data_4ED2
# 
_entry.id   4ED2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ED2         
NDB   NA1712       
RCSB  RCSB071464   
WWPDB D_1000071464 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ED2 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ED2 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ED2 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ?                                     ? 
4 non-polymer syn 'SODIUM ION'                                         22.990    1   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 water       nat water                                                18.015    454 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ED2       4ED2   2 ? ? ? 
3 PDB 4ED2       4ED2   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ED2 A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ED2 T 1 ? 12  ? 4ED2   1 ? 12  ? 1 12  
3 3 4ED2 P 1 ? 8   ? 4ED2   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ED2 GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ED2 PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ED2 HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
NA  non-polymer         . 'SODIUM ION'                         ?                               'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ED2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ED2 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.71 
_reflns.number_obs                   49015 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.088 
_reflns.pdbx_netI_over_sigmaI        15.0 
_reflns.B_iso_Wilson_estimate        14.200 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.71 
_reflns_shell.d_res_low                   1.74 
_reflns_shell.percent_possible_all        98.3 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.479 
_reflns_shell.meanI_over_sigI_obs         2.6 
_reflns_shell.pdbx_redundancy             3.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ED2 
_refine.ls_number_reflns_obs                     46937 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.07 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.950 
_refine.ls_d_res_high                            1.711 
_refine.ls_percent_reflns_obs                    95.28 
_refine.ls_R_factor_obs                          0.1715 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1697 
_refine.ls_R_factor_R_free                       0.2062 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  2354 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               21.4011 
_refine.aniso_B[1][1]                            0.2350 
_refine.aniso_B[2][2]                            0.2350 
_refine.aniso_B[3][3]                            -0.4699 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.344 
_refine.solvent_model_param_bsol                 34.955 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_FOM_work_R_set                   0.8832 
_refine.B_iso_max                                85.130 
_refine.B_iso_min                                2.480 
_refine.pdbx_overall_phase_error                 19.3300 
_refine.occupancy_max                            1.200 
_refine.occupancy_min                            0.200 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             454 
_refine_hist.number_atoms_total               4257 
_refine_hist.d_res_high                       1.711 
_refine_hist.d_res_low                        26.950 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4019 0.008  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5521 1.138  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     616  0.069  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      635  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1593 18.306 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.7113 1.7462  17 83.0000  2265 . 0.2019 0.2493 . 124 . 2389 . 'X-RAY DIFFRACTION' . 
1.7462 1.7842  17 88.0000  2414 . 0.1888 0.2700 . 128 . 2542 . 'X-RAY DIFFRACTION' . 
1.7842 1.8257  17 89.0000  2451 . 0.1804 0.2322 . 139 . 2590 . 'X-RAY DIFFRACTION' . 
1.8257 1.8713  17 92.0000  2493 . 0.1679 0.2150 . 139 . 2632 . 'X-RAY DIFFRACTION' . 
1.8713 1.9219  17 92.0000  2556 . 0.1709 0.2152 . 120 . 2676 . 'X-RAY DIFFRACTION' . 
1.9219 1.9784  17 94.0000  2639 . 0.1732 0.2021 . 109 . 2748 . 'X-RAY DIFFRACTION' . 
1.9784 2.0423  17 96.0000  2619 . 0.1802 0.2229 . 137 . 2756 . 'X-RAY DIFFRACTION' . 
2.0423 2.1152  17 97.0000  2632 . 0.1733 0.1950 . 148 . 2780 . 'X-RAY DIFFRACTION' . 
2.1152 2.1999  17 98.0000  2681 . 0.1723 0.2084 . 133 . 2814 . 'X-RAY DIFFRACTION' . 
2.1999 2.3000  17 98.0000  2690 . 0.1690 0.2276 . 146 . 2836 . 'X-RAY DIFFRACTION' . 
2.3000 2.4211  17 98.0000  2713 . 0.1676 0.2047 . 140 . 2853 . 'X-RAY DIFFRACTION' . 
2.4211 2.5727  17 99.0000  2698 . 0.1791 0.1965 . 153 . 2851 . 'X-RAY DIFFRACTION' . 
2.5727 2.7712  17 99.0000  2721 . 0.1821 0.2020 . 142 . 2863 . 'X-RAY DIFFRACTION' . 
2.7712 3.0497  17 99.0000  2725 . 0.1833 0.2249 . 152 . 2877 . 'X-RAY DIFFRACTION' . 
3.0497 3.4902  17 99.0000  2742 . 0.1632 0.2129 . 148 . 2890 . 'X-RAY DIFFRACTION' . 
3.4902 4.3942  17 100.0000 2759 . 0.1416 0.1863 . 143 . 2902 . 'X-RAY DIFFRACTION' . 
4.3942 26.9532 17 99.0000  2785 . 0.1576 0.1731 . 153 . 2938 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ED2 
_struct.title                     
'Human DNA polymerase eta - DNA ternary complex: AT crystal at pH 7.2 (Na+ HEPES) with 1 Ca2+ ion' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ED2 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? SER A 180 ? GLN A 162 SER A 177 1 ? 16 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D NA  . NA  B ? A ASP 115 A NA  501 1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc2  metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D NA  . NA  B ? P DT  8   A NA  501 1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc3  metalc ? ? I DTP .   O1B   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.272 ? 
metalc4  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  ? ? A MET 14  A CA  503 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc5  metalc ? ? I DTP .   O3G   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc6  metalc ? ? A GLU 119 OE1   B ? ? 1_555 D NA  . NA  B ? A GLU 116 A NA  501 1_555 ? ? ? ? ? ? ?            2.383 ? 
metalc7  metalc ? ? I DTP .   O2A   ? ? ? 1_555 E CA  . CA  ? ? P DTP 502 A CA  503 1_555 ? ? ? ? ? ? ?            2.387 ? 
metalc8  metalc ? ? D NA  .   NA    B ? ? 1_555 I DTP . O2A ? ? A NA  501 P DTP 502 1_555 ? ? ? ? ? ? ?            2.428 ? 
metalc9  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA  ? ? A ASP 115 A CA  503 1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc10 metalc ? ? A ASP 16  OD2   B ? ? 1_555 D NA  . NA  B ? A ASP 13  A NA  501 1_555 ? ? ? ? ? ? ?            2.445 ? 
metalc11 metalc ? ? A ASP 16  OD2   A ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.480 ? 
metalc12 metalc ? ? A ASP 16  OD2   B ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.641 ? 
metalc13 metalc ? ? A ASP 16  OD1   B ? ? 1_555 E CA  . CA  ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.691 ? 
metalc14 metalc ? ? D NA  .   NA    B ? ? 1_555 J HOH . O   ? ? A NA  501 A HOH 847 1_555 ? ? ? ? ? ? ?            2.956 ? 
hydrog1  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -0.36 
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -0.93 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -6.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
A 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE NA A 501'  
AC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE DTP P 502' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 503'  
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 504' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 505' 
AC6 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 8  SER A 116 ? SER A 113 . ? 1_555 ? 
3  AC1 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
4  AC1 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
5  AC1 8  CA  E .   ? CA  A 503 . ? 1_555 ? 
6  AC1 8  HOH J .   ? HOH A 847 . ? 1_555 ? 
7  AC1 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8  AC1 8  DTP I .   ? DTP P 502 . ? 1_555 ? 
9  AC2 27 ASP A 16  ? ASP A 13  . ? 1_555 ? 
10 AC2 27 MET A 17  ? MET A 14  . ? 1_555 ? 
11 AC2 27 ASP A 18  ? ASP A 15  . ? 1_555 ? 
12 AC2 27 CYS A 19  ? CYS A 16  . ? 1_555 ? 
13 AC2 27 PHE A 20  ? PHE A 17  . ? 1_555 ? 
14 AC2 27 PHE A 21  ? PHE A 18  . ? 1_555 ? 
15 AC2 27 ILE A 51  ? ILE A 48  . ? 1_555 ? 
16 AC2 27 ALA A 52  ? ALA A 49  . ? 1_555 ? 
17 AC2 27 TYR A 55  ? TYR A 52  . ? 1_555 ? 
18 AC2 27 ARG A 58  ? ARG A 55  . ? 1_555 ? 
19 AC2 27 ARG A 64  ? ARG A 61  . ? 1_555 ? 
20 AC2 27 ASP A 118 ? ASP A 115 . ? 1_555 ? 
21 AC2 27 LYS A 234 ? LYS A 231 . ? 1_555 ? 
22 AC2 27 NA  D .   ? NA  A 501 . ? 1_555 ? 
23 AC2 27 CA  E .   ? CA  A 503 . ? 1_555 ? 
24 AC2 27 HOH J .   ? HOH A 605 . ? 1_555 ? 
25 AC2 27 HOH J .   ? HOH A 616 . ? 1_555 ? 
26 AC2 27 HOH J .   ? HOH A 642 . ? 1_555 ? 
27 AC2 27 HOH J .   ? HOH A 723 . ? 1_555 ? 
28 AC2 27 HOH J .   ? HOH A 820 . ? 1_555 ? 
29 AC2 27 HOH J .   ? HOH A 847 . ? 1_555 ? 
30 AC2 27 DT  C 8   ? DT  P 8   . ? 1_555 ? 
31 AC2 27 HOH L .   ? HOH P 109 . ? 1_555 ? 
32 AC2 27 HOH L .   ? HOH P 124 . ? 1_555 ? 
33 AC2 27 DT  B 3   ? DT  T 3   . ? 1_555 ? 
34 AC2 27 DT  B 4   ? DT  T 4   . ? 1_555 ? 
35 AC2 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
36 AC3 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
37 AC3 5  MET A 17  ? MET A 14  . ? 1_555 ? 
38 AC3 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
39 AC3 5  NA  D .   ? NA  A 501 . ? 1_555 ? 
40 AC3 5  DTP I .   ? DTP P 502 . ? 1_555 ? 
41 AC4 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
42 AC4 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
43 AC4 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
44 AC4 10 SER A 251 ? SER A 248 . ? 1_555 ? 
45 AC4 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
46 AC4 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
47 AC4 10 HOH J .   ? HOH A 602 . ? 1_555 ? 
48 AC4 10 HOH J .   ? HOH A 644 . ? 1_555 ? 
49 AC4 10 HOH J .   ? HOH A 675 . ? 1_555 ? 
50 AC4 10 HOH J .   ? HOH A 782 . ? 1_555 ? 
51 AC5 9  GLU A 97  ? GLU A 94  . ? 1_555 ? 
52 AC5 9  ALA A 98  ? ALA A 95  . ? 1_555 ? 
53 AC5 9  GLU A 101 ? GLU A 98  . ? 1_555 ? 
54 AC5 9  ARG A 306 ? ARG A 303 . ? 5_664 ? 
55 AC5 9  HOH J .   ? HOH A 639 . ? 1_555 ? 
56 AC5 9  HOH J .   ? HOH A 668 . ? 1_555 ? 
57 AC5 9  HOH J .   ? HOH A 755 . ? 5_664 ? 
58 AC5 9  HOH J .   ? HOH A 757 . ? 1_555 ? 
59 AC5 9  HOH J .   ? HOH A 838 . ? 1_555 ? 
60 AC6 11 ASN A 29  ? ASN A 26  . ? 1_555 ? 
61 AC6 11 PRO A 30  ? PRO A 27  . ? 1_555 ? 
62 AC6 11 HIS A 31  ? HIS A 28  . ? 1_555 ? 
63 AC6 11 GLY A 274 ? GLY A 271 . ? 5_664 ? 
64 AC6 11 GLU A 276 ? GLU A 273 . ? 5_664 ? 
65 AC6 11 TYR A 277 ? TYR A 274 . ? 5_664 ? 
66 AC6 11 GLU A 280 ? GLU A 277 . ? 5_664 ? 
67 AC6 11 HOH J .   ? HOH A 837 . ? 1_555 ? 
68 AC6 11 HOH J .   ? HOH A 913 . ? 1_555 ? 
69 AC6 11 HOH J .   ? HOH A 984 . ? 5_664 ? 
70 AC6 11 HOH J .   ? HOH A 991 . ? 5_664 ? 
# 
_database_PDB_matrix.entry_id          4ED2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ED2 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.871 -34.221 -3.559  1.00 39.24 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.283 -34.181 -3.904  1.00 47.65 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.624 -33.192 -5.009  1.00 42.04 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.386 -31.990 -4.868  1.00 43.47 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.190 -33.698 -6.119  1.00 44.46 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.607 -32.904 -7.286  1.00 44.11 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.444 -32.291 -8.075  1.00 44.88 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.644 -31.319 -8.807  1.00 46.39 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.358 -33.926 -8.153  1.00 43.18 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.801 -35.253 -7.749  1.00 40.45 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.515 -35.127 -6.279  1.00 44.11 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.247 -32.850 -7.922  1.00 30.21 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.073 -32.389 -8.664  1.00 40.85 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.141 -31.546 -7.803  1.00 43.34 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.041 -31.189 -8.231  1.00 42.27 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.307 -33.587 -9.232  1.00 34.04 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.192 -34.604 -9.876  1.00 35.69 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.943 -34.329 -10.998 1.00 29.17 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.467 -35.888 -9.543  1.00 28.42 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.632 -35.403 -11.338 1.00 33.35 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.363 -36.361 -10.471 1.00 31.15 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.582 -31.234 -6.588  1.00 39.24 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.763 -30.463 -5.661  1.00 41.33 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.954 -28.965 -5.874  1.00 42.55 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.997 -28.407 -5.531  1.00 39.06 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 64.090 -30.835 -4.214  1.00 47.81 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.977 -30.498 -3.235  1.00 59.03 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.499 -31.495 -3.527  1.00 70.50 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 62.092 -33.119 -3.047  1.00 58.11 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.943 -28.322 -6.448  1.00 42.59 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.987 -26.884 -6.687  1.00 42.86 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.142 -26.132 -5.371  1.00 35.61 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.591 -26.541 -4.348  1.00 36.41 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.738 -26.430 -7.416  1.00 45.54 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.894 -25.035 -5.396  1.00 24.22 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.203 -24.310 -4.169  1.00 24.57 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.724 -22.863 -4.220  1.00 20.03 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.972 -22.093 -3.296  1.00 21.75 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.711 -24.314 -3.881  1.00 26.10 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.397 -23.642 -4.944  1.00 23.04 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.227 -25.743 -3.764  1.00 29.77 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.044 -22.504 -5.306  1.00 19.88 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.484 -21.169 -5.445  1.00 21.44 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.541 -20.083 -5.352  1.00 23.45 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.342 -19.078 -4.662  1.00 20.68 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.664 -20.289 -6.039  1.00 17.32 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.781 -19.344 -5.993  1.00 12.41 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.105 -18.767 -7.376  1.00 16.58 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.199 -18.242 -7.597  1.00 14.71 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.024 -20.016 -5.398  1.00 12.84 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.996 -20.167 -3.871  1.00 17.69 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.157 -20.992 -3.359  1.00 15.16 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.268 -22.181 -3.671  1.00 21.45 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 69.046 -20.366 -2.591  1.00 19.19 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.116 -18.835 -8.268  1.00 16.60 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.241 -18.490 -9.687  1.00 18.01 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.198 -16.993 -10.005 1.00 17.79 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.619 -16.578 -11.083 1.00 20.41 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.118 -19.181 -10.486 1.00 21.75 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.721 -18.934 -9.892  1.00 29.97 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 61.841 -18.414 -10.619 1.00 37.90 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 62.488 -19.260 -8.702  1.00 28.45 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.670 -16.196 -9.085  1.00 15.75 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.455 -14.761 -9.314  1.00 15.98 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.052 -13.932 -8.189  1.00 12.00 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.262 -14.424 -7.080  1.00 10.97 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.952 -14.437 -9.364  1.00 13.24 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.142 -15.103 -10.471 1.00 15.37 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.660 -14.719 -10.344 1.00 14.56 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.001 -15.350 -9.192  1.00 12.15 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.949 -14.850 -8.541  1.00 12.64 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.423 -15.520 -7.523  1.00 10.63 ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.417 -13.684 -8.894  1.00 11.03 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.326 -12.662 -8.477  1.00 8.21  ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.621 -11.689 -7.428  1.00 6.17  ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.488 -10.670 -7.445  1.00 10.23 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.252 -10.032 -8.471  1.00 11.22 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.972 -10.982 -7.641  1.00 12.03 ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.220 -9.968  -6.520  1.00 9.88  ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.116 -11.996 -7.699  1.00 10.06 ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.773 -10.534 -6.328  1.00 7.53  ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.604 -9.652  -6.266  1.00 6.99  ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.804 -8.688  -5.111  1.00 9.15  ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.266 -9.085  -4.050  1.00 9.97  ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.306 -10.449 -6.026  1.00 7.50  ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.123 -9.523  -5.769  1.00 11.73 ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.006 -11.354 -7.201  1.00 7.78  ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.479 -7.415  -5.303  1.00 8.25  ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.526 -6.488  -4.173  1.00 6.73  ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.154 -5.874  -3.959  1.00 7.38  ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.342 -5.808  -4.887  1.00 10.50 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.590 -5.385  -4.398  1.00 8.69  ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.895 -5.441  -2.728  1.00 6.23  ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.712 -4.660  -2.421  1.00 6.32  ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.208 -3.359  -1.797  1.00 11.77 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.919 -3.377  -0.787  1.00 9.34  ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.796 -5.421  -1.460  1.00 9.96  ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.443 -4.823  -1.041  1.00 12.89 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.566 -3.845  0.134   1.00 12.50 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.754 -4.136  -2.236  1.00 10.64 ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.868 -2.239  -2.429  1.00 9.72  ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.276 -0.933  -1.932  1.00 10.05 ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 59.045 -0.256  -1.364  1.00 13.81 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 58.006 -0.175  -2.019  1.00 11.62 ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.910 -0.074  -3.033  1.00 10.64 ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.273 1.311   -2.471  1.00 9.06  ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 62.156 -0.760  -3.589  1.00 13.45 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.159 0.236   -0.135  1.00 9.54  ? 13  ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 58.015 0.765   0.583   0.20 11.35 ? 13  ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 58.005 0.800   0.560   0.80 11.35 ? 13  ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.384 2.097   1.251   1.00 8.24  ? 13  ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.294 2.134   2.068   1.00 10.10 ? 13  ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.591 -0.294  1.603   0.20 11.22 ? 13  ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.449 -0.189  1.579   0.80 10.95 ? 13  ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.565 0.201   2.574   0.20 15.94 ? 13  ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.366 0.420   2.440   0.80 15.90 ? 13  ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 55.483 -0.417  2.664   0.20 16.47 ? 13  ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 56.573 0.541   3.655   0.80 23.53 ? 13  ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 56.860 1.189   3.269   0.20 12.54 ? 13  ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 55.312 0.792   1.900   0.80 15.68 ? 13  ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.680 3.184   0.918   1.00 6.99  ? 14  MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 58.031 4.487   1.487   1.00 6.47  ? 14  MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.777 4.524   2.991   1.00 9.71  ? 14  MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.809 3.977   3.460   1.00 8.35  ? 14  MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.230 5.622   0.836   1.00 9.13  ? 14  MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.305 5.653   -0.680  1.00 10.41 ? 14  MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.971 5.591   -1.369  1.00 16.00 ? 14  MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.667 7.135   -0.903  1.00 15.33 ? 14  MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.643 5.177   3.749   1.00 7.53  ? 15  ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.401 5.283   5.190   1.00 5.97  ? 15  ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.334 6.325   5.453   1.00 8.77  ? 15  ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.319 7.383   4.800   1.00 6.98  ? 15  ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.675 5.643   5.943   1.00 7.60  ? 15  ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.785 4.621   5.739   1.00 10.36 ? 15  ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.494 3.414   5.609   1.00 11.10 ? 15  ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 61.952 5.035   5.729   1.00 15.09 ? 15  ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.444 6.016   6.397   1.00 8.66  ? 16  CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.341 6.913   6.796   1.00 8.22  ? 16  CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.967 7.904   5.683   1.00 7.67  ? 16  CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.121 9.118   5.822   1.00 7.47  ? 16  CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.664 7.624   8.116   1.00 9.81  ? 16  CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.205 8.569   8.185   1.00 12.45 ? 16  CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.467 7.363   4.579   1.00 6.27  ? 17  PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.454 8.104   3.315   1.00 6.14  ? 17  PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.727 9.443   3.359   1.00 6.02  ? 17  PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.319 10.458  2.997   1.00 5.55  ? 17  PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.903 7.230   2.180   1.00 4.13  ? 17  PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 53.959 7.883   0.836   1.00 6.93  ? 17  PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.134 8.477   0.380   1.00 8.11  ? 17  PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.843 7.911   0.025   1.00 8.79  ? 17  PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.185 9.073   -0.887  1.00 9.53  ? 17  PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.889 8.522   -1.227  1.00 10.00 ? 17  PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 54.054 9.095   -1.677  1.00 9.79  ? 17  PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.464 9.466   3.789   1.00 4.95  ? 18  PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.734 10.741  3.716   1.00 4.74  ? 18  PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.410 11.788  4.614   1.00 7.25  ? 18  PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.387 12.978  4.318   1.00 6.14  ? 18  PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.251 10.618  4.094   1.00 4.16  ? 18  PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.406 9.901   3.082   1.00 8.01  ? 18  PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 49.977 9.160   2.057   1.00 8.14  ? 18  PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 48.025 9.966   3.164   1.00 8.48  ? 18  PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.182 8.507   1.138   1.00 10.89 ? 18  PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.221 9.308   2.234   1.00 9.02  ? 18  PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.807 8.572   1.238   1.00 10.59 ? 18  PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.978 11.345  5.732   1.00 4.38  ? 19  VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.736 12.250  6.605   1.00 6.05  ? 19  VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.944 12.839  5.887   1.00 6.78  ? 19  VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.191 14.043  5.973   1.00 6.08  ? 19  VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.192 11.546  7.904   1.00 5.98  ? 19  VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.285 12.376  8.604   1.00 7.26  ? 19  VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.994 11.316  8.833   1.00 9.33  ? 19  VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.718 12.011  5.186   1.00 6.88  ? 20  GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.851 12.555  4.429   1.00 4.54  ? 20  GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.433 13.568  3.373   1.00 5.31  ? 20  GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.161 14.536  3.130   1.00 8.40  ? 20  GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.631 11.451  3.731   1.00 4.90  ? 20  GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.438 10.588  4.672   1.00 10.57 ? 20  GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.563 9.917   3.931   1.00 11.68 ? 20  GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.605 10.533  3.696   1.00 11.07 ? 20  GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.366 8.654   3.549   1.00 12.72 ? 20  GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.309 13.318  2.715   1.00 4.77  ? 21  VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.809 14.245  1.690   1.00 2.48  ? 21  VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.539 15.599  2.359   1.00 8.27  ? 21  VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.934 16.650  1.843   1.00 7.65  ? 21  VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.534 13.727  0.974   1.00 5.12  ? 21  VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.971 14.803  0.024   1.00 6.16  ? 21  VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.835 12.447  0.178   1.00 5.06  ? 21  VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.896 15.568  3.523   1.00 5.99  ? 22  GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.591 16.813  4.237   1.00 8.32  ? 22  GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.838 17.488  4.825   1.00 6.34  ? 22  GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.889 18.707  4.925   1.00 7.72  ? 22  GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.517 16.587  5.325   1.00 4.02  ? 22  GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.175 16.094  4.791   1.00 6.10  ? 22  GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.452 17.144  3.955   1.00 14.56 ? 22  GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.726 18.344  4.144   1.00 13.48 ? 22  GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.608 16.767  3.113   1.00 14.66 ? 22  GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.834 16.697  5.223   1.00 6.05  ? 23  GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.051 17.262  5.821   1.00 6.18  ? 23  GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.939 17.884  4.755   1.00 7.57  ? 23  GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.610 18.880  5.003   1.00 9.08  ? 23  GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.835 16.183  6.561   1.00 7.34  ? 23  GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.192 15.733  7.874   1.00 7.77  ? 23  GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.931 14.546  8.500   1.00 7.88  ? 23  GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.369 13.638  7.795   1.00 10.53 ? 23  GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.089 14.566  9.833   1.00 10.45 ? 23  GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.938 17.294  3.566   1.00 7.07  ? 24  ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.660 17.913  2.467   1.00 8.04  ? 24  ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.093 19.308  2.203   1.00 10.47 ? 24  ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.830 20.260  2.019   1.00 7.69  ? 24  ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.566 17.075  1.191   1.00 6.79  ? 24  ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.451 17.650  0.068   1.00 10.47 ? 24  ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.464 16.750  -1.170  1.00 8.49  ? 24  ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.172 16.701  -1.849  1.00 8.21  ? 24  ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 57.983 16.121  -3.027  1.00 8.64  ? 24  ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 59.008 15.544  -3.656  1.00 6.57  ? 24  ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.779 16.122  -3.580  1.00 10.54 ? 24  ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.770 19.408  2.199   1.00 7.33  ? 25  GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.090 20.646  1.864   1.00 9.70  ? 25  GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.252 21.689  2.952   1.00 9.48  ? 25  GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.353 22.895  2.674   1.00 10.27 ? 25  GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.606 20.366  1.638   1.00 8.59  ? 25  GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.812 21.602  1.193   1.00 11.72 ? 25  GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.325 21.295  1.030   1.00 14.80 ? 25  GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 51.956 20.276  0.454   1.00 17.71 ? 25  GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.474 22.170  1.554   1.00 26.30 ? 25  GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.221 21.229  4.198   1.00 6.88  ? 26  ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.286 22.108  5.357   1.00 9.64  ? 26  ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.430 21.727  6.290   1.00 9.52  ? 26  ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.287 20.853  7.135   1.00 8.14  ? 26  ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.951 22.109  6.122   1.00 11.19 ? 26  ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.969 23.063  7.324   1.00 11.20 ? 26  ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 55.974 23.711  7.588   1.00 10.57 ? 26  ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.846 23.165  8.033   1.00 14.46 ? 26  ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.583 22.388  6.135   1.00 8.96  ? 27  PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.792 22.047  6.887   1.00 13.03 ? 27  PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.596 22.111  8.407   1.00 10.49 ? 27  PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.335 21.451  9.143   1.00 9.95  ? 27  PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.795 23.109  6.429   1.00 16.66 ? 27  PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.314 23.503  5.055   1.00 9.64  ? 27  PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.824 23.435  5.124   1.00 10.81 ? 27  PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.601 22.866  8.864   1.00 9.66  ? 28  HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.307 22.943  10.296  1.00 18.50 ? 28  HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.872 21.605  10.886  1.00 14.67 ? 28  HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 57.923 21.415  12.107  1.00 14.08 ? 28  HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.222 23.982  10.568  1.00 17.00 ? 28  HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.702 25.394  10.494  1.00 23.36 ? 28  HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 57.044 26.363  9.769   1.00 35.36 ? 28  HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.769 26.004  11.059  1.00 21.92 ? 28  HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.686 27.511  9.890   1.00 33.43 ? 28  HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.738 27.320  10.665  1.00 28.25 ? 28  HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.412 20.690  10.036  1.00 11.33 ? 29  LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 56.975 19.373  10.504  1.00 11.33 ? 29  LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.114 18.345  10.514  1.00 10.31 ? 29  LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 57.956 17.249  11.040  1.00 7.78  ? 29  LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.818 18.843  9.647   1.00 8.11  ? 29  LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.582 19.739  9.560   1.00 8.08  ? 29  LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.582 19.163  8.558   1.00 9.71  ? 29  LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 53.954 19.905  10.937  1.00 14.02 ? 29  LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.271 18.697  9.952   1.00 9.91  ? 30  ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.366 17.740  9.819   1.00 9.05  ? 30  ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 60.989 17.379  11.162  1.00 8.04  ? 30  ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.168 18.240  12.012  1.00 11.27 ? 30  ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.447 18.290  8.885   1.00 9.46  ? 30  ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 60.935 18.556  7.472   1.00 8.30  ? 30  ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 61.994 19.171  6.569   1.00 12.78 ? 30  ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.465 19.455  5.230   1.00 11.38 ? 30  ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.176 19.997  4.244   1.00 17.65 ? 30  ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.454 20.307  4.445   1.00 15.68 ? 30  ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.613 20.234  3.061   1.00 10.94 ? 30  ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.296 16.095  11.334  1.00 11.97 ? 31  ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.914 15.603  12.566  1.00 16.31 ? 31  ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.090 15.896  13.814  1.00 16.89 ? 31  ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.647 16.155  14.889  1.00 20.53 ? 31  ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.313 16.192  12.735  1.00 18.68 ? 31  ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.198 15.928  11.538  1.00 19.77 ? 31  ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.329 14.790  11.086  1.00 26.04 ? 31  ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.794 16.988  11.001  1.00 31.04 ? 31  ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.770 15.853  13.667  1.00 10.81 ? 32  LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.855 16.084  14.772  1.00 12.71 ? 32  LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.895 14.918  14.890  1.00 9.73  ? 32  LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.643 14.220  13.907  1.00 12.90 ? 32  LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.016 17.348  14.523  1.00 13.27 ? 32  LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 58.829 18.626  14.336  1.00 18.32 ? 32  LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 59.210 19.221  15.655  1.00 29.16 ? 32  LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 60.021 20.493  15.469  1.00 29.38 ? 32  LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 60.266 21.108  16.796  1.00 35.64 ? 32  LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.341 14.713  16.094  1.00 11.89 ? 33  PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.191 13.818  16.186  1.00 12.27 ? 33  PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.061 14.501  15.418  1.00 8.56  ? 33  PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.656 15.621  15.744  1.00 10.07 ? 33  PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.911 13.772  17.689  1.00 13.68 ? 33  PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.371 15.086  18.199  1.00 18.12 ? 33  PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.570 15.463  17.342  1.00 14.60 ? 33  PRO A CD    1 
ATOM   294  N  N     A CYS A 1 37  ? 54.583 13.855  14.369  0.50 8.36  ? 34  CYS A N     1 
ATOM   295  N  N     B CYS A 1 37  ? 54.569 13.819  14.385  0.50 8.37  ? 34  CYS A N     1 
ATOM   296  C  CA    A CYS A 1 37  ? 53.476 14.418  13.626  0.50 9.07  ? 34  CYS A CA    1 
ATOM   297  C  CA    B CYS A 1 37  ? 53.647 14.401  13.416  0.50 9.38  ? 34  CYS A CA    1 
ATOM   298  C  C     A CYS A 1 37  ? 52.666 13.318  12.979  0.50 8.15  ? 34  CYS A C     1 
ATOM   299  C  C     B CYS A 1 37  ? 52.715 13.318  12.868  0.50 8.18  ? 34  CYS A C     1 
ATOM   300  O  O     A CYS A 1 37  ? 53.099 12.165  12.918  0.50 9.54  ? 34  CYS A O     1 
ATOM   301  O  O     B CYS A 1 37  ? 53.112 12.152  12.781  0.50 9.52  ? 34  CYS A O     1 
ATOM   302  C  CB    A CYS A 1 37  ? 53.976 15.429  12.588  0.50 10.70 ? 34  CYS A CB    1 
ATOM   303  C  CB    B CYS A 1 37  ? 54.470 15.032  12.281  0.50 10.02 ? 34  CYS A CB    1 
ATOM   304  S  SG    A CYS A 1 37  ? 55.069 14.749  11.324  0.50 7.32  ? 34  CYS A SG    1 
ATOM   305  S  SG    B CYS A 1 37  ? 53.555 15.718  10.876  0.50 15.31 ? 34  CYS A SG    1 
ATOM   306  N  N     . ALA A 1 38  ? 51.481 13.679  12.511  1.00 5.83  ? 35  ALA A N     1 
ATOM   307  C  CA    . ALA A 1 38  ? 50.572 12.714  11.901  1.00 5.94  ? 35  ALA A CA    1 
ATOM   308  C  C     . ALA A 1 38  ? 49.757 13.416  10.855  1.00 7.56  ? 35  ALA A C     1 
ATOM   309  O  O     . ALA A 1 38  ? 49.643 14.635  10.893  1.00 10.15 ? 35  ALA A O     1 
ATOM   310  C  CB    . ALA A 1 38  ? 49.648 12.104  12.935  1.00 7.99  ? 35  ALA A CB    1 
ATOM   311  N  N     . VAL A 1 39  ? 49.204 12.639  9.929   1.00 6.43  ? 36  VAL A N     1 
ATOM   312  C  CA    . VAL A 1 39  ? 48.281 13.180  8.940   1.00 8.11  ? 36  VAL A CA    1 
ATOM   313  C  C     . VAL A 1 39  ? 46.881 12.734  9.313   1.00 10.58 ? 36  VAL A C     1 
ATOM   314  O  O     . VAL A 1 39  ? 46.671 11.581  9.681   1.00 8.25  ? 36  VAL A O     1 
ATOM   315  C  CB    . VAL A 1 39  ? 48.642 12.686  7.530   1.00 6.19  ? 36  VAL A CB    1 
ATOM   316  C  CG1   . VAL A 1 39  ? 47.601 13.137  6.504   1.00 8.50  ? 36  VAL A CG1   1 
ATOM   317  C  CG2   . VAL A 1 39  ? 50.026 13.192  7.144   1.00 7.35  ? 36  VAL A CG2   1 
ATOM   318  N  N     . VAL A 1 40  ? 45.927 13.658  9.223   1.00 9.36  ? 37  VAL A N     1 
ATOM   319  C  CA    . VAL A 1 40  ? 44.571 13.424  9.693   1.00 8.60  ? 37  VAL A CA    1 
ATOM   320  C  C     . VAL A 1 40  ? 43.576 13.779  8.601   1.00 12.92 ? 37  VAL A C     1 
ATOM   321  O  O     . VAL A 1 40  ? 43.844 14.651  7.774   1.00 11.65 ? 37  VAL A O     1 
ATOM   322  C  CB    . VAL A 1 40  ? 44.255 14.310  10.942  1.00 11.95 ? 37  VAL A CB    1 
ATOM   323  C  CG1   A VAL A 1 40  ? 45.032 13.818  12.155  0.50 8.52  ? 37  VAL A CG1   1 
ATOM   324  C  CG1   B VAL A 1 40  ? 44.087 15.763  10.547  0.50 12.85 ? 37  VAL A CG1   1 
ATOM   325  C  CG2   A VAL A 1 40  ? 44.541 15.778  10.665  0.50 13.02 ? 37  VAL A CG2   1 
ATOM   326  C  CG2   B VAL A 1 40  ? 43.021 13.818  11.640  0.50 8.81  ? 37  VAL A CG2   1 
ATOM   327  N  N     . GLN A 1 41  ? 42.433 13.107  8.586   1.00 11.59 ? 38  GLN A N     1 
ATOM   328  C  CA    . GLN A 1 41  ? 41.365 13.541  7.694   1.00 10.25 ? 38  GLN A CA    1 
ATOM   329  C  C     . GLN A 1 41  ? 40.153 13.959  8.493   1.00 11.91 ? 38  GLN A C     1 
ATOM   330  O  O     . GLN A 1 41  ? 39.772 13.293  9.469   1.00 11.57 ? 38  GLN A O     1 
ATOM   331  C  CB    . GLN A 1 41  ? 41.024 12.514  6.606   1.00 16.94 ? 38  GLN A CB    1 
ATOM   332  C  CG    . GLN A 1 41  ? 40.697 11.125  7.082   1.00 19.21 ? 38  GLN A CG    1 
ATOM   333  C  CD    . GLN A 1 41  ? 40.781 10.094  5.949   1.00 18.62 ? 38  GLN A CD    1 
ATOM   334  O  OE1   . GLN A 1 41  ? 41.200 10.404  4.826   1.00 16.64 ? 38  GLN A OE1   1 
ATOM   335  N  NE2   . GLN A 1 41  ? 40.389 8.870   6.250   1.00 25.24 ? 38  GLN A NE2   1 
ATOM   336  N  N     . TYR A 1 42  ? 39.565 15.071  8.054   1.00 13.16 ? 39  TYR A N     1 
ATOM   337  C  CA    . TYR A 1 42  ? 38.438 15.711  8.722   1.00 14.05 ? 39  TYR A CA    1 
ATOM   338  C  C     . TYR A 1 42  ? 38.937 16.221  10.079  1.00 22.57 ? 39  TYR A C     1 
ATOM   339  O  O     . TYR A 1 42  ? 40.099 16.016  10.426  1.00 21.42 ? 39  TYR A O     1 
ATOM   340  C  CB    . TYR A 1 42  ? 37.228 14.782  8.783   1.00 11.04 ? 39  TYR A CB    1 
ATOM   341  C  CG    . TYR A 1 42  ? 36.836 14.231  7.405   1.00 9.56  ? 39  TYR A CG    1 
ATOM   342  C  CD1   . TYR A 1 42  ? 36.397 15.076  6.399   1.00 14.65 ? 39  TYR A CD1   1 
ATOM   343  C  CD2   . TYR A 1 42  ? 36.943 12.868  7.110   1.00 10.23 ? 39  TYR A CD2   1 
ATOM   344  C  CE1   . TYR A 1 42  ? 36.052 14.587  5.137   1.00 15.56 ? 39  TYR A CE1   1 
ATOM   345  C  CE2   . TYR A 1 42  ? 36.596 12.364  5.846   1.00 10.14 ? 39  TYR A CE2   1 
ATOM   346  C  CZ    . TYR A 1 42  ? 36.153 13.238  4.865   1.00 10.18 ? 39  TYR A CZ    1 
ATOM   347  O  OH    . TYR A 1 42  ? 35.790 12.775  3.604   1.00 11.89 ? 39  TYR A OH    1 
ATOM   348  N  N     . LYS A 1 43  ? 38.109 16.931  10.825  1.00 23.06 ? 40  LYS A N     1 
ATOM   349  C  CA    . LYS A 1 43  ? 38.622 17.584  12.032  1.00 21.43 ? 40  LYS A CA    1 
ATOM   350  C  C     . LYS A 1 43  ? 37.539 17.707  13.082  1.00 27.29 ? 40  LYS A C     1 
ATOM   351  O  O     . LYS A 1 43  ? 37.815 17.678  14.286  1.00 22.31 ? 40  LYS A O     1 
ATOM   352  C  CB    . LYS A 1 43  ? 39.194 18.970  11.697  1.00 28.28 ? 40  LYS A CB    1 
ATOM   353  C  CG    . LYS A 1 43  ? 40.260 19.488  12.672  1.00 37.38 ? 40  LYS A CG    1 
ATOM   354  C  CD    . LYS A 1 43  ? 41.665 19.011  12.274  1.00 27.12 ? 40  LYS A CD    1 
ATOM   355  C  CE    . LYS A 1 43  ? 42.731 19.397  13.304  1.00 28.18 ? 40  LYS A CE    1 
ATOM   356  N  NZ    . LYS A 1 43  ? 42.720 18.530  14.519  1.00 31.45 ? 40  LYS A NZ    1 
ATOM   357  N  N     . SER A 1 44  ? 36.300 17.817  12.619  1.00 21.87 ? 41  SER A N     1 
ATOM   358  C  CA    . SER A 1 44  ? 35.169 18.079  13.501  1.00 21.18 ? 41  SER A CA    1 
ATOM   359  C  C     . SER A 1 44  ? 34.895 16.957  14.492  1.00 26.30 ? 41  SER A C     1 
ATOM   360  O  O     . SER A 1 44  ? 34.616 17.217  15.661  1.00 32.10 ? 41  SER A O     1 
ATOM   361  C  CB    . SER A 1 44  ? 33.917 18.362  12.671  1.00 29.19 ? 41  SER A CB    1 
ATOM   362  O  OG    . SER A 1 44  ? 34.179 19.406  11.756  1.00 40.29 ? 41  SER A OG    1 
ATOM   363  N  N     . TRP A 1 45  ? 34.971 15.713  14.029  1.00 23.67 ? 42  TRP A N     1 
ATOM   364  C  CA    . TRP A 1 45  ? 34.729 14.571  14.904  1.00 21.28 ? 42  TRP A CA    1 
ATOM   365  C  C     . TRP A 1 45  ? 36.035 14.122  15.544  1.00 20.95 ? 42  TRP A C     1 
ATOM   366  O  O     . TRP A 1 45  ? 36.882 13.505  14.888  1.00 17.13 ? 42  TRP A O     1 
ATOM   367  C  CB    . TRP A 1 45  ? 34.071 13.412  14.140  1.00 26.17 ? 42  TRP A CB    1 
ATOM   368  C  CG    . TRP A 1 45  ? 33.630 12.255  15.015  1.00 24.34 ? 42  TRP A CG    1 
ATOM   369  C  CD1   . TRP A 1 45  ? 34.344 11.126  15.304  1.00 22.27 ? 42  TRP A CD1   1 
ATOM   370  C  CD2   . TRP A 1 45  ? 32.375 12.114  15.686  1.00 30.16 ? 42  TRP A CD2   1 
ATOM   371  N  NE1   . TRP A 1 45  ? 33.616 10.300  16.124  1.00 29.55 ? 42  TRP A NE1   1 
ATOM   372  C  CE2   . TRP A 1 45  ? 32.402 10.883  16.371  1.00 30.22 ? 42  TRP A CE2   1 
ATOM   373  C  CE3   . TRP A 1 45  ? 31.230 12.912  15.776  1.00 32.91 ? 42  TRP A CE3   1 
ATOM   374  C  CZ2   . TRP A 1 45  ? 31.330 10.431  17.138  1.00 32.57 ? 42  TRP A CZ2   1 
ATOM   375  C  CZ3   . TRP A 1 45  ? 30.165 12.460  16.536  1.00 33.17 ? 42  TRP A CZ3   1 
ATOM   376  C  CH2   . TRP A 1 45  ? 30.222 11.229  17.205  1.00 30.75 ? 42  TRP A CH2   1 
ATOM   377  N  N     . LYS A 1 46  ? 36.187 14.475  16.821  1.00 25.68 ? 43  LYS A N     1 
ATOM   378  C  CA    . LYS A 1 46  ? 37.300 14.039  17.668  1.00 20.44 ? 43  LYS A CA    1 
ATOM   379  C  C     . LYS A 1 46  ? 38.685 14.401  17.138  1.00 16.95 ? 43  LYS A C     1 
ATOM   380  O  O     . LYS A 1 46  ? 39.658 13.677  17.370  1.00 17.04 ? 43  LYS A O     1 
ATOM   381  C  CB    . LYS A 1 46  ? 37.193 12.537  17.954  1.00 24.15 ? 43  LYS A CB    1 
ATOM   382  C  CG    . LYS A 1 46  ? 35.909 12.143  18.675  1.00 28.61 ? 43  LYS A CG    1 
ATOM   383  C  CD    . LYS A 1 46  ? 35.854 10.647  18.934  1.00 27.08 ? 43  LYS A CD    1 
ATOM   384  C  CE    . LYS A 1 46  ? 34.590 10.276  19.697  1.00 40.26 ? 43  LYS A CE    1 
ATOM   385  N  NZ    . LYS A 1 46  ? 34.501 8.812   19.949  1.00 39.07 ? 43  LYS A NZ    1 
ATOM   386  N  N     . GLY A 1 47  ? 38.759 15.518  16.421  1.00 12.94 ? 44  GLY A N     1 
ATOM   387  C  CA    . GLY A 1 47  ? 40.013 16.106  15.995  1.00 14.27 ? 44  GLY A CA    1 
ATOM   388  C  C     . GLY A 1 47  ? 40.475 15.573  14.655  1.00 12.01 ? 44  GLY A C     1 
ATOM   389  O  O     . GLY A 1 47  ? 41.492 16.007  14.128  1.00 14.87 ? 44  GLY A O     1 
ATOM   390  N  N     . GLY A 1 48  ? 39.714 14.624  14.122  1.00 16.10 ? 45  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 48  ? 40.001 14.003  12.846  1.00 16.37 ? 45  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 48  ? 40.593 12.617  13.035  1.00 15.71 ? 45  GLY A C     1 
ATOM   393  O  O     . GLY A 1 48  ? 41.086 12.281  14.110  1.00 13.45 ? 45  GLY A O     1 
ATOM   394  N  N     . GLY A 1 49  ? 40.572 11.818  11.978  1.00 10.76 ? 46  GLY A N     1 
ATOM   395  C  CA    . GLY A 1 49  ? 41.057 10.449  12.077  1.00 10.62 ? 46  GLY A CA    1 
ATOM   396  C  C     . GLY A 1 49  ? 42.465 10.377  11.527  1.00 11.79 ? 46  GLY A C     1 
ATOM   397  O  O     . GLY A 1 49  ? 42.720 10.869  10.433  1.00 11.46 ? 46  GLY A O     1 
ATOM   398  N  N     . ILE A 1 50  ? 43.377 9.765   12.277  1.00 8.35  ? 47  ILE A N     1 
ATOM   399  C  CA    . ILE A 1 50  ? 44.781 9.683   11.843  1.00 8.36  ? 47  ILE A CA    1 
ATOM   400  C  C     . ILE A 1 50  ? 44.964 8.609   10.773  1.00 11.20 ? 47  ILE A C     1 
ATOM   401  O  O     . ILE A 1 50  ? 44.480 7.486   10.918  1.00 12.47 ? 47  ILE A O     1 
ATOM   402  C  CB    . ILE A 1 50  ? 45.710 9.407   13.034  1.00 9.67  ? 47  ILE A CB    1 
ATOM   403  C  CG1   . ILE A 1 50  ? 45.804 10.652  13.912  1.00 14.71 ? 47  ILE A CG1   1 
ATOM   404  C  CG2   . ILE A 1 50  ? 47.107 8.967   12.569  1.00 8.59  ? 47  ILE A CG2   1 
ATOM   405  C  CD1   . ILE A 1 50  ? 46.520 10.407  15.210  1.00 21.90 ? 47  ILE A CD1   1 
ATOM   406  N  N     . ILE A 1 51  ? 45.634 8.965   9.681   1.00 7.49  ? 48  ILE A N     1 
ATOM   407  C  CA    . ILE A 1 51  ? 45.904 7.987   8.627   1.00 8.08  ? 48  ILE A CA    1 
ATOM   408  C  C     . ILE A 1 51  ? 47.402 7.701   8.387   1.00 8.88  ? 48  ILE A C     1 
ATOM   409  O  O     . ILE A 1 51  ? 47.732 6.752   7.685   1.00 9.47  ? 48  ILE A O     1 
ATOM   410  C  CB    . ILE A 1 51  ? 45.209 8.320   7.297   1.00 12.92 ? 48  ILE A CB    1 
ATOM   411  C  CG1   . ILE A 1 51  ? 45.673 9.672   6.748   1.00 7.50  ? 48  ILE A CG1   1 
ATOM   412  C  CG2   . ILE A 1 51  ? 43.685 8.280   7.462   1.00 15.65 ? 48  ILE A CG2   1 
ATOM   413  C  CD1   . ILE A 1 51  ? 45.247 9.886   5.314   1.00 14.17 ? 48  ILE A CD1   1 
ATOM   414  N  N     . ALA A 1 52  ? 48.293 8.506   8.969   1.00 8.47  ? 49  ALA A N     1 
ATOM   415  C  CA    . ALA A 1 52  ? 49.746 8.266   8.878   1.00 4.95  ? 49  ALA A CA    1 
ATOM   416  C  C     . ALA A 1 52  ? 50.446 8.920   10.066  1.00 8.66  ? 49  ALA A C     1 
ATOM   417  O  O     . ALA A 1 52  ? 50.004 9.966   10.538  1.00 7.66  ? 49  ALA A O     1 
ATOM   418  C  CB    . ALA A 1 52  ? 50.314 8.816   7.548   1.00 5.07  ? 49  ALA A CB    1 
ATOM   419  N  N     . VAL A 1 53  ? 51.527 8.295   10.541  1.00 7.15  ? 50  VAL A N     1 
ATOM   420  C  CA    . VAL A 1 53  ? 52.188 8.681   11.788  1.00 5.33  ? 50  VAL A CA    1 
ATOM   421  C  C     . VAL A 1 53  ? 53.711 8.645   11.653  1.00 6.70  ? 50  VAL A C     1 
ATOM   422  O  O     . VAL A 1 53  ? 54.279 7.637   11.225  1.00 6.47  ? 50  VAL A O     1 
ATOM   423  C  CB    . VAL A 1 53  ? 51.771 7.721   12.931  1.00 5.72  ? 50  VAL A CB    1 
ATOM   424  C  CG1   . VAL A 1 53  ? 52.273 8.253   14.270  1.00 10.04 ? 50  VAL A CG1   1 
ATOM   425  C  CG2   . VAL A 1 53  ? 50.263 7.539   12.960  1.00 9.86  ? 50  VAL A CG2   1 
ATOM   426  N  N     . SER A 1 54  ? 54.382 9.733   12.018  1.00 6.23  ? 51  SER A N     1 
ATOM   427  C  CA    . SER A 1 54  ? 55.836 9.780   11.924  1.00 8.14  ? 51  SER A CA    1 
ATOM   428  C  C     . SER A 1 54  ? 56.415 8.844   12.978  1.00 6.62  ? 51  SER A C     1 
ATOM   429  O  O     . SER A 1 54  ? 55.763 8.552   13.994  1.00 8.82  ? 51  SER A O     1 
ATOM   430  C  CB    . SER A 1 54  ? 56.377 11.200  12.127  1.00 11.12 ? 51  SER A CB    1 
ATOM   431  O  OG    . SER A 1 54  ? 56.368 11.553  13.503  1.00 8.95  ? 51  SER A OG    1 
