J 8 HOH 185 785 212 HOH HOH A . 
J 8 HOH 186 786 214 HOH HOH A . 
J 8 HOH 187 787 216 HOH HOH A . 
J 8 HOH 188 788 217 HOH HOH A . 
J 8 HOH 189 789 218 HOH HOH A . 
J 8 HOH 190 790 219 HOH HOH A . 
J 8 HOH 191 791 220 HOH HOH A . 
J 8 HOH 192 792 221 HOH HOH A . 
J 8 HOH 193 793 222 HOH HOH A . 
J 8 HOH 194 794 223 HOH HOH A . 
J 8 HOH 195 795 224 HOH HOH A . 
J 8 HOH 196 796 225 HOH HOH A . 
J 8 HOH 197 797 226 HOH HOH A . 
J 8 HOH 198 798 227 HOH HOH A . 
J 8 HOH 199 799 228 HOH HOH A . 
J 8 HOH 200 800 229 HOH HOH A . 
J 8 HOH 201 801 232 HOH HOH A . 
J 8 HOH 202 802 233 HOH HOH A . 
J 8 HOH 203 803 234 HOH HOH A . 
J 8 HOH 204 804 235 HOH HOH A . 
J 8 HOH 205 805 236 HOH HOH A . 
J 8 HOH 206 806 237 HOH HOH A . 
J 8 HOH 207 807 238 HOH HOH A . 
J 8 HOH 208 808 241 HOH HOH A . 
J 8 HOH 209 809 242 HOH HOH A . 
J 8 HOH 210 810 243 HOH HOH A . 
J 8 HOH 211 811 245 HOH HOH A . 
J 8 HOH 212 812 246 HOH HOH A . 
J 8 HOH 213 813 248 HOH HOH A . 
J 8 HOH 214 814 250 HOH HOH A . 
J 8 HOH 215 815 251 HOH HOH A . 
J 8 HOH 216 816 252 HOH HOH A . 
J 8 HOH 217 817 253 HOH HOH A . 
J 8 HOH 218 818 255 HOH HOH A . 
J 8 HOH 219 819 256 HOH HOH A . 
J 8 HOH 220 820 257 HOH HOH A . 
J 8 HOH 221 821 258 HOH HOH A . 
J 8 HOH 222 822 259 HOH HOH A . 
J 8 HOH 223 823 260 HOH HOH A . 
J 8 HOH 224 824 261 HOH HOH A . 
J 8 HOH 225 825 262 HOH HOH A . 
J 8 HOH 226 826 264 HOH HOH A . 
J 8 HOH 227 827 265 HOH HOH A . 
J 8 HOH 228 828 266 HOH HOH A . 
J 8 HOH 229 829 267 HOH HOH A . 
J 8 HOH 230 830 268 HOH HOH A . 
J 8 HOH 231 831 269 HOH HOH A . 
J 8 HOH 232 832 270 HOH HOH A . 
J 8 HOH 233 833 271 HOH HOH A . 
J 8 HOH 234 834 272 HOH HOH A . 
J 8 HOH 235 835 273 HOH HOH A . 
J 8 HOH 236 836 274 HOH HOH A . 
J 8 HOH 237 837 275 HOH HOH A . 
J 8 HOH 238 838 276 HOH HOH A . 
J 8 HOH 239 839 277 HOH HOH A . 
J 8 HOH 240 840 278 HOH HOH A . 
J 8 HOH 241 841 280 HOH HOH A . 
J 8 HOH 242 842 281 HOH HOH A . 
J 8 HOH 243 843 282 HOH HOH A . 
J 8 HOH 244 844 283 HOH HOH A . 
J 8 HOH 245 845 284 HOH HOH A . 
J 8 HOH 246 846 285 HOH HOH A . 
J 8 HOH 247 847 287 HOH HOH A . 
J 8 HOH 248 848 288 HOH HOH A . 
J 8 HOH 249 849 289 HOH HOH A . 
J 8 HOH 250 850 291 HOH HOH A . 
J 8 HOH 251 851 292 HOH HOH A . 
J 8 HOH 252 852 293 HOH HOH A . 
J 8 HOH 253 853 294 HOH HOH A . 
J 8 HOH 254 854 295 HOH HOH A . 