ATOM   432  N  N     . TYR A 1 55  ? 57.629 8.362   12.731  1.00 6.89  ? 52  TYR A N     1 
ATOM   433  C  CA    . TYR A 1 55  ? 58.273 7.461   13.681  1.00 8.85  ? 52  TYR A CA    1 
ATOM   434  C  C     . TYR A 1 55  ? 58.496 8.110   15.055  1.00 9.73  ? 52  TYR A C     1 
ATOM   435  O  O     . TYR A 1 55  ? 58.401 7.434   16.082  1.00 10.28 ? 52  TYR A O     1 
ATOM   436  C  CB    . TYR A 1 55  ? 59.558 6.865   13.079  1.00 10.70 ? 52  TYR A CB    1 
ATOM   437  C  CG    . TYR A 1 55  ? 59.214 5.770   12.101  1.00 13.04 ? 52  TYR A CG    1 
ATOM   438  C  CD1   . TYR A 1 55  ? 58.802 6.074   10.809  1.00 11.93 ? 52  TYR A CD1   1 
ATOM   439  C  CD2   . TYR A 1 55  ? 59.239 4.441   12.480  1.00 15.42 ? 52  TYR A CD2   1 
ATOM   440  C  CE1   . TYR A 1 55  ? 58.441 5.076   9.917   1.00 11.16 ? 52  TYR A CE1   1 
ATOM   441  C  CE2   . TYR A 1 55  ? 58.887 3.434   11.593  1.00 12.80 ? 52  TYR A CE2   1 
ATOM   442  C  CZ    . TYR A 1 55  ? 58.484 3.754   10.315  1.00 12.26 ? 52  TYR A CZ    1 
ATOM   443  O  OH    . TYR A 1 55  ? 58.141 2.744   9.437   1.00 12.06 ? 52  TYR A OH    1 
ATOM   444  N  N     . GLU A 1 56  ? 58.742 9.416   15.081  1.00 11.88 ? 53  GLU A N     1 
ATOM   445  C  CA    . GLU A 1 56  ? 58.833 10.124  16.352  1.00 11.99 ? 53  GLU A CA    1 
ATOM   446  C  C     . GLU A 1 56  ? 57.524 10.049  17.131  1.00 11.22 ? 53  GLU A C     1 
ATOM   447  O  O     . GLU A 1 56  ? 57.546 9.908   18.355  1.00 13.01 ? 53  GLU A O     1 
ATOM   448  C  CB    . GLU A 1 56  ? 59.243 11.587  16.141  1.00 12.10 ? 53  GLU A CB    1 
ATOM   449  C  CG    . GLU A 1 56  ? 60.615 11.770  15.481  1.00 15.00 ? 53  GLU A CG    1 
ATOM   450  C  CD    . GLU A 1 56  ? 60.588 11.757  13.949  1.00 29.12 ? 53  GLU A CD    1 
ATOM   451  O  OE1   . GLU A 1 56  ? 59.641 11.205  13.340  1.00 19.47 ? 53  GLU A OE1   1 
ATOM   452  O  OE2   . GLU A 1 56  ? 61.535 12.307  13.349  1.00 22.11 ? 53  GLU A OE2   1 
ATOM   453  N  N     . ALA A 1 57  ? 56.385 10.179  16.441  1.00 8.36  ? 54  ALA A N     1 
ATOM   454  C  CA    . ALA A 1 57  ? 55.084 10.054  17.110  1.00 8.27  ? 54  ALA A CA    1 
ATOM   455  C  C     . ALA A 1 57  ? 54.761 8.607   17.517  1.00 6.31  ? 54  ALA A C     1 
ATOM   456  O  O     . ALA A 1 57  ? 54.086 8.372   18.524  1.00 8.94  ? 54  ALA A O     1 
ATOM   457  C  CB    . ALA A 1 57  ? 53.949 10.633  16.228  1.00 10.23 ? 54  ALA A CB    1 
ATOM   458  N  N     . ARG A 1 58  ? 55.226 7.629   16.742  1.00 11.07 ? 55  ARG A N     1 
ATOM   459  C  CA    . ARG A 1 58  ? 54.965 6.218   17.088  1.00 9.30  ? 55  ARG A CA    1 
ATOM   460  C  C     . ARG A 1 58  ? 55.552 5.855   18.452  1.00 12.66 ? 55  ARG A C     1 
ATOM   461  O  O     . ARG A 1 58  ? 54.996 5.015   19.177  1.00 12.86 ? 55  ARG A O     1 
ATOM   462  C  CB    . ARG A 1 58  ? 55.513 5.275   16.013  1.00 8.03  ? 55  ARG A CB    1 
ATOM   463  C  CG    . ARG A 1 58  ? 54.841 5.489   14.676  1.00 9.80  ? 55  ARG A CG    1 
ATOM   464  C  CD    . ARG A 1 58  ? 55.352 4.537   13.617  1.00 9.62  ? 55  ARG A CD    1 
ATOM   465  N  NE    . ARG A 1 58  ? 54.911 5.010   12.305  1.00 9.97  ? 55  ARG A NE    1 
ATOM   466  C  CZ    . ARG A 1 58  ? 54.977 4.302   11.186  1.00 12.92 ? 55  ARG A CZ    1 
ATOM   467  N  NH1   . ARG A 1 58  ? 55.469 3.073   11.216  1.00 11.37 ? 55  ARG A NH1   1 
ATOM   468  N  NH2   . ARG A 1 58  ? 54.544 4.835   10.035  1.00 11.78 ? 55  ARG A NH2   1 
ATOM   469  N  N     . ALA A 1 59  ? 56.662 6.502   18.794  1.00 11.48 ? 56  ALA A N     1 
ATOM   470  C  CA    . ALA A 1 59  ? 57.320 6.272   20.081  1.00 13.16 ? 56  ALA A CA    1 
ATOM   471  C  C     . ALA A 1 59  ? 56.423 6.603   21.278  1.00 15.21 ? 56  ALA A C     1 
ATOM   472  O  O     . ALA A 1 59  ? 56.594 6.038   22.367  1.00 16.47 ? 56  ALA A O     1 
ATOM   473  C  CB    . ALA A 1 59  ? 58.637 7.051   20.158  1.00 14.56 ? 56  ALA A CB    1 
ATOM   474  N  N     . PHE A 1 60  ? 55.479 7.520   21.084  1.00 9.70  ? 57  PHE A N     1 
ATOM   475  C  CA    . PHE A 1 60  ? 54.507 7.862   22.116  1.00 13.63 ? 57  PHE A CA    1 
ATOM   476  C  C     . PHE A 1 60  ? 53.294 6.937   22.124  1.00 16.17 ? 57  PHE A C     1 
ATOM   477  O  O     . PHE A 1 60  ? 52.439 7.033   23.012  1.00 16.43 ? 57  PHE A O     1 
ATOM   478  C  CB    . PHE A 1 60  ? 54.026 9.304   21.931  1.00 12.06 ? 57  PHE A CB    1 
ATOM   479  C  CG    . PHE A 1 60  ? 55.065 10.344  22.236  1.00 12.74 ? 57  PHE A CG    1 
ATOM   480  C  CD1   . PHE A 1 60  ? 55.101 10.962  23.478  1.00 19.09 ? 57  PHE A CD1   1 
ATOM   481  C  CD2   . PHE A 1 60  ? 55.971 10.743  21.271  1.00 13.59 ? 57  PHE A CD2   1 
ATOM   482  C  CE1   . PHE A 1 60  ? 56.034 11.951  23.758  1.00 20.06 ? 57  PHE A CE1   1 
ATOM   483  C  CE2   . PHE A 1 60  ? 56.910 11.727  21.540  1.00 14.65 ? 57  PHE A CE2   1 
ATOM   484  C  CZ    . PHE A 1 60  ? 56.948 12.330  22.787  1.00 22.57 ? 57  PHE A CZ    1 
ATOM   485  N  N     . GLY A 1 61  ? 53.199 6.061   21.128  1.00 14.28 ? 58  GLY A N     1 
ATOM   486  C  CA    . GLY A 1 61  ? 52.067 5.155   21.014  1.00 16.35 ? 58  GLY A CA    1 
ATOM   487  C  C     . GLY A 1 61  ? 50.974 5.616   20.065  1.00 14.11 ? 58  GLY A C     1 
ATOM   488  O  O     . GLY A 1 61  ? 49.882 5.037   20.019  1.00 11.61 ? 58  GLY A O     1 
ATOM   489  N  N     . VAL A 1 62  ? 51.254 6.668   19.298  1.00 7.92  ? 59  VAL A N     1 
ATOM   490  C  CA    . VAL A 1 62  ? 50.298 7.145   18.304  1.00 10.57 ? 59  VAL A CA    1 
ATOM   491  C  C     . VAL A 1 62  ? 50.200 6.158   17.143  1.00 12.65 ? 59  VAL A C     1 
ATOM   492  O  O     . VAL A 1 62  ? 51.219 5.704   16.625  1.00 12.02 ? 59  VAL A O     1 
ATOM   493  C  CB    . VAL A 1 62  ? 50.675 8.569   17.798  1.00 8.29  ? 59  VAL A CB    1 
ATOM   494  C  CG1   . VAL A 1 62  ? 49.631 9.063   16.807  1.00 10.36 ? 59  VAL A CG1   1 
ATOM   495  C  CG2   . VAL A 1 62  ? 50.741 9.535   18.969  1.00 10.21 ? 59  VAL A CG2   1 
ATOM   496  N  N     . THR A 1 63  ? 48.971 5.813   16.746  1.00 10.52 ? 60  THR A N     1 
ATOM   497  C  CA    . THR A 1 63  ? 48.761 4.858   15.658  1.00 11.15 ? 60  THR A CA    1 
ATOM   498  C  C     . THR A 1 63  ? 47.698 5.310   14.673  1.00 11.78 ? 60  THR A C     1 
ATOM   499  O  O     . THR A 1 63  ? 46.864 6.161   14.974  1.00 15.22 ? 60  THR A O     1 
ATOM   500  C  CB    . THR A 1 63  ? 48.319 3.484   16.195  1.00 15.99 ? 60  THR A CB    1 
ATOM   501  O  OG1   . THR A 1 63  ? 47.036 3.614   16.819  1.00 17.42 ? 60  THR A OG1   1 
ATOM   502  C  CG2   . THR A 1 63  ? 49.312 2.973   17.209  1.00 15.53 ? 60  THR A CG2   1 
ATOM   503  N  N     . ARG A 1 64  ? 47.734 4.726   13.480  1.00 11.35 ? 61  ARG A N     1 
ATOM   504  C  CA    . ARG A 1 64  ? 46.648 4.864   12.517  1.00 14.31 ? 61  ARG A CA    1 
ATOM   505  C  C     . ARG A 1 64  ? 45.313 4.414   13.123  1.00 21.03 ? 61  ARG A C     1 
ATOM   506  O  O     . ARG A 1 64  ? 45.270 3.507   13.957  1.00 16.71 ? 61  ARG A O     1 
ATOM   507  C  CB    . ARG A 1 64  ? 46.984 4.039   11.265  1.00 15.75 ? 61  ARG A CB    1 
ATOM   508  C  CG    . ARG A 1 64  ? 45.888 3.915   10.228  1.00 25.44 ? 61  ARG A CG    1 
ATOM   509  C  CD    . ARG A 1 64  ? 46.422 3.165   9.002   1.00 20.95 ? 61  ARG A CD    1 
ATOM   510  N  NE    . ARG A 1 64  ? 47.479 3.937   8.366   1.00 17.89 ? 61  ARG A NE    1 
ATOM   511  C  CZ    . ARG A 1 64  ? 48.687 3.474   8.050   1.00 21.31 ? 61  ARG A CZ    1 
ATOM   512  N  NH1   . ARG A 1 64  ? 49.001 2.203   8.275   1.00 28.37 ? 61  ARG A NH1   1 
ATOM   513  N  NH2   . ARG A 1 64  ? 49.573 4.289   7.478   1.00 13.53 ? 61  ARG A NH2   1 
ATOM   514  N  N     . SER A 1 65  ? 44.231 5.056   12.689  1.00 15.10 ? 62  SER A N     1 
ATOM   515  C  CA    . SER A 1 65  ? 42.868 4.778   13.152  1.00 20.87 ? 62  SER A CA    1 
ATOM   516  C  C     . SER A 1 65  ? 42.519 5.462   14.481  1.00 22.99 ? 62  SER A C     1 
ATOM   517  O  O     . SER A 1 65  ? 41.371 5.452   14.908  1.00 33.49 ? 62  SER A O     1 
ATOM   518  C  CB    . SER A 1 65  ? 42.607 3.277   13.257  1.00 24.78 ? 62  SER A CB    1 
ATOM   519  O  OG    . SER A 1 65  ? 42.895 2.804   14.561  1.00 38.31 ? 62  SER A OG    1 
ATOM   520  N  N     . MET A 1 66  ? 43.516 6.045   15.129  1.00 17.22 ? 63  MET A N     1 
ATOM   521  C  CA    . MET A 1 66  ? 43.310 6.771   16.371  1.00 15.00 ? 63  MET A CA    1 
ATOM   522  C  C     . MET A 1 66  ? 42.702 8.123   16.031  1.00 15.92 ? 63  MET A C     1 
ATOM   523  O  O     . MET A 1 66  ? 43.037 8.715   14.997  1.00 15.75 ? 63  MET A O     1 
ATOM   524  C  CB    . MET A 1 66  ? 44.670 6.941   17.044  1.00 15.30 ? 63  MET A CB    1 
ATOM   525  C  CG    . MET A 1 66  ? 44.690 7.339   18.474  1.00 25.88 ? 63  MET A CG    1 
ATOM   526  S  SD    . MET A 1 66  ? 46.399 7.138   19.022  1.00 18.77 ? 63  MET A SD    1 
ATOM   527  C  CE    . MET A 1 66  ? 46.420 5.463   19.635  1.00 18.22 ? 63  MET A CE    1 
ATOM   528  N  N     . TRP A 1 67  ? 41.800 8.617   16.880  1.00 12.48 ? 64  TRP A N     1 
ATOM   529  C  CA    . TRP A 1 67  ? 41.318 9.993   16.737  1.00 13.76 ? 64  TRP A CA    1 
ATOM   530  C  C     . TRP A 1 67  ? 42.393 10.955  17.217  1.00 12.03 ? 64  TRP A C     1 
ATOM   531  O  O     . TRP A 1 67  ? 43.086 10.681  18.193  1.00 13.26 ? 64  TRP A O     1 
ATOM   532  C  CB    . TRP A 1 67  ? 40.027 10.224  17.527  1.00 13.45 ? 64  TRP A CB    1 
ATOM   533  C  CG    . TRP A 1 67  ? 38.919 9.340   17.090  1.00 15.69 ? 64  TRP A CG    1 
ATOM   534  C  CD1   . TRP A 1 67  ? 38.341 8.325   17.807  1.00 18.41 ? 64  TRP A CD1   1 
ATOM   535  C  CD2   . TRP A 1 67  ? 38.256 9.363   15.819  1.00 14.35 ? 64  TRP A CD2   1 
ATOM   536  N  NE1   . TRP A 1 67  ? 37.351 7.728   17.058  1.00 20.62 ? 64  TRP A NE1   1 
ATOM   537  C  CE2   . TRP A 1 67  ? 37.286 8.342   15.834  1.00 23.28 ? 64  TRP A CE2   1 
ATOM   538  C  CE3   . TRP A 1 67  ? 38.391 10.151  14.667  1.00 13.86 ? 64  TRP A CE3   1 
ATOM   539  C  CZ2   . TRP A 1 67  ? 36.450 8.087   14.741  1.00 21.31 ? 64  TRP A CZ2   1 
ATOM   540  C  CZ3   . TRP A 1 67  ? 37.562 9.894   13.589  1.00 15.17 ? 64  TRP A CZ3   1 
ATOM   541  C  CH2   . TRP A 1 67  ? 36.611 8.872   13.633  1.00 14.39 ? 64  TRP A CH2   1 
ATOM   542  N  N     . ALA A 1 68  ? 42.543 12.084  16.537  1.00 10.72 ? 65  ALA A N     1 
ATOM   543  C  CA    . ALA A 1 68  ? 43.614 13.004  16.913  1.00 11.89 ? 65  ALA A CA    1 
ATOM   544  C  C     . ALA A 1 68  ? 43.469 13.481  18.362  1.00 10.67 ? 65  ALA A C     1 
ATOM   545  O  O     . ALA A 1 68  ? 44.467 13.696  19.056  1.00 12.19 ? 65  ALA A O     1 
ATOM   546  C  CB    . ALA A 1 68  ? 43.669 14.179  15.958  1.00 12.00 ? 65  ALA A CB    1 
ATOM   547  N  N     . ASP A 1 69  ? 42.235 13.660  18.825  1.00 11.91 ? 66  ASP A N     1 
ATOM   548  C  CA    . ASP A 1 69  ? 42.038 14.094  20.211  1.00 12.22 ? 66  ASP A CA    1 
ATOM   549  C  C     . ASP A 1 69  ? 42.644 13.077  21.176  1.00 12.60 ? 66  ASP A C     1 
ATOM   550  O  O     . ASP A 1 69  ? 43.179 13.437  22.235  1.00 12.88 ? 66  ASP A O     1 
ATOM   551  C  CB    . ASP A 1 69  ? 40.557 14.279  20.532  1.00 14.89 ? 66  ASP A CB    1 
ATOM   552  C  CG    . ASP A 1 69  ? 39.973 15.547  19.921  1.00 20.32 ? 66  ASP A CG    1 
ATOM   553  O  OD1   . ASP A 1 69  ? 40.742 16.388  19.390  1.00 19.93 ? 66  ASP A OD1   1 
ATOM   554  O  OD2   . ASP A 1 69  ? 38.737 15.703  19.986  1.00 25.45 ? 66  ASP A OD2   1 
ATOM   555  N  N     . ASP A 1 70  ? 42.539 11.804  20.821  1.00 10.48 ? 67  ASP A N     1 
ATOM   556  C  CA    . ASP A 1 70  ? 43.046 10.750  21.683  1.00 12.59 ? 67  ASP A CA    1 
ATOM   557  C  C     . ASP A 1 70  ? 44.551 10.629  21.526  1.00 12.79 ? 67  ASP A C     1 
ATOM   558  O  O     . ASP A 1 70  ? 45.272 10.384  22.486  1.00 10.98 ? 67  ASP A O     1 
ATOM   559  C  CB    . ASP A 1 70  ? 42.364 9.427   21.337  1.00 15.07 ? 67  ASP A CB    1 
ATOM   560  C  CG    . ASP A 1 70  ? 40.871 9.443   21.650  1.00 24.79 ? 67  ASP A CG    1 
ATOM   561  O  OD1   . ASP A 1 70  ? 40.465 10.122  22.621  1.00 19.68 ? 67  ASP A OD1   1 
ATOM   562  O  OD2   . ASP A 1 70  ? 40.103 8.778   20.923  1.00 19.20 ? 67  ASP A OD2   1 
ATOM   563  N  N     . ALA A 1 71  ? 45.037 10.816  20.303  1.00 13.19 ? 68  ALA A N     1 
ATOM   564  C  CA    . ALA A 1 71  ? 46.472 10.822  20.069  1.00 11.53 ? 68  ALA A CA    1 
ATOM   565  C  C     . ALA A 1 71  ? 47.174 11.914  20.877  1.00 10.60 ? 68  ALA A C     1 
ATOM   566  O  O     . ALA A 1 71  ? 48.274 11.698  21.365  1.00 13.39 ? 68  ALA A O     1 
ATOM   567  C  CB    . ALA A 1 71  ? 46.790 10.970  18.571  1.00 10.67 ? 68  ALA A CB    1 
ATOM   568  N  N     . LYS A 1 72  ? 46.536 13.080  20.993  1.00 8.96  ? 69  LYS A N     1 
ATOM   569  C  CA    . LYS A 1 72  ? 47.070 14.207  21.755  1.00 12.79 ? 69  LYS A CA    1 
ATOM   570  C  C     . LYS A 1 72  ? 47.198 13.871  23.243  1.00 13.11 ? 69  LYS A C     1 
ATOM   571  O  O     . LYS A 1 72  ? 47.997 14.474  23.953  1.00 13.54 ? 69  LYS A O     1 
ATOM   572  C  CB    . LYS A 1 72  ? 46.170 15.437  21.582  1.00 12.90 ? 69  LYS A CB    1 
ATOM   573  C  CG    . LYS A 1 72  ? 46.479 16.265  20.317  1.00 17.87 ? 69  LYS A CG    1 
ATOM   574  C  CD    . LYS A 1 72  ? 47.788 17.040  20.515  1.00 15.49 ? 69  LYS A CD    1 
ATOM   575  C  CE    . LYS A 1 72  ? 47.966 18.164  19.500  1.00 24.48 ? 69  LYS A CE    1 
ATOM   576  N  NZ    . LYS A 1 72  ? 49.245 18.914  19.757  1.00 16.09 ? 69  LYS A NZ    1 
ATOM   577  N  N     . LYS A 1 73  ? 46.404 12.915  23.714  1.00 12.29 ? 70  LYS A N     1 
ATOM   578  C  CA    . LYS A 1 73  ? 46.514 12.484  25.110  1.00 11.82 ? 70  LYS A CA    1 
ATOM   579  C  C     . LYS A 1 73  ? 47.816 11.722  25.337  1.00 16.48 ? 70  LYS A C     1 
ATOM   580  O  O     . LYS A 1 73  ? 48.421 11.815  26.409  1.00 14.79 ? 70  LYS A O     1 
ATOM   581  C  CB    . LYS A 1 73  ? 45.300 11.636  25.516  1.00 6.94  ? 70  LYS A CB    1 
ATOM   582  C  CG    . LYS A 1 73  ? 43.981 12.363  25.347  1.00 8.54  ? 70  LYS A CG    1 
ATOM   583  C  CD    . LYS A 1 73  ? 42.800 11.405  25.531  1.00 11.62 ? 70  LYS A CD    1 
ATOM   584  C  CE    . LYS A 1 73  ? 41.464 12.115  25.257  1.00 13.35 ? 70  LYS A CE    1 
ATOM   585  N  NZ    . LYS A 1 73  ? 40.356 11.109  25.154  1.00 15.74 ? 70  LYS A NZ    1 
ATOM   586  N  N     . LEU A 1 74  ? 48.257 10.981  24.321  1.00 12.25 ? 71  LEU A N     1 
ATOM   587  C  CA    . LEU A 1 74  ? 49.527 10.254  24.400  1.00 11.10 ? 71  LEU A CA    1 
ATOM   588  C  C     . LEU A 1 74  ? 50.715 11.163  24.103  1.00 18.35 ? 71  LEU A C     1 
ATOM   589  O  O     . LEU A 1 74  ? 51.807 10.970  24.629  1.00 16.29 ? 71  LEU A O     1 
ATOM   590  C  CB    . LEU A 1 74  ? 49.536 9.098   23.394  1.00 10.55 ? 71  LEU A CB    1 
ATOM   591  C  CG    . LEU A 1 74  ? 48.449 8.046   23.589  1.00 14.63 ? 71  LEU A CG    1 
ATOM   592  C  CD1   . LEU A 1 74  ? 48.556 7.001   22.490  1.00 18.96 ? 71  LEU A CD1   1 
ATOM   593  C  CD2   . LEU A 1 74  ? 48.591 7.388   24.955  1.00 10.94 ? 71  LEU A CD2   1 
ATOM   594  N  N     . CYS A 1 75  ? 50.482 12.149  23.246  1.00 10.82 ? 72  CYS A N     1 
ATOM   595  C  CA    . CYS A 1 75  ? 51.543 12.983  22.694  1.00 13.84 ? 72  CYS A CA    1 
ATOM   596  C  C     . CYS A 1 75  ? 51.019 14.412  22.561  1.00 12.79 ? 72  CYS A C     1 
ATOM   597  O  O     . CYS A 1 75  ? 50.562 14.827  21.499  1.00 13.11 ? 72  CYS A O     1 
ATOM   598  C  CB    . CYS A 1 75  ? 51.943 12.426  21.330  1.00 12.65 ? 72  CYS A CB    1 
ATOM   599  S  SG    . CYS A 1 75  ? 53.334 13.265  20.538  1.00 16.50 ? 72  CYS A SG    1 
ATOM   600  N  N     . PRO A 1 76  ? 51.068 15.178  23.656  1.00 11.97 ? 73  PRO A N     1 
ATOM   601  C  CA    . PRO A 1 76  ? 50.493 16.525  23.692  1.00 13.62 ? 73  PRO A CA    1 
ATOM   602  C  C     . PRO A 1 76  ? 51.096 17.464  22.641  1.00 13.12 ? 73  PRO A C     1 
ATOM   603  O  O     . PRO A 1 76  ? 50.396 18.366  22.172  1.00 16.53 ? 73  PRO A O     1 
ATOM   604  C  CB    . PRO A 1 76  ? 50.841 17.009  25.108  1.00 17.22 ? 73  PRO A CB    1 
ATOM   605  C  CG    . PRO A 1 76  ? 50.979 15.753  25.895  1.00 18.24 ? 73  PRO A CG    1 
ATOM   606  C  CD    . PRO A 1 76  ? 51.574 14.747  24.969  1.00 19.59 ? 73  PRO A CD    1 
ATOM   607  N  N     . ASP A 1 77  ? 52.354 17.253  22.279  1.00 15.22 ? 74  ASP A N     1 
ATOM   608  C  CA    . ASP A 1 77  ? 53.031 18.115  21.308  1.00 17.10 ? 74  ASP A CA    1 
ATOM   609  C  C     . ASP A 1 77  ? 52.925 17.617  19.860  1.00 16.93 ? 74  ASP A C     1 
ATOM   610  O  O     . ASP A 1 77  ? 53.566 18.177  18.959  1.00 15.36 ? 74  ASP A O     1 
ATOM   611  C  CB    . ASP A 1 77  ? 54.504 18.273  21.676  1.00 18.91 ? 74  ASP A CB    1 
ATOM   612  C  CG    . ASP A 1 77  ? 54.698 19.010  22.982  1.00 37.71 ? 74  ASP A CG    1 
ATOM   613  O  OD1   . ASP A 1 77  ? 55.486 18.526  23.821  1.00 36.11 ? 74  ASP A OD1   1 
ATOM   614  O  OD2   . ASP A 1 77  ? 54.063 20.071  23.171  1.00 36.00 ? 74  ASP A OD2   1 
ATOM   615  N  N     . LEU A 1 78  ? 52.129 16.574  19.642  1.00 12.40 ? 75  LEU A N     1 
ATOM   616  C  CA    . LEU A 1 78  ? 51.918 16.025  18.289  1.00 9.90  ? 75  LEU A CA    1 
ATOM   617  C  C     . LEU A 1 78  ? 51.514 17.115  17.314  1.00 11.21 ? 75  LEU A C     1 
ATOM   618  O  O     . LEU A 1 78  ? 50.597 17.878  17.589  1.00 11.06 ? 75  LEU A O     1 
ATOM   619  C  CB    . LEU A 1 78  ? 50.821 14.960  18.313  1.00 13.09 ? 75  LEU A CB    1 
ATOM   620  C  CG    . LEU A 1 78  ? 50.493 14.240  17.005  1.00 8.85  ? 75  LEU A CG    1 
ATOM   621  C  CD1   . LEU A 1 78  ? 51.658 13.357  16.571  1.00 10.05 ? 75  LEU A CD1   1 
ATOM   622  C  CD2   . LEU A 1 78  ? 49.230 13.414  17.196  1.00 11.98 ? 75  LEU A CD2   1 
ATOM   623  N  N     . LEU A 1 79  ? 52.189 17.176  16.172  1.00 6.21  ? 76  LEU A N     1 
ATOM   624  C  CA    . LEU A 1 79  ? 51.821 18.124  15.119  1.00 5.60  ? 76  LEU A CA    1 
ATOM   625  C  C     . LEU A 1 79  ? 50.938 17.415  14.092  1.00 11.77 ? 76  LEU A C     1 
ATOM   626  O  O     . LEU A 1 79  ? 51.097 16.227  13.847  1.00 10.08 ? 76  LEU A O     1 
ATOM   627  C  CB    . LEU A 1 79  ? 53.078 18.688  14.442  1.00 7.30  ? 76  LEU A CB    1 
ATOM   628  C  CG    . LEU A 1 79  ? 54.017 19.464  15.379  1.00 7.96  ? 76  LEU A CG    1 
ATOM   629  C  CD1   . LEU A 1 79  ? 55.206 20.034  14.633  1.00 10.77 ? 76  LEU A CD1   1 
ATOM   630  C  CD2   . LEU A 1 79  ? 53.274 20.562  16.142  1.00 10.90 ? 76  LEU A CD2   1 
ATOM   631  N  N     . LEU A 1 80  ? 50.021 18.155  13.475  1.00 10.63 ? 77  LEU A N     1 
ATOM   632  C  CA    . LEU A 1 80  ? 49.068 17.548  12.559  1.00 11.00 ? 77  LEU A CA    1 
ATOM   633  C  C     . LEU A 1 80  ? 49.072 18.255  11.214  1.00 12.50 ? 77  LEU A C     1 
ATOM   634  O  O     . LEU A 1 80  ? 49.194 19.480  11.138  1.00 16.11 ? 77  LEU A O     1 
ATOM   635  C  CB    . LEU A 1 80  ? 47.667 17.579  13.161  1.00 9.95  ? 77  LEU A CB    1 
ATOM   636  C  CG    . LEU A 1 80  ? 47.493 16.835  14.473  1.00 10.64 ? 77  LEU A CG    1 
ATOM   637  C  CD1   . LEU A 1 80  ? 46.076 17.011  14.993  1.00 18.07 ? 77  LEU A CD1   1 
ATOM   638  C  CD2   . LEU A 1 80  ? 47.831 15.349  14.292  1.00 12.78 ? 77  LEU A CD2   1 
ATOM   639  N  N     . ALA A 1 81  ? 48.954 17.469  10.153  1.00 7.56  ? 78  ALA A N     1 
ATOM   640  C  CA    . ALA A 1 81  ? 48.702 17.988  8.814   1.00 9.88  ? 78  ALA A CA    1 
ATOM   641  C  C     . ALA A 1 81  ? 47.383 17.401  8.330   1.00 11.56 ? 78  ALA A C     1 
ATOM   642  O  O     . ALA A 1 81  ? 47.129 16.217  8.505   1.00 11.64 ? 78  ALA A O     1 
ATOM   643  C  CB    . ALA A 1 81  ? 49.854 17.625  7.873   1.00 11.17 ? 78  ALA A CB    1 
ATOM   644  N  N     . GLN A 1 82  ? 46.528 18.233  7.746   1.00 9.61  ? 79  GLN A N     1 
ATOM   645  C  CA    . GLN A 1 82  ? 45.204 17.788  7.314   1.00 13.38 ? 79  GLN A CA    1 
ATOM   646  C  C     . GLN A 1 82  ? 45.172 17.444  5.833   1.00 11.18 ? 79  GLN A C     1 
ATOM   647  O  O     . GLN A 1 82  ? 45.693 18.198  5.010   1.00 11.74 ? 79  GLN A O     1 
ATOM   648  C  CB    . GLN A 1 82  ? 44.170 18.888  7.567   1.00 16.14 ? 79  GLN A CB    1 
ATOM   649  C  CG    . GLN A 1 82  ? 43.933 19.216  9.014   1.00 27.39 ? 79  GLN A CG    1 
ATOM   650  C  CD    . GLN A 1 82  ? 42.836 20.248  9.177   1.00 35.38 ? 79  GLN A CD    1 
ATOM   651  O  OE1   . GLN A 1 82  ? 43.088 21.376  9.604   1.00 31.96 ? 79  GLN A OE1   1 
ATOM   652  N  NE2   . GLN A 1 82  ? 41.611 19.869  8.821   1.00 36.72 ? 79  GLN A NE2   1 
ATOM   653  N  N     . VAL A 1 83  ? 44.549 16.314  5.503   1.00 8.20  ? 80  VAL A N     1 
ATOM   654  C  CA    . VAL A 1 83  ? 44.245 15.989  4.113   1.00 10.29 ? 80  VAL A CA    1 
ATOM   655  C  C     . VAL A 1 83  ? 43.340 17.063  3.532   1.00 15.38 ? 80  VAL A C     1 
ATOM   656  O  O     . VAL A 1 83  ? 42.405 17.533  4.180   1.00 10.11 ? 80  VAL A O     1 
ATOM   657  C  CB    . VAL A 1 83  ? 43.548 14.631  3.993   1.00 8.73  ? 80  VAL A CB    1 
ATOM   658  C  CG1   . VAL A 1 83  ? 43.172 14.337  2.558   1.00 11.72 ? 80  VAL A CG1   1 
ATOM   659  C  CG2   . VAL A 1 83  ? 44.466 13.530  4.547   1.00 9.65  ? 80  VAL A CG2   1 
ATOM   660  N  N     . ARG A 1 84  ? 43.638 17.452  2.302   1.00 10.58 ? 81  ARG A N     1 
ATOM   661  C  CA    . ARG A 1 84  ? 42.864 18.490  1.628   1.00 7.96  ? 81  ARG A CA    1 
ATOM   662  C  C     . ARG A 1 84  ? 41.415 18.047  1.454   1.00 10.32 ? 81  ARG A C     1 
ATOM   663  O  O     . ARG A 1 84  ? 41.132 16.860  1.273   1.00 11.40 ? 81  ARG A O     1 
ATOM   664  C  CB    . ARG A 1 84  ? 43.500 18.771  0.266   1.00 13.98 ? 81  ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 84  ? 42.642 19.605  -0.674  1.00 14.86 ? 81  ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 84  ? 43.390 19.812  -1.982  1.00 26.53 ? 81  ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 84  ? 42.587 20.490  -2.993  1.00 40.32 ? 81  ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 84  ? 42.930 20.567  -4.275  1.00 53.47 ? 81  ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 84  ? 44.058 20.002  -4.692  1.00 37.84 ? 81  ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 84  ? 42.146 21.198  -5.141  1.00 47.59 ? 81  ARG A NH2   1 
ATOM   671  N  N     . GLU A 1 85  ? 40.494 19.002  1.538   1.00 11.23 ? 82  GLU A N     1 
ATOM   672  C  CA    . GLU A 1 85  ? 39.098 18.708  1.289   1.00 13.41 ? 82  GLU A CA    1 
ATOM   673  C  C     . GLU A 1 85  ? 38.627 19.477  0.077   1.00 12.20 ? 82  GLU A C     1 
ATOM   674  O  O     . GLU A 1 85  ? 38.863 20.677  -0.026  1.00 16.32 ? 82  GLU A O     1 
ATOM   675  C  CB    . GLU A 1 85  ? 38.250 19.038  2.517   1.00 14.77 ? 82  GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 85  ? 38.289 17.929  3.560   1.00 16.29 ? 82  GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 85  ? 37.583 18.300  4.853   1.00 32.21 ? 82  GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 85  ? 36.365 18.595  4.822   1.00 31.23 ? 82  GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 85  ? 38.260 18.289  5.905   1.00 33.41 ? 82  GLU A OE2   1 
ATOM   680  N  N     . SER A 1 86  ? 37.976 18.768  -0.845  1.00 12.10 ? 83  SER A N     1 
ATOM   681  C  CA    . SER A 1 86  ? 37.383 19.362  -2.040  1.00 12.67 ? 83  SER A CA    1 
ATOM   682  C  C     . SER A 1 86  ? 36.002 18.770  -2.241  1.00 15.32 ? 83  SER A C     1 
ATOM   683  O  O     . SER A 1 86  ? 35.819 17.572  -2.102  1.00 13.47 ? 83  SER A O     1 
ATOM   684  C  CB    . SER A 1 86  ? 38.220 19.038  -3.276  1.00 17.16 ? 83  SER A CB    1 
ATOM   685  O  OG    . SER A 1 86  ? 39.534 19.532  -3.139  1.00 22.45 ? 83  SER A OG    1 
ATOM   686  N  N     . ARG A 1 87  ? 35.032 19.612  -2.581  1.00 17.43 ? 84  ARG A N     1 
ATOM   687  C  CA    . ARG A 1 87  ? 33.673 19.142  -2.829  1.00 15.64 ? 84  ARG A CA    1 
ATOM   688  C  C     . ARG A 1 87  ? 33.114 18.344  -1.663  1.00 17.47 ? 84  ARG A C     1 
ATOM   689  O  O     . ARG A 1 87  ? 32.397 17.357  -1.858  1.00 22.40 ? 84  ARG A O     1 
ATOM   690  C  CB    . ARG A 1 87  ? 33.614 18.332  -4.128  1.00 20.52 ? 84  ARG A CB    1 
ATOM   691  C  CG    . ARG A 1 87  ? 34.048 19.119  -5.351  1.00 27.28 ? 84  ARG A CG    1 
ATOM   692  C  CD    . ARG A 1 87  ? 33.848 18.319  -6.630  1.00 24.73 ? 84  ARG A CD    1 
ATOM   693  N  NE    . ARG A 1 87  ? 35.104 18.165  -7.356  1.00 34.21 ? 84  ARG A NE    1 
ATOM   694  C  CZ    . ARG A 1 87  ? 35.459 18.910  -8.395  1.00 34.05 ? 84  ARG A CZ    1 
ATOM   695  N  NH1   . ARG A 1 87  ? 34.643 19.858  -8.843  1.00 43.82 ? 84  ARG A NH1   1 
ATOM   696  N  NH2   . ARG A 1 87  ? 36.628 18.705  -8.992  1.00 39.35 ? 84  ARG A NH2   1 
ATOM   697  N  N     . GLY A 1 88  ? 33.449 18.765  -0.446  1.00 13.91 ? 85  GLY A N     1 
ATOM   698  C  CA    . GLY A 1 88  ? 32.932 18.142  0.757   1.00 19.58 ? 85  GLY A CA    1 
ATOM   699  C  C     . GLY A 1 88  ? 33.569 16.834  1.196   1.00 16.10 ? 85  GLY A C     1 
ATOM   700  O  O     . GLY A 1 88  ? 33.093 16.204  2.146   1.00 16.58 ? 85  GLY A O     1 
ATOM   701  N  N     . LYS A 1 89  ? 34.645 16.425  0.522   1.00 11.43 ? 86  LYS A N     1 
ATOM   702  C  CA    . LYS A 1 89  ? 35.282 15.147  0.827   1.00 11.32 ? 86  LYS A CA    1 
ATOM   703  C  C     . LYS A 1 89  ? 36.811 15.220  0.825   1.00 11.60 ? 86  LYS A C     1 
ATOM   704  O  O     . LYS A 1 89  ? 37.410 16.113  0.228   1.00 9.89  ? 86  LYS A O     1 
ATOM   705  C  CB    . LYS A 1 89  ? 34.821 14.068  -0.155  1.00 18.26 ? 86  LYS A CB    1 
ATOM   706  C  CG    . LYS A 1 89  ? 35.348 14.257  -1.566  1.00 17.61 ? 86  LYS A CG    1 
ATOM   707  C  CD    . LYS A 1 89  ? 34.879 13.145  -2.515  1.00 16.72 ? 86  LYS A CD    1 
ATOM   708  C  CE    . LYS A 1 89  ? 35.491 11.791  -2.176  1.00 14.19 ? 86  LYS A CE    1 
ATOM   709  N  NZ    . LYS A 1 89  ? 36.989 11.785  -2.287  1.00 13.70 ? 86  LYS A NZ    1 
ATOM   710  N  N     . ALA A 1 90  ? 37.443 14.257  1.478   1.00 13.15 ? 87  ALA A N     1 
ATOM   711  C  CA    . ALA A 1 90  ? 38.898 14.197  1.492   1.00 10.89 ? 87  ALA A CA    1 
ATOM   712  C  C     . ALA A 1 90  ? 39.362 13.980  0.070   1.00 12.26 ? 87  ALA A C     1 
ATOM   713  O  O     . ALA A 1 90  ? 38.750 13.222  -0.684  1.00 16.39 ? 87  ALA A O     1 
ATOM   714  C  CB    . ALA A 1 90  ? 39.380 13.072  2.383   1.00 17.13 ? 87  ALA A CB    1 
ATOM   715  N  N     . ASN A 1 91  ? 40.421 14.687  -0.302  1.00 11.15 ? 88  ASN A N     1 
ATOM   716  C  CA    . ASN A 1 91  ? 40.977 14.577  -1.645  1.00 15.22 ? 88  ASN A CA    1 
ATOM   717  C  C     . ASN A 1 91  ? 42.445 14.177  -1.578  1.00 15.32 ? 88  ASN A C     1 
ATOM   718  O  O     . ASN A 1 91  ? 43.272 14.919  -1.052  1.00 13.43 ? 88  ASN A O     1 
ATOM   719  C  CB    . ASN A 1 91  ? 40.815 15.905  -2.383  1.00 13.73 ? 88  ASN A CB    1 
ATOM   720  C  CG    . ASN A 1 91  ? 41.209 15.809  -3.834  1.00 23.97 ? 88  ASN A CG    1 
ATOM   721  O  OD1   . ASN A 1 91  ? 42.308 15.380  -4.152  1.00 14.55 ? 88  ASN A OD1   1 
ATOM   722  N  ND2   . ASN A 1 91  ? 40.293 16.169  -4.728  1.00 31.58 ? 88  ASN A ND2   1 
ATOM   723  N  N     . LEU A 1 92  ? 42.771 12.998  -2.097  1.00 13.50 ? 89  LEU A N     1 
ATOM   724  C  CA    . LEU A 1 92  ? 44.118 12.452  -1.902  1.00 13.28 ? 89  LEU A CA    1 
ATOM   725  C  C     . LEU A 1 92  ? 45.068 12.740  -3.052  1.00 13.24 ? 89  LEU A C     1 
ATOM   726  O  O     . LEU A 1 92  ? 46.108 12.087  -3.182  1.00 10.35 ? 89  LEU A O     1 
ATOM   727  C  CB    . LEU A 1 92  ? 44.051 10.941  -1.655  1.00 11.32 ? 89  LEU A CB    1 
ATOM   728  C  CG    . LEU A 1 92  ? 43.151 10.499  -0.502  1.00 13.89 ? 89  LEU A CG    1 
ATOM   729  C  CD1   . LEU A 1 92  ? 43.058 8.997   -0.451  1.00 14.50 ? 89  LEU A CD1   1 
ATOM   730  C  CD2   . LEU A 1 92  ? 43.700 11.051  0.802   1.00 14.44 ? 89  LEU A CD2   1 
ATOM   731  N  N     . THR A 1 93  ? 44.726 13.720  -3.882  1.00 9.87  ? 90  THR A N     1 
ATOM   732  C  CA    . THR A 1 93  ? 45.534 14.001  -5.067  1.00 12.16 ? 90  THR A CA    1 
ATOM   733  C  C     . THR A 1 93  ? 47.028 14.239  -4.800  1.00 11.45 ? 90  THR A C     1 
ATOM   734  O  O     . THR A 1 93  ? 47.881 13.705  -5.515  1.00 11.34 ? 90  THR A O     1 
ATOM   735  C  CB    . THR A 1 93  ? 44.926 15.155  -5.884  1.00 15.74 ? 90  THR A CB    1 
ATOM   736  O  OG1   . THR A 1 93  ? 43.625 14.752  -6.338  1.00 20.36 ? 90  THR A OG1   1 
ATOM   737  C  CG2   . THR A 1 93  ? 45.795 15.484  -7.093  1.00 12.92 ? 90  THR A CG2   1 
ATOM   738  N  N     . LYS A 1 94  ? 47.344 15.017  -3.767  1.00 9.86  ? 91  LYS A N     1 
ATOM   739  C  CA    . LYS A 1 94  ? 48.737 15.334  -3.460  1.00 9.70  ? 91  LYS A CA    1 
ATOM   740  C  C     . LYS A 1 94  ? 49.581 14.071  -3.257  1.00 9.05  ? 91  LYS A C     1 
ATOM   741  O  O     . LYS A 1 94  ? 50.745 14.009  -3.681  1.00 10.56 ? 91  LYS A O     1 
ATOM   742  C  CB    . LYS A 1 94  ? 48.823 16.222  -2.213  1.00 11.08 ? 91  LYS A CB    1 
ATOM   743  C  CG    . LYS A 1 94  ? 50.227 16.724  -1.907  1.00 12.87 ? 91  LYS A CG    1 
ATOM   744  C  CD    . LYS A 1 94  ? 50.331 17.206  -0.461  1.00 12.40 ? 91  LYS A CD    1 
ATOM   745  C  CE    . LYS A 1 94  ? 49.428 18.397  -0.205  1.00 21.99 ? 91  LYS A CE    1 
ATOM   746  N  NZ    . LYS A 1 94  ? 49.576 18.887  1.189   1.00 9.99  ? 91  LYS A NZ    1 
ATOM   747  N  N     . TYR A 1 95  ? 48.990 13.061  -2.624  1.00 8.33  ? 92  TYR A N     1 
ATOM   748  C  CA    . TYR A 1 95  ? 49.710 11.839  -2.301  1.00 5.75  ? 92  TYR A CA    1 
ATOM   749  C  C     . TYR A 1 95  ? 49.820 10.946  -3.532  1.00 9.22  ? 92  TYR A C     1 
ATOM   750  O  O     . TYR A 1 95  ? 50.856 10.307  -3.760  1.00 11.90 ? 92  TYR A O     1 
ATOM   751  C  CB    . TYR A 1 95  ? 49.047 11.107  -1.117  1.00 6.92  ? 92  TYR A CB    1 
ATOM   752  C  CG    . TYR A 1 95  ? 48.741 12.087  -0.019  1.00 5.56  ? 92  TYR A CG    1 
ATOM   753  C  CD1   . TYR A 1 95  ? 47.444 12.495  0.210   1.00 10.46 ? 92  TYR A CD1   1 
ATOM   754  C  CD2   . TYR A 1 95  ? 49.767 12.662  0.741   1.00 7.66  ? 92  TYR A CD2   1 
ATOM   755  C  CE1   . TYR A 1 95  ? 47.154 13.439  1.165   1.00 9.35  ? 92  TYR A CE1   1 
ATOM   756  C  CE2   . TYR A 1 95  ? 49.482 13.589  1.712   1.00 8.79  ? 92  TYR A CE2   1 
ATOM   757  C  CZ    . TYR A 1 95  ? 48.164 13.977  1.909   1.00 10.00 ? 92  TYR A CZ    1 
ATOM   758  O  OH    . TYR A 1 95  ? 47.825 14.916  2.858   1.00 11.09 ? 92  TYR A OH    1 
ATOM   759  N  N     . ARG A 1 96  ? 48.768 10.922  -4.346  1.00 8.20  ? 93  ARG A N     1 
ATOM   760  C  CA    . ARG A 1 96  ? 48.842 10.192  -5.627  1.00 9.37  ? 93  ARG A CA    1 
ATOM   761  C  C     . ARG A 1 96  ? 49.927 10.750  -6.550  1.00 14.91 ? 93  ARG A C     1 
ATOM   762  O  O     . ARG A 1 96  ? 50.642 9.992   -7.224  1.00 11.85 ? 93  ARG A O     1 
ATOM   763  C  CB    . ARG A 1 96  ? 47.483 10.186  -6.340  1.00 10.18 ? 93  ARG A CB    1 
ATOM   764  C  CG    . ARG A 1 96  ? 46.426 9.381   -5.613  1.00 12.75 ? 93  ARG A CG    1 
ATOM   765  C  CD    . ARG A 1 96  ? 45.188 9.121   -6.476  1.00 10.36 ? 93  ARG A CD    1 
ATOM   766  N  NE    . ARG A 1 96  ? 44.168 8.429   -5.692  1.00 15.78 ? 93  ARG A NE    1 
ATOM   767  C  CZ    . ARG A 1 96  ? 43.125 9.016   -5.111  1.00 13.02 ? 93  ARG A CZ    1 
ATOM   768  N  NH1   . ARG A 1 96  ? 42.280 8.278   -4.395  1.00 12.96 ? 93  ARG A NH1   1 
ATOM   769  N  NH2   . ARG A 1 96  ? 42.919 10.324  -5.250  1.00 11.82 ? 93  ARG A NH2   1 
ATOM   770  N  N     . GLU A 1 97  ? 50.044 12.071  -6.587  1.00 10.60 ? 94  GLU A N     1 
ATOM   771  C  CA    . GLU A 1 97  ? 51.045 12.722  -7.433  1.00 12.47 ? 94  GLU A CA    1 
ATOM   772  C  C     . GLU A 1 97  ? 52.445 12.443  -6.909  1.00 15.02 ? 94  GLU A C     1 
ATOM   773  O  O     . GLU A 1 97  ? 53.367 12.186  -7.694  1.00 10.02 ? 94  GLU A O     1 
ATOM   774  C  CB    . GLU A 1 97  ? 50.763 14.211  -7.562  1.00 14.27 ? 94  GLU A CB    1 
ATOM   775  C  CG    . GLU A 1 97  ? 49.475 14.462  -8.333  1.00 16.43 ? 94  GLU A CG    1 
ATOM   776  C  CD    . GLU A 1 97  ? 49.138 15.926  -8.502  1.00 30.21 ? 94  GLU A CD    1 
ATOM   777  O  OE1   . GLU A 1 97  ? 49.788 16.772  -7.854  1.00 38.51 ? 94  GLU A OE1   1 
ATOM   778  O  OE2   . GLU A 1 97  ? 48.214 16.229  -9.289  1.00 35.78 ? 94  GLU A OE2   1 
ATOM   779  N  N     . ALA A 1 98  ? 52.595 12.443  -5.583  1.00 10.19 ? 95  ALA A N     1 
ATOM   780  C  CA    . ALA A 1 98  ? 53.885 12.106  -4.981  1.00 9.44  ? 95  ALA A CA    1 
ATOM   781  C  C     . ALA A 1 98  ? 54.264 10.661  -5.306  1.00 9.10  ? 95  ALA A C     1 
ATOM   782  O  O     . ALA A 1 98  ? 55.432 10.340  -5.536  1.00 10.12 ? 95  ALA A O     1 
ATOM   783  C  CB    . ALA A 1 98  ? 53.852 12.325  -3.475  1.00 8.08  ? 95  ALA A CB    1 
ATOM   784  N  N     . SER A 1 99  ? 53.266 9.785   -5.329  1.00 9.25  ? 96  SER A N     1 
ATOM   785  C  CA    . SER A 1 99  ? 53.487 8.380   -5.648  1.00 9.16  ? 96  SER A CA    1 
ATOM   786  C  C     . SER A 1 99  ? 54.027 8.238   -7.074  1.00 9.06  ? 96  SER A C     1 
ATOM   787  O  O     . SER A 1 99  ? 54.966 7.483   -7.331  1.00 10.36 ? 96  SER A O     1 
ATOM   788  C  CB    . SER A 1 99  ? 52.172 7.610   -5.524  1.00 12.47 ? 96  SER A CB    1 
ATOM   789  O  OG    . SER A 1 99  ? 52.326 6.264   -5.915  1.00 17.19 ? 96  SER A OG    1 
ATOM   790  N  N     . VAL A 1 100 ? 53.424 8.960   -8.008  1.00 10.72 ? 97  VAL A N     1 
ATOM   791  C  CA    . VAL A 1 100 ? 53.934 8.915   -9.388  1.00 9.56  ? 97  VAL A CA    1 
ATOM   792  C  C     . VAL A 1 100 ? 55.409 9.316   -9.466  1.00 12.74 ? 97  VAL A C     1 
ATOM   793  O  O     . VAL A 1 100 ? 56.178 8.701   -10.209 1.00 12.33 ? 97  VAL A O     1 
ATOM   794  C  CB    . VAL A 1 100 ? 53.071 9.776   -10.331 1.00 11.48 ? 97  VAL A CB    1 
ATOM   795  C  CG1   . VAL A 1 100 ? 53.736 9.889   -11.723 1.00 16.90 ? 97  VAL A CG1   1 
ATOM   796  C  CG2   . VAL A 1 100 ? 51.669 9.165   -10.444 1.00 13.31 ? 97  VAL A CG2   1 
ATOM   797  N  N     . GLU A 1 101 ? 55.814 10.332  -8.698  1.00 7.91  ? 98  GLU A N     1 
ATOM   798  C  CA    . GLU A 1 101 ? 57.224 10.751  -8.655  1.00 12.48 ? 98  GLU A CA    1 
ATOM   799  C  C     . GLU A 1 101 ? 58.134 9.574   -8.345  1.00 11.77 ? 98  GLU A C     1 
ATOM   800  O  O     . GLU A 1 101 ? 59.173 9.382   -8.980  1.00 11.89 ? 98  GLU A O     1 
ATOM   801  C  CB    . GLU A 1 101 ? 57.476 11.799  -7.566  1.00 13.50 ? 98  GLU A CB    1 
ATOM   802  C  CG    . GLU A 1 101 ? 57.053 13.226  -7.877  1.00 16.58 ? 98  GLU A CG    1 
ATOM   803  C  CD    . GLU A 1 101 ? 57.391 14.178  -6.730  1.00 16.41 ? 98  GLU A CD    1 
ATOM   804  O  OE1   . GLU A 1 101 ? 58.587 14.549  -6.576  1.00 12.74 ? 98  GLU A OE1   1 
ATOM   805  O  OE2   . GLU A 1 101 ? 56.457 14.551  -5.978  1.00 16.84 ? 98  GLU A OE2   1 
ATOM   806  N  N     . VAL A 1 102 ? 57.747 8.801   -7.337  1.00 9.11  ? 99  VAL A N     1 
ATOM   807  C  CA    . VAL A 1 102 ? 58.579 7.702   -6.901  1.00 7.98  ? 99  VAL A CA    1 
ATOM   808  C  C     . VAL A 1 102 ? 58.549 6.543   -7.875  1.00 9.63  ? 99  VAL A C     1 
ATOM   809  O  O     . VAL A 1 102 ? 59.591 5.965   -8.186  1.00 10.43 ? 99  VAL A O     1 
ATOM   810  C  CB    . VAL A 1 102 ? 58.175 7.233   -5.503  1.00 9.62  ? 99  VAL A CB    1 
ATOM   811  C  CG1   . VAL A 1 102 ? 58.949 5.978   -5.136  1.00 14.08 ? 99  VAL A CG1   1 
ATOM   812  C  CG2   . VAL A 1 102 ? 58.431 8.367   -4.506  1.00 9.48  ? 99  VAL A CG2   1 
ATOM   813  N  N     . MET A 1 103 ? 57.360 6.209   -8.363  1.00 7.34  ? 100 MET A N     1 
ATOM   814  C  CA    . MET A 1 103 ? 57.200 5.104   -9.302  1.00 7.95  ? 100 MET A CA    1 
ATOM   815  C  C     . MET A 1 103 ? 58.001 5.352   -10.577 1.00 12.47 ? 100 MET A C     1 
ATOM   816  O  O     . MET A 1 103 ? 58.595 4.423   -11.121 1.00 11.42 ? 100 MET A O     1 
ATOM   817  C  CB    . MET A 1 103 ? 55.729 4.869   -9.653  1.00 16.45 ? 100 MET A CB    1 
ATOM   818  C  CG    . MET A 1 103 ? 54.825 4.588   -8.457  1.00 19.59 ? 100 MET A CG    1 
ATOM   819  S  SD    . MET A 1 103 ? 55.170 3.000   -7.670  1.00 21.96 ? 100 MET A SD    1 
ATOM   820  C  CE    . MET A 1 103 ? 54.242 3.146   -6.131  1.00 17.68 ? 100 MET A CE    1 
ATOM   821  N  N     . GLU A 1 104 ? 58.006 6.597   -11.054 1.00 9.21  ? 101 GLU A N     1 
ATOM   822  C  CA    . GLU A 1 104 ? 58.772 6.937   -12.258 1.00 12.01 ? 101 GLU A CA    1 
ATOM   823  C  C     . GLU A 1 104 ? 60.281 6.734   -12.093 1.00 12.37 ? 101 GLU A C     1 
ATOM   824  O  O     . GLU A 1 104 ? 60.948 6.211   -12.998 1.00 11.85 ? 101 GLU A O     1 
ATOM   825  C  CB    . GLU A 1 104 ? 58.397 8.342   -12.778 1.00 13.30 ? 101 GLU A CB    1 
ATOM   826  C  CG    . GLU A 1 104 ? 57.004 8.358   -13.418 1.00 19.84 ? 101 GLU A CG    1 
ATOM   827  C  CD    . GLU A 1 104 ? 56.589 9.716   -13.981 1.00 30.66 ? 101 GLU A CD    1 
ATOM   828  O  OE1   . GLU A 1 104 ? 57.297 10.722  -13.739 1.00 31.22 ? 101 GLU A OE1   1 
ATOM   829  O  OE2   . GLU A 1 104 ? 55.538 9.768   -14.662 1.00 33.71 ? 101 GLU A OE2   1 
ATOM   830  N  N     . ILE A 1 105 ? 60.815 7.095   -10.930 1.00 11.70 ? 102 ILE A N     1 
ATOM   831  C  CA    . ILE A 1 105 ? 62.213 6.808   -10.614 1.00 10.52 ? 102 ILE A CA    1 
ATOM   832  C  C     . ILE A 1 105 ? 62.485 5.302   -10.555 1.00 10.77 ? 102 ILE A C     1 
ATOM   833  O  O     . ILE A 1 105 ? 63.423 4.798   -11.191 1.00 12.22 ? 102 ILE A O     1 
ATOM   834  C  CB    . ILE A 1 105 ? 62.631 7.482   -9.300  1.00 12.21 ? 102 ILE A CB    1 
ATOM   835  C  CG1   . ILE A 1 105 ? 62.564 9.001   -9.458  1.00 11.91 ? 102 ILE A CG1   1 
ATOM   836  C  CG2   . ILE A 1 105 ? 64.036 7.057   -8.892  1.00 13.13 ? 102 ILE A CG2   1 
ATOM   837  C  CD1   . ILE A 1 105 ? 62.444 9.736   -8.132  1.00 16.69 ? 102 ILE A CD1   1 
ATOM   838  N  N     . MET A 1 106 ? 61.667 4.565   -9.813  1.00 9.85  ? 103 MET A N     1 
ATOM   839  C  CA    . MET A 1 106 ? 61.870 3.119   -9.765  1.00 7.80  ? 103 MET A CA    1 
ATOM   840  C  C     . MET A 1 106 ? 61.878 2.478   -11.147 1.00 11.41 ? 103 MET A C     1 
ATOM   841  O  O     . MET A 1 106 ? 62.670 1.582   -11.413 1.00 11.76 ? 103 MET A O     1 
ATOM   842  C  CB    . MET A 1 106 ? 60.808 2.456   -8.881  1.00 8.55  ? 103 MET A CB    1 
ATOM   843  C  CG    . MET A 1 106 ? 60.982 2.840   -7.434  1.00 11.62 ? 103 MET A CG    1 
ATOM   844  S  SD    . MET A 1 106 ? 59.882 1.907   -6.368  1.00 18.00 ? 103 MET A SD    1 
ATOM   845  C  CE    . MET A 1 106 ? 58.338 2.706   -6.724  1.00 25.75 ? 103 MET A CE    1 
ATOM   846  N  N     . SER A 1 107 ? 60.994 2.942   -12.021 1.00 10.45 ? 104 SER A N     1 
ATOM   847  C  CA    . SER A 1 107 ? 60.868 2.384   -13.357 1.00 13.12 ? 104 SER A CA    1 
ATOM   848  C  C     . SER A 1 107 ? 62.130 2.528   -14.204 1.00 13.55 ? 104 SER A C     1 
ATOM   849  O  O     . SER A 1 107 ? 62.242 1.861   -15.234 1.00 14.39 ? 104 SER A O     1 
ATOM   850  C  CB    . SER A 1 107 ? 59.679 3.018   -14.090 1.00 16.46 ? 104 SER A CB    1 
ATOM   851  O  OG    . SER A 1 107 ? 58.461 2.599   -13.511 1.00 23.40 ? 104 SER A OG    1 
ATOM   852  N  N     . ARG A 1 108 ? 63.068 3.387   -13.797 1.00 13.57 ? 105 ARG A N     1 
ATOM   853  C  CA    . ARG A 1 108 ? 64.313 3.546   -14.564 1.00 13.58 ? 105 ARG A CA    1 
ATOM   854  C  C     . ARG A 1 108 ? 65.221 2.342   -14.376 1.00 20.81 ? 105 ARG A C     1 
ATOM   855  O  O     . ARG A 1 108 ? 66.061 2.034   -15.230 1.00 19.48 ? 105 ARG A O     1 
ATOM   856  C  CB    . ARG A 1 108 ? 65.084 4.812   -14.169 1.00 17.90 ? 105 ARG A CB    1 
ATOM   857  C  CG    . ARG A 1 108 ? 64.355 6.110   -14.436 1.00 13.60 ? 105 ARG A CG    1 
ATOM   858  C  CD    . ARG A 1 108 ? 65.334 7.269   -14.569 1.00 24.32 ? 105 ARG A CD    1 
ATOM   859  N  NE    . ARG A 1 108 ? 66.302 7.319   -13.481 1.00 25.99 ? 105 ARG A NE    1 
ATOM   860  C  CZ    . ARG A 1 108 ? 66.270 8.201   -12.484 1.00 20.92 ? 105 ARG A CZ    1 
ATOM   861  N  NH1   . ARG A 1 108 ? 67.198 8.164   -11.544 1.00 25.14 ? 105 ARG A NH1   1 
ATOM   862  N  NH2   . ARG A 1 108 ? 65.313 9.122   -12.434 1.00 23.57 ? 105 ARG A NH2   1 
ATOM   863  N  N     . PHE A 1 109 ? 65.044 1.659   -13.254 1.00 15.56 ? 106 PHE A N     1 
ATOM   864  C  CA    . PHE A 1 109 ? 65.932 0.563   -12.887 1.00 16.57 ? 106 PHE A CA    1 
ATOM   865  C  C     . PHE A 1 109 ? 65.387 -0.771  -13.366 1.00 20.72 ? 106 PHE A C     1 
ATOM   866  O  O     . PHE A 1 109 ? 66.149 -1.678  -13.711 1.00 20.22 ? 106 PHE A O     1 
ATOM   867  C  CB    . PHE A 1 109 ? 66.125 0.534   -11.375 1.00 15.19 ? 106 PHE A CB    1 
ATOM   868  C  CG    . PHE A 1 109 ? 66.888 1.710   -10.838 1.00 19.40 ? 106 PHE A CG    1 
ATOM   869  C  CD1   . PHE A 1 109 ? 66.263 2.934   -10.644 1.00 13.29 ? 106 PHE A CD1   1 
ATOM   870  C  CD2   . PHE A 1 109 ? 68.227 1.589   -10.516 1.00 15.08 ? 106 PHE A CD2   1 
ATOM   871  C  CE1   . PHE A 1 109 ? 66.961 4.016   -10.142 1.00 15.54 ? 106 PHE A CE1   1 
ATOM   872  C  CE2   . PHE A 1 109 ? 68.931 2.659   -10.012 1.00 17.88 ? 106 PHE A CE2   1 
ATOM   873  C  CZ    . PHE A 1 109 ? 68.300 3.883   -9.823  1.00 17.61 ? 106 PHE A CZ    1 
ATOM   874  N  N     . ALA A 1 110 ? 64.068 -0.891  -13.396 1.00 18.88 ? 107 ALA A N     1 
ATOM   875  C  CA    . ALA A 1 110 ? 63.442 -2.160  -13.722 1.00 17.75 ? 107 ALA A CA    1 
ATOM   876  C  C     . ALA A 1 110 ? 61.940 -2.040  -13.863 1.00 19.82 ? 107 ALA A C     1 
ATOM   877  O  O     . ALA A 1 110 ? 61.336 -1.043  -13.472 1.00 19.55 ? 107 ALA A O     1 
ATOM   878  C  CB    . ALA A 1 110 ? 63.769 -3.196  -12.659 1.00 20.93 ? 107 ALA A CB    1 
ATOM   879  N  N     . VAL A 1 111 ? 61.347 -3.080  -14.429 1.00 26.20 ? 108 VAL A N     1 
ATOM   880  C  CA    . VAL A 1 111 ? 59.906 -3.228  -14.484 1.00 29.20 ? 108 VAL A CA    1 
ATOM   881  C  C     . VAL A 1 111 ? 59.351 -3.293  -13.065 1.00 18.37 ? 108 VAL A C     1 
ATOM   882  O  O     . VAL A 1 111 ? 59.879 -4.013  -12.211 1.00 23.36 ? 108 VAL A O     1 
ATOM   883  C  CB    . VAL A 1 111 ? 59.530 -4.524  -15.218 1.00 36.01 ? 108 VAL A CB    1 
ATOM   884  C  CG1   . VAL A 1 111 ? 58.077 -4.909  -14.931 1.00 34.25 ? 108 VAL A CG1   1 
ATOM   885  C  CG2   . VAL A 1 111 ? 59.791 -4.375  -16.711 1.00 36.70 ? 108 VAL A CG2   1 
ATOM   886  N  N     . ILE A 1 112 ? 58.306 -2.517  -12.799 1.00 24.00 ? 109 ILE A N     1 
ATOM   887  C  CA    . ILE A 1 112 ? 57.710 -2.535  -11.469 1.00 16.71 ? 109 ILE A CA    1 
ATOM   888  C  C     . ILE A 1 112 ? 56.246 -2.930  -11.508 1.00 14.21 ? 109 ILE A C     1 
ATOM   889  O  O     . ILE A 1 112 ? 55.572 -2.748  -12.520 1.00 13.55 ? 109 ILE A O     1 
ATOM   890  C  CB    . ILE A 1 112 ? 57.834 -1.167  -10.747 1.00 17.47 ? 109 ILE A CB    1 
ATOM   891  C  CG1   . ILE A 1 112 ? 56.849 -0.158  -11.323 1.00 17.48 ? 109 ILE A CG1   1 
ATOM   892  C  CG2   . ILE A 1 112 ? 59.275 -0.647  -10.790 1.00 23.03 ? 109 ILE A CG2   1 
ATOM   893  C  CD1   . ILE A 1 112 ? 56.853 1.189   -10.589 1.00 18.28 ? 109 ILE A CD1   1 
ATOM   894  N  N     . GLU A 1 113 ? 55.783 -3.501  -10.400 1.00 7.90  ? 110 GLU A N     1 
ATOM   895  C  CA    . GLU A 1 113 ? 54.368 -3.731  -10.151 1.00 9.79  ? 110 GLU A CA    1 
ATOM   896  C  C     . GLU A 1 113 ? 53.945 -2.804  -9.026  1.00 8.91  ? 110 GLU A C     1 
ATOM   897  O  O     . GLU A 1 113 ? 54.411 -2.938  -7.884  1.00 11.07 ? 110 GLU A O     1 
ATOM   898  C  CB    . GLU A 1 113 ? 54.102 -5.186  -9.735  1.00 13.11 ? 110 GLU A CB    1 
ATOM   899  C  CG    . GLU A 1 113 ? 52.635 -5.455  -9.413  1.00 10.84 ? 110 GLU A CG    1 
ATOM   900  C  CD    . GLU A 1 113 ? 52.364 -6.868  -8.908  1.00 20.44 ? 110 GLU A CD    1 
ATOM   901  O  OE1   . GLU A 1 113 ? 51.303 -7.087  -8.282  1.00 19.20 ? 110 GLU A OE1   1 
ATOM   902  O  OE2   . GLU A 1 113 ? 53.199 -7.763  -9.141  1.00 14.75 ? 110 GLU A OE2   1 
ATOM   903  N  N     . ARG A 1 114 ? 53.084 -1.843  -9.343  1.00 9.54  ? 111 ARG A N     1 
ATOM   904  C  CA    . ARG A 1 114 ? 52.542 -0.958  -8.306  1.00 8.89  ? 111 ARG A CA    1 
ATOM   905  C  C     . ARG A 1 114 ? 51.658 -1.778  -7.380  1.00 13.94 ? 111 ARG A C     1 
ATOM   906  O  O     . ARG A 1 114 ? 50.655 -2.346  -7.808  1.00 19.36 ? 111 ARG A O     1 
ATOM   907  C  CB    . ARG A 1 114 ? 51.736 0.180   -8.938  1.00 14.16 ? 111 ARG A CB    1 
ATOM   908  C  CG    . ARG A 1 114 ? 51.122 1.155   -7.926  1.00 14.81 ? 111 ARG A CG    1 
ATOM   909  C  CD    . ARG A 1 114 ? 50.062 2.019   -8.609  1.00 18.80 ? 111 ARG A CD    1 
ATOM   910  N  NE    . ARG A 1 114 ? 49.742 3.251   -7.889  1.00 18.73 ? 111 ARG A NE    1 
ATOM   911  C  CZ    . ARG A 1 114 ? 48.759 3.369   -6.998  1.00 23.39 ? 111 ARG A CZ    1 
ATOM   912  N  NH1   . ARG A 1 114 ? 48.003 2.321   -6.689  1.00 25.76 ? 111 ARG A NH1   1 
ATOM   913  N  NH2   . ARG A 1 114 ? 48.542 4.535   -6.401  1.00 20.28 ? 111 ARG A NH2   1 
ATOM   914  N  N     . ALA A 1 115 ? 52.026 -1.856  -6.107  1.00 10.18 ? 112 ALA A N     1 
ATOM   915  C  CA    . ALA A 1 115 ? 51.285 -2.676  -5.174  1.00 10.49 ? 112 ALA A CA    1 
ATOM   916  C  C     . ALA A 1 115 ? 50.329 -1.856  -4.324  1.00 14.64 ? 112 ALA A C     1 
ATOM   917  O  O     . ALA A 1 115 ? 49.363 -2.389  -3.766  1.00 17.91 ? 112 ALA A O     1 
ATOM   918  C  CB    . ALA A 1 115 ? 52.240 -3.442  -4.284  1.00 13.11 ? 112 ALA A CB    1 
ATOM   919  N  N     . SER A 1 116 ? 50.620 -0.570  -4.208  1.00 11.49 ? 113 SER A N     1 
ATOM   920  C  CA    . SER A 1 116 ? 49.786 0.333   -3.437  1.00 12.17 ? 113 SER A CA    1 
ATOM   921  C  C     . SER A 1 116 ? 50.250 1.749   -3.724  1.00 10.84 ? 113 SER A C     1 
ATOM   922  O  O     . SER A 1 116 ? 51.174 1.961   -4.508  1.00 12.36 ? 113 SER A O     1 
ATOM   923  C  CB    . SER A 1 116 ? 49.926 0.033   -1.940  1.00 18.16 ? 113 SER A CB    1 
ATOM   924  O  OG    A SER A 1 116 ? 51.158 0.520   -1.434  0.50 9.76  ? 113 SER A OG    1 
ATOM   925  O  OG    B SER A 1 116 ? 49.059 0.835   -1.159  0.50 20.44 ? 113 SER A OG    1 
ATOM   926  N  N     . ILE A 1 117 ? 49.649 2.725   -3.054  1.00 11.87 ? 114 ILE A N     1 
ATOM   927  C  CA    . ILE A 1 117 ? 50.053 4.101   -3.280  1.00 8.57  ? 114 ILE A CA    1 
ATOM   928  C  C     . ILE A 1 117 ? 51.550 4.350   -3.017  1.00 11.55 ? 114 ILE A C     1 
ATOM   929  O  O     . ILE A 1 117 ? 52.142 5.240   -3.615  1.00 11.73 ? 114 ILE A O     1 
ATOM   930  C  CB    . ILE A 1 117 ? 49.211 5.093   -2.440  1.00 8.51  ? 114 ILE A CB    1 
ATOM   931  C  CG1   . ILE A 1 117 ? 49.389 6.512   -2.992  1.00 13.05 ? 114 ILE A CG1   1 
ATOM   932  C  CG2   . ILE A 1 117 ? 49.597 5.022   -0.975  1.00 12.52 ? 114 ILE A CG2   1 
ATOM   933  C  CD1   . ILE A 1 117 ? 48.259 7.458   -2.631  1.00 18.19 ? 114 ILE A CD1   1 
ATOM   934  N  N     . ASP A 1 118 ? 52.166 3.566   -2.135  1.00 10.18 ? 115 ASP A N     1 
ATOM   935  C  CA    . ASP A 1 118 ? 53.554 3.856   -1.785  1.00 10.30 ? 115 ASP A CA    1 
ATOM   936  C  C     . ASP A 1 118 ? 54.474 2.638   -1.781  1.00 12.55 ? 115 ASP A C     1 
ATOM   937  O  O     . ASP A 1 118 ? 55.520 2.643   -1.117  1.00 13.00 ? 115 ASP A O     1 
ATOM   938  C  CB    . ASP A 1 118 ? 53.614 4.535   -0.426  1.00 10.05 ? 115 ASP A CB    1 
ATOM   939  C  CG    . ASP A 1 118 ? 53.550 3.553   0.702   1.00 10.51 ? 115 ASP A CG    1 
ATOM   940  O  OD1   . ASP A 1 118 ? 54.187 3.839   1.725   1.00 11.56 ? 115 ASP A OD1   1 
ATOM   941  O  OD2   . ASP A 1 118 ? 52.887 2.496   0.578   1.00 13.34 ? 115 ASP A OD2   1 
ATOM   942  N  N     . GLU A 1 119 ? 54.103 1.594   -2.508  1.00 11.07 ? 116 GLU A N     1 
ATOM   943  C  CA    A GLU A 1 119 ? 54.876 0.346   -2.543  0.20 13.73 ? 116 GLU A CA    1 
ATOM   944  C  CA    B GLU A 1 119 ? 55.018 0.478   -2.613  0.80 13.99 ? 116 GLU A CA    1 
ATOM   945  C  C     . GLU A 1 119 ? 54.952 -0.193  -3.965  1.00 10.52 ? 116 GLU A C     1 
ATOM   946  O  O     . GLU A 1 119 ? 53.943 -0.157  -4.672  1.00 10.39 ? 116 GLU A O     1 
ATOM   947  C  CB    A GLU A 1 119 ? 54.198 -0.735  -1.695  0.20 14.38 ? 116 GLU A CB    1 
ATOM   948  C  CB    B GLU A 1 119 ? 54.816 -0.523  -1.489  0.80 16.78 ? 116 GLU A CB    1 
ATOM   949  C  CG    A GLU A 1 119 ? 53.981 -0.424  -0.225  0.20 14.61 ? 116 GLU A CG    1 
ATOM   950  C  CG    B GLU A 1 119 ? 53.689 -1.471  -1.707  0.80 14.36 ? 116 GLU A CG    1 
ATOM   951  C  CD    A GLU A 1 119 ? 53.443 -1.627  0.532   0.20 19.72 ? 116 GLU A CD    1 
ATOM   952  C  CD    B GLU A 1 119 ? 53.232 -2.094  -0.417  0.80 22.57 ? 116 GLU A CD    1 
ATOM   953  O  OE1   A GLU A 1 119 ? 52.726 -1.439  1.534   0.20 19.27 ? 116 GLU A OE1   1 
ATOM   954  O  OE1   B GLU A 1 119 ? 52.626 -1.372  0.400   0.80 24.68 ? 116 GLU A OE1   1 
ATOM   955  O  OE2   A GLU A 1 119 ? 53.739 -2.768  0.119   0.20 20.62 ? 116 GLU A OE2   1 
ATOM   956  O  OE2   B GLU A 1 119 ? 53.495 -3.294  -0.208  0.80 25.51 ? 116 GLU A OE2   1 
ATOM   957  N  N     . ALA A 1 120 ? 56.093 -0.735  -4.357  1.00 8.84  ? 117 ALA A N     1 
ATOM   958  C  CA    . ALA A 1 120 ? 56.162 -1.420  -5.631  1.00 7.86  ? 117 ALA A CA    1 
ATOM   959  C  C     . ALA A 1 120 ? 57.121 -2.592  -5.539  1.00 8.87  ? 117 ALA A C     1 
ATOM   960  O  O     . ALA A 1 120 ? 58.139 -2.522  -4.842  1.00 9.60  ? 117 ALA A O     1 
ATOM   961  C  CB    . ALA A 1 120 ? 56.593 -0.474  -6.736  1.00 12.11 ? 117 ALA A CB    1 
ATOM   962  N  N     . TYR A 1 121 ? 56.794 -3.657  -6.258  1.00 8.26  ? 118 TYR A N     1 
ATOM   963  C  CA    . TYR A 1 121 ? 57.720 -4.769  -6.415  1.00 8.89  ? 118 TYR A CA    1 
ATOM   964  C  C     . TYR A 1 121 ? 58.541 -4.552  -7.659  1.00 9.08  ? 118 TYR A C     1 
ATOM   965  O  O     . TYR A 1 121 ? 58.076 -3.938  -8.622  1.00 11.14 ? 118 TYR A O     1 
ATOM   966  C  CB    . TYR A 1 121 ? 56.972 -6.096  -6.526  1.00 7.05  ? 118 TYR A CB    1 
ATOM   967  C  CG    . TYR A 1 121 ? 56.232 -6.474  -5.270  1.00 7.42  ? 118 TYR A CG    1 
ATOM   968  C  CD1   . TYR A 1 121 ? 54.905 -6.117  -5.089  1.00 6.93  ? 118 TYR A CD1   1 
ATOM   969  C  CD2   . TYR A 1 121 ? 56.869 -7.171  -4.256  1.00 10.09 ? 118 TYR A CD2   1 
ATOM   970  C  CE1   . TYR A 1 121 ? 54.224 -6.462  -3.936  1.00 12.08 ? 118 TYR A CE1   1 
ATOM   971  C  CE2   . TYR A 1 121 ? 56.198 -7.522  -3.095  1.00 12.19 ? 118 TYR A CE2   1 
ATOM   972  C  CZ    . TYR A 1 121 ? 54.881 -7.161  -2.944  1.00 16.57 ? 118 TYR A CZ    1 
ATOM   973  O  OH    . TYR A 1 121 ? 54.225 -7.512  -1.792  1.00 18.17 ? 118 TYR A OH    1 
ATOM   974  N  N     . VAL A 1 122 ? 59.758 -5.087  -7.631  1.00 8.04  ? 119 VAL A N     1 
ATOM   975  C  CA    . VAL A 1 122 ? 60.745 -4.929  -8.685  1.00 12.36 ? 119 VAL A CA    1 
ATOM   976  C  C     . VAL A 1 122 ? 61.259 -6.325  -9.013  1.00 12.60 ? 119 VAL A C     1 
ATOM   977  O  O     . VAL A 1 122 ? 61.667 -7.039  -8.102  1.00 12.56 ? 119 VAL A O     1 