J 8 HOH 255 855 296 HOH HOH A . 
J 8 HOH 256 856 297 HOH HOH A . 
J 8 HOH 257 857 298 HOH HOH A . 
J 8 HOH 258 858 301 HOH HOH A . 
J 8 HOH 259 859 302 HOH HOH A . 
J 8 HOH 260 860 303 HOH HOH A . 
J 8 HOH 261 861 304 HOH HOH A . 
J 8 HOH 262 862 305 HOH HOH A . 
J 8 HOH 263 863 307 HOH HOH A . 
J 8 HOH 264 864 308 HOH HOH A . 
J 8 HOH 265 865 309 HOH HOH A . 
J 8 HOH 266 866 310 HOH HOH A . 
J 8 HOH 267 867 311 HOH HOH A . 
J 8 HOH 268 868 312 HOH HOH A . 
J 8 HOH 269 869 313 HOH HOH A . 
J 8 HOH 270 870 314 HOH HOH A . 
J 8 HOH 271 871 315 HOH HOH A . 
J 8 HOH 272 872 316 HOH HOH A . 
J 8 HOH 273 873 317 HOH HOH A . 
J 8 HOH 274 874 318 HOH HOH A . 
J 8 HOH 275 875 321 HOH HOH A . 
J 8 HOH 276 876 322 HOH HOH A . 
J 8 HOH 277 877 324 HOH HOH A . 
J 8 HOH 278 878 325 HOH HOH A . 
J 8 HOH 279 879 326 HOH HOH A . 
J 8 HOH 280 880 327 HOH HOH A . 
J 8 HOH 281 881 328 HOH HOH A . 
J 8 HOH 282 882 329 HOH HOH A . 
J 8 HOH 283 883 331 HOH HOH A . 
J 8 HOH 284 884 332 HOH HOH A . 
J 8 HOH 285 885 333 HOH HOH A . 
J 8 HOH 286 886 334 HOH HOH A . 
J 8 HOH 287 887 335 HOH HOH A . 
J 8 HOH 288 888 337 HOH HOH A . 
J 8 HOH 289 889 339 HOH HOH A . 
J 8 HOH 290 890 341 HOH HOH A . 
J 8 HOH 291 891 345 HOH HOH A . 
J 8 HOH 292 892 346 HOH HOH A . 
J 8 HOH 293 893 347 HOH HOH A . 
J 8 HOH 294 894 350 HOH HOH A . 
J 8 HOH 295 895 351 HOH HOH A . 
J 8 HOH 296 896 352 HOH HOH A . 
J 8 HOH 297 897 353 HOH HOH A . 
J 8 HOH 298 898 354 HOH HOH A . 
J 8 HOH 299 899 356 HOH HOH A . 
J 8 HOH 300 900 358 HOH HOH A . 
J 8 HOH 301 901 359 HOH HOH A . 
J 8 HOH 302 902 360 HOH HOH A . 
J 8 HOH 303 903 361 HOH HOH A . 
J 8 HOH 304 904 362 HOH HOH A . 
J 8 HOH 305 905 363 HOH HOH A . 
J 8 HOH 306 906 364 HOH HOH A . 
J 8 HOH 307 907 365 HOH HOH A . 
J 8 HOH 308 908 366 HOH HOH A . 
J 8 HOH 309 909 367 HOH HOH A . 
J 8 HOH 310 910 368 HOH HOH A . 
J 8 HOH 311 911 369 HOH HOH A . 
J 8 HOH 312 912 370 HOH HOH A . 
J 8 HOH 313 913 372 HOH HOH A . 
J 8 HOH 314 914 373 HOH HOH A . 
J 8 HOH 315 915 374 HOH HOH A . 
J 8 HOH 316 916 375 HOH HOH A . 
J 8 HOH 317 917 377 HOH HOH A . 
J 8 HOH 318 918 379 HOH HOH A . 
J 8 HOH 319 919 380 HOH HOH A . 
J 8 HOH 320 920 381 HOH HOH A . 
J 8 HOH 321 921 382 HOH HOH A . 
J 8 HOH 322 922 383 HOH HOH A . 
J 8 HOH 323 923 384 HOH HOH A . 