ATOM   978  C  CB    . VAL A 1 122 ? 61.944 -4.116  -8.126  1.00 16.69 ? 119 VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 122 ? 62.775 -3.551  -9.243  1.00 26.35 ? 119 VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 122 ? 61.445 -3.006  -7.193  1.00 19.68 ? 119 VAL A CG2   1 
ATOM   981  N  N     . ASP A 1 123 ? 61.255 -6.743  -10.280 1.00 12.78 ? 120 ASP A N     1 
ATOM   982  C  CA    . ASP A 1 123 ? 61.961 -7.992  -10.610 1.00 11.85 ? 120 ASP A CA    1 
ATOM   983  C  C     . ASP A 1 123 ? 63.352 -7.630  -11.103 1.00 16.51 ? 120 ASP A C     1 
ATOM   984  O  O     . ASP A 1 123 ? 63.515 -7.045  -12.173 1.00 16.13 ? 120 ASP A O     1 
ATOM   985  C  CB    . ASP A 1 123 ? 61.191 -8.866  -11.621 1.00 21.02 ? 120 ASP A CB    1 
ATOM   986  C  CG    . ASP A 1 123 ? 61.875 -10.213 -11.876 1.00 25.80 ? 120 ASP A CG    1 
ATOM   987  O  OD1   . ASP A 1 123 ? 63.103 -10.228 -12.050 1.00 18.53 ? 120 ASP A OD1   1 
ATOM   988  O  OD2   . ASP A 1 123 ? 61.200 -11.273 -11.894 1.00 28.43 ? 120 ASP A OD2   1 
ATOM   989  N  N     . LEU A 1 124 ? 64.355 -7.941  -10.290 1.00 14.38 ? 121 LEU A N     1 
ATOM   990  C  CA    . LEU A 1 124 ? 65.723 -7.516  -10.553 1.00 10.23 ? 121 LEU A CA    1 
ATOM   991  C  C     . LEU A 1 124 ? 66.565 -8.595  -11.219 1.00 10.01 ? 121 LEU A C     1 
ATOM   992  O  O     . LEU A 1 124 ? 67.775 -8.425  -11.367 1.00 12.06 ? 121 LEU A O     1 
ATOM   993  C  CB    . LEU A 1 124 ? 66.390 -7.081  -9.246  1.00 11.05 ? 121 LEU A CB    1 
ATOM   994  C  CG    . LEU A 1 124 ? 65.789 -5.819  -8.632  1.00 11.89 ? 121 LEU A CG    1 
ATOM   995  C  CD1   . LEU A 1 124 ? 66.351 -5.574  -7.244  1.00 17.20 ? 121 LEU A CD1   1 
ATOM   996  C  CD2   . LEU A 1 124 ? 66.040 -4.641  -9.564  1.00 17.78 ? 121 LEU A CD2   1 
ATOM   997  N  N     . THR A 1 125 ? 65.929 -9.701  -11.593 1.00 11.40 ? 122 THR A N     1 
ATOM   998  C  CA    . THR A 1 125 ? 66.667 -10.861 -12.088 1.00 11.13 ? 122 THR A CA    1 
ATOM   999  C  C     . THR A 1 125 ? 67.603 -10.457 -13.232 1.00 14.36 ? 122 THR A C     1 
ATOM   1000 O  O     . THR A 1 125 ? 68.801 -10.733 -13.178 1.00 13.25 ? 122 THR A O     1 
ATOM   1001 C  CB    . THR A 1 125 ? 65.742 -11.997 -12.511 1.00 15.72 ? 122 THR A CB    1 
ATOM   1002 O  OG1   . THR A 1 125 ? 64.830 -12.287 -11.445 1.00 11.68 ? 122 THR A OG1   1 
ATOM   1003 C  CG2   . THR A 1 125 ? 66.561 -13.256 -12.833 1.00 16.68 ? 122 THR A CG2   1 
ATOM   1004 N  N     . SER A 1 126 ? 67.064 -9.760  -14.231 1.00 16.08 ? 123 SER A N     1 
ATOM   1005 C  CA    . SER A 1 126 ? 67.869 -9.378  -15.399 1.00 15.35 ? 123 SER A CA    1 
ATOM   1006 C  C     . SER A 1 126 ? 68.949 -8.333  -15.085 1.00 18.40 ? 123 SER A C     1 
ATOM   1007 O  O     . SER A 1 126 ? 70.088 -8.454  -15.534 1.00 17.39 ? 123 SER A O     1 
ATOM   1008 C  CB    . SER A 1 126 ? 66.984 -8.906  -16.557 1.00 17.38 ? 123 SER A CB    1 
ATOM   1009 O  OG    A SER A 1 126 ? 66.242 -9.975  -17.111 0.50 19.76 ? 123 SER A OG    1 
ATOM   1010 O  OG    B SER A 1 126 ? 66.136 -7.842  -16.171 0.50 23.50 ? 123 SER A OG    1 
ATOM   1011 N  N     . ALA A 1 127 ? 68.586 -7.313  -14.317 1.00 11.65 ? 124 ALA A N     1 
ATOM   1012 C  CA    . ALA A 1 127 ? 69.537 -6.291  -13.882 1.00 15.96 ? 124 ALA A CA    1 
ATOM   1013 C  C     . ALA A 1 127 ? 70.721 -6.884  -13.111 1.00 13.93 ? 124 ALA A C     1 
ATOM   1014 O  O     . ALA A 1 127 ? 71.866 -6.445  -13.279 1.00 15.11 ? 124 ALA A O     1 
ATOM   1015 C  CB    . ALA A 1 127 ? 68.828 -5.226  -13.033 1.00 16.06 ? 124 ALA A CB    1 
ATOM   1016 N  N     . VAL A 1 128 ? 70.445 -7.881  -12.262 1.00 12.62 ? 125 VAL A N     1 
ATOM   1017 C  CA    . VAL A 1 128 ? 71.495 -8.549  -11.502 1.00 16.85 ? 125 VAL A CA    1 
ATOM   1018 C  C     . VAL A 1 128 ? 72.458 -9.293  -12.417 1.00 14.54 ? 125 VAL A C     1 
ATOM   1019 O  O     . VAL A 1 128 ? 73.667 -9.194  -12.253 1.00 16.03 ? 125 VAL A O     1 
ATOM   1020 C  CB    . VAL A 1 128 ? 70.908 -9.521  -10.449 1.00 14.41 ? 125 VAL A CB    1 
ATOM   1021 C  CG1   . VAL A 1 128 ? 71.976 -10.484 -9.933  1.00 13.06 ? 125 VAL A CG1   1 
ATOM   1022 C  CG2   . VAL A 1 128 ? 70.324 -8.727  -9.311  1.00 10.80 ? 125 VAL A CG2   1 
ATOM   1023 N  N     . GLN A 1 129 ? 71.914 -10.032 -13.380 1.00 14.86 ? 126 GLN A N     1 
ATOM   1024 C  CA    . GLN A 1 129 ? 72.746 -10.725 -14.362 1.00 24.65 ? 126 GLN A CA    1 
ATOM   1025 C  C     . GLN A 1 129 ? 73.686 -9.747  -15.057 1.00 22.82 ? 126 GLN A C     1 
ATOM   1026 O  O     . GLN A 1 129 ? 74.885 -10.005 -15.189 1.00 25.58 ? 126 GLN A O     1 
ATOM   1027 C  CB    . GLN A 1 129 ? 71.879 -11.445 -15.395 1.00 26.10 ? 126 GLN A CB    1 
ATOM   1028 C  CG    . GLN A 1 129 ? 71.104 -12.622 -14.831 1.00 30.73 ? 126 GLN A CG    1 
ATOM   1029 C  CD    . GLN A 1 129 ? 72.013 -13.704 -14.271 1.00 45.42 ? 126 GLN A CD    1 
ATOM   1030 O  OE1   . GLN A 1 129 ? 72.007 -13.977 -13.068 1.00 45.66 ? 126 GLN A OE1   1 
ATOM   1031 N  NE2   . GLN A 1 129 ? 72.799 -14.328 -15.142 1.00 47.62 ? 126 GLN A NE2   1 
ATOM   1032 N  N     . GLU A 1 130 ? 73.132 -8.623  -15.501 1.00 20.62 ? 127 GLU A N     1 
ATOM   1033 C  CA    . GLU A 1 130 ? 73.916 -7.572  -16.143 1.00 30.11 ? 127 GLU A CA    1 
ATOM   1034 C  C     . GLU A 1 130 ? 75.044 -7.058  -15.255 1.00 30.71 ? 127 GLU A C     1 
ATOM   1035 O  O     . GLU A 1 130 ? 76.191 -6.945  -15.688 1.00 30.64 ? 127 GLU A O     1 
ATOM   1036 C  CB    . GLU A 1 130 ? 73.009 -6.403  -16.533 1.00 23.81 ? 127 GLU A CB    1 
ATOM   1037 C  CG    . GLU A 1 130 ? 72.048 -6.714  -17.666 1.00 36.36 ? 127 GLU A CG    1 
ATOM   1038 C  CD    . GLU A 1 130 ? 71.290 -5.479  -18.134 1.00 64.18 ? 127 GLU A CD    1 
ATOM   1039 O  OE1   . GLU A 1 130 ? 71.728 -4.349  -17.814 1.00 56.07 ? 127 GLU A OE1   1 
ATOM   1040 O  OE2   . GLU A 1 130 ? 70.256 -5.639  -18.819 1.00 73.19 ? 127 GLU A OE2   1 
ATOM   1041 N  N     . ARG A 1 131 ? 74.710 -6.736  -14.011 1.00 16.64 ? 128 ARG A N     1 
ATOM   1042 C  CA    . ARG A 1 131 ? 75.678 -6.164  -13.088 1.00 21.75 ? 128 ARG A CA    1 
ATOM   1043 C  C     . ARG A 1 131 ? 76.782 -7.175  -12.767 1.00 23.18 ? 128 ARG A C     1 
ATOM   1044 O  O     . ARG A 1 131 ? 77.947 -6.806  -12.617 1.00 28.57 ? 128 ARG A O     1 
ATOM   1045 C  CB    . ARG A 1 131 ? 74.968 -5.686  -11.816 1.00 15.98 ? 128 ARG A CB    1 
ATOM   1046 C  CG    A ARG A 1 131 ? 75.837 -4.919  -10.837 0.50 20.24 ? 128 ARG A CG    1 
ATOM   1047 C  CG    B ARG A 1 131 ? 75.903 -5.102  -10.762 0.50 20.30 ? 128 ARG A CG    1 
ATOM   1048 C  CD    A ARG A 1 131 ? 76.280 -3.582  -11.411 0.50 21.52 ? 128 ARG A CD    1 
ATOM   1049 C  CD    B ARG A 1 131 ? 76.609 -3.852  -11.277 0.50 22.33 ? 128 ARG A CD    1 
ATOM   1050 N  NE    A ARG A 1 131 ? 76.978 -2.786  -10.410 0.50 24.44 ? 128 ARG A NE    1 
ATOM   1051 N  NE    B ARG A 1 131 ? 75.644 -2.811  -11.602 0.50 20.51 ? 128 ARG A NE    1 
ATOM   1052 C  CZ    A ARG A 1 131 ? 76.373 -1.954  -9.569  0.50 23.06 ? 128 ARG A CZ    1 
ATOM   1053 C  CZ    B ARG A 1 131 ? 75.164 -1.948  -10.714 0.50 19.98 ? 128 ARG A CZ    1 
ATOM   1054 N  NH1   A ARG A 1 131 ? 77.086 -1.267  -8.685  0.50 20.57 ? 128 ARG A NH1   1 
ATOM   1055 N  NH1   B ARG A 1 131 ? 74.277 -1.036  -11.084 0.50 24.22 ? 128 ARG A NH1   1 
ATOM   1056 N  NH2   A ARG A 1 131 ? 75.055 -1.807  -9.619  0.50 20.83 ? 128 ARG A NH2   1 
ATOM   1057 N  NH2   B ARG A 1 131 ? 75.577 -1.994  -9.454  0.50 20.63 ? 128 ARG A NH2   1 
ATOM   1058 N  N     . LEU A 1 132 ? 76.411 -8.448  -12.666 1.00 17.98 ? 129 LEU A N     1 
ATOM   1059 C  CA    . LEU A 1 132 ? 77.382 -9.515  -12.424 1.00 20.66 ? 129 LEU A CA    1 
ATOM   1060 C  C     . LEU A 1 132 ? 78.417 -9.588  -13.541 1.00 33.39 ? 129 LEU A C     1 
ATOM   1061 O  O     . LEU A 1 132 ? 79.586 -9.890  -13.296 1.00 29.63 ? 129 LEU A O     1 
ATOM   1062 C  CB    . LEU A 1 132 ? 76.677 -10.865 -12.255 1.00 20.63 ? 129 LEU A CB    1 
ATOM   1063 C  CG    . LEU A 1 132 ? 76.165 -11.127 -10.830 1.00 21.13 ? 129 LEU A CG    1 
ATOM   1064 C  CD1   . LEU A 1 132 ? 75.293 -12.372 -10.762 1.00 22.49 ? 129 LEU A CD1   1 
ATOM   1065 C  CD2   . LEU A 1 132 ? 77.328 -11.231 -9.851  1.00 21.92 ? 129 LEU A CD2   1 
ATOM   1066 N  N     . GLN A 1 133 ? 77.981 -9.308  -14.766 1.00 31.08 ? 130 GLN A N     1 
ATOM   1067 C  CA    . GLN A 1 133 ? 78.886 -9.280  -15.911 1.00 33.16 ? 130 GLN A CA    1 
ATOM   1068 C  C     . GLN A 1 133 ? 79.906 -8.156  -15.794 1.00 39.46 ? 130 GLN A C     1 
ATOM   1069 O  O     . GLN A 1 133 ? 81.084 -8.355  -16.075 1.00 49.55 ? 130 GLN A O     1 
ATOM   1070 C  CB    . GLN A 1 133 ? 78.107 -9.150  -17.220 1.00 38.32 ? 130 GLN A CB    1 
ATOM   1071 C  CG    . GLN A 1 133 ? 77.187 -10.329 -17.518 1.00 45.65 ? 130 GLN A CG    1 
ATOM   1072 C  CD    . GLN A 1 133 ? 77.916 -11.661 -17.531 1.00 59.04 ? 130 GLN A CD    1 
ATOM   1073 O  OE1   . GLN A 1 133 ? 79.144 -11.715 -17.424 1.00 69.29 ? 130 GLN A OE1   1 
ATOM   1074 N  NE2   . GLN A 1 133 ? 77.161 -12.747 -17.663 1.00 60.62 ? 130 GLN A NE2   1 
ATOM   1075 N  N     . LYS A 1 134 ? 79.462 -6.976  -15.375 1.00 33.19 ? 131 LYS A N     1 
ATOM   1076 C  CA    . LYS A 1 134 ? 80.387 -5.861  -15.182 1.00 43.77 ? 131 LYS A CA    1 
ATOM   1077 C  C     . LYS A 1 134 ? 81.387 -6.150  -14.063 1.00 50.78 ? 131 LYS A C     1 
ATOM   1078 O  O     . LYS A 1 134 ? 82.582 -5.887  -14.201 1.00 53.28 ? 131 LYS A O     1 
ATOM   1079 C  CB    . LYS A 1 134 ? 79.638 -4.562  -14.880 1.00 46.28 ? 131 LYS A CB    1 
ATOM   1080 C  CG    . LYS A 1 134 ? 78.894 -3.973  -16.065 1.00 51.29 ? 131 LYS A CG    1 
ATOM   1081 C  CD    . LYS A 1 134 ? 78.495 -2.531  -15.782 1.00 56.86 ? 131 LYS A CD    1 
ATOM   1082 C  CE    . LYS A 1 134 ? 77.733 -2.420  -14.470 1.00 48.91 ? 131 LYS A CE    1 
ATOM   1083 N  NZ    . LYS A 1 134 ? 77.474 -1.006  -14.079 1.00 46.04 ? 131 LYS A NZ    1 
ATOM   1084 N  N     . LEU A 1 135 ? 80.889 -6.689  -12.955 1.00 40.71 ? 132 LEU A N     1 
ATOM   1085 C  CA    . LEU A 1 135 ? 81.730 -6.968  -11.798 1.00 51.28 ? 132 LEU A CA    1 
ATOM   1086 C  C     . LEU A 1 135 ? 82.900 -7.882  -12.147 1.00 56.07 ? 132 LEU A C     1 
ATOM   1087 O  O     . LEU A 1 135 ? 84.012 -7.695  -11.650 1.00 60.35 ? 132 LEU A O     1 
ATOM   1088 C  CB    . LEU A 1 135 ? 80.899 -7.574  -10.666 1.00 44.04 ? 132 LEU A CB    1 
ATOM   1089 C  CG    . LEU A 1 135 ? 80.428 -6.582  -9.602  1.00 44.13 ? 132 LEU A CG    1 
ATOM   1090 C  CD1   . LEU A 1 135 ? 79.914 -5.302  -10.240 1.00 43.85 ? 132 LEU A CD1   1 
ATOM   1091 C  CD2   . LEU A 1 135 ? 79.367 -7.214  -8.709  1.00 34.44 ? 132 LEU A CD2   1 
ATOM   1092 N  N     . GLN A 1 136 ? 82.638 -8.867  -13.003 1.00 49.85 ? 133 GLN A N     1 
ATOM   1093 C  CA    . GLN A 1 136 ? 83.659 -9.821  -13.433 1.00 53.70 ? 133 GLN A CA    1 
ATOM   1094 C  C     . GLN A 1 136 ? 84.418 -10.464 -12.271 1.00 53.14 ? 133 GLN A C     1 
ATOM   1095 O  O     . GLN A 1 136 ? 85.627 -10.270 -12.124 1.00 49.29 ? 133 GLN A O     1 
ATOM   1096 C  CB    . GLN A 1 136 ? 84.641 -9.164  -14.410 1.00 51.67 ? 133 GLN A CB    1 
ATOM   1097 C  CG    . GLN A 1 136 ? 84.046 -8.835  -15.776 1.00 59.61 ? 133 GLN A CG    1 
ATOM   1098 C  CD    . GLN A 1 136 ? 83.495 -10.061 -16.499 1.00 69.98 ? 133 GLN A CD    1 
ATOM   1099 O  OE1   . GLN A 1 136 ? 82.576 -10.729 -16.014 1.00 62.91 ? 133 GLN A OE1   1 
ATOM   1100 N  NE2   . GLN A 1 136 ? 84.055 -10.357 -17.668 1.00 75.89 ? 133 GLN A NE2   1 
ATOM   1101 N  N     . GLY A 1 137 ? 83.698 -11.226 -11.450 1.00 46.39 ? 134 GLY A N     1 
ATOM   1102 C  CA    . GLY A 1 137 ? 84.299 -11.981 -10.363 1.00 45.33 ? 134 GLY A CA    1 
ATOM   1103 C  C     . GLY A 1 137 ? 84.808 -11.141 -9.206  1.00 45.61 ? 134 GLY A C     1 
ATOM   1104 O  O     . GLY A 1 137 ? 85.200 -11.673 -8.168  1.00 52.89 ? 134 GLY A O     1 
ATOM   1105 N  N     . GLN A 1 138 ? 84.803 -9.825  -9.383  1.00 41.00 ? 135 GLN A N     1 
ATOM   1106 C  CA    . GLN A 1 138 ? 85.255 -8.911  -8.344  1.00 44.59 ? 135 GLN A CA    1 
ATOM   1107 C  C     . GLN A 1 138 ? 84.338 -8.972  -7.125  1.00 44.74 ? 135 GLN A C     1 
ATOM   1108 O  O     . GLN A 1 138 ? 83.115 -9.022  -7.264  1.00 39.18 ? 135 GLN A O     1 
ATOM   1109 C  CB    . GLN A 1 138 ? 85.307 -7.488  -8.894  1.00 50.35 ? 135 GLN A CB    1 
ATOM   1110 C  CG    . GLN A 1 138 ? 85.734 -6.441  -7.891  1.00 57.94 ? 135 GLN A CG    1 
ATOM   1111 C  CD    . GLN A 1 138 ? 85.680 -5.043  -8.471  1.00 72.14 ? 135 GLN A CD    1 
ATOM   1112 O  OE1   . GLN A 1 138 ? 85.447 -4.866  -9.669  1.00 74.24 ? 135 GLN A OE1   1 
ATOM   1113 N  NE2   . GLN A 1 138 ? 85.891 -4.040  -7.625  1.00 60.79 ? 135 GLN A NE2   1 
ATOM   1114 N  N     . PRO A 1 139 ? 84.931 -8.966  -5.922  1.00 45.39 ? 136 PRO A N     1 
ATOM   1115 C  CA    . PRO A 1 139 ? 84.179 -9.067  -4.667  1.00 38.98 ? 136 PRO A CA    1 
ATOM   1116 C  C     . PRO A 1 139 ? 83.274 -7.862  -4.437  1.00 39.27 ? 136 PRO A C     1 
ATOM   1117 O  O     . PRO A 1 139 ? 83.467 -6.811  -5.045  1.00 36.67 ? 136 PRO A O     1 
ATOM   1118 C  CB    . PRO A 1 139 ? 85.282 -9.104  -3.604  1.00 38.98 ? 136 PRO A CB    1 
ATOM   1119 C  CG    . PRO A 1 139 ? 86.444 -8.430  -4.247  1.00 39.13 ? 136 PRO A CG    1 
ATOM   1120 C  CD    . PRO A 1 139 ? 86.378 -8.829  -5.686  1.00 39.92 ? 136 PRO A CD    1 
ATOM   1121 N  N     . ILE A 1 140 ? 82.290 -8.023  -3.563  1.00 32.70 ? 137 ILE A N     1 
ATOM   1122 C  CA    . ILE A 1 140 ? 81.383 -6.933  -3.238  1.00 25.38 ? 137 ILE A CA    1 
ATOM   1123 C  C     . ILE A 1 140 ? 81.751 -6.318  -1.899  1.00 22.98 ? 137 ILE A C     1 
ATOM   1124 O  O     . ILE A 1 140 ? 81.766 -6.994  -0.871  1.00 24.81 ? 137 ILE A O     1 
ATOM   1125 C  CB    . ILE A 1 140 ? 79.924 -7.409  -3.210  1.00 25.70 ? 137 ILE A CB    1 
ATOM   1126 C  CG1   . ILE A 1 140 ? 79.557 -8.015  -4.567  1.00 31.57 ? 137 ILE A CG1   1 
ATOM   1127 C  CG2   . ILE A 1 140 ? 79.000 -6.258  -2.861  1.00 21.10 ? 137 ILE A CG2   1 
ATOM   1128 C  CD1   . ILE A 1 140 ? 78.144 -8.529  -4.654  1.00 37.43 ? 137 ILE A CD1   1 
ATOM   1129 N  N     . SER A 1 141 ? 82.045 -5.025  -1.923  1.00 24.42 ? 138 SER A N     1 
ATOM   1130 C  CA    . SER A 1 141 ? 82.457 -4.298  -0.729  1.00 23.72 ? 138 SER A CA    1 
ATOM   1131 C  C     . SER A 1 141 ? 81.259 -3.957  0.150   1.00 20.75 ? 138 SER A C     1 
ATOM   1132 O  O     . SER A 1 141 ? 80.171 -3.675  -0.361  1.00 19.49 ? 138 SER A O     1 
ATOM   1133 C  CB    . SER A 1 141 ? 83.191 -3.021  -1.143  1.00 24.63 ? 138 SER A CB    1 
ATOM   1134 O  OG    . SER A 1 141 ? 83.301 -2.106  -0.071  1.00 27.19 ? 138 SER A OG    1 
ATOM   1135 N  N     . ALA A 1 142 ? 81.462 -3.994  1.464   1.00 18.49 ? 139 ALA A N     1 
ATOM   1136 C  CA    . ALA A 1 142 ? 80.427 -3.595  2.413   1.00 18.74 ? 139 ALA A CA    1 
ATOM   1137 C  C     . ALA A 1 142 ? 80.012 -2.145  2.183   1.00 22.95 ? 139 ALA A C     1 
ATOM   1138 O  O     . ALA A 1 142 ? 78.899 -1.742  2.527   1.00 18.17 ? 139 ALA A O     1 
ATOM   1139 C  CB    . ALA A 1 142 ? 80.907 -3.782  3.839   1.00 19.08 ? 139 ALA A CB    1 
ATOM   1140 N  N     . ASP A 1 143 ? 80.913 -1.364  1.601   1.00 20.87 ? 140 ASP A N     1 
ATOM   1141 C  CA    . ASP A 1 143 ? 80.638 0.044   1.360   1.00 25.64 ? 140 ASP A CA    1 
ATOM   1142 C  C     . ASP A 1 143 ? 79.501 0.219   0.368   1.00 23.93 ? 140 ASP A C     1 
ATOM   1143 O  O     . ASP A 1 143 ? 78.868 1.271   0.335   1.00 23.03 ? 140 ASP A O     1 
ATOM   1144 C  CB    . ASP A 1 143 ? 81.885 0.770   0.845   1.00 23.00 ? 140 ASP A CB    1 
ATOM   1145 C  CG    . ASP A 1 143 ? 83.007 0.795   1.866   1.00 41.38 ? 140 ASP A CG    1 
ATOM   1146 O  OD1   . ASP A 1 143 ? 82.719 0.639   3.074   1.00 33.16 ? 140 ASP A OD1   1 
ATOM   1147 O  OD2   . ASP A 1 143 ? 84.176 0.979   1.460   1.00 48.73 ? 140 ASP A OD2   1 
ATOM   1148 N  N     . LEU A 1 144 ? 79.251 -0.806  -0.443  1.00 17.48 ? 141 LEU A N     1 
ATOM   1149 C  CA    . LEU A 1 144 ? 78.169 -0.751  -1.413  1.00 15.48 ? 141 LEU A CA    1 
ATOM   1150 C  C     . LEU A 1 144 ? 76.811 -1.079  -0.785  1.00 17.42 ? 141 LEU A C     1 
ATOM   1151 O  O     . LEU A 1 144 ? 75.787 -0.971  -1.443  1.00 17.01 ? 141 LEU A O     1 
ATOM   1152 C  CB    . LEU A 1 144 ? 78.436 -1.688  -2.589  1.00 12.32 ? 141 LEU A CB    1 
ATOM   1153 C  CG    . LEU A 1 144 ? 79.722 -1.432  -3.367  1.00 17.47 ? 141 LEU A CG    1 
ATOM   1154 C  CD1   . LEU A 1 144 ? 79.843 -2.404  -4.524  1.00 19.95 ? 141 LEU A CD1   1 
ATOM   1155 C  CD2   . LEU A 1 144 ? 79.724 -0.002  -3.861  1.00 23.92 ? 141 LEU A CD2   1 
ATOM   1156 N  N     . LEU A 1 145 ? 76.818 -1.484  0.480   1.00 15.64 ? 142 LEU A N     1 
ATOM   1157 C  CA    . LEU A 1 145 ? 75.599 -1.907  1.179   1.00 13.56 ? 142 LEU A CA    1 
ATOM   1158 C  C     . LEU A 1 145 ? 75.479 -1.188  2.526   1.00 12.87 ? 142 LEU A C     1 
ATOM   1159 O  O     . LEU A 1 145 ? 75.356 -1.817  3.581   1.00 12.52 ? 142 LEU A O     1 
ATOM   1160 C  CB    . LEU A 1 145 ? 75.619 -3.438  1.364   1.00 12.85 ? 142 LEU A CB    1 
ATOM   1161 C  CG    . LEU A 1 145 ? 75.638 -4.262  0.071   1.00 11.18 ? 142 LEU A CG    1 
ATOM   1162 C  CD1   . LEU A 1 145 ? 76.015 -5.726  0.310   1.00 13.87 ? 142 LEU A CD1   1 
ATOM   1163 C  CD2   . LEU A 1 145 ? 74.298 -4.181  -0.636  1.00 14.67 ? 142 LEU A CD2   1 
ATOM   1164 N  N     . PRO A 1 146 ? 75.503 0.157   2.499   1.00 14.92 ? 143 PRO A N     1 
ATOM   1165 C  CA    . PRO A 1 146 ? 75.586 0.970   3.721   1.00 16.66 ? 143 PRO A CA    1 
ATOM   1166 C  C     . PRO A 1 146 ? 74.334 0.947   4.600   1.00 15.87 ? 143 PRO A C     1 
ATOM   1167 O  O     . PRO A 1 146 ? 74.428 1.331   5.762   1.00 18.20 ? 143 PRO A O     1 
ATOM   1168 C  CB    . PRO A 1 146 ? 75.821 2.388   3.180   1.00 19.23 ? 143 PRO A CB    1 
ATOM   1169 C  CG    . PRO A 1 146 ? 75.183 2.370   1.813   1.00 17.49 ? 143 PRO A CG    1 
ATOM   1170 C  CD    . PRO A 1 146 ? 75.483 0.986   1.278   1.00 14.17 ? 143 PRO A CD    1 
ATOM   1171 N  N     . SER A 1 147 ? 73.196 0.502   4.070   1.00 14.72 ? 144 SER A N     1 
ATOM   1172 C  CA    . SER A 1 147 ? 71.975 0.468   4.867   1.00 11.98 ? 144 SER A CA    1 
ATOM   1173 C  C     . SER A 1 147 ? 71.283 -0.902  4.841   1.00 11.17 ? 144 SER A C     1 
ATOM   1174 O  O     . SER A 1 147 ? 70.095 -1.005  5.141   1.00 10.52 ? 144 SER A O     1 
ATOM   1175 C  CB    . SER A 1 147 ? 70.993 1.553   4.401   1.00 15.03 ? 144 SER A CB    1 
ATOM   1176 O  OG    . SER A 1 147 ? 70.564 1.321   3.069   1.00 17.21 ? 144 SER A OG    1 
ATOM   1177 N  N     . THR A 1 148 ? 72.054 -1.947  4.545   1.00 10.14 ? 145 THR A N     1 
ATOM   1178 C  CA    . THR A 1 148 ? 71.517 -3.297  4.385   1.00 8.56  ? 145 THR A CA    1 
ATOM   1179 C  C     . THR A 1 148 ? 71.717 -4.166  5.618   1.00 11.51 ? 145 THR A C     1 
ATOM   1180 O  O     . THR A 1 148 ? 72.809 -4.197  6.205   1.00 12.23 ? 145 THR A O     1 
ATOM   1181 C  CB    . THR A 1 148 ? 72.188 -4.012  3.186   1.00 10.02 ? 145 THR A CB    1 
ATOM   1182 O  OG1   . THR A 1 148 ? 71.848 -3.327  1.976   1.00 10.27 ? 145 THR A OG1   1 
ATOM   1183 C  CG2   . THR A 1 148 ? 71.707 -5.459  3.076   1.00 9.23  ? 145 THR A CG2   1 
ATOM   1184 N  N     . TYR A 1 149 ? 70.654 -4.856  6.003   1.00 8.70  ? 146 TYR A N     1 
ATOM   1185 C  CA    . TYR A 1 149 ? 70.701 -5.897  7.035   1.00 10.45 ? 146 TYR A CA    1 
ATOM   1186 C  C     . TYR A 1 149 ? 70.615 -7.254  6.368   1.00 11.97 ? 146 TYR A C     1 
ATOM   1187 O  O     . TYR A 1 149 ? 69.855 -7.432  5.406   1.00 12.48 ? 146 TYR A O     1 
ATOM   1188 C  CB    . TYR A 1 149 ? 69.509 -5.772  7.977   1.00 9.59  ? 146 TYR A CB    1 
ATOM   1189 C  CG    . TYR A 1 149 ? 69.686 -4.701  9.012   1.00 9.09  ? 146 TYR A CG    1 
ATOM   1190 C  CD1   . TYR A 1 149 ? 70.145 -5.018  10.281  1.00 11.31 ? 146 TYR A CD1   1 
ATOM   1191 C  CD2   . TYR A 1 149 ? 69.410 -3.365  8.716   1.00 12.43 ? 146 TYR A CD2   1 
ATOM   1192 C  CE1   . TYR A 1 149 ? 70.322 -4.034  11.234  1.00 16.24 ? 146 TYR A CE1   1 
ATOM   1193 C  CE2   . TYR A 1 149 ? 69.588 -2.369  9.666   1.00 15.84 ? 146 TYR A CE2   1 
ATOM   1194 C  CZ    . TYR A 1 149 ? 70.046 -2.715  10.921  1.00 19.33 ? 146 TYR A CZ    1 
ATOM   1195 O  OH    . TYR A 1 149 ? 70.222 -1.746  11.881  1.00 26.56 ? 146 TYR A OH    1 
ATOM   1196 N  N     . ILE A 1 150 ? 71.375 -8.221  6.881   1.00 7.09  ? 147 ILE A N     1 
ATOM   1197 C  CA    . ILE A 1 150 ? 71.247 -9.600  6.410   1.00 7.86  ? 147 ILE A CA    1 
ATOM   1198 C  C     . ILE A 1 150 ? 70.488 -10.397 7.470   1.00 9.09  ? 147 ILE A C     1 
ATOM   1199 O  O     . ILE A 1 150 ? 71.002 -10.638 8.561   1.00 11.78 ? 147 ILE A O     1 
ATOM   1200 C  CB    . ILE A 1 150 ? 72.626 -10.249 6.180   1.00 8.90  ? 147 ILE A CB    1 
ATOM   1201 C  CG1   . ILE A 1 150 ? 73.520 -9.392  5.269   1.00 9.51  ? 147 ILE A CG1   1 
ATOM   1202 C  CG2   . ILE A 1 150 ? 72.470 -11.676 5.624   1.00 10.27 ? 147 ILE A CG2   1 
ATOM   1203 C  CD1   . ILE A 1 150 ? 72.951 -9.135  3.855   1.00 10.71 ? 147 ILE A CD1   1 
ATOM   1204 N  N     . GLU A 1 151 ? 69.250 -10.775 7.173   1.00 9.26  ? 148 GLU A N     1 
ATOM   1205 C  CA    . GLU A 1 151 ? 68.420 -11.430 8.174   1.00 10.92 ? 148 GLU A CA    1 
ATOM   1206 C  C     . GLU A 1 151 ? 69.065 -12.723 8.666   1.00 13.07 ? 148 GLU A C     1 
ATOM   1207 O  O     . GLU A 1 151 ? 69.484 -13.560 7.863   1.00 10.14 ? 148 GLU A O     1 
ATOM   1208 C  CB    . GLU A 1 151 ? 67.013 -11.704 7.619   1.00 8.66  ? 148 GLU A CB    1 
ATOM   1209 C  CG    . GLU A 1 151 ? 66.061 -12.452 8.610   1.00 13.85 ? 148 GLU A CG    1 
ATOM   1210 C  CD    . GLU A 1 151 ? 65.904 -11.775 9.974   1.00 20.12 ? 148 GLU A CD    1 
ATOM   1211 O  OE1   . GLU A 1 151 ? 65.634 -12.486 10.972  1.00 20.19 ? 148 GLU A OE1   1 
ATOM   1212 O  OE2   . GLU A 1 151 ? 66.029 -10.538 10.061  1.00 22.36 ? 148 GLU A OE2   1 
ATOM   1213 N  N     . GLY A 1 152 ? 69.159 -12.855 9.993   1.00 10.04 ? 149 GLY A N     1 
ATOM   1214 C  CA    . GLY A 1 152 ? 69.688 -14.050 10.625  1.00 15.34 ? 149 GLY A CA    1 
ATOM   1215 C  C     . GLY A 1 152 ? 71.120 -13.896 11.100  1.00 15.39 ? 149 GLY A C     1 
ATOM   1216 O  O     . GLY A 1 152 ? 71.620 -14.723 11.857  1.00 17.97 ? 149 GLY A O     1 
ATOM   1217 N  N     . LEU A 1 153 ? 71.784 -12.836 10.652  1.00 12.52 ? 150 LEU A N     1 
ATOM   1218 C  CA    . LEU A 1 153 ? 73.167 -12.586 11.047  1.00 13.83 ? 150 LEU A CA    1 
ATOM   1219 C  C     . LEU A 1 153 ? 73.260 -11.285 11.840  1.00 19.02 ? 150 LEU A C     1 
ATOM   1220 O  O     . LEU A 1 153 ? 72.386 -10.433 11.730  1.00 14.71 ? 150 LEU A O     1 
ATOM   1221 C  CB    . LEU A 1 153 ? 74.058 -12.532 9.809   1.00 11.73 ? 150 LEU A CB    1 
ATOM   1222 C  CG    . LEU A 1 153 ? 74.089 -13.782 8.931   1.00 13.70 ? 150 LEU A CG    1 
ATOM   1223 C  CD1   . LEU A 1 153 ? 74.975 -13.547 7.710   1.00 11.75 ? 150 LEU A CD1   1 
ATOM   1224 C  CD2   . LEU A 1 153 ? 74.580 -14.993 9.744   1.00 14.09 ? 150 LEU A CD2   1 
ATOM   1225 N  N     . PRO A 1 154 ? 74.312 -11.131 12.664  1.00 13.40 ? 151 PRO A N     1 
ATOM   1226 C  CA    . PRO A 1 154 ? 75.388 -12.112 12.880  1.00 12.84 ? 151 PRO A CA    1 
ATOM   1227 C  C     . PRO A 1 154 ? 74.920 -13.290 13.724  1.00 15.33 ? 151 PRO A C     1 
ATOM   1228 O  O     . PRO A 1 154 ? 73.934 -13.188 14.450  1.00 16.88 ? 151 PRO A O     1 
ATOM   1229 C  CB    . PRO A 1 154 ? 76.422 -11.311 13.685  1.00 13.61 ? 151 PRO A CB    1 
ATOM   1230 C  CG    . PRO A 1 154 ? 75.598 -10.312 14.446  1.00 19.80 ? 151 PRO A CG    1 
ATOM   1231 C  CD    . PRO A 1 154 ? 74.490 -9.922  13.490  1.00 19.41 ? 151 PRO A CD    1 
ATOM   1232 N  N     . GLN A 1 155 ? 75.635 -14.401 13.634  1.00 18.11 ? 152 GLN A N     1 
ATOM   1233 C  CA    . GLN A 1 155 ? 75.327 -15.576 14.438  1.00 21.83 ? 152 GLN A CA    1 
ATOM   1234 C  C     . GLN A 1 155 ? 76.619 -16.303 14.772  1.00 31.35 ? 152 GLN A C     1 
ATOM   1235 O  O     . GLN A 1 155 ? 77.637 -16.099 14.106  1.00 31.35 ? 152 GLN A O     1 
ATOM   1236 C  CB    . GLN A 1 155 ? 74.396 -16.520 13.679  1.00 23.96 ? 152 GLN A CB    1 
ATOM   1237 C  CG    . GLN A 1 155 ? 74.826 -17.980 13.741  1.00 39.85 ? 152 GLN A CG    1 
ATOM   1238 C  CD    . GLN A 1 155 ? 75.033 -18.577 12.368  1.00 41.94 ? 152 GLN A CD    1 
ATOM   1239 O  OE1   . GLN A 1 155 ? 74.166 -18.468 11.500  1.00 44.89 ? 152 GLN A OE1   1 
ATOM   1240 N  NE2   . GLN A 1 155 ? 76.186 -19.206 12.156  1.00 29.59 ? 152 GLN A NE2   1 
ATOM   1241 N  N     . GLY A 1 156 ? 76.575 -17.146 15.802  1.00 30.64 ? 153 GLY A N     1 
ATOM   1242 C  CA    . GLY A 1 156 ? 77.683 -18.034 16.110  1.00 43.39 ? 153 GLY A CA    1 
ATOM   1243 C  C     . GLY A 1 156 ? 78.701 -17.477 17.087  1.00 47.19 ? 153 GLY A C     1 
ATOM   1244 O  O     . GLY A 1 156 ? 78.486 -16.420 17.685  1.00 44.48 ? 153 GLY A O     1 
ATOM   1245 N  N     . PRO A 1 157 ? 79.825 -18.194 17.251  1.00 52.35 ? 154 PRO A N     1 
ATOM   1246 C  CA    . PRO A 1 157 ? 80.911 -17.841 18.174  1.00 47.60 ? 154 PRO A CA    1 
ATOM   1247 C  C     . PRO A 1 157 ? 81.783 -16.710 17.632  1.00 37.29 ? 154 PRO A C     1 
ATOM   1248 O  O     . PRO A 1 157 ? 81.935 -16.603 16.415  1.00 45.54 ? 154 PRO A O     1 
ATOM   1249 C  CB    . PRO A 1 157 ? 81.722 -19.138 18.253  1.00 36.72 ? 154 PRO A CB    1 
ATOM   1250 C  CG    . PRO A 1 157 ? 81.530 -19.762 16.916  1.00 27.97 ? 154 PRO A CG    1 
ATOM   1251 C  CD    . PRO A 1 157 ? 80.109 -19.444 16.522  1.00 42.94 ? 154 PRO A CD    1 
ATOM   1252 N  N     . THR A 1 163 ? 80.043 -5.827  20.559  1.00 63.30 ? 160 THR A N     1 
ATOM   1253 C  CA    . THR A 1 163 ? 79.312 -4.581  20.350  1.00 57.73 ? 160 THR A CA    1 
ATOM   1254 C  C     . THR A 1 163 ? 77.869 -4.700  20.832  1.00 49.87 ? 160 THR A C     1 
ATOM   1255 O  O     . THR A 1 163 ? 77.248 -5.757  20.721  1.00 53.02 ? 160 THR A O     1 
ATOM   1256 C  CB    . THR A 1 163 ? 79.318 -4.154  18.866  1.00 58.32 ? 160 THR A CB    1 
ATOM   1257 O  OG1   . THR A 1 163 ? 78.583 -2.932  18.715  1.00 59.27 ? 160 THR A OG1   1 
ATOM   1258 C  CG2   . THR A 1 163 ? 78.685 -5.229  17.998  1.00 54.80 ? 160 THR A CG2   1 
ATOM   1259 N  N     . VAL A 1 164 ? 77.341 -3.606  21.365  1.00 51.59 ? 161 VAL A N     1 
ATOM   1260 C  CA    . VAL A 1 164 ? 75.996 -3.608  21.920  1.00 48.60 ? 161 VAL A CA    1 
ATOM   1261 C  C     . VAL A 1 164 ? 75.106 -2.582  21.216  1.00 49.79 ? 161 VAL A C     1 
ATOM   1262 O  O     . VAL A 1 164 ? 73.989 -2.307  21.658  1.00 52.25 ? 161 VAL A O     1 
ATOM   1263 C  CB    . VAL A 1 164 ? 76.025 -3.330  23.440  1.00 50.39 ? 161 VAL A CB    1 
ATOM   1264 C  CG1   . VAL A 1 164 ? 76.857 -4.388  24.157  1.00 41.40 ? 161 VAL A CG1   1 
ATOM   1265 C  CG2   . VAL A 1 164 ? 76.573 -1.933  23.722  1.00 38.26 ? 161 VAL A CG2   1 
ATOM   1266 N  N     . GLN A 1 165 ? 75.606 -2.032  20.113  1.00 34.34 ? 162 GLN A N     1 
ATOM   1267 C  CA    . GLN A 1 165 ? 74.904 -0.986  19.375  1.00 37.60 ? 162 GLN A CA    1 
ATOM   1268 C  C     . GLN A 1 165 ? 74.279 -1.530  18.090  1.00 32.38 ? 162 GLN A C     1 
ATOM   1269 O  O     . GLN A 1 165 ? 74.768 -2.499  17.510  1.00 35.01 ? 162 GLN A O     1 
ATOM   1270 C  CB    . GLN A 1 165 ? 75.867 0.148   19.036  1.00 43.25 ? 162 GLN A CB    1 
ATOM   1271 C  CG    . GLN A 1 165 ? 77.025 -0.294  18.155  1.00 52.47 ? 162 GLN A CG    1 
ATOM   1272 C  CD    . GLN A 1 165 ? 78.112 0.756   18.042  1.00 66.56 ? 162 GLN A CD    1 
ATOM   1273 O  OE1   . GLN A 1 165 ? 78.200 1.666   18.868  1.00 73.25 ? 162 GLN A OE1   1 
ATOM   1274 N  NE2   . GLN A 1 165 ? 78.947 0.635   17.014  1.00 54.56 ? 162 GLN A NE2   1 
ATOM   1275 N  N     . LYS A 1 166 ? 73.203 -0.889  17.647  1.00 31.97 ? 163 LYS A N     1 
ATOM   1276 C  CA    . LYS A 1 166 ? 72.443 -1.369  16.500  1.00 35.64 ? 163 LYS A CA    1 
ATOM   1277 C  C     . LYS A 1 166 ? 73.272 -1.411  15.215  1.00 24.67 ? 163 LYS A C     1 
ATOM   1278 O  O     . LYS A 1 166 ? 73.273 -2.413  14.497  1.00 25.06 ? 163 LYS A O     1 
ATOM   1279 C  CB    . LYS A 1 166 ? 71.193 -0.506  16.303  1.00 36.28 ? 163 LYS A CB    1 
ATOM   1280 C  CG    . LYS A 1 166 ? 70.260 -0.986  15.210  1.00 42.03 ? 163 LYS A CG    1 
ATOM   1281 C  CD    . LYS A 1 166 ? 69.059 -0.057  15.085  1.00 51.66 ? 163 LYS A CD    1 
ATOM   1282 C  CE    . LYS A 1 166 ? 69.495 1.387   14.846  1.00 55.90 ? 163 LYS A CE    1 
ATOM   1283 N  NZ    . LYS A 1 166 ? 68.333 2.324   14.789  1.00 62.38 ? 163 LYS A NZ    1 
ATOM   1284 N  N     . GLU A 1 167 ? 73.969 -0.321  14.921  1.00 23.95 ? 164 GLU A N     1 
ATOM   1285 C  CA    . GLU A 1 167 ? 74.736 -0.224  13.686  1.00 27.28 ? 164 GLU A CA    1 
ATOM   1286 C  C     . GLU A 1 167 ? 75.916 -1.191  13.704  1.00 30.06 ? 164 GLU A C     1 
ATOM   1287 O  O     . GLU A 1 167 ? 76.317 -1.716  12.666  1.00 22.99 ? 164 GLU A O     1 
ATOM   1288 C  CB    . GLU A 1 167 ? 75.190 1.223   13.441  1.00 32.51 ? 164 GLU A CB    1 
ATOM   1289 C  CG    . GLU A 1 167 ? 76.145 1.427   12.264  1.00 25.41 ? 164 GLU A CG    1 
ATOM   1290 C  CD    . GLU A 1 167 ? 75.530 1.128   10.893  1.00 35.29 ? 164 GLU A CD    1 
ATOM   1291 O  OE1   . GLU A 1 167 ? 76.286 1.149   9.896   1.00 34.45 ? 164 GLU A OE1   1 
ATOM   1292 O  OE2   . GLU A 1 167 ? 74.305 0.884   10.802  1.00 28.49 ? 164 GLU A OE2   1 
ATOM   1293 N  N     . GLY A 1 168 ? 76.466 -1.430  14.888  1.00 28.56 ? 165 GLY A N     1 
ATOM   1294 C  CA    . GLY A 1 168 ? 77.550 -2.381  15.032  1.00 29.61 ? 165 GLY A CA    1 
ATOM   1295 C  C     . GLY A 1 168 ? 77.081 -3.776  14.675  1.00 20.94 ? 165 GLY A C     1 
ATOM   1296 O  O     . GLY A 1 168 ? 77.759 -4.503  13.950  1.00 23.04 ? 165 GLY A O     1 
ATOM   1297 N  N     . MET A 1 169 ? 75.917 -4.150  15.196  1.00 25.40 ? 166 MET A N     1 
ATOM   1298 C  CA    . MET A 1 169 ? 75.292 -5.423  14.856  1.00 22.14 ? 166 MET A CA    1 
ATOM   1299 C  C     . MET A 1 169 ? 75.106 -5.539  13.347  1.00 22.00 ? 166 MET A C     1 
ATOM   1300 O  O     . MET A 1 169 ? 75.473 -6.553  12.747  1.00 21.15 ? 166 MET A O     1 
ATOM   1301 C  CB    . MET A 1 169 ? 73.940 -5.566  15.560  1.00 29.11 ? 166 MET A CB    1 
ATOM   1302 C  CG    . MET A 1 169 ? 74.028 -5.841  17.051  1.00 40.21 ? 166 MET A CG    1 
ATOM   1303 S  SD    . MET A 1 169 ? 74.515 -7.543  17.408  1.00 59.73 ? 166 MET A SD    1 
ATOM   1304 C  CE    . MET A 1 169 ? 75.923 -7.266  18.473  1.00 46.02 ? 166 MET A CE    1 
ATOM   1305 N  N     . ARG A 1 170 ? 74.556 -4.499  12.722  1.00 19.11 ? 167 ARG A N     1 
ATOM   1306 C  CA    . ARG A 1 170 ? 74.298 -4.560  11.283  1.00 17.01 ? 167 ARG A CA    1 
ATOM   1307 C  C     . ARG A 1 170 ? 75.571 -4.875  10.524  1.00 16.35 ? 167 ARG A C     1 
ATOM   1308 O  O     . ARG A 1 170 ? 75.584 -5.737  9.653   1.00 16.10 ? 167 ARG A O     1 
ATOM   1309 C  CB    . ARG A 1 170 ? 73.693 -3.257  10.751  1.00 18.09 ? 167 ARG A CB    1 
ATOM   1310 C  CG    . ARG A 1 170 ? 73.326 -3.329  9.270   1.00 13.84 ? 167 ARG A CG    1 
ATOM   1311 C  CD    . ARG A 1 170 ? 73.093 -1.950  8.663   1.00 15.04 ? 167 ARG A CD    1 
ATOM   1312 N  NE    . ARG A 1 170 ? 74.344 -1.212  8.483   1.00 16.60 ? 167 ARG A NE    1 
ATOM   1313 C  CZ    . ARG A 1 170 ? 75.166 -1.372  7.447   1.00 15.69 ? 167 ARG A CZ    1 
ATOM   1314 N  NH1   . ARG A 1 170 ? 74.892 -2.250  6.489   1.00 13.45 ? 167 ARG A NH1   1 
ATOM   1315 N  NH2   . ARG A 1 170 ? 76.275 -0.650  7.367   1.00 20.62 ? 167 ARG A NH2   1 
ATOM   1316 N  N     . LYS A 1 171 ? 76.644 -4.166  10.857  1.00 16.00 ? 168 LYS A N     1 
ATOM   1317 C  CA    . LYS A 1 171 ? 77.913 -4.362  10.180  1.00 16.86 ? 168 LYS A CA    1 
ATOM   1318 C  C     . LYS A 1 171 ? 78.508 -5.746  10.426  1.00 14.47 ? 168 LYS A C     1 
ATOM   1319 O  O     . LYS A 1 171 ? 79.082 -6.346  9.513   1.00 15.53 ? 168 LYS A O     1 
ATOM   1320 C  CB    . LYS A 1 171 ? 78.918 -3.278  10.584  1.00 26.32 ? 168 LYS A CB    1 
ATOM   1321 C  CG    . LYS A 1 171 ? 78.714 -1.938  9.889   1.00 28.40 ? 168 LYS A CG    1 
ATOM   1322 C  CD    . LYS A 1 171 ? 79.950 -1.057  10.095  1.00 38.91 ? 168 LYS A CD    1 
ATOM   1323 C  CE    . LYS A 1 171 ? 79.841 0.273   9.371   1.00 48.68 ? 168 LYS A CE    1 
ATOM   1324 N  NZ    . LYS A 1 171 ? 79.060 1.279   10.148  1.00 49.00 ? 168 LYS A NZ    1 
ATOM   1325 N  N     . GLN A 1 172 ? 78.385 -6.255  11.648  1.00 18.00 ? 169 GLN A N     1 
ATOM   1326 C  CA    . GLN A 1 172 ? 78.895 -7.590  11.942  1.00 20.48 ? 169 GLN A CA    1 
ATOM   1327 C  C     . GLN A 1 172 ? 78.193 -8.626  11.072  1.00 18.27 ? 169 GLN A C     1 
ATOM   1328 O  O     . GLN A 1 172 ? 78.827 -9.519  10.514  1.00 14.54 ? 169 GLN A O     1 
ATOM   1329 C  CB    . GLN A 1 172 ? 78.721 -7.949  13.418  1.00 22.91 ? 169 GLN A CB    1 
ATOM   1330 C  CG    . GLN A 1 172 ? 79.652 -7.207  14.356  1.00 34.46 ? 169 GLN A CG    1 
ATOM   1331 C  CD    . GLN A 1 172 ? 79.976 -8.011  15.605  1.00 60.05 ? 169 GLN A CD    1 
ATOM   1332 O  OE1   . GLN A 1 172 ? 79.796 -9.232  15.637  1.00 56.89 ? 169 GLN A OE1   1 
ATOM   1333 N  NE2   . GLN A 1 172 ? 80.460 -7.330  16.640  1.00 59.01 ? 169 GLN A NE2   1 
ATOM   1334 N  N     . GLY A 1 173 ? 76.876 -8.497  10.951  1.00 18.85 ? 170 GLY A N     1 
ATOM   1335 C  CA    . GLY A 1 173 ? 76.114 -9.444  10.162  1.00 15.31 ? 170 GLY A CA    1 
ATOM   1336 C  C     . GLY A 1 173 ? 76.488 -9.340  8.703   1.00 11.72 ? 170 GLY A C     1 
ATOM   1337 O  O     . GLY A 1 173 ? 76.683 -10.344 8.011   1.00 12.92 ? 170 GLY A O     1 
ATOM   1338 N  N     . LEU A 1 174 ? 76.599 -8.109  8.220   1.00 13.62 ? 171 LEU A N     1 
ATOM   1339 C  CA    . LEU A 1 174 ? 76.995 -7.895  6.836   1.00 13.21 ? 171 LEU A CA    1 
ATOM   1340 C  C     . LEU A 1 174 ? 78.366 -8.492  6.532   1.00 18.04 ? 171 LEU A C     1 
ATOM   1341 O  O     . LEU A 1 174 ? 78.559 -9.107  5.485   1.00 14.42 ? 171 LEU A O     1 
ATOM   1342 C  CB    . LEU A 1 174 ? 76.957 -6.411  6.473   1.00 11.31 ? 171 LEU A CB    1 
ATOM   1343 C  CG    . LEU A 1 174 ? 77.322 -6.109  5.018   1.00 12.39 ? 171 LEU A CG    1 
ATOM   1344 C  CD1   . LEU A 1 174 ? 76.358 -6.801  4.049   1.00 13.19 ? 171 LEU A CD1   1 
ATOM   1345 C  CD2   . LEU A 1 174 ? 77.365 -4.594  4.765   1.00 15.07 ? 171 LEU A CD2   1 
ATOM   1346 N  N     . PHE A 1 175 ? 79.312 -8.314  7.448   1.00 14.26 ? 172 PHE A N     1 
ATOM   1347 C  CA    . PHE A 1 175 ? 80.645 -8.886  7.268   1.00 19.69 ? 172 PHE A CA    1 
ATOM   1348 C  C     . PHE A 1 175 ? 80.616 -10.416 7.201   1.00 14.39 ? 172 PHE A C     1 
ATOM   1349 O  O     . PHE A 1 175 ? 81.263 -11.004 6.338   1.00 18.93 ? 172 PHE A O     1 
ATOM   1350 C  CB    . PHE A 1 175 ? 81.584 -8.419  8.374   1.00 15.25 ? 172 PHE A CB    1 
ATOM   1351 C  CG    . PHE A 1 175 ? 81.978 -6.973  8.271   1.00 36.30 ? 172 PHE A CG    1 
ATOM   1352 C  CD1   . PHE A 1 175 ? 82.052 -6.345  7.039   1.00 37.37 ? 172 PHE A CD1   1 
ATOM   1353 C  CD2   . PHE A 1 175 ? 82.283 -6.242  9.412   1.00 40.84 ? 172 PHE A CD2   1 
ATOM   1354 C  CE1   . PHE A 1 175 ? 82.419 -5.014  6.944   1.00 44.20 ? 172 PHE A CE1   1 
ATOM   1355 C  CE2   . PHE A 1 175 ? 82.654 -4.912  9.323   1.00 46.92 ? 172 PHE A CE2   1 
ATOM   1356 C  CZ    . PHE A 1 175 ? 82.719 -4.297  8.087   1.00 44.92 ? 172 PHE A CZ    1 
ATOM   1357 N  N     . GLN A 1 176 ? 79.871 -11.059 8.101   1.00 16.43 ? 173 GLN A N     1 
ATOM   1358 C  CA    . GLN A 1 176 ? 79.778 -12.520 8.085   1.00 18.40 ? 173 GLN A CA    1 
ATOM   1359 C  C     . GLN A 1 176 ? 79.210 -12.983 6.755   1.00 19.21 ? 173 GLN A C     1 
ATOM   1360 O  O     . GLN A 1 176 ? 79.689 -13.946 6.157   1.00 18.58 ? 173 GLN A O     1 
ATOM   1361 C  CB    . GLN A 1 176 ? 78.937 -13.056 9.250   1.00 16.06 ? 173 GLN A CB    1 
ATOM   1362 C  CG    . GLN A 1 176 ? 79.511 -12.750 10.620  1.00 16.62 ? 173 GLN A CG    1 
ATOM   1363 C  CD    . GLN A 1 176 ? 78.770 -13.453 11.734  1.00 19.61 ? 173 GLN A CD    1 
ATOM   1364 O  OE1   . GLN A 1 176 ? 77.690 -14.005 11.529  1.00 22.95 ? 173 GLN A OE1   1 
ATOM   1365 N  NE2   . GLN A 1 176 ? 79.354 -13.447 12.927  1.00 27.69 ? 173 GLN A NE2   1 
ATOM   1366 N  N     . TRP A 1 177 ? 78.200 -12.266 6.274   1.00 16.22 ? 174 TRP A N     1 
ATOM   1367 C  CA    . TRP A 1 177 ? 77.576 -12.597 4.998   1.00 12.27 ? 174 TRP A CA    1 
ATOM   1368 C  C     . TRP A 1 177 ? 78.556 -12.467 3.838   1.00 12.64 ? 174 TRP A C     1 
ATOM   1369 O  O     . TRP A 1 177 ? 78.693 -13.376 3.018   1.00 16.49 ? 174 TRP A O     1 
ATOM   1370 C  CB    . TRP A 1 177 ? 76.369 -11.686 4.753   1.00 14.33 ? 174 TRP A CB    1 
ATOM   1371 C  CG    . TRP A 1 177 ? 75.705 -11.856 3.405   1.00 13.32 ? 174 TRP A CG    1 
ATOM   1372 C  CD1   . TRP A 1 177 ? 75.806 -11.011 2.336   1.00 12.02 ? 174 TRP A CD1   1 
ATOM   1373 C  CD2   . TRP A 1 177 ? 74.810 -12.907 3.001   1.00 10.10 ? 174 TRP A CD2   1 
ATOM   1374 N  NE1   . TRP A 1 177 ? 75.051 -11.478 1.290   1.00 12.24 ? 174 TRP A NE1   1 
ATOM   1375 C  CE2   . TRP A 1 177 ? 74.422 -12.635 1.670   1.00 12.81 ? 174 TRP A CE2   1 
ATOM   1376 C  CE3   . TRP A 1 177 ? 74.306 -14.052 3.632   1.00 14.70 ? 174 TRP A CE3   1 
ATOM   1377 C  CZ2   . TRP A 1 177 ? 73.560 -13.470 0.953   1.00 13.71 ? 174 TRP A CZ2   1 
ATOM   1378 C  CZ3   . TRP A 1 177 ? 73.448 -14.876 2.926   1.00 12.61 ? 174 TRP A CZ3   1 
ATOM   1379 C  CH2   . TRP A 1 177 ? 73.077 -14.579 1.599   1.00 13.86 ? 174 TRP A CH2   1 
ATOM   1380 N  N     . LEU A 1 178 ? 79.230 -11.329 3.761   1.00 15.03 ? 175 LEU A N     1 
ATOM   1381 C  CA    . LEU A 1 178 ? 80.121 -11.093 2.629   1.00 14.39 ? 175 LEU A CA    1 
ATOM   1382 C  C     . LEU A 1 178 ? 81.301 -12.054 2.679   1.00 25.10 ? 175 LEU A C     1 
ATOM   1383 O  O     . LEU A 1 178 ? 81.791 -12.505 1.645   1.00 24.10 ? 175 LEU A O     1 
ATOM   1384 C  CB    . LEU A 1 178 ? 80.615 -9.651  2.617   1.00 16.88 ? 175 LEU A CB    1 
ATOM   1385 C  CG    . LEU A 1 178 ? 79.482 -8.648  2.404   1.00 15.24 ? 175 LEU A CG    1 
ATOM   1386 C  CD1   . LEU A 1 178 ? 80.010 -7.232  2.539   1.00 20.69 ? 175 LEU A CD1   1 
ATOM   1387 C  CD2   . LEU A 1 178 ? 78.825 -8.866  1.045   1.00 12.87 ? 175 LEU A CD2   1 
ATOM   1388 N  N     . ASP A 1 179 ? 81.744 -12.368 3.890   1.00 19.60 ? 176 ASP A N     1 
ATOM   1389 C  CA    . ASP A 1 179 ? 82.868 -13.286 4.071   1.00 32.11 ? 176 ASP A CA    1 
ATOM   1390 C  C     . ASP A 1 179 ? 82.588 -14.658 3.484   1.00 28.89 ? 176 ASP A C     1 
ATOM   1391 O  O     . ASP A 1 179 ? 83.504 -15.331 3.007   1.00 34.32 ? 176 ASP A O     1 
ATOM   1392 C  CB    . ASP A 1 179 ? 83.247 -13.413 5.550   1.00 23.71 ? 176 ASP A CB    1 
ATOM   1393 C  CG    . ASP A 1 179 ? 84.054 -12.233 6.038   1.00 36.14 ? 176 ASP A CG    1 
ATOM   1394 O  OD1   . ASP A 1 179 ? 84.754 -11.619 5.205   1.00 48.89 ? 176 ASP A OD1   1 
ATOM   1395 O  OD2   . ASP A 1 179 ? 83.988 -11.915 7.246   1.00 48.58 ? 176 ASP A OD2   1 
ATOM   1396 N  N     . SER A 1 180 ? 81.319 -15.057 3.507   1.00 21.85 ? 177 SER A N     1 
ATOM   1397 C  CA    . SER A 1 180 ? 80.911 -16.395 3.090   1.00 29.97 ? 177 SER A CA    1 
ATOM   1398 C  C     . SER A 1 180 ? 80.513 -16.507 1.619   1.00 36.44 ? 177 SER A C     1 
ATOM   1399 O  O     . SER A 1 180 ? 80.204 -17.603 1.140   1.00 32.76 ? 177 SER A O     1 
ATOM   1400 C  CB    . SER A 1 180 ? 79.733 -16.856 3.949   1.00 29.02 ? 177 SER A CB    1 
ATOM   1401 O  OG    . SER A 1 180 ? 80.019 -16.681 5.323   1.00 42.10 ? 177 SER A OG    1 
ATOM   1402 N  N     . LEU A 1 181 ? 80.494 -15.383 0.913   1.00 18.41 ? 178 LEU A N     1 
ATOM   1403 C  CA    . LEU A 1 181 ? 80.028 -15.362 -0.477  1.00 19.11 ? 178 LEU A CA    1 
ATOM   1404 C  C     . LEU A 1 181 ? 80.995 -16.006 -1.464  1.00 35.43 ? 178 LEU A C     1 
ATOM   1405 O  O     . LEU A 1 181 ? 82.203 -15.824 -1.357  1.00 37.97 ? 178 LEU A O     1 
ATOM   1406 C  CB    . LEU A 1 181 ? 79.748 -13.925 -0.929  1.00 31.05 ? 178 LEU A CB    1 
ATOM   1407 C  CG    . LEU A 1 181 ? 78.354 -13.337 -0.729  1.00 27.04 ? 178 LEU A CG    1 
ATOM   1408 C  CD1   . LEU A 1 181 ? 78.245 -11.985 -1.455  1.00 15.59 ? 178 LEU A CD1   1 
ATOM   1409 C  CD2   . LEU A 1 181 ? 77.287 -14.296 -1.233  1.00 22.63 ? 178 LEU A CD2   1 
ATOM   1410 N  N     . GLN A 1 182 ? 80.461 -16.749 -2.433  1.00 37.24 ? 179 GLN A N     1 
ATOM   1411 C  CA    . GLN A 1 182 ? 81.281 -17.249 -3.535  1.00 45.07 ? 179 GLN A CA    1 
ATOM   1412 C  C     . GLN A 1 182 ? 81.066 -16.429 -4.806  1.00 47.52 ? 179 GLN A C     1 
ATOM   1413 O  O     . GLN A 1 182 ? 80.242 -16.783 -5.653  1.00 48.66 ? 179 GLN A O     1 
ATOM   1414 C  CB    . GLN A 1 182 ? 81.008 -18.728 -3.811  1.00 53.20 ? 179 GLN A CB    1 
ATOM   1415 C  CG    . GLN A 1 182 ? 81.902 -19.317 -4.902  1.00 56.99 ? 179 GLN A CG    1 
ATOM   1416 C  CD    . GLN A 1 182 ? 83.382 -19.024 -4.673  1.00 68.38 ? 179 GLN A CD    1 
ATOM   1417 O  OE1   . GLN A 1 182 ? 83.914 -18.020 -5.157  1.00 55.79 ? 179 GLN A OE1   1 
ATOM   1418 N  NE2   . GLN A 1 182 ? 84.051 -19.901 -3.928  1.00 63.34 ? 179 GLN A NE2   1 
ATOM   1419 N  N     . ILE A 1 183 ? 81.824 -15.342 -4.935  1.00 46.05 ? 180 ILE A N     1 
ATOM   1420 C  CA    . ILE A 1 183 ? 81.673 -14.409 -6.054  1.00 53.06 ? 180 ILE A CA    1 
ATOM   1421 C  C     . ILE A 1 183 ? 82.125 -15.006 -7.385  1.00 52.40 ? 180 ILE A C     1 
ATOM   1422 O  O     . ILE A 1 183 ? 81.996 -14.379 -8.439  1.00 50.13 ? 180 ILE A O     1 
ATOM   1423 C  CB    . ILE A 1 183 ? 82.423 -13.081 -5.795  1.00 46.24 ? 180 ILE A CB    1 
ATOM   1424 C  CG1   . ILE A 1 183 ? 83.795 -13.342 -5.170  1.00 47.81 ? 180 ILE A CG1   1 
ATOM   1425 C  CG2   . ILE A 1 183 ? 81.612 -12.189 -4.877  1.00 46.27 ? 180 ILE A CG2   1 
ATOM   1426 C  CD1   . ILE A 1 183 ? 84.775 -14.042 -6.083  1.00 49.02 ? 180 ILE A CD1   1 
ATOM   1427 N  N     . ASP A 1 184 ? 82.650 -16.224 -7.321  1.00 54.42 ? 181 ASP A N     1 
ATOM   1428 C  CA    . ASP A 1 184 ? 83.166 -16.911 -8.494  1.00 54.22 ? 181 ASP A CA    1 
ATOM   1429 C  C     . ASP A 1 184 ? 82.037 -17.542 -9.306  1.00 51.72 ? 181 ASP A C     1 
ATOM   1430 O  O     . ASP A 1 184 ? 82.203 -17.844 -10.487 1.00 50.01 ? 181 ASP A O     1 
ATOM   1431 C  CB    . ASP A 1 184 ? 84.170 -17.981 -8.058  1.00 58.35 ? 181 ASP A CB    1 
ATOM   1432 C  CG    . ASP A 1 184 ? 84.830 -18.678 -9.228  1.00 78.15 ? 181 ASP A CG    1 
ATOM   1433 O  OD1   . ASP A 1 184 ? 85.001 -18.035 -10.288 1.00 78.06 ? 181 ASP A OD1   1 
ATOM   1434 O  OD2   . ASP A 1 184 ? 85.182 -19.870 -9.085  1.00 85.13 ? 181 ASP A OD2   1 
ATOM   1435 N  N     . ASN A 1 185 ? 80.886 -17.733 -8.667  1.00 45.98 ? 182 ASN A N     1 
ATOM   1436 C  CA    . ASN A 1 185 ? 79.748 -18.384 -9.311  1.00 46.18 ? 182 ASN A CA    1 
ATOM   1437 C  C     . ASN A 1 185 ? 78.625 -17.404 -9.649  1.00 44.46 ? 182 ASN A C     1 
ATOM   1438 O  O     . ASN A 1 185 ? 77.877 -16.974 -8.767  1.00 37.07 ? 182 ASN A O     1 
ATOM   1439 C  CB    . ASN A 1 185 ? 79.220 -19.522 -8.431  1.00 39.57 ? 182 ASN A CB    1 
ATOM   1440 C  CG    . ASN A 1 185 ? 78.055 -20.263 -9.064  1.00 42.70 ? 182 ASN A CG    1 
ATOM   1441 O  OD1   . ASN A 1 185 ? 77.827 -20.178 -10.273 1.00 36.72 ? 182 ASN A OD1   1 
ATOM   1442 N  ND2   . ASN A 1 185 ? 77.309 -20.998 -8.244  1.00 46.67 ? 182 ASN A ND2   1 
ATOM   1443 N  N     . LEU A 1 186 ? 78.510 -17.061 -10.930 1.00 38.40 ? 183 LEU A N     1 
ATOM   1444 C  CA    . LEU A 1 186 ? 77.502 -16.104 -11.384 1.00 34.26 ? 183 LEU A CA    1 
ATOM   1445 C  C     . LEU A 1 186 ? 76.079 -16.609 -11.150 1.00 39.83 ? 183 LEU A C     1 
ATOM   1446 O  O     . LEU A 1 186 ? 75.127 -15.825 -11.144 1.00 38.95 ? 183 LEU A O     1 
ATOM   1447 C  CB    . LEU A 1 186 ? 77.697 -15.762 -12.865 1.00 42.19 ? 183 LEU A CB    1 
ATOM   1448 C  CG    . LEU A 1 186 ? 78.809 -14.773 -13.219 1.00 51.14 ? 183 LEU A CG    1 
ATOM   1449 C  CD1   . LEU A 1 186 ? 80.180 -15.371 -12.936 1.00 55.54 ? 183 LEU A CD1   1 
ATOM   1450 C  CD2   . LEU A 1 186 ? 78.699 -14.356 -14.675 1.00 46.51 ? 183 LEU A CD2   1 
ATOM   1451 N  N     . THR A 1 187 ? 75.937 -17.916 -10.958 1.00 30.90 ? 184 THR A N     1 
ATOM   1452 C  CA    . THR A 1 187 ? 74.619 -18.499 -10.724 1.00 35.88 ? 184 THR A CA    1 
ATOM   1453 C  C     . THR A 1 187 ? 74.313 -18.778 -9.248  1.00 31.39 ? 184 THR A C     1 
ATOM   1454 O  O     . THR A 1 187 ? 73.288 -19.387 -8.944  1.00 33.64 ? 184 THR A O     1 
ATOM   1455 C  CB    . THR A 1 187 ? 74.425 -19.809 -11.520 1.00 39.78 ? 184 THR A CB    1 
ATOM   1456 O  OG1   . THR A 1 187 ? 75.245 -20.843 -10.958 1.00 41.86 ? 184 THR A OG1   1 
ATOM   1457 C  CG2   . THR A 1 187 ? 74.788 -19.604 -12.988 1.00 46.77 ? 184 THR A CG2   1 
ATOM   1458 N  N     . SER A 1 188 ? 75.190 -18.361 -8.336  1.00 29.23 ? 185 SER A N     1 
ATOM   1459 C  CA    . SER A 1 188 ? 74.900 -18.513 -6.903  1.00 20.01 ? 185 SER A CA    1 
ATOM   1460 C  C     . SER A 1 188 ? 73.736 -17.623 -6.494  1.00 17.50 ? 185 SER A C     1 
ATOM   1461 O  O     . SER A 1 188 ? 73.812 -16.404 -6.617  1.00 15.14 ? 185 SER A O     1 
ATOM   1462 C  CB    . SER A 1 188 ? 76.106 -18.167 -6.035  1.00 26.45 ? 185 SER A CB    1 
ATOM   1463 O  OG    . SER A 1 188 ? 75.727 -18.060 -4.663  1.00 28.54 ? 185 SER A OG    1 
ATOM   1464 N  N     . PRO A 1 189 ? 72.655 -18.229 -5.990  1.00 14.73 ? 186 PRO A N     1 
ATOM   1465 C  CA    . PRO A 1 189 ? 71.504 -17.420 -5.553  1.00 12.77 ? 186 PRO A CA    1 
ATOM   1466 C  C     . PRO A 1 189 ? 71.848 -16.388 -4.475  1.00 11.84 ? 186 PRO A C     1 
ATOM   1467 O  O     . PRO A 1 189 ? 71.302 -15.273 -4.514  1.00 9.16  ? 186 PRO A O     1 
ATOM   1468 C  CB    . PRO A 1 189 ? 70.545 -18.468 -4.982  1.00 12.40 ? 186 PRO A CB    1 
ATOM   1469 C  CG    . PRO A 1 189 ? 70.898 -19.734 -5.745  1.00 14.08 ? 186 PRO A CG    1 
ATOM   1470 C  CD    . PRO A 1 189 ? 72.393 -19.673 -5.891  1.00 18.21 ? 186 PRO A CD    1 
ATOM   1471 N  N     . ASP A 1 190 ? 72.710 -16.735 -3.516  1.00 9.82  ? 187 ASP A N     1 
ATOM   1472 C  CA    . ASP A 1 190 ? 73.077 -15.765 -2.478  1.00 8.00  ? 187 ASP A CA    1 
ATOM   1473 C  C     . ASP A 1 190 ? 73.813 -14.578 -3.101  1.00 9.42  ? 187 ASP A C     1 
ATOM   1474 O  O     . ASP A 1 190 ? 73.618 -13.432 -2.692  1.00 10.62 ? 187 ASP A O     1 
ATOM   1475 C  CB    . ASP A 1 190 ? 73.964 -16.399 -1.396  1.00 12.53 ? 187 ASP A CB    1 
ATOM   1476 C  CG    . ASP A 1 190 ? 73.198 -17.362 -0.487  1.00 20.98 ? 187 ASP A CG    1 
ATOM   1477 O  OD1   . ASP A 1 190 ? 71.955 -17.370 -0.523  1.00 13.06 ? 187 ASP A OD1   1 
ATOM   1478 O  OD2   . ASP A 1 190 ? 73.845 -18.100 0.283   1.00 21.72 ? 187 ASP A OD2   1 
ATOM   1479 N  N     . LEU A 1 191 ? 74.676 -14.862 -4.070  1.00 9.98  ? 188 LEU A N     1 
ATOM   1480 C  CA    . LEU A 1 191 ? 75.390 -13.795 -4.760  1.00 12.05 ? 188 LEU A CA    1 
ATOM   1481 C  C     . LEU A 1 191 ? 74.404 -12.918 -5.533  1.00 10.30 ? 188 LEU A C     1 
ATOM   1482 O  O     . LEU A 1 191 ? 74.519 -11.693 -5.522  1.00 12.07 ? 188 LEU A O     1 
ATOM   1483 C  CB    . LEU A 1 191 ? 76.435 -14.371 -5.731  1.00 12.15 ? 188 LEU A CB    1 
ATOM   1484 C  CG    . LEU A 1 191 ? 77.211 -13.322 -6.532  1.00 16.73 ? 188 LEU A CG    1 
ATOM   1485 C  CD1   . LEU A 1 191 ? 77.861 -12.332 -5.602  1.00 18.13 ? 188 LEU A CD1   1 
ATOM   1486 C  CD2   . LEU A 1 191 ? 78.263 -13.988 -7.424  1.00 19.23 ? 188 LEU A CD2   1 
ATOM   1487 N  N     . GLN A 1 192 ? 73.440 -13.544 -6.195  1.00 9.38  ? 189 GLN A N     1 
ATOM   1488 C  CA    . GLN A 1 192 ? 72.439 -12.800 -6.964  1.00 10.91 ? 189 GLN A CA    1 
ATOM   1489 C  C     . GLN A 1 192 ? 71.629 -11.873 -6.056  1.00 10.21 ? 189 GLN A C     1 
ATOM   1490 O  O     . GLN A 1 192 ? 71.375 -10.713 -6.399  1.00 9.58  ? 189 GLN A O     1 
ATOM   1491 C  CB    . GLN A 1 192 ? 71.531 -13.763 -7.736  1.00 11.55 ? 189 GLN A CB    1 
ATOM   1492 C  CG    . GLN A 1 192 ? 72.282 -14.474 -8.855  1.00 14.49 ? 189 GLN A CG    1 
ATOM   1493 C  CD    . GLN A 1 192 ? 71.527 -15.637 -9.450  1.00 26.37 ? 189 GLN A CD    1 
ATOM   1494 O  OE1   . GLN A 1 192 ? 70.551 -16.122 -8.881  1.00 31.03 ? 189 GLN A OE1   1 
ATOM   1495 N  NE2   . GLN A 1 192 ? 71.987 -16.104 -10.606 1.00 35.19 ? 189 GLN A NE2   1 
ATOM   1496 N  N     . LEU A 1 193 ? 71.242 -12.379 -4.891  1.00 8.36  ? 190 LEU A N     1 
ATOM   1497 C  CA    . LEU A 1 193 ? 70.550 -11.548 -3.908  1.00 8.31  ? 190 LEU A CA    1 
ATOM   1498 C  C     . LEU A 1 193 ? 71.393 -10.350 -3.453  1.00 11.37 ? 190 LEU A C     1 
ATOM   1499 O  O     . LEU A 1 193 ? 70.874 -9.252  -3.247  1.00 10.32 ? 190 LEU A O     1 
ATOM   1500 C  CB    . LEU A 1 193 ? 70.138 -12.379 -2.689  1.00 11.10 ? 190 LEU A CB    1 
ATOM   1501 C  CG    . LEU A 1 193 ? 68.993 -13.376 -2.844  1.00 9.70  ? 190 LEU A CG    1 
ATOM   1502 C  CD1   . LEU A 1 193 ? 68.707 -13.996 -1.475  1.00 7.52  ? 190 LEU A CD1   1 
ATOM   1503 C  CD2   . LEU A 1 193 ? 67.762 -12.693 -3.363  1.00 8.11  ? 190 LEU A CD2   1 
ATOM   1504 N  N     . THR A 1 194 ? 72.689 -10.573 -3.249  1.00 7.96  ? 191 THR A N     1 
ATOM   1505 C  CA    . THR A 1 194 ? 73.574 -9.514  -2.786  1.00 8.05  ? 191 THR A CA    1 
ATOM   1506 C  C     . THR A 1 194 ? 73.699 -8.412  -3.827  1.00 9.31  ? 191 THR A C     1 
ATOM   1507 O  O     . THR A 1 194 ? 73.662 -7.231  -3.491  1.00 10.52 ? 191 THR A O     1 
ATOM   1508 C  CB    . THR A 1 194 ? 74.962 -10.069 -2.477  1.00 8.38  ? 191 THR A CB    1 
ATOM   1509 O  OG1   . THR A 1 194 ? 74.819 -11.107 -1.508  1.00 10.24 ? 191 THR A OG1   1 
ATOM   1510 C  CG2   . THR A 1 194 ? 75.883 -8.973  -1.919  1.00 11.22 ? 191 THR A CG2   1 
ATOM   1511 N  N     . VAL A 1 195 ? 73.848 -8.807  -5.084  1.00 12.40 ? 192 VAL A N     1 
ATOM   1512 C  CA    . VAL A 1 195 ? 73.934 -7.831  -6.164  1.00 10.62 ? 192 VAL A CA    1 
ATOM   1513 C  C     . VAL A 1 195 ? 72.591 -7.121  -6.259  1.00 9.97  ? 192 VAL A C     1 
ATOM   1514 O  O     . VAL A 1 195 ? 72.533 -5.906  -6.477  1.00 11.85 ? 192 VAL A O     1 
ATOM   1515 C  CB    . VAL A 1 195 ? 74.337 -8.483  -7.491  1.00 10.66 ? 192 VAL A CB    1 
ATOM   1516 C  CG1   . VAL A 1 195 ? 74.160 -7.492  -8.654  1.00 13.09 ? 192 VAL A CG1   1 
ATOM   1517 C  CG2   . VAL A 1 195 ? 75.786 -8.932  -7.405  1.00 11.09 ? 192 VAL A CG2   1 
ATOM   1518 N  N     . GLY A 1 196 ? 71.515 -7.873  -6.065  1.00 7.67  ? 193 GLY A N     1 
ATOM   1519 C  CA    . GLY A 1 196 ? 70.191 -7.264  -5.984  1.00 10.55 ? 193 GLY A CA    1 
ATOM   1520 C  C     . GLY A 1 196 ? 70.132 -6.167  -4.933  1.00 12.15 ? 193 GLY A C     1 
ATOM   1521 O  O     . GLY A 1 196 ? 69.588 -5.078  -5.168  1.00 12.02 ? 193 GLY A O     1 
ATOM   1522 N  N     . ALA A 1 197 ? 70.692 -6.442  -3.758  1.00 7.28  ? 194 ALA A N     1 
ATOM   1523 C  CA    . ALA A 1 197 ? 70.713 -5.456  -2.693  1.00 7.35  ? 194 ALA A CA    1 
ATOM   1524 C  C     . ALA A 1 197 ? 71.550 -4.229  -3.062  1.00 11.35 ? 194 ALA A C     1 