J 8 HOH 324 924 385 HOH HOH A . 
J 8 HOH 325 925 386 HOH HOH A . 
J 8 HOH 326 926 387 HOH HOH A . 
J 8 HOH 327 927 388 HOH HOH A . 
J 8 HOH 328 928 389 HOH HOH A . 
J 8 HOH 329 929 391 HOH HOH A . 
J 8 HOH 330 930 392 HOH HOH A . 
J 8 HOH 331 931 393 HOH HOH A . 
J 8 HOH 332 932 394 HOH HOH A . 
J 8 HOH 333 933 395 HOH HOH A . 
J 8 HOH 334 934 397 HOH HOH A . 
J 8 HOH 335 935 398 HOH HOH A . 
J 8 HOH 336 936 399 HOH HOH A . 
J 8 HOH 337 937 402 HOH HOH A . 
J 8 HOH 338 938 403 HOH HOH A . 
J 8 HOH 339 939 404 HOH HOH A . 
J 8 HOH 340 940 405 HOH HOH A . 
J 8 HOH 341 941 406 HOH HOH A . 
J 8 HOH 342 942 407 HOH HOH A . 
J 8 HOH 343 943 408 HOH HOH A . 
J 8 HOH 344 944 118 HOH HOH A . 
K 8 HOH 1   101 11  HOH HOH T . 
K 8 HOH 2   102 27  HOH HOH T . 
K 8 HOH 3   103 29  HOH HOH T . 
K 8 HOH 4   104 36  HOH HOH T . 
K 8 HOH 5   105 74  HOH HOH T . 
K 8 HOH 6   106 119 HOH HOH T . 
K 8 HOH 7   107 126 HOH HOH T . 
K 8 HOH 8   108 154 HOH HOH T . 
K 8 HOH 9   109 170 HOH HOH T . 
K 8 HOH 10  110 180 HOH HOH T . 
K 8 HOH 11  111 181 HOH HOH T . 
K 8 HOH 12  112 187 HOH HOH T . 
K 8 HOH 13  113 203 HOH HOH T . 
K 8 HOH 14  114 213 HOH HOH T . 
K 8 HOH 15  115 230 HOH HOH T . 
K 8 HOH 16  116 244 HOH HOH T . 
K 8 HOH 17  117 249 HOH HOH T . 
K 8 HOH 18  118 263 HOH HOH T . 
K 8 HOH 19  119 279 HOH HOH T . 
K 8 HOH 20  120 286 HOH HOH T . 
K 8 HOH 21  121 290 HOH HOH T . 
K 8 HOH 22  122 299 HOH HOH T . 
K 8 HOH 23  123 319 HOH HOH T . 
K 8 HOH 24  124 320 HOH HOH T . 
K 8 HOH 25  125 336 HOH HOH T . 
L 8 HOH 1   101 2   HOH HOH P . 
L 8 HOH 2   102 65  HOH HOH P . 
L 8 HOH 3   103 69  HOH HOH P . 
L 8 HOH 4   104 79  HOH HOH P . 
L 8 HOH 5   105 86  HOH HOH P . 
L 8 HOH 6   106 112 HOH HOH P . 
L 8 HOH 7   107 123 HOH HOH P . 
L 8 HOH 8   108 133 HOH HOH P . 
L 8 HOH 9   109 139 HOH HOH P . 
L 8 HOH 10  110 163 HOH HOH P . 
L 8 HOH 11  111 166 HOH HOH P . 
L 8 HOH 12  112 239 HOH HOH P . 
L 8 HOH 13  113 240 HOH HOH P . 
L 8 HOH 14  114 247 HOH HOH P . 
L 8 HOH 15  115 254 HOH HOH P . 
L 8 HOH 16  116 300 HOH HOH P . 
L 8 HOH 17  117 330 HOH HOH P . 
L 8 HOH 18  118 371 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5740  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  22140 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 90.8  ? 
2  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 96.8  ? 
3  "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 85.4  ? 
4  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OE1   B A GLU 119 ? A GLU 116 ? 1_555 109.2 ? 
5  "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OE1   B A GLU 119 ? A GLU 116 ? 1_555 77.9  ? 