ATOM   1525 O  O     . ALA A 1 197 ? 71.205 -3.115  -2.673  1.00 9.16  ? 194 ALA A O     1 
ATOM   1526 C  CB    . ALA A 1 197 ? 71.206 -6.082  -1.378  1.00 10.81 ? 194 ALA A CB    1 
ATOM   1527 N  N     . VAL A 1 198 ? 72.636 -4.431  -3.811  1.00 7.85  ? 195 VAL A N     1 
ATOM   1528 C  CA    . VAL A 1 198 ? 73.454 -3.296  -4.253  1.00 7.83  ? 195 VAL A CA    1 
ATOM   1529 C  C     . VAL A 1 198 ? 72.643 -2.372  -5.144  1.00 10.31 ? 195 VAL A C     1 
ATOM   1530 O  O     . VAL A 1 198 ? 72.687 -1.134  -4.982  1.00 13.23 ? 195 VAL A O     1 
ATOM   1531 C  CB    . VAL A 1 198 ? 74.737 -3.743  -4.981  1.00 11.98 ? 195 VAL A CB    1 
ATOM   1532 C  CG1   . VAL A 1 198 ? 75.436 -2.530  -5.604  1.00 13.16 ? 195 VAL A CG1   1 
ATOM   1533 C  CG2   . VAL A 1 198 ? 75.663 -4.436  -4.005  1.00 14.07 ? 195 VAL A CG2   1 
ATOM   1534 N  N     . ILE A 1 199 ? 71.872 -2.968  -6.048  1.00 8.67  ? 196 ILE A N     1 
ATOM   1535 C  CA    . ILE A 1 199 ? 71.030 -2.193  -6.954  1.00 14.26 ? 196 ILE A CA    1 
ATOM   1536 C  C     . ILE A 1 199 ? 69.947 -1.434  -6.180  1.00 12.56 ? 196 ILE A C     1 
ATOM   1537 O  O     . ILE A 1 199 ? 69.655 -0.278  -6.485  1.00 11.52 ? 196 ILE A O     1 
ATOM   1538 C  CB    . ILE A 1 199 ? 70.419 -3.071  -8.044  1.00 9.92  ? 196 ILE A CB    1 
ATOM   1539 C  CG1   . ILE A 1 199 ? 71.531 -3.612  -8.966  1.00 8.41  ? 196 ILE A CG1   1 
ATOM   1540 C  CG2   . ILE A 1 199 ? 69.369 -2.287  -8.849  1.00 12.47 ? 196 ILE A CG2   1 
ATOM   1541 C  CD1   . ILE A 1 199 ? 71.066 -4.658  -9.983  1.00 10.31 ? 196 ILE A CD1   1 
ATOM   1542 N  N     . VAL A 1 200 ? 69.372 -2.079  -5.169  1.00 10.32 ? 197 VAL A N     1 
ATOM   1543 C  CA    . VAL A 1 200 ? 68.309 -1.451  -4.380  1.00 7.92  ? 197 VAL A CA    1 
ATOM   1544 C  C     . VAL A 1 200 ? 68.845 -0.296  -3.537  1.00 10.15 ? 197 VAL A C     1 
ATOM   1545 O  O     . VAL A 1 200 ? 68.157 0.724   -3.356  1.00 9.24  ? 197 VAL A O     1 
ATOM   1546 C  CB    . VAL A 1 200 ? 67.525 -2.510  -3.545  1.00 6.48  ? 197 VAL A CB    1 
ATOM   1547 C  CG1   . VAL A 1 200 ? 66.509 -1.848  -2.637  1.00 8.89  ? 197 VAL A CG1   1 
ATOM   1548 C  CG2   . VAL A 1 200 ? 66.846 -3.484  -4.483  1.00 10.64 ? 197 VAL A CG2   1 
ATOM   1549 N  N     . GLU A 1 201 ? 70.086 -0.412  -3.071  1.00 8.70  ? 198 GLU A N     1 
ATOM   1550 C  CA    . GLU A 1 201 ? 70.722 0.726   -2.400  1.00 8.56  ? 198 GLU A CA    1 
ATOM   1551 C  C     . GLU A 1 201 ? 70.751 1.911   -3.365  1.00 9.07  ? 198 GLU A C     1 
ATOM   1552 O  O     . GLU A 1 201 ? 70.454 3.050   -2.979  1.00 10.37 ? 198 GLU A O     1 
ATOM   1553 C  CB    . GLU A 1 201 ? 72.161 0.404   -1.946  1.00 13.02 ? 198 GLU A CB    1 
ATOM   1554 C  CG    . GLU A 1 201 ? 72.293 -0.603  -0.775  1.00 13.93 ? 198 GLU A CG    1 
ATOM   1555 C  CD    . GLU A 1 201 ? 72.177 0.010   0.618   1.00 17.00 ? 198 GLU A CD    1 
ATOM   1556 O  OE1   . GLU A 1 201 ? 71.840 1.207   0.759   1.00 17.37 ? 198 GLU A OE1   1 
ATOM   1557 O  OE2   . GLU A 1 201 ? 72.419 -0.727  1.602   1.00 13.74 ? 198 GLU A OE2   1 
ATOM   1558 N  N     . GLU A 1 202 ? 71.122 1.637   -4.617  1.00 9.10  ? 199 GLU A N     1 
ATOM   1559 C  CA    . GLU A 1 202 ? 71.214 2.679   -5.642  1.00 8.50  ? 199 GLU A CA    1 
ATOM   1560 C  C     . GLU A 1 202 ? 69.828 3.278   -5.945  1.00 14.42 ? 199 GLU A C     1 
ATOM   1561 O  O     . GLU A 1 202 ? 69.685 4.499   -6.075  1.00 10.33 ? 199 GLU A O     1 
ATOM   1562 C  CB    . GLU A 1 202 ? 71.859 2.123   -6.921  1.00 16.15 ? 199 GLU A CB    1 
ATOM   1563 C  CG    . GLU A 1 202 ? 73.338 1.765   -6.753  1.00 16.93 ? 199 GLU A CG    1 
ATOM   1564 C  CD    . GLU A 1 202 ? 73.903 0.874   -7.868  1.00 24.14 ? 199 GLU A CD    1 
ATOM   1565 O  OE1   . GLU A 1 202 ? 75.132 0.637   -7.864  1.00 27.76 ? 199 GLU A OE1   1 
ATOM   1566 O  OE2   . GLU A 1 202 ? 73.140 0.412   -8.741  1.00 27.33 ? 199 GLU A OE2   1 
ATOM   1567 N  N     . MET A 1 203 ? 68.822 2.415   -6.055  1.00 8.66  ? 200 MET A N     1 
ATOM   1568 C  CA    . MET A 1 203 ? 67.445 2.859   -6.289  1.00 7.05  ? 200 MET A CA    1 
ATOM   1569 C  C     . MET A 1 203 ? 66.967 3.724   -5.149  1.00 11.72 ? 200 MET A C     1 
ATOM   1570 O  O     . MET A 1 203 ? 66.329 4.770   -5.368  1.00 9.39  ? 200 MET A O     1 
ATOM   1571 C  CB    . MET A 1 203 ? 66.489 1.672   -6.454  1.00 8.46  ? 200 MET A CB    1 
ATOM   1572 C  CG    A MET A 1 203 ? 65.076 2.079   -6.810  0.50 11.30 ? 200 MET A CG    1 
ATOM   1573 C  CG    B MET A 1 203 ? 66.785 0.769   -7.624  0.50 10.74 ? 200 MET A CG    1 
ATOM   1574 S  SD    A MET A 1 203 ? 63.929 0.688   -6.884  0.50 21.19 ? 200 MET A SD    1 
ATOM   1575 S  SD    B MET A 1 203 ? 65.607 -0.604  -7.705  0.50 14.67 ? 200 MET A SD    1 
ATOM   1576 C  CE    A MET A 1 203 ? 64.284 -0.014  -8.490  0.50 15.74 ? 200 MET A CE    1 
ATOM   1577 C  CE    B MET A 1 203 ? 64.063 0.291   -7.872  0.50 13.65 ? 200 MET A CE    1 
ATOM   1578 N  N     . ARG A 1 204 ? 67.254 3.296   -3.925  1.00 8.26  ? 201 ARG A N     1 
ATOM   1579 C  CA    . ARG A 1 204 ? 66.791 4.036   -2.746  1.00 6.81  ? 201 ARG A CA    1 
ATOM   1580 C  C     . ARG A 1 204 ? 67.505 5.387   -2.645  1.00 9.07  ? 201 ARG A C     1 
ATOM   1581 O  O     . ARG A 1 204 ? 66.903 6.391   -2.257  1.00 10.29 ? 201 ARG A O     1 
ATOM   1582 C  CB    . ARG A 1 204 ? 66.938 3.203   -1.468  1.00 9.51  ? 201 ARG A CB    1 
ATOM   1583 C  CG    . ARG A 1 204 ? 65.912 2.056   -1.435  1.00 9.06  ? 201 ARG A CG    1 
ATOM   1584 C  CD    . ARG A 1 204 ? 66.030 1.207   -0.186  1.00 10.70 ? 201 ARG A CD    1 
ATOM   1585 N  NE    . ARG A 1 204 ? 66.071 2.039   1.003   1.00 11.15 ? 201 ARG A NE    1 
ATOM   1586 C  CZ    . ARG A 1 204 ? 67.105 2.131   1.826   1.00 14.19 ? 201 ARG A CZ    1 
ATOM   1587 N  NH1   . ARG A 1 204 ? 67.039 2.940   2.874   1.00 12.04 ? 201 ARG A NH1   1 
ATOM   1588 N  NH2   . ARG A 1 204 ? 68.204 1.418   1.606   1.00 14.02 ? 201 ARG A NH2   1 
ATOM   1589 N  N     . ALA A 1 205 ? 68.778 5.413   -3.033  1.00 12.99 ? 202 ALA A N     1 
ATOM   1590 C  CA    . ALA A 1 205 ? 69.522 6.671   -3.041  1.00 12.10 ? 202 ALA A CA    1 
ATOM   1591 C  C     . ALA A 1 205 ? 68.923 7.636   -4.071  1.00 11.13 ? 202 ALA A C     1 
ATOM   1592 O  O     . ALA A 1 205 ? 68.774 8.830   -3.794  1.00 8.83  ? 202 ALA A O     1 
ATOM   1593 C  CB    . ALA A 1 205 ? 71.006 6.418   -3.333  1.00 13.30 ? 202 ALA A CB    1 
ATOM   1594 N  N     . ALA A 1 206 ? 68.574 7.117   -5.247  1.00 8.76  ? 203 ALA A N     1 
ATOM   1595 C  CA    . ALA A 1 206 ? 67.983 7.938   -6.304  1.00 9.00  ? 203 ALA A CA    1 
ATOM   1596 C  C     . ALA A 1 206 ? 66.636 8.488   -5.858  1.00 10.66 ? 203 ALA A C     1 
ATOM   1597 O  O     . ALA A 1 206 ? 66.319 9.656   -6.091  1.00 12.82 ? 203 ALA A O     1 
ATOM   1598 C  CB    . ALA A 1 206 ? 67.818 7.129   -7.573  1.00 14.25 ? 203 ALA A CB    1 
ATOM   1599 N  N     . ILE A 1 207 ? 65.830 7.651   -5.212  1.00 7.93  ? 204 ILE A N     1 
ATOM   1600 C  CA    . ILE A 1 207 ? 64.537 8.144   -4.729  1.00 7.67  ? 204 ILE A CA    1 
ATOM   1601 C  C     . ILE A 1 207 ? 64.750 9.289   -3.750  1.00 10.61 ? 204 ILE A C     1 
ATOM   1602 O  O     . ILE A 1 207 ? 64.114 10.332  -3.869  1.00 8.22  ? 204 ILE A O     1 
ATOM   1603 C  CB    . ILE A 1 207 ? 63.689 7.032   -4.083  1.00 5.43  ? 204 ILE A CB    1 
ATOM   1604 C  CG1   . ILE A 1 207 ? 63.252 6.026   -5.146  1.00 7.40  ? 204 ILE A CG1   1 
ATOM   1605 C  CG2   . ILE A 1 207 ? 62.478 7.632   -3.378  1.00 7.44  ? 204 ILE A CG2   1 
ATOM   1606 C  CD1   . ILE A 1 207 ? 62.705 4.711   -4.550  1.00 8.38  ? 204 ILE A CD1   1 
ATOM   1607 N  N     . GLU A 1 208 ? 65.661 9.114   -2.796  1.00 8.64  ? 205 GLU A N     1 
ATOM   1608 C  CA    . GLU A 1 208 ? 65.876 10.154  -1.798  1.00 7.31  ? 205 GLU A CA    1 
ATOM   1609 C  C     . GLU A 1 208 ? 66.473 11.423  -2.395  1.00 12.37 ? 205 GLU A C     1 
ATOM   1610 O  O     . GLU A 1 208 ? 66.009 12.520  -2.102  1.00 11.26 ? 205 GLU A O     1 
ATOM   1611 C  CB    . GLU A 1 208 ? 66.721 9.665   -0.620  1.00 9.41  ? 205 GLU A CB    1 
ATOM   1612 C  CG    . GLU A 1 208 ? 66.761 10.699  0.508   1.00 14.36 ? 205 GLU A CG    1 
ATOM   1613 C  CD    . GLU A 1 208 ? 67.501 10.225  1.744   1.00 20.63 ? 205 GLU A CD    1 
ATOM   1614 O  OE1   . GLU A 1 208 ? 67.472 10.944  2.769   1.00 21.87 ? 205 GLU A OE1   1 
ATOM   1615 O  OE2   . GLU A 1 208 ? 68.100 9.137   1.695   1.00 19.76 ? 205 GLU A OE2   1 
ATOM   1616 N  N     . ARG A 1 209 ? 67.477 11.272  -3.254  1.00 10.99 ? 206 ARG A N     1 
ATOM   1617 C  CA    . ARG A 1 209 ? 68.067 12.437  -3.921  1.00 11.81 ? 206 ARG A CA    1 
ATOM   1618 C  C     . ARG A 1 209 ? 67.024 13.240  -4.702  1.00 11.76 ? 206 ARG A C     1 
ATOM   1619 O  O     . ARG A 1 209 ? 66.994 14.468  -4.607  1.00 14.14 ? 206 ARG A O     1 
ATOM   1620 C  CB    . ARG A 1 209 ? 69.217 12.035  -4.871  1.00 10.48 ? 206 ARG A CB    1 
ATOM   1621 C  CG    . ARG A 1 209 ? 69.971 13.260  -5.443  1.00 14.95 ? 206 ARG A CG    1 
ATOM   1622 C  CD    . ARG A 1 209 ? 71.019 12.910  -6.517  1.00 17.69 ? 206 ARG A CD    1 
ATOM   1623 N  NE    . ARG A 1 209 ? 70.436 12.623  -7.832  1.00 25.89 ? 206 ARG A NE    1 
ATOM   1624 C  CZ    . ARG A 1 209 ? 70.092 13.545  -8.732  1.00 28.13 ? 206 ARG A CZ    1 
ATOM   1625 N  NH1   . ARG A 1 209 ? 69.579 13.174  -9.905  1.00 21.72 ? 206 ARG A NH1   1 
ATOM   1626 N  NH2   . ARG A 1 209 ? 70.254 14.836  -8.466  1.00 17.06 ? 206 ARG A NH2   1 
ATOM   1627 N  N     . GLU A 1 210 ? 66.182 12.558  -5.484  1.00 7.92  ? 207 GLU A N     1 
ATOM   1628 C  CA    . GLU A 1 210 ? 65.320 13.241  -6.454  1.00 7.98  ? 207 GLU A CA    1 
ATOM   1629 C  C     . GLU A 1 210 ? 63.934 13.614  -5.924  1.00 10.80 ? 207 GLU A C     1 
ATOM   1630 O  O     . GLU A 1 210 ? 63.202 14.369  -6.575  1.00 9.86  ? 207 GLU A O     1 
ATOM   1631 C  CB    . GLU A 1 210 ? 65.179 12.405  -7.725  1.00 9.89  ? 207 GLU A CB    1 
ATOM   1632 C  CG    . GLU A 1 210 ? 66.520 12.068  -8.359  1.00 10.35 ? 207 GLU A CG    1 
ATOM   1633 C  CD    . GLU A 1 210 ? 66.403 11.146  -9.545  1.00 19.49 ? 207 GLU A CD    1 
ATOM   1634 O  OE1   . GLU A 1 210 ? 65.347 11.153  -10.212 1.00 21.86 ? 207 GLU A OE1   1 
ATOM   1635 O  OE2   . GLU A 1 210 ? 67.380 10.415  -9.812  1.00 28.45 ? 207 GLU A OE2   1 
ATOM   1636 N  N     . THR A 1 211 ? 63.574 13.095  -4.751  1.00 8.52  ? 208 THR A N     1 
ATOM   1637 C  CA    . THR A 1 211 ? 62.259 13.405  -4.187  1.00 7.50  ? 208 THR A CA    1 
ATOM   1638 C  C     . THR A 1 211 ? 62.324 13.926  -2.774  1.00 10.90 ? 208 THR A C     1 
ATOM   1639 O  O     . THR A 1 211 ? 61.399 14.595  -2.335  1.00 11.02 ? 208 THR A O     1 
ATOM   1640 C  CB    . THR A 1 211 ? 61.265 12.201  -4.174  1.00 11.75 ? 208 THR A CB    1 
ATOM   1641 O  OG1   . THR A 1 211 ? 61.671 11.235  -3.194  1.00 9.74  ? 208 THR A OG1   1 
ATOM   1642 C  CG2   . THR A 1 211 ? 61.132 11.553  -5.548  1.00 12.25 ? 208 THR A CG2   1 
ATOM   1643 N  N     . GLY A 1 212 ? 63.382 13.579  -2.047  1.00 9.01  ? 209 GLY A N     1 
ATOM   1644 C  CA    . GLY A 1 212 ? 63.465 13.888  -0.629  1.00 13.21 ? 209 GLY A CA    1 
ATOM   1645 C  C     . GLY A 1 212 ? 62.903 12.802  0.282   1.00 14.71 ? 209 GLY A C     1 
ATOM   1646 O  O     . GLY A 1 212 ? 63.040 12.880  1.503   1.00 16.51 ? 209 GLY A O     1 
ATOM   1647 N  N     . PHE A 1 213 ? 62.285 11.782  -0.302  1.00 10.78 ? 210 PHE A N     1 
ATOM   1648 C  CA    . PHE A 1 213 ? 61.584 10.775  0.492   1.00 7.15  ? 210 PHE A CA    1 
ATOM   1649 C  C     . PHE A 1 213 ? 62.506 9.594   0.810   1.00 9.00  ? 210 PHE A C     1 
ATOM   1650 O  O     . PHE A 1 213 ? 63.246 9.120   -0.058  1.00 12.54 ? 210 PHE A O     1 
ATOM   1651 C  CB    . PHE A 1 213 ? 60.347 10.240  -0.241  1.00 8.95  ? 210 PHE A CB    1 
ATOM   1652 C  CG    . PHE A 1 213 ? 59.327 11.305  -0.638  1.00 8.50  ? 210 PHE A CG    1 
ATOM   1653 C  CD1   . PHE A 1 213 ? 58.670 11.218  -1.856  1.00 12.31 ? 210 PHE A CD1   1 
ATOM   1654 C  CD2   . PHE A 1 213 ? 59.015 12.356  0.210   1.00 10.44 ? 210 PHE A CD2   1 
ATOM   1655 C  CE1   . PHE A 1 213 ? 57.724 12.159  -2.235  1.00 9.71  ? 210 PHE A CE1   1 
ATOM   1656 C  CE2   . PHE A 1 213 ? 58.063 13.310  -0.164  1.00 8.29  ? 210 PHE A CE2   1 
ATOM   1657 C  CZ    . PHE A 1 213 ? 57.416 13.204  -1.399  1.00 6.48  ? 210 PHE A CZ    1 
ATOM   1658 N  N     . GLN A 1 214 ? 62.436 9.123   2.052   1.00 7.24  ? 211 GLN A N     1 
ATOM   1659 C  CA    . GLN A 1 214 ? 63.132 7.905   2.483   1.00 10.61 ? 211 GLN A CA    1 
ATOM   1660 C  C     . GLN A 1 214 ? 62.232 6.680   2.373   1.00 11.18 ? 211 GLN A C     1 
ATOM   1661 O  O     . GLN A 1 214 ? 61.015 6.782   2.466   1.00 9.28  ? 211 GLN A O     1 
ATOM   1662 C  CB    . GLN A 1 214 ? 63.621 8.067   3.923   1.00 9.12  ? 211 GLN A CB    1 
ATOM   1663 C  CG    . GLN A 1 214 ? 64.741 9.095   4.031   1.00 16.82 ? 211 GLN A CG    1 
ATOM   1664 C  CD    . GLN A 1 214 ? 65.323 9.208   5.421   1.00 14.05 ? 211 GLN A CD    1 
ATOM   1665 O  OE1   . GLN A 1 214 ? 64.739 8.741   6.402   1.00 13.84 ? 211 GLN A OE1   1 
ATOM   1666 N  NE2   . GLN A 1 214 ? 66.490 9.835   5.513   1.00 18.58 ? 211 GLN A NE2   1 
ATOM   1667 N  N     . CYS A 1 215 ? 62.823 5.507   2.185   1.00 9.48  ? 212 CYS A N     1 
ATOM   1668 C  CA    . CYS A 1 215 ? 62.010 4.307   2.101   1.00 9.00  ? 212 CYS A CA    1 
ATOM   1669 C  C     . CYS A 1 215 ? 62.793 3.144   2.670   1.00 8.14  ? 212 CYS A C     1 
ATOM   1670 O  O     . CYS A 1 215 ? 63.994 3.264   2.962   1.00 11.95 ? 212 CYS A O     1 
ATOM   1671 C  CB    . CYS A 1 215 ? 61.632 4.011   0.649   1.00 10.78 ? 212 CYS A CB    1 
ATOM   1672 S  SG    . CYS A 1 215 ? 63.071 3.729   -0.406  1.00 17.12 ? 212 CYS A SG    1 
ATOM   1673 N  N     . SER A 1 216 ? 62.101 2.030   2.848   1.00 9.28  ? 213 SER A N     1 
ATOM   1674 C  CA    . SER A 1 216 ? 62.754 0.788   3.223   1.00 9.73  ? 213 SER A CA    1 
ATOM   1675 C  C     . SER A 1 216 ? 62.565 -0.201  2.083   1.00 9.52  ? 213 SER A C     1 
ATOM   1676 O  O     . SER A 1 216 ? 61.776 0.030   1.161   1.00 8.85  ? 213 SER A O     1 
ATOM   1677 C  CB    . SER A 1 216 ? 62.135 0.249   4.499   1.00 12.36 ? 213 SER A CB    1 
ATOM   1678 O  OG    . SER A 1 216 ? 62.383 1.153   5.569   1.00 16.29 ? 213 SER A OG    1 
ATOM   1679 N  N     . ALA A 1 217 ? 63.312 -1.297  2.103   1.00 9.38  ? 214 ALA A N     1 
ATOM   1680 C  CA    . ALA A 1 217 ? 63.087 -2.306  1.079   1.00 4.71  ? 214 ALA A CA    1 
ATOM   1681 C  C     . ALA A 1 217 ? 63.423 -3.691  1.592   1.00 6.86  ? 214 ALA A C     1 
ATOM   1682 O  O     . ALA A 1 217 ? 64.194 -3.835  2.542   1.00 7.05  ? 214 ALA A O     1 
ATOM   1683 C  CB    . ALA A 1 217 ? 63.910 -2.017  -0.174  1.00 9.17  ? 214 ALA A CB    1 
ATOM   1684 N  N     . GLY A 1 218 ? 62.835 -4.691  0.948   1.00 5.81  ? 215 GLY A N     1 
ATOM   1685 C  CA    . GLY A 1 218 ? 63.215 -6.080  1.177   1.00 5.67  ? 215 GLY A CA    1 
ATOM   1686 C  C     . GLY A 1 218 ? 63.741 -6.671  -0.117  1.00 7.47  ? 215 GLY A C     1 
ATOM   1687 O  O     . GLY A 1 218 ? 63.219 -6.368  -1.199  1.00 8.57  ? 215 GLY A O     1 
ATOM   1688 N  N     . ILE A 1 219 ? 64.794 -7.483  -0.030  1.00 6.24  ? 216 ILE A N     1 
ATOM   1689 C  CA    . ILE A 1 219 ? 65.301 -8.198  -1.199  1.00 4.62  ? 216 ILE A CA    1 
ATOM   1690 C  C     . ILE A 1 219 ? 65.282 -9.694  -0.902  1.00 6.00  ? 216 ILE A C     1 
ATOM   1691 O  O     . ILE A 1 219 ? 65.837 -10.130 0.106   1.00 7.37  ? 216 ILE A O     1 
ATOM   1692 C  CB    . ILE A 1 219 ? 66.740 -7.754  -1.532  1.00 7.86  ? 216 ILE A CB    1 
ATOM   1693 C  CG1   . ILE A 1 219 ? 66.809 -6.226  -1.732  1.00 9.70  ? 216 ILE A CG1   1 
ATOM   1694 C  CG2   . ILE A 1 219 ? 67.263 -8.509  -2.762  1.00 9.67  ? 216 ILE A CG2   1 
ATOM   1695 C  CD1   . ILE A 1 219 ? 67.211 -5.424  -0.483  1.00 10.43 ? 216 ILE A CD1   1 
ATOM   1696 N  N     . SER A 1 220 ? 64.626 -10.474 -1.760  1.00 7.76  ? 217 SER A N     1 
ATOM   1697 C  CA    . SER A 1 220 ? 64.601 -11.927 -1.617  1.00 6.05  ? 217 SER A CA    1 
ATOM   1698 C  C     . SER A 1 220 ? 64.314 -12.587 -2.971  1.00 8.45  ? 217 SER A C     1 
ATOM   1699 O  O     . SER A 1 220 ? 64.544 -11.988 -4.020  1.00 9.56  ? 217 SER A O     1 
ATOM   1700 C  CB    . SER A 1 220 ? 63.550 -12.342 -0.575  1.00 9.46  ? 217 SER A CB    1 
ATOM   1701 O  OG    . SER A 1 220 ? 63.709 -13.696 -0.191  1.00 8.98  ? 217 SER A OG    1 
ATOM   1702 N  N     . HIS A 1 221 ? 63.828 -13.826 -2.943  1.00 6.96  ? 218 HIS A N     1 
ATOM   1703 C  CA    . HIS A 1 221 ? 63.610 -14.580 -4.170  1.00 8.18  ? 218 HIS A CA    1 
ATOM   1704 C  C     . HIS A 1 221 ? 62.164 -14.545 -4.668  1.00 8.32  ? 218 HIS A C     1 
ATOM   1705 O  O     . HIS A 1 221 ? 61.854 -15.071 -5.746  1.00 8.05  ? 218 HIS A O     1 
ATOM   1706 C  CB    . HIS A 1 221 ? 64.064 -16.034 -3.989  1.00 8.19  ? 218 HIS A CB    1 
ATOM   1707 C  CG    . HIS A 1 221 ? 65.552 -16.194 -3.896  1.00 9.35  ? 218 HIS A CG    1 
ATOM   1708 N  ND1   . HIS A 1 221 ? 66.403 -15.840 -4.922  1.00 9.46  ? 218 HIS A ND1   1 
ATOM   1709 C  CD2   . HIS A 1 221 ? 66.340 -16.670 -2.899  1.00 7.96  ? 218 HIS A CD2   1 
ATOM   1710 C  CE1   . HIS A 1 221 ? 67.651 -16.100 -4.567  1.00 12.01 ? 218 HIS A CE1   1 
ATOM   1711 N  NE2   . HIS A 1 221 ? 67.639 -16.598 -3.342  1.00 9.96  ? 218 HIS A NE2   1 
ATOM   1712 N  N     . ASN A 1 222 ? 61.281 -13.927 -3.899  1.00 6.93  ? 219 ASN A N     1 
ATOM   1713 C  CA    . ASN A 1 222 ? 59.883 -13.814 -4.296  1.00 6.85  ? 219 ASN A CA    1 
ATOM   1714 C  C     . ASN A 1 222 ? 59.192 -12.658 -3.584  1.00 8.23  ? 219 ASN A C     1 
ATOM   1715 O  O     . ASN A 1 222 ? 59.764 -12.036 -2.687  1.00 8.43  ? 219 ASN A O     1 
ATOM   1716 C  CB    . ASN A 1 222 ? 59.136 -15.134 -4.066  1.00 9.69  ? 219 ASN A CB    1 
ATOM   1717 C  CG    . ASN A 1 222 ? 59.216 -15.602 -2.614  1.00 11.16 ? 219 ASN A CG    1 
ATOM   1718 O  OD1   . ASN A 1 222 ? 58.733 -14.924 -1.721  1.00 9.47  ? 219 ASN A OD1   1 
ATOM   1719 N  ND2   . ASN A 1 222 ? 59.818 -16.768 -2.383  1.00 10.13 ? 219 ASN A ND2   1 
ATOM   1720 N  N     . LYS A 1 223 ? 57.972 -12.353 -4.004  1.00 8.69  ? 220 LYS A N     1 
ATOM   1721 C  CA    . LYS A 1 223 ? 57.256 -11.190 -3.455  1.00 6.27  ? 220 LYS A CA    1 
ATOM   1722 C  C     . LYS A 1 223 ? 56.924 -11.302 -1.960  1.00 9.09  ? 220 LYS A C     1 
ATOM   1723 O  O     . LYS A 1 223 ? 57.047 -10.326 -1.217  1.00 8.16  ? 220 LYS A O     1 
ATOM   1724 C  CB    . LYS A 1 223 ? 55.991 -10.908 -4.289  1.00 8.15  ? 220 LYS A CB    1 
ATOM   1725 C  CG    . LYS A 1 223 ? 56.284 -10.439 -5.716  1.00 11.55 ? 220 LYS A CG    1 
ATOM   1726 C  CD    . LYS A 1 223 ? 55.064 -10.609 -6.652  1.00 21.45 ? 220 LYS A CD    1 
ATOM   1727 C  CE    . LYS A 1 223 ? 53.933 -9.660  -6.341  1.00 26.26 ? 220 LYS A CE    1 
ATOM   1728 N  NZ    . LYS A 1 223 ? 52.770 -9.830  -7.288  1.00 16.63 ? 220 LYS A NZ    1 
ATOM   1729 N  N     . VAL A 1 224 ? 56.469 -12.471 -1.514  1.00 8.53  ? 221 VAL A N     1 
ATOM   1730 C  CA    . VAL A 1 224 ? 56.079 -12.633 -0.108  1.00 7.75  ? 221 VAL A CA    1 
ATOM   1731 C  C     . VAL A 1 224 ? 57.277 -12.426 0.831   1.00 8.01  ? 221 VAL A C     1 
ATOM   1732 O  O     . VAL A 1 224 ? 57.184 -11.699 1.836   1.00 8.00  ? 221 VAL A O     1 
ATOM   1733 C  CB    . VAL A 1 224 ? 55.405 -14.013 0.159   1.00 10.05 ? 221 VAL A CB    1 
ATOM   1734 C  CG1   . VAL A 1 224 ? 55.314 -14.303 1.659   1.00 12.17 ? 221 VAL A CG1   1 
ATOM   1735 C  CG2   . VAL A 1 224 ? 54.026 -14.038 -0.459  1.00 13.76 ? 221 VAL A CG2   1 
ATOM   1736 N  N     . LEU A 1 225 ? 58.411 -13.033 0.490   1.00 6.95  ? 222 LEU A N     1 
ATOM   1737 C  CA    . LEU A 1 225 ? 59.597 -12.876 1.317   1.00 9.47  ? 222 LEU A CA    1 
ATOM   1738 C  C     . LEU A 1 225 ? 60.132 -11.448 1.227   1.00 9.92  ? 222 LEU A C     1 
ATOM   1739 O  O     . LEU A 1 225 ? 60.614 -10.903 2.214   1.00 8.43  ? 222 LEU A O     1 
ATOM   1740 C  CB    . LEU A 1 225 ? 60.692 -13.895 0.961   1.00 6.30  ? 222 LEU A CB    1 
ATOM   1741 C  CG    . LEU A 1 225 ? 60.409 -15.354 1.359   1.00 7.54  ? 222 LEU A CG    1 
ATOM   1742 C  CD1   . LEU A 1 225 ? 61.576 -16.278 0.996   1.00 11.06 ? 222 LEU A CD1   1 
ATOM   1743 C  CD2   . LEU A 1 225 ? 60.110 -15.464 2.841   1.00 10.02 ? 222 LEU A CD2   1 
ATOM   1744 N  N     . ALA A 1 226 ? 60.067 -10.845 0.044   1.00 7.56  ? 223 ALA A N     1 
ATOM   1745 C  CA    . ALA A 1 226 ? 60.548 -9.473  -0.087  1.00 6.58  ? 223 ALA A CA    1 
ATOM   1746 C  C     . ALA A 1 226 ? 59.729 -8.509  0.777   1.00 9.21  ? 223 ALA A C     1 
ATOM   1747 O  O     . ALA A 1 226 ? 60.276 -7.586  1.401   1.00 7.42  ? 223 ALA A O     1 
ATOM   1748 C  CB    . ALA A 1 226 ? 60.519 -9.041  -1.552  1.00 8.19  ? 223 ALA A CB    1 
ATOM   1749 N  N     . LYS A 1 227 ? 58.414 -8.716  0.802   1.00 6.60  ? 224 LYS A N     1 
ATOM   1750 C  CA    . LYS A 1 227 ? 57.513 -7.896  1.608   1.00 8.55  ? 224 LYS A CA    1 
ATOM   1751 C  C     . LYS A 1 227 ? 57.790 -8.090  3.098   1.00 10.38 ? 224 LYS A C     1 
ATOM   1752 O  O     . LYS A 1 227 ? 57.878 -7.119  3.859   1.00 10.06 ? 224 LYS A O     1 
ATOM   1753 C  CB    . LYS A 1 227 ? 56.051 -8.242  1.296   1.00 8.87  ? 224 LYS A CB    1 
ATOM   1754 C  CG    A LYS A 1 227 ? 55.017 -7.512  2.177   0.80 13.56 ? 224 LYS A CG    1 
ATOM   1755 C  CG    B LYS A 1 227 ? 55.045 -7.526  2.178   0.20 13.64 ? 224 LYS A CG    1 
ATOM   1756 C  CD    A LYS A 1 227 ? 55.145 -5.990  2.062   0.80 16.31 ? 224 LYS A CD    1 
ATOM   1757 C  CD    B LYS A 1 227 ? 55.069 -6.027  1.940   0.20 16.37 ? 224 LYS A CD    1 
ATOM   1758 C  CE    A LYS A 1 227 ? 54.003 -5.272  2.792   0.80 25.80 ? 224 LYS A CE    1 
ATOM   1759 C  CE    B LYS A 1 227 ? 54.081 -5.332  2.854   0.20 25.41 ? 224 LYS A CE    1 
ATOM   1760 N  NZ    A LYS A 1 227 ? 54.213 -3.797  2.851   0.80 23.20 ? 224 LYS A NZ    1 
ATOM   1761 N  NZ    B LYS A 1 227 ? 52.783 -6.053  2.851   0.20 17.93 ? 224 LYS A NZ    1 
ATOM   1762 N  N     . LEU A 1 228 ? 57.914 -9.348  3.502   1.00 9.48  ? 225 LEU A N     1 
ATOM   1763 C  CA    . LEU A 1 228 ? 58.245 -9.665  4.885   1.00 9.25  ? 225 LEU A CA    1 
ATOM   1764 C  C     . LEU A 1 228 ? 59.588 -9.026  5.271   1.00 11.88 ? 225 LEU A C     1 
ATOM   1765 O  O     . LEU A 1 228 ? 59.709 -8.380  6.327   1.00 10.57 ? 225 LEU A O     1 
ATOM   1766 C  CB    . LEU A 1 228 ? 58.291 -11.175 5.068   1.00 10.30 ? 225 LEU A CB    1 
ATOM   1767 C  CG    . LEU A 1 228 ? 58.487 -11.618 6.517   1.00 17.16 ? 225 LEU A CG    1 
ATOM   1768 C  CD1   . LEU A 1 228 ? 57.306 -11.153 7.357   1.00 16.72 ? 225 LEU A CD1   1 
ATOM   1769 C  CD2   . LEU A 1 228 ? 58.676 -13.125 6.603   1.00 15.00 ? 225 LEU A CD2   1 
ATOM   1770 N  N     . ALA A 1 229 ? 60.593 -9.214  4.418   1.00 9.52  ? 226 ALA A N     1 
ATOM   1771 C  CA    . ALA A 1 229 ? 61.916 -8.620  4.638   1.00 8.28  ? 226 ALA A CA    1 
ATOM   1772 C  C     . ALA A 1 229 ? 61.852 -7.105  4.832   1.00 8.87  ? 226 ALA A C     1 
ATOM   1773 O  O     . ALA A 1 229 ? 62.501 -6.549  5.721   1.00 10.62 ? 226 ALA A O     1 
ATOM   1774 C  CB    . ALA A 1 229 ? 62.873 -8.970  3.479   1.00 8.03  ? 226 ALA A CB    1 
ATOM   1775 N  N     . CYS A 1 230 ? 61.093 -6.427  3.979   1.00 7.50  ? 227 CYS A N     1 
ATOM   1776 C  CA    . CYS A 1 230 ? 61.052 -4.967  4.020   1.00 7.94  ? 227 CYS A CA    1 
ATOM   1777 C  C     . CYS A 1 230 ? 60.710 -4.452  5.427   1.00 11.67 ? 227 CYS A C     1 
ATOM   1778 O  O     . CYS A 1 230 ? 61.321 -3.497  5.919   1.00 15.52 ? 227 CYS A O     1 
ATOM   1779 C  CB    . CYS A 1 230 ? 60.046 -4.452  2.984   1.00 8.36  ? 227 CYS A CB    1 
ATOM   1780 S  SG    . CYS A 1 230 ? 59.954 -2.658  2.890   1.00 12.90 ? 227 CYS A SG    1 
ATOM   1781 N  N     . GLY A 1 231 ? 59.764 -5.110  6.085   1.00 11.90 ? 228 GLY A N     1 
ATOM   1782 C  CA    . GLY A 1 231 ? 59.322 -4.686  7.404   1.00 11.12 ? 228 GLY A CA    1 
ATOM   1783 C  C     . GLY A 1 231 ? 60.229 -5.028  8.582   1.00 11.32 ? 228 GLY A C     1 
ATOM   1784 O  O     . GLY A 1 231 ? 59.963 -4.607  9.714   1.00 16.35 ? 228 GLY A O     1 
ATOM   1785 N  N     . LEU A 1 232 ? 61.304 -5.769  8.341   1.00 9.59  ? 229 LEU A N     1 
ATOM   1786 C  CA    . LEU A 1 232 ? 62.122 -6.268  9.454   1.00 10.05 ? 229 LEU A CA    1 
ATOM   1787 C  C     . LEU A 1 232 ? 62.992 -5.167  10.056  1.00 12.51 ? 229 LEU A C     1 
ATOM   1788 O  O     . LEU A 1 232 ? 63.326 -5.190  11.259  1.00 14.11 ? 229 LEU A O     1 
ATOM   1789 C  CB    . LEU A 1 232 ? 62.987 -7.440  8.996   1.00 10.97 ? 229 LEU A CB    1 
ATOM   1790 C  CG    . LEU A 1 232 ? 62.195 -8.729  8.743   1.00 12.85 ? 229 LEU A CG    1 
ATOM   1791 C  CD1   . LEU A 1 232 ? 63.128 -9.849  8.300   1.00 12.40 ? 229 LEU A CD1   1 
ATOM   1792 C  CD2   . LEU A 1 232 ? 61.389 -9.110  9.983   1.00 19.69 ? 229 LEU A CD2   1 
ATOM   1793 N  N     . ASN A 1 233 ? 63.354 -4.199  9.219   1.00 9.54  ? 230 ASN A N     1 
ATOM   1794 C  CA    . ASN A 1 233 ? 64.203 -3.097  9.636   1.00 9.73  ? 230 ASN A CA    1 
ATOM   1795 C  C     . ASN A 1 233 ? 63.696 -1.819  8.969   1.00 13.55 ? 230 ASN A C     1 
ATOM   1796 O  O     . ASN A 1 233 ? 64.094 -1.477  7.865   1.00 25.50 ? 230 ASN A O     1 
ATOM   1797 C  CB    . ASN A 1 233 ? 65.679 -3.361  9.289   1.00 10.56 ? 230 ASN A CB    1 
ATOM   1798 C  CG    . ASN A 1 233 ? 66.255 -4.565  10.040  1.00 11.89 ? 230 ASN A CG    1 
ATOM   1799 O  OD1   . ASN A 1 233 ? 66.565 -4.470  11.233  1.00 13.39 ? 230 ASN A OD1   1 
ATOM   1800 N  ND2   . ASN A 1 233 ? 66.418 -5.693  9.344   1.00 11.65 ? 230 ASN A ND2   1 
ATOM   1801 N  N     . LYS A 1 234 ? 62.752 -1.175  9.630   1.00 20.00 ? 231 LYS A N     1 
ATOM   1802 C  CA    . LYS A 1 234 ? 62.212 0.102   9.186   1.00 17.29 ? 231 LYS A CA    1 
ATOM   1803 C  C     . LYS A 1 234 ? 62.517 1.057   10.319  1.00 17.10 ? 231 LYS A C     1 
ATOM   1804 O  O     . LYS A 1 234 ? 62.612 0.635   11.475  1.00 24.48 ? 231 LYS A O     1 
ATOM   1805 C  CB    . LYS A 1 234 ? 60.694 0.013   8.996   1.00 20.60 ? 231 LYS A CB    1 
ATOM   1806 C  CG    . LYS A 1 234 ? 60.223 -0.340  7.595   1.00 23.53 ? 231 LYS A CG    1 
ATOM   1807 C  CD    . LYS A 1 234 ? 58.762 0.126   7.392   1.00 20.72 ? 231 LYS A CD    1 
ATOM   1808 C  CE    . LYS A 1 234 ? 58.364 0.171   5.916   1.00 21.23 ? 231 LYS A CE    1 
ATOM   1809 N  NZ    . LYS A 1 234 ? 58.476 1.556   5.327   1.00 16.07 ? 231 LYS A NZ    1 
ATOM   1810 N  N     . PRO A 1 235 ? 62.678 2.347   10.015  1.00 11.71 ? 232 PRO A N     1 
ATOM   1811 C  CA    . PRO A 1 235 ? 62.613 2.965   8.690   1.00 10.21 ? 232 PRO A CA    1 
ATOM   1812 C  C     . PRO A 1 235 ? 63.990 3.133   8.070   1.00 12.11 ? 232 PRO A C     1 
ATOM   1813 O  O     . PRO A 1 235 ? 65.014 2.912   8.726   1.00 11.26 ? 232 PRO A O     1 
ATOM   1814 C  CB    . PRO A 1 235 ? 62.044 4.348   9.004   1.00 13.68 ? 232 PRO A CB    1 
ATOM   1815 C  CG    . PRO A 1 235 ? 62.689 4.688   10.331  1.00 15.29 ? 232 PRO A CG    1 
ATOM   1816 C  CD    . PRO A 1 235 ? 62.775 3.361   11.082  1.00 15.21 ? 232 PRO A CD    1 
ATOM   1817 N  N     . ASN A 1 236 ? 63.992 3.526   6.801   1.00 9.35  ? 233 ASN A N     1 
ATOM   1818 C  CA    . ASN A 1 236 ? 65.210 3.935   6.116   1.00 8.35  ? 233 ASN A CA    1 
ATOM   1819 C  C     . ASN A 1 236 ? 66.312 2.877   6.081   1.00 10.12 ? 233 ASN A C     1 
ATOM   1820 O  O     . ASN A 1 236 ? 67.489 3.202   6.144   1.00 9.81  ? 233 ASN A O     1 
ATOM   1821 C  CB    . ASN A 1 236 ? 65.725 5.250   6.716   1.00 10.74 ? 233 ASN A CB    1 
ATOM   1822 C  CG    . ASN A 1 236 ? 66.751 5.926   5.836   1.00 13.86 ? 233 ASN A CG    1 
ATOM   1823 O  OD1   . ASN A 1 236 ? 66.646 5.898   4.615   1.00 13.43 ? 233 ASN A OD1   1 
ATOM   1824 N  ND2   . ASN A 1 236 ? 67.758 6.533   6.455   1.00 21.43 ? 233 ASN A ND2   1 
ATOM   1825 N  N     . ARG A 1 237 ? 65.926 1.608   5.965   1.00 7.00  ? 234 ARG A N     1 
ATOM   1826 C  CA    . ARG A 1 237 ? 66.912 0.523   5.871   1.00 6.71  ? 234 ARG A CA    1 
ATOM   1827 C  C     . ARG A 1 237 ? 66.382 -0.531  4.925   1.00 7.75  ? 234 ARG A C     1 
ATOM   1828 O  O     . ARG A 1 237 ? 65.193 -0.537  4.585   1.00 10.68 ? 234 ARG A O     1 
ATOM   1829 C  CB    . ARG A 1 237 ? 67.153 -0.124  7.244   1.00 10.69 ? 234 ARG A CB    1 
ATOM   1830 C  CG    . ARG A 1 237 ? 67.727 0.788   8.315   1.00 12.26 ? 234 ARG A CG    1 
ATOM   1831 C  CD    . ARG A 1 237 ? 69.184 1.118   8.014   1.00 17.88 ? 234 ARG A CD    1 
ATOM   1832 N  NE    . ARG A 1 237 ? 69.815 1.864   9.108   1.00 19.69 ? 234 ARG A NE    1 
ATOM   1833 C  CZ    . ARG A 1 237 ? 69.934 3.190   9.139   1.00 25.95 ? 234 ARG A CZ    1 
ATOM   1834 N  NH1   . ARG A 1 237 ? 69.478 3.926   8.136   1.00 20.39 ? 234 ARG A NH1   1 
ATOM   1835 N  NH2   . ARG A 1 237 ? 70.519 3.782   10.174  1.00 27.38 ? 234 ARG A NH2   1 
ATOM   1836 N  N     . GLN A 1 238 ? 67.261 -1.417  4.471   1.00 6.83  ? 235 GLN A N     1 
ATOM   1837 C  CA    . GLN A 1 238 ? 66.808 -2.519  3.635   1.00 7.75  ? 235 GLN A CA    1 
ATOM   1838 C  C     . GLN A 1 238 ? 67.310 -3.838  4.177   1.00 8.11  ? 235 GLN A C     1 
ATOM   1839 O  O     . GLN A 1 238 ? 68.337 -3.880  4.846   1.00 8.56  ? 235 GLN A O     1 
ATOM   1840 C  CB    . GLN A 1 238 ? 67.231 -2.328  2.186   1.00 8.41  ? 235 GLN A CB    1 
ATOM   1841 C  CG    . GLN A 1 238 ? 68.731 -2.196  1.985   1.00 9.42  ? 235 GLN A CG    1 
ATOM   1842 C  CD    . GLN A 1 238 ? 69.083 -1.918  0.527   1.00 12.27 ? 235 GLN A CD    1 
ATOM   1843 O  OE1   . GLN A 1 238 ? 68.664 -0.910  -0.043  1.00 12.39 ? 235 GLN A OE1   1 
ATOM   1844 N  NE2   . GLN A 1 238 ? 69.836 -2.821  -0.088  1.00 9.15  ? 235 GLN A NE2   1 
ATOM   1845 N  N     . THR A 1 239 ? 66.574 -4.909  3.888   1.00 6.39  ? 236 THR A N     1 
ATOM   1846 C  CA    . THR A 1 239 ? 66.861 -6.201  4.497   1.00 9.87  ? 236 THR A CA    1 
ATOM   1847 C  C     . THR A 1 239 ? 66.883 -7.286  3.436   1.00 8.82  ? 236 THR A C     1 
ATOM   1848 O  O     . THR A 1 239 ? 65.981 -7.374  2.592   1.00 7.87  ? 236 THR A O     1 
ATOM   1849 C  CB    . THR A 1 239 ? 65.807 -6.551  5.570   1.00 9.47  ? 236 THR A CB    1 
ATOM   1850 O  OG1   . THR A 1 239 ? 65.790 -5.539  6.578   1.00 8.43  ? 236 THR A OG1   1 
ATOM   1851 C  CG2   . THR A 1 239 ? 66.142 -7.879  6.258   1.00 11.71 ? 236 THR A CG2   1 
ATOM   1852 N  N     . LEU A 1 240 ? 67.926 -8.110  3.488   1.00 7.62  ? 237 LEU A N     1 
ATOM   1853 C  CA    . LEU A 1 240 ? 68.100 -9.227  2.577   1.00 8.20  ? 237 LEU A CA    1 
ATOM   1854 C  C     . LEU A 1 240 ? 67.703 -10.511 3.308   1.00 7.41  ? 237 LEU A C     1 
ATOM   1855 O  O     . LEU A 1 240 ? 68.242 -10.823 4.373   1.00 8.76  ? 237 LEU A O     1 
ATOM   1856 C  CB    . LEU A 1 240 ? 69.559 -9.280  2.074   1.00 8.58  ? 237 LEU A CB    1 
ATOM   1857 C  CG    . LEU A 1 240 ? 69.964 -10.303 1.006   1.00 8.63  ? 237 LEU A CG    1 
ATOM   1858 C  CD1   . LEU A 1 240 ? 71.289 -9.935  0.323   1.00 9.74  ? 237 LEU A CD1   1 
ATOM   1859 C  CD2   . LEU A 1 240 ? 70.048 -11.741 1.549   1.00 8.83  ? 237 LEU A CD2   1 
ATOM   1860 N  N     . VAL A 1 241 ? 66.719 -11.224 2.756   1.00 5.53  ? 238 VAL A N     1 
ATOM   1861 C  CA    . VAL A 1 241 ? 66.288 -12.508 3.310   1.00 8.99  ? 238 VAL A CA    1 
ATOM   1862 C  C     . VAL A 1 241 ? 66.646 -13.603 2.321   1.00 9.84  ? 238 VAL A C     1 
ATOM   1863 O  O     . VAL A 1 241 ? 66.076 -13.679 1.240   1.00 8.82  ? 238 VAL A O     1 
ATOM   1864 C  CB    . VAL A 1 241 ? 64.781 -12.513 3.575   1.00 8.15  ? 238 VAL A CB    1 
ATOM   1865 C  CG1   . VAL A 1 241 ? 64.253 -13.957 3.794   1.00 10.07 ? 238 VAL A CG1   1 
ATOM   1866 C  CG2   . VAL A 1 241 ? 64.474 -11.652 4.786   1.00 7.44  ? 238 VAL A CG2   1 
ATOM   1867 N  N     . SER A 1 242 ? 67.631 -14.419 2.685   1.00 9.11  ? 239 SER A N     1 
ATOM   1868 C  CA    . SER A 1 242 ? 68.125 -15.463 1.799   1.00 7.90  ? 239 SER A CA    1 
ATOM   1869 C  C     . SER A 1 242 ? 67.275 -16.728 1.935   1.00 6.04  ? 239 SER A C     1 
ATOM   1870 O  O     . SER A 1 242 ? 66.508 -16.871 2.883   1.00 7.57  ? 239 SER A O     1 
ATOM   1871 C  CB    . SER A 1 242 ? 69.592 -15.777 2.132   1.00 11.53 ? 239 SER A CB    1 
ATOM   1872 O  OG    . SER A 1 242 ? 69.690 -16.253 3.469   1.00 12.37 ? 239 SER A OG    1 
ATOM   1873 N  N     . HIS A 1 243 ? 67.398 -17.643 0.982   1.00 7.28  ? 240 HIS A N     1 
ATOM   1874 C  CA    . HIS A 1 243 ? 66.650 -18.888 1.078   1.00 9.37  ? 240 HIS A CA    1 
ATOM   1875 C  C     . HIS A 1 243 ? 67.025 -19.608 2.375   1.00 9.06  ? 240 HIS A C     1 
ATOM   1876 O  O     . HIS A 1 243 ? 66.161 -20.170 3.071   1.00 9.02  ? 240 HIS A O     1 
ATOM   1877 C  CB    . HIS A 1 243 ? 66.941 -19.801 -0.111  1.00 11.72 ? 240 HIS A CB    1 
ATOM   1878 C  CG    . HIS A 1 243 ? 66.129 -21.060 -0.097  1.00 12.73 ? 240 HIS A CG    1 
ATOM   1879 N  ND1   . HIS A 1 243 ? 64.766 -21.061 -0.291  1.00 15.90 ? 240 HIS A ND1   1 
ATOM   1880 C  CD2   . HIS A 1 243 ? 66.479 -22.348 0.130   1.00 16.25 ? 240 HIS A CD2   1 
ATOM   1881 C  CE1   . HIS A 1 243 ? 64.311 -22.301 -0.210  1.00 17.79 ? 240 HIS A CE1   1 
ATOM   1882 N  NE2   . HIS A 1 243 ? 65.330 -23.101 0.048   1.00 19.33 ? 240 HIS A NE2   1 
ATOM   1883 N  N     . GLY A 1 244 ? 68.316 -19.569 2.686   1.00 11.10 ? 241 GLY A N     1 
ATOM   1884 C  CA    . GLY A 1 244 ? 68.850 -20.264 3.844   1.00 10.36 ? 241 GLY A CA    1 
ATOM   1885 C  C     . GLY A 1 244 ? 68.334 -19.730 5.168   1.00 8.85  ? 241 GLY A C     1 
ATOM   1886 O  O     . GLY A 1 244 ? 68.265 -20.469 6.147   1.00 12.85 ? 241 GLY A O     1 
ATOM   1887 N  N     . SER A 1 245 ? 67.971 -18.448 5.198   1.00 8.15  ? 242 SER A N     1 
ATOM   1888 C  CA    . SER A 1 245 ? 67.464 -17.819 6.424   1.00 8.23  ? 242 SER A CA    1 
ATOM   1889 C  C     . SER A 1 245 ? 66.031 -18.227 6.762   1.00 8.35  ? 242 SER A C     1 
ATOM   1890 O  O     . SER A 1 245 ? 65.546 -17.978 7.868   1.00 8.48  ? 242 SER A O     1 
ATOM   1891 C  CB    . SER A 1 245 ? 67.556 -16.290 6.338   1.00 10.07 ? 242 SER A CB    1 
ATOM   1892 O  OG    . SER A 1 245 ? 66.509 -15.747 5.545   1.00 11.64 ? 242 SER A OG    1 
ATOM   1893 N  N     . VAL A 1 246 ? 65.350 -18.869 5.823   1.00 6.08  ? 243 VAL A N     1 
ATOM   1894 C  CA    . VAL A 1 246 ? 63.932 -19.152 6.026   1.00 5.82  ? 243 VAL A CA    1 
ATOM   1895 C  C     . VAL A 1 246 ? 63.581 -20.083 7.211   1.00 8.62  ? 243 VAL A C     1 
ATOM   1896 O  O     . VAL A 1 246 ? 62.699 -19.758 8.001   1.00 7.97  ? 243 VAL A O     1 
ATOM   1897 C  CB    . VAL A 1 246 ? 63.261 -19.597 4.718   1.00 6.54  ? 243 VAL A CB    1 
ATOM   1898 C  CG1   . VAL A 1 246 ? 61.807 -20.013 4.977   1.00 8.63  ? 243 VAL A CG1   1 
ATOM   1899 C  CG2   . VAL A 1 246 ? 63.321 -18.461 3.706   1.00 9.76  ? 243 VAL A CG2   1 
ATOM   1900 N  N     . PRO A 1 247 ? 64.271 -21.226 7.356   1.00 7.02  ? 244 PRO A N     1 
ATOM   1901 C  CA    . PRO A 1 247 ? 63.859 -22.090 8.470   1.00 6.85  ? 244 PRO A CA    1 
ATOM   1902 C  C     . PRO A 1 247 ? 63.884 -21.405 9.843   1.00 6.57  ? 244 PRO A C     1 
ATOM   1903 O  O     . PRO A 1 247 ? 62.919 -21.541 10.608  1.00 8.41  ? 244 PRO A O     1 
ATOM   1904 C  CB    . PRO A 1 247 ? 64.873 -23.248 8.412   1.00 9.88  ? 244 PRO A CB    1 
ATOM   1905 C  CG    . PRO A 1 247 ? 65.188 -23.362 6.934   1.00 10.59 ? 244 PRO A CG    1 
ATOM   1906 C  CD    . PRO A 1 247 ? 65.251 -21.893 6.475   1.00 7.42  ? 244 PRO A CD    1 
ATOM   1907 N  N     . GLN A 1 248 ? 64.953 -20.690 10.170  1.00 7.49  ? 245 GLN A N     1 
ATOM   1908 C  CA    . GLN A 1 248 ? 64.989 -20.036 11.472  1.00 9.00  ? 245 GLN A CA    1 
ATOM   1909 C  C     . GLN A 1 248 ? 63.978 -18.890 11.541  1.00 10.02 ? 245 GLN A C     1 
ATOM   1910 O  O     . GLN A 1 248 ? 63.285 -18.725 12.551  1.00 9.92  ? 245 GLN A O     1 
ATOM   1911 C  CB    . GLN A 1 248 ? 66.398 -19.551 11.809  1.00 11.07 ? 245 GLN A CB    1 
ATOM   1912 C  CG    . GLN A 1 248 ? 67.392 -20.694 12.021  1.00 20.39 ? 245 GLN A CG    1 
ATOM   1913 C  CD    . GLN A 1 248 ? 68.549 -20.318 12.944  1.00 29.58 ? 245 GLN A CD    1 
ATOM   1914 O  OE1   . GLN A 1 248 ? 68.373 -20.220 14.164  1.00 38.90 ? 245 GLN A OE1   1 
ATOM   1915 N  NE2   . GLN A 1 248 ? 69.740 -20.116 12.368  1.00 21.41 ? 245 GLN A NE2   1 
ATOM   1916 N  N     . LEU A 1 249 ? 63.901 -18.094 10.471  1.00 8.23  ? 246 LEU A N     1 
ATOM   1917 C  CA    . LEU A 1 249 ? 62.980 -16.955 10.447  1.00 8.05  ? 246 LEU A CA    1 
ATOM   1918 C  C     . LEU A 1 249 ? 61.544 -17.417 10.657  1.00 6.86  ? 246 LEU A C     1 
ATOM   1919 O  O     . LEU A 1 249 ? 60.778 -16.808 11.418  1.00 9.88  ? 246 LEU A O     1 
ATOM   1920 C  CB    . LEU A 1 249 ? 63.082 -16.229 9.102   1.00 8.98  ? 246 LEU A CB    1 
ATOM   1921 C  CG    . LEU A 1 249 ? 62.163 -15.030 8.922   1.00 11.90 ? 246 LEU A CG    1 
ATOM   1922 C  CD1   . LEU A 1 249 ? 62.497 -13.990 9.967   1.00 11.57 ? 246 LEU A CD1   1 
ATOM   1923 C  CD2   . LEU A 1 249 ? 62.332 -14.458 7.521   1.00 11.37 ? 246 LEU A CD2   1 
ATOM   1924 N  N     . PHE A 1 250 ? 61.178 -18.497 9.978   1.00 8.78  ? 247 PHE A N     1 
ATOM   1925 C  CA    . PHE A 1 250 ? 59.804 -18.964 10.017  1.00 7.34  ? 247 PHE A CA    1 
ATOM   1926 C  C     . PHE A 1 250 ? 59.481 -19.734 11.284  1.00 7.20  ? 247 PHE A C     1 
ATOM   1927 O  O     . PHE A 1 250 ? 58.302 -19.920 11.594  1.00 8.08  ? 247 PHE A O     1 
ATOM   1928 C  CB    . PHE A 1 250 ? 59.479 -19.818 8.785   1.00 5.84  ? 247 PHE A CB    1 
ATOM   1929 C  CG    . PHE A 1 250 ? 59.061 -19.022 7.572   1.00 6.22  ? 247 PHE A CG    1 
ATOM   1930 C  CD1   . PHE A 1 250 ? 58.540 -19.674 6.463   1.00 8.12  ? 247 PHE A CD1   1 
ATOM   1931 C  CD2   . PHE A 1 250 ? 59.200 -17.641 7.537   1.00 10.36 ? 247 PHE A CD2   1 
ATOM   1932 C  CE1   . PHE A 1 250 ? 58.155 -18.969 5.334   1.00 9.10  ? 247 PHE A CE1   1 
ATOM   1933 C  CE2   . PHE A 1 250 ? 58.820 -16.916 6.410   1.00 11.82 ? 247 PHE A CE2   1 
ATOM   1934 C  CZ    . PHE A 1 250 ? 58.292 -17.587 5.309   1.00 8.27  ? 247 PHE A CZ    1 
ATOM   1935 N  N     . SER A 1 251 ? 60.510 -20.159 12.023  1.00 6.15  ? 248 SER A N     1 
ATOM   1936 C  CA    . SER A 1 251 ? 60.289 -21.066 13.149  1.00 6.36  ? 248 SER A CA    1 
ATOM   1937 C  C     . SER A 1 251 ? 59.536 -20.357 14.272  1.00 7.45  ? 248 SER A C     1 
ATOM   1938 O  O     . SER A 1 251 ? 58.875 -20.993 15.084  1.00 8.39  ? 248 SER A O     1 
ATOM   1939 C  CB    . SER A 1 251 ? 61.616 -21.634 13.677  1.00 7.96  ? 248 SER A CB    1 
ATOM   1940 O  OG    . SER A 1 251 ? 62.374 -20.645 14.342  1.00 9.88  ? 248 SER A OG    1 
ATOM   1941 N  N     . GLN A 1 252 ? 59.633 -19.034 14.317  1.00 9.32  ? 249 GLN A N     1 
ATOM   1942 C  CA    . GLN A 1 252 ? 58.887 -18.270 15.306  1.00 10.10 ? 249 GLN A CA    1 
ATOM   1943 C  C     . GLN A 1 252 ? 58.027 -17.175 14.684  1.00 11.25 ? 249 GLN A C     1 
ATOM   1944 O  O     . GLN A 1 252 ? 57.697 -16.200 15.358  1.00 13.24 ? 249 GLN A O     1 
ATOM   1945 C  CB    . GLN A 1 252 ? 59.846 -17.615 16.292  1.00 13.94 ? 249 GLN A CB    1 
ATOM   1946 C  CG    . GLN A 1 252 ? 60.707 -18.578 17.053  1.00 17.58 ? 249 GLN A CG    1 
ATOM   1947 C  CD    . GLN A 1 252 ? 61.479 -17.857 18.124  1.00 19.68 ? 249 GLN A CD    1 
ATOM   1948 O  OE1   . GLN A 1 252 ? 60.973 -17.636 19.228  1.00 22.03 ? 249 GLN A OE1   1 
ATOM   1949 N  NE2   . GLN A 1 252 ? 62.685 -17.426 17.787  1.00 21.78 ? 249 GLN A NE2   1 
ATOM   1950 N  N     . MET A 1 253 ? 57.687 -17.323 13.408  1.00 8.50  ? 250 MET A N     1 
ATOM   1951 C  CA    . MET A 1 253 ? 56.948 -16.297 12.689  1.00 11.21 ? 250 MET A CA    1 
ATOM   1952 C  C     . MET A 1 253 ? 55.467 -16.596 12.750  1.00 7.23  ? 250 MET A C     1 
ATOM   1953 O  O     . MET A 1 253 ? 55.019 -17.571 12.177  1.00 10.05 ? 250 MET A O     1 
ATOM   1954 C  CB    . MET A 1 253 ? 57.409 -16.231 11.222  1.00 10.24 ? 250 MET A CB    1 
ATOM   1955 C  CG    . MET A 1 253 ? 56.728 -15.137 10.379  1.00 15.10 ? 250 MET A CG    1 
ATOM   1956 S  SD    . MET A 1 253 ? 57.134 -13.468 10.940  1.00 16.67 ? 250 MET A SD    1 
ATOM   1957 C  CE    . MET A 1 253 ? 58.909 -13.363 10.628  1.00 12.76 ? 250 MET A CE    1 
ATOM   1958 N  N     . PRO A 1 254 ? 54.694 -15.757 13.453  1.00 11.11 ? 251 PRO A N     1 
ATOM   1959 C  CA    . PRO A 1 254 ? 53.248 -15.993 13.456  1.00 10.17 ? 251 PRO A CA    1 
ATOM   1960 C  C     . PRO A 1 254 ? 52.703 -16.011 12.033  1.00 9.67  ? 251 PRO A C     1 
ATOM   1961 O  O     . PRO A 1 254 ? 53.090 -15.193 11.202  1.00 9.87  ? 251 PRO A O     1 
ATOM   1962 C  CB    . PRO A 1 254 ? 52.693 -14.783 14.228  1.00 9.97  ? 251 PRO A CB    1 
ATOM   1963 C  CG    . PRO A 1 254 ? 53.853 -14.298 15.049  1.00 13.17 ? 251 PRO A CG    1 
ATOM   1964 C  CD    . PRO A 1 254 ? 55.060 -14.524 14.166  1.00 11.22 ? 251 PRO A CD    1 
ATOM   1965 N  N     . ILE A 1 255 ? 51.817 -16.962 11.766  1.00 8.98  ? 252 ILE A N     1 
ATOM   1966 C  CA    . ILE A 1 255 ? 51.205 -17.127 10.461  1.00 10.46 ? 252 ILE A CA    1 
ATOM   1967 C  C     . ILE A 1 255 ? 50.612 -15.823 9.905   1.00 8.06  ? 252 ILE A C     1 
ATOM   1968 O  O     . ILE A 1 255 ? 50.734 -15.546 8.712   1.00 9.54  ? 252 ILE A O     1 
ATOM   1969 C  CB    . ILE A 1 255 ? 50.184 -18.289 10.512  1.00 14.06 ? 252 ILE A CB    1 
ATOM   1970 C  CG1   . ILE A 1 255 ? 50.954 -19.611 10.624  1.00 15.35 ? 252 ILE A CG1   1 
ATOM   1971 C  CG2   . ILE A 1 255 ? 49.261 -18.284 9.297   1.00 10.73 ? 252 ILE A CG2   1 
ATOM   1972 C  CD1   . ILE A 1 255 ? 50.121 -20.780 11.075  1.00 18.39 ? 252 ILE A CD1   1 
ATOM   1973 N  N     . ARG A 1 256 ? 50.011 -15.000 10.769  1.00 8.54  ? 253 ARG A N     1 
ATOM   1974 C  CA    . ARG A 1 256 ? 49.315 -13.810 10.293  1.00 7.54  ? 253 ARG A CA    1 
ATOM   1975 C  C     . ARG A 1 256 ? 50.245 -12.769 9.685   1.00 12.11 ? 253 ARG A C     1 
ATOM   1976 O  O     . ARG A 1 256 ? 49.783 -11.825 9.049   1.00 14.04 ? 253 ARG A O     1 
ATOM   1977 C  CB    . ARG A 1 256 ? 48.502 -13.162 11.419  1.00 12.73 ? 253 ARG A CB    1 
ATOM   1978 C  CG    . ARG A 1 256 ? 49.371 -12.659 12.552  1.00 13.86 ? 253 ARG A CG    1 
ATOM   1979 C  CD    . ARG A 1 256 ? 48.546 -12.036 13.681  1.00 19.03 ? 253 ARG A CD    1 
ATOM   1980 N  NE    . ARG A 1 256 ? 49.412 -11.537 14.753  1.00 18.08 ? 253 ARG A NE    1 
ATOM   1981 C  CZ    . ARG A 1 256 ? 49.857 -12.278 15.765  1.00 22.01 ? 253 ARG A CZ    1 
ATOM   1982 N  NH1   . ARG A 1 256 ? 49.509 -13.557 15.863  1.00 17.59 ? 253 ARG A NH1   1 
ATOM   1983 N  NH2   . ARG A 1 256 ? 50.651 -11.738 16.682  1.00 19.61 ? 253 ARG A NH2   1 
ATOM   1984 N  N     . LYS A 1 257 ? 51.551 -12.918 9.885   1.00 10.72 ? 254 LYS A N     1 
ATOM   1985 C  CA    . LYS A 1 257 ? 52.491 -11.922 9.360   1.00 9.00  ? 254 LYS A CA    1 
ATOM   1986 C  C     . LYS A 1 257 ? 52.751 -12.045 7.873   1.00 10.66 ? 254 LYS A C     1 
ATOM   1987 O  O     . LYS A 1 257 ? 53.308 -11.121 7.256   1.00 12.66 ? 254 LYS A O     1 
ATOM   1988 C  CB    . LYS A 1 257 ? 53.838 -11.982 10.092  1.00 9.93  ? 254 LYS A CB    1 
ATOM   1989 C  CG    . LYS A 1 257 ? 53.759 -11.790 11.600  1.00 16.30 ? 254 LYS A CG    1 
ATOM   1990 C  CD    . LYS A 1 257 ? 53.165 -10.459 11.997  1.00 20.43 ? 254 LYS A CD    1 
ATOM   1991 C  CE    . LYS A 1 257 ? 53.203 -10.296 13.524  1.00 26.94 ? 254 LYS A CE    1 
ATOM   1992 N  NZ    . LYS A 1 257 ? 52.600 -9.004  13.974  1.00 27.61 ? 254 LYS A NZ    1 
ATOM   1993 N  N     . ILE A 1 258 ? 52.396 -13.188 7.295   1.00 10.81 ? 255 ILE A N     1 
ATOM   1994 C  CA    . ILE A 1 258 ? 52.693 -13.436 5.886   1.00 8.46  ? 255 ILE A CA    1 
ATOM   1995 C  C     . ILE A 1 258 ? 51.570 -12.857 5.043   1.00 12.37 ? 255 ILE A C     1 
ATOM   1996 O  O     . ILE A 1 258 ? 50.397 -13.048 5.357   1.00 13.45 ? 255 ILE A O     1 
ATOM   1997 C  CB    . ILE A 1 258 ? 52.824 -14.945 5.620   1.00 11.79 ? 255 ILE A CB    1 
ATOM   1998 C  CG1   . ILE A 1 258 ? 54.166 -15.462 6.159   1.00 16.66 ? 255 ILE A CG1   1 
ATOM   1999 C  CG2   . ILE A 1 258 ? 52.681 -15.248 4.140   1.00 14.08 ? 255 ILE A CG2   1 
ATOM   2000 C  CD1   . ILE A 1 258 ? 54.339 -15.289 7.641   1.00 21.53 ? 255 ILE A CD1   1 
ATOM   2001 N  N     . ARG A 1 259 ? 51.916 -12.147 3.974   1.00 12.77 ? 256 ARG A N     1 
ATOM   2002 C  CA    . ARG A 1 259 ? 50.885 -11.479 3.177   1.00 13.20 ? 256 ARG A CA    1 
ATOM   2003 C  C     . ARG A 1 259 ? 49.853 -12.482 2.647   1.00 16.18 ? 256 ARG A C     1 
ATOM   2004 O  O     . ARG A 1 259 ? 50.212 -13.503 2.057   1.00 15.56 ? 256 ARG A O     1 
ATOM   2005 C  CB    . ARG A 1 259 ? 51.513 -10.682 2.025   1.00 13.99 ? 256 ARG A CB    1 
ATOM   2006 C  CG    A ARG A 1 259 ? 50.550 -9.791  1.251   0.50 17.88 ? 256 ARG A CG    1 
ATOM   2007 C  CG    B ARG A 1 259 ? 50.534 -9.685  1.400   0.50 17.77 ? 256 ARG A CG    1 
ATOM   2008 C  CD    A ARG A 1 259 ? 51.115 -9.461  -0.130  0.50 21.97 ? 256 ARG A CD    1 
ATOM   2009 C  CD    B ARG A 1 259 ? 51.136 -8.928  0.226   0.50 20.67 ? 256 ARG A CD    1 
ATOM   2010 N  NE    A ARG A 1 259 ? 50.741 -10.472 -1.115  0.50 27.37 ? 256 ARG A NE    1 
ATOM   2011 N  NE    B ARG A 1 259 ? 50.182 -7.982  -0.354  0.50 19.67 ? 256 ARG A NE    1 
ATOM   2012 C  CZ    A ARG A 1 259 ? 51.257 -10.579 -2.337  0.50 31.54 ? 256 ARG A CZ    1 
ATOM   2013 C  CZ    B ARG A 1 259 ? 49.248 -8.312  -1.241  0.50 25.62 ? 256 ARG A CZ    1 
ATOM   2014 N  NH1   A ARG A 1 259 ? 50.826 -11.537 -3.146  0.50 36.24 ? 256 ARG A NH1   1 
ATOM   2015 N  NH1   B ARG A 1 259 ? 49.137 -9.567  -1.653  0.50 26.54 ? 256 ARG A NH1   1 
ATOM   2016 N  NH2   A ARG A 1 259 ? 52.200 -9.742  -2.756  0.50 25.26 ? 256 ARG A NH2   1 
ATOM   2017 N  NH2   B ARG A 1 259 ? 48.420 -7.390  -1.715  0.50 23.16 ? 256 ARG A NH2   1 
ATOM   2018 N  N     . SER A 1 260 ? 48.578 -12.160 2.876   1.00 13.17 ? 257 SER A N     1 
ATOM   2019 C  CA    . SER A 1 260 ? 47.402 -12.958 2.498   1.00 15.00 ? 257 SER A CA    1 
ATOM   2020 C  C     . SER A 1 260 ? 46.910 -13.877 3.625   1.00 15.66 ? 257 SER A C     1 
ATOM   2021 O  O     . SER A 1 260 ? 45.824 -14.449 3.529   1.00 12.86 ? 257 SER A O     1 
ATOM   2022 C  CB    . SER A 1 260 ? 47.605 -13.750 1.200   1.00 16.75 ? 257 SER A CB    1 
ATOM   2023 O  OG    . SER A 1 260 ? 48.149 -15.036 1.448   1.00 15.74 ? 257 SER A OG    1 
ATOM   2024 N  N     . LEU A 1 261 ? 47.696 -14.004 4.693   1.00 8.53  ? 258 LEU A N     1 
ATOM   2025 C  CA    . LEU A 1 261 ? 47.289 -14.837 5.821   1.00 8.44  ? 258 LEU A CA    1 
ATOM   2026 C  C     . LEU A 1 261 ? 46.865 -14.033 7.039   1.00 11.58 ? 258 LEU A C     1 
ATOM   2027 O  O     . LEU A 1 261 ? 46.717 -14.580 8.131   1.00 11.52 ? 258 LEU A O     1 
ATOM   2028 C  CB    . LEU A 1 261 ? 48.409 -15.812 6.201   1.00 10.28 ? 258 LEU A CB    1 
ATOM   2029 C  CG    . LEU A 1 261 ? 48.789 -16.744 5.054   1.00 10.45 ? 258 LEU A CG    1 
ATOM   2030 C  CD1   . LEU A 1 261 ? 49.874 -17.677 5.515   1.00 7.18  ? 258 LEU A CD1   1 
ATOM   2031 C  CD2   . LEU A 1 261 ? 47.592 -17.533 4.560   1.00 12.83 ? 258 LEU A CD2   1 
ATOM   2032 N  N     . GLY A 1 262 ? 46.647 -12.738 6.845   1.00 11.25 ? 259 GLY A N     1 
ATOM   2033 C  CA    . GLY A 1 262 ? 46.364 -11.848 7.954   1.00 11.43 ? 259 GLY A CA    1 
ATOM   2034 C  C     . GLY A 1 262 ? 44.903 -11.821 8.353   1.00 14.74 ? 259 GLY A C     1 
ATOM   2035 O  O     . GLY A 1 262 ? 44.539 -11.141 9.309   1.00 15.18 ? 259 GLY A O     1 
ATOM   2036 N  N     . GLY A 1 263 ? 44.064 -12.540 7.611   1.00 11.21 ? 260 GLY A N     1 
ATOM   2037 C  CA    . GLY A 1 263 ? 42.634 -12.535 7.868   1.00 11.03 ? 260 GLY A CA    1 
ATOM   2038 C  C     . GLY A 1 263 ? 42.042 -13.892 8.218   1.00 17.85 ? 260 GLY A C     1 
ATOM   2039 O  O     . GLY A 1 263 ? 42.618 -14.670 8.999   1.00 13.89 ? 260 GLY A O     1 
ATOM   2040 N  N     . LYS A 1 264 ? 40.885 -14.190 7.633   1.00 14.31 ? 261 LYS A N     1 
ATOM   2041 C  CA    . LYS A 1 264 ? 40.163 -15.423 7.955   1.00 14.59 ? 261 LYS A CA    1 
ATOM   2042 C  C     . LYS A 1 264 ? 40.898 -16.722 7.589   1.00 15.10 ? 261 LYS A C     1 
ATOM   2043 O  O     . LYS A 1 264 ? 40.885 -17.671 8.377   1.00 16.63 ? 261 LYS A O     1 
ATOM   2044 C  CB    . LYS A 1 264 ? 38.755 -15.395 7.338   1.00 15.28 ? 261 LYS A CB    1 
ATOM   2045 C  CG    . LYS A 1 264 ? 37.851 -14.345 7.972   1.00 20.19 ? 261 LYS A CG    1 
ATOM   2046 C  CD    . LYS A 1 264 ? 36.507 -14.244 7.249   1.00 25.10 ? 261 LYS A CD    1 
ATOM   2047 C  CE    . LYS A 1 264 ? 35.598 -13.228 7.938   1.00 40.65 ? 261 LYS A CE    1 
ATOM   2048 N  NZ    . LYS A 1 264 ? 34.277 -13.081 7.259   1.00 41.46 ? 261 LYS A NZ    1 
ATOM   2049 N  N     . LEU A 1 265 ? 41.531 -16.772 6.416   1.00 11.09 ? 262 LEU A N     1 
ATOM   2050 C  CA    . LEU A 1 265 ? 42.269 -17.968 6.009   1.00 11.89 ? 262 LEU A CA    1 
ATOM   2051 C  C     . LEU A 1 265 ? 43.362 -18.262 7.032   1.00 13.92 ? 262 LEU A C     1 
ATOM   2052 O  O     . LEU A 1 265 ? 43.510 -19.399 7.494   1.00 13.32 ? 262 LEU A O     1 
ATOM   2053 C  CB    . LEU A 1 265 ? 42.902 -17.789 4.627   1.00 11.52 ? 262 LEU A CB    1 
ATOM   2054 C  CG    . LEU A 1 265 ? 43.791 -18.935 4.105   1.00 13.48 ? 262 LEU A CG    1 
ATOM   2055 C  CD1   . LEU A 1 265 ? 42.993 -20.222 4.042   1.00 17.90 ? 262 LEU A CD1   1 
ATOM   2056 C  CD2   . LEU A 1 265 ? 44.379 -18.603 2.731   1.00 13.90 ? 262 LEU A CD2   1 
ATOM   2057 N  N     . GLY A 1 266 ? 44.119 -17.230 7.391   1.00 12.07 ? 263 GLY A N     1 
ATOM   2058 C  CA    . GLY A 1 266 ? 45.188 -17.395 8.360   1.00 12.80 ? 263 GLY A CA    1 
ATOM   2059 C  C     . GLY A 1 266 ? 44.668 -17.885 9.695   1.00 12.23 ? 263 GLY A C     1 
ATOM   2060 O  O     . GLY A 1 266 ? 45.290 -18.725 10.360  1.00 12.50 ? 263 GLY A O     1 
ATOM   2061 N  N     . ALA A 1 267 ? 43.518 -17.355 10.103  1.00 12.11 ? 264 ALA A N     1 
ATOM   2062 C  CA    . ALA A 1 267 ? 42.931 -17.767 11.370  1.00 14.46 ? 264 ALA A CA    1 
ATOM   2063 C  C     . ALA A 1 267 ? 42.519 -19.230 11.290  1.00 15.18 ? 264 ALA A C     1 
ATOM   2064 O  O     . ALA A 1 267 ? 42.639 -19.978 12.260  1.00 15.48 ? 264 ALA A O     1 
ATOM   2065 C  CB    . ALA A 1 267 ? 41.736 -16.878 11.719  1.00 18.03 ? 264 ALA A CB    1 
ATOM   2066 N  N     . SER A 1 268 ? 42.049 -19.646 10.120  1.00 13.48 ? 265 SER A N     1 
ATOM   2067 C  CA    . SER A 1 268 ? 41.621 -21.024 9.955   1.00 14.36 ? 265 SER A CA    1 
ATOM   2068 C  C     . SER A 1 268 ? 42.821 -21.971 9.933   1.00 12.88 ? 265 SER A C     1 
ATOM   2069 O  O     . SER A 1 268 ? 42.737 -23.076 10.456  1.00 12.96 ? 265 SER A O     1 
ATOM   2070 C  CB    . SER A 1 268 ? 40.729 -21.203 8.721   1.00 20.29 ? 265 SER A CB    1 
ATOM   2071 O  OG    . SER A 1 268 ? 41.461 -21.056 7.521   1.00 27.38 ? 265 SER A OG    1 
ATOM   2072 N  N     . VAL A 1 269 ? 43.937 -21.537 9.351   1.00 10.50 ? 266 VAL A N     1 
ATOM   2073 C  CA    . VAL A 1 269 ? 45.136 -22.369 9.363   1.00 9.53  ? 266 VAL A CA    1 
ATOM   2074 C  C     . VAL A 1 269 ? 45.514 -22.675 10.820  1.00 13.68 ? 266 VAL A C     1 
ATOM   2075 O  O     . VAL A 1 269 ? 45.765 -23.828 11.201  1.00 12.88 ? 266 VAL A O     1 
ATOM   2076 C  CB    . VAL A 1 269 ? 46.311 -21.710 8.622   1.00 10.39 ? 266 VAL A CB    1 
ATOM   2077 C  CG1   . VAL A 1 269 ? 47.579 -22.530 8.820   1.00 11.37 ? 266 VAL A CG1   1 
ATOM   2078 C  CG2   . VAL A 1 269 ? 45.990 -21.586 7.125   1.00 9.77  ? 266 VAL A CG2   1 
ATOM   2079 N  N     . ILE A 1 270 ? 45.509 -21.632 11.641  1.00 9.81  ? 267 ILE A N     1 
ATOM   2080 C  CA    . ILE A 1 270 ? 45.875 -21.759 13.044  1.00 12.09 ? 267 ILE A CA    1 
ATOM   2081 C  C     . ILE A 1 270 ? 44.901 -22.667 13.787  1.00 16.80 ? 267 ILE A C     1 
ATOM   2082 O  O     . ILE A 1 270 ? 45.321 -23.531 14.564  1.00 16.38 ? 267 ILE A O     1 
ATOM   2083 C  CB    . ILE A 1 270 ? 45.917 -20.366 13.705  1.00 12.65 ? 267 ILE A CB    1 
ATOM   2084 C  CG1   . ILE A 1 270 ? 47.136 -19.590 13.201  1.00 12.61 ? 267 ILE A CG1   1 
ATOM   2085 C  CG2   . ILE A 1 270 ? 45.948 -20.482 15.222  1.00 20.75 ? 267 ILE A CG2   1 
ATOM   2086 C  CD1   . ILE A 1 270 ? 47.088 -18.110 13.522  1.00 15.61 ? 267 ILE A CD1   1 
ATOM   2087 N  N     . GLU A 1 271 ? 43.602 -22.489 13.531  1.00 11.89 ? 268 GLU A N     1 
ATOM   2088 C  CA    . GLU A 1 271 ? 42.579 -23.207 14.278  1.00 17.04 ? 268 GLU A CA    1 
ATOM   2089 C  C     . GLU A 1 271 ? 42.502 -24.673 13.890  1.00 15.53 ? 268 GLU A C     1 
ATOM   2090 O  O     . GLU A 1 271 ? 42.456 -25.557 14.749  1.00 19.83 ? 268 GLU A O     1 
ATOM   2091 C  CB    . GLU A 1 271 ? 41.211 -22.556 14.090  1.00 23.48 ? 268 GLU A CB    1 
ATOM   2092 C  CG    . GLU A 1 271 ? 40.063 -23.355 14.689  1.00 34.58 ? 268 GLU A CG    1 
ATOM   2093 C  CD    . GLU A 1 271 ? 39.008 -22.466 15.328  1.00 51.05 ? 268 GLU A CD    1 
ATOM   2094 O  OE1   . GLU A 1 271 ? 37.812 -22.828 15.276  1.00 56.20 ? 268 GLU A OE1   1 
ATOM   2095 O  OE2   . GLU A 1 271 ? 39.377 -21.409 15.889  1.00 56.84 ? 268 GLU A OE2   1 
ATOM   2096 N  N     . ILE A 1 272 ? 42.487 -24.919 12.587  1.00 14.06 ? 269 ILE A N     1 
ATOM   2097 C  CA    . ILE A 1 272 ? 42.298 -26.258 12.070  1.00 12.95 ? 269 ILE A CA    1 
ATOM   2098 C  C     . ILE A 1 272 ? 43.518 -27.130 12.327  1.00 16.00 ? 269 ILE A C     1 
ATOM   2099 O  O     . ILE A 1 272 ? 43.395 -28.307 12.678  1.00 14.98 ? 269 ILE A O     1 
ATOM   2100 C  CB    . ILE A 1 272 ? 41.988 -26.235 10.563  1.00 14.39 ? 269 ILE A CB    1 
ATOM   2101 C  CG1   . ILE A 1 272 ? 40.591 -25.657 10.317  1.00 19.20 ? 269 ILE A CG1   1 
ATOM   2102 C  CG2   . ILE A 1 272 ? 42.080 -27.637 9.988   1.00 17.37 ? 269 ILE A CG2   1 
ATOM   2103 C  CD1   . ILE A 1 272 ? 40.213 -25.567 8.852   1.00 21.11 ? 269 ILE A CD1   1 
ATOM   2104 N  N     . LEU A 1 273 ? 44.707 -26.561 12.144  1.00 14.29 ? 270 LEU A N     1 
ATOM   2105 C  CA    . LEU A 1 273 ? 45.932 -27.344 12.270  1.00 14.96 ? 270 LEU A CA    1 
ATOM   2106 C  C     . LEU A 1 273 ? 46.508 -27.345 13.677  1.00 14.04 ? 270 LEU A C     1 
ATOM   2107 O  O     . LEU A 1 273 ? 47.330 -28.200 14.014  1.00 15.37 ? 270 LEU A O     1 
ATOM   2108 C  CB    . LEU A 1 273 ? 46.977 -26.857 11.277  1.00 11.88 ? 270 LEU A CB    1 
ATOM   2109 C  CG    . LEU A 1 273 ? 46.567 -26.980 9.818   1.00 13.30 ? 270 LEU A CG    1 
ATOM   2110 C  CD1   . LEU A 1 273 ? 47.686 -26.427 8.946   1.00 12.94 ? 270 LEU A CD1   1 
ATOM   2111 C  CD2   . LEU A 1 273 ? 46.278 -28.425 9.464   1.00 17.02 ? 270 LEU A CD2   1 
ATOM   2112 N  N     . GLY A 1 274 ? 46.070 -26.387 14.487  1.00 14.42 ? 271 GLY A N     1 
ATOM   2113 C  CA    . GLY A 1 274 ? 46.551 -26.243 15.851  1.00 14.41 ? 271 GLY A CA    1 
ATOM   2114 C  C     . GLY A 1 274 ? 48.004 -25.811 15.922  1.00 18.09 ? 271 GLY A C     1 
ATOM   2115 O  O     . GLY A 1 274 ? 48.768 -26.314 16.743  1.00 19.05 ? 271 GLY A O     1 
ATOM   2116 N  N     . ILE A 1 275 ? 48.395 -24.889 15.050  1.00 12.54 ? 272 ILE A N     1 
ATOM   2117 C  CA    . ILE A 1 275 ? 49.769 -24.404 15.018  1.00 11.71 ? 272 ILE A CA    1 
ATOM   2118 C  C     . ILE A 1 275 ? 49.787 -22.891 15.201  1.00 10.67 ? 272 ILE A C     1 
ATOM   2119 O  O     . ILE A 1 275 ? 48.735 -22.256 15.171  1.00 13.18 ? 272 ILE A O     1 
ATOM   2120 C  CB    . ILE A 1 275 ? 50.472 -24.786 13.690  1.00 13.28 ? 272 ILE A CB    1 
ATOM   2121 C  CG1   . ILE A 1 275 ? 49.716 -24.206 12.487  1.00 15.61 ? 272 ILE A CG1   1 
ATOM   2122 C  CG2   . ILE A 1 275 ? 50.603 -26.312 13.583  1.00 11.85 ? 272 ILE A CG2   1 
ATOM   2123 C  CD1   . ILE A 1 275 ? 50.454 -24.396 11.144  1.00 10.36 ? 272 ILE A CD1   1 
ATOM   2124 N  N     . GLU A 1 276 ? 50.974 -22.316 15.397  1.00 11.31 ? 273 GLU A N     1 
ATOM   2125 C  CA    . GLU A 1 276 ? 51.118 -20.869 15.582  1.00 10.21 ? 273 GLU A CA    1 
ATOM   2126 C  C     . GLU A 1 276 ? 52.047 -20.216 14.557  1.00 10.63 ? 273 GLU A C     1 
ATOM   2127 O  O     . GLU A 1 276 ? 51.840 -19.064 14.167  1.00 10.93 ? 273 GLU A O     1 
ATOM   2128 C  CB    . GLU A 1 276 ? 51.649 -20.549 16.981  1.00 14.90 ? 273 GLU A CB    1 
ATOM   2129 C  CG    . GLU A 1 276 ? 50.708 -20.943 18.110  1.00 23.84 ? 273 GLU A CG    1 
ATOM   2130 C  CD    . GLU A 1 276 ? 51.275 -20.611 19.487  1.00 36.68 ? 273 GLU A CD    1 
ATOM   2131 O  OE1   . GLU A 1 276 ? 51.081 -21.420 20.421  1.00 47.11 ? 273 GLU A OE1   1 
ATOM   2132 O  OE2   . GLU A 1 276 ? 51.904 -19.538 19.634  1.00 35.32 ? 273 GLU A OE2   1 
ATOM   2133 N  N     . TYR A 1 277 ? 53.063 -20.951 14.126  1.00 10.00 ? 274 TYR A N     1 
ATOM   2134 C  CA    . TYR A 1 277 ? 54.139 -20.350 13.333  1.00 11.16 ? 274 TYR A CA    1 
ATOM   2135 C  C     . TYR A 1 277 ? 54.218 -20.913 11.925  1.00 9.86  ? 274 TYR A C     1 
ATOM   2136 O  O     . TYR A 1 277 ? 53.873 -22.073 11.673  1.00 9.91  ? 274 TYR A O     1 
ATOM   2137 C  CB    . TYR A 1 277 ? 55.485 -20.530 14.032  1.00 11.32 ? 274 TYR A CB    1 
ATOM   2138 C  CG    . TYR A 1 277 ? 55.499 -20.026 15.455  1.00 9.84  ? 274 TYR A CG    1 
ATOM   2139 C  CD1   . TYR A 1 277 ? 55.777 -20.882 16.516  1.00 11.16 ? 274 TYR A CD1   1 
ATOM   2140 C  CD2   . TYR A 1 277 ? 55.228 -18.697 15.733  1.00 9.42  ? 274 TYR A CD2   1 
ATOM   2141 C  CE1   . TYR A 1 277 ? 55.784 -20.413 17.831  1.00 13.60 ? 274 TYR A CE1   1 
ATOM   2142 C  CE2   . TYR A 1 277 ? 55.225 -18.221 17.028  1.00 11.18 ? 274 TYR A CE2   1 
ATOM   2143 C  CZ    . TYR A 1 277 ? 55.501 -19.085 18.077  1.00 18.64 ? 274 TYR A CZ    1 
ATOM   2144 O  OH    . TYR A 1 277 ? 55.499 -18.607 19.369  1.00 16.58 ? 274 TYR A OH    1 
ATOM   2145 N  N     . MET A 1 278 ? 54.689 -20.090 10.999  1.00 7.76  ? 275 MET A N     1 
ATOM   2146 C  CA    . MET A 1 278 ? 54.809 -20.515 9.602   1.00 8.53  ? 275 MET A CA    1 
ATOM   2147 C  C     . MET A 1 278 ? 55.579 -21.823 9.425   1.00 11.83 ? 275 MET A C     1 
ATOM   2148 O  O     . MET A 1 278 ? 55.183 -22.668 8.635   1.00 9.81  ? 275 MET A O     1 
ATOM   2149 C  CB    . MET A 1 278 ? 55.456 -19.414 8.752   1.00 10.71 ? 275 MET A CB    1 
ATOM   2150 C  CG    . MET A 1 278 ? 54.497 -18.407 8.201   1.00 25.54 ? 275 MET A CG    1 
ATOM   2151 S  SD    . MET A 1 278 ? 53.287 -19.065 7.031   1.00 16.16 ? 275 MET A SD    1 
ATOM   2152 C  CE    . MET A 1 278 ? 54.271 -19.508 5.614   1.00 25.02 ? 275 MET A CE    1 
ATOM   2153 N  N     . GLY A 1 279 ? 56.680 -21.986 10.153  1.00 9.15  ? 276 GLY A N     1 
ATOM   2154 C  CA    . GLY A 1 279 ? 57.531 -23.147 9.976   1.00 10.65 ? 276 GLY A CA    1 
ATOM   2155 C  C     . GLY A 1 279 ? 56.814 -24.449 10.300  1.00 14.71 ? 276 GLY A C     1 
ATOM   2156 O  O     . GLY A 1 279 ? 57.113 -25.497 9.725   1.00 11.58 ? 276 GLY A O     1 
ATOM   2157 N  N     . GLU A 1 280 ? 55.862 -24.390 11.225  1.00 7.51  ? 277 GLU A N     1 
ATOM   2158 C  CA    . GLU A 1 280 ? 55.101 -25.582 11.581  1.00 7.04  ? 277 GLU A CA    1 
ATOM   2159 C  C     . GLU A 1 280 ? 54.324 -26.173 10.396  1.00 7.90  ? 277 GLU A C     1 
ATOM   2160 O  O     . GLU A 1 280 ? 53.969 -27.359 10.410  1.00 9.55  ? 277 GLU A O     1 
ATOM   2161 C  CB    . GLU A 1 280 ? 54.144 -25.297 12.740  1.00 8.54  ? 277 GLU A CB    1 
ATOM   2162 C  CG    . GLU A 1 280 ? 54.838 -25.026 14.056  1.00 7.86  ? 277 GLU A CG    1 
ATOM   2163 C  CD    . GLU A 1 280 ? 53.847 -24.736 15.173  1.00 16.34 ? 277 GLU A CD    1 
ATOM   2164 O  OE1   . GLU A 1 280 ? 53.522 -23.557 15.375  1.00 16.23 ? 277 GLU A OE1   1 
ATOM   2165 O  OE2   . GLU A 1 280 ? 53.393 -25.686 15.849  1.00 14.14 ? 277 GLU A OE2   1 
ATOM   2166 N  N     . LEU A 1 281 ? 54.072 -25.374 9.363   1.00 9.44  ? 278 LEU A N     1 
ATOM   2167 C  CA    . LEU A 1 281 ? 53.369 -25.905 8.189   1.00 7.89  ? 278 LEU A CA    1 
ATOM   2168 C  C     . LEU A 1 281 ? 54.127 -26.994 7.438   1.00 8.13  ? 278 LEU A C     1 
ATOM   2169 O  O     . LEU A 1 281 ? 53.515 -27.751 6.688   1.00 9.68  ? 278 LEU A O     1 
ATOM   2170 C  CB    . LEU A 1 281 ? 52.994 -24.778 7.210   1.00 7.43  ? 278 LEU A CB    1 
ATOM   2171 C  CG    . LEU A 1 281 ? 51.839 -23.886 7.656   1.00 10.16 ? 278 LEU A CG    1 
ATOM   2172 C  CD1   . LEU A 1 281 ? 51.869 -22.537 6.917   1.00 11.93 ? 278 LEU A CD1   1 
ATOM   2173 C  CD2   . LEU A 1 281 ? 50.507 -24.618 7.423   1.00 9.59  ? 278 LEU A CD2   1 
ATOM   2174 N  N     . THR A 1 282 ? 55.450 -27.065 7.610   1.00 10.36 ? 279 THR A N     1 
ATOM   2175 C  CA    . THR A 1 282 ? 56.243 -28.017 6.813   1.00 13.77 ? 279 THR A CA    1 
ATOM   2176 C  C     . THR A 1 282 ? 55.891 -29.469 7.120   1.00 11.77 ? 279 THR A C     1 
ATOM   2177 O  O     . THR A 1 282 ? 56.181 -30.357 6.329   1.00 12.42 ? 279 THR A O     1 
ATOM   2178 C  CB    . THR A 1 282 ? 57.768 -27.846 7.003   1.00 12.39 ? 279 THR A CB    1 
ATOM   2179 O  OG1   . THR A 1 282 ? 58.117 -28.128 8.366   1.00 13.44 ? 279 THR A OG1   1 
ATOM   2180 C  CG2   . THR A 1 282 ? 58.218 -26.434 6.654   1.00 9.53  ? 279 THR A CG2   1 
ATOM   2181 N  N     . GLN A 1 283 ? 55.260 -29.710 8.266   1.00 10.23 ? 280 GLN A N     1 
ATOM   2182 C  CA    . GLN A 1 283 ? 54.981 -31.078 8.668   1.00 13.24 ? 280 GLN A CA    1 
ATOM   2183 C  C     . GLN A 1 283 ? 53.736 -31.696 8.044   1.00 17.56 ? 280 GLN A C     1 
ATOM   2184 O  O     . GLN A 1 283 ? 53.428 -32.855 8.296   1.00 23.50 ? 280 GLN A O     1 
ATOM   2185 C  CB    . GLN A 1 283 ? 54.936 -31.173 10.190  1.00 15.54 ? 280 GLN A CB    1 
ATOM   2186 C  CG    A GLN A 1 283 ? 56.284 -30.898 10.780  0.50 11.43 ? 280 GLN A CG    1 
ATOM   2187 C  CG    B GLN A 1 283 ? 53.804 -30.432 10.820  0.50 12.24 ? 280 GLN A CG    1 
ATOM   2188 C  CD    A GLN A 1 283 ? 57.339 -31.747 10.106  0.50 14.82 ? 280 GLN A CD    1 
ATOM   2189 C  CD    B GLN A 1 283 ? 53.966 -30.333 12.321  0.50 21.17 ? 280 GLN A CD    1 
ATOM   2190 O  OE1   A GLN A 1 283 ? 57.314 -32.973 10.210  0.50 16.14 ? 280 GLN A OE1   1 
ATOM   2191 O  OE1   B GLN A 1 283 ? 54.315 -31.311 12.992  0.50 16.09 ? 280 GLN A OE1   1 
ATOM   2192 N  NE2   A GLN A 1 283 ? 58.256 -31.106 9.385   0.50 12.62 ? 280 GLN A NE2   1 
ATOM   2193 N  NE2   B GLN A 1 283 ? 53.723 -29.148 12.858  0.50 10.31 ? 280 GLN A NE2   1 
ATOM   2194 N  N     . PHE A 1 284 ? 53.037 -30.932 7.218   1.00 11.26 ? 281 PHE A N     1 
ATOM   2195 C  CA    . PHE A 1 284 ? 51.847 -31.431 6.547   1.00 9.47  ? 281 PHE A CA    1 
ATOM   2196 C  C     . PHE A 1 284 ? 52.126 -31.732 5.077   1.00 12.36 ? 281 PHE A C     1 
ATOM   2197 O  O     . PHE A 1 284 ? 52.963 -31.081 4.457   1.00 15.18 ? 281 PHE A O     1 
ATOM   2198 C  CB    . PHE A 1 284 ? 50.738 -30.403 6.678   1.00 9.35  ? 281 PHE A CB    1 
ATOM   2199 C  CG    . PHE A 1 284 ? 50.375 -30.124 8.096   1.00 9.22  ? 281 PHE A CG    1 
ATOM   2200 C  CD1   . PHE A 1 284 ? 49.478 -30.940 8.763   1.00 13.94 ? 281 PHE A CD1   1 
ATOM   2201 C  CD2   . PHE A 1 284 ? 50.973 -29.084 8.790   1.00 11.16 ? 281 PHE A CD2   1 
ATOM   2202 C  CE1   . PHE A 1 284 ? 49.158 -30.701 10.093  1.00 14.69 ? 281 PHE A CE1   1 
ATOM   2203 C  CE2   . PHE A 1 284 ? 50.656 -28.851 10.108  1.00 15.06 ? 281 PHE A CE2   1 
ATOM   2204 C  CZ    . PHE A 1 284 ? 49.755 -29.657 10.761  1.00 17.94 ? 281 PHE A CZ    1 
ATOM   2205 N  N     . THR A 1 285 ? 51.429 -32.714 4.516   1.00 11.12 ? 282 THR A N     1 
ATOM   2206 C  CA    . THR A 1 285 ? 51.628 -33.007 3.101   1.00 11.61 ? 282 THR A CA    1 
ATOM   2207 C  C     . THR A 1 285 ? 50.892 -31.968 2.290   1.00 8.62  ? 282 THR A C     1 
ATOM   2208 O  O     . THR A 1 285 ? 50.007 -31.292 2.799   1.00 11.15 ? 282 THR A O     1 
ATOM   2209 C  CB    . THR A 1 285 ? 51.104 -34.395 2.702   1.00 12.25 ? 282 THR A CB    1 
ATOM   2210 O  OG1   . THR A 1 285 ? 49.677 -34.412 2.814   1.00 12.75 ? 282 THR A OG1   1 
ATOM   2211 C  CG2   . THR A 1 285 ? 51.696 -35.451 3.605   1.00 13.90 ? 282 THR A CG2   1 
ATOM   2212 N  N     . GLU A 1 286 ? 51.263 -31.846 1.024   1.00 9.38  ? 283 GLU A N     1 
ATOM   2213 C  CA    . GLU A 1 286 ? 50.555 -30.947 0.129   1.00 13.71 ? 283 GLU A CA    1 
ATOM   2214 C  C     . GLU A 1 286 ? 49.066 -31.318 0.058   1.00 12.82 ? 283 GLU A C     1 
ATOM   2215 O  O     . GLU A 1 286 ? 48.215 -30.436 0.150   1.00 10.53 ? 283 GLU A O     1 
ATOM   2216 C  CB    . GLU A 1 286 ? 51.202 -30.943 -1.256  1.00 11.37 ? 283 GLU A CB    1 
ATOM   2217 C  CG    . GLU A 1 286 ? 50.588 -29.908 -2.178  1.00 11.94 ? 283 GLU A CG    1 
ATOM   2218 C  CD    . GLU A 1 286 ? 51.252 -29.876 -3.543  1.00 27.72 ? 283 GLU A CD    1 
ATOM   2219 O  OE1   . GLU A 1 286 ? 52.108 -30.742 -3.809  1.00 26.00 ? 283 GLU A OE1   1 
ATOM   2220 O  OE2   . GLU A 1 286 ? 50.914 -28.982 -4.348  1.00 28.10 ? 283 GLU A OE2   1 
ATOM   2221 N  N     . SER A 1 287 ? 48.747 -32.616 -0.063  1.00 9.48  ? 284 SER A N     1 
ATOM   2222 C  CA    . SER A 1 287 ? 47.339 -33.043 -0.113  1.00 14.14 ? 284 SER A CA    1 
ATOM   2223 C  C     . SER A 1 287 ? 46.584 -32.712 1.175   1.00 11.39 ? 284 SER A C     1 
ATOM   2224 O  O     . SER A 1 287 ? 45.400 -32.363 1.139   1.00 12.21 ? 284 SER A O     1 
ATOM   2225 C  CB    . SER A 1 287 ? 47.209 -34.543 -0.429  1.00 14.46 ? 284 SER A CB    1 
ATOM   2226 O  OG    A SER A 1 287 ? 47.926 -34.899 -1.595  0.50 15.32 ? 284 SER A OG    1 
ATOM   2227 O  OG    B SER A 1 287 ? 47.901 -35.332 0.517   0.50 14.95 ? 284 SER A OG    1 
ATOM   2228 N  N     . GLN A 1 288 ? 47.260 -32.820 2.321   1.00 11.58 ? 285 GLN A N     1 
ATOM   2229 C  CA    . GLN A 1 288 ? 46.605 -32.478 3.574   1.00 10.57 ? 285 GLN A CA    1 
ATOM   2230 C  C     . GLN A 1 288 ? 46.220 -31.001 3.566   1.00 13.24 ? 285 GLN A C     1 
ATOM   2231 O  O     . GLN A 1 288 ? 45.118 -30.625 3.974   1.00 12.07 ? 285 GLN A O     1 
ATOM   2232 C  CB    . GLN A 1 288 ? 47.507 -32.757 4.777   1.00 10.00 ? 285 GLN A CB    1 
ATOM   2233 C  CG    . GLN A 1 288 ? 47.675 -34.216 5.120   1.00 18.38 ? 285 GLN A CG    1 
ATOM   2234 C  CD    . GLN A 1 288 ? 48.553 -34.405 6.341   1.00 24.70 ? 285 GLN A CD    1 
ATOM   2235 O  OE1   . GLN A 1 288 ? 49.683 -33.937 6.372   1.00 14.40 ? 285 GLN A OE1   1 
ATOM   2236 N  NE2   . GLN A 1 288 ? 48.026 -35.075 7.360   1.00 29.69 ? 285 GLN A NE2   1 
ATOM   2237 N  N     . LEU A 1 289 ? 47.139 -30.151 3.120   1.00 11.10 ? 286 LEU A N     1 
ATOM   2238 C  CA    . LEU A 1 289 ? 46.861 -28.712 3.091   1.00 10.78 ? 286 LEU A CA    1 
ATOM   2239 C  C     . LEU A 1 289 ? 45.762 -28.372 2.092   1.00 11.21 ? 286 LEU A C     1 
ATOM   2240 O  O     . LEU A 1 289 ? 44.904 -27.529 2.353   1.00 11.59 ? 286 LEU A O     1 
ATOM   2241 C  CB    . LEU A 1 289 ? 48.132 -27.916 2.797   1.00 11.30 ? 286 LEU A CB    1 
ATOM   2242 C  CG    . LEU A 1 289 ? 49.233 -28.025 3.861   1.00 8.60  ? 286 LEU A CG    1 
ATOM   2243 C  CD1   . LEU A 1 289 ? 50.486 -27.237 3.457   1.00 8.90  ? 286 LEU A CD1   1 
ATOM   2244 C  CD2   . LEU A 1 289 ? 48.697 -27.559 5.210   1.00 10.34 ? 286 LEU A CD2   1 
ATOM   2245 N  N     . GLN A 1 290 ? 45.782 -29.030 0.943   1.00 12.14 ? 287 GLN A N     1 
ATOM   2246 C  CA    . GLN A 1 290 ? 44.732 -28.808 -0.042  1.00 14.27 ? 287 GLN A CA    1 
ATOM   2247 C  C     . GLN A 1 290 ? 43.373 -29.262 0.473   1.00 14.39 ? 287 GLN A C     1 
ATOM   2248 O  O     . GLN A 1 290 ? 42.337 -28.667 0.151   1.00 13.64 ? 287 GLN A O     1 
ATOM   2249 C  CB    . GLN A 1 290 ? 45.056 -29.549 -1.330  1.00 13.38 ? 287 GLN A CB    1 
ATOM   2250 C  CG    . GLN A 1 290 ? 46.205 -28.933 -2.110  1.00 15.96 ? 287 GLN A CG    1 
ATOM   2251 C  CD    . GLN A 1 290 ? 46.600 -29.781 -3.287  1.00 20.59 ? 287 GLN A CD    1 
ATOM   2252 O  OE1   . GLN A 1 290 ? 46.643 -31.010 -3.190  1.00 21.83 ? 287 GLN A OE1   1 
ATOM   2253 N  NE2   . GLN A 1 290 ? 46.900 -29.134 -4.412  1.00 19.22 ? 287 GLN A NE2   1 
ATOM   2254 N  N     . SER A 1 291 ? 43.373 -30.328 1.264   1.00 13.78 ? 288 SER A N     1 
ATOM   2255 C  CA    . SER A 1 291 ? 42.131 -30.823 1.838   1.00 11.26 ? 288 SER A CA    1 
ATOM   2256 C  C     . SER A 1 291 ? 41.443 -29.795 2.736   1.00 17.89 ? 288 SER A C     1 
ATOM   2257 O  O     . SER A 1 291 ? 40.220 -29.667 2.717   1.00 22.47 ? 288 SER A O     1 
ATOM   2258 C  CB    . SER A 1 291 ? 42.333 -32.136 2.592   1.00 11.52 ? 288 SER A CB    1 
ATOM   2259 O  OG    A SER A 1 291 ? 42.897 -31.936 3.887   0.50 12.79 ? 288 SER A OG    1 
ATOM   2260 O  OG    B SER A 1 291 ? 41.068 -32.709 2.857   0.50 12.73 ? 288 SER A OG    1 
ATOM   2261 N  N     . HIS A 1 292 ? 42.226 -29.056 3.516   1.00 16.86 ? 289 HIS A N     1 
ATOM   2262 C  CA    . HIS A 1 292 ? 41.653 -28.087 4.437   1.00 13.90 ? 289 HIS A CA    1 
ATOM   2263 C  C     . HIS A 1 292 ? 41.375 -26.733 3.801   1.00 17.78 ? 289 HIS A C     1 
ATOM   2264 O  O     . HIS A 1 292 ? 40.379 -26.083 4.118   1.00 22.94 ? 289 HIS A O     1 
ATOM   2265 C  CB    . HIS A 1 292 ? 42.576 -27.860 5.636   1.00 17.58 ? 289 HIS A CB    1 
ATOM   2266 C  CG    . HIS A 1 292 ? 42.798 -29.072 6.486   1.00 18.35 ? 289 HIS A CG    1 
ATOM   2267 N  ND1   . HIS A 1 292 ? 41.802 -29.643 7.250   1.00 26.48 ? 289 HIS A ND1   1 
ATOM   2268 C  CD2   . HIS A 1 292 ? 43.919 -29.791 6.729   1.00 19.37 ? 289 HIS A CD2   1 
ATOM   2269 C  CE1   . HIS A 1 292 ? 42.300 -30.671 7.915   1.00 14.96 ? 289 HIS A CE1   1 
ATOM   2270 N  NE2   . HIS A 1 292 ? 43.579 -30.785 7.614   1.00 29.54 ? 289 HIS A NE2   1 
ATOM   2271 N  N     . PHE A 1 293 ? 42.265 -26.290 2.922   1.00 14.41 ? 290 PHE A N     1 
ATOM   2272 C  CA    . PHE A 1 293 ? 42.233 -24.896 2.483   1.00 11.82 ? 290 PHE A CA    1 
ATOM   2273 C  C     . PHE A 1 293 ? 41.978 -24.728 0.981   1.00 16.35 ? 290 PHE A C     1 
ATOM   2274 O  O     . PHE A 1 293 ? 41.921 -23.607 0.475   1.00 19.03 ? 290 PHE A O     1 
ATOM   2275 C  CB    . PHE A 1 293 ? 43.534 -24.207 2.925   1.00 14.19 ? 290 PHE A CB    1 
ATOM   2276 C  CG    . PHE A 1 293 ? 43.890 -24.491 4.362   1.00 13.96 ? 290 PHE A CG    1 
ATOM   2277 C  CD1   . PHE A 1 293 ? 43.103 -23.990 5.396   1.00 14.45 ? 290 PHE A CD1   1 
ATOM   2278 C  CD2   . PHE A 1 293 ? 44.978 -25.285 4.685   1.00 13.86 ? 290 PHE A CD2   1 
ATOM   2279 C  CE1   . PHE A 1 293 ? 43.396 -24.271 6.721   1.00 13.18 ? 290 PHE A CE1   1 
ATOM   2280 C  CE2   . PHE A 1 293 ? 45.286 -25.566 6.010   1.00 12.31 ? 290 PHE A CE2   1 
ATOM   2281 C  CZ    . PHE A 1 293 ? 44.490 -25.061 7.031   1.00 10.94 ? 290 PHE A CZ    1 
ATOM   2282 N  N     . GLY A 1 294 ? 41.812 -25.842 0.272   1.00 14.17 ? 291 GLY A N     1 
ATOM   2283 C  CA    . GLY A 1 294 ? 41.559 -25.794 -1.154  1.00 15.26 ? 291 GLY A CA    1 
ATOM   2284 C  C     . GLY A 1 294 ? 42.794 -26.101 -1.962  1.00 17.39 ? 291 GLY A C     1 
ATOM   2285 O  O     . GLY A 1 294 ? 43.914 -25.993 -1.461  1.00 15.37 ? 291 GLY A O     1 
ATOM   2286 N  N     . GLU A 1 295 ? 42.594 -26.481 -3.221  1.00 14.18 ? 292 GLU A N     1 
ATOM   2287 C  CA    . GLU A 1 295 ? 43.687 -26.864 -4.097  1.00 15.48 ? 292 GLU A CA    1 
ATOM   2288 C  C     . GLU A 1 295 ? 44.715 -25.742 -4.229  1.00 11.36 ? 292 GLU A C     1 
ATOM   2289 O  O     . GLU A 1 295 ? 45.920 -25.965 -4.101  1.00 13.64 ? 292 GLU A O     1 
ATOM   2290 C  CB    . GLU A 1 295 ? 43.129 -27.230 -5.475  1.00 19.90 ? 292 GLU A CB    1 
ATOM   2291 C  CG    . GLU A 1 295 ? 44.150 -27.738 -6.463  1.00 23.39 ? 292 GLU A CG    1 
ATOM   2292 C  CD    . GLU A 1 295 ? 43.536 -28.004 -7.821  1.00 42.27 ? 292 GLU A CD    1 
ATOM   2293 O  OE1   . GLU A 1 295 ? 44.263 -27.910 -8.834  1.00 51.07 ? 292 GLU A OE1   1 
ATOM   2294 O  OE2   . GLU A 1 295 ? 42.322 -28.303 -7.872  1.00 29.30 ? 292 GLU A OE2   1 
ATOM   2295 N  N     . LYS A 1 296 ? 44.235 -24.531 -4.496  1.00 11.74 ? 293 LYS A N     1 
ATOM   2296 C  CA    . LYS A 1 296 ? 45.128 -23.416 -4.767  1.00 13.38 ? 293 LYS A CA    1 
ATOM   2297 C  C     . LYS A 1 296 ? 45.860 -23.001 -3.485  1.00 14.34 ? 293 LYS A C     1 
ATOM   2298 O  O     . LYS A 1 296 ? 47.093 -22.911 -3.454  1.00 11.84 ? 293 LYS A O     1 
ATOM   2299 C  CB    . LYS A 1 296 ? 44.342 -22.234 -5.350  1.00 19.89 ? 293 LYS A CB    1 
ATOM   2300 C  CG    . LYS A 1 296 ? 45.206 -21.090 -5.848  1.00 34.16 ? 293 LYS A CG    1 
ATOM   2301 C  CD    . LYS A 1 296 ? 44.364 -20.030 -6.554  1.00 37.66 ? 293 LYS A CD    1 
ATOM   2302 C  CE    . LYS A 1 296 ? 45.184 -18.781 -6.861  1.00 46.07 ? 293 LYS A CE    1 
ATOM   2303 N  NZ    . LYS A 1 296 ? 44.393 -17.763 -7.608  1.00 43.31 ? 293 LYS A NZ    1 
ATOM   2304 N  N     . ASN A 1 297 ? 45.101 -22.745 -2.431  1.00 11.40 ? 294 ASN A N     1 
ATOM   2305 C  CA    . ASN A 1 297 ? 45.705 -22.311 -1.165  1.00 11.76 ? 294 ASN A CA    1 
ATOM   2306 C  C     . ASN A 1 297 ? 46.631 -23.374 -0.587  1.00 14.30 ? 294 ASN A C     1 
ATOM   2307 O  O     . ASN A 1 297 ? 47.679 -23.059 -0.031  1.00 11.04 ? 294 ASN A O     1 
ATOM   2308 C  CB    . ASN A 1 297 ? 44.630 -21.997 -0.131  1.00 16.28 ? 294 ASN A CB    1 
ATOM   2309 C  CG    . ASN A 1 297 ? 43.936 -20.682 -0.380  1.00 17.52 ? 294 ASN A CG    1 
ATOM   2310 O  OD1   . ASN A 1 297 ? 44.479 -19.789 -1.032  1.00 19.09 ? 294 ASN A OD1   1 
ATOM   2311 N  ND2   . ASN A 1 297 ? 42.720 -20.549 0.152   1.00 20.45 ? 294 ASN A ND2   1 
ATOM   2312 N  N     . GLY A 1 298 ? 46.231 -24.636 -0.685  1.00 13.92 ? 295 GLY A N     1 
ATOM   2313 C  CA    . GLY A 1 298 ? 47.050 -25.711 -0.143  1.00 11.89 ? 295 GLY A CA    1 
ATOM   2314 C  C     . GLY A 1 298 ? 48.417 -25.824 -0.808  1.00 10.34 ? 295 GLY A C     1 
ATOM   2315 O  O     . GLY A 1 298 ? 49.438 -25.995 -0.125  1.00 11.35 ? 295 GLY A O     1 
ATOM   2316 N  N     . SER A 1 299 ? 48.446 -25.754 -2.138  1.00 8.73  ? 296 SER A N     1 
ATOM   2317 C  CA    . SER A 1 299 ? 49.708 -25.792 -2.866  1.00 9.74  ? 296 SER A CA    1 
ATOM   2318 C  C     . SER A 1 299 ? 50.524 -24.570 -2.503  1.00 8.99  ? 296 SER A C     1 
ATOM   2319 O  O     . SER A 1 299 ? 51.738 -24.658 -2.332  1.00 10.19 ? 296 SER A O     1 
ATOM   2320 C  CB    . SER A 1 299 ? 49.477 -25.809 -4.379  1.00 15.84 ? 296 SER A CB    1 
ATOM   2321 O  OG    . SER A 1 299 ? 49.011 -27.075 -4.798  1.00 18.92 ? 296 SER A OG    1 
ATOM   2322 N  N     . TRP A 1 300 ? 49.857 -23.426 -2.394  1.00 9.95  ? 297 TRP A N     1 
ATOM   2323 C  CA    . TRP A 1 300 ? 50.553 -22.187 -2.077  1.00 6.94  ? 297 TRP A CA    1 
ATOM   2324 C  C     . TRP A 1 300 ? 51.208 -22.277 -0.700  1.00 9.96  ? 297 TRP A C     1 
ATOM   2325 O  O     . TRP A 1 300 ? 52.391 -21.938 -0.549  1.00 10.12 ? 297 TRP A O     1 
ATOM   2326 C  CB    . TRP A 1 300 ? 49.590 -21.005 -2.139  1.00 9.38  ? 297 TRP A CB    1 
ATOM   2327 C  CG    . TRP A 1 300 ? 50.263 -19.684 -1.980  1.00 11.49 ? 297 TRP A CG    1 
ATOM   2328 C  CD1   . TRP A 1 300 ? 50.838 -18.934 -2.963  1.00 14.53 ? 297 TRP A CD1   1 
ATOM   2329 C  CD2   . TRP A 1 300 ? 50.430 -18.947 -0.762  1.00 10.69 ? 297 TRP A CD2   1 
ATOM   2330 N  NE1   . TRP A 1 300 ? 51.346 -17.770 -2.430  1.00 19.06 ? 297 TRP A NE1   1 
ATOM   2331 C  CE2   . TRP A 1 300 ? 51.106 -17.757 -1.082  1.00 13.09 ? 297 TRP A CE2   1 
ATOM   2332 C  CE3   . TRP A 1 300 ? 50.064 -19.179 0.565   1.00 17.08 ? 297 TRP A CE3   1 
ATOM   2333 C  CZ2   . TRP A 1 300 ? 51.424 -16.799 -0.121  1.00 15.57 ? 297 TRP A CZ2   1 
ATOM   2334 C  CZ3   . TRP A 1 300 ? 50.386 -18.230 1.515   1.00 21.15 ? 297 TRP A CZ3   1 
ATOM   2335 C  CH2   . TRP A 1 300 ? 51.059 -17.061 1.169   1.00 14.46 ? 297 TRP A CH2   1 
ATOM   2336 N  N     . LEU A 1 301 ? 50.445 -22.738 0.291   1.00 9.25  ? 298 LEU A N     1 
ATOM   2337 C  CA    . LEU A 1 301 ? 50.966 -22.918 1.648   1.00 11.64 ? 298 LEU A CA    1 
ATOM   2338 C  C     . LEU A 1 301 ? 52.114 -23.920 1.706   1.00 13.39 ? 298 LEU A C     1 
ATOM   2339 O  O     . LEU A 1 301 ? 53.123 -23.684 2.376   1.00 8.92  ? 298 LEU A O     1 
ATOM   2340 C  CB    . LEU A 1 301 ? 49.858 -23.345 2.618   1.00 7.86  ? 298 LEU A CB    1 
ATOM   2341 C  CG    . LEU A 1 301 ? 48.806 -22.272 2.919   1.00 8.97  ? 298 LEU A CG    1 
ATOM   2342 C  CD1   . LEU A 1 301 ? 47.537 -22.865 3.548   1.00 11.41 ? 298 LEU A CD1   1 
ATOM   2343 C  CD2   . LEU A 1 301 ? 49.394 -21.192 3.817   1.00 12.57 ? 298 LEU A CD2   1 
ATOM   2344 N  N     . TYR A 1 302 ? 51.966 -25.038 1.007   1.00 9.08  ? 299 TYR A N     1 
ATOM   2345 C  CA    . TYR A 1 302 ? 53.007 -26.052 1.009   1.00 9.35  ? 299 TYR A CA    1 
ATOM   2346 C  C     . TYR A 1 302 ? 54.356 -25.478 0.553   1.00 9.08  ? 299 TYR A C     1 
ATOM   2347 O  O     . TYR A 1 302 ? 55.405 -25.722 1.179   1.00 9.51  ? 299 TYR A O     1 
ATOM   2348 C  CB    . TYR A 1 302 ? 52.602 -27.238 0.121   1.00 9.41  ? 299 TYR A CB    1 
ATOM   2349 C  CG    . TYR A 1 302 ? 53.622 -28.341 0.142   1.00 11.40 ? 299 TYR A CG    1 
ATOM   2350 C  CD1   . TYR A 1 302 ? 53.577 -29.329 1.119   1.00 10.57 ? 299 TYR A CD1   1 
ATOM   2351 C  CD2   . TYR A 1 302 ? 54.665 -28.368 -0.777  1.00 11.84 ? 299 TYR A CD2   1 
ATOM   2352 C  CE1   . TYR A 1 302 ? 54.528 -30.345 1.159   1.00 11.88 ? 299 TYR A CE1   1 
ATOM   2353 C  CE2   . TYR A 1 302 ? 55.628 -29.370 -0.737  1.00 13.59 ? 299 TYR A CE2   1 
ATOM   2354 C  CZ    . TYR A 1 302 ? 55.543 -30.356 0.229   1.00 18.92 ? 299 TYR A CZ    1 
ATOM   2355 O  OH    . TYR A 1 302 ? 56.490 -31.352 0.270   1.00 19.31 ? 299 TYR A OH    1 
ATOM   2356 N  N     . ALA A 1 303 ? 54.330 -24.712 -0.535  1.00 11.49 ? 300 ALA A N     1 
ATOM   2357 C  CA    . ALA A 1 303 ? 55.535 -24.075 -1.048  1.00 8.50  ? 300 ALA A CA    1 
ATOM   2358 C  C     . ALA A 1 303 ? 55.980 -22.889 -0.183  1.00 6.09  ? 300 ALA A C     1 
ATOM   2359 O  O     . ALA A 1 303 ? 57.167 -22.730 0.095   1.00 9.22  ? 300 ALA A O     1 
ATOM   2360 C  CB    . ALA A 1 303 ? 55.319 -23.624 -2.500  1.00 11.16 ? 300 ALA A CB    1 
ATOM   2361 N  N     . MET A 1 304 ? 55.028 -22.063 0.243   1.00 7.01  ? 301 MET A N     1 
ATOM   2362 C  CA    . MET A 1 304 ? 55.382 -20.842 0.976   1.00 9.98  ? 301 MET A CA    1 
ATOM   2363 C  C     . MET A 1 304 ? 56.090 -21.109 2.303   1.00 7.55  ? 301 MET A C     1 
ATOM   2364 O  O     . MET A 1 304 ? 57.022 -20.381 2.662   1.00 8.97  ? 301 MET A O     1 
ATOM   2365 C  CB    . MET A 1 304 ? 54.154 -19.963 1.204   1.00 11.16 ? 301 MET A CB    1 
ATOM   2366 C  CG    . MET A 1 304 ? 54.477 -18.558 1.703   1.00 12.07 ? 301 MET A CG    1 
ATOM   2367 S  SD    . MET A 1 304 ? 55.226 -17.584 0.392   1.00 14.94 ? 301 MET A SD    1 
ATOM   2368 C  CE    . MET A 1 304 ? 56.951 -17.540 0.907   1.00 13.03 ? 301 MET A CE    1 
ATOM   2369 N  N     . CYS A 1 305 ? 55.665 -22.139 3.037   1.00 7.61  ? 302 CYS A N     1 
ATOM   2370 C  CA    . CYS A 1 305 ? 56.302 -22.408 4.334   1.00 8.51  ? 302 CYS A CA    1 
ATOM   2371 C  C     . CYS A 1 305 ? 57.755 -22.895 4.177   1.00 8.16  ? 302 CYS A C     1 
ATOM   2372 O  O     . CYS A 1 305 ? 58.512 -22.937 5.163   1.00 8.52  ? 302 CYS A O     1 
ATOM   2373 C  CB    . CYS A 1 305 ? 55.477 -23.401 5.168   1.00 7.70  ? 302 CYS A CB    1 
ATOM   2374 S  SG    . CYS A 1 305 ? 55.508 -25.087 4.514   1.00 9.25  ? 302 CYS A SG    1 
ATOM   2375 N  N     . ARG A 1 306 ? 58.132 -23.244 2.947   1.00 8.54  ? 303 ARG A N     1 
ATOM   2376 C  CA    . ARG A 1 306 ? 59.508 -23.601 2.573   1.00 7.68  ? 303 ARG A CA    1 
ATOM   2377 C  C     . ARG A 1 306 ? 60.262 -22.434 1.905   1.00 9.94  ? 303 ARG A C     1 
ATOM   2378 O  O     . ARG A 1 306 ? 61.424 -22.581 1.484   1.00 11.96 ? 303 ARG A O     1 
ATOM   2379 C  CB    . ARG A 1 306 ? 59.508 -24.832 1.647   1.00 9.89  ? 303 ARG A CB    1 
ATOM   2380 C  CG    . ARG A 1 306 ? 58.985 -26.091 2.325   1.00 7.95  ? 303 ARG A CG    1 
ATOM   2381 C  CD    . ARG A 1 306 ? 58.686 -27.256 1.367   1.00 11.36 ? 303 ARG A CD    1 
ATOM   2382 N  NE    . ARG A 1 306 ? 58.509 -28.480 2.155   1.00 12.59 ? 303 ARG A NE    1 
ATOM   2383 C  CZ    . ARG A 1 306 ? 57.408 -28.769 2.852   1.00 10.92 ? 303 ARG A CZ    1 
ATOM   2384 N  NH1   . ARG A 1 306 ? 57.352 -29.891 3.562   1.00 13.10 ? 303 ARG A NH1   1 
ATOM   2385 N  NH2   . ARG A 1 306 ? 56.354 -27.953 2.829   1.00 9.72  ? 303 ARG A NH2   1 
ATOM   2386 N  N     . GLY A 1 307 ? 59.615 -21.276 1.838   1.00 7.61  ? 304 GLY A N     1 
ATOM   2387 C  CA    . GLY A 1 307 ? 60.219 -20.063 1.316   1.00 9.44  ? 304 GLY A CA    1 
ATOM   2388 C  C     . GLY A 1 307 ? 60.042 -19.929 -0.190  1.00 8.91  ? 304 GLY A C     1 
ATOM   2389 O  O     . GLY A 1 307 ? 60.713 -19.131 -0.840  1.00 11.37 ? 304 GLY A O     1 
ATOM   2390 N  N     . ILE A 1 308 ? 59.142 -20.716 -0.750  1.00 7.41  ? 305 ILE A N     1 
ATOM   2391 C  CA    . ILE A 1 308 ? 59.000 -20.773 -2.207  1.00 9.19  ? 305 ILE A CA    1 
ATOM   2392 C  C     . ILE A 1 308 ? 57.655 -20.214 -2.659  1.00 9.83  ? 305 ILE A C     1 
ATOM   2393 O  O     . ILE A 1 308 ? 56.621 -20.580 -2.123  1.00 8.24  ? 305 ILE A O     1 
ATOM   2394 C  CB    . ILE A 1 308 ? 59.123 -22.229 -2.669  1.00 10.68 ? 305 ILE A CB    1 
ATOM   2395 C  CG1   . ILE A 1 308 ? 60.525 -22.752 -2.331  1.00 12.66 ? 305 ILE A CG1   1 
ATOM   2396 C  CG2   . ILE A 1 308 ? 58.802 -22.351 -4.149  1.00 13.86 ? 305 ILE A CG2   1 
ATOM   2397 C  CD1   . ILE A 1 308 ? 60.771 -24.171 -2.798  1.00 20.28 ? 305 ILE A CD1   1 
ATOM   2398 N  N     . GLU A 1 309 ? 57.662 -19.325 -3.651  1.00 7.56  ? 306 GLU A N     1 
ATOM   2399 C  CA    . GLU A 1 309 ? 56.412 -18.730 -4.134  1.00 13.07 ? 306 GLU A CA    1 
ATOM   2400 C  C     . GLU A 1 309 ? 56.651 -18.241 -5.553  1.00 15.75 ? 306 GLU A C     1 
ATOM   2401 O  O     . GLU A 1 309 ? 57.726 -17.740 -5.849  1.00 16.46 ? 306 GLU A O     1 
ATOM   2402 C  CB    . GLU A 1 309 ? 56.002 -17.550 -3.255  1.00 16.93 ? 306 GLU A CB    1 
ATOM   2403 C  CG    . GLU A 1 309 ? 54.519 -17.246 -3.297  1.00 24.21 ? 306 GLU A CG    1 
ATOM   2404 C  CD    . GLU A 1 309 ? 54.205 -15.774 -3.511  1.00 25.38 ? 306 GLU A CD    1 
ATOM   2405 O  OE1   . GLU A 1 309 ? 55.147 -14.950 -3.641  1.00 22.23 ? 306 GLU A OE1   1 
ATOM   2406 O  OE2   . GLU A 1 309 ? 53.000 -15.446 -3.554  1.00 29.17 ? 306 GLU A OE2   1 
ATOM   2407 N  N     . HIS A 1 310 ? 55.664 -18.362 -6.434  1.00 16.48 ? 307 HIS A N     1 
ATOM   2408 C  CA    . HIS A 1 310 ? 55.939 -18.087 -7.842  1.00 15.36 ? 307 HIS A CA    1 
ATOM   2409 C  C     . HIS A 1 310 ? 55.181 -16.917 -8.455  1.00 13.21 ? 307 HIS A C     1 
ATOM   2410 O  O     . HIS A 1 310 ? 55.357 -16.629 -9.635  1.00 20.03 ? 307 HIS A O     1 
ATOM   2411 C  CB    . HIS A 1 310 ? 55.715 -19.343 -8.682  1.00 22.20 ? 307 HIS A CB    1 
ATOM   2412 C  CG    . HIS A 1 310 ? 56.584 -20.491 -8.275  1.00 33.87 ? 307 HIS A CG    1 
ATOM   2413 N  ND1   . HIS A 1 310 ? 57.960 -20.398 -8.218  1.00 31.51 ? 307 HIS A ND1   1 
ATOM   2414 C  CD2   . HIS A 1 310 ? 56.275 -21.750 -7.885  1.00 35.68 ? 307 HIS A CD2   1 
ATOM   2415 C  CE1   . HIS A 1 310 ? 58.460 -21.555 -7.823  1.00 31.87 ? 307 HIS A CE1   1 
ATOM   2416 N  NE2   . HIS A 1 310 ? 57.460 -22.393 -7.616  1.00 33.15 ? 307 HIS A NE2   1 
ATOM   2417 N  N     . ASP A 1 311 ? 54.349 -16.249 -7.667  1.00 12.59 ? 308 ASP A N     1 
ATOM   2418 C  CA    . ASP A 1 311 ? 53.595 -15.107 -8.178  1.00 11.98 ? 308 ASP A CA    1 
ATOM   2419 C  C     . ASP A 1 311 ? 54.523 -14.121 -8.905  1.00 14.57 ? 308 ASP A C     1 
ATOM   2420 O  O     . ASP A 1 311 ? 55.496 -13.628 -8.329  1.00 12.06 ? 308 ASP A O     1 
ATOM   2421 C  CB    . ASP A 1 311 ? 52.868 -14.412 -7.035  1.00 12.39 ? 308 ASP A CB    1 
ATOM   2422 C  CG    . ASP A 1 311 ? 51.927 -13.324 -7.524  1.00 23.10 ? 308 ASP A CG    1 
ATOM   2423 O  OD1   . ASP A 1 311 ? 51.822 -12.273 -6.861  1.00 33.79 ? 308 ASP A OD1   1 
ATOM   2424 O  OD2   . ASP A 1 311 ? 51.286 -13.524 -8.577  1.00 32.55 ? 308 ASP A OD2   1 
ATOM   2425 N  N     . PRO A 1 312 ? 54.232 -13.820 -10.182 1.00 13.57 ? 309 PRO A N     1 
ATOM   2426 C  CA    . PRO A 1 312 ? 55.169 -12.921 -10.861 1.00 11.16 ? 309 PRO A CA    1 
ATOM   2427 C  C     . PRO A 1 312 ? 54.991 -11.458 -10.487 1.00 10.23 ? 309 PRO A C     1 
ATOM   2428 O  O     . PRO A 1 312 ? 53.922 -11.037 -10.037 1.00 13.07 ? 309 PRO A O     1 
ATOM   2429 C  CB    . PRO A 1 312 ? 54.839 -13.127 -12.351 1.00 15.21 ? 309 PRO A CB    1 
ATOM   2430 C  CG    . PRO A 1 312 ? 53.429 -13.599 -12.362 1.00 15.65 ? 309 PRO A CG    1 
ATOM   2431 C  CD    . PRO A 1 312 ? 53.255 -14.421 -11.111 1.00 15.32 ? 309 PRO A CD    1 
ATOM   2432 N  N     . VAL A 1 313 ? 56.070 -10.698 -10.640 1.00 9.29  ? 310 VAL A N     1 
ATOM   2433 C  CA    . VAL A 1 313 ? 56.013 -9.245  -10.590 1.00 9.50  ? 310 VAL A CA    1 
ATOM   2434 C  C     . VAL A 1 313 ? 55.336 -8.829  -11.883 1.00 11.63 ? 310 VAL A C     1 
ATOM   2435 O  O     . VAL A 1 313 ? 55.921 -8.945  -12.955 1.00 13.28 ? 310 VAL A O     1 
ATOM   2436 C  CB    . VAL A 1 313 ? 57.422 -8.645  -10.539 1.00 13.12 ? 310 VAL A CB    1 
ATOM   2437 C  CG1   . VAL A 1 313 ? 57.373 -7.116  -10.603 1.00 9.19  ? 310 VAL A CG1   1 
ATOM   2438 C  CG2   . VAL A 1 313 ? 58.120 -9.086  -9.269  1.00 11.98 ? 310 VAL A CG2   1 
ATOM   2439 N  N     . LYS A 1 314 ? 54.092 -8.386  -11.786 1.00 14.35 ? 311 LYS A N     1 
ATOM   2440 C  CA    . LYS A 1 314 ? 53.347 -8.013  -12.984 1.00 12.45 ? 311 LYS A CA    1 
ATOM   2441 C  C     . LYS A 1 314 ? 53.775 -6.648  -13.500 1.00 11.03 ? 311 LYS A C     1 
ATOM   2442 O  O     . LYS A 1 314 ? 53.978 -5.714  -12.722 1.00 12.87 ? 311 LYS A O     1 
ATOM   2443 C  CB    . LYS A 1 314 ? 51.847 -8.052  -12.699 1.00 13.70 ? 311 LYS A CB    1 
ATOM   2444 C  CG    . LYS A 1 314 ? 51.383 -9.447  -12.295 1.00 19.90 ? 311 LYS A CG    1 
ATOM   2445 C  CD    . LYS A 1 314 ? 50.051 -9.439  -11.567 1.00 31.54 ? 311 LYS A CD    1 
ATOM   2446 C  CE    . LYS A 1 314 ? 49.699 -10.852 -11.101 1.00 35.94 ? 311 LYS A CE    1 
ATOM   2447 N  NZ    . LYS A 1 314 ? 50.808 -11.486 -10.299 1.00 32.51 ? 311 LYS A NZ    1 
ATOM   2448 N  N     . PRO A 1 315 ? 53.938 -6.533  -14.823 1.00 9.53  ? 312 PRO A N     1 
ATOM   2449 C  CA    . PRO A 1 315 ? 54.325 -5.259  -15.422 1.00 9.87  ? 312 PRO A CA    1 
ATOM   2450 C  C     . PRO A 1 315 ? 53.155 -4.289  -15.426 1.00 15.10 ? 312 PRO A C     1 
ATOM   2451 O  O     . PRO A 1 315 ? 52.445 -4.181  -16.430 1.00 14.90 ? 312 PRO A O     1 
ATOM   2452 C  CB    . PRO A 1 315 ? 54.687 -5.659  -16.860 1.00 17.03 ? 312 PRO A CB    1 
ATOM   2453 C  CG    . PRO A 1 315 ? 53.852 -6.868  -17.123 1.00 15.84 ? 312 PRO A CG    1 
ATOM   2454 C  CD    . PRO A 1 315 ? 53.861 -7.617  -15.822 1.00 12.88 ? 312 PRO A CD    1 
ATOM   2455 N  N     . ARG A 1 316 ? 52.956 -3.583  -14.320 1.00 13.99 ? 313 ARG A N     1 
ATOM   2456 C  CA    . ARG A 1 316 ? 51.835 -2.652  -14.220 1.00 10.83 ? 313 ARG A CA    1 
ATOM   2457 C  C     . ARG A 1 316 ? 52.173 -1.530  -13.263 1.00 17.43 ? 313 ARG A C     1 
ATOM   2458 O  O     . ARG A 1 316 ? 52.337 -1.762  -12.072 1.00 15.17 ? 313 ARG A O     1 
ATOM   2459 C  CB    . ARG A 1 316 ? 50.569 -3.364  -13.754 1.00 16.14 ? 313 ARG A CB    1 
ATOM   2460 C  CG    A ARG A 1 316 ? 49.352 -2.464  -13.618 0.50 18.82 ? 313 ARG A CG    1 
ATOM   2461 C  CG    B ARG A 1 316 ? 49.370 -2.430  -13.655 0.50 18.82 ? 313 ARG A CG    1 
ATOM   2462 C  CD    A ARG A 1 316 ? 48.210 -3.182  -12.912 0.50 18.80 ? 313 ARG A CD    1 
ATOM   2463 C  CD    B ARG A 1 316 ? 48.168 -3.110  -13.032 0.50 18.80 ? 313 ARG A CD    1 
ATOM   2464 N  NE    A ARG A 1 316 ? 48.447 -3.300  -11.475 0.50 20.16 ? 313 ARG A NE    1 
ATOM   2465 N  NE    B ARG A 1 316 ? 48.467 -3.602  -11.692 0.50 20.92 ? 313 ARG A NE    1 
ATOM   2466 C  CZ    A ARG A 1 316 ? 48.646 -4.448  -10.832 0.50 25.68 ? 313 ARG A CZ    1 
ATOM   2467 C  CZ    B ARG A 1 316 ? 48.496 -2.844  -10.599 0.50 20.39 ? 313 ARG A CZ    1 
ATOM   2468 N  NH1   A ARG A 1 316 ? 48.856 -4.441  -9.520  0.50 23.65 ? 313 ARG A NH1   1 
ATOM   2469 N  NH1   B ARG A 1 316 ? 48.782 -3.394  -9.425  0.50 18.30 ? 313 ARG A NH1   1 
ATOM   2470 N  NH2   A ARG A 1 316 ? 48.634 -5.600  -11.493 0.50 25.70 ? 313 ARG A NH2   1 
ATOM   2471 N  NH2   B ARG A 1 316 ? 48.246 -1.539  -10.675 0.50 13.34 ? 313 ARG A NH2   1 
ATOM   2472 N  N     . GLN A 1 317 ? 52.272 -0.317  -13.796 1.00 15.61 ? 314 GLN A N     1 
ATOM   2473 C  CA    . GLN A 1 317 ? 52.727 0.834   -13.025 1.00 16.79 ? 314 GLN A CA    1 
ATOM   2474 C  C     . GLN A 1 317 ? 51.551 1.722   -12.633 1.00 20.75 ? 314 GLN A C     1 
ATOM   2475 O  O     . GLN A 1 317 ? 51.621 2.489   -11.666 1.00 22.62 ? 314 GLN A O     1 
ATOM   2476 C  CB    . GLN A 1 317 ? 53.728 1.636   -13.855 1.00 26.74 ? 314 GLN A CB    1 
ATOM   2477 C  CG    . GLN A 1 317 ? 54.480 2.678   -13.067 1.00 33.82 ? 314 GLN A CG    1 
ATOM   2478 C  CD    . GLN A 1 317 ? 55.465 3.439   -13.918 1.00 29.08 ? 314 GLN A CD    1 
ATOM   2479 O  OE1   . GLN A 1 317 ? 55.805 3.015   -15.027 1.00 36.57 ? 314 GLN A OE1   1 
ATOM   2480 N  NE2   . GLN A 1 317 ? 55.935 4.571   -13.407 1.00 29.51 ? 314 GLN A NE2   1 
ATOM   2481 N  N     . LEU A 1 318 ? 50.467 1.601   -13.387 1.00 14.15 ? 315 LEU A N     1 
ATOM   2482 C  CA    . LEU A 1 318 ? 49.278 2.421   -13.180 1.00 16.20 ? 315 LEU A CA    1 
ATOM   2483 C  C     . LEU A 1 318 ? 48.149 1.641   -12.522 1.00 15.54 ? 315 LEU A C     1 
ATOM   2484 O  O     . LEU A 1 318 ? 47.959 0.451   -12.781 1.00 15.73 ? 315 LEU A O     1 
ATOM   2485 C  CB    . LEU A 1 318 ? 48.759 2.931   -14.523 1.00 19.13 ? 315 LEU A CB    1 
ATOM   2486 C  CG    . LEU A 1 318 ? 49.709 3.711   -15.425 1.00 20.36 ? 315 LEU A CG    1 
ATOM   2487 C  CD1   . LEU A 1 318 ? 49.046 3.930   -16.779 1.00 23.38 ? 315 LEU A CD1   1 
ATOM   2488 C  CD2   . LEU A 1 318 ? 50.115 5.031   -14.789 1.00 21.35 ? 315 LEU A CD2   1 
ATOM   2489 N  N     . PRO A 1 319 ? 47.346 2.330   -11.701 1.00 16.35 ? 316 PRO A N     1 
ATOM   2490 C  CA    . PRO A 1 319 ? 46.175 1.650   -11.135 1.00 17.88 ? 316 PRO A CA    1 
ATOM   2491 C  C     . PRO A 1 319 ? 45.198 1.214   -12.232 1.00 16.90 ? 316 PRO A C     1 
ATOM   2492 O  O     . PRO A 1 319 ? 45.153 1.867   -13.267 1.00 19.48 ? 316 PRO A O     1 
ATOM   2493 C  CB    . PRO A 1 319 ? 45.546 2.718   -10.230 1.00 21.06 ? 316 PRO A CB    1 
ATOM   2494 C  CG    . PRO A 1 319 ? 46.141 4.018   -10.669 1.00 27.27 ? 316 PRO A CG    1 
ATOM   2495 C  CD    . PRO A 1 319 ? 47.493 3.714   -11.226 1.00 17.53 ? 316 PRO A CD    1 
ATOM   2496 N  N     . LYS A 1 320 ? 44.454 0.128   -11.996 1.00 17.89 ? 317 LYS A N     1 
ATOM   2497 C  CA    . LYS A 1 320 ? 43.499 -0.461  -12.953 1.00 11.57 ? 317 LYS A CA    1 
ATOM   2498 C  C     . LYS A 1 320 ? 42.103 0.127   -12.825 1.00 21.20 ? 317 LYS A C     1 
ATOM   2499 O  O     . LYS A 1 320 ? 41.238 -0.123  -13.663 1.00 18.43 ? 317 LYS A O     1 
ATOM   2500 C  CB    . LYS A 1 320 ? 43.332 -1.962  -12.674 1.00 22.54 ? 317 LYS A CB    1 
ATOM   2501 C  CG    . LYS A 1 320 ? 44.507 -2.851  -12.986 1.00 30.69 ? 317 LYS A CG    1 
ATOM   2502 C  CD    . LYS A 1 320 ? 44.085 -4.313  -12.856 1.00 27.32 ? 317 LYS A CD    1 
ATOM   2503 C  CE    . LYS A 1 320 ? 45.099 -5.242  -13.494 1.00 38.59 ? 317 LYS A CE    1 
ATOM   2504 N  NZ    . LYS A 1 320 ? 44.572 -6.627  -13.640 1.00 36.10 ? 317 LYS A NZ    1 
ATOM   2505 N  N     . THR A 1 321 ? 41.868 0.844   -11.733 1.00 18.31 ? 318 THR A N     1 
ATOM   2506 C  CA    . THR A 1 321 ? 40.573 1.446   -11.465 1.00 18.08 ? 318 THR A CA    1 
ATOM   2507 C  C     . THR A 1 321 ? 40.816 2.828   -10.891 1.00 15.08 ? 318 THR A C     1 
ATOM   2508 O  O     . THR A 1 321 ? 41.894 3.106   -10.354 1.00 17.51 ? 318 THR A O     1 
ATOM   2509 C  CB    . THR A 1 321 ? 39.723 0.598   -10.482 1.00 21.09 ? 318 THR A CB    1 
ATOM   2510 O  OG1   . THR A 1 321 ? 40.438 0.406   -9.252  1.00 20.10 ? 318 THR A OG1   1 
ATOM   2511 C  CG2   . THR A 1 321 ? 39.376 -0.757  -11.083 1.00 18.39 ? 318 THR A CG2   1 
ATOM   2512 N  N     . ILE A 1 322 ? 39.837 3.712   -11.048 1.00 11.03 ? 319 ILE A N     1 
ATOM   2513 C  CA    . ILE A 1 322 ? 39.914 5.042   -10.466 1.00 15.75 ? 319 ILE A CA    1 
ATOM   2514 C  C     . ILE A 1 322 ? 38.596 5.268   -9.739  1.00 13.80 ? 319 ILE A C     1 
ATOM   2515 O  O     . ILE A 1 322 ? 37.538 5.292   -10.360 1.00 15.22 ? 319 ILE A O     1 
ATOM   2516 C  CB    . ILE A 1 322 ? 40.150 6.113   -11.548 1.00 10.76 ? 319 ILE A CB    1 
ATOM   2517 C  CG1   . ILE A 1 322 ? 41.518 5.892   -12.201 1.00 20.46 ? 319 ILE A CG1   1 
ATOM   2518 C  CG2   . ILE A 1 322 ? 40.035 7.516   -10.959 1.00 14.93 ? 319 ILE A CG2   1 
ATOM   2519 C  CD1   . ILE A 1 322 ? 41.897 6.939   -13.225 1.00 18.81 ? 319 ILE A CD1   1 
ATOM   2520 N  N     . GLY A 1 323 ? 38.653 5.377   -8.417  1.00 11.69 ? 320 GLY A N     1 
ATOM   2521 C  CA    . GLY A 1 323 ? 37.437 5.424   -7.627  1.00 13.51 ? 320 GLY A CA    1 
ATOM   2522 C  C     . GLY A 1 323 ? 37.347 6.588   -6.664  1.00 10.95 ? 320 GLY A C     1 
ATOM   2523 O  O     . GLY A 1 323 ? 38.354 7.179   -6.280  1.00 13.65 ? 320 GLY A O     1 
ATOM   2524 N  N     . CYS A 1 324 ? 36.115 6.893   -6.263  1.00 11.45 ? 321 CYS A N     1 
ATOM   2525 C  CA    . CYS A 1 324 ? 35.792 7.997   -5.360  1.00 11.96 ? 321 CYS A CA    1 
ATOM   2526 C  C     . CYS A 1 324 ? 34.758 7.473   -4.363  1.00 11.35 ? 321 CYS A C     1 
ATOM   2527 O  O     . CYS A 1 324 ? 33.720 6.953   -4.772  1.00 15.59 ? 321 CYS A O     1 
ATOM   2528 C  CB    . CYS A 1 324 ? 35.191 9.163   -6.174  1.00 12.28 ? 321 CYS A CB    1 
ATOM   2529 S  SG    A CYS A 1 324 ? 35.484 10.768  -5.476  0.40 19.67 ? 321 CYS A SG    1 
ATOM   2530 S  SG    B CYS A 1 324 ? 36.392 10.060  -7.209  0.60 18.59 ? 321 CYS A SG    1 
ATOM   2531 N  N     . SER A 1 325 ? 35.024 7.605   -3.067  1.00 10.99 ? 322 SER A N     1 
ATOM   2532 C  CA    A SER A 1 325 ? 34.094 7.081   -2.074  0.50 14.35 ? 322 SER A CA    1 
ATOM   2533 C  CA    B SER A 1 325 ? 34.181 7.014   -2.026  0.50 14.40 ? 322 SER A CA    1 
ATOM   2534 C  C     . SER A 1 325 ? 33.970 7.977   -0.858  1.00 15.38 ? 322 SER A C     1 
ATOM   2535 O  O     . SER A 1 325 ? 34.890 8.708   -0.498  1.00 13.20 ? 322 SER A O     1 
ATOM   2536 C  CB    A SER A 1 325 ? 34.504 5.678   -1.630  0.50 15.29 ? 322 SER A CB    1 
ATOM   2537 C  CB    B SER A 1 325 ? 34.856 5.733   -1.514  0.50 14.51 ? 322 SER A CB    1 
ATOM   2538 O  OG    A SER A 1 325 ? 35.737 5.716   -0.943  0.50 12.28 ? 322 SER A OG    1 
ATOM   2539 O  OG    B SER A 1 325 ? 34.179 5.164   -0.408  0.50 15.81 ? 322 SER A OG    1 
ATOM   2540 N  N     . LYS A 1 326 ? 32.786 7.942   -0.248  1.00 12.08 ? 323 LYS A N     1 
ATOM   2541 C  CA    . LYS A 1 326 ? 32.556 8.700   0.984   1.00 12.09 ? 323 LYS A CA    1 
ATOM   2542 C  C     . LYS A 1 326 ? 31.588 7.984   1.913   1.00 15.59 ? 323 LYS A C     1 
ATOM   2543 O  O     . LYS A 1 326 ? 30.541 7.502   1.469   1.00 11.78 ? 323 LYS A O     1 
ATOM   2544 C  CB    . LYS A 1 326 ? 32.041 10.114  0.697   1.00 11.57 ? 323 LYS A CB    1 
ATOM   2545 C  CG    . LYS A 1 326 ? 31.935 10.948  1.981   1.00 14.46 ? 323 LYS A CG    1 
ATOM   2546 C  CD    . LYS A 1 326 ? 31.693 12.417  1.689   1.00 14.93 ? 323 LYS A CD    1 
ATOM   2547 C  CE    . LYS A 1 326 ? 31.561 13.211  2.978   1.00 18.16 ? 323 LYS A CE    1 
ATOM   2548 N  NZ    . LYS A 1 326 ? 32.699 12.937  3.872   1.00 25.40 ? 323 LYS A NZ    1 
ATOM   2549 N  N     . ASN A 1 327 ? 31.967 7.892   3.186   1.00 12.14 ? 324 ASN A N     1 
ATOM   2550 C  CA    . ASN A 1 327 ? 31.088 7.418   4.253   1.00 17.26 ? 324 ASN A CA    1 
ATOM   2551 C  C     . ASN A 1 327 ? 30.248 8.549   4.832   1.00 15.40 ? 324 ASN A C     1 
ATOM   2552 O  O     . ASN A 1 327 ? 30.656 9.711   4.833   1.00 13.79 ? 324 ASN A O     1 
ATOM   2553 C  CB    . ASN A 1 327 ? 31.886 6.791   5.404   1.00 13.85 ? 324 ASN A CB    1 
ATOM   2554 C  CG    . ASN A 1 327 ? 32.570 5.490   5.021   1.00 20.33 ? 324 ASN A CG    1 
ATOM   2555 O  OD1   . ASN A 1 327 ? 32.346 4.931   3.944   1.00 23.01 ? 324 ASN A OD1   1 
ATOM   2556 N  ND2   . ASN A 1 327 ? 33.411 4.993   5.920   1.00 24.75 ? 324 ASN A ND2   1 
ATOM   2557 N  N     . PHE A 1 328 ? 29.073 8.181   5.334   1.00 15.32 ? 325 PHE A N     1 
ATOM   2558 C  CA    . PHE A 1 328 ? 28.155 9.109   5.959   1.00 18.87 ? 325 PHE A CA    1 
ATOM   2559 C  C     . PHE A 1 328 ? 27.685 8.451   7.248   1.00 22.73 ? 325 PHE A C     1 
ATOM   2560 O  O     . PHE A 1 328 ? 26.582 7.897   7.321   1.00 20.79 ? 325 PHE A O     1 
ATOM   2561 C  CB    . PHE A 1 328 ? 26.995 9.403   5.008   1.00 17.24 ? 325 PHE A CB    1 
ATOM   2562 C  CG    . PHE A 1 328 ? 27.428 9.992   3.694   1.00 16.15 ? 325 PHE A CG    1 
ATOM   2563 C  CD1   . PHE A 1 328 ? 27.636 9.179   2.588   1.00 17.36 ? 325 PHE A CD1   1 
ATOM   2564 C  CD2   . PHE A 1 328 ? 27.644 11.350  3.564   1.00 14.52 ? 325 PHE A CD2   1 
ATOM   2565 C  CE1   . PHE A 1 328 ? 28.035 9.721   1.373   1.00 11.73 ? 325 PHE A CE1   1 
ATOM   2566 C  CE2   . PHE A 1 328 ? 28.040 11.899  2.357   1.00 15.04 ? 325 PHE A CE2   1 
ATOM   2567 C  CZ    . PHE A 1 328 ? 28.247 11.078  1.255   1.00 14.15 ? 325 PHE A CZ    1 
ATOM   2568 N  N     . PRO A 1 329 ? 28.549 8.484   8.271   1.00 27.48 ? 326 PRO A N     1 
ATOM   2569 C  CA    . PRO A 1 329 ? 28.334 7.730   9.510   1.00 29.75 ? 326 PRO A CA    1 
ATOM   2570 C  C     . PRO A 1 329 ? 27.237 8.295   10.406  1.00 27.38 ? 326 PRO A C     1 
ATOM   2571 O  O     . PRO A 1 329 ? 26.959 9.497   10.388  1.00 23.69 ? 326 PRO A O     1 
ATOM   2572 C  CB    . PRO A 1 329 ? 29.687 7.835   10.218  1.00 27.93 ? 326 PRO A CB    1 
ATOM   2573 C  CG    . PRO A 1 329 ? 30.285 9.102   9.696   1.00 32.38 ? 326 PRO A CG    1 
ATOM   2574 C  CD    . PRO A 1 329 ? 29.856 9.161   8.256   1.00 28.88 ? 326 PRO A CD    1 
ATOM   2575 N  N     . GLY A 1 330 ? 26.630 7.403   11.183  1.00 34.05 ? 327 GLY A N     1 
ATOM   2576 C  CA    . GLY A 1 330 ? 25.664 7.765   12.204  1.00 35.45 ? 327 GLY A CA    1 
ATOM   2577 C  C     . GLY A 1 330 ? 24.574 8.707   11.739  1.00 31.02 ? 327 GLY A C     1 
ATOM   2578 O  O     . GLY A 1 330 ? 23.774 8.375   10.863  1.00 31.48 ? 327 GLY A O     1 
ATOM   2579 N  N     . LYS A 1 331 ? 24.555 9.893   12.334  1.00 28.23 ? 328 LYS A N     1 
ATOM   2580 C  CA    . LYS A 1 331 ? 23.488 10.852  12.102  1.00 31.31 ? 328 LYS A CA    1 
ATOM   2581 C  C     . LYS A 1 331 ? 23.645 11.592  10.782  1.00 30.82 ? 328 LYS A C     1 
ATOM   2582 O  O     . LYS A 1 331 ? 22.735 12.298  10.355  1.00 36.04 ? 328 LYS A O     1 
ATOM   2583 C  CB    . LYS A 1 331 ? 23.406 11.839  13.273  1.00 38.74 ? 328 LYS A CB    1 
ATOM   2584 C  CG    . LYS A 1 331 ? 22.246 12.815  13.192  1.00 60.31 ? 328 LYS A CG    1 
ATOM   2585 C  CD    . LYS A 1 331 ? 22.106 13.627  14.473  1.00 65.39 ? 328 LYS A CD    1 
ATOM   2586 C  CE    . LYS A 1 331 ? 21.198 14.832  14.263  1.00 53.64 ? 328 LYS A CE    1 
ATOM   2587 N  NZ    . LYS A 1 331 ? 21.748 15.749  13.223  1.00 52.47 ? 328 LYS A NZ    1 
ATOM   2588 N  N     . THR A 1 332 ? 24.792 11.439  10.126  1.00 30.32 ? 329 THR A N     1 
ATOM   2589 C  CA    . THR A 1 332 ? 24.998 12.119  8.849   1.00 30.58 ? 329 THR A CA    1 
ATOM   2590 C  C     . THR A 1 332 ? 24.471 11.305  7.668   1.00 20.80 ? 329 THR A C     1 
ATOM   2591 O  O     . THR A 1 332 ? 24.497 11.776  6.536   1.00 20.68 ? 329 THR A O     1 
ATOM   2592 C  CB    . THR A 1 332 ? 26.481 12.496  8.593   1.00 26.99 ? 329 THR A CB    1 
ATOM   2593 O  OG1   . THR A 1 332 ? 27.259 11.311  8.388   1.00 29.25 ? 329 THR A OG1   1 
ATOM   2594 C  CG2   . THR A 1 332 ? 27.055 13.294  9.764   1.00 28.42 ? 329 THR A CG2   1 
ATOM   2595 N  N     . ALA A 1 333 ? 23.994 10.092  7.934   1.00 23.46 ? 330 ALA A N     1 
ATOM   2596 C  CA    . ALA A 1 333 ? 23.505 9.221   6.863   1.00 26.09 ? 330 ALA A CA    1 
ATOM   2597 C  C     . ALA A 1 333 ? 22.477 9.921   5.979   1.00 30.72 ? 330 ALA A C     1 
ATOM   2598 O  O     . ALA A 1 333 ? 21.657 10.704  6.457   1.00 33.13 ? 330 ALA A O     1 
ATOM   2599 C  CB    . ALA A 1 333 ? 22.951 7.924   7.433   1.00 27.42 ? 330 ALA A CB    1 
ATOM   2600 N  N     . LEU A 1 334 ? 22.528 9.643   4.681   1.00 23.64 ? 331 LEU A N     1 
ATOM   2601 C  CA    . LEU A 1 334 ? 21.703 10.362  3.721   1.00 25.87 ? 331 LEU A CA    1 
ATOM   2602 C  C     . LEU A 1 334 ? 20.264 9.826   3.718   1.00 26.90 ? 331 LEU A C     1 
ATOM   2603 O  O     . LEU A 1 334 ? 20.033 8.639   3.484   1.00 28.02 ? 331 LEU A O     1 
ATOM   2604 C  CB    . LEU A 1 334 ? 22.321 10.281  2.326   1.00 27.38 ? 331 LEU A CB    1 
ATOM   2605 C  CG    . LEU A 1 334 ? 23.832 10.530  2.258   1.00 17.86 ? 331 LEU A CG    1 
ATOM   2606 C  CD1   . LEU A 1 334 ? 24.304 10.422  0.816   1.00 16.89 ? 331 LEU A CD1   1 
ATOM   2607 C  CD2   . LEU A 1 334 ? 24.205 11.889  2.853   1.00 18.59 ? 331 LEU A CD2   1 
ATOM   2608 N  N     . ALA A 1 335 ? 19.308 10.713  3.975   1.00 32.41 ? 332 ALA A N     1 
ATOM   2609 C  CA    . ALA A 1 335 ? 17.926 10.302  4.217   1.00 30.41 ? 332 ALA A CA    1 
ATOM   2610 C  C     . ALA A 1 335 ? 16.929 10.950  3.264   1.00 34.93 ? 332 ALA A C     1 
ATOM   2611 O  O     . ALA A 1 335 ? 15.721 10.740  3.380   1.00 34.99 ? 332 ALA A O     1 
ATOM   2612 C  CB    . ALA A 1 335 ? 17.542 10.600  5.658   1.00 29.23 ? 332 ALA A CB    1 
ATOM   2613 N  N     . THR A 1 336 ? 17.434 11.744  2.330   1.00 26.10 ? 333 THR A N     1 
ATOM   2614 C  CA    . THR A 1 336 ? 16.587 12.366  1.324   1.00 29.87 ? 333 THR A CA    1 
ATOM   2615 C  C     . THR A 1 336 ? 17.152 12.142  -0.074  1.00 40.42 ? 333 THR A C     1 
ATOM   2616 O  O     . THR A 1 336 ? 18.358 11.963  -0.245  1.00 32.92 ? 333 THR A O     1 
ATOM   2617 C  CB    . THR A 1 336 ? 16.437 13.874  1.557   1.00 36.32 ? 333 THR A CB    1 