6  O2A   ? I DTP .   ? P DTP 502 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OE1   B A GLU 119 ? A GLU 116 ? 1_555 149.1 ? 
7  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 85.4  ? 
8  "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 171.8 ? 
9  O2A   ? I DTP .   ? P DTP 502 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 87.8  ? 
10 OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 110.2 ? 
11 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 664 ? 1_555 162.0 ? 
12 "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 664 ? 1_555 85.3  ? 
13 O2A   ? I DTP .   ? P DTP 502 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 664 ? 1_555 65.5  ? 
14 OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 664 ? 1_555 87.2  ? 
15 OD2   B A ASP 16  ? A ASP 13  ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 664 ? 1_555 96.0  ? 
16 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O3G   ? I DTP .   ? P DTP 502 ? 1_555 78.5  ? 
17 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 87.2  ? 
18 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 100.1 ? 
19 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 85.9  ? 
20 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 164.0 ? 
21 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 82.6  ? 
22 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 83.7  ? 
23 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 83.5  ? 
24 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 169.4 ? 
25 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 91.3  ? 
26 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 161.0 ? 
27 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 115.3 ? 
28 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 102.2 ? 
29 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 79.2  ? 
30 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 85.1  ? 
31 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 144.9 ? 
32 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 82.7  ? 
33 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 67.1  ? 
34 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 112.6 ? 
35 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 123.4 ? 
36 OD2   B A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 53.5  ? 
37 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 148.9 ? 
38 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 74.0  ? 
39 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 83.7  ? 
40 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 122.0 ? 
41 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 106.9 ? 
42 OD2   B A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 49.7  ? 
43 OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 17.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ED1 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;GLU A 116 HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS GLU 116 (OCCUPANCY 0.30), 
ALTERNATE B HAS GLU 116 (OCCUPANCY 0.70) + NA 501.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DC 9 ? ? "C1'" T DC 9 ? ? N1 T DC 9 ? ? 110.39 108.30 2.09 0.30 N 
2 1 "O4'" P DG 2 ? B "C1'" P DG 2 ? B N9 P DG 2 ? ? 110.49 108.30 2.19 0.30 N 
3 1 "O4'" P DA 7 ? B "C1'" P DA 7 ? B N9 P DA 7 ? ? 110.36 108.30 2.06 0.30 N 
4 1 "O4'" P DT 8 ? ? "C1'" P DT 8 ? ? N1 P DT 8 ? ? 110.14 108.30 1.84 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 24.90   68.54   
2 1 TYR A 39  ? ? 64.60   165.74  
3 1 LYS A 40  ? ? -142.23 -27.15  
4 1 SER A 62  ? ? 80.91   -11.23  
5 1 SER A 217 ? ? -154.94 -159.25 
6 1 SER A 257 ? ? 95.27   -11.68  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ED1 'double helix'        
4ED1 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 6  1_555 C DA 7 1_555 -0.050 -0.011 0.175  -1.066 -14.701 3.960  1 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.152 -0.082 -0.378 -9.557 -4.887  -0.381 2 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.172  -0.059 -0.061 1.436  -4.201  1.425  3 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.279  -0.128 -0.331 11.501 -8.262  -0.145 4 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.505 -0.108 -0.061 -4.194 -9.324  5.227  5 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.077  -0.090 0.077  -5.450 -2.790  0.832  6 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.197 -0.174 -0.255 19.223 -1.370  4.416  7 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.427 -1.103 3.525 6.233  9.593 30.364 -3.697 1.883  2.910 17.552 -11.405 
32.400 1 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.627 -0.386 3.135 -2.189 1.310 34.828 -0.834 0.726  3.152 2.185  3.651   
34.918 2 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.367  -0.606 3.170 2.291  1.310 29.995 -1.426 -0.252 3.160 2.525  -4.416  
30.108 3 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.270 -0.553 3.791 -5.411 6.600 33.950 -2.066 -0.491 3.623 11.087 9.089   
34.976 4 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.653 -0.583 3.427 -2.201 0.206 36.783 -0.952 0.719  3.456 0.326  3.485   
36.847 5 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.270  0.234  2.893 -0.520 3.523 26.489 -0.307 -0.704 2.893 7.645  1.128   
26.723 6 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION'                        NA  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 water                               HOH 
#