ATOM   2618 O  OG1   . THR A 1 336 ? 17.583 14.560  1.039   1.00 35.97 ? 333 THR A OG1   1 
ATOM   2619 C  CG2   . THR A 1 336 ? 16.278 14.183  3.044   1.00 37.02 ? 333 THR A CG2   1 
ATOM   2620 N  N     . ARG A 1 337 ? 16.274 12.164  -1.071  1.00 36.08 ? 334 ARG A N     1 
ATOM   2621 C  CA    . ARG A 1 337 ? 16.677 11.976  -2.460  1.00 36.90 ? 334 ARG A CA    1 
ATOM   2622 C  C     . ARG A 1 337 ? 17.626 13.076  -2.916  1.00 34.83 ? 334 ARG A C     1 
ATOM   2623 O  O     . ARG A 1 337 ? 18.589 12.813  -3.634  1.00 33.77 ? 334 ARG A O     1 
ATOM   2624 C  CB    . ARG A 1 337 ? 15.444 11.934  -3.364  1.00 42.99 ? 334 ARG A CB    1 
ATOM   2625 C  CG    . ARG A 1 337 ? 15.755 11.844  -4.848  1.00 49.37 ? 334 ARG A CG    1 
ATOM   2626 C  CD    . ARG A 1 337 ? 14.477 11.869  -5.684  1.00 50.32 ? 334 ARG A CD    1 
ATOM   2627 N  NE    . ARG A 1 337 ? 13.601 12.978  -5.309  1.00 61.69 ? 334 ARG A NE    1 
ATOM   2628 C  CZ    . ARG A 1 337 ? 13.791 14.241  -5.678  1.00 59.88 ? 334 ARG A CZ    1 
ATOM   2629 N  NH1   . ARG A 1 337 ? 14.833 14.566  -6.432  1.00 54.64 ? 334 ARG A NH1   1 
ATOM   2630 N  NH2   . ARG A 1 337 ? 12.942 15.184  -5.288  1.00 61.61 ? 334 ARG A NH2   1 
ATOM   2631 N  N     . GLU A 1 338 ? 17.347 14.306  -2.500  1.00 37.88 ? 335 GLU A N     1 
ATOM   2632 C  CA    . GLU A 1 338 ? 18.201 15.446  -2.825  1.00 36.65 ? 335 GLU A CA    1 
ATOM   2633 C  C     . GLU A 1 338 ? 19.619 15.269  -2.287  1.00 31.12 ? 335 GLU A C     1 
ATOM   2634 O  O     . GLU A 1 338 ? 20.597 15.592  -2.962  1.00 28.45 ? 335 GLU A O     1 
ATOM   2635 C  CB    . GLU A 1 338 ? 17.608 16.733  -2.253  1.00 31.99 ? 335 GLU A CB    1 
ATOM   2636 C  CG    . GLU A 1 338 ? 16.392 17.245  -3.003  1.00 50.97 ? 335 GLU A CG    1 
ATOM   2637 C  CD    . GLU A 1 338 ? 16.745 17.803  -4.368  1.00 60.43 ? 335 GLU A CD    1 
ATOM   2638 O  OE1   . GLU A 1 338 ? 17.946 17.818  -4.712  1.00 60.12 ? 335 GLU A OE1   1 
ATOM   2639 O  OE2   . GLU A 1 338 ? 15.821 18.231  -5.095  1.00 63.35 ? 335 GLU A OE2   1 
ATOM   2640 N  N     . GLN A 1 339 ? 19.720 14.781  -1.056  1.00 30.58 ? 336 GLN A N     1 
ATOM   2641 C  CA    . GLN A 1 339 ? 21.019 14.537  -0.445  1.00 31.93 ? 336 GLN A CA    1 
ATOM   2642 C  C     . GLN A 1 339 ? 21.796 13.536  -1.280  1.00 30.29 ? 336 GLN A C     1 
ATOM   2643 O  O     . GLN A 1 339 ? 22.947 13.775  -1.651  1.00 27.43 ? 336 GLN A O     1 
ATOM   2644 C  CB    . GLN A 1 339 ? 20.844 13.964  0.954   1.00 34.21 ? 336 GLN A CB    1 
ATOM   2645 C  CG    . GLN A 1 339 ? 20.961 14.957  2.083   1.00 26.73 ? 336 GLN A CG    1 
ATOM   2646 C  CD    . GLN A 1 339 ? 20.969 14.256  3.419   1.00 23.33 ? 336 GLN A CD    1 
ATOM   2647 O  OE1   . GLN A 1 339 ? 20.108 13.418  3.697   1.00 27.02 ? 336 GLN A OE1   1 
ATOM   2648 N  NE2   . GLN A 1 339 ? 21.953 14.578  4.253   1.00 26.43 ? 336 GLN A NE2   1 
ATOM   2649 N  N     . VAL A 1 340 ? 21.154 12.408  -1.565  1.00 30.08 ? 337 VAL A N     1 
ATOM   2650 C  CA    . VAL A 1 340 ? 21.781 11.343  -2.328  1.00 28.05 ? 337 VAL A CA    1 
ATOM   2651 C  C     . VAL A 1 340 ? 22.280 11.855  -3.677  1.00 28.76 ? 337 VAL A C     1 
ATOM   2652 O  O     . VAL A 1 340 ? 23.382 11.519  -4.109  1.00 25.38 ? 337 VAL A O     1 
ATOM   2653 C  CB    . VAL A 1 340 ? 20.825 10.149  -2.527  1.00 30.54 ? 337 VAL A CB    1 
ATOM   2654 C  CG1   . VAL A 1 340 ? 21.430 9.135   -3.473  1.00 18.02 ? 337 VAL A CG1   1 
ATOM   2655 C  CG2   . VAL A 1 340 ? 20.505 9.495   -1.193  1.00 21.21 ? 337 VAL A CG2   1 
ATOM   2656 N  N     . GLN A 1 341 ? 21.482 12.689  -4.333  1.00 25.56 ? 338 GLN A N     1 
ATOM   2657 C  CA    . GLN A 1 341 ? 21.848 13.189  -5.651  1.00 26.88 ? 338 GLN A CA    1 
ATOM   2658 C  C     . GLN A 1 341 ? 22.971 14.214  -5.584  1.00 24.83 ? 338 GLN A C     1 
ATOM   2659 O  O     . GLN A 1 341 ? 23.832 14.262  -6.456  1.00 21.54 ? 338 GLN A O     1 
ATOM   2660 C  CB    . GLN A 1 341 ? 20.626 13.761  -6.375  1.00 29.78 ? 338 GLN A CB    1 
ATOM   2661 C  CG    . GLN A 1 341 ? 19.566 12.714  -6.668  1.00 32.14 ? 338 GLN A CG    1 
ATOM   2662 C  CD    . GLN A 1 341 ? 18.329 13.295  -7.329  1.00 38.72 ? 338 GLN A CD    1 
ATOM   2663 O  OE1   . GLN A 1 341 ? 18.038 14.485  -7.198  1.00 37.56 ? 338 GLN A OE1   1 
ATOM   2664 N  NE2   . GLN A 1 341 ? 17.596 12.452  -8.050  1.00 37.85 ? 338 GLN A NE2   1 
ATOM   2665 N  N     . TRP A 1 342 ? 22.966 15.038  -4.548  1.00 21.69 ? 339 TRP A N     1 
ATOM   2666 C  CA    . TRP A 1 342 ? 23.995 16.049  -4.411  1.00 19.20 ? 339 TRP A CA    1 
ATOM   2667 C  C     . TRP A 1 342 ? 25.358 15.404  -4.177  1.00 15.02 ? 339 TRP A C     1 
ATOM   2668 O  O     . TRP A 1 342 ? 26.358 15.817  -4.753  1.00 17.59 ? 339 TRP A O     1 
ATOM   2669 C  CB    . TRP A 1 342 ? 23.664 17.004  -3.264  1.00 17.86 ? 339 TRP A CB    1 
ATOM   2670 C  CG    . TRP A 1 342 ? 24.576 18.174  -3.244  1.00 23.12 ? 339 TRP A CG    1 
ATOM   2671 C  CD1   . TRP A 1 342 ? 24.506 19.279  -4.039  1.00 24.33 ? 339 TRP A CD1   1 
ATOM   2672 C  CD2   . TRP A 1 342 ? 25.725 18.348  -2.414  1.00 20.25 ? 339 TRP A CD2   1 
ATOM   2673 N  NE1   . TRP A 1 342 ? 25.531 20.138  -3.747  1.00 27.46 ? 339 TRP A NE1   1 
ATOM   2674 C  CE2   . TRP A 1 342 ? 26.295 19.592  -2.750  1.00 18.43 ? 339 TRP A CE2   1 
ATOM   2675 C  CE3   . TRP A 1 342 ? 26.323 17.578  -1.414  1.00 19.58 ? 339 TRP A CE3   1 
ATOM   2676 C  CZ2   . TRP A 1 342 ? 27.436 20.084  -2.126  1.00 26.31 ? 339 TRP A CZ2   1 
ATOM   2677 C  CZ3   . TRP A 1 342 ? 27.449 18.068  -0.789  1.00 25.66 ? 339 TRP A CZ3   1 
ATOM   2678 C  CH2   . TRP A 1 342 ? 27.998 19.309  -1.148  1.00 25.84 ? 339 TRP A CH2   1 
ATOM   2679 N  N     . TRP A 1 343 ? 25.396 14.389  -3.330  1.00 14.22 ? 340 TRP A N     1 
ATOM   2680 C  CA    . TRP A 1 343 ? 26.666 13.719  -3.076  1.00 12.88 ? 340 TRP A CA    1 
ATOM   2681 C  C     . TRP A 1 343 ? 27.132 12.867  -4.254  1.00 14.82 ? 340 TRP A C     1 
ATOM   2682 O  O     . TRP A 1 343 ? 28.328 12.784  -4.511  1.00 15.18 ? 340 TRP A O     1 
ATOM   2683 C  CB    . TRP A 1 343 ? 26.628 12.910  -1.780  1.00 13.19 ? 340 TRP A CB    1 
ATOM   2684 C  CG    . TRP A 1 343 ? 26.740 13.788  -0.548  1.00 18.15 ? 340 TRP A CG    1 
ATOM   2685 C  CD1   . TRP A 1 343 ? 25.739 14.113  0.321   1.00 20.77 ? 340 TRP A CD1   1 
ATOM   2686 C  CD2   . TRP A 1 343 ? 27.923 14.440  -0.062  1.00 13.23 ? 340 TRP A CD2   1 
ATOM   2687 N  NE1   . TRP A 1 343 ? 26.228 14.932  1.320   1.00 21.41 ? 340 TRP A NE1   1 
ATOM   2688 C  CE2   . TRP A 1 343 ? 27.565 15.143  1.106   1.00 20.62 ? 340 TRP A CE2   1 
ATOM   2689 C  CE3   . TRP A 1 343 ? 29.252 14.492  -0.501  1.00 17.53 ? 340 TRP A CE3   1 
ATOM   2690 C  CZ2   . TRP A 1 343 ? 28.488 15.893  1.842   1.00 16.03 ? 340 TRP A CZ2   1 
ATOM   2691 C  CZ3   . TRP A 1 343 ? 30.163 15.237  0.225   1.00 16.89 ? 340 TRP A CZ3   1 
ATOM   2692 C  CH2   . TRP A 1 343 ? 29.777 15.927  1.388   1.00 19.32 ? 340 TRP A CH2   1 
ATOM   2693 N  N     . LEU A 1 344 ? 26.213 12.239  -4.982  1.00 15.80 ? 341 LEU A N     1 
ATOM   2694 C  CA    . LEU A 1 344 ? 26.653 11.487  -6.159  1.00 18.77 ? 341 LEU A CA    1 
ATOM   2695 C  C     . LEU A 1 344 ? 27.321 12.446  -7.127  1.00 16.49 ? 341 LEU A C     1 
ATOM   2696 O  O     . LEU A 1 344 ? 28.300 12.099  -7.790  1.00 14.95 ? 341 LEU A O     1 
ATOM   2697 C  CB    . LEU A 1 344 ? 25.501 10.753  -6.859  1.00 15.43 ? 341 LEU A CB    1 
ATOM   2698 C  CG    . LEU A 1 344 ? 24.941 9.531   -6.134  1.00 19.69 ? 341 LEU A CG    1 
ATOM   2699 C  CD1   . LEU A 1 344 ? 23.653 9.078   -6.804  1.00 23.00 ? 341 LEU A CD1   1 
ATOM   2700 C  CD2   . LEU A 1 344 ? 25.964 8.400   -6.085  1.00 19.18 ? 341 LEU A CD2   1 
ATOM   2701 N  N     . LEU A 1 345 ? 26.793 13.661  -7.212  1.00 16.24 ? 342 LEU A N     1 
ATOM   2702 C  CA    . LEU A 1 345 ? 27.376 14.669  -8.080  1.00 12.93 ? 342 LEU A CA    1 
ATOM   2703 C  C     . LEU A 1 345 ? 28.768 15.102  -7.612  1.00 15.72 ? 342 LEU A C     1 
ATOM   2704 O  O     . LEU A 1 345 ? 29.668 15.293  -8.419  1.00 13.86 ? 342 LEU A O     1 
ATOM   2705 C  CB    . LEU A 1 345 ? 26.459 15.888  -8.177  1.00 18.54 ? 342 LEU A CB    1 
ATOM   2706 C  CG    . LEU A 1 345 ? 26.977 17.014  -9.065  1.00 19.82 ? 342 LEU A CG    1 
ATOM   2707 C  CD1   . LEU A 1 345 ? 27.153 16.531  -10.514 1.00 18.72 ? 342 LEU A CD1   1 
ATOM   2708 C  CD2   . LEU A 1 345 ? 26.031 18.205  -9.013  1.00 26.09 ? 342 LEU A CD2   1 
ATOM   2709 N  N     . GLN A 1 346 ? 28.939 15.265  -6.306  1.00 15.38 ? 343 GLN A N     1 
ATOM   2710 C  CA    . GLN A 1 346 ? 30.226 15.687  -5.777  1.00 11.77 ? 343 GLN A CA    1 
ATOM   2711 C  C     . GLN A 1 346 ? 31.287 14.647  -6.144  1.00 13.22 ? 343 GLN A C     1 
ATOM   2712 O  O     . GLN A 1 346 ? 32.377 14.992  -6.602  1.00 13.94 ? 343 GLN A O     1 
ATOM   2713 C  CB    . GLN A 1 346 ? 30.179 15.837  -4.254  1.00 19.83 ? 343 GLN A CB    1 
ATOM   2714 C  CG    . GLN A 1 346 ? 29.201 16.901  -3.760  1.00 16.96 ? 343 GLN A CG    1 
ATOM   2715 C  CD    . GLN A 1 346 ? 29.184 18.149  -4.628  1.00 20.53 ? 343 GLN A CD    1 
ATOM   2716 O  OE1   . GLN A 1 346 ? 30.141 18.925  -4.653  1.00 20.46 ? 343 GLN A OE1   1 
ATOM   2717 N  NE2   . GLN A 1 346 ? 28.076 18.356  -5.339  1.00 17.29 ? 343 GLN A NE2   1 
ATOM   2718 N  N     . LEU A 1 347 ? 30.952 13.387  -5.893  1.00 16.89 ? 344 LEU A N     1 
ATOM   2719 C  CA    . LEU A 1 347 ? 31.818 12.258  -6.230  1.00 15.82 ? 344 LEU A CA    1 
ATOM   2720 C  C     . LEU A 1 347 ? 32.093 12.210  -7.730  1.00 13.88 ? 344 LEU A C     1 
ATOM   2721 O  O     . LEU A 1 347 ? 33.237 12.033  -8.150  1.00 12.45 ? 344 LEU A O     1 
ATOM   2722 C  CB    . LEU A 1 347 ? 31.189 10.947  -5.779  1.00 13.67 ? 344 LEU A CB    1 
ATOM   2723 C  CG    . LEU A 1 347 ? 31.238 10.681  -4.275  1.00 19.63 ? 344 LEU A CG    1 
ATOM   2724 C  CD1   . LEU A 1 347 ? 30.548 9.373   -3.936  1.00 22.93 ? 344 LEU A CD1   1 
ATOM   2725 C  CD2   . LEU A 1 347 ? 32.668 10.670  -3.798  1.00 23.61 ? 344 LEU A CD2   1 
ATOM   2726 N  N     . ALA A 1 348 ? 31.042 12.373  -8.532  1.00 14.21 ? 345 ALA A N     1 
ATOM   2727 C  CA    . ALA A 1 348 ? 31.175 12.288  -9.978  1.00 12.83 ? 345 ALA A CA    1 
ATOM   2728 C  C     . ALA A 1 348 ? 32.085 13.381  -10.506 1.00 15.73 ? 345 ALA A C     1 
ATOM   2729 O  O     . ALA A 1 348 ? 32.802 13.188  -11.486 1.00 13.57 ? 345 ALA A O     1 
ATOM   2730 C  CB    . ALA A 1 348 ? 29.793 12.370  -10.654 1.00 11.44 ? 345 ALA A CB    1 
ATOM   2731 N  N     . GLN A 1 349 ? 32.034 14.544  -9.867  1.00 13.20 ? 346 GLN A N     1 
ATOM   2732 C  CA    . GLN A 1 349 ? 32.861 15.665  -10.274 1.00 10.44 ? 346 GLN A CA    1 
ATOM   2733 C  C     . GLN A 1 349 ? 34.336 15.412  -9.988  1.00 13.82 ? 346 GLN A C     1 
ATOM   2734 O  O     . GLN A 1 349 ? 35.201 15.773  -10.794 1.00 13.53 ? 346 GLN A O     1 
ATOM   2735 C  CB    . GLN A 1 349 ? 32.401 16.949  -9.597  1.00 16.26 ? 346 GLN A CB    1 
ATOM   2736 C  CG    . GLN A 1 349 ? 31.051 17.443  -10.110 1.00 18.10 ? 346 GLN A CG    1 
ATOM   2737 C  CD    . GLN A 1 349 ? 30.651 18.787  -9.522  1.00 26.73 ? 346 GLN A CD    1 
ATOM   2738 O  OE1   . GLN A 1 349 ? 31.260 19.264  -8.569  1.00 31.82 ? 346 GLN A OE1   1 
ATOM   2739 N  NE2   . GLN A 1 349 ? 29.622 19.399  -10.093 1.00 31.57 ? 346 GLN A NE2   1 
ATOM   2740 N  N     . GLU A 1 350 ? 34.628 14.798  -8.848  1.00 12.67 ? 347 GLU A N     1 
ATOM   2741 C  CA    . GLU A 1 350 ? 36.013 14.451  -8.553  1.00 12.95 ? 347 GLU A CA    1 
ATOM   2742 C  C     . GLU A 1 350 ? 36.475 13.361  -9.522  1.00 10.46 ? 347 GLU A C     1 
ATOM   2743 O  O     . GLU A 1 350 ? 37.583 13.426  -10.049 1.00 15.14 ? 347 GLU A O     1 
ATOM   2744 C  CB    . GLU A 1 350 ? 36.223 14.009  -7.097  1.00 14.77 ? 347 GLU A CB    1 
ATOM   2745 C  CG    . GLU A 1 350 ? 37.691 13.622  -6.847  1.00 16.73 ? 347 GLU A CG    1 
ATOM   2746 C  CD    . GLU A 1 350 ? 37.945 12.998  -5.487  1.00 24.43 ? 347 GLU A CD    1 
ATOM   2747 O  OE1   . GLU A 1 350 ? 37.276 13.383  -4.510  1.00 23.62 ? 347 GLU A OE1   1 
ATOM   2748 O  OE2   . GLU A 1 350 ? 38.827 12.120  -5.394  1.00 21.08 ? 347 GLU A OE2   1 
ATOM   2749 N  N     . LEU A 1 351 ? 35.614 12.376  -9.758  1.00 9.63  ? 348 LEU A N     1 
ATOM   2750 C  CA    . LEU A 1 351 ? 35.935 11.274  -10.668 1.00 11.07 ? 348 LEU A CA    1 
ATOM   2751 C  C     . LEU A 1 351 ? 36.200 11.803  -12.081 1.00 12.81 ? 348 LEU A C     1 
ATOM   2752 O  O     . LEU A 1 351 ? 37.169 11.402  -12.733 1.00 12.89 ? 348 LEU A O     1 
ATOM   2753 C  CB    . LEU A 1 351 ? 34.810 10.236  -10.666 1.00 12.00 ? 348 LEU A CB    1 
ATOM   2754 C  CG    . LEU A 1 351 ? 35.026 8.923   -11.431 1.00 14.54 ? 348 LEU A CG    1 
ATOM   2755 C  CD1   . LEU A 1 351 ? 36.330 8.272   -10.986 1.00 19.87 ? 348 LEU A CD1   1 
ATOM   2756 C  CD2   . LEU A 1 351 ? 33.838 7.969   -11.227 1.00 16.69 ? 348 LEU A CD2   1 
ATOM   2757 N  N     . GLU A 1 352 ? 35.350 12.711  -12.559 1.00 14.22 ? 349 GLU A N     1 
ATOM   2758 C  CA    . GLU A 1 352 ? 35.563 13.291  -13.889 1.00 12.91 ? 349 GLU A CA    1 
ATOM   2759 C  C     . GLU A 1 352 ? 36.925 13.956  -13.982 1.00 12.67 ? 349 GLU A C     1 
ATOM   2760 O  O     . GLU A 1 352 ? 37.641 13.808  -14.976 1.00 15.89 ? 349 GLU A O     1 
ATOM   2761 C  CB    . GLU A 1 352 ? 34.466 14.315  -14.231 1.00 14.51 ? 349 GLU A CB    1 
ATOM   2762 C  CG    . GLU A 1 352 ? 34.588 14.869  -15.647 1.00 24.01 ? 349 GLU A CG    1 
ATOM   2763 C  CD    . GLU A 1 352 ? 33.694 16.080  -15.908 1.00 44.45 ? 349 GLU A CD    1 
ATOM   2764 O  OE1   . GLU A 1 352 ? 34.104 16.956  -16.702 1.00 50.30 ? 349 GLU A OE1   1 
ATOM   2765 O  OE2   . GLU A 1 352 ? 32.583 16.159  -15.336 1.00 33.83 ? 349 GLU A OE2   1 
ATOM   2766 N  N     . GLU A 1 353 ? 37.279 14.698  -12.941 1.00 11.96 ? 350 GLU A N     1 
ATOM   2767 C  CA    . GLU A 1 353 ? 38.547 15.406  -12.910 1.00 11.98 ? 350 GLU A CA    1 
ATOM   2768 C  C     . GLU A 1 353 ? 39.704 14.416  -13.005 1.00 12.85 ? 350 GLU A C     1 
ATOM   2769 O  O     . GLU A 1 353 ? 40.649 14.603  -13.782 1.00 16.38 ? 350 GLU A O     1 
ATOM   2770 C  CB    . GLU A 1 353 ? 38.648 16.201  -11.607 1.00 20.41 ? 350 GLU A CB    1 
ATOM   2771 C  CG    . GLU A 1 353 ? 39.820 17.156  -11.530 1.00 34.29 ? 350 GLU A CG    1 
ATOM   2772 C  CD    . GLU A 1 353 ? 39.717 18.087  -10.333 1.00 47.83 ? 350 GLU A CD    1 
ATOM   2773 O  OE1   . GLU A 1 353 ? 39.151 17.667  -9.300  1.00 52.42 ? 350 GLU A OE1   1 
ATOM   2774 O  OE2   . GLU A 1 353 ? 40.189 19.238  -10.429 1.00 52.68 ? 350 GLU A OE2   1 
ATOM   2775 N  N     . ARG A 1 354 ? 39.637 13.367  -12.198 1.00 12.21 ? 351 ARG A N     1 
ATOM   2776 C  CA    . ARG A 1 354 ? 40.694 12.356  -12.235 1.00 12.93 ? 351 ARG A CA    1 
ATOM   2777 C  C     . ARG A 1 354 ? 40.749 11.583  -13.550 1.00 14.95 ? 351 ARG A C     1 
ATOM   2778 O  O     . ARG A 1 354 ? 41.831 11.286  -14.053 1.00 13.48 ? 351 ARG A O     1 
ATOM   2779 C  CB    . ARG A 1 354 ? 40.589 11.406  -11.046 1.00 12.59 ? 351 ARG A CB    1 
ATOM   2780 C  CG    A ARG A 1 354 ? 41.061 12.070  -9.761  0.50 15.00 ? 351 ARG A CG    1 
ATOM   2781 C  CG    B ARG A 1 354 ? 40.810 12.051  -9.686  0.50 15.38 ? 351 ARG A CG    1 
ATOM   2782 C  CD    A ARG A 1 354 ? 40.479 11.387  -8.556  0.50 15.08 ? 351 ARG A CD    1 
ATOM   2783 C  CD    B ARG A 1 354 ? 40.701 10.997  -8.600  0.50 15.56 ? 351 ARG A CD    1 
ATOM   2784 N  NE    A ARG A 1 354 ? 41.029 10.051  -8.384  0.50 11.44 ? 351 ARG A NE    1 
ATOM   2785 N  NE    B ARG A 1 354 ? 41.666 9.926   -8.823  0.50 11.65 ? 351 ARG A NE    1 
ATOM   2786 C  CZ    A ARG A 1 354 ? 40.627 9.198   -7.455  0.50 12.86 ? 351 ARG A CZ    1 
ATOM   2787 C  CZ    B ARG A 1 354 ? 41.616 8.725   -8.255  0.50 15.69 ? 351 ARG A CZ    1 
ATOM   2788 N  NH1   A ARG A 1 354 ? 39.655 9.539   -6.610  0.50 9.76  ? 351 ARG A NH1   1 
ATOM   2789 N  NH1   B ARG A 1 354 ? 40.634 8.415   -7.426  0.50 14.50 ? 351 ARG A NH1   1 
ATOM   2790 N  NH2   A ARG A 1 354 ? 41.198 8.000   -7.378  0.50 10.17 ? 351 ARG A NH2   1 
ATOM   2791 N  NH2   B ARG A 1 354 ? 42.548 7.827   -8.531  0.50 14.52 ? 351 ARG A NH2   1 
ATOM   2792 N  N     . LEU A 1 355 ? 39.588 11.254  -14.103 1.00 11.68 ? 352 LEU A N     1 
ATOM   2793 C  CA    . LEU A 1 355 ? 39.527 10.499  -15.352 1.00 15.14 ? 352 LEU A CA    1 
ATOM   2794 C  C     . LEU A 1 355 ? 40.105 11.293  -16.510 1.00 15.61 ? 352 LEU A C     1 
ATOM   2795 O  O     . LEU A 1 355 ? 40.860 10.763  -17.332 1.00 15.25 ? 352 LEU A O     1 
ATOM   2796 C  CB    . LEU A 1 355 ? 38.085 10.105  -15.673 1.00 10.73 ? 352 LEU A CB    1 
ATOM   2797 C  CG    . LEU A 1 355 ? 37.530 8.900   -14.916 1.00 12.79 ? 352 LEU A CG    1 
ATOM   2798 C  CD1   . LEU A 1 355 ? 36.068 8.671   -15.263 1.00 13.00 ? 352 LEU A CD1   1 
ATOM   2799 C  CD2   . LEU A 1 355 ? 38.348 7.666   -15.248 1.00 14.04 ? 352 LEU A CD2   1 
ATOM   2800 N  N     . THR A 1 356 ? 39.733 12.564  -16.585 1.00 14.44 ? 353 THR A N     1 
ATOM   2801 C  CA    . THR A 1 356 ? 40.194 13.412  -17.677 1.00 15.40 ? 353 THR A CA    1 
ATOM   2802 C  C     . THR A 1 356 ? 41.712 13.541  -17.655 1.00 17.54 ? 353 THR A C     1 
ATOM   2803 O  O     . THR A 1 356 ? 42.369 13.454  -18.693 1.00 18.07 ? 353 THR A O     1 
ATOM   2804 C  CB    . THR A 1 356 ? 39.503 14.796  -17.644 1.00 18.63 ? 353 THR A CB    1 
ATOM   2805 O  OG1   . THR A 1 356 ? 38.099 14.615  -17.871 1.00 20.00 ? 353 THR A OG1   1 
ATOM   2806 C  CG2   . THR A 1 356 ? 40.069 15.705  -18.713 1.00 23.75 ? 353 THR A CG2   1 
ATOM   2807 N  N     . LYS A 1 357 ? 42.269 13.727  -16.464 1.00 18.52 ? 354 LYS A N     1 
ATOM   2808 C  CA    . LYS A 1 357 ? 43.712 13.789  -16.306 1.00 13.59 ? 354 LYS A CA    1 
ATOM   2809 C  C     . LYS A 1 357 ? 44.323 12.442  -16.697 1.00 15.15 ? 354 LYS A C     1 
ATOM   2810 O  O     . LYS A 1 357 ? 45.357 12.380  -17.366 1.00 15.21 ? 354 LYS A O     1 
ATOM   2811 C  CB    . LYS A 1 357 ? 44.069 14.140  -14.861 1.00 18.52 ? 354 LYS A CB    1 
ATOM   2812 C  CG    . LYS A 1 357 ? 45.554 14.160  -14.579 1.00 26.96 ? 354 LYS A CG    1 
ATOM   2813 C  CD    . LYS A 1 357 ? 46.265 15.176  -15.463 1.00 37.63 ? 354 LYS A CD    1 
ATOM   2814 C  CE    . LYS A 1 357 ? 47.414 15.841  -14.717 1.00 46.97 ? 354 LYS A CE    1 
ATOM   2815 N  NZ    . LYS A 1 357 ? 48.285 14.837  -14.050 1.00 34.28 ? 354 LYS A NZ    1 
ATOM   2816 N  N     . ASP A 1 358 ? 43.675 11.356  -16.286 1.00 14.55 ? 355 ASP A N     1 
ATOM   2817 C  CA    . ASP A 1 358 ? 44.191 10.028  -16.599 1.00 14.47 ? 355 ASP A CA    1 
ATOM   2818 C  C     . ASP A 1 358 ? 44.216 9.786   -18.101 1.00 16.35 ? 355 ASP A C     1 
ATOM   2819 O  O     . ASP A 1 358 ? 45.164 9.205   -18.611 1.00 20.31 ? 355 ASP A O     1 
ATOM   2820 C  CB    . ASP A 1 358 ? 43.385 8.922   -15.909 1.00 13.88 ? 355 ASP A CB    1 
ATOM   2821 C  CG    . ASP A 1 358 ? 43.950 7.535   -16.180 1.00 19.91 ? 355 ASP A CG    1 
ATOM   2822 O  OD1   . ASP A 1 358 ? 44.951 7.159   -15.537 1.00 18.32 ? 355 ASP A OD1   1 
ATOM   2823 O  OD2   . ASP A 1 358 ? 43.395 6.820   -17.035 1.00 19.82 ? 355 ASP A OD2   1 
ATOM   2824 N  N     . ARG A 1 359 ? 43.168 10.209  -18.809 1.00 12.69 ? 356 ARG A N     1 
ATOM   2825 C  CA    . ARG A 1 359 ? 43.132 10.031  -20.260 1.00 15.46 ? 356 ARG A CA    1 
ATOM   2826 C  C     . ARG A 1 359 ? 44.269 10.786  -20.946 1.00 14.52 ? 356 ARG A C     1 
ATOM   2827 O  O     . ARG A 1 359 ? 44.887 10.274  -21.886 1.00 16.01 ? 356 ARG A O     1 
ATOM   2828 C  CB    . ARG A 1 359 ? 41.785 10.489  -20.834 1.00 18.80 ? 356 ARG A CB    1 
ATOM   2829 C  CG    . ARG A 1 359 ? 41.569 10.141  -22.323 1.00 17.93 ? 356 ARG A CG    1 
ATOM   2830 C  CD    . ARG A 1 359 ? 40.169 10.568  -22.784 1.00 19.77 ? 356 ARG A CD    1 
ATOM   2831 N  NE    . ARG A 1 359 ? 39.993 12.020  -22.685 1.00 23.19 ? 356 ARG A NE    1 
ATOM   2832 C  CZ    . ARG A 1 359 ? 38.831 12.636  -22.464 1.00 28.40 ? 356 ARG A CZ    1 
ATOM   2833 N  NH1   . ARG A 1 359 ? 37.713 11.933  -22.319 1.00 30.49 ? 356 ARG A NH1   1 
ATOM   2834 N  NH2   . ARG A 1 359 ? 38.793 13.963  -22.395 1.00 23.46 ? 356 ARG A NH2   1 
ATOM   2835 N  N     . ASN A 1 360 ? 44.550 12.003  -20.484 1.00 14.38 ? 357 ASN A N     1 
ATOM   2836 C  CA    . ASN A 1 360 ? 45.618 12.811  -21.078 1.00 17.30 ? 357 ASN A CA    1 
ATOM   2837 C  C     . ASN A 1 360 ? 47.014 12.250  -20.812 1.00 23.41 ? 357 ASN A C     1 
ATOM   2838 O  O     . ASN A 1 360 ? 47.876 12.252  -21.696 1.00 22.15 ? 357 ASN A O     1 
ATOM   2839 C  CB    . ASN A 1 360 ? 45.558 14.254  -20.569 1.00 16.46 ? 357 ASN A CB    1 
ATOM   2840 C  CG    . ASN A 1 360 ? 44.451 15.053  -21.218 1.00 21.43 ? 357 ASN A CG    1 
ATOM   2841 O  OD1   . ASN A 1 360 ? 43.995 14.731  -22.318 1.00 28.57 ? 357 ASN A OD1   1 
ATOM   2842 N  ND2   . ASN A 1 360 ? 44.018 16.109  -20.545 1.00 24.09 ? 357 ASN A ND2   1 
ATOM   2843 N  N     . ASP A 1 361 ? 47.241 11.791  -19.584 1.00 17.27 ? 358 ASP A N     1 
ATOM   2844 C  CA    . ASP A 1 361 ? 48.566 11.327  -19.172 1.00 19.14 ? 358 ASP A CA    1 
ATOM   2845 C  C     . ASP A 1 361 ? 48.882 9.942   -19.700 1.00 15.91 ? 358 ASP A C     1 
ATOM   2846 O  O     . ASP A 1 361 ? 50.022 9.652   -20.062 1.00 16.60 ? 358 ASP A O     1 
ATOM   2847 C  CB    . ASP A 1 361 ? 48.676 11.282  -17.642 1.00 23.60 ? 358 ASP A CB    1 
ATOM   2848 C  CG    . ASP A 1 361 ? 48.780 12.656  -17.016 1.00 31.08 ? 358 ASP A CG    1 
ATOM   2849 O  OD1   . ASP A 1 361 ? 48.970 13.648  -17.757 1.00 26.42 ? 358 ASP A OD1   1 
ATOM   2850 O  OD2   . ASP A 1 361 ? 48.683 12.735  -15.772 1.00 34.25 ? 358 ASP A OD2   1 
ATOM   2851 N  N     . ASN A 1 362 ? 47.871 9.085   -19.726 1.00 16.85 ? 359 ASN A N     1 
ATOM   2852 C  CA    . ASN A 1 362 ? 48.103 7.652   -19.883 1.00 18.06 ? 359 ASN A CA    1 
ATOM   2853 C  C     . ASN A 1 362 ? 47.494 7.016   -21.127 1.00 15.98 ? 359 ASN A C     1 
ATOM   2854 O  O     . ASN A 1 362 ? 47.614 5.812   -21.322 1.00 19.96 ? 359 ASN A O     1 
ATOM   2855 C  CB    . ASN A 1 362 ? 47.657 6.905   -18.615 1.00 16.28 ? 359 ASN A CB    1 
ATOM   2856 C  CG    . ASN A 1 362 ? 48.417 7.365   -17.380 1.00 20.76 ? 359 ASN A CG    1 
ATOM   2857 O  OD1   . ASN A 1 362 ? 49.625 7.572   -17.431 1.00 17.04 ? 359 ASN A OD1   1 
ATOM   2858 N  ND2   . ASN A 1 362 ? 47.710 7.532   -16.268 1.00 15.08 ? 359 ASN A ND2   1 
ATOM   2859 N  N     . ASP A 1 363 ? 46.858 7.821   -21.974 1.00 18.14 ? 360 ASP A N     1 
ATOM   2860 C  CA    . ASP A 1 363 ? 46.339 7.332   -23.252 1.00 17.05 ? 360 ASP A CA    1 
ATOM   2861 C  C     . ASP A 1 363 ? 45.416 6.146   -23.102 1.00 22.38 ? 360 ASP A C     1 
ATOM   2862 O  O     . ASP A 1 363 ? 45.611 5.110   -23.746 1.00 23.54 ? 360 ASP A O     1 
ATOM   2863 C  CB    . ASP A 1 363 ? 47.486 6.934   -24.176 1.00 25.92 ? 360 ASP A CB    1 
ATOM   2864 C  CG    . ASP A 1 363 ? 48.371 8.102   -24.528 1.00 28.17 ? 360 ASP A CG    1 
ATOM   2865 O  OD1   . ASP A 1 363 ? 47.828 9.128   -24.992 1.00 25.71 ? 360 ASP A OD1   1 
ATOM   2866 O  OD2   . ASP A 1 363 ? 49.601 7.992   -24.329 1.00 37.50 ? 360 ASP A OD2   1 
ATOM   2867 N  N     . ARG A 1 364 ? 44.404 6.293   -22.256 1.00 18.79 ? 361 ARG A N     1 
ATOM   2868 C  CA    . ARG A 1 364 ? 43.424 5.238   -22.049 1.00 20.86 ? 361 ARG A CA    1 
ATOM   2869 C  C     . ARG A 1 364 ? 42.102 5.847   -21.609 1.00 20.31 ? 361 ARG A C     1 
ATOM   2870 O  O     . ARG A 1 364 ? 42.064 6.978   -21.123 1.00 21.64 ? 361 ARG A O     1 
ATOM   2871 C  CB    . ARG A 1 364 ? 43.924 4.246   -20.997 1.00 20.98 ? 361 ARG A CB    1 
ATOM   2872 C  CG    . ARG A 1 364 ? 44.237 4.881   -19.654 1.00 14.75 ? 361 ARG A CG    1 
ATOM   2873 C  CD    . ARG A 1 364 ? 44.714 3.840   -18.644 1.00 15.74 ? 361 ARG A CD    1 
ATOM   2874 N  NE    . ARG A 1 364 ? 44.772 4.384   -17.290 1.00 17.39 ? 361 ARG A NE    1 
ATOM   2875 C  CZ    . ARG A 1 364 ? 44.947 3.650   -16.193 1.00 24.66 ? 361 ARG A CZ    1 
ATOM   2876 N  NH1   . ARG A 1 364 ? 44.983 4.230   -14.992 1.00 16.25 ? 361 ARG A NH1   1 
ATOM   2877 N  NH2   . ARG A 1 364 ? 45.089 2.339   -16.291 1.00 22.85 ? 361 ARG A NH2   1 
ATOM   2878 N  N     . VAL A 1 365 ? 41.031 5.087   -21.787 1.00 15.72 ? 362 VAL A N     1 
ATOM   2879 C  CA    . VAL A 1 365 ? 39.687 5.506   -21.399 1.00 18.95 ? 362 VAL A CA    1 
ATOM   2880 C  C     . VAL A 1 365 ? 38.933 4.406   -20.648 1.00 23.08 ? 362 VAL A C     1 
ATOM   2881 O  O     . VAL A 1 365 ? 38.911 3.254   -21.075 1.00 19.26 ? 362 VAL A O     1 
ATOM   2882 C  CB    . VAL A 1 365 ? 38.864 5.904   -22.634 1.00 21.52 ? 362 VAL A CB    1 
ATOM   2883 C  CG1   . VAL A 1 365 ? 39.420 7.180   -23.242 1.00 31.83 ? 362 VAL A CG1   1 
ATOM   2884 C  CG2   . VAL A 1 365 ? 38.881 4.783   -23.667 1.00 31.97 ? 362 VAL A CG2   1 
ATOM   2885 N  N     . ALA A 1 366 ? 38.300 4.764   -19.535 1.00 15.16 ? 363 ALA A N     1 
ATOM   2886 C  CA    . ALA A 1 366 ? 37.485 3.813   -18.788 1.00 19.06 ? 363 ALA A CA    1 
ATOM   2887 C  C     . ALA A 1 366 ? 36.167 3.561   -19.522 1.00 17.56 ? 363 ALA A C     1 
ATOM   2888 O  O     . ALA A 1 366 ? 35.619 4.471   -20.145 1.00 24.29 ? 363 ALA A O     1 
ATOM   2889 C  CB    . ALA A 1 366 ? 37.218 4.351   -17.387 1.00 12.50 ? 363 ALA A CB    1 
ATOM   2890 N  N     . THR A 1 367 ? 35.645 2.340   -19.449 1.00 17.02 ? 364 THR A N     1 
ATOM   2891 C  CA    . THR A 1 367 ? 34.420 2.025   -20.177 1.00 18.45 ? 364 THR A CA    1 
ATOM   2892 C  C     . THR A 1 367 ? 33.270 1.536   -19.298 1.00 20.56 ? 364 THR A C     1 
ATOM   2893 O  O     . THR A 1 367 ? 32.157 1.327   -19.776 1.00 18.25 ? 364 THR A O     1 
ATOM   2894 C  CB    . THR A 1 367 ? 34.688 0.994   -21.291 1.00 21.03 ? 364 THR A CB    1 
ATOM   2895 O  OG1   . THR A 1 367 ? 35.060 -0.256  -20.704 1.00 22.52 ? 364 THR A OG1   1 
ATOM   2896 C  CG2   . THR A 1 367 ? 35.822 1.480   -22.180 1.00 20.05 ? 364 THR A CG2   1 
ATOM   2897 N  N     . GLN A 1 368 ? 33.537 1.353   -18.011 1.00 21.49 ? 365 GLN A N     1 
ATOM   2898 C  CA    . GLN A 1 368 ? 32.514 0.884   -17.099 1.00 20.20 ? 365 GLN A CA    1 
ATOM   2899 C  C     . GLN A 1 368 ? 32.500 1.751   -15.843 1.00 18.80 ? 365 GLN A C     1 
ATOM   2900 O  O     . GLN A 1 368 ? 33.546 2.145   -15.342 1.00 19.59 ? 365 GLN A O     1 
ATOM   2901 C  CB    . GLN A 1 368 ? 32.772 -0.569  -16.722 1.00 20.41 ? 365 GLN A CB    1 
ATOM   2902 C  CG    . GLN A 1 368 ? 31.654 -1.219  -15.944 1.00 25.96 ? 365 GLN A CG    1 
ATOM   2903 C  CD    . GLN A 1 368 ? 31.894 -2.701  -15.738 1.00 31.42 ? 365 GLN A CD    1 
ATOM   2904 O  OE1   . GLN A 1 368 ? 32.801 -3.098  -15.006 1.00 40.93 ? 365 GLN A OE1   1 
ATOM   2905 N  NE2   . GLN A 1 368 ? 31.092 -3.529  -16.396 1.00 33.64 ? 365 GLN A NE2   1 
ATOM   2906 N  N     . LEU A 1 369 ? 31.303 2.059   -15.364 1.00 17.63 ? 366 LEU A N     1 
ATOM   2907 C  CA    . LEU A 1 369 ? 31.138 2.780   -14.102 1.00 19.65 ? 366 LEU A CA    1 
ATOM   2908 C  C     . LEU A 1 369 ? 30.471 1.850   -13.093 1.00 18.10 ? 366 LEU A C     1 
ATOM   2909 O  O     . LEU A 1 369 ? 29.400 1.315   -13.352 1.00 24.92 ? 366 LEU A O     1 
ATOM   2910 C  CB    . LEU A 1 369 ? 30.287 4.035   -14.320 1.00 18.32 ? 366 LEU A CB    1 
ATOM   2911 C  CG    . LEU A 1 369 ? 29.965 4.860   -13.071 1.00 21.05 ? 366 LEU A CG    1 
ATOM   2912 C  CD1   . LEU A 1 369 ? 31.241 5.508   -12.560 1.00 19.52 ? 366 LEU A CD1   1 
ATOM   2913 C  CD2   . LEU A 1 369 ? 28.908 5.915   -13.371 1.00 29.02 ? 366 LEU A CD2   1 
ATOM   2914 N  N     . VAL A 1 370 ? 31.115 1.637   -11.951 1.00 15.85 ? 367 VAL A N     1 
ATOM   2915 C  CA    . VAL A 1 370 ? 30.571 0.777   -10.916 1.00 17.77 ? 367 VAL A CA    1 
ATOM   2916 C  C     . VAL A 1 370 ? 30.065 1.658   -9.785  1.00 19.03 ? 367 VAL A C     1 
ATOM   2917 O  O     . VAL A 1 370 ? 30.765 2.569   -9.360  1.00 18.91 ? 367 VAL A O     1 
ATOM   2918 C  CB    . VAL A 1 370 ? 31.652 -0.179  -10.378 1.00 17.91 ? 367 VAL A CB    1 
ATOM   2919 C  CG1   . VAL A 1 370 ? 31.150 -0.933  -9.155  1.00 24.42 ? 367 VAL A CG1   1 
ATOM   2920 C  CG2   . VAL A 1 370 ? 32.084 -1.142  -11.473 1.00 19.38 ? 367 VAL A CG2   1 
ATOM   2921 N  N     . VAL A 1 371 ? 28.848 1.398   -9.317  1.00 18.36 ? 368 VAL A N     1 
ATOM   2922 C  CA    . VAL A 1 371 ? 28.242 2.211   -8.265  1.00 18.52 ? 368 VAL A CA    1 
ATOM   2923 C  C     . VAL A 1 371 ? 27.954 1.332   -7.075  1.00 20.92 ? 368 VAL A C     1 
ATOM   2924 O  O     . VAL A 1 371 ? 27.321 0.293   -7.209  1.00 21.39 ? 368 VAL A O     1 
ATOM   2925 C  CB    . VAL A 1 371 ? 26.923 2.848   -8.737  1.00 21.14 ? 368 VAL A CB    1 
ATOM   2926 C  CG1   . VAL A 1 371 ? 26.364 3.800   -7.671  1.00 19.40 ? 368 VAL A CG1   1 
ATOM   2927 C  CG2   . VAL A 1 371 ? 27.132 3.565   -10.055 1.00 22.84 ? 368 VAL A CG2   1 
ATOM   2928 N  N     . SER A 1 372 ? 28.444 1.731   -5.908  1.00 15.53 ? 369 SER A N     1 
ATOM   2929 C  CA    . SER A 1 372 ? 28.272 0.918   -4.718  1.00 18.14 ? 369 SER A CA    1 
ATOM   2930 C  C     . SER A 1 372 ? 27.723 1.770   -3.591  1.00 17.13 ? 369 SER A C     1 
ATOM   2931 O  O     . SER A 1 372 ? 28.070 2.944   -3.462  1.00 17.96 ? 369 SER A O     1 
ATOM   2932 C  CB    . SER A 1 372 ? 29.603 0.288   -4.300  1.00 20.37 ? 369 SER A CB    1 
ATOM   2933 O  OG    . SER A 1 372 ? 29.461 -0.427  -3.088  1.00 29.06 ? 369 SER A OG    1 
ATOM   2934 N  N     . ILE A 1 373 ? 26.832 1.185   -2.803  1.00 17.74 ? 370 ILE A N     1 
ATOM   2935 C  CA    . ILE A 1 373 ? 26.320 1.861   -1.622  1.00 17.66 ? 370 ILE A CA    1 
ATOM   2936 C  C     . ILE A 1 373 ? 26.311 0.942   -0.406  1.00 19.34 ? 370 ILE A C     1 
ATOM   2937 O  O     . ILE A 1 373 ? 26.423 -0.283  -0.519  1.00 20.00 ? 370 ILE A O     1 
ATOM   2938 C  CB    . ILE A 1 373 ? 24.897 2.435   -1.845  1.00 20.41 ? 370 ILE A CB    1 
ATOM   2939 C  CG1   . ILE A 1 373 ? 23.880 1.302   -1.993  1.00 27.92 ? 370 ILE A CG1   1 
ATOM   2940 C  CG2   . ILE A 1 373 ? 24.871 3.404   -3.052  1.00 15.97 ? 370 ILE A CG2   1 
ATOM   2941 C  CD1   . ILE A 1 373 ? 22.452 1.787   -2.175  1.00 33.60 ? 370 ILE A CD1   1 
ATOM   2942 N  N     . ARG A 1 374 ? 26.196 1.551   0.769   1.00 21.21 ? 371 ARG A N     1 
ATOM   2943 C  CA    . ARG A 1 374 ? 25.956 0.802   1.990   1.00 24.45 ? 371 ARG A CA    1 
ATOM   2944 C  C     . ARG A 1 374 ? 24.700 1.378   2.626   1.00 29.00 ? 371 ARG A C     1 
ATOM   2945 O  O     . ARG A 1 374 ? 24.445 2.580   2.530   1.00 23.82 ? 371 ARG A O     1 
ATOM   2946 C  CB    . ARG A 1 374 ? 27.148 0.906   2.936   1.00 26.20 ? 371 ARG A CB    1 
ATOM   2947 C  CG    . ARG A 1 374 ? 27.137 -0.104  4.070   1.00 31.23 ? 371 ARG A CG    1 
ATOM   2948 C  CD    . ARG A 1 374 ? 28.211 0.228   5.081   1.00 39.34 ? 371 ARG A CD    1 
ATOM   2949 N  NE    . ARG A 1 374 ? 28.257 -0.731  6.179   1.00 49.97 ? 371 ARG A NE    1 
ATOM   2950 C  CZ    . ARG A 1 374 ? 28.962 -0.549  7.289   1.00 53.35 ? 371 ARG A CZ    1 
ATOM   2951 N  NH1   . ARG A 1 374 ? 29.668 0.564   7.450   1.00 49.71 ? 371 ARG A NH1   1 
ATOM   2952 N  NH2   . ARG A 1 374 ? 28.954 -1.472  8.242   1.00 63.15 ? 371 ARG A NH2   1 
ATOM   2953 N  N     . VAL A 1 375 ? 23.894 0.510   3.228   1.00 31.89 ? 372 VAL A N     1 
ATOM   2954 C  CA    . VAL A 1 375 ? 22.673 0.938   3.900   1.00 33.54 ? 372 VAL A CA    1 
ATOM   2955 C  C     . VAL A 1 375 ? 22.855 0.850   5.411   1.00 27.44 ? 372 VAL A C     1 
ATOM   2956 O  O     . VAL A 1 375 ? 23.609 0.010   5.909   1.00 26.63 ? 372 VAL A O     1 
ATOM   2957 C  CB    . VAL A 1 375 ? 21.468 0.084   3.478   1.00 38.48 ? 372 VAL A CB    1 
ATOM   2958 C  CG1   . VAL A 1 375 ? 21.069 0.405   2.048   1.00 39.14 ? 372 VAL A CG1   1 
ATOM   2959 C  CG2   . VAL A 1 375 ? 21.791 -1.390  3.637   1.00 44.10 ? 372 VAL A CG2   1 
ATOM   2960 N  N     . GLN A 1 376 ? 22.178 1.725   6.143   1.00 34.00 ? 373 GLN A N     1 
ATOM   2961 C  CA    . GLN A 1 376 ? 22.329 1.736   7.591   1.00 41.20 ? 373 GLN A CA    1 
ATOM   2962 C  C     . GLN A 1 376 ? 21.817 0.437   8.200   1.00 38.70 ? 373 GLN A C     1 
ATOM   2963 O  O     . GLN A 1 376 ? 20.684 0.034   7.958   1.00 43.19 ? 373 GLN A O     1 
ATOM   2964 C  CB    . GLN A 1 376 ? 21.616 2.938   8.204   1.00 35.89 ? 373 GLN A CB    1 
ATOM   2965 C  CG    . GLN A 1 376 ? 22.148 3.316   9.578   1.00 43.11 ? 373 GLN A CG    1 
ATOM   2966 C  CD    . GLN A 1 376 ? 21.898 4.771   9.909   1.00 51.43 ? 373 GLN A CD    1 
ATOM   2967 O  OE1   . GLN A 1 376 ? 20.767 5.252   9.816   1.00 41.54 ? 373 GLN A OE1   1 
ATOM   2968 N  NE2   . GLN A 1 376 ? 22.958 5.489   10.280  1.00 49.68 ? 373 GLN A NE2   1 
ATOM   2969 N  N     . GLY A 1 377 ? 22.666 -0.220  8.981   1.00 43.02 ? 374 GLY A N     1 
ATOM   2970 C  CA    . GLY A 1 377 ? 22.305 -1.480  9.601   1.00 52.60 ? 374 GLY A CA    1 
ATOM   2971 C  C     . GLY A 1 377 ? 23.170 -2.632  9.122   1.00 55.94 ? 374 GLY A C     1 
ATOM   2972 O  O     . GLY A 1 377 ? 23.465 -3.558  9.878   1.00 47.92 ? 374 GLY A O     1 
ATOM   2973 N  N     . ASP A 1 378 ? 23.585 -2.571  7.861   1.00 51.05 ? 375 ASP A N     1 
ATOM   2974 C  CA    . ASP A 1 378 ? 24.384 -3.635  7.269   1.00 44.88 ? 375 ASP A CA    1 
ATOM   2975 C  C     . ASP A 1 378 ? 25.805 -3.644  7.831   1.00 51.83 ? 375 ASP A C     1 
ATOM   2976 O  O     . ASP A 1 378 ? 26.508 -2.635  7.775   1.00 54.01 ? 375 ASP A O     1 
ATOM   2977 C  CB    . ASP A 1 378 ? 24.422 -3.476  5.750   1.00 44.38 ? 375 ASP A CB    1 
ATOM   2978 C  CG    . ASP A 1 378 ? 24.917 -4.721  5.047   1.00 47.66 ? 375 ASP A CG    1 
ATOM   2979 O  OD1   . ASP A 1 378 ? 25.671 -5.504  5.667   1.00 43.25 ? 375 ASP A OD1   1 
ATOM   2980 O  OD2   . ASP A 1 378 ? 24.544 -4.914  3.872   1.00 44.92 ? 375 ASP A OD2   1 
ATOM   2981 N  N     . LYS A 1 379 ? 26.228 -4.784  8.370   1.00 53.56 ? 376 LYS A N     1 
ATOM   2982 C  CA    . LYS A 1 379 ? 27.573 -4.899  8.929   1.00 60.78 ? 376 LYS A CA    1 
ATOM   2983 C  C     . LYS A 1 379 ? 28.635 -4.925  7.831   1.00 62.30 ? 376 LYS A C     1 
ATOM   2984 O  O     . LYS A 1 379 ? 29.809 -4.639  8.078   1.00 60.47 ? 376 LYS A O     1 
ATOM   2985 C  CB    . LYS A 1 379 ? 27.698 -6.144  9.814   1.00 61.01 ? 376 LYS A CB    1 
ATOM   2986 C  CG    . LYS A 1 379 ? 29.089 -6.330  10.414  1.00 65.18 ? 376 LYS A CG    1 
ATOM   2987 C  CD    . LYS A 1 379 ? 29.194 -7.614  11.224  1.00 66.73 ? 376 LYS A CD    1 
ATOM   2988 C  CE    . LYS A 1 379 ? 30.625 -7.856  11.691  1.00 69.36 ? 376 LYS A CE    1 
ATOM   2989 N  NZ    . LYS A 1 379 ? 31.580 -7.974  10.549  1.00 67.68 ? 376 LYS A NZ    1 
ATOM   2990 N  N     . ARG A 1 380 ? 28.214 -5.268  6.617   1.00 58.66 ? 377 ARG A N     1 
ATOM   2991 C  CA    . ARG A 1 380 ? 29.123 -5.343  5.477   1.00 57.87 ? 377 ARG A CA    1 
ATOM   2992 C  C     . ARG A 1 380 ? 29.507 -3.958  4.970   1.00 55.75 ? 377 ARG A C     1 
ATOM   2993 O  O     . ARG A 1 380 ? 28.678 -3.048  4.947   1.00 55.68 ? 377 ARG A O     1 
ATOM   2994 C  CB    . ARG A 1 380 ? 28.481 -6.142  4.345   1.00 54.05 ? 377 ARG A CB    1 
ATOM   2995 C  CG    . ARG A 1 380 ? 28.132 -7.570  4.718   1.00 54.23 ? 377 ARG A CG    1 
ATOM   2996 C  CD    . ARG A 1 380 ? 27.330 -8.219  3.612   1.00 49.44 ? 377 ARG A CD    1 
ATOM   2997 N  NE    . ARG A 1 380 ? 26.116 -7.466  3.319   1.00 45.09 ? 377 ARG A NE    1 
ATOM   2998 C  CZ    . ARG A 1 380 ? 25.332 -7.707  2.276   1.00 43.07 ? 377 ARG A CZ    1 
ATOM   2999 N  NH1   . ARG A 1 380 ? 25.643 -8.679  1.431   1.00 41.13 ? 377 ARG A NH1   1 
ATOM   3000 N  NH2   . ARG A 1 380 ? 24.241 -6.980  2.076   1.00 39.13 ? 377 ARG A NH2   1 
ATOM   3001 N  N     . LEU A 1 381 ? 30.763 -3.804  4.559   1.00 54.15 ? 378 LEU A N     1 
ATOM   3002 C  CA    . LEU A 1 381 ? 31.239 -2.527  4.040   1.00 49.66 ? 378 LEU A CA    1 
ATOM   3003 C  C     . LEU A 1 381 ? 30.448 -2.078  2.813   1.00 52.03 ? 378 LEU A C     1 
ATOM   3004 O  O     . LEU A 1 381 ? 30.015 -0.930  2.736   1.00 50.93 ? 378 LEU A O     1 
ATOM   3005 C  CB    . LEU A 1 381 ? 32.737 -2.574  3.738   1.00 55.59 ? 378 LEU A CB    1 
ATOM   3006 C  CG    . LEU A 1 381 ? 33.658 -2.173  4.896   1.00 57.59 ? 378 LEU A CG    1 
ATOM   3007 C  CD1   . LEU A 1 381 ? 33.483 -3.110  6.085   1.00 56.85 ? 378 LEU A CD1   1 
ATOM   3008 C  CD2   . LEU A 1 381 ? 35.115 -2.133  4.446   1.00 60.17 ? 378 LEU A CD2   1 
ATOM   3009 N  N     . SER A 1 382 ? 30.261 -2.973  1.851   1.00 50.14 ? 379 SER A N     1 
ATOM   3010 C  CA    . SER A 1 382 ? 29.390 -2.663  0.721   1.00 44.87 ? 379 SER A CA    1 
ATOM   3011 C  C     . SER A 1 382 ? 28.120 -3.481  0.794   1.00 34.32 ? 379 SER A C     1 
ATOM   3012 O  O     . SER A 1 382 ? 28.160 -4.678  1.075   1.00 39.07 ? 379 SER A O     1 
ATOM   3013 C  CB    . SER A 1 382 ? 30.077 -2.922  -0.616  1.00 42.19 ? 379 SER A CB    1 
ATOM   3014 O  OG    . SER A 1 382 ? 29.112 -2.941  -1.660  1.00 40.38 ? 379 SER A OG    1 
ATOM   3015 N  N     . SER A 1 383 ? 26.994 -2.833  0.523   1.00 37.31 ? 380 SER A N     1 
ATOM   3016 C  CA    . SER A 1 383 ? 25.701 -3.499  0.578   1.00 33.08 ? 380 SER A CA    1 
ATOM   3017 C  C     . SER A 1 383 ? 25.225 -3.915  -0.806  1.00 43.92 ? 380 SER A C     1 
ATOM   3018 O  O     . SER A 1 383 ? 24.570 -4.946  -0.959  1.00 36.03 ? 380 SER A O     1 
ATOM   3019 C  CB    . SER A 1 383 ? 24.652 -2.589  1.232   1.00 41.72 ? 380 SER A CB    1 
ATOM   3020 O  OG    . SER A 1 383 ? 24.961 -2.334  2.593   1.00 37.00 ? 380 SER A OG    1 
ATOM   3021 N  N     . LEU A 1 384 ? 25.557 -3.111  -1.811  1.00 37.91 ? 381 LEU A N     1 
ATOM   3022 C  CA    . LEU A 1 384 ? 25.043 -3.323  -3.160  1.00 31.41 ? 381 LEU A CA    1 
ATOM   3023 C  C     . LEU A 1 384 ? 25.927 -2.673  -4.215  1.00 35.82 ? 381 LEU A C     1 
ATOM   3024 O  O     . LEU A 1 384 ? 26.317 -1.512  -4.084  1.00 25.61 ? 381 LEU A O     1 
ATOM   3025 C  CB    . LEU A 1 384 ? 23.624 -2.772  -3.281  1.00 35.10 ? 381 LEU A CB    1 
ATOM   3026 C  CG    . LEU A 1 384 ? 23.035 -2.785  -4.695  1.00 30.56 ? 381 LEU A CG    1 
ATOM   3027 C  CD1   . LEU A 1 384 ? 21.591 -3.259  -4.676  1.00 43.71 ? 381 LEU A CD1   1 
ATOM   3028 C  CD2   . LEU A 1 384 ? 23.141 -1.420  -5.353  1.00 34.33 ? 381 LEU A CD2   1 
ATOM   3029 N  N     . ARG A 1 385 ? 26.216 -3.424  -5.273  1.00 25.82 ? 382 ARG A N     1 
ATOM   3030 C  CA    . ARG A 1 385 ? 27.104 -2.959  -6.325  1.00 23.23 ? 382 ARG A CA    1 
ATOM   3031 C  C     . ARG A 1 385 ? 26.441 -3.213  -7.672  1.00 28.69 ? 382 ARG A C     1 
ATOM   3032 O  O     . ARG A 1 385 ? 26.003 -4.326  -7.954  1.00 30.03 ? 382 ARG A O     1 
ATOM   3033 C  CB    . ARG A 1 385 ? 28.430 -3.717  -6.252  1.00 30.36 ? 382 ARG A CB    1 
ATOM   3034 C  CG    . ARG A 1 385 ? 29.652 -2.896  -6.619  1.00 41.96 ? 382 ARG A CG    1 
ATOM   3035 C  CD    . ARG A 1 385 ? 30.694 -3.753  -7.322  1.00 49.02 ? 382 ARG A CD    1 
ATOM   3036 N  NE    . ARG A 1 385 ? 30.165 -4.310  -8.564  1.00 50.23 ? 382 ARG A NE    1 
ATOM   3037 C  CZ    . ARG A 1 385 ? 30.903 -4.864  -9.522  1.00 41.30 ? 382 ARG A CZ    1 
ATOM   3038 N  NH1   . ARG A 1 385 ? 30.317 -5.338  -10.612 1.00 38.73 ? 382 ARG A NH1   1 
ATOM   3039 N  NH2   . ARG A 1 385 ? 32.223 -4.940  -9.397  1.00 46.31 ? 382 ARG A NH2   1 
ATOM   3040 N  N     . ARG A 1 386 ? 26.352 -2.176  -8.493  1.00 18.47 ? 383 ARG A N     1 
ATOM   3041 C  CA    . ARG A 1 386 ? 25.763 -2.294  -9.820  1.00 24.42 ? 383 ARG A CA    1 
ATOM   3042 C  C     . ARG A 1 386 ? 26.644 -1.571  -10.829 1.00 24.19 ? 383 ARG A C     1 
ATOM   3043 O  O     . ARG A 1 386 ? 27.243 -0.550  -10.514 1.00 19.03 ? 383 ARG A O     1 
ATOM   3044 C  CB    . ARG A 1 386 ? 24.370 -1.675  -9.831  1.00 27.51 ? 383 ARG A CB    1 
ATOM   3045 C  CG    . ARG A 1 386 ? 23.366 -2.374  -8.945  1.00 27.81 ? 383 ARG A CG    1 
ATOM   3046 C  CD    . ARG A 1 386 ? 22.795 -3.592  -9.634  1.00 24.90 ? 383 ARG A CD    1 
ATOM   3047 N  NE    . ARG A 1 386 ? 21.711 -4.195  -8.869  1.00 24.12 ? 383 ARG A NE    1 
ATOM   3048 C  CZ    . ARG A 1 386 ? 21.890 -5.074  -7.889  1.00 37.64 ? 383 ARG A CZ    1 
ATOM   3049 N  NH1   . ARG A 1 386 ? 23.117 -5.449  -7.548  1.00 30.19 ? 383 ARG A NH1   1 
ATOM   3050 N  NH2   . ARG A 1 386 ? 20.841 -5.579  -7.250  1.00 43.18 ? 383 ARG A NH2   1 
ATOM   3051 N  N     . CYS A 1 387 ? 26.730 -2.093  -12.045 1.00 25.96 ? 384 CYS A N     1 
ATOM   3052 C  CA    . CYS A 1 387 ? 27.494 -1.405  -13.078 1.00 27.92 ? 384 CYS A CA    1 
ATOM   3053 C  C     . CYS A 1 387 ? 26.605 -0.812  -14.160 1.00 27.67 ? 384 CYS A C     1 
ATOM   3054 O  O     . CYS A 1 387 ? 25.474 -1.247  -14.361 1.00 29.41 ? 384 CYS A O     1 
ATOM   3055 C  CB    . CYS A 1 387 ? 28.519 -2.345  -13.717 1.00 29.52 ? 384 CYS A CB    1 
ATOM   3056 S  SG    A CYS A 1 387 ? 27.823 -3.800  -14.537 0.50 28.98 ? 384 CYS A SG    1 
ATOM   3057 S  SG    B CYS A 1 387 ? 29.606 -3.129  -12.548 0.50 35.19 ? 384 CYS A SG    1 
ATOM   3058 N  N     . CYS A 1 388 ? 27.133 0.183   -14.860 1.00 28.70 ? 385 CYS A N     1 
ATOM   3059 C  CA    . CYS A 1 388 ? 26.500 0.692   -16.069 1.00 34.93 ? 385 CYS A CA    1 
ATOM   3060 C  C     . CYS A 1 388 ? 27.588 1.167   -17.023 1.00 32.99 ? 385 CYS A C     1 
ATOM   3061 O  O     . CYS A 1 388 ? 28.762 1.203   -16.660 1.00 29.32 ? 385 CYS A O     1 
ATOM   3062 C  CB    . CYS A 1 388 ? 25.524 1.824   -15.747 1.00 31.46 ? 385 CYS A CB    1 
ATOM   3063 S  SG    . CYS A 1 388 ? 26.298 3.324   -15.120 1.00 36.35 ? 385 CYS A SG    1 
ATOM   3064 N  N     . ALA A 1 389 ? 27.207 1.523   -18.245 1.00 29.76 ? 386 ALA A N     1 
ATOM   3065 C  CA    . ALA A 1 389 ? 28.196 1.948   -19.228 1.00 26.28 ? 386 ALA A CA    1 
ATOM   3066 C  C     . ALA A 1 389 ? 28.751 3.329   -18.909 1.00 25.70 ? 386 ALA A C     1 
ATOM   3067 O  O     . ALA A 1 389 ? 28.010 4.243   -18.539 1.00 32.98 ? 386 ALA A O     1 
ATOM   3068 C  CB    . ALA A 1 389 ? 27.605 1.928   -20.632 1.00 27.99 ? 386 ALA A CB    1 
ATOM   3069 N  N     . LEU A 1 390 ? 30.062 3.473   -19.043 1.00 22.04 ? 387 LEU A N     1 
ATOM   3070 C  CA    . LEU A 1 390 ? 30.698 4.781   -18.951 1.00 23.89 ? 387 LEU A CA    1 
ATOM   3071 C  C     . LEU A 1 390 ? 31.094 5.218   -20.356 1.00 28.58 ? 387 LEU A C     1 
ATOM   3072 O  O     . LEU A 1 390 ? 32.154 4.832   -20.855 1.00 27.35 ? 387 LEU A O     1 
ATOM   3073 C  CB    . LEU A 1 390 ? 31.940 4.703   -18.062 1.00 23.03 ? 387 LEU A CB    1 
ATOM   3074 C  CG    . LEU A 1 390 ? 32.381 5.957   -17.303 1.00 20.46 ? 387 LEU A CG    1 
ATOM   3075 C  CD1   . LEU A 1 390 ? 33.592 5.611   -16.446 1.00 18.67 ? 387 LEU A CD1   1 
ATOM   3076 C  CD2   . LEU A 1 390 ? 32.706 7.102   -18.230 1.00 23.46 ? 387 LEU A CD2   1 
ATOM   3077 N  N     . THR A 1 391 ? 30.246 6.022   -20.993 1.00 20.74 ? 388 THR A N     1 
ATOM   3078 C  CA    . THR A 1 391 ? 30.463 6.405   -22.387 1.00 28.36 ? 388 THR A CA    1 
ATOM   3079 C  C     . THR A 1 391 ? 31.012 7.820   -22.569 1.00 31.70 ? 388 THR A C     1 
ATOM   3080 O  O     . THR A 1 391 ? 31.573 8.143   -23.615 1.00 30.19 ? 388 THR A O     1 
ATOM   3081 C  CB    . THR A 1 391 ? 29.168 6.261   -23.210 1.00 34.29 ? 388 THR A CB    1 
ATOM   3082 O  OG1   . THR A 1 391 ? 28.157 7.121   -22.669 1.00 32.83 ? 388 THR A OG1   1 
ATOM   3083 C  CG2   . THR A 1 391 ? 28.672 4.823   -23.176 1.00 27.78 ? 388 THR A CG2   1 
ATOM   3084 N  N     . ARG A 1 392 ? 30.839 8.665   -21.557 1.00 26.18 ? 389 ARG A N     1 
ATOM   3085 C  CA    . ARG A 1 392 ? 31.345 10.026  -21.605 1.00 27.44 ? 389 ARG A CA    1 
ATOM   3086 C  C     . ARG A 1 392 ? 31.874 10.474  -20.242 1.00 22.62 ? 389 ARG A C     1 
ATOM   3087 O  O     . ARG A 1 392 ? 31.259 10.211  -19.211 1.00 25.82 ? 389 ARG A O     1 
ATOM   3088 C  CB    . ARG A 1 392 ? 30.254 10.994  -22.079 1.00 32.41 ? 389 ARG A CB    1 
ATOM   3089 C  CG    . ARG A 1 392 ? 29.807 10.780  -23.518 1.00 36.99 ? 389 ARG A CG    1 
ATOM   3090 C  CD    . ARG A 1 392 ? 28.732 11.783  -23.922 1.00 51.09 ? 389 ARG A CD    1 
ATOM   3091 N  NE    . ARG A 1 392 ? 29.176 13.161  -23.725 1.00 54.57 ? 389 ARG A NE    1 
ATOM   3092 C  CZ    . ARG A 1 392 ? 28.837 13.918  -22.685 1.00 63.00 ? 389 ARG A CZ    1 
ATOM   3093 N  NH1   . ARG A 1 392 ? 29.293 15.162  -22.588 1.00 55.69 ? 389 ARG A NH1   1 
ATOM   3094 N  NH2   . ARG A 1 392 ? 28.038 13.434  -21.742 1.00 59.18 ? 389 ARG A NH2   1 
ATOM   3095 N  N     . TYR A 1 393 ? 33.018 11.145  -20.256 1.00 19.73 ? 390 TYR A N     1 
ATOM   3096 C  CA    . TYR A 1 393 ? 33.582 11.741  -19.051 1.00 23.82 ? 390 TYR A CA    1 
ATOM   3097 C  C     . TYR A 1 393 ? 32.826 13.028  -18.721 1.00 26.60 ? 390 TYR A C     1 
ATOM   3098 O  O     . TYR A 1 393 ? 33.312 14.137  -18.977 1.00 21.70 ? 390 TYR A O     1 
ATOM   3099 C  CB    . TYR A 1 393 ? 35.076 12.027  -19.243 1.00 21.71 ? 390 TYR A CB    1 
ATOM   3100 C  CG    . TYR A 1 393 ? 35.980 10.804  -19.185 1.00 14.95 ? 390 TYR A CG    1 
ATOM   3101 C  CD1   . TYR A 1 393 ? 37.361 10.937  -19.243 1.00 15.53 ? 390 TYR A CD1   1 
ATOM   3102 C  CD2   . TYR A 1 393 ? 35.448 9.524   -19.069 1.00 21.96 ? 390 TYR A CD2   1 
ATOM   3103 C  CE1   . TYR A 1 393 ? 38.194 9.816   -19.181 1.00 14.37 ? 390 TYR A CE1   1 
ATOM   3104 C  CE2   . TYR A 1 393 ? 36.271 8.401   -19.007 1.00 21.70 ? 390 TYR A CE2   1 
ATOM   3105 C  CZ    . TYR A 1 393 ? 37.639 8.556   -19.065 1.00 18.49 ? 390 TYR A CZ    1 
ATOM   3106 O  OH    . TYR A 1 393 ? 38.454 7.444   -18.994 1.00 18.26 ? 390 TYR A OH    1 
ATOM   3107 N  N     . ASP A 1 394 ? 31.629 12.871  -18.164 1.00 26.40 ? 391 ASP A N     1 
ATOM   3108 C  CA    . ASP A 1 394 ? 30.786 14.004  -17.802 1.00 24.39 ? 391 ASP A CA    1 
ATOM   3109 C  C     . ASP A 1 394 ? 30.116 13.717  -16.466 1.00 15.51 ? 391 ASP A C     1 
ATOM   3110 O  O     . ASP A 1 394 ? 29.377 12.743  -16.335 1.00 20.88 ? 391 ASP A O     1 
ATOM   3111 C  CB    . ASP A 1 394 ? 29.732 14.249  -18.885 1.00 27.28 ? 391 ASP A CB    1 
ATOM   3112 C  CG    . ASP A 1 394 ? 28.867 15.460  -18.589 1.00 33.27 ? 391 ASP A CG    1 
ATOM   3113 O  OD1   . ASP A 1 394 ? 27.850 15.305  -17.882 1.00 33.57 ? 391 ASP A OD1   1 
ATOM   3114 O  OD2   . ASP A 1 394 ? 29.208 16.566  -19.057 1.00 50.19 ? 391 ASP A OD2   1 
ATOM   3115 N  N     . ALA A 1 395 ? 30.396 14.561  -15.475 1.00 18.60 ? 392 ALA A N     1 
ATOM   3116 C  CA    . ALA A 1 395 ? 29.980 14.295  -14.095 1.00 20.56 ? 392 ALA A CA    1 
ATOM   3117 C  C     . ALA A 1 395 ? 28.464 14.247  -13.908 1.00 17.34 ? 392 ALA A C     1 
ATOM   3118 O  O     . ALA A 1 395 ? 27.951 13.404  -13.176 1.00 19.43 ? 392 ALA A O     1 
ATOM   3119 C  CB    . ALA A 1 395 ? 30.617 15.315  -13.134 1.00 18.59 ? 392 ALA A CB    1 
ATOM   3120 N  N     . HIS A 1 396 ? 27.748 15.155  -14.563 1.00 19.42 ? 393 HIS A N     1 
ATOM   3121 C  CA    . HIS A 1 396 ? 26.293 15.178  -14.460 1.00 24.09 ? 393 HIS A CA    1 
ATOM   3122 C  C     . HIS A 1 396 ? 25.692 13.898  -15.023 1.00 16.41 ? 393 HIS A C     1 
ATOM   3123 O  O     . HIS A 1 396 ? 24.783 13.312  -14.433 1.00 22.35 ? 393 HIS A O     1 
ATOM   3124 C  CB    . HIS A 1 396 ? 25.716 16.428  -15.145 1.00 24.58 ? 393 HIS A CB    1 
ATOM   3125 C  CG    . HIS A 1 396 ? 26.021 17.703  -14.418 1.00 31.95 ? 393 HIS A CG    1 
ATOM   3126 N  ND1   . HIS A 1 396 ? 27.151 18.455  -14.668 1.00 43.68 ? 393 HIS A ND1   1 
ATOM   3127 C  CD2   . HIS A 1 396 ? 25.357 18.347  -13.428 1.00 38.16 ? 393 HIS A CD2   1 
ATOM   3128 C  CE1   . HIS A 1 396 ? 27.164 19.508  -13.873 1.00 36.40 ? 393 HIS A CE1   1 
ATOM   3129 N  NE2   . HIS A 1 396 ? 26.086 19.467  -13.108 1.00 35.77 ? 393 HIS A NE2   1 
ATOM   3130 N  N     . LYS A 1 397 ? 26.215 13.447  -16.159 1.00 20.98 ? 394 LYS A N     1 
ATOM   3131 C  CA    . LYS A 1 397 ? 25.775 12.175  -16.719 1.00 20.10 ? 394 LYS A CA    1 
ATOM   3132 C  C     . LYS A 1 397 ? 26.110 10.985  -15.827 1.00 19.11 ? 394 LYS A C     1 
ATOM   3133 O  O     . LYS A 1 397 ? 25.273 10.116  -15.595 1.00 25.45 ? 394 LYS A O     1 
ATOM   3134 C  CB    . LYS A 1 397 ? 26.351 11.942  -18.114 1.00 26.45 ? 394 LYS A CB    1 
ATOM   3135 C  CG    . LYS A 1 397 ? 26.060 10.536  -18.621 1.00 30.38 ? 394 LYS A CG    1 
ATOM   3136 C  CD    . LYS A 1 397 ? 26.378 10.370  -20.097 1.00 37.63 ? 394 LYS A CD    1 
ATOM   3137 C  CE    . LYS A 1 397 ? 26.155 8.926   -20.537 1.00 39.17 ? 394 LYS A CE    1 
ATOM   3138 N  NZ    . LYS A 1 397 ? 24.825 8.392   -20.115 1.00 42.68 ? 394 LYS A NZ    1 
ATOM   3139 N  N     . MET A 1 398 ? 27.347 10.933  -15.343 1.00 20.01 ? 395 MET A N     1 
ATOM   3140 C  CA    . MET A 1 398 ? 27.741 9.844   -14.465 1.00 21.42 ? 395 MET A CA    1 
ATOM   3141 C  C     . MET A 1 398 ? 26.886 9.785   -13.195 1.00 19.38 ? 395 MET A C     1 
ATOM   3142 O  O     . MET A 1 398 ? 26.505 8.705   -12.754 1.00 20.47 ? 395 MET A O     1 
ATOM   3143 C  CB    . MET A 1 398 ? 29.231 9.934   -14.131 1.00 17.64 ? 395 MET A CB    1 
ATOM   3144 C  CG    . MET A 1 398 ? 30.106 9.551   -15.298 1.00 15.86 ? 395 MET A CG    1 
ATOM   3145 S  SD    . MET A 1 398 ? 31.836 9.384   -14.845 1.00 28.41 ? 395 MET A SD    1 
ATOM   3146 C  CE    . MET A 1 398 ? 32.307 11.113  -14.801 1.00 18.15 ? 395 MET A CE    1 
ATOM   3147 N  N     . SER A 1 399 ? 26.573 10.943  -12.620 1.00 20.34 ? 396 SER A N     1 
ATOM   3148 C  CA    . SER A 1 399 ? 25.816 10.964  -11.370 1.00 19.48 ? 396 SER A CA    1 
ATOM   3149 C  C     . SER A 1 399 ? 24.353 10.612  -11.620 1.00 17.61 ? 396 SER A C     1 
ATOM   3150 O  O     . SER A 1 399 ? 23.715 9.954   -10.800 1.00 21.03 ? 396 SER A O     1 
ATOM   3151 C  CB    . SER A 1 399 ? 25.945 12.314  -10.660 1.00 22.77 ? 396 SER A CB    1 
ATOM   3152 O  OG    . SER A 1 399 ? 25.454 13.381  -11.455 1.00 23.78 ? 396 SER A OG    1 
ATOM   3153 N  N     . HIS A 1 400 ? 23.833 11.043  -12.762 1.00 21.16 ? 397 HIS A N     1 
ATOM   3154 C  CA    . HIS A 1 400 ? 22.473 10.688  -13.144 1.00 26.97 ? 397 HIS A CA    1 
ATOM   3155 C  C     . HIS A 1 400 ? 22.391 9.183   -13.381 1.00 24.08 ? 397 HIS A C     1 
ATOM   3156 O  O     . HIS A 1 400 ? 21.465 8.515   -12.919 1.00 25.16 ? 397 HIS A O     1 
ATOM   3157 C  CB    . HIS A 1 400 ? 22.045 11.454  -14.396 1.00 32.28 ? 397 HIS A CB    1 
ATOM   3158 C  CG    . HIS A 1 400 ? 20.628 11.191  -14.804 1.00 43.47 ? 397 HIS A CG    1 
ATOM   3159 N  ND1   . HIS A 1 400 ? 20.262 10.094  -15.555 1.00 44.84 ? 397 HIS A ND1   1 
ATOM   3160 C  CD2   . HIS A 1 400 ? 19.487 11.874  -14.556 1.00 45.26 ? 397 HIS A CD2   1 
ATOM   3161 C  CE1   . HIS A 1 400 ? 18.957 10.116  -15.755 1.00 47.36 ? 397 HIS A CE1   1 
ATOM   3162 N  NE2   . HIS A 1 400 ? 18.462 11.186  -15.160 1.00 53.83 ? 397 HIS A NE2   1 
ATOM   3163 N  N     . ASP A 1 401 ? 23.383 8.648   -14.087 1.00 23.88 ? 398 ASP A N     1 
ATOM   3164 C  CA    . ASP A 1 401 ? 23.439 7.216   -14.337 1.00 21.20 ? 398 ASP A CA    1 
ATOM   3165 C  C     . ASP A 1 401 ? 23.576 6.407   -13.050 1.00 22.90 ? 398 ASP A C     1 
ATOM   3166 O  O     . ASP A 1 401 ? 22.958 5.359   -12.903 1.00 22.87 ? 398 ASP A O     1 
ATOM   3167 C  CB    . ASP A 1 401 ? 24.575 6.880   -15.299 1.00 19.11 ? 398 ASP A CB    1 
ATOM   3168 C  CG    . ASP A 1 401 ? 24.318 7.388   -16.710 1.00 35.83 ? 398 ASP A CG    1 
ATOM   3169 O  OD1   . ASP A 1 401 ? 23.164 7.776   -17.019 1.00 29.63 ? 398 ASP A OD1   1 
ATOM   3170 O  OD2   . ASP A 1 401 ? 25.271 7.392   -17.517 1.00 34.16 ? 398 ASP A OD2   1 
ATOM   3171 N  N     . ALA A 1 402 ? 24.390 6.893   -12.114 1.00 21.44 ? 399 ALA A N     1 
ATOM   3172 C  CA    . ALA A 1 402 ? 24.566 6.201   -10.843 1.00 18.26 ? 399 ALA A CA    1 
ATOM   3173 C  C     . ALA A 1 402 ? 23.255 6.157   -10.065 1.00 17.47 ? 399 ALA A C     1 
ATOM   3174 O  O     . ALA A 1 402 ? 22.906 5.134   -9.469  1.00 22.95 ? 399 ALA A O     1 
ATOM   3175 C  CB    . ALA A 1 402 ? 25.650 6.883   -10.012 1.00 24.20 ? 399 ALA A CB    1 
ATOM   3176 N  N     . PHE A 1 403 ? 22.538 7.274   -10.060 1.00 24.74 ? 400 PHE A N     1 
ATOM   3177 C  CA    . PHE A 1 403 ? 21.262 7.341   -9.356  1.00 26.59 ? 400 PHE A CA    1 
ATOM   3178 C  C     . PHE A 1 403 ? 20.269 6.360   -9.969  1.00 28.64 ? 400 PHE A C     1 
ATOM   3179 O  O     . PHE A 1 403 ? 19.565 5.652   -9.257  1.00 27.31 ? 400 PHE A O     1 
ATOM   3180 C  CB    . PHE A 1 403 ? 20.696 8.759   -9.384  1.00 22.49 ? 400 PHE A CB    1 
ATOM   3181 C  CG    . PHE A 1 403 ? 19.431 8.921   -8.589  1.00 36.52 ? 400 PHE A CG    1 
ATOM   3182 C  CD1   . PHE A 1 403 ? 18.197 8.915   -9.218  1.00 40.72 ? 400 PHE A CD1   1 
ATOM   3183 C  CD2   . PHE A 1 403 ? 19.476 9.070   -7.213  1.00 29.90 ? 400 PHE A CD2   1 
ATOM   3184 C  CE1   . PHE A 1 403 ? 17.030 9.061   -8.488  1.00 45.46 ? 400 PHE A CE1   1 
ATOM   3185 C  CE2   . PHE A 1 403 ? 18.316 9.217   -6.479  1.00 42.65 ? 400 PHE A CE2   1 
ATOM   3186 C  CZ    . PHE A 1 403 ? 17.092 9.213   -7.116  1.00 44.72 ? 400 PHE A CZ    1 
ATOM   3187 N  N     . THR A 1 404 ? 20.226 6.320   -11.295 1.00 30.49 ? 401 THR A N     1 
ATOM   3188 C  CA    . THR A 1 404 ? 19.335 5.402   -11.996 1.00 28.73 ? 401 THR A CA    1 
ATOM   3189 C  C     . THR A 1 404 ? 19.553 3.952   -11.570 1.00 28.88 ? 401 THR A C     1 
ATOM   3190 O  O     . THR A 1 404 ? 18.591 3.209   -11.363 1.00 30.84 ? 401 THR A O     1 
ATOM   3191 C  CB    . THR A 1 404 ? 19.476 5.531   -13.523 1.00 27.45 ? 401 THR A CB    1 
ATOM   3192 O  OG1   . THR A 1 404 ? 19.064 6.843   -13.933 1.00 27.31 ? 401 THR A OG1   1 
ATOM   3193 C  CG2   . THR A 1 404 ? 18.627 4.489   -14.234 1.00 32.74 ? 401 THR A CG2   1 
ATOM   3194 N  N     . VAL A 1 405 ? 20.809 3.543   -11.416 1.00 26.86 ? 402 VAL A N     1 
ATOM   3195 C  CA    . VAL A 1 405 ? 21.083 2.146   -11.086 1.00 24.55 ? 402 VAL A CA    1 
ATOM   3196 C  C     . VAL A 1 405 ? 20.852 1.781   -9.618  1.00 26.83 ? 402 VAL A C     1 
ATOM   3197 O  O     . VAL A 1 405 ? 20.688 0.604   -9.302  1.00 34.43 ? 402 VAL A O     1 
ATOM   3198 C  CB    . VAL A 1 405 ? 22.483 1.676   -11.567 1.00 31.29 ? 402 VAL A CB    1 
ATOM   3199 C  CG1   . VAL A 1 405 ? 22.613 1.871   -13.073 1.00 32.08 ? 402 VAL A CG1   1 
ATOM   3200 C  CG2   . VAL A 1 405 ? 23.589 2.405   -10.838 1.00 32.47 ? 402 VAL A CG2   1 
ATOM   3201 N  N     . ILE A 1 406 ? 20.832 2.774   -8.729  1.00 27.83 ? 403 ILE A N     1 
ATOM   3202 C  CA    . ILE A 1 406 ? 20.587 2.517   -7.307  1.00 36.20 ? 403 ILE A CA    1 
ATOM   3203 C  C     . ILE A 1 406 ? 19.202 2.943   -6.810  1.00 31.58 ? 403 ILE A C     1 
ATOM   3204 O  O     . ILE A 1 406 ? 18.782 2.537   -5.727  1.00 34.55 ? 403 ILE A O     1 
ATOM   3205 C  CB    . ILE A 1 406 ? 21.623 3.222   -6.394  1.00 28.82 ? 403 ILE A CB    1 
ATOM   3206 C  CG1   . ILE A 1 406 ? 21.420 4.740   -6.425  1.00 24.79 ? 403 ILE A CG1   1 
ATOM   3207 C  CG2   . ILE A 1 406 ? 23.030 2.828   -6.779  1.00 25.50 ? 403 ILE A CG2   1 
ATOM   3208 C  CD1   . ILE A 1 406 ? 22.063 5.470   -5.253  1.00 29.33 ? 403 ILE A CD1   1 
ATOM   3209 N  N     . LYS A 1 407 ? 18.506 3.766   -7.589  1.00 29.89 ? 404 LYS A N     1 
ATOM   3210 C  CA    . LYS A 1 407 ? 17.275 4.398   -7.116  1.00 38.59 ? 404 LYS A CA    1 
ATOM   3211 C  C     . LYS A 1 407 ? 16.218 3.416   -6.598  1.00 39.41 ? 404 LYS A C     1 
ATOM   3212 O  O     . LYS A 1 407 ? 15.393 3.775   -5.757  1.00 42.96 ? 404 LYS A O     1 
ATOM   3213 C  CB    . LYS A 1 407 ? 16.682 5.318   -8.189  1.00 35.38 ? 404 LYS A CB    1 
ATOM   3214 C  CG    . LYS A 1 407 ? 16.135 4.608   -9.421  1.00 33.63 ? 404 LYS A CG    1 
ATOM   3215 C  CD    . LYS A 1 407 ? 15.664 5.628   -10.453 1.00 42.80 ? 404 LYS A CD    1 
ATOM   3216 C  CE    . LYS A 1 407 ? 14.963 4.970   -11.636 1.00 47.27 ? 404 LYS A CE    1 
ATOM   3217 N  NZ    . LYS A 1 407 ? 15.880 4.102   -12.428 1.00 53.70 ? 404 LYS A NZ    1 
ATOM   3218 N  N     . ASN A 1 408 ? 16.248 2.182   -7.089  1.00 39.22 ? 405 ASN A N     1 
ATOM   3219 C  CA    . ASN A 1 408 ? 15.271 1.179   -6.674  1.00 45.61 ? 405 ASN A CA    1 
ATOM   3220 C  C     . ASN A 1 408 ? 15.563 0.599   -5.294  1.00 47.61 ? 405 ASN A C     1 
ATOM   3221 O  O     . ASN A 1 408 ? 14.764 -0.165  -4.754  1.00 46.05 ? 405 ASN A O     1 
ATOM   3222 C  CB    . ASN A 1 408 ? 15.185 0.047   -7.699  1.00 47.12 ? 405 ASN A CB    1 
ATOM   3223 C  CG    . ASN A 1 408 ? 16.486 -0.726  -7.821  1.00 60.83 ? 405 ASN A CG    1 
ATOM   3224 O  OD1   . ASN A 1 408 ? 17.556 -0.139  -8.007  1.00 45.26 ? 405 ASN A OD1   1 
ATOM   3225 N  ND2   . ASN A 1 408 ? 16.404 -2.048  -7.700  1.00 66.25 ? 405 ASN A ND2   1 
ATOM   3226 N  N     . CYS A 1 409 ? 16.715 0.950   -4.731  1.00 45.74 ? 406 CYS A N     1 
ATOM   3227 C  CA    . CYS A 1 409 ? 17.079 0.481   -3.399  1.00 49.05 ? 406 CYS A CA    1 
ATOM   3228 C  C     . CYS A 1 409 ? 16.265 1.221   -2.359  1.00 39.75 ? 406 CYS A C     1 
ATOM   3229 O  O     . CYS A 1 409 ? 16.229 0.839   -1.191  1.00 48.69 ? 406 CYS A O     1 
ATOM   3230 C  CB    . CYS A 1 409 ? 18.566 0.708   -3.129  1.00 48.30 ? 406 CYS A CB    1 
ATOM   3231 S  SG    . CYS A 1 409 ? 19.654 -0.317  -4.114  1.00 63.38 ? 406 CYS A SG    1 
ATOM   3232 N  N     . ASN A 1 410 ? 15.617 2.291   -2.798  1.00 44.03 ? 407 ASN A N     1 
ATOM   3233 C  CA    . ASN A 1 410 ? 14.833 3.133   -1.916  1.00 38.49 ? 407 ASN A CA    1 
ATOM   3234 C  C     . ASN A 1 410 ? 13.551 2.442   -1.440  1.00 49.06 ? 407 ASN A C     1 
ATOM   3235 O  O     . ASN A 1 410 ? 12.596 2.293   -2.200  1.00 43.55 ? 407 ASN A O     1 
ATOM   3236 C  CB    . ASN A 1 410 ? 14.500 4.442   -2.628  1.00 37.97 ? 407 ASN A CB    1 
ATOM   3237 C  CG    . ASN A 1 410 ? 14.030 5.509   -1.679  1.00 30.77 ? 407 ASN A CG    1 
ATOM   3238 O  OD1   . ASN A 1 410 ? 13.852 5.253   -0.489  1.00 35.62 ? 407 ASN A OD1   1 
ATOM   3239 N  ND2   . ASN A 1 410 ? 13.819 6.717   -2.197  1.00 34.71 ? 407 ASN A ND2   1 
ATOM   3240 N  N     . THR A 1 411 ? 13.546 2.019   -0.178  1.00 46.34 ? 408 THR A N     1 
ATOM   3241 C  CA    . THR A 1 411 ? 12.380 1.386   0.435   1.00 47.75 ? 408 THR A CA    1 
ATOM   3242 C  C     . THR A 1 411 ? 11.257 2.392   0.649   1.00 46.97 ? 408 THR A C     1 
ATOM   3243 O  O     . THR A 1 411 ? 10.078 2.037   0.612   1.00 49.68 ? 408 THR A O     1 
ATOM   3244 C  CB    . THR A 1 411 ? 12.744 0.745   1.793   1.00 43.61 ? 408 THR A CB    1 
ATOM   3245 O  OG1   . THR A 1 411 ? 13.355 -0.533  1.573   1.00 55.33 ? 408 THR A OG1   1 
ATOM   3246 C  CG2   . THR A 1 411 ? 11.508 0.564   2.661   1.00 55.78 ? 408 THR A CG2   1 
ATOM   3247 N  N     . SER A 1 412 ? 11.633 3.647   0.870   1.00 49.55 ? 409 SER A N     1 
ATOM   3248 C  CA    . SER A 1 412 ? 10.673 4.710   1.156   1.00 54.41 ? 409 SER A CA    1 
ATOM   3249 C  C     . SER A 1 412 ? 9.488  4.710   0.196   1.00 57.26 ? 409 SER A C     1 
ATOM   3250 O  O     . SER A 1 412 ? 9.660  4.613   -1.019  1.00 57.74 ? 409 SER A O     1 
ATOM   3251 C  CB    . SER A 1 412 ? 11.363 6.076   1.125   1.00 49.73 ? 409 SER A CB    1 
ATOM   3252 O  OG    . SER A 1 412 ? 10.430 7.128   1.300   1.00 55.88 ? 409 SER A OG    1 
ATOM   3253 N  N     . GLY A 1 413 ? 8.285  4.818   0.751   1.00 61.17 ? 410 GLY A N     1 
ATOM   3254 C  CA    . GLY A 1 413 ? 7.088  4.962   -0.054  1.00 60.70 ? 410 GLY A CA    1 
ATOM   3255 C  C     . GLY A 1 413 ? 7.037  6.358   -0.642  1.00 62.58 ? 410 GLY A C     1 
ATOM   3256 O  O     . GLY A 1 413 ? 6.555  6.562   -1.756  1.00 63.35 ? 410 GLY A O     1 
ATOM   3257 N  N     . ILE A 1 414 ? 7.544  7.322   0.119   1.00 61.11 ? 411 ILE A N     1 
ATOM   3258 C  CA    . ILE A 1 414 ? 7.631  8.701   -0.337  1.00 57.58 ? 411 ILE A CA    1 
ATOM   3259 C  C     . ILE A 1 414 ? 8.774  8.847   -1.336  1.00 62.27 ? 411 ILE A C     1 
ATOM   3260 O  O     . ILE A 1 414 ? 9.876  8.339   -1.114  1.00 58.78 ? 411 ILE A O     1 
ATOM   3261 C  CB    . ILE A 1 414 ? 7.870  9.665   0.841   1.00 55.07 ? 411 ILE A CB    1 
ATOM   3262 C  CG1   . ILE A 1 414 ? 6.986  9.284   2.031   1.00 48.74 ? 411 ILE A CG1   1 
ATOM   3263 C  CG2   . ILE A 1 414 ? 7.630  11.107  0.412   1.00 53.00 ? 411 ILE A CG2   1 
ATOM   3264 C  CD1   . ILE A 1 414 ? 7.200  10.152  3.248   1.00 52.71 ? 411 ILE A CD1   1 
ATOM   3265 N  N     . GLN A 1 415 ? 8.504  9.545   -2.435  1.00 66.86 ? 412 GLN A N     1 
ATOM   3266 C  CA    . GLN A 1 415 ? 9.489  9.742   -3.494  1.00 57.42 ? 412 GLN A CA    1 
ATOM   3267 C  C     . GLN A 1 415 ? 10.679 10.563  -3.002  1.00 60.09 ? 412 GLN A C     1 
ATOM   3268 O  O     . GLN A 1 415 ? 11.830 10.276  -3.338  1.00 60.79 ? 412 GLN A O     1 
ATOM   3269 C  CB    . GLN A 1 415 ? 8.834  10.440  -4.690  1.00 57.72 ? 412 GLN A CB    1 
ATOM   3270 C  CG    . GLN A 1 415 ? 9.709  10.540  -5.932  1.00 62.39 ? 412 GLN A CG    1 
ATOM   3271 C  CD    . GLN A 1 415 ? 9.847  9.216   -6.667  1.00 76.78 ? 412 GLN A CD    1 
ATOM   3272 O  OE1   . GLN A 1 415 ? 9.927  8.151   -6.051  1.00 75.56 ? 412 GLN A OE1   1 
ATOM   3273 N  NE2   . GLN A 1 415 ? 9.869  9.280   -7.995  1.00 72.53 ? 412 GLN A NE2   1 
ATOM   3274 N  N     . THR A 1 416 ? 10.383 11.578  -2.197  1.00 53.75 ? 413 THR A N     1 
ATOM   3275 C  CA    . THR A 1 416 ? 11.380 12.540  -1.737  1.00 51.38 ? 413 THR A CA    1 
ATOM   3276 C  C     . THR A 1 416 ? 12.318 11.981  -0.666  1.00 47.93 ? 413 THR A C     1 
ATOM   3277 O  O     . THR A 1 416 ? 13.461 12.418  -0.546  1.00 46.71 ? 413 THR A O     1 
ATOM   3278 C  CB    . THR A 1 416 ? 10.693 13.811  -1.197  1.00 55.80 ? 413 THR A CB    1 
ATOM   3279 O  OG1   . THR A 1 416 ? 9.907  14.403  -2.238  1.00 60.03 ? 413 THR A OG1   1 
ATOM   3280 C  CG2   . THR A 1 416 ? 11.719 14.822  -0.709  1.00 55.90 ? 413 THR A CG2   1 
ATOM   3281 N  N     . GLU A 1 417 ? 11.835 11.017  0.110   1.00 46.62 ? 414 GLU A N     1 
ATOM   3282 C  CA    . GLU A 1 417 ? 12.626 10.460  1.200   1.00 43.58 ? 414 GLU A CA    1 
ATOM   3283 C  C     . GLU A 1 417 ? 13.458 9.266   0.753   1.00 46.21 ? 414 GLU A C     1 
ATOM   3284 O  O     . GLU A 1 417 ? 13.111 8.576   -0.207  1.00 44.23 ? 414 GLU A O     1 
ATOM   3285 C  CB    . GLU A 1 417 ? 11.722 10.054  2.366   1.00 47.44 ? 414 GLU A CB    1 
ATOM   3286 C  CG    . GLU A 1 417 ? 10.793 11.162  2.840   1.00 53.66 ? 414 GLU A CG    1 
ATOM   3287 C  CD    . GLU A 1 417 ? 11.518 12.476  3.070   1.00 45.98 ? 414 GLU A CD    1 
ATOM   3288 O  OE1   . GLU A 1 417 ? 12.215 12.602  4.099   1.00 42.86 ? 414 GLU A OE1   1 
ATOM   3289 O  OE2   . GLU A 1 417 ? 11.391 13.381  2.217   1.00 48.71 ? 414 GLU A OE2   1 
ATOM   3290 N  N     . TRP A 1 418 ? 14.564 9.028   1.451   1.00 27.35 ? 415 TRP A N     1 
ATOM   3291 C  CA    . TRP A 1 418 ? 15.377 7.853   1.188   1.00 34.16 ? 415 TRP A CA    1 
ATOM   3292 C  C     . TRP A 1 418 ? 15.507 6.973   2.424   1.00 36.69 ? 415 TRP A C     1 
ATOM   3293 O  O     . TRP A 1 418 ? 15.989 7.415   3.467   1.00 36.76 ? 415 TRP A O     1 
ATOM   3294 C  CB    . TRP A 1 418 ? 16.769 8.236   0.678   1.00 31.43 ? 415 TRP A CB    1 
ATOM   3295 C  CG    . TRP A 1 418 ? 17.437 7.075   0.036   1.00 23.67 ? 415 TRP A CG    1 
ATOM   3296 C  CD1   . TRP A 1 418 ? 17.958 5.982   0.658   1.00 27.01 ? 415 TRP A CD1   1 
ATOM   3297 C  CD2   . TRP A 1 418 ? 17.615 6.865   -1.367  1.00 30.70 ? 415 TRP A CD2   1 
ATOM   3298 N  NE1   . TRP A 1 418 ? 18.461 5.103   -0.273  1.00 32.25 ? 415 TRP A NE1   1 
ATOM   3299 C  CE2   . TRP A 1 418 ? 18.259 5.623   -1.525  1.00 27.72 ? 415 TRP A CE2   1 
ATOM   3300 C  CE3   . TRP A 1 418 ? 17.291 7.609   -2.506  1.00 35.91 ? 415 TRP A CE3   1 
ATOM   3301 C  CZ2   . TRP A 1 418 ? 18.597 5.111   -2.778  1.00 33.28 ? 415 TRP A CZ2   1 
ATOM   3302 C  CZ3   . TRP A 1 418 ? 17.629 7.100   -3.751  1.00 35.52 ? 415 TRP A CZ3   1 
ATOM   3303 C  CH2   . TRP A 1 418 ? 18.273 5.863   -3.876  1.00 29.61 ? 415 TRP A CH2   1 
ATOM   3304 N  N     . SER A 1 419 ? 15.082 5.720   2.301   1.00 40.50 ? 416 SER A N     1 
ATOM   3305 C  CA    . SER A 1 419 ? 15.214 4.766   3.393   1.00 35.01 ? 416 SER A CA    1 
ATOM   3306 C  C     . SER A 1 419 ? 15.525 3.375   2.861   1.00 40.51 ? 416 SER A C     1 
ATOM   3307 O  O     . SER A 1 419 ? 15.084 3.019   1.772   1.00 43.26 ? 416 SER A O     1 
ATOM   3308 C  CB    . SER A 1 419 ? 13.940 4.737   4.242   1.00 46.50 ? 416 SER A CB    1 
ATOM   3309 O  OG    . SER A 1 419 ? 12.805 4.444   3.445   1.00 56.53 ? 416 SER A OG    1 
ATOM   3310 N  N     . PRO A 1 420 ? 16.319 2.599   3.616   1.00 41.13 ? 417 PRO A N     1 
ATOM   3311 C  CA    . PRO A 1 420 ? 16.984 3.108   4.822   1.00 43.33 ? 417 PRO A CA    1 
ATOM   3312 C  C     . PRO A 1 420 ? 18.094 4.068   4.421   1.00 33.92 ? 417 PRO A C     1 
ATOM   3313 O  O     . PRO A 1 420 ? 18.586 3.972   3.296   1.00 41.54 ? 417 PRO A O     1 
ATOM   3314 C  CB    . PRO A 1 420 ? 17.573 1.845   5.456   1.00 40.61 ? 417 PRO A CB    1 
ATOM   3315 C  CG    . PRO A 1 420 ? 17.753 0.903   4.316   1.00 42.94 ? 417 PRO A CG    1 
ATOM   3316 C  CD    . PRO A 1 420 ? 16.615 1.176   3.378   1.00 42.39 ? 417 PRO A CD    1 
ATOM   3317 N  N     . PRO A 1 421 ? 18.475 4.989   5.320   1.00 34.72 ? 418 PRO A N     1 
ATOM   3318 C  CA    . PRO A 1 421 ? 19.496 5.992   4.998   1.00 34.22 ? 418 PRO A CA    1 
ATOM   3319 C  C     . PRO A 1 421 ? 20.776 5.347   4.460   1.00 21.70 ? 418 PRO A C     1 
ATOM   3320 O  O     . PRO A 1 421 ? 21.101 4.222   4.842   1.00 25.42 ? 418 PRO A O     1 
ATOM   3321 C  CB    . PRO A 1 421 ? 19.760 6.666   6.348   1.00 33.86 ? 418 PRO A CB    1 
ATOM   3322 C  CG    . PRO A 1 421 ? 18.503 6.464   7.127   1.00 33.12 ? 418 PRO A CG    1 
ATOM   3323 C  CD    . PRO A 1 421 ? 17.978 5.120   6.702   1.00 35.37 ? 418 PRO A CD    1 
ATOM   3324 N  N     . LEU A 1 422 ? 21.478 6.057   3.581   1.00 27.46 ? 419 LEU A N     1 
ATOM   3325 C  CA    . LEU A 1 422 ? 22.717 5.558   2.990   1.00 22.41 ? 419 LEU A CA    1 
ATOM   3326 C  C     . LEU A 1 422 ? 23.916 6.003   3.823   1.00 20.81 ? 419 LEU A C     1 
ATOM   3327 O  O     . LEU A 1 422 ? 24.041 7.177   4.159   1.00 26.97 ? 419 LEU A O     1 
ATOM   3328 C  CB    . LEU A 1 422 ? 22.871 6.057   1.550   1.00 20.15 ? 419 LEU A CB    1 
ATOM   3329 C  CG    . LEU A 1 422 ? 21.781 5.605   0.575   1.00 25.26 ? 419 LEU A CG    1 
ATOM   3330 C  CD1   . LEU A 1 422 ? 22.111 6.033   -0.853  1.00 24.28 ? 419 LEU A CD1   1 
ATOM   3331 C  CD2   . LEU A 1 422 ? 21.600 4.104   0.664   1.00 25.02 ? 419 LEU A CD2   1 
ATOM   3332 N  N     . THR A 1 423 ? 24.784 5.060   4.164   1.00 23.91 ? 420 THR A N     1 
ATOM   3333 C  CA    . THR A 1 423 ? 25.953 5.373   4.981   1.00 18.61 ? 420 THR A CA    1 
ATOM   3334 C  C     . THR A 1 423 ? 27.248 5.343   4.169   1.00 20.46 ? 420 THR A C     1 
ATOM   3335 O  O     . THR A 1 423 ? 28.327 5.603   4.705   1.00 17.56 ? 420 THR A O     1 
ATOM   3336 C  CB    . THR A 1 423 ? 26.073 4.439   6.190   1.00 27.93 ? 420 THR A CB    1 
ATOM   3337 O  OG1   . THR A 1 423 ? 26.011 3.079   5.749   1.00 32.04 ? 420 THR A OG1   1 
ATOM   3338 C  CG2   . THR A 1 423 ? 24.936 4.705   7.172   1.00 33.20 ? 420 THR A CG2   1 
ATOM   3339 N  N     . MET A 1 424 ? 27.138 5.041   2.878   1.00 14.00 ? 421 MET A N     1 
ATOM   3340 C  CA    . MET A 1 424 ? 28.309 5.051   2.000   1.00 13.66 ? 421 MET A CA    1 
ATOM   3341 C  C     . MET A 1 424 ? 27.902 5.195   0.535   1.00 17.74 ? 421 MET A C     1 
ATOM   3342 O  O     . MET A 1 424 ? 26.931 4.575   0.100   1.00 19.22 ? 421 MET A O     1 
ATOM   3343 C  CB    . MET A 1 424 ? 29.131 3.774   2.206   1.00 18.71 ? 421 MET A CB    1 
ATOM   3344 C  CG    . MET A 1 424 ? 30.450 3.707   1.417   1.00 20.33 ? 421 MET A CG    1 
ATOM   3345 S  SD    . MET A 1 424 ? 30.219 3.150   -0.285  1.00 21.56 ? 421 MET A SD    1 
ATOM   3346 C  CE    . MET A 1 424 ? 29.651 1.471   -0.052  1.00 20.74 ? 421 MET A CE    1 
ATOM   3347 N  N     . LEU A 1 425 ? 28.618 6.044   -0.206  1.00 13.38 ? 422 LEU A N     1 
ATOM   3348 C  CA    . LEU A 1 425 ? 28.496 6.120   -1.666  1.00 13.94 ? 422 LEU A CA    1 
ATOM   3349 C  C     . LEU A 1 425 ? 29.872 5.886   -2.274  1.00 15.53 ? 422 LEU A C     1 
ATOM   3350 O  O     . LEU A 1 425 ? 30.882 6.301   -1.704  1.00 15.46 ? 422 LEU A O     1 
ATOM   3351 C  CB    . LEU A 1 425 ? 28.003 7.492   -2.120  1.00 12.73 ? 422 LEU A CB    1 
ATOM   3352 C  CG    . LEU A 1 425 ? 26.597 7.949   -1.735  1.00 22.27 ? 422 LEU A CG    1 
ATOM   3353 C  CD1   . LEU A 1 425 ? 26.342 9.349   -2.287  1.00 17.60 ? 422 LEU A CD1   1 
ATOM   3354 C  CD2   . LEU A 1 425 ? 25.541 6.975   -2.234  1.00 18.38 ? 422 LEU A CD2   1 
ATOM   3355 N  N     . PHE A 1 426 ? 29.908 5.257   -3.446  1.00 11.10 ? 423 PHE A N     1 
ATOM   3356 C  CA    . PHE A 1 426 ? 31.167 4.869   -4.077  1.00 11.53 ? 423 PHE A CA    1 
ATOM   3357 C  C     . PHE A 1 426 ? 30.948 4.839   -5.586  1.00 17.24 ? 423 PHE A C     1 
ATOM   3358 O  O     . PHE A 1 426 ? 30.011 4.193   -6.058  1.00 20.30 ? 423 PHE A O     1 
ATOM   3359 C  CB    . PHE A 1 426 ? 31.564 3.477   -3.565  1.00 17.23 ? 423 PHE A CB    1 
ATOM   3360 C  CG    . PHE A 1 426 ? 32.870 2.959   -4.109  1.00 22.13 ? 423 PHE A CG    1 
ATOM   3361 C  CD1   . PHE A 1 426 ? 33.050 1.602   -4.317  1.00 42.66 ? 423 PHE A CD1   1 
ATOM   3362 C  CD2   . PHE A 1 426 ? 33.926 3.816   -4.382  1.00 19.01 ? 423 PHE A CD2   1 
ATOM   3363 C  CE1   . PHE A 1 426 ? 34.249 1.112   -4.809  1.00 36.13 ? 423 PHE A CE1   1 
ATOM   3364 C  CE2   . PHE A 1 426 ? 35.127 3.334   -4.871  1.00 23.62 ? 423 PHE A CE2   1 
ATOM   3365 C  CZ    . PHE A 1 426 ? 35.289 1.979   -5.082  1.00 31.51 ? 423 PHE A CZ    1 
ATOM   3366 N  N     . LEU A 1 427 ? 31.775 5.573   -6.330  1.00 9.92  ? 424 LEU A N     1 
ATOM   3367 C  CA    . LEU A 1 427 ? 31.768 5.519   -7.794  1.00 11.45 ? 424 LEU A CA    1 
ATOM   3368 C  C     . LEU A 1 427 ? 33.140 5.075   -8.239  1.00 15.10 ? 424 LEU A C     1 
ATOM   3369 O  O     . LEU A 1 427 ? 34.138 5.630   -7.797  1.00 15.17 ? 424 LEU A O     1 
ATOM   3370 C  CB    . LEU A 1 427 ? 31.499 6.896   -8.407  1.00 12.79 ? 424 LEU A CB    1 
ATOM   3371 C  CG    . LEU A 1 427 ? 30.141 7.539   -8.139  1.00 15.76 ? 424 LEU A CG    1 
ATOM   3372 C  CD1   . LEU A 1 427 ? 30.038 8.921   -8.803  1.00 16.39 ? 424 LEU A CD1   1 
ATOM   3373 C  CD2   . LEU A 1 427 ? 29.026 6.617   -8.611  1.00 15.79 ? 424 LEU A CD2   1 
ATOM   3374 N  N     . CYS A 1 428 ? 33.202 4.094   -9.132  1.00 13.40 ? 425 CYS A N     1 
ATOM   3375 C  CA    . CYS A 1 428 ? 34.493 3.588   -9.586  1.00 13.34 ? 425 CYS A CA    1 
ATOM   3376 C  C     . CYS A 1 428 ? 34.512 3.376   -11.104 1.00 18.34 ? 425 CYS A C     1 
ATOM   3377 O  O     . CYS A 1 428 ? 33.639 2.699   -11.649 1.00 19.45 ? 425 CYS A O     1 
ATOM   3378 C  CB    . CYS A 1 428 ? 34.826 2.284   -8.864  1.00 23.88 ? 425 CYS A CB    1 
ATOM   3379 S  SG    . CYS A 1 428 ? 36.481 1.640   -9.218  1.00 23.15 ? 425 CYS A SG    1 
ATOM   3380 N  N     . ALA A 1 429 ? 35.500 3.971   -11.771 1.00 16.06 ? 426 ALA A N     1 
ATOM   3381 C  CA    . ALA A 1 429 ? 35.705 3.778   -13.202 1.00 15.97 ? 426 ALA A CA    1 
ATOM   3382 C  C     . ALA A 1 429 ? 36.622 2.580   -13.438 1.00 14.94 ? 426 ALA A C     1 
ATOM   3383 O  O     . ALA A 1 429 ? 37.686 2.456   -12.803 1.00 14.98 ? 426 ALA A O     1 
ATOM   3384 C  CB    . ALA A 1 429 ? 36.302 5.026   -13.823 1.00 12.79 ? 426 ALA A CB    1 
ATOM   3385 N  N     . THR A 1 430 ? 36.220 1.709   -14.363 1.00 16.90 ? 427 THR A N     1 
ATOM   3386 C  CA    . THR A 1 430 ? 36.939 0.454   -14.595 1.00 18.05 ? 427 THR A CA    1 
ATOM   3387 C  C     . THR A 1 430 ? 36.962 0.076   -16.074 1.00 20.92 ? 427 THR A C     1 
ATOM   3388 O  O     . THR A 1 430 ? 36.385 0.769   -16.918 1.00 16.17 ? 427 THR A O     1 
ATOM   3389 C  CB    . THR A 1 430 ? 36.307 -0.724  -13.814 1.00 19.96 ? 427 THR A CB    1 
ATOM   3390 O  OG1   . THR A 1 430 ? 35.047 -1.064  -14.395 1.00 25.34 ? 427 THR A OG1   1 
ATOM   3391 C  CG2   . THR A 1 430 ? 36.089 -0.360  -12.347 1.00 23.83 ? 427 THR A CG2   1 
ATOM   3392 N  N     . LYS A 1 431 ? 37.638 -1.032  -16.370 1.00 18.62 ? 428 LYS A N     1 
ATOM   3393 C  CA    . LYS A 1 431 ? 37.693 -1.585  -17.726 1.00 23.18 ? 428 LYS A CA    1 
ATOM   3394 C  C     . LYS A 1 431 ? 38.280 -0.609  -18.749 1.00 19.17 ? 428 LYS A C     1 
ATOM   3395 O  O     . LYS A 1 431 ? 37.600 -0.176  -19.687 1.00 18.12 ? 428 LYS A O     1 
ATOM   3396 C  CB    . LYS A 1 431 ? 36.316 -2.082  -18.164 1.00 20.11 ? 428 LYS A CB    1 
ATOM   3397 C  CG    . LYS A 1 431 ? 35.786 -3.186  -17.268 1.00 32.19 ? 428 LYS A CG    1 
ATOM   3398 C  CD    . LYS A 1 431 ? 34.662 -3.964  -17.927 1.00 41.62 ? 428 LYS A CD    1 
ATOM   3399 C  CE    . LYS A 1 431 ? 34.183 -5.083  -17.015 1.00 39.41 ? 428 LYS A CE    1 
ATOM   3400 N  NZ    . LYS A 1 431 ? 35.324 -5.900  -16.509 1.00 41.17 ? 428 LYS A NZ    1 
ATOM   3401 N  N     . PHE A 1 432 ? 39.550 -0.274  -18.567 1.00 18.54 ? 429 PHE A N     1 
ATOM   3402 C  CA    . PHE A 1 432 ? 40.215 0.681   -19.443 1.00 16.66 ? 429 PHE A CA    1 
ATOM   3403 C  C     . PHE A 1 432 ? 40.542 0.096   -20.812 1.00 22.77 ? 429 PHE A C     1 
ATOM   3404 O  O     . PHE A 1 432 ? 40.852 -1.091  -20.933 1.00 23.39 ? 429 PHE A O     1 
ATOM   3405 C  CB    . PHE A 1 432 ? 41.482 1.228   -18.777 1.00 16.41 ? 429 PHE A CB    1 
ATOM   3406 C  CG    . PHE A 1 432 ? 41.200 2.220   -17.681 1.00 19.41 ? 429 PHE A CG    1 
ATOM   3407 C  CD1   . PHE A 1 432 ? 41.077 3.568   -17.966 1.00 15.76 ? 429 PHE A CD1   1 
ATOM   3408 C  CD2   . PHE A 1 432 ? 41.041 1.800   -16.370 1.00 26.09 ? 429 PHE A CD2   1 
ATOM   3409 C  CE1   . PHE A 1 432 ? 40.803 4.484   -16.968 1.00 16.57 ? 429 PHE A CE1   1 
ATOM   3410 C  CE2   . PHE A 1 432 ? 40.775 2.712   -15.361 1.00 27.24 ? 429 PHE A CE2   1 
ATOM   3411 C  CZ    . PHE A 1 432 ? 40.654 4.058   -15.661 1.00 23.25 ? 429 PHE A CZ    1 
ATOM   3412 N  N     . SER A 1 433 ? 40.458 0.945   -21.836 1.00 18.89 ? 430 SER A N     1 
ATOM   3413 C  CA    . SER A 1 433 ? 40.871 0.595   -23.198 1.00 21.71 ? 430 SER A CA    1 
ATOM   3414 C  C     . SER A 1 433 ? 41.823 1.660   -23.716 1.00 23.64 ? 430 SER A C     1 
ATOM   3415 O  O     . SER A 1 433 ? 41.724 2.830   -23.341 1.00 20.24 ? 430 SER A O     1 
ATOM   3416 C  CB    . SER A 1 433 ? 39.656 0.495   -24.130 1.00 26.73 ? 430 SER A CB    1 
ATOM   3417 O  OG    . SER A 1 433 ? 38.790 -0.560  -23.749 1.00 36.96 ? 430 SER A OG    1 
ATOM   3418 N  N     . ALA A 1 434 ? 42.755 1.264   -24.573 1.00 20.81 ? 431 ALA A N     1 
ATOM   3419 C  CA    . ALA A 1 434 ? 43.731 2.215   -25.079 1.00 23.15 ? 431 ALA A CA    1 
ATOM   3420 C  C     . ALA A 1 434 ? 43.016 3.279   -25.897 1.00 29.66 ? 431 ALA A C     1 
ATOM   3421 O  O     . ALA A 1 434 ? 41.975 3.014   -26.508 1.00 30.43 ? 431 ALA A O     1 
ATOM   3422 C  CB    . ALA A 1 434 ? 44.797 1.508   -25.908 1.00 25.84 ? 431 ALA A CB    1 
ATOM   3423 N  N     . SER A 1 435 ? 43.564 4.488   -25.883 1.00 24.16 ? 432 SER A N     1 
ATOM   3424 C  CA    . SER A 1 435 ? 42.975 5.603   -26.616 1.00 34.62 ? 432 SER A CA    1 
ATOM   3425 C  C     . SER A 1 435 ? 44.063 6.529   -27.146 1.00 38.53 ? 432 SER A C     1 
ATOM   3426 O  O     . SER A 1 435 ? 43.791 7.660   -27.543 1.00 35.87 ? 432 SER A O     1 
ATOM   3427 C  CB    . SER A 1 435 ? 42.033 6.389   -25.712 1.00 33.62 ? 432 SER A CB    1 
ATOM   3428 O  OG    . SER A 1 435 ? 42.763 7.013   -24.669 1.00 44.85 ? 432 SER A OG    1 
ATOM   3429 O  OXT   . SER A 1 435 ? 45.242 6.177   -27.181 1.00 44.33 ? 432 SER A OXT   1 
ATOM   3430 O  "O3'" . DC  B 2 1   ? 27.858 4.872   11.689  1.00 39.32 ? 1   DC  T "O3'" 1 
ATOM   3431 P  P     . DA  B 2 2   ? 28.267 4.473   13.192  1.00 72.41 ? 2   DA  T P     1 
ATOM   3432 O  OP1   . DA  B 2 2   ? 28.410 2.997   13.252  1.00 56.68 ? 2   DA  T OP1   1 
ATOM   3433 O  OP2   . DA  B 2 2   ? 27.346 5.172   14.117  1.00 63.10 ? 2   DA  T OP2   1 
ATOM   3434 O  "O5'" . DA  B 2 2   ? 29.706 5.148   13.381  1.00 49.05 ? 2   DA  T "O5'" 1 
ATOM   3435 C  "C5'" . DA  B 2 2   ? 30.794 4.783   12.549  1.00 44.65 ? 2   DA  T "C5'" 1 
ATOM   3436 C  "C4'" . DA  B 2 2   ? 32.036 5.512   13.019  1.00 32.34 ? 2   DA  T "C4'" 1 
ATOM   3437 O  "O4'" . DA  B 2 2   ? 31.894 6.922   12.743  1.00 37.56 ? 2   DA  T "O4'" 1 
ATOM   3438 C  "C3'" . DA  B 2 2   ? 32.288 5.415   14.520  1.00 39.98 ? 2   DA  T "C3'" 1 
ATOM   3439 O  "O3'" . DA  B 2 2   ? 33.681 5.355   14.767  1.00 37.63 ? 2   DA  T "O3'" 1 
ATOM   3440 C  "C2'" . DA  B 2 2   ? 31.686 6.692   15.093  1.00 36.66 ? 2   DA  T "C2'" 1 
ATOM   3441 C  "C1'" . DA  B 2 2   ? 31.916 7.664   13.948  1.00 33.61 ? 2   DA  T "C1'" 1 
ATOM   3442 N  N9    . DA  B 2 2   ? 30.873 8.675   13.861  1.00 34.50 ? 2   DA  T N9    1 
ATOM   3443 C  C8    . DA  B 2 2   ? 29.601 8.623   14.358  1.00 33.25 ? 2   DA  T C8    1 
ATOM   3444 N  N7    . DA  B 2 2   ? 28.900 9.702   14.112  1.00 34.25 ? 2   DA  T N7    1 
ATOM   3445 C  C5    . DA  B 2 2   ? 29.779 10.508  13.408  1.00 33.39 ? 2   DA  T C5    1 
ATOM   3446 C  C6    . DA  B 2 2   ? 29.657 11.792  12.856  1.00 33.78 ? 2   DA  T C6    1 
ATOM   3447 N  N6    . DA  B 2 2   ? 28.538 12.519  12.932  1.00 37.45 ? 2   DA  T N6    1 
ATOM   3448 N  N1    . DA  B 2 2   ? 30.736 12.295  12.217  1.00 38.19 ? 2   DA  T N1    1 
ATOM   3449 C  C2    . DA  B 2 2   ? 31.857 11.566  12.136  1.00 22.43 ? 2   DA  T C2    1 
ATOM   3450 N  N3    . DA  B 2 2   ? 32.091 10.354  12.621  1.00 35.53 ? 2   DA  T N3    1 
ATOM   3451 C  C4    . DA  B 2 2   ? 30.999 9.888   13.248  1.00 28.87 ? 2   DA  T C4    1 
ATOM   3452 P  P     . DT  B 2 3   ? 34.352 3.977   15.244  1.00 40.21 ? 3   DT  T P     1 
ATOM   3453 O  OP1   . DT  B 2 3   ? 33.301 3.157   15.883  1.00 50.08 ? 3   DT  T OP1   1 
ATOM   3454 O  OP2   . DT  B 2 3   ? 35.595 4.305   15.981  1.00 40.93 ? 3   DT  T OP2   1 
ATOM   3455 O  "O5'" . DT  B 2 3   ? 34.745 3.255   13.874  1.00 44.33 ? 3   DT  T "O5'" 1 
ATOM   3456 C  "C5'" . DT  B 2 3   ? 36.044 3.442   13.335  1.00 35.67 ? 3   DT  T "C5'" 1 
ATOM   3457 C  "C4'" . DT  B 2 3   ? 36.103 4.726   12.538  1.00 37.53 ? 3   DT  T "C4'" 1 
ATOM   3458 O  "O4'" . DT  B 2 3   ? 37.484 5.007   12.211  1.00 31.36 ? 3   DT  T "O4'" 1 
ATOM   3459 C  "C3'" . DT  B 2 3   ? 35.374 4.677   11.201  1.00 36.48 ? 3   DT  T "C3'" 1 
ATOM   3460 O  "O3'" . DT  B 2 3   ? 34.935 5.967   10.879  1.00 29.92 ? 3   DT  T "O3'" 1 
ATOM   3461 C  "C2'" . DT  B 2 3   ? 36.463 4.243   10.229  1.00 34.66 ? 3   DT  T "C2'" 1 
ATOM   3462 C  "C1'" . DT  B 2 3   ? 37.637 5.025   10.799  1.00 34.21 ? 3   DT  T "C1'" 1 
ATOM   3463 N  N1    . DT  B 2 3   ? 38.959 4.424   10.517  1.00 37.26 ? 3   DT  T N1    1 
ATOM   3464 C  C2    . DT  B 2 3   ? 39.926 5.200   9.909   1.00 37.17 ? 3   DT  T C2    1 
ATOM   3465 O  O2    . DT  B 2 3   ? 39.740 6.360   9.582   1.00 48.36 ? 3   DT  T O2    1 
ATOM   3466 N  N3    . DT  B 2 3   ? 41.124 4.566   9.698   1.00 33.30 ? 3   DT  T N3    1 
ATOM   3467 C  C4    . DT  B 2 3   ? 41.432 3.259   10.035  1.00 32.43 ? 3   DT  T C4    1 
ATOM   3468 O  O4    . DT  B 2 3   ? 42.538 2.785   9.804   1.00 34.83 ? 3   DT  T O4    1 
ATOM   3469 C  C5    . DT  B 2 3   ? 40.373 2.502   10.670  1.00 30.86 ? 3   DT  T C5    1 
ATOM   3470 C  C7    . DT  B 2 3   ? 40.589 1.074   11.084  1.00 44.63 ? 3   DT  T C7    1 
ATOM   3471 C  C6    . DT  B 2 3   ? 39.200 3.115   10.886  1.00 33.97 ? 3   DT  T C6    1 
ATOM   3472 P  P     . DT  B 2 4   ? 34.215 6.236   9.474   1.00 40.35 ? 4   DT  T P     1 
ATOM   3473 O  OP1   . DT  B 2 4   ? 33.356 7.425   9.624   1.00 39.09 ? 4   DT  T OP1   1 
ATOM   3474 O  OP2   . DT  B 2 4   ? 33.646 4.954   9.004   1.00 46.67 ? 4   DT  T OP2   1 
ATOM   3475 O  "O5'" . DT  B 2 4   ? 35.432 6.600   8.502   1.00 28.46 ? 4   DT  T "O5'" 1 
ATOM   3476 C  "C5'" . DT  B 2 4   ? 36.016 7.887   8.565   1.00 23.40 ? 4   DT  T "C5'" 1 
ATOM   3477 C  "C4'" . DT  B 2 4   ? 36.786 8.105   7.280   1.00 17.38 ? 4   DT  T "C4'" 1 
ATOM   3478 O  "O4'" . DT  B 2 4   ? 37.933 7.226   7.277   1.00 19.11 ? 4   DT  T "O4'" 1 
ATOM   3479 C  "C3'" . DT  B 2 4   ? 36.016 7.787   6.006   1.00 14.23 ? 4   DT  T "C3'" 1 
ATOM   3480 O  "O3'" . DT  B 2 4   ? 36.327 8.849   5.139   1.00 15.76 ? 4   DT  T "O3'" 1 
ATOM   3481 C  "C2'" . DT  B 2 4   ? 36.580 6.438   5.554   1.00 13.62 ? 4   DT  T "C2'" 1 
ATOM   3482 C  "C1'" . DT  B 2 4   ? 38.013 6.561   6.036   1.00 18.12 ? 4   DT  T "C1'" 1 
ATOM   3483 N  N1    . DT  B 2 4   ? 38.725 5.301   6.342   1.00 16.99 ? 4   DT  T N1    1 
ATOM   3484 C  C2    . DT  B 2 4   ? 40.053 5.279   6.005   1.00 13.11 ? 4   DT  T C2    1 
ATOM   3485 O  O2    . DT  B 2 4   ? 40.609 6.217   5.456   1.00 15.05 ? 4   DT  T O2    1 
ATOM   3486 N  N3    . DT  B 2 4   ? 40.691 4.116   6.310   1.00 19.34 ? 4   DT  T N3    1 
ATOM   3487 C  C4    . DT  B 2 4   ? 40.157 3.006   6.925   1.00 16.15 ? 4   DT  T C4    1 
ATOM   3488 O  O4    . DT  B 2 4   ? 40.843 2.017   7.160   1.00 18.05 ? 4   DT  T O4    1 
ATOM   3489 C  C5    . DT  B 2 4   ? 38.757 3.096   7.271   1.00 21.16 ? 4   DT  T C5    1 
ATOM   3490 C  C7    . DT  B 2 4   ? 38.085 1.930   7.937   1.00 20.17 ? 4   DT  T C7    1 
ATOM   3491 C  C6    . DT  B 2 4   ? 38.109 4.234   6.973   1.00 16.24 ? 4   DT  T C6    1 
ATOM   3492 P  P     . DA  B 2 5   ? 35.710 8.910   3.659   1.00 14.39 ? 5   DA  T P     1 
ATOM   3493 O  OP1   . DA  B 2 5   ? 35.480 10.320  3.326   1.00 15.52 ? 5   DA  T OP1   1 
ATOM   3494 O  OP2   . DA  B 2 5   ? 34.632 7.902   3.564   1.00 15.70 ? 5   DA  T OP2   1 
ATOM   3495 O  "O5'" . DA  B 2 5   ? 36.916 8.402   2.753   1.00 13.38 ? 5   DA  T "O5'" 1 
ATOM   3496 C  "C5'" . DA  B 2 5   ? 38.097 9.209   2.636   1.00 10.48 ? 5   DA  T "C5'" 1 
ATOM   3497 C  "C4'" . DA  B 2 5   ? 39.031 8.581   1.625   1.00 11.16 ? 5   DA  T "C4'" 1 
ATOM   3498 O  "O4'" . DA  B 2 5   ? 39.639 7.381   2.181   1.00 14.34 ? 5   DA  T "O4'" 1 
ATOM   3499 C  "C3'" . DA  B 2 5   ? 38.370 8.153   0.313   1.00 11.42 ? 5   DA  T "C3'" 1 
ATOM   3500 O  "O3'" . DA  B 2 5   ? 39.304 8.380   -0.725  1.00 13.89 ? 5   DA  T "O3'" 1 
ATOM   3501 C  "C2'" . DA  B 2 5   ? 38.160 6.663   0.558   1.00 15.02 ? 5   DA  T "C2'" 1 
ATOM   3502 C  "C1'" . DA  B 2 5   ? 39.470 6.319   1.273   1.00 14.68 ? 5   DA  T "C1'" 1 
ATOM   3503 N  N9    . DA  B 2 5   ? 39.425 5.078   2.032   1.00 13.27 ? 5   DA  T N9    1 
ATOM   3504 C  C8    . DA  B 2 5   ? 38.355 4.544   2.687   1.00 15.56 ? 5   DA  T C8    1 
ATOM   3505 N  N7    . DA  B 2 5   ? 38.619 3.415   3.302   1.00 15.58 ? 5   DA  T N7    1 
ATOM   3506 C  C5    . DA  B 2 5   ? 39.955 3.187   3.035   1.00 15.61 ? 5   DA  T C5    1 
ATOM   3507 C  C6    . DA  B 2 5   ? 40.830 2.148   3.407   1.00 17.11 ? 5   DA  T C6    1 
ATOM   3508 N  N6    . DA  B 2 5   ? 40.463 1.101   4.155   1.00 16.83 ? 5   DA  T N6    1 
ATOM   3509 N  N1    . DA  B 2 5   ? 42.099 2.232   2.969   1.00 16.48 ? 5   DA  T N1    1 
ATOM   3510 C  C2    . DA  B 2 5   ? 42.457 3.288   2.224   1.00 15.29 ? 5   DA  T C2    1 
ATOM   3511 N  N3    . DA  B 2 5   ? 41.727 4.323   1.812   1.00 14.18 ? 5   DA  T N3    1 
ATOM   3512 C  C4    . DA  B 2 5   ? 40.469 4.205   2.257   1.00 13.81 ? 5   DA  T C4    1 
ATOM   3513 P  P     . DT  B 2 6   ? 38.837 8.388   -2.267  1.00 13.51 ? 6   DT  T P     1 
ATOM   3514 O  OP1   . DT  B 2 6   ? 39.969 8.856   -3.076  1.00 15.99 ? 6   DT  T OP1   1 
ATOM   3515 O  OP2   . DT  B 2 6   ? 37.550 9.097   -2.363  1.00 13.54 ? 6   DT  T OP2   1 
ATOM   3516 O  "O5'" . DT  B 2 6   ? 38.497 6.857   -2.558  1.00 16.30 ? 6   DT  T "O5'" 1 
ATOM   3517 C  "C5'" . DT  B 2 6   ? 39.254 6.078   -3.481  1.00 18.13 ? 6   DT  T "C5'" 1 
ATOM   3518 C  "C4'" . DT  B 2 6   ? 40.489 5.462   -2.855  1.00 16.67 ? 6   DT  T "C4'" 1 
ATOM   3519 O  "O4'" . DT  B 2 6   ? 40.104 4.753   -1.662  1.00 17.32 ? 6   DT  T "O4'" 1 
ATOM   3520 C  "C3'" . DT  B 2 6   ? 41.058 4.391   -3.769  1.00 22.26 ? 6   DT  T "C3'" 1 
ATOM   3521 O  "O3'" . DT  B 2 6   ? 42.045 4.995   -4.565  1.00 16.98 ? 6   DT  T "O3'" 1 
ATOM   3522 C  "C2'" . DT  B 2 6   ? 41.621 3.323   -2.830  1.00 23.36 ? 6   DT  T "C2'" 1 
ATOM   3523 C  "C1'" . DT  B 2 6   ? 41.035 3.707   -1.474  1.00 21.27 ? 6   DT  T "C1'" 1 
ATOM   3524 N  N1    . DT  B 2 6   ? 40.340 2.631   -0.743  1.00 17.86 ? 6   DT  T N1    1 
ATOM   3525 C  C2    . DT  B 2 6   ? 41.071 1.545   -0.334  1.00 13.12 ? 6   DT  T C2    1 
ATOM   3526 O  O2    . DT  B 2 6   ? 42.255 1.438   -0.588  1.00 17.56 ? 6   DT  T O2    1 
ATOM   3527 N  N3    . DT  B 2 6   ? 40.360 0.612   0.373   1.00 13.44 ? 6   DT  T N3    1 
ATOM   3528 C  C4    . DT  B 2 6   ? 39.022 0.666   0.711   1.00 18.04 ? 6   DT  T C4    1 
ATOM   3529 O  O4    . DT  B 2 6   ? 38.471 -0.221  1.357   1.00 17.08 ? 6   DT  T O4    1 
ATOM   3530 C  C5    . DT  B 2 6   ? 38.320 1.845   0.264   1.00 19.56 ? 6   DT  T C5    1 
ATOM   3531 C  C7    . DT  B 2 6   ? 36.856 2.023   0.566   1.00 23.60 ? 6   DT  T C7    1 
ATOM   3532 C  C6    . DT  B 2 6   ? 39.003 2.757   -0.428  1.00 14.70 ? 6   DT  T C6    1 
ATOM   3533 P  P     . DG  B 2 7   ? 42.192 4.599   -6.114  1.00 18.44 ? 7   DG  T P     1 
ATOM   3534 O  OP1   . DG  B 2 7   ? 43.347 5.337   -6.654  1.00 19.79 ? 7   DG  T OP1   1 
ATOM   3535 O  OP2   . DG  B 2 7   ? 40.869 4.700   -6.746  1.00 15.78 ? 7   DG  T OP2   1 
ATOM   3536 O  "O5'" . DG  B 2 7   ? 42.510 3.028   -6.074  1.00 21.80 ? 7   DG  T "O5'" 1 
ATOM   3537 C  "C5'" . DG  B 2 7   ? 43.824 2.560   -5.899  1.00 25.66 ? 7   DG  T "C5'" 1 
ATOM   3538 C  "C4'" . DG  B 2 7   ? 43.810 1.052   -5.742  1.00 15.49 ? 7   DG  T "C4'" 1 
ATOM   3539 O  "O4'" . DG  B 2 7   ? 43.094 0.698   -4.544  1.00 16.20 ? 7   DG  T "O4'" 1 
ATOM   3540 C  "C3'" . DG  B 2 7   ? 43.155 0.259   -6.878  1.00 18.47 ? 7   DG  T "C3'" 1 
ATOM   3541 O  "O3'" . DG  B 2 7   ? 44.198 -0.437  -7.539  1.00 22.62 ? 7   DG  T "O3'" 1 
ATOM   3542 C  "C2'" . DG  B 2 7   ? 42.205 -0.699  -6.167  1.00 21.74 ? 7   DG  T "C2'" 1 
ATOM   3543 C  "C1'" . DG  B 2 7   ? 42.664 -0.622  -4.715  1.00 21.30 ? 7   DG  T "C1'" 1 
ATOM   3544 N  N9    . DG  B 2 7   ? 41.589 -0.947  -3.783  1.00 17.36 ? 7   DG  T N9    1 
ATOM   3545 C  C8    . DG  B 2 7   ? 40.395 -0.302  -3.581  1.00 14.30 ? 7   DG  T C8    1 
ATOM   3546 N  N7    . DG  B 2 7   ? 39.649 -0.880  -2.673  1.00 17.31 ? 7   DG  T N7    1 
ATOM   3547 C  C5    . DG  B 2 7   ? 40.394 -1.983  -2.277  1.00 14.80 ? 7   DG  T C5    1 
ATOM   3548 C  C6    . DG  B 2 7   ? 40.108 -2.985  -1.324  1.00 12.54 ? 7   DG  T C6    1 
ATOM   3549 O  O6    . DG  B 2 7   ? 39.091 -3.099  -0.627  1.00 16.74 ? 7   DG  T O6    1 
ATOM   3550 N  N1    . DG  B 2 7   ? 41.147 -3.915  -1.243  1.00 13.62 ? 7   DG  T N1    1 
ATOM   3551 C  C2    . DG  B 2 7   ? 42.314 -3.872  -1.971  1.00 14.97 ? 7   DG  T C2    1 
ATOM   3552 N  N2    . DG  B 2 7   ? 43.217 -4.842  -1.762  1.00 15.08 ? 7   DG  T N2    1 
ATOM   3553 N  N3    . DG  B 2 7   ? 42.597 -2.931  -2.864  1.00 14.21 ? 7   DG  T N3    1 
ATOM   3554 C  C4    . DG  B 2 7   ? 41.588 -2.033  -2.948  1.00 14.11 ? 7   DG  T C4    1 
ATOM   3555 P  P     . DA  B 2 8   ? 43.902 -1.331  -8.843  1.00 18.62 ? 8   DA  T P     1 
ATOM   3556 O  OP1   . DA  B 2 8   ? 44.946 -1.043  -9.832  1.00 22.85 ? 8   DA  T OP1   1 
ATOM   3557 O  OP2   . DA  B 2 8   ? 42.454 -1.257  -9.159  1.00 21.15 ? 8   DA  T OP2   1 
ATOM   3558 O  "O5'" . DA  B 2 8   ? 44.190 -2.822  -8.340  1.00 18.67 ? 8   DA  T "O5'" 1 
ATOM   3559 C  "C5'" . DA  B 2 8   ? 45.451 -3.098  -7.740  1.00 19.11 ? 8   DA  T "C5'" 1 
ATOM   3560 C  "C4'" . DA  B 2 8   ? 45.527 -4.562  -7.344  1.00 18.28 ? 8   DA  T "C4'" 1 
ATOM   3561 O  "O4'" . DA  B 2 8   ? 44.703 -4.757  -6.173  1.00 23.34 ? 8   DA  T "O4'" 1 
ATOM   3562 C  "C3'" . DA  B 2 8   ? 45.028 -5.533  -8.416  1.00 22.28 ? 8   DA  T "C3'" 1 
ATOM   3563 O  "O3'" . DA  B 2 8   ? 45.884 -6.651  -8.487  1.00 20.43 ? 8   DA  T "O3'" 1 
ATOM   3564 C  "C2'" . DA  B 2 8   ? 43.655 -5.960  -7.921  1.00 24.43 ? 8   DA  T "C2'" 1 
ATOM   3565 C  "C1'" . DA  B 2 8   ? 43.795 -5.809  -6.410  1.00 24.35 ? 8   DA  T "C1'" 1 
ATOM   3566 N  N9    . DA  B 2 8   ? 42.513 -5.452  -5.837  1.00 19.44 ? 8   DA  T N9    1 
ATOM   3567 C  C8    . DA  B 2 8   ? 41.721 -4.406  -6.226  1.00 19.96 ? 8   DA  T C8    1 
ATOM   3568 N  N7    . DA  B 2 8   ? 40.607 -4.326  -5.555  1.00 15.28 ? 8   DA  T N7    1 
ATOM   3569 C  C5    . DA  B 2 8   ? 40.670 -5.387  -4.673  1.00 17.09 ? 8   DA  T C5    1 
ATOM   3570 C  C6    . DA  B 2 8   ? 39.779 -5.834  -3.685  1.00 15.97 ? 8   DA  T C6    1 
ATOM   3571 N  N6    . DA  B 2 8   ? 38.603 -5.229  -3.434  1.00 16.32 ? 8   DA  T N6    1 
ATOM   3572 N  N1    . DA  B 2 8   ? 40.138 -6.932  -2.983  1.00 14.73 ? 8   DA  T N1    1 
ATOM   3573 C  C2    . DA  B 2 8   ? 41.307 -7.521  -3.257  1.00 14.37 ? 8   DA  T C2    1 
ATOM   3574 N  N3    . DA  B 2 8   ? 42.234 -7.188  -4.156  1.00 13.84 ? 8   DA  T N3    1 
ATOM   3575 C  C4    . DA  B 2 8   ? 41.841 -6.099  -4.837  1.00 17.94 ? 8   DA  T C4    1 
ATOM   3576 P  P     . DC  B 2 9   ? 45.711 -7.736  -9.662  1.00 25.01 ? 9   DC  T P     1 
ATOM   3577 O  OP1   . DC  B 2 9   ? 47.054 -8.220  -10.027 1.00 25.45 ? 9   DC  T OP1   1 
ATOM   3578 O  OP2   . DC  B 2 9   ? 44.823 -7.163  -10.698 1.00 26.66 ? 9   DC  T OP2   1 
ATOM   3579 O  "O5'" . DC  B 2 9   ? 44.881 -8.906  -8.965  1.00 19.84 ? 9   DC  T "O5'" 1 
ATOM   3580 C  "C5'" . DC  B 2 9   ? 45.437 -9.526  -7.826  1.00 22.52 ? 9   DC  T "C5'" 1 
ATOM   3581 C  "C4'" . DC  B 2 9   ? 44.385 -10.409 -7.205  1.00 18.93 ? 9   DC  T "C4'" 1 
ATOM   3582 O  "O4'" . DC  B 2 9   ? 43.298 -9.599  -6.700  1.00 25.08 ? 9   DC  T "O4'" 1 
ATOM   3583 C  "C3'" . DC  B 2 9   ? 43.746 -11.384 -8.182  1.00 23.97 ? 9   DC  T "C3'" 1 
ATOM   3584 O  "O3'" . DC  B 2 9   ? 43.829 -12.651 -7.576  1.00 31.91 ? 9   DC  T "O3'" 1 
ATOM   3585 C  "C2'" . DC  B 2 9   ? 42.300 -10.915 -8.306  1.00 22.61 ? 9   DC  T "C2'" 1 
ATOM   3586 C  "C1'" . DC  B 2 9   ? 42.098 -10.293 -6.933  1.00 22.94 ? 9   DC  T "C1'" 1 
ATOM   3587 N  N1    . DC  B 2 9   ? 40.981 -9.335  -6.890  1.00 17.75 ? 9   DC  T N1    1 
ATOM   3588 C  C2    . DC  B 2 9   ? 40.058 -9.445  -5.858  1.00 18.14 ? 9   DC  T C2    1 
ATOM   3589 O  O2    . DC  B 2 9   ? 40.218 -10.343 -5.019  1.00 18.68 ? 9   DC  T O2    1 
ATOM   3590 N  N3    . DC  B 2 9   ? 39.026 -8.575  -5.812  1.00 17.66 ? 9   DC  T N3    1 
ATOM   3591 C  C4    . DC  B 2 9   ? 38.905 -7.622  -6.743  1.00 22.80 ? 9   DC  T C4    1 
ATOM   3592 N  N4    . DC  B 2 9   ? 37.864 -6.787  -6.651  1.00 24.58 ? 9   DC  T N4    1 
ATOM   3593 C  C5    . DC  B 2 9   ? 39.844 -7.495  -7.805  1.00 24.39 ? 9   DC  T C5    1 
ATOM   3594 C  C6    . DC  B 2 9   ? 40.864 -8.364  -7.838  1.00 20.36 ? 9   DC  T C6    1 
ATOM   3595 P  P     . DG  B 2 10  ? 43.391 -13.968 -8.383  1.00 27.95 ? 10  DG  T P     1 
ATOM   3596 O  OP1   . DG  B 2 10  ? 44.571 -14.847 -8.491  1.00 43.27 ? 10  DG  T OP1   1 
ATOM   3597 O  OP2   . DG  B 2 10  ? 42.646 -13.551 -9.591  1.00 28.17 ? 10  DG  T OP2   1 
ATOM   3598 O  "O5'" . DG  B 2 10  ? 42.330 -14.650 -7.417  1.00 25.69 ? 10  DG  T "O5'" 1 
ATOM   3599 C  "C5'" . DG  B 2 10  ? 42.552 -14.647 -6.020  1.00 25.29 ? 10  DG  T "C5'" 1 
ATOM   3600 C  "C4'" . DG  B 2 10  ? 41.395 -15.335 -5.325  1.00 24.27 ? 10  DG  T "C4'" 1 
ATOM   3601 O  "O4'" . DG  B 2 10  ? 40.328 -14.385 -5.085  1.00 28.04 ? 10  DG  T "O4'" 1 
ATOM   3602 C  "C3'" . DG  B 2 10  ? 40.773 -16.475 -6.124  1.00 30.11 ? 10  DG  T "C3'" 1 
ATOM   3603 O  "O3'" . DG  B 2 10  ? 40.243 -17.422 -5.200  1.00 34.92 ? 10  DG  T "O3'" 1 
ATOM   3604 C  "C2'" . DG  B 2 10  ? 39.689 -15.752 -6.912  1.00 29.06 ? 10  DG  T "C2'" 1 
ATOM   3605 C  "C1'" . DG  B 2 10  ? 39.216 -14.719 -5.896  1.00 28.80 ? 10  DG  T "C1'" 1 
ATOM   3606 N  N9    . DG  B 2 10  ? 38.693 -13.500 -6.514  1.00 22.01 ? 10  DG  T N9    1 
ATOM   3607 C  C8    . DG  B 2 10  ? 39.294 -12.700 -7.455  1.00 24.25 ? 10  DG  T C8    1 
ATOM   3608 N  N7    . DG  B 2 10  ? 38.566 -11.675 -7.813  1.00 19.98 ? 10  DG  T N7    1 
ATOM   3609 C  C5    . DG  B 2 10  ? 37.408 -11.813 -7.063  1.00 19.65 ? 10  DG  T C5    1 
ATOM   3610 C  C6    . DG  B 2 10  ? 36.249 -11.009 -7.016  1.00 17.27 ? 10  DG  T C6    1 
ATOM   3611 O  O6    . DG  B 2 10  ? 36.003 -9.979  -7.649  1.00 23.42 ? 10  DG  T O6    1 
ATOM   3612 N  N1    . DG  B 2 10  ? 35.315 -11.512 -6.109  1.00 20.97 ? 10  DG  T N1    1 
ATOM   3613 C  C2    . DG  B 2 10  ? 35.478 -12.649 -5.348  1.00 21.29 ? 10  DG  T C2    1 
ATOM   3614 N  N2    . DG  B 2 10  ? 34.462 -12.981 -4.534  1.00 21.12 ? 10  DG  T N2    1 
ATOM   3615 N  N3    . DG  B 2 10  ? 36.561 -13.414 -5.378  1.00 23.04 ? 10  DG  T N3    1 
ATOM   3616 C  C4    . DG  B 2 10  ? 37.479 -12.927 -6.251  1.00 16.76 ? 10  DG  T C4    1 
ATOM   3617 P  P     . DC  B 2 11  ? 39.562 -18.786 -5.721  1.00 34.65 ? 11  DC  T P     1 
ATOM   3618 O  OP1   . DC  B 2 11  ? 39.957 -19.872 -4.802  1.00 44.13 ? 11  DC  T OP1   1 
ATOM   3619 O  OP2   . DC  B 2 11  ? 39.824 -18.921 -7.164  1.00 25.13 ? 11  DC  T OP2   1 
ATOM   3620 O  "O5'" . DC  B 2 11  ? 38.007 -18.507 -5.557  1.00 27.25 ? 11  DC  T "O5'" 1 
ATOM   3621 C  "C5'" . DC  B 2 11  ? 37.417 -18.310 -4.294  1.00 29.17 ? 11  DC  T "C5'" 1 
ATOM   3622 C  "C4'" . DC  B 2 11  ? 35.910 -18.248 -4.475  1.00 24.50 ? 11  DC  T "C4'" 1 
ATOM   3623 O  "O4'" . DC  B 2 11  ? 35.520 -16.999 -5.103  1.00 22.91 ? 11  DC  T "O4'" 1 
ATOM   3624 C  "C3'" . DC  B 2 11  ? 35.302 -19.367 -5.325  1.00 18.07 ? 11  DC  T "C3'" 1 
ATOM   3625 O  "O3'" . DC  B 2 11  ? 34.240 -19.904 -4.541  1.00 17.86 ? 11  DC  T "O3'" 1 
ATOM   3626 C  "C2'" . DC  B 2 11  ? 34.823 -18.675 -6.609  1.00 18.52 ? 11  DC  T "C2'" 1 
ATOM   3627 C  "C1'" . DC  B 2 11  ? 34.583 -17.246 -6.135  1.00 23.54 ? 11  DC  T "C1'" 1 
ATOM   3628 N  N1    . DC  B 2 11  ? 34.798 -16.146 -7.123  1.00 15.54 ? 11  DC  T N1    1 
ATOM   3629 C  C2    . DC  B 2 11  ? 33.779 -15.203 -7.298  1.00 15.63 ? 11  DC  T C2    1 
ATOM   3630 O  O2    . DC  B 2 11  ? 32.720 -15.302 -6.668  1.00 16.22 ? 11  DC  T O2    1 
ATOM   3631 N  N3    . DC  B 2 11  ? 33.971 -14.188 -8.182  1.00 14.78 ? 11  DC  T N3    1 
ATOM   3632 C  C4    . DC  B 2 11  ? 35.115 -14.099 -8.856  1.00 17.06 ? 11  DC  T C4    1 
ATOM   3633 N  N4    . DC  B 2 11  ? 35.238 -13.066 -9.707  1.00 15.55 ? 11  DC  T N4    1 
ATOM   3634 C  C5    . DC  B 2 11  ? 36.168 -15.043 -8.688  1.00 14.35 ? 11  DC  T C5    1 
ATOM   3635 C  C6    . DC  B 2 11  ? 35.971 -16.049 -7.810  1.00 16.94 ? 11  DC  T C6    1 
ATOM   3636 P  P     . DT  B 2 12  ? 33.472 -21.233 -5.016  1.00 17.79 ? 12  DT  T P     1 
ATOM   3637 O  OP1   . DT  B 2 12  ? 32.920 -21.893 -3.814  1.00 20.67 ? 12  DT  T OP1   1 
ATOM   3638 O  OP2   . DT  B 2 12  ? 34.364 -21.979 -5.916  1.00 15.48 ? 12  DT  T OP2   1 
ATOM   3639 O  "O5'" . DT  B 2 12  ? 32.262 -20.664 -5.886  1.00 20.79 ? 12  DT  T "O5'" 1 
ATOM   3640 C  "C5'" . DT  B 2 12  ? 31.157 -20.113 -5.199  1.00 17.23 ? 12  DT  T "C5'" 1 
ATOM   3641 C  "C4'" . DT  B 2 12  ? 30.142 -19.642 -6.209  1.00 21.79 ? 12  DT  T "C4'" 1 
ATOM   3642 O  "O4'" . DT  B 2 12  ? 30.727 -18.529 -6.918  1.00 19.36 ? 12  DT  T "O4'" 1 
ATOM   3643 C  "C3'" . DT  B 2 12  ? 29.799 -20.699 -7.256  1.00 20.59 ? 12  DT  T "C3'" 1 
ATOM   3644 O  "O3'" . DT  B 2 12  ? 28.387 -20.758 -7.440  1.00 20.57 ? 12  DT  T "O3'" 1 
ATOM   3645 C  "C2'" . DT  B 2 12  ? 30.535 -20.208 -8.504  1.00 20.00 ? 12  DT  T "C2'" 1 
ATOM   3646 C  "C1'" . DT  B 2 12  ? 30.445 -18.704 -8.291  1.00 22.38 ? 12  DT  T "C1'" 1 
ATOM   3647 N  N1    . DT  B 2 12  ? 31.409 -17.899 -9.095  1.00 28.93 ? 12  DT  T N1    1 
ATOM   3648 C  C2    . DT  B 2 12  ? 31.053 -16.622 -9.471  1.00 19.07 ? 12  DT  T C2    1 
ATOM   3649 O  O2    . DT  B 2 12  ? 29.994 -16.104 -9.181  1.00 30.00 ? 12  DT  T O2    1 
ATOM   3650 N  N3    . DT  B 2 12  ? 31.984 -15.959 -10.209 1.00 24.39 ? 12  DT  T N3    1 
ATOM   3651 C  C4    . DT  B 2 12  ? 33.215 -16.434 -10.613 1.00 22.01 ? 12  DT  T C4    1 
ATOM   3652 O  O4    . DT  B 2 12  ? 33.968 -15.739 -11.287 1.00 24.14 ? 12  DT  T O4    1 
ATOM   3653 C  C5    . DT  B 2 12  ? 33.533 -17.776 -10.187 1.00 22.50 ? 12  DT  T C5    1 
ATOM   3654 C  C7    . DT  B 2 12  ? 34.843 -18.397 -10.561 1.00 21.42 ? 12  DT  T C7    1 
ATOM   3655 C  C6    . DT  B 2 12  ? 32.627 -18.442 -9.456  1.00 24.52 ? 12  DT  T C6    1 
ATOM   3656 O  "O5'" A DA  C 3 1   ? 29.028 -7.408  -14.915 0.50 29.93 ? 1   DA  P "O5'" 1 
ATOM   3657 O  "O5'" B DA  C 3 1   ? 29.393 -8.391  -15.746 0.50 29.90 ? 1   DA  P "O5'" 1 
ATOM   3658 C  "C5'" A DA  C 3 1   ? 27.772 -7.780  -15.461 0.50 28.06 ? 1   DA  P "C5'" 1 
ATOM   3659 C  "C5'" B DA  C 3 1   ? 27.995 -8.193  -15.893 0.50 28.36 ? 1   DA  P "C5'" 1 
ATOM   3660 C  "C4'" A DA  C 3 1   ? 26.964 -8.598  -14.469 0.50 28.29 ? 1   DA  P "C4'" 1 
ATOM   3661 C  "C4'" B DA  C 3 1   ? 27.229 -8.651  -14.662 0.50 28.00 ? 1   DA  P "C4'" 1 
ATOM   3662 O  "O4'" A DA  C 3 1   ? 27.556 -9.916  -14.374 0.50 31.02 ? 1   DA  P "O4'" 1 
ATOM   3663 O  "O4'" B DA  C 3 1   ? 27.537 -10.038 -14.387 0.50 31.02 ? 1   DA  P "O4'" 1 
ATOM   3664 C  "C3'" A DA  C 3 1   ? 26.885 -8.020  -13.056 0.50 23.26 ? 1   DA  P "C3'" 1 
ATOM   3665 C  "C3'" B DA  C 3 1   ? 27.499 -7.866  -13.384 0.50 23.83 ? 1   DA  P "C3'" 1 
ATOM   3666 O  "O3'" A DA  C 3 1   ? 25.513 -7.945  -12.633 0.50 19.55 ? 1   DA  P "O3'" 1 
ATOM   3667 O  "O3'" B DA  C 3 1   ? 26.294 -7.287  -12.958 0.50 23.04 ? 1   DA  P "O3'" 1 
ATOM   3668 C  "C2'" A DA  C 3 1   ? 27.732 -8.964  -12.194 0.50 26.15 ? 1   DA  P "C2'" 1 
ATOM   3669 C  "C2'" B DA  C 3 1   ? 27.932 -8.877  -12.330 0.50 26.44 ? 1   DA  P "C2'" 1 
ATOM   3670 C  "C1'" A DA  C 3 1   ? 27.938 -10.219 -13.049 0.50 26.27 ? 1   DA  P "C1'" 1 
ATOM   3671 C  "C1'" B DA  C 3 1   ? 27.960 -10.215 -13.053 0.50 26.27 ? 1   DA  P "C1'" 1 
ATOM   3672 N  N9    . DA  C 3 1   ? 29.312 -10.734 -13.097 1.00 23.60 ? 1   DA  P N9    1 
ATOM   3673 C  C8    . DA  C 3 1   ? 30.339 -10.287 -13.879 1.00 27.38 ? 1   DA  P C8    1 
ATOM   3674 N  N7    . DA  C 3 1   ? 31.456 -10.955 -13.704 1.00 29.04 ? 1   DA  P N7    1 
ATOM   3675 C  C5    . DA  C 3 1   ? 31.129 -11.899 -12.743 1.00 22.05 ? 1   DA  P C5    1 
ATOM   3676 C  C6    . DA  C 3 1   ? 31.872 -12.918 -12.121 1.00 23.53 ? 1   DA  P C6    1 
ATOM   3677 N  N6    . DA  C 3 1   ? 33.156 -13.156 -12.388 1.00 26.56 ? 1   DA  P N6    1 
ATOM   3678 N  N1    . DA  C 3 1   ? 31.239 -13.682 -11.207 1.00 28.46 ? 1   DA  P N1    1 
ATOM   3679 C  C2    . DA  C 3 1   ? 29.952 -13.445 -10.939 1.00 22.41 ? 1   DA  P C2    1 
ATOM   3680 N  N3    A DA  C 3 1   ? 29.150 -12.518 -11.459 0.50 22.99 ? 1   DA  P N3    1 
ATOM   3681 N  N3    B DA  C 3 1   ? 29.150 -12.517 -11.458 0.50 22.99 ? 1   DA  P N3    1 
ATOM   3682 C  C4    . DA  C 3 1   ? 29.811 -11.776 -12.360 1.00 24.42 ? 1   DA  P C4    1 
ATOM   3683 P  P     A DG  C 3 2   ? 25.001 -6.689  -11.764 0.50 17.04 ? 2   DG  P P     1 
ATOM   3684 P  P     B DG  C 3 2   ? 26.288 -6.248  -11.733 0.50 26.08 ? 2   DG  P P     1 
ATOM   3685 O  OP1   A DG  C 3 2   ? 23.527 -6.651  -11.829 0.50 19.58 ? 2   DG  P OP1   1 
ATOM   3686 O  OP1   B DG  C 3 2   ? 24.962 -5.594  -11.704 0.50 27.34 ? 2   DG  P OP1   1 
ATOM   3687 O  OP2   A DG  C 3 2   ? 25.791 -5.505  -12.169 0.50 24.34 ? 2   DG  P OP2   1 
ATOM   3688 O  OP2   B DG  C 3 2   ? 27.530 -5.445  -11.810 0.50 27.61 ? 2   DG  P OP2   1 
ATOM   3689 O  "O5'" A DG  C 3 2   ? 25.418 -7.076  -10.277 0.50 22.84 ? 2   DG  P "O5'" 1 
ATOM   3690 O  "O5'" B DG  C 3 2   ? 26.421 -7.185  -10.445 0.50 23.66 ? 2   DG  P "O5'" 1 
ATOM   3691 C  "C5'" A DG  C 3 2   ? 24.751 -8.145  -9.637  0.50 24.74 ? 2   DG  P "C5'" 1 
ATOM   3692 C  "C5'" B DG  C 3 2   ? 25.273 -7.826  -9.916  0.50 23.76 ? 2   DG  P "C5'" 1 
ATOM   3693 C  "C4'" A DG  C 3 2   ? 25.599 -8.697  -8.507  0.50 21.70 ? 2   DG  P "C4'" 1 
ATOM   3694 C  "C4'" B DG  C 3 2   ? 25.641 -8.555  -8.638  0.50 21.65 ? 2   DG  P "C4'" 1 
ATOM   3695 O  "O4'" A DG  C 3 2   ? 26.829 -9.270  -9.011  0.50 21.45 ? 2   DG  P "O4'" 1 
ATOM   3696 O  "O4'" B DG  C 3 2   ? 26.789 -9.397  -8.915  0.50 21.41 ? 2   DG  P "O4'" 1 
ATOM   3697 C  "C3'" A DG  C 3 2   ? 26.005 -7.692  -7.431  0.50 22.78 ? 2   DG  P "C3'" 1 
ATOM   3698 C  "C3'" B DG  C 3 2   ? 26.021 -7.662  -7.454  0.50 22.77 ? 2   DG  P "C3'" 1 
ATOM   3699 O  "O3'" A DG  C 3 2   ? 25.425 -8.197  -6.248  0.50 29.40 ? 2   DG  P "O3'" 1 
ATOM   3700 O  "O3'" B DG  C 3 2   ? 25.432 -8.192  -6.258  0.50 29.39 ? 2   DG  P "O3'" 1 
ATOM   3701 C  "C2'" A DG  C 3 2   ? 27.533 -7.744  -7.416  0.50 23.03 ? 2   DG  P "C2'" 1 
ATOM   3702 C  "C2'" B DG  C 3 2   ? 27.546 -7.724  -7.451  0.50 23.02 ? 2   DG  P "C2'" 1 
ATOM   3703 C  "C1'" A DG  C 3 2   ? 27.807 -9.120  -8.007  0.50 21.37 ? 2   DG  P "C1'" 1 
ATOM   3704 C  "C1'" B DG  C 3 2   ? 27.813 -9.127  -7.983  0.50 21.38 ? 2   DG  P "C1'" 1 
ATOM   3705 N  N9    . DG  C 3 2   ? 29.129 -9.280  -8.606  1.00 21.20 ? 2   DG  P N9    1 
ATOM   3706 C  C8    . DG  C 3 2   ? 29.781 -8.415  -9.461  1.00 18.59 ? 2   DG  P C8    1 
ATOM   3707 N  N7    . DG  C 3 2   ? 30.960 -8.844  -9.831  1.00 21.26 ? 2   DG  P N7    1 
ATOM   3708 C  C5    . DG  C 3 2   ? 31.096 -10.074 -9.180  1.00 19.99 ? 2   DG  P C5    1 
ATOM   3709 C  C6    . DG  C 3 2   ? 32.153 -11.019 -9.180  1.00 16.64 ? 2   DG  P C6    1 
ATOM   3710 O  O6    . DG  C 3 2   ? 33.233 -10.970 -9.784  1.00 16.68 ? 2   DG  P O6    1 
ATOM   3711 N  N1    . DG  C 3 2   ? 31.869 -12.123 -8.375  1.00 17.89 ? 2   DG  P N1    1 
ATOM   3712 C  C2    . DG  C 3 2   ? 30.704 -12.289 -7.666  1.00 16.32 ? 2   DG  P C2    1 
ATOM   3713 N  N2    . DG  C 3 2   ? 30.579 -13.414 -6.937  1.00 17.07 ? 2   DG  P N2    1 
ATOM   3714 N  N3    . DG  C 3 2   ? 29.713 -11.415 -7.656  1.00 23.75 ? 2   DG  P N3    1 
ATOM   3715 C  C4    . DG  C 3 2   ? 29.978 -10.340 -8.429  1.00 21.15 ? 2   DG  P C4    1 
ATOM   3716 P  P     . DC  C 3 3   ? 25.660 -7.465  -4.837  1.00 27.65 ? 3   DC  P P     1 
ATOM   3717 O  OP1   . DC  C 3 3   ? 24.381 -7.477  -4.108  1.00 30.48 ? 3   DC  P OP1   1 
ATOM   3718 O  OP2   . DC  C 3 3   ? 26.384 -6.198  -5.080  1.00 33.02 ? 3   DC  P OP2   1 
ATOM   3719 O  "O5'" . DC  C 3 3   ? 26.676 -8.441  -4.078  1.00 33.62 ? 3   DC  P "O5'" 1 
ATOM   3720 C  "C5'" . DC  C 3 3   ? 26.363 -9.816  -3.902  1.00 39.61 ? 3   DC  P "C5'" 1 
ATOM   3721 C  "C4'" . DC  C 3 3   ? 27.577 -10.544 -3.358  1.00 36.38 ? 3   DC  P "C4'" 1 
ATOM   3722 O  "O4'" . DC  C 3 3   ? 28.586 -10.570 -4.394  1.00 32.88 ? 3   DC  P "O4'" 1 
ATOM   3723 C  "C3'" . DC  C 3 3   ? 28.216 -9.880  -2.136  1.00 32.52 ? 3   DC  P "C3'" 1 
ATOM   3724 O  "O3'" . DC  C 3 3   ? 28.101 -10.717 -0.989  1.00 37.08 ? 3   DC  P "O3'" 1 
ATOM   3725 C  "C2'" . DC  C 3 3   ? 29.680 -9.665  -2.511  1.00 34.10 ? 3   DC  P "C2'" 1 
ATOM   3726 C  "C1'" . DC  C 3 3   ? 29.856 -10.483 -3.788  1.00 33.01 ? 3   DC  P "C1'" 1 
ATOM   3727 N  N1    . DC  C 3 3   ? 30.796 -9.810  -4.717  1.00 30.42 ? 3   DC  P N1    1 
ATOM   3728 C  C2    . DC  C 3 3   ? 32.002 -10.439 -5.034  1.00 18.20 ? 3   DC  P C2    1 
ATOM   3729 O  O2    . DC  C 3 3   ? 32.237 -11.550 -4.551  1.00 29.92 ? 3   DC  P O2    1 
ATOM   3730 N  N3    . DC  C 3 3   ? 32.867 -9.816  -5.864  1.00 26.44 ? 3   DC  P N3    1 
ATOM   3731 C  C4    . DC  C 3 3   ? 32.565 -8.618  -6.360  1.00 24.59 ? 3   DC  P C4    1 
ATOM   3732 N  N4    . DC  C 3 3   ? 33.456 -8.046  -7.175  1.00 23.97 ? 3   DC  P N4    1 
ATOM   3733 C  C5    . DC  C 3 3   ? 31.339 -7.955  -6.041  1.00 29.93 ? 3   DC  P C5    1 
ATOM   3734 C  C6    . DC  C 3 3   ? 30.493 -8.579  -5.216  1.00 27.62 ? 3   DC  P C6    1 
ATOM   3735 P  P     . DG  C 3 4   ? 28.713 -10.245 0.421   1.00 35.61 ? 4   DG  P P     1 
ATOM   3736 O  OP1   . DG  C 3 4   ? 27.958 -10.929 1.497   1.00 44.88 ? 4   DG  P OP1   1 
ATOM   3737 O  OP2   . DG  C 3 4   ? 28.826 -8.770  0.405   1.00 35.10 ? 4   DG  P OP2   1 
ATOM   3738 O  "O5'" . DG  C 3 4   ? 30.204 -10.826 0.397   1.00 36.76 ? 4   DG  P "O5'" 1 
ATOM   3739 C  "C5'" . DG  C 3 4   ? 30.408 -12.223 0.231   1.00 38.06 ? 4   DG  P "C5'" 1 
ATOM   3740 C  "C4'" . DG  C 3 4   ? 31.895 -12.525 0.216   1.00 42.13 ? 4   DG  P "C4'" 1 
ATOM   3741 O  "O4'" . DG  C 3 4   ? 32.496 -11.929 -0.963  1.00 36.02 ? 4   DG  P "O4'" 1 
ATOM   3742 C  "C3'" . DG  C 3 4   ? 32.646 -11.980 1.430   1.00 29.74 ? 4   DG  P "C3'" 1 
ATOM   3743 O  "O3'" . DG  C 3 4   ? 33.325 -13.057 2.086   1.00 42.56 ? 4   DG  P "O3'" 1 
ATOM   3744 C  "C2'" . DG  C 3 4   ? 33.594 -10.930 0.855   1.00 29.84 ? 4   DG  P "C2'" 1 
ATOM   3745 C  "C1'" . DG  C 3 4   ? 33.723 -11.329 -0.610  1.00 26.92 ? 4   DG  P "C1'" 1 
ATOM   3746 N  N9    . DG  C 3 4   ? 33.953 -10.197 -1.504  1.00 25.79 ? 4   DG  P N9    1 
ATOM   3747 C  C8    . DG  C 3 4   ? 33.133 -9.116  -1.760  1.00 24.89 ? 4   DG  P C8    1 
ATOM   3748 N  N7    . DG  C 3 4   ? 33.635 -8.275  -2.628  1.00 25.80 ? 4   DG  P N7    1 
ATOM   3749 C  C5    . DG  C 3 4   ? 34.868 -8.835  -2.961  1.00 21.07 ? 4   DG  P C5    1 
ATOM   3750 C  C6    . DG  C 3 4   ? 35.872 -8.390  -3.841  1.00 22.77 ? 4   DG  P C6    1 
ATOM   3751 O  O6    . DG  C 3 4   ? 35.886 -7.363  -4.535  1.00 26.53 ? 4   DG  P O6    1 
ATOM   3752 N  N1    . DG  C 3 4   ? 36.955 -9.269  -3.874  1.00 18.66 ? 4   DG  P N1    1 
ATOM   3753 C  C2    . DG  C 3 4   ? 37.054 -10.432 -3.149  1.00 16.24 ? 4   DG  P C2    1 
ATOM   3754 N  N2    . DG  C 3 4   ? 38.168 -11.158 -3.297  1.00 16.06 ? 4   DG  P N2    1 
ATOM   3755 N  N3    . DG  C 3 4   ? 36.122 -10.865 -2.317  1.00 20.86 ? 4   DG  P N3    1 
ATOM   3756 C  C4    . DG  C 3 4   ? 35.066 -10.015 -2.279  1.00 19.70 ? 4   DG  P C4    1 
ATOM   3757 P  P     . DT  C 3 5   ? 34.101 -12.804 3.472   1.00 43.35 ? 5   DT  P P     1 
ATOM   3758 O  OP1   . DT  C 3 5   ? 33.987 -14.028 4.288   1.00 35.59 ? 5   DT  P OP1   1 
ATOM   3759 O  OP2   . DT  C 3 5   ? 33.668 -11.502 4.013   1.00 34.52 ? 5   DT  P OP2   1 
ATOM   3760 O  "O5'" . DT  C 3 5   ? 35.622 -12.622 3.018   1.00 37.07 ? 5   DT  P "O5'" 1 
ATOM   3761 C  "C5'" . DT  C 3 5   ? 36.183 -13.551 2.121   1.00 25.11 ? 5   DT  P "C5'" 1 
ATOM   3762 C  "C4'" . DT  C 3 5   ? 37.616 -13.154 1.823   1.00 21.48 ? 5   DT  P "C4'" 1 
ATOM   3763 O  "O4'" . DT  C 3 5   ? 37.663 -12.109 0.820   1.00 19.59 ? 5   DT  P "O4'" 1 
ATOM   3764 C  "C3'" . DT  C 3 5   ? 38.395 -12.638 3.027   1.00 18.64 ? 5   DT  P "C3'" 1 
ATOM   3765 O  "O3'" . DT  C 3 5   ? 39.600 -13.375 3.063   1.00 21.30 ? 5   DT  P "O3'" 1 
ATOM   3766 C  "C2'" . DT  C 3 5   ? 38.636 -11.161 2.714   1.00 16.71 ? 5   DT  P "C2'" 1 
ATOM   3767 C  "C1'" . DT  C 3 5   ? 38.650 -11.161 1.197   1.00 18.58 ? 5   DT  P "C1'" 1 
ATOM   3768 N  N1    . DT  C 3 5   ? 38.225 -9.888  0.553   1.00 16.23 ? 5   DT  P N1    1 
ATOM   3769 C  C2    . DT  C 3 5   ? 39.027 -9.307  -0.398  1.00 17.73 ? 5   DT  P C2    1 
ATOM   3770 O  O2    . DT  C 3 5   ? 40.096 -9.765  -0.745  1.00 15.73 ? 5   DT  P O2    1 
ATOM   3771 N  N3    . DT  C 3 5   ? 38.532 -8.153  -0.945  1.00 15.54 ? 5   DT  P N3    1 
ATOM   3772 C  C4    . DT  C 3 5   ? 37.328 -7.555  -0.638  1.00 14.31 ? 5   DT  P C4    1 
ATOM   3773 O  O4    . DT  C 3 5   ? 36.977 -6.511  -1.199  1.00 16.26 ? 5   DT  P O4    1 
ATOM   3774 C  C5    . DT  C 3 5   ? 36.536 -8.218  0.374   1.00 20.42 ? 5   DT  P C5    1 
ATOM   3775 C  C7    . DT  C 3 5   ? 35.214 -7.659  0.804   1.00 19.85 ? 5   DT  P C7    1 
ATOM   3776 C  C6    . DT  C 3 5   ? 37.012 -9.346  0.922   1.00 16.58 ? 5   DT  P C6    1 
ATOM   3777 P  P     . DC  C 3 6   ? 40.589 -13.267 4.324   1.00 14.32 ? 6   DC  P P     1 
ATOM   3778 O  OP1   . DC  C 3 6   ? 41.310 -14.571 4.445   1.00 17.61 ? 6   DC  P OP1   1 
ATOM   3779 O  OP2   . DC  C 3 6   ? 39.827 -12.738 5.464   1.00 15.42 ? 6   DC  P OP2   1 
ATOM   3780 O  "O5'" . DC  C 3 6   ? 41.634 -12.160 3.876   1.00 14.65 ? 6   DC  P "O5'" 1 
ATOM   3781 C  "C5'" . DC  C 3 6   ? 42.524 -12.411 2.813   1.00 12.61 ? 6   DC  P "C5'" 1 
ATOM   3782 C  "C4'" . DC  C 3 6   ? 43.229 -11.107 2.496   1.00 15.53 ? 6   DC  P "C4'" 1 
ATOM   3783 O  "O4'" . DC  C 3 6   ? 42.279 -10.227 1.858   1.00 14.94 ? 6   DC  P "O4'" 1 
ATOM   3784 C  "C3'" . DC  C 3 6   ? 43.762 -10.333 3.699   1.00 13.04 ? 6   DC  P "C3'" 1 
ATOM   3785 O  "O3'" . DC  C 3 6   ? 45.166 -10.547 3.676   1.00 11.98 ? 6   DC  P "O3'" 1 
ATOM   3786 C  "C2'" . DC  C 3 6   ? 43.352 -8.875  3.432   1.00 12.25 ? 6   DC  P "C2'" 1 
ATOM   3787 C  "C1'" . DC  C 3 6   ? 42.756 -8.921  2.027   1.00 14.78 ? 6   DC  P "C1'" 1 
ATOM   3788 N  N1    . DC  C 3 6   ? 41.641 -7.953  1.854   1.00 14.10 ? 6   DC  P N1    1 
ATOM   3789 C  C2    . DC  C 3 6   ? 41.740 -7.008  0.825   1.00 11.61 ? 6   DC  P C2    1 
ATOM   3790 O  O2    . DC  C 3 6   ? 42.721 -7.028  0.066   1.00 14.26 ? 6   DC  P O2    1 
ATOM   3791 N  N3    . DC  C 3 6   ? 40.735 -6.108  0.680   1.00 14.02 ? 6   DC  P N3    1 
ATOM   3792 C  C4    . DC  C 3 6   ? 39.692 -6.121  1.513   1.00 14.39 ? 6   DC  P C4    1 
ATOM   3793 N  N4    . DC  C 3 6   ? 38.744 -5.204  1.305   1.00 15.81 ? 6   DC  P N4    1 
ATOM   3794 C  C5    . DC  C 3 6   ? 39.571 -7.064  2.581   1.00 13.63 ? 6   DC  P C5    1 
ATOM   3795 C  C6    . DC  C 3 6   ? 40.567 -7.957  2.710   1.00 13.94 ? 6   DC  P C6    1 
ATOM   3796 P  P     . DA  C 3 7   ? 46.144 -9.782  4.704   1.00 12.66 ? 7   DA  P P     1 
ATOM   3797 O  OP1   . DA  C 3 7   ? 47.370 -10.602 4.860   1.00 15.68 ? 7   DA  P OP1   1 
ATOM   3798 O  OP2   . DA  C 3 7   ? 45.374 -9.426  5.909   1.00 15.32 ? 7   DA  P OP2   1 
ATOM   3799 O  "O5'" A DA  C 3 7   ? 46.454 -8.390  3.971   0.50 16.12 ? 7   DA  P "O5'" 1 
ATOM   3800 O  "O5'" B DA  C 3 7   ? 46.446 -8.386  3.976   0.50 16.11 ? 7   DA  P "O5'" 1 
ATOM   3801 C  "C5'" A DA  C 3 7   ? 47.157 -8.303  2.741   0.50 19.51 ? 7   DA  P "C5'" 1 
ATOM   3802 C  "C5'" B DA  C 3 7   ? 47.172 -8.285  2.765   0.50 19.52 ? 7   DA  P "C5'" 1 
ATOM   3803 C  "C4'" A DA  C 3 7   ? 47.040 -6.887  2.204   0.50 22.01 ? 7   DA  P "C4'" 1 
ATOM   3804 C  "C4'" B DA  C 3 7   ? 47.058 -6.864  2.242   0.50 22.02 ? 7   DA  P "C4'" 1 
ATOM   3805 O  "O4'" A DA  C 3 7   ? 45.655 -6.604  1.893   0.50 19.11 ? 7   DA  P "O4'" 1 
ATOM   3806 O  "O4'" B DA  C 3 7   ? 45.698 -6.592  1.820   0.50 19.18 ? 7   DA  P "O4'" 1 
ATOM   3807 C  "C3'" A DA  C 3 7   ? 47.376 -5.767  3.184   0.50 20.58 ? 7   DA  P "C3'" 1 
ATOM   3808 C  "C3'" B DA  C 3 7   ? 47.259 -5.749  3.263   0.50 20.60 ? 7   DA  P "C3'" 1 
ATOM   3809 O  "O3'" A DA  C 3 7   ? 48.767 -5.491  3.270   0.50 26.42 ? 7   DA  P "O3'" 1 
ATOM   3810 O  "O3'" B DA  C 3 7   ? 48.608 -5.667  3.810   0.50 28.65 ? 7   DA  P "O3'" 1 
ATOM   3811 C  "C2'" A DA  C 3 7   ? 46.672 -4.567  2.570   0.50 19.24 ? 7   DA  P "C2'" 1 
ATOM   3812 C  "C2'" B DA  C 3 7   ? 46.754 -4.550  2.468   0.50 19.23 ? 7   DA  P "C2'" 1 
ATOM   3813 C  "C1'" A DA  C 3 7   ? 45.557 -5.201  1.753   0.50 20.59 ? 7   DA  P "C1'" 1 
ATOM   3814 C  "C1'" B DA  C 3 7   ? 45.570 -5.181  1.728   0.50 20.59 ? 7   DA  P "C1'" 1 
ATOM   3815 N  N9    . DA  C 3 7   ? 44.252 -4.753  2.203   1.00 15.56 ? 7   DA  P N9    1 
ATOM   3816 C  C8    . DA  C 3 7   ? 43.433 -5.332  3.136   1.00 16.29 ? 7   DA  P C8    1 
ATOM   3817 N  N7    . DA  C 3 7   ? 42.309 -4.674  3.321   1.00 14.77 ? 7   DA  P N7    1 
ATOM   3818 C  C5    . DA  C 3 7   ? 42.408 -3.598  2.444   1.00 16.26 ? 7   DA  P C5    1 
ATOM   3819 C  C6    . DA  C 3 7   ? 41.555 -2.516  2.146   1.00 17.47 ? 7   DA  P C6    1 
ATOM   3820 N  N6    . DA  C 3 7   ? 40.368 -2.344  2.722   1.00 15.13 ? 7   DA  P N6    1 
ATOM   3821 N  N1    . DA  C 3 7   ? 41.974 -1.625  1.225   1.00 11.77 ? 7   DA  P N1    1 
ATOM   3822 C  C2    . DA  C 3 7   ? 43.170 -1.801  0.647   1.00 16.10 ? 7   DA  P C2    1 
ATOM   3823 N  N3    . DA  C 3 7   ? 44.060 -2.773  0.845   1.00 14.54 ? 7   DA  P N3    1 
ATOM   3824 C  C4    . DA  C 3 7   ? 43.602 -3.634  1.761   1.00 16.11 ? 7   DA  P C4    1 
ATOM   3825 P  P     A DT  C 3 8   ? 49.295 -4.270  4.180   0.50 18.09 ? 8   DT  P P     1 
ATOM   3826 P  P     B DT  C 3 8   ? 49.800 -4.939  3.004   0.50 35.49 ? 8   DT  P P     1 
ATOM   3827 O  OP1   A DT  C 3 8   ? 50.746 -4.456  4.402   0.50 23.13 ? 8   DT  P OP1   1 
ATOM   3828 O  OP1   B DT  C 3 8   ? 49.955 -5.602  1.696   0.50 21.17 ? 8   DT  P OP1   1 
ATOM   3829 O  OP2   A DT  C 3 8   ? 48.396 -4.142  5.353   0.50 18.50 ? 8   DT  P OP2   1 
ATOM   3830 O  OP2   B DT  C 3 8   ? 50.944 -4.789  3.930   0.50 25.80 ? 8   DT  P OP2   1 
ATOM   3831 O  "O5'" A DT  C 3 8   ? 49.070 -2.979  3.252   0.50 25.30 ? 8   DT  P "O5'" 1 
ATOM   3832 O  "O5'" B DT  C 3 8   ? 49.250 -3.472  2.736   0.50 24.60 ? 8   DT  P "O5'" 1 
ATOM   3833 C  "C5'" A DT  C 3 8   ? 49.672 -2.812  1.953   0.50 20.45 ? 8   DT  P "C5'" 1 
ATOM   3834 C  "C5'" B DT  C 3 8   ? 49.818 -2.841  1.621   0.50 20.02 ? 8   DT  P "C5'" 1 
ATOM   3835 C  "C4'" . DT  C 3 8   ? 49.372 -1.402  1.467   1.00 14.38 ? 8   DT  P "C4'" 1 
ATOM   3836 O  "O4'" . DT  C 3 8   ? 47.931 -1.260  1.519   1.00 18.35 ? 8   DT  P "O4'" 1 
ATOM   3837 C  "C3'" . DT  C 3 8   ? 49.955 -0.362  2.426   1.00 15.01 ? 8   DT  P "C3'" 1 
ATOM   3838 O  "O3'" . DT  C 3 8   ? 50.613 0.624   1.663   1.00 19.43 ? 8   DT  P "O3'" 1 
ATOM   3839 C  "C2'" . DT  C 3 8   ? 48.739 0.191   3.176   1.00 20.37 ? 8   DT  P "C2'" 1 
ATOM   3840 C  "C1'" . DT  C 3 8   ? 47.590 -0.076  2.205   1.00 21.65 ? 8   DT  P "C1'" 1 
ATOM   3841 N  N1    . DT  C 3 8   ? 46.284 -0.279  2.891   1.00 12.58 ? 8   DT  P N1    1 
ATOM   3842 C  C2    . DT  C 3 8   ? 45.261 0.624   2.648   1.00 14.33 ? 8   DT  P C2    1 
ATOM   3843 O  O2    . DT  C 3 8   ? 45.367 1.571   1.890   1.00 17.27 ? 8   DT  P O2    1 
ATOM   3844 N  N3    . DT  C 3 8   ? 44.099 0.368   3.320   1.00 16.26 ? 8   DT  P N3    1 
ATOM   3845 C  C4    . DT  C 3 8   ? 43.854 -0.674  4.189   1.00 12.65 ? 8   DT  P C4    1 
ATOM   3846 O  O4    . DT  C 3 8   ? 42.781 -0.833  4.756   1.00 17.62 ? 8   DT  P O4    1 
ATOM   3847 C  C5    . DT  C 3 8   ? 44.957 -1.567  4.405   1.00 19.41 ? 8   DT  P C5    1 
ATOM   3848 C  C7    . DT  C 3 8   ? 44.773 -2.723  5.343   1.00 13.74 ? 8   DT  P C7    1 
ATOM   3849 C  C6    . DT  C 3 8   ? 46.104 -1.336  3.756   1.00 14.37 ? 8   DT  P C6    1 
HETATM 3850 NA NA    B NA  D 4 .   ? 52.881 0.581   1.741   0.80 16.66 ? 501 NA  A NA    1 
HETATM 3851 CA CA    . CA  E 5 .   ? 54.917 2.661   3.724   1.00 10.00 ? 503 CA  A CA    1 
HETATM 3852 C  C1    . GOL F 6 .   ? 60.724 -24.971 12.226  1.00 14.93 ? 504 GOL A C1    1 
HETATM 3853 O  O1    . GOL F 6 .   ? 59.330 -24.882 12.314  1.00 15.81 ? 504 GOL A O1    1 
HETATM 3854 C  C2    . GOL F 6 .   ? 61.245 -24.406 10.897  1.00 15.36 ? 504 GOL A C2    1 
HETATM 3855 O  O2    . GOL F 6 .   ? 60.733 -23.120 10.665  1.00 12.80 ? 504 GOL A O2    1 
HETATM 3856 C  C3    . GOL F 6 .   ? 60.944 -25.321 9.709   1.00 17.47 ? 504 GOL A C3    1 
HETATM 3857 O  O3    . GOL F 6 .   ? 61.661 -24.869 8.566   1.00 15.72 ? 504 GOL A O3    1 
HETATM 3858 C  C1    . GOL G 6 .   ? 54.184 16.657  -7.130  1.00 32.56 ? 505 GOL A C1    1 
HETATM 3859 O  O1    . GOL G 6 .   ? 54.099 15.301  -6.757  1.00 18.47 ? 505 GOL A O1    1 
HETATM 3860 C  C2    . GOL G 6 .   ? 54.840 16.731  -8.504  1.00 36.78 ? 505 GOL A C2    1 
HETATM 3861 O  O2    . GOL G 6 .   ? 53.934 16.257  -9.479  1.00 30.65 ? 505 GOL A O2    1 
HETATM 3862 C  C3    . GOL G 6 .   ? 55.228 18.175  -8.812  1.00 24.33 ? 505 GOL A C3    1 
HETATM 3863 O  O3    . GOL G 6 .   ? 55.963 18.194  -10.017 1.00 36.37 ? 505 GOL A O3    1 
HETATM 3864 C  C1    . GOL H 6 .   ? 54.532 28.181  4.557   1.00 30.19 ? 506 GOL A C1    1 
HETATM 3865 O  O1    . GOL H 6 .   ? 53.197 27.846  4.240   1.00 29.63 ? 506 GOL A O1    1 
HETATM 3866 C  C2    . GOL H 6 .   ? 55.091 27.147  5.532   1.00 38.69 ? 506 GOL A C2    1 
HETATM 3867 O  O2    . GOL H 6 .   ? 54.664 25.851  5.167   1.00 38.30 ? 506 GOL A O2    1 
HETATM 3868 C  C3    . GOL H 6 .   ? 56.615 27.186  5.523   1.00 36.16 ? 506 GOL A C3    1 
HETATM 3869 O  O3    . GOL H 6 .   ? 57.123 26.183  6.388   1.00 26.74 ? 506 GOL A O3    1 
HETATM 3870 P  PG    . DTP I 7 .   ? 55.310 2.677   7.258   1.00 10.25 ? 502 DTP P PG    1 
HETATM 3871 O  O1G   . DTP I 7 .   ? 54.997 1.802   8.454   1.00 11.39 ? 502 DTP P O1G   1 
HETATM 3872 O  O2G   . DTP I 7 .   ? 56.581 3.476   7.426   1.00 10.46 ? 502 DTP P O2G   1 
HETATM 3873 O  O3G   . DTP I 7 .   ? 55.214 1.946   5.954   1.00 11.55 ? 502 DTP P O3G   1 
HETATM 3874 P  PB    . DTP I 7 .   ? 53.164 4.234   6.098   1.00 10.02 ? 502 DTP P PB    1 
HETATM 3875 O  O1B   . DTP I 7 .   ? 53.908 4.396   4.789   1.00 7.87  ? 502 DTP P O1B   1 
HETATM 3876 O  O2B   . DTP I 7 .   ? 52.368 5.401   6.624   1.00 8.99  ? 502 DTP P O2B   1 
HETATM 3877 O  O3B   . DTP I 7 .   ? 54.119 3.777   7.314   1.00 8.94  ? 502 DTP P O3B   1 
HETATM 3878 P  PA    . DTP I 7 .   ? 51.641 2.100   4.785   1.00 10.00 ? 502 DTP P PA    1 
HETATM 3879 O  O1A   . DTP I 7 .   ? 50.764 1.031   5.418   1.00 12.70 ? 502 DTP P O1A   1 
HETATM 3880 O  O2A   . DTP I 7 .   ? 52.757 1.662   3.911   1.00 10.84 ? 502 DTP P O2A   1 
HETATM 3881 O  O3A   . DTP I 7 .   ? 52.176 2.948   6.069   1.00 11.70 ? 502 DTP P O3A   1 
HETATM 3882 O  "O5'" . DTP I 7 .   ? 50.645 3.082   4.015   1.00 9.26  ? 502 DTP P "O5'" 1 
HETATM 3883 C  "C5'" . DTP I 7 .   ? 51.079 4.027   3.045   1.00 8.05  ? 502 DTP P "C5'" 1 
HETATM 3884 C  "C4'" . DTP I 7 .   ? 50.145 5.232   3.057   1.00 11.28 ? 502 DTP P "C4'" 1 
HETATM 3885 O  "O4'" . DTP I 7 .   ? 48.814 4.841   2.690   1.00 11.79 ? 502 DTP P "O4'" 1 
HETATM 3886 C  "C3'" . DTP I 7 .   ? 50.011 5.857   4.440   1.00 8.72  ? 502 DTP P "C3'" 1 
HETATM 3887 O  "O3'" . DTP I 7 .   ? 51.025 6.851   4.648   1.00 6.82  ? 502 DTP P "O3'" 1 
HETATM 3888 C  "C2'" . DTP I 7 .   ? 48.614 6.460   4.409   1.00 8.00  ? 502 DTP P "C2'" 1 
HETATM 3889 C  "C1'" . DTP I 7 .   ? 47.836 5.472   3.527   1.00 8.19  ? 502 DTP P "C1'" 1 
HETATM 3890 N  N9    . DTP I 7 .   ? 47.123 4.429   4.307   1.00 11.91 ? 502 DTP P N9    1 
HETATM 3891 C  C8    . DTP I 7 .   ? 47.608 3.266   4.777   1.00 8.81  ? 502 DTP P C8    1 
HETATM 3892 N  N7    . DTP I 7 .   ? 46.612 2.611   5.425   1.00 11.40 ? 502 DTP P N7    1 
HETATM 3893 C  C5    . DTP I 7 .   ? 45.502 3.377   5.341   1.00 10.17 ? 502 DTP P C5    1 
HETATM 3894 C  C6    . DTP I 7 .   ? 44.189 3.245   5.788   1.00 13.77 ? 502 DTP P C6    1 
HETATM 3895 N  N6    . DTP I 7 .   ? 43.812 2.150   6.486   1.00 15.09 ? 502 DTP P N6    1 
HETATM 3896 N  N1    . DTP I 7 .   ? 43.293 4.230   5.527   1.00 12.81 ? 502 DTP P N1    1 
HETATM 3897 C  C2    . DTP I 7 .   ? 43.657 5.319   4.842   1.00 12.45 ? 502 DTP P C2    1 
HETATM 3898 N  N3    . DTP I 7 .   ? 44.912 5.465   4.390   1.00 14.46 ? 502 DTP P N3    1 
HETATM 3899 C  C4    . DTP I 7 .   ? 45.835 4.503   4.628   1.00 10.85 ? 502 DTP P C4    1 
HETATM 3900 O  O     . HOH J 8 .   ? 64.127 -3.378  6.062   1.00 9.19  ? 601 HOH A O     1 
HETATM 3901 O  O     . HOH J 8 .   ? 57.984 -23.557 14.136  1.00 9.70  ? 602 HOH A O     1 
HETATM 3902 O  O     . HOH J 8 .   ? 56.455 -13.989 -5.848  1.00 10.22 ? 603 HOH A O     1 
HETATM 3903 O  O     . HOH J 8 .   ? 43.883 -14.552 5.653   1.00 12.39 ? 604 HOH A O     1 
HETATM 3904 O  O     . HOH J 8 .   ? 51.879 5.825   9.345   1.00 9.58  ? 605 HOH A O     1 
HETATM 3905 O  O     . HOH J 8 .   ? 67.516 -20.666 8.772   1.00 8.84  ? 606 HOH A O     1 
HETATM 3906 O  O     . HOH J 8 .   ? 68.994 16.309  -4.045  1.00 13.27 ? 607 HOH A O     1 
HETATM 3907 O  O     . HOH J 8 .   ? 73.213 -7.367  8.999   1.00 12.03 ? 608 HOH A O     1 
HETATM 3908 O  O     . HOH J 8 .   ? 69.203 -17.607 -1.321  1.00 10.26 ? 609 HOH A O     1 
HETATM 3909 O  O     . HOH J 8 .   ? 69.310 -13.413 5.063   1.00 9.47  ? 610 HOH A O     1 
HETATM 3910 O  O     . HOH J 8 .   ? 59.464 9.631   10.792  1.00 11.31 ? 611 HOH A O     1 
HETATM 3911 O  O     . HOH J 8 .   ? 46.245 16.742  1.108   1.00 12.04 ? 612 HOH A O     1 
HETATM 3912 O  O     . HOH J 8 .   ? 45.679 15.974  -1.603  1.00 12.48 ? 613 HOH A O     1 
HETATM 3913 O  O     . HOH J 8 .   ? 67.258 -16.617 9.697   1.00 13.57 ? 614 HOH A O     1 
HETATM 3914 O  O     . HOH J 8 .   ? 55.600 17.428  -0.709  1.00 10.76 ? 615 HOH A O     1 
HETATM 3915 O  O     . HOH J 8 .   ? 52.715 1.401   9.665   1.00 15.70 ? 616 HOH A O     1 
HETATM 3916 O  O     . HOH J 8 .   ? 60.514 -18.471 -4.589  1.00 11.05 ? 617 HOH A O     1 
HETATM 3917 O  O     . HOH J 8 .   ? 54.728 -11.402 3.452   1.00 13.08 ? 618 HOH A O     1 
HETATM 3918 O  O     . HOH J 8 .   ? 40.771 11.530  -3.534  1.00 14.08 ? 619 HOH A O     1 
HETATM 3919 O  O     . HOH J 8 .   ? 58.648 -12.103 -11.463 1.00 13.76 ? 620 HOH A O     1 
HETATM 3920 O  O     . HOH J 8 .   ? 35.230 5.591   2.002   1.00 13.57 ? 621 HOH A O     1 
HETATM 3921 O  O     . HOH J 8 .   ? 70.730 -16.010 7.738   1.00 17.28 ? 622 HOH A O     1 
HETATM 3922 O  O     . HOH J 8 .   ? 62.499 7.487   7.120   1.00 13.29 ? 623 HOH A O     1 
HETATM 3923 O  O     . HOH J 8 .   ? 62.723 14.846  -9.218  1.00 11.85 ? 624 HOH A O     1 
HETATM 3924 O  O     . HOH J 8 .   ? 53.868 -20.374 -2.468  1.00 14.25 ? 625 HOH A O     1 
HETATM 3925 O  O     . HOH J 8 .   ? 54.044 -28.515 4.146   1.00 14.27 ? 626 HOH A O     1 
HETATM 3926 O  O     . HOH J 8 .   ? 65.742 -22.951 3.234   1.00 11.77 ? 627 HOH A O     1 
HETATM 3927 O  O     . HOH J 8 .   ? 71.216 3.515   -0.277  1.00 15.58 ? 628 HOH A O     1 
HETATM 3928 O  O     . HOH J 8 .   ? 59.379 11.131  8.494   1.00 14.92 ? 629 HOH A O     1 
HETATM 3929 O  O     . HOH J 8 .   ? 65.992 -15.213 11.786  1.00 16.87 ? 630 HOH A O     1 
HETATM 3930 O  O     . HOH J 8 .   ? 41.135 6.917   19.112  1.00 14.76 ? 631 HOH A O     1 
HETATM 3931 O  O     . HOH J 8 .   ? 40.547 16.671  5.938   1.00 19.06 ? 632 HOH A O     1 
HETATM 3932 O  O     . HOH J 8 .   ? 42.262 -22.628 -2.608  1.00 15.68 ? 633 HOH A O     1 
HETATM 3933 O  O     . HOH J 8 .   ? 53.416 -33.460 -0.080  1.00 23.27 ? 634 HOH A O     1 
HETATM 3934 O  O     . HOH J 8 .   ? 43.431 -33.179 -0.595  1.00 17.63 ? 635 HOH A O     1 
HETATM 3935 O  O     . HOH J 8 .   ? 60.069 11.593  -10.453 1.00 16.96 ? 636 HOH A O     1 
HETATM 3936 O  O     . HOH J 8 .   ? 49.188 -15.584 13.641  1.00 14.27 ? 637 HOH A O     1 
HETATM 3937 O  O     . HOH J 8 .   ? 70.746 -19.083 1.340   1.00 14.23 ? 638 HOH A O     1 
HETATM 3938 O  O     . HOH J 8 .   ? 52.348 15.851  -4.704  1.00 15.80 ? 639 HOH A O     1 
HETATM 3939 O  O     . HOH J 8 .   ? 43.618 12.143  -7.286  1.00 16.73 ? 640 HOH A O     1 
HETATM 3940 O  O     . HOH J 8 .   ? 33.218 10.801  5.476   1.00 20.29 ? 641 HOH A O     1 
HETATM 3941 O  O     . HOH J 8 .   ? 44.509 7.387   2.361   1.00 16.49 ? 642 HOH A O     1 
HETATM 3942 O  O     . HOH J 8 .   ? 54.074 17.448  -3.231  1.00 18.52 ? 643 HOH A O     1 
HETATM 3943 O  O     . HOH J 8 .   ? 60.904 -23.471 6.324   1.00 17.18 ? 644 HOH A O     1 
HETATM 3944 O  O     . HOH J 8 .   ? 51.379 5.489   -8.377  1.00 19.78 ? 645 HOH A O     1 
HETATM 3945 O  O     . HOH J 8 .   ? 49.991 2.934   12.840  1.00 20.78 ? 646 HOH A O     1 
HETATM 3946 O  O     . HOH J 8 .   ? 41.171 7.609   -18.638 1.00 16.90 ? 647 HOH A O     1 
HETATM 3947 O  O     . HOH J 8 .   ? 61.500 14.605  8.735   1.00 22.36 ? 648 HOH A O     1 
HETATM 3948 O  O     . HOH J 8 .   ? 71.670 6.028   -7.296  1.00 16.11 ? 649 HOH A O     1 
HETATM 3949 O  O     . HOH J 8 .   ? 64.126 -9.423  -14.498 1.00 17.99 ? 650 HOH A O     1 
HETATM 3950 O  O     . HOH J 8 .   ? 50.669 -34.687 -0.912  1.00 19.54 ? 651 HOH A O     1 
HETATM 3951 O  O     . HOH J 8 .   ? 45.103 -14.335 10.399  1.00 15.30 ? 652 HOH A O     1 
HETATM 3952 O  O     . HOH J 8 .   ? 50.259 -17.252 15.524  1.00 14.93 ? 653 HOH A O     1 
HETATM 3953 O  O     . HOH J 8 .   ? 54.307 -9.628  5.370   1.00 16.69 ? 654 HOH A O     1 
HETATM 3954 O  O     . HOH J 8 .   ? 64.708 6.596   -0.593  1.00 15.42 ? 655 HOH A O     1 
HETATM 3955 O  O     . HOH J 8 .   ? 48.531 -36.852 2.536   1.00 20.77 ? 656 HOH A O     1 
HETATM 3956 O  O     . HOH J 8 .   ? 65.675 -6.608  -13.927 1.00 18.75 ? 657 HOH A O     1 
HETATM 3957 O  O     . HOH J 8 .   ? 45.144 7.463   -10.376 1.00 18.46 ? 658 HOH A O     1 
HETATM 3958 O  O     . HOH J 8 .   ? 36.842 16.074  -4.381  1.00 26.03 ? 659 HOH A O     1 
HETATM 3959 O  O     . HOH J 8 .   ? 69.510 4.438   3.838   1.00 21.70 ? 660 HOH A O     1 
HETATM 3960 O  O     . HOH J 8 .   ? 65.665 5.660   2.190   1.00 24.58 ? 661 HOH A O     1 
HETATM 3961 O  O     . HOH J 8 .   ? 42.576 15.630  23.702  1.00 18.39 ? 662 HOH A O     1 
HETATM 3962 O  O     . HOH J 8 .   ? 48.951 6.774   -11.892 1.00 21.34 ? 663 HOH A O     1 
HETATM 3963 O  O     . HOH J 8 .   ? 78.196 -0.940  5.358   1.00 18.29 ? 664 HOH A O     1 
HETATM 3964 O  O     . HOH J 8 .   ? 44.183 -15.117 1.334   1.00 18.82 ? 665 HOH A O     1 
HETATM 3965 O  O     . HOH J 8 .   ? 41.464 17.016  -14.855 1.00 20.51 ? 666 HOH A O     1 
HETATM 3966 O  O     . HOH J 8 .   ? 44.118 11.014  -12.594 1.00 18.54 ? 667 HOH A O     1 
HETATM 3967 O  O     . HOH J 8 .   ? 53.713 13.550  -9.999  1.00 20.85 ? 668 HOH A O     1 
HETATM 3968 O  O     . HOH J 8 .   ? 68.449 -15.782 -7.684  1.00 21.51 ? 669 HOH A O     1 
HETATM 3969 O  O     . HOH J 8 .   ? 53.351 -28.288 15.280  1.00 20.97 ? 670 HOH A O     1 
HETATM 3970 O  O     . HOH J 8 .   ? 51.291 3.517   10.554  1.00 20.07 ? 671 HOH A O     1 
HETATM 3971 O  O     . HOH J 8 .   ? 63.330 -18.920 -1.565  1.00 18.11 ? 672 HOH A O     1 
HETATM 3972 O  O     . HOH J 8 .   ? 46.895 19.470  1.391   1.00 21.09 ? 673 HOH A O     1 
HETATM 3973 O  O     . HOH J 8 .   ? 43.690 9.766   -10.103 1.00 20.54 ? 674 HOH A O     1 
HETATM 3974 O  O     . HOH J 8 .   ? 63.079 -26.627 7.066   1.00 17.37 ? 675 HOH A O     1 
HETATM 3975 O  O     . HOH J 8 .   ? 41.696 -30.390 -6.522  1.00 21.50 ? 676 HOH A O     1 
HETATM 3976 O  O     . HOH J 8 .   ? 41.580 15.706  -23.042 1.00 22.69 ? 677 HOH A O     1 
HETATM 3977 O  O     . HOH J 8 .   ? 60.030 14.121  -8.696  1.00 18.57 ? 678 HOH A O     1 
HETATM 3978 O  O     . HOH J 8 .   ? 46.846 -0.319  -15.191 1.00 18.23 ? 679 HOH A O     1 
HETATM 3979 O  O     . HOH J 8 .   ? 58.520 -9.160  -14.254 1.00 22.84 ? 680 HOH A O     1 
HETATM 3980 O  O     . HOH J 8 .   ? 51.165 0.391   -16.151 1.00 26.86 ? 681 HOH A O     1 
HETATM 3981 O  O     . HOH J 8 .   ? 52.435 20.236  4.867   1.00 16.32 ? 682 HOH A O     1 
HETATM 3982 O  O     . HOH J 8 .   ? 48.950 2.811   21.229  1.00 21.10 ? 683 HOH A O     1 
HETATM 3983 O  O     . HOH J 8 .   ? 48.651 -22.337 -5.752  1.00 21.73 ? 684 HOH A O     1 
HETATM 3984 O  O     . HOH J 8 .   ? 57.956 -7.493  8.215   1.00 19.80 ? 685 HOH A O     1 
HETATM 3985 O  O     . HOH J 8 .   ? 36.838 13.085  12.012  1.00 23.87 ? 686 HOH A O     1 
HETATM 3986 O  O     . HOH J 8 .   ? 49.956 -3.185  -17.321 1.00 21.75 ? 687 HOH A O     1 
HETATM 3987 O  O     . HOH J 8 .   ? 58.947 4.657   23.098  1.00 26.63 ? 688 HOH A O     1 
HETATM 3988 O  O     . HOH J 8 .   ? 48.952 -9.484  10.400  1.00 22.74 ? 689 HOH A O     1 
HETATM 3989 O  O     . HOH J 8 .   ? 46.919 -14.746 14.904  1.00 29.20 ? 690 HOH A O     1 
HETATM 3990 O  O     . HOH J 8 .   ? 29.127 8.266   -19.017 1.00 25.76 ? 691 HOH A O     1 
HETATM 3991 O  O     . HOH J 8 .   ? 48.442 -18.011 17.363  1.00 25.94 ? 692 HOH A O     1 
HETATM 3992 O  O     . HOH J 8 .   ? 49.500 8.427   -13.681 1.00 24.93 ? 693 HOH A O     1 
HETATM 3993 O  O     . HOH J 8 .   ? 47.180 16.407  25.750  1.00 24.72 ? 694 HOH A O     1 
HETATM 3994 O  O     . HOH J 8 .   ? 57.334 -16.566 -11.370 1.00 25.89 ? 695 HOH A O     1 
HETATM 3995 O  O     . HOH J 8 .   ? 58.014 -14.438 -12.963 1.00 19.54 ? 696 HOH A O     1 
HETATM 3996 O  O     . HOH J 8 .   ? 65.763 -4.245  -15.249 1.00 25.11 ? 697 HOH A O     1 
HETATM 3997 O  O     . HOH J 8 .   ? 61.664 8.115   9.886   1.00 22.15 ? 698 HOH A O     1 
HETATM 3998 O  O     . HOH J 8 .   ? 62.335 -13.372 -13.611 1.00 33.44 ? 699 HOH A O     1 
HETATM 3999 O  O     . HOH J 8 .   ? 43.014 -1.410  -25.229 1.00 27.69 ? 700 HOH A O     1 
HETATM 4000 O  O     . HOH J 8 .   ? 45.996 -10.769 -0.096  1.00 23.90 ? 701 HOH A O     1 
HETATM 4001 O  O     . HOH J 8 .   ? 35.479 20.905  0.570   1.00 22.89 ? 702 HOH A O     1 
HETATM 4002 O  O     . HOH J 8 .   ? 46.261 -9.736  10.913  1.00 26.62 ? 703 HOH A O     1 
HETATM 4003 O  O     . HOH J 8 .   ? 24.269 16.497  3.357   1.00 26.50 ? 704 HOH A O     1 
HETATM 4004 O  O     . HOH J 8 .   ? 49.257 7.388   -7.698  1.00 22.29 ? 705 HOH A O     1 
HETATM 4005 O  O     . HOH J 8 .   ? 41.502 -23.732 -5.064  1.00 24.29 ? 706 HOH A O     1 
HETATM 4006 O  O     . HOH J 8 .   ? 47.945 10.530  -9.883  1.00 30.12 ? 707 HOH A O     1 
HETATM 4007 O  O     . HOH J 8 .   ? 51.637 5.200   -11.062 1.00 19.25 ? 708 HOH A O     1 
HETATM 4008 O  O     . HOH J 8 .   ? 49.641 -9.262  -8.445  1.00 23.41 ? 709 HOH A O     1 
HETATM 4009 O  O     . HOH J 8 .   ? 53.102 0.162   12.127  1.00 26.48 ? 710 HOH A O     1 
HETATM 4010 O  O     . HOH J 8 .   ? 49.008 13.725  28.342  1.00 26.52 ? 711 HOH A O     1 
HETATM 4011 O  O     . HOH J 8 .   ? 41.110 -1.666  -16.462 1.00 25.52 ? 712 HOH A O     1 
HETATM 4012 O  O     . HOH J 8 .   ? 47.164 2.517   -1.441  1.00 25.42 ? 713 HOH A O     1 
HETATM 4013 O  O     . HOH J 8 .   ? 47.327 -0.341  -8.361  1.00 25.53 ? 714 HOH A O     1 
HETATM 4014 O  O     . HOH J 8 .   ? 29.647 3.692   6.331   1.00 31.45 ? 715 HOH A O     1 
HETATM 4015 O  O     . HOH J 8 .   ? 59.898 10.469  19.804  1.00 18.08 ? 716 HOH A O     1 
HETATM 4016 O  O     . HOH J 8 .   ? 59.467 4.926   16.577  1.00 21.77 ? 717 HOH A O     1 
HETATM 4017 O  O     . HOH J 8 .   ? 47.798 7.818   -9.679  1.00 27.22 ? 718 HOH A O     1 
HETATM 4018 O  O     . HOH J 8 .   ? 48.450 20.023  4.589   1.00 30.37 ? 719 HOH A O     1 
HETATM 4019 O  O     . HOH J 8 .   ? 61.279 21.049  11.828  1.00 27.36 ? 720 HOH A O     1 
HETATM 4020 O  O     . HOH J 8 .   ? 72.221 -3.726  -13.896 1.00 21.36 ? 721 HOH A O     1 
HETATM 4021 O  O     . HOH J 8 .   ? 64.120 -24.584 -8.118  1.00 36.19 ? 722 HOH A O     1 
HETATM 4022 O  O     . HOH J 8 .   ? 54.834 -0.743  5.898   1.00 24.93 ? 723 HOH A O     1 
HETATM 4023 O  O     . HOH J 8 .   ? 63.507 12.916  -10.955 1.00 22.70 ? 724 HOH A O     1 
HETATM 4024 O  O     . HOH J 8 .   ? 33.463 2.590   -0.317  1.00 26.30 ? 725 HOH A O     1 
HETATM 4025 O  O     . HOH J 8 .   ? 56.667 -3.314  4.557   1.00 30.82 ? 726 HOH A O     1 
HETATM 4026 O  O     . HOH J 8 .   ? 83.942 -5.197  2.490   1.00 25.92 ? 727 HOH A O     1 
HETATM 4027 O  O     . HOH J 8 .   ? 40.942 -29.664 13.253  1.00 29.44 ? 728 HOH A O     1 
HETATM 4028 O  O     . HOH J 8 .   ? 58.764 15.334  -10.838 1.00 27.32 ? 729 HOH A O     1 
HETATM 4029 O  O     . HOH J 8 .   ? 50.730 -6.373  -5.583  1.00 30.99 ? 730 HOH A O     1 
HETATM 4030 O  O     . HOH J 8 .   ? 34.656 15.033  11.379  1.00 20.99 ? 731 HOH A O     1 
HETATM 4031 O  O     . HOH J 8 .   ? 43.953 -29.032 15.824  1.00 31.92 ? 732 HOH A O     1 
HETATM 4032 O  O     . HOH J 8 .   ? 51.407 8.718   -15.484 1.00 30.84 ? 733 HOH A O     1 
HETATM 4033 O  O     . HOH J 8 .   ? 53.427 -20.160 -5.137  1.00 24.29 ? 734 HOH A O     1 
HETATM 4034 O  O     . HOH J 8 .   ? 50.621 -13.038 -0.805  1.00 22.52 ? 735 HOH A O     1 
HETATM 4035 O  O     . HOH J 8 .   ? 43.336 -2.721  -20.191 1.00 26.98 ? 736 HOH A O     1 
HETATM 4036 O  O     . HOH J 8 .   ? 44.202 -12.964 -0.356  1.00 21.51 ? 737 HOH A O     1 
HETATM 4037 O  O     . HOH J 8 .   ? 34.600 5.958   -22.041 1.00 34.60 ? 738 HOH A O     1 
HETATM 4038 O  O     . HOH J 8 .   ? 46.699 -30.693 13.033  1.00 40.80 ? 739 HOH A O     1 
HETATM 4039 O  O     . HOH J 8 .   ? 68.161 -14.750 -10.160 1.00 23.26 ? 740 HOH A O     1 
HETATM 4040 O  O     . HOH J 8 .   ? 71.924 -19.041 13.789  1.00 30.25 ? 741 HOH A O     1 
HETATM 4041 O  O     . HOH J 8 .   ? 56.135 18.805  18.179  1.00 21.72 ? 742 HOH A O     1 
HETATM 4042 O  O     . HOH J 8 .   ? 23.295 14.306  -9.225  1.00 27.44 ? 743 HOH A O     1 
HETATM 4043 O  O     . HOH J 8 .   ? 51.206 -8.771  -5.137  1.00 26.93 ? 744 HOH A O     1 
HETATM 4044 O  O     . HOH J 8 .   ? 67.597 -6.468  12.806  1.00 20.98 ? 745 HOH A O     1 
HETATM 4045 O  O     . HOH J 8 .   ? 51.474 6.298   -19.005 1.00 30.83 ? 746 HOH A O     1 
HETATM 4046 O  O     . HOH J 8 .   ? 62.995 -17.040 -7.244  1.00 24.72 ? 747 HOH A O     1 
HETATM 4047 O  O     . HOH J 8 .   ? 44.758 -17.064 -0.493  1.00 27.77 ? 748 HOH A O     1 
HETATM 4048 O  O     . HOH J 8 .   ? 54.769 -35.171 0.898   1.00 32.55 ? 749 HOH A O     1 
HETATM 4049 O  O     . HOH J 8 .   ? 72.287 -7.759  11.708  1.00 17.22 ? 750 HOH A O     1 
HETATM 4050 O  O     . HOH J 8 .   ? 64.004 -11.632 12.734  1.00 38.08 ? 751 HOH A O     1 
HETATM 4051 O  O     . HOH J 8 .   ? 37.534 17.517  -6.672  1.00 38.77 ? 752 HOH A O     1 
HETATM 4052 O  O     . HOH J 8 .   ? 33.530 7.617   17.549  1.00 29.77 ? 753 HOH A O     1 
HETATM 4053 O  O     . HOH J 8 .   ? 45.917 7.829   -13.050 1.00 26.72 ? 754 HOH A O     1 
HETATM 4054 O  O     . HOH J 8 .   ? 60.736 -28.418 8.391   1.00 25.78 ? 755 HOH A O     1 
HETATM 4055 O  O     . HOH J 8 .   ? 53.042 -26.496 -3.901  1.00 21.43 ? 756 HOH A O     1 
HETATM 4056 O  O     . HOH J 8 .   ? 58.448 19.010  -8.895  1.00 25.49 ? 757 HOH A O     1 
HETATM 4057 O  O     . HOH J 8 .   ? 73.705 4.450   -1.242  1.00 31.48 ? 758 HOH A O     1 
HETATM 4058 O  O     . HOH J 8 .   ? 73.095 1.966   8.176   1.00 27.10 ? 759 HOH A O     1 
HETATM 4059 O  O     . HOH J 8 .   ? 52.521 3.632   17.901  1.00 28.03 ? 760 HOH A O     1 
HETATM 4060 O  O     . HOH J 8 .   ? 79.089 3.474   1.899   1.00 29.98 ? 761 HOH A O     1 
HETATM 4061 O  O     . HOH J 8 .   ? 62.922 9.429   -13.570 1.00 31.63 ? 762 HOH A O     1 
HETATM 4062 O  O     . HOH J 8 .   ? 43.419 -16.244 -2.768  1.00 36.25 ? 763 HOH A O     1 
HETATM 4063 O  O     . HOH J 8 .   ? 55.675 -7.384  6.451   1.00 27.79 ? 764 HOH A O     1 
HETATM 4064 O  O     . HOH J 8 .   ? 54.381 15.480  23.365  1.00 29.03 ? 765 HOH A O     1 
HETATM 4065 O  O     . HOH J 8 .   ? 58.558 -17.906 19.859  1.00 25.15 ? 766 HOH A O     1 
HETATM 4066 O  O     . HOH J 8 .   ? 46.638 -18.656 -2.329  1.00 31.96 ? 767 HOH A O     1 
HETATM 4067 O  O     . HOH J 8 .   ? 71.215 0.715   11.333  1.00 32.81 ? 768 HOH A O     1 
HETATM 4068 O  O     . HOH J 8 .   ? 49.968 -9.014  13.007  1.00 26.98 ? 769 HOH A O     1 
HETATM 4069 O  O     . HOH J 8 .   ? 55.824 -32.839 5.084   1.00 26.63 ? 770 HOH A O     1 
HETATM 4070 O  O     . HOH J 8 .   ? 40.088 -18.307 -1.660  1.00 31.47 ? 771 HOH A O     1 
HETATM 4071 O  O     . HOH J 8 .   ? 45.102 0.602   -18.534 1.00 24.87 ? 772 HOH A O     1 
HETATM 4072 O  O     . HOH J 8 .   ? 35.413 22.363  -3.446  1.00 36.74 ? 773 HOH A O     1 
HETATM 4073 O  O     . HOH J 8 .   ? 76.621 2.599   6.903   1.00 27.31 ? 774 HOH A O     1 
HETATM 4074 O  O     . HOH J 8 .   ? 51.192 -22.803 -5.676  1.00 29.42 ? 775 HOH A O     1 
HETATM 4075 O  O     . HOH J 8 .   ? 52.977 -12.698 -3.926  1.00 25.44 ? 776 HOH A O     1 
HETATM 4076 O  O     . HOH J 8 .   ? 44.121 0.602   -21.343 1.00 30.71 ? 777 HOH A O     1 
HETATM 4077 O  O     . HOH J 8 .   ? 60.037 -6.413  -12.905 1.00 27.22 ? 778 HOH A O     1 
HETATM 4078 O  O     . HOH J 8 .   ? 70.564 -17.169 12.432  1.00 26.48 ? 779 HOH A O     1 
HETATM 4079 O  O     . HOH J 8 .   ? 69.786 -12.934 -11.456 1.00 27.88 ? 780 HOH A O     1 
HETATM 4080 O  O     . HOH J 8 .   ? 52.505 8.396   25.583  1.00 28.96 ? 781 HOH A O     1 
HETATM 4081 O  O     . HOH J 8 .   ? 58.250 -27.495 11.309  1.00 18.38 ? 782 HOH A O     1 
HETATM 4082 O  O     . HOH J 8 .   ? 45.751 18.272  -3.459  1.00 28.06 ? 783 HOH A O     1 
HETATM 4083 O  O     . HOH J 8 .   ? 47.927 -27.131 -7.237  1.00 26.66 ? 784 HOH A O     1 
HETATM 4084 O  O     . HOH J 8 .   ? 45.152 17.075  -18.103 1.00 32.24 ? 785 HOH A O     1 
HETATM 4085 O  O     . HOH J 8 .   ? 51.006 17.682  -6.017  1.00 29.56 ? 786 HOH A O     1 
HETATM 4086 O  O     . HOH J 8 .   ? 41.259 19.001  -19.066 1.00 24.42 ? 787 HOH A O     1 
HETATM 4087 O  O     . HOH J 8 .   ? 40.416 -28.567 -10.165 1.00 30.96 ? 788 HOH A O     1 
HETATM 4088 O  O     . HOH J 8 .   ? 66.485 -2.507  12.842  1.00 28.10 ? 789 HOH A O     1 
HETATM 4089 O  O     . HOH J 8 .   ? 61.193 9.980   6.964   1.00 27.00 ? 790 HOH A O     1 
HETATM 4090 O  O     . HOH J 8 .   ? 59.899 13.054  11.385  1.00 26.48 ? 791 HOH A O     1 
HETATM 4091 O  O     . HOH J 8 .   ? 42.767 17.297  -17.123 1.00 30.74 ? 792 HOH A O     1 
HETATM 4092 O  O     . HOH J 8 .   ? 80.632 -4.062  13.915  1.00 35.05 ? 793 HOH A O     1 
HETATM 4093 O  O     . HOH J 8 .   ? 61.179 -15.924 13.728  1.00 26.96 ? 794 HOH A O     1 
HETATM 4094 O  O     . HOH J 8 .   ? 57.484 -34.842 8.401   1.00 34.55 ? 795 HOH A O     1 
HETATM 4095 O  O     . HOH J 8 .   ? 44.300 15.714  26.153  1.00 30.33 ? 796 HOH A O     1 
HETATM 4096 O  O     . HOH J 8 .   ? 48.565 -0.222  9.534   1.00 40.16 ? 797 HOH A O     1 
HETATM 4097 O  O     . HOH J 8 .   ? 49.251 14.897  -22.635 1.00 28.35 ? 798 HOH A O     1 
HETATM 4098 O  O     . HOH J 8 .   ? 48.369 -33.244 -3.795  1.00 29.16 ? 799 HOH A O     1 
HETATM 4099 O  O     . HOH J 8 .   ? 42.413 13.174  -23.989 1.00 29.29 ? 800 HOH A O     1 
HETATM 4100 O  O     . HOH J 8 .   ? 47.306 3.133   -23.950 1.00 35.92 ? 801 HOH A O     1 
HETATM 4101 O  O     . HOH J 8 .   ? 36.036 10.991  0.654   1.00 21.40 ? 802 HOH A O     1 
HETATM 4102 O  O     . HOH J 8 .   ? 42.299 -9.073  9.655   1.00 32.50 ? 803 HOH A O     1 
HETATM 4103 O  O     . HOH J 8 .   ? 40.090 -27.483 15.653  1.00 33.14 ? 804 HOH A O     1 
HETATM 4104 O  O     . HOH J 8 .   ? 67.419 -8.174  10.159  1.00 23.10 ? 805 HOH A O     1 
HETATM 4105 O  O     . HOH J 8 .   ? 51.944 11.687  -19.925 1.00 33.24 ? 806 HOH A O     1 
HETATM 4106 O  O     . HOH J 8 .   ? 34.682 17.488  -12.747 1.00 28.83 ? 807 HOH A O     1 
HETATM 4107 O  O     . HOH J 8 .   ? 20.168 10.339  8.858   1.00 34.30 ? 808 HOH A O     1 
HETATM 4108 O  O     . HOH J 8 .   ? 53.598 7.358   -14.820 1.00 30.32 ? 809 HOH A O     1 
HETATM 4109 O  O     . HOH J 8 .   ? 21.743 13.720  6.894   1.00 28.61 ? 810 HOH A O     1 
HETATM 4110 O  O     . HOH J 8 .   ? 44.307 10.468  -24.707 1.00 32.38 ? 811 HOH A O     1 
HETATM 4111 O  O     . HOH J 8 .   ? 80.916 -15.681 7.620   1.00 28.10 ? 812 HOH A O     1 
HETATM 4112 O  O     . HOH J 8 .   ? 49.448 12.060  -11.738 1.00 32.09 ? 813 HOH A O     1 
HETATM 4113 O  O     . HOH J 8 .   ? 41.500 20.283  4.898   1.00 25.67 ? 814 HOH A O     1 
HETATM 4114 O  O     . HOH J 8 .   ? 39.899 7.208   13.431  1.00 27.80 ? 815 HOH A O     1 
HETATM 4115 O  O     . HOH J 8 .   ? 71.292 -12.079 14.177  1.00 34.29 ? 816 HOH A O     1 
HETATM 4116 O  O     . HOH J 8 .   ? 42.463 -19.026 14.845  1.00 23.02 ? 817 HOH A O     1 
HETATM 4117 O  O     . HOH J 8 .   ? 57.645 0.186   -14.900 1.00 27.89 ? 818 HOH A O     1 
HETATM 4118 O  O     . HOH J 8 .   ? 65.762 -21.647 14.604  1.00 31.01 ? 819 HOH A O     1 
HETATM 4119 O  O     . HOH J 8 .   ? 46.388 0.267   6.945   1.00 28.20 ? 820 HOH A O     1 
HETATM 4120 O  O     . HOH J 8 .   ? 69.776 10.040  -8.762  1.00 24.64 ? 821 HOH A O     1 
HETATM 4121 O  O     . HOH J 8 .   ? 47.877 16.708  28.177  1.00 25.80 ? 822 HOH A O     1 
HETATM 4122 O  O     . HOH J 8 .   ? 65.658 -22.385 -8.075  1.00 29.01 ? 823 HOH A O     1 
HETATM 4123 O  O     . HOH J 8 .   ? 40.791 -18.337 0.720   1.00 33.09 ? 824 HOH A O     1 
HETATM 4124 O  O     . HOH J 8 .   ? 50.506 22.041  10.128  1.00 35.64 ? 825 HOH A O     1 
HETATM 4125 O  O     . HOH J 8 .   ? 61.952 16.121  2.342   1.00 27.35 ? 826 HOH A O     1 
HETATM 4126 O  O     . HOH J 8 .   ? 77.769 3.105   -1.783  1.00 30.90 ? 827 HOH A O     1 
HETATM 4127 O  O     . HOH J 8 .   ? 47.074 -8.638  -4.485  1.00 33.42 ? 828 HOH A O     1 
HETATM 4128 O  O     . HOH J 8 .   ? 37.249 18.730  16.647  1.00 31.81 ? 829 HOH A O     1 
HETATM 4129 O  O     . HOH J 8 .   ? 65.313 19.941  6.835   1.00 31.58 ? 830 HOH A O     1 
HETATM 4130 O  O     . HOH J 8 .   ? 81.419 -11.454 13.579  1.00 40.75 ? 831 HOH A O     1 
HETATM 4131 O  O     . HOH J 8 .   ? 38.391 10.645  9.710   1.00 22.85 ? 832 HOH A O     1 
HETATM 4132 O  O     . HOH J 8 .   ? 53.641 6.019   -12.461 1.00 29.27 ? 833 HOH A O     1 
HETATM 4133 O  O     . HOH J 8 .   ? 39.590 4.727   18.248  1.00 35.02 ? 834 HOH A O     1 
HETATM 4134 O  O     . HOH J 8 .   ? 39.564 18.740  18.229  1.00 29.33 ? 835 HOH A O     1 
HETATM 4135 O  O     . HOH J 8 .   ? 57.621 0.061   10.749  1.00 28.83 ? 836 HOH A O     1 
HETATM 4136 O  O     . HOH J 8 .   ? 53.215 24.125  4.111   1.00 32.11 ? 837 HOH A O     1 
HETATM 4137 O  O     . HOH J 8 .   ? 51.948 18.023  -9.824  1.00 27.21 ? 838 HOH A O     1 
HETATM 4138 O  O     . HOH J 8 .   ? 75.412 -22.456 -6.302  1.00 42.50 ? 839 HOH A O     1 
HETATM 4139 O  O     . HOH J 8 .   ? 51.714 -17.920 -6.270  1.00 32.00 ? 840 HOH A O     1 
HETATM 4140 O  O     . HOH J 8 .   ? 53.591 19.269  -1.533  1.00 22.32 ? 841 HOH A O     1 
HETATM 4141 O  O     . HOH J 8 .   ? 66.291 3.492   -17.731 1.00 33.49 ? 842 HOH A O     1 
HETATM 4142 O  O     . HOH J 8 .   ? 69.080 1.843   -15.842 1.00 38.70 ? 843 HOH A O     1 
HETATM 4143 O  O     . HOH J 8 .   ? 47.520 -20.293 18.391  1.00 31.08 ? 844 HOH A O     1 
HETATM 4144 O  O     . HOH J 8 .   ? 60.225 14.358  3.429   1.00 28.21 ? 845 HOH A O     1 
HETATM 4145 O  O     . HOH J 8 .   ? 61.671 -31.562 -10.667 1.00 34.04 ? 846 HOH A O     1 
HETATM 4146 O  O     . HOH J 8 .   ? 52.964 -1.382  3.950   0.40 16.95 ? 847 HOH A O     1 
HETATM 4147 O  O     . HOH J 8 .   ? 33.223 22.536  -5.718  1.00 45.41 ? 848 HOH A O     1 
HETATM 4148 O  O     . HOH J 8 .   ? 34.779 14.026  21.950  1.00 35.19 ? 849 HOH A O     1 
HETATM 4149 O  O     . HOH J 8 .   ? 63.263 -7.241  12.887  1.00 29.48 ? 850 HOH A O     1 
HETATM 4150 O  O     . HOH J 8 .   ? 66.696 4.027   10.658  1.00 26.49 ? 851 HOH A O     1 
HETATM 4151 O  O     . HOH J 8 .   ? 26.197 10.691  14.383  1.00 39.71 ? 852 HOH A O     1 
HETATM 4152 O  O     . HOH J 8 .   ? 67.505 6.526   0.954   1.00 31.47 ? 853 HOH A O     1 
HETATM 4153 O  O     . HOH J 8 .   ? 76.667 1.149   -5.816  1.00 33.79 ? 854 HOH A O     1 
HETATM 4154 O  O     . HOH J 8 .   ? 75.228 0.338   -3.719  1.00 25.09 ? 855 HOH A O     1 
HETATM 4155 O  O     . HOH J 8 .   ? 50.612 14.134  -20.139 1.00 37.71 ? 856 HOH A O     1 
HETATM 4156 O  O     . HOH J 8 .   ? 47.723 -11.704 -1.972  1.00 35.51 ? 857 HOH A O     1 
HETATM 4157 O  O     . HOH J 8 .   ? 71.701 -21.286 -1.899  1.00 34.83 ? 858 HOH A O     1 
HETATM 4158 O  O     . HOH J 8 .   ? 50.263 23.794  5.518   1.00 46.53 ? 859 HOH A O     1 
HETATM 4159 O  O     . HOH J 8 .   ? 64.098 16.452  4.326   1.00 35.37 ? 860 HOH A O     1 
HETATM 4160 O  O     . HOH J 8 .   ? 55.451 -1.094  -14.781 1.00 27.63 ? 861 HOH A O     1 
HETATM 4161 O  O     . HOH J 8 .   ? 35.931 10.898  10.455  1.00 24.57 ? 862 HOH A O     1 
HETATM 4162 O  O     . HOH J 8 .   ? 40.981 14.029  -6.391  1.00 29.63 ? 863 HOH A O     1 
HETATM 4163 O  O     . HOH J 8 .   ? 37.437 13.962  21.705  1.00 32.22 ? 864 HOH A O     1 
HETATM 4164 O  O     . HOH J 8 .   ? 27.116 20.735  -6.270  1.00 33.86 ? 865 HOH A O     1 
HETATM 4165 O  O     . HOH J 8 .   ? 68.741 -1.488  -13.831 1.00 34.02 ? 866 HOH A O     1 
HETATM 4166 O  O     . HOH J 8 .   ? 55.571 5.374   25.110  1.00 33.46 ? 867 HOH A O     1 
HETATM 4167 O  O     . HOH J 8 .   ? 56.325 1.117   12.993  1.00 24.06 ? 868 HOH A O     1 
HETATM 4168 O  O     . HOH J 8 .   ? 60.478 -17.686 -7.365  1.00 24.46 ? 869 HOH A O     1 
HETATM 4169 O  O     . HOH J 8 .   ? 52.366 -5.609  -0.919  1.00 23.42 ? 870 HOH A O     1 
HETATM 4170 O  O     . HOH J 8 .   ? 42.691 -30.100 -4.058  1.00 30.08 ? 871 HOH A O     1 
HETATM 4171 O  O     . HOH J 8 .   ? 38.699 -17.975 10.139  1.00 25.26 ? 872 HOH A O     1 
HETATM 4172 O  O     . HOH J 8 .   ? 41.330 -3.080  -23.022 1.00 21.47 ? 873 HOH A O     1 
HETATM 4173 O  O     . HOH J 8 .   ? 65.064 -19.342 15.584  1.00 25.05 ? 874 HOH A O     1 
HETATM 4174 O  O     . HOH J 8 .   ? 47.483 -16.772 -0.626  1.00 31.59 ? 875 HOH A O     1 
HETATM 4175 O  O     . HOH J 8 .   ? 47.195 15.878  -23.786 1.00 26.61 ? 876 HOH A O     1 
HETATM 4176 O  O     . HOH J 8 .   ? 69.852 -8.831  10.599  1.00 23.67 ? 877 HOH A O     1 
HETATM 4177 O  O     . HOH J 8 .   ? 71.454 9.096   -6.648  1.00 27.95 ? 878 HOH A O     1 
HETATM 4178 O  O     . HOH J 8 .   ? 47.053 -38.180 4.399   1.00 26.84 ? 879 HOH A O     1 
HETATM 4179 O  O     . HOH J 8 .   ? 27.806 6.685   -17.099 1.00 29.22 ? 880 HOH A O     1 
HETATM 4180 O  O     . HOH J 8 .   ? 56.014 13.606  -11.513 1.00 26.83 ? 881 HOH A O     1 
HETATM 4181 O  O     . HOH J 8 .   ? 14.712 14.750  -1.124  1.00 37.49 ? 882 HOH A O     1 
HETATM 4182 O  O     . HOH J 8 .   ? 33.978 2.915   2.811   1.00 29.35 ? 883 HOH A O     1 
HETATM 4183 O  O     . HOH J 8 .   ? 41.241 21.697  2.132   1.00 23.14 ? 884 HOH A O     1 
HETATM 4184 O  O     . HOH J 8 .   ? 47.248 -22.653 17.369  1.00 24.53 ? 885 HOH A O     1 
HETATM 4185 O  O     . HOH J 8 .   ? 70.617 -6.802  13.856  1.00 28.08 ? 886 HOH A O     1 
HETATM 4186 O  O     . HOH J 8 .   ? 51.598 13.558  -11.432 1.00 25.67 ? 887 HOH A O     1 
HETATM 4187 O  O     . HOH J 8 .   ? 39.116 -19.907 12.411  1.00 32.85 ? 888 HOH A O     1 
HETATM 4188 O  O     . HOH J 8 .   ? 49.071 -0.536  -16.887 1.00 30.81 ? 889 HOH A O     1 
HETATM 4189 O  O     . HOH J 8 .   ? 25.532 14.594  5.293   1.00 32.29 ? 890 HOH A O     1 
HETATM 4190 O  O     . HOH J 8 .   ? 49.723 17.439  -11.549 1.00 32.84 ? 891 HOH A O     1 
HETATM 4191 O  O     . HOH J 8 .   ? 53.726 -8.498  8.700   1.00 24.67 ? 892 HOH A O     1 
HETATM 4192 O  O     . HOH J 8 .   ? 60.627 19.112  -10.315 1.00 29.94 ? 893 HOH A O     1 
HETATM 4193 O  O     . HOH J 8 .   ? 82.977 -4.495  -5.855  1.00 38.51 ? 894 HOH A O     1 
HETATM 4194 O  O     . HOH J 8 .   ? 33.464 11.093  8.676   1.00 34.71 ? 895 HOH A O     1 
HETATM 4195 O  O     . HOH J 8 .   ? 69.133 -10.763 12.160  1.00 29.21 ? 896 HOH A O     1 
HETATM 4196 O  O     . HOH J 8 .   ? 43.051 15.306  -10.787 1.00 28.67 ? 897 HOH A O     1 
HETATM 4197 O  O     . HOH J 8 .   ? 50.116 0.696   20.465  1.00 39.14 ? 898 HOH A O     1 
HETATM 4198 O  O     . HOH J 8 .   ? 73.763 -20.568 1.135   1.00 28.60 ? 899 HOH A O     1 
HETATM 4199 O  O     . HOH J 8 .   ? 61.635 15.901  4.915   1.00 33.12 ? 900 HOH A O     1 
HETATM 4200 O  O     . HOH J 8 .   ? 64.313 19.880  11.301  1.00 28.62 ? 901 HOH A O     1 
HETATM 4201 O  O     . HOH J 8 .   ? 53.083 -19.671 22.230  1.00 32.05 ? 902 HOH A O     1 
HETATM 4202 O  O     . HOH J 8 .   ? 60.652 6.206   -15.608 1.00 28.32 ? 903 HOH A O     1 
HETATM 4203 O  O     . HOH J 8 .   ? 60.126 9.841   22.439  1.00 31.61 ? 904 HOH A O     1 
HETATM 4204 O  O     . HOH J 8 .   ? 38.522 13.791  24.563  1.00 35.90 ? 905 HOH A O     1 
HETATM 4205 O  O     . HOH J 8 .   ? 47.255 21.068  -1.214  1.00 26.80 ? 906 HOH A O     1 
HETATM 4206 O  O     . HOH J 8 .   ? 30.845 1.873   -22.113 1.00 29.04 ? 907 HOH A O     1 
HETATM 4207 O  O     . HOH J 8 .   ? 61.837 7.867   16.235  1.00 30.42 ? 908 HOH A O     1 
HETATM 4208 O  O     . HOH J 8 .   ? 81.477 -11.073 -8.338  1.00 39.22 ? 909 HOH A O     1 
HETATM 4209 O  O     . HOH J 8 .   ? 69.668 5.444   1.089   1.00 31.16 ? 910 HOH A O     1 
HETATM 4210 O  O     . HOH J 8 .   ? 59.797 3.524   20.914  1.00 28.95 ? 911 HOH A O     1 
HETATM 4211 O  O     . HOH J 8 .   ? 61.967 11.507  -12.379 1.00 24.97 ? 912 HOH A O     1 
HETATM 4212 O  O     . HOH J 8 .   ? 59.336 27.014  7.562   1.00 32.15 ? 913 HOH A O     1 
HETATM 4213 O  O     . HOH J 8 .   ? 49.179 -38.208 0.397   1.00 27.76 ? 914 HOH A O     1 
HETATM 4214 O  O     . HOH J 8 .   ? 83.142 -2.947  -4.008  1.00 35.65 ? 915 HOH A O     1 
HETATM 4215 O  O     . HOH J 8 .   ? 61.932 9.151   18.729  1.00 33.55 ? 916 HOH A O     1 
HETATM 4216 O  O     . HOH J 8 .   ? 36.705 -4.511  -12.863 1.00 37.67 ? 917 HOH A O     1 
HETATM 4217 O  O     . HOH J 8 .   ? 61.654 1.801   14.142  1.00 28.41 ? 918 HOH A O     1 
HETATM 4218 O  O     . HOH J 8 .   ? 72.489 4.391   7.438   1.00 38.72 ? 919 HOH A O     1 
HETATM 4219 O  O     . HOH J 8 .   ? 66.522 -6.481  15.312  1.00 40.13 ? 920 HOH A O     1 
HETATM 4220 O  O     . HOH J 8 .   ? 56.450 -33.120 2.274   1.00 27.44 ? 921 HOH A O     1 
HETATM 4221 O  O     . HOH J 8 .   ? 38.744 4.734   15.796  1.00 37.24 ? 922 HOH A O     1 
HETATM 4222 O  O     . HOH J 8 .   ? 70.432 -21.763 0.595   1.00 28.55 ? 923 HOH A O     1 
HETATM 4223 O  O     . HOH J 8 .   ? 58.159 18.058  19.936  1.00 34.70 ? 924 HOH A O     1 
HETATM 4224 O  O     . HOH J 8 .   ? 51.673 -35.208 7.624   1.00 34.24 ? 925 HOH A O     1 
HETATM 4225 O  O     . HOH J 8 .   ? 55.880 -27.336 -4.093  1.00 31.72 ? 926 HOH A O     1 
HETATM 4226 O  O     . HOH J 8 .   ? 64.404 -15.383 13.725  1.00 29.67 ? 927 HOH A O     1 
HETATM 4227 O  O     . HOH J 8 .   ? 68.510 4.489   -14.024 1.00 36.34 ? 928 HOH A O     1 
HETATM 4228 O  O     . HOH J 8 .   ? 37.328 -7.342  -18.277 1.00 41.55 ? 929 HOH A O     1 
HETATM 4229 O  O     . HOH J 8 .   ? 21.985 12.069  -9.512  1.00 29.33 ? 930 HOH A O     1 
HETATM 4230 O  O     . HOH J 8 .   ? 40.983 15.717  -8.799  1.00 37.79 ? 931 HOH A O     1 
HETATM 4231 O  O     . HOH J 8 .   ? 68.841 -21.640 -8.434  1.00 35.93 ? 932 HOH A O     1 
HETATM 4232 O  O     . HOH J 8 .   ? 51.344 -29.405 16.747  1.00 38.65 ? 933 HOH A O     1 
HETATM 4233 O  O     . HOH J 8 .   ? 46.011 18.000  29.862  1.00 26.95 ? 934 HOH A O     1 
HETATM 4234 O  O     . HOH J 8 .   ? 50.845 5.723   -23.402 1.00 35.00 ? 935 HOH A O     1 
HETATM 4235 O  O     . HOH J 8 .   ? 32.293 -1.474  -2.839  1.00 38.08 ? 936 HOH A O     1 
HETATM 4236 O  O     . HOH J 8 .   ? 37.405 15.328  -20.427 1.00 35.42 ? 937 HOH A O     1 
HETATM 4237 O  O     . HOH J 8 .   ? 59.068 -30.302 -1.232  1.00 34.09 ? 938 HOH A O     1 
HETATM 4238 O  O     . HOH J 8 .   ? 44.581 -23.192 17.536  1.00 36.05 ? 939 HOH A O     1 
HETATM 4239 O  O     . HOH J 8 .   ? 44.319 18.160  23.484  1.00 38.27 ? 940 HOH A O     1 
HETATM 4240 O  O     . HOH J 8 .   ? 57.805 5.472   -15.821 1.00 38.35 ? 941 HOH A O     1 
HETATM 4241 O  O     . HOH J 8 .   ? 50.359 26.236  6.770   1.00 37.20 ? 942 HOH A O     1 
HETATM 4242 O  O     . HOH J 8 .   ? 24.667 -7.898  -0.917  1.00 43.84 ? 943 HOH A O     1 
HETATM 4243 O  O     . HOH J 8 .   ? 60.610 13.782  6.292   1.00 31.89 ? 944 HOH A O     1 
HETATM 4244 O  O     . HOH J 8 .   ? 53.957 -9.946  -0.914  1.00 32.14 ? 945 HOH A O     1 
HETATM 4245 O  O     . HOH J 8 .   ? 58.903 0.422   -17.276 1.00 32.95 ? 946 HOH A O     1 
HETATM 4246 O  O     . HOH J 8 .   ? 34.172 15.717  18.682  1.00 33.63 ? 947 HOH A O     1 
HETATM 4247 O  O     . HOH J 8 .   ? 43.302 17.678  27.940  1.00 34.68 ? 948 HOH A O     1 
HETATM 4248 O  O     . HOH J 8 .   ? 44.609 13.384  -10.526 1.00 34.23 ? 949 HOH A O     1 
HETATM 4249 O  O     . HOH J 8 .   ? 30.831 1.374   3.423   1.00 41.00 ? 950 HOH A O     1 
HETATM 4250 O  O     . HOH J 8 .   ? 45.230 -15.180 13.053  1.00 37.01 ? 951 HOH A O     1 
HETATM 4251 O  O     . HOH J 8 .   ? 75.551 -12.865 -15.312 1.00 33.09 ? 952 HOH A O     1 
HETATM 4252 O  O     . HOH J 8 .   ? 46.539 1.083   14.230  1.00 27.96 ? 953 HOH A O     1 
HETATM 4253 O  O     . HOH J 8 .   ? 62.679 -29.433 -12.345 1.00 37.94 ? 954 HOH A O     1 
HETATM 4254 O  O     . HOH J 8 .   ? 33.540 -4.452  -12.883 1.00 42.01 ? 955 HOH A O     1 
HETATM 4255 O  O     . HOH J 8 .   ? 40.275 15.436  25.703  1.00 39.95 ? 956 HOH A O     1 
HETATM 4256 O  O     . HOH J 8 .   ? 53.532 -37.640 1.384   1.00 32.15 ? 957 HOH A O     1 
HETATM 4257 O  O     . HOH J 8 .   ? 31.105 21.375  -7.021  1.00 40.76 ? 958 HOH A O     1 
HETATM 4258 O  O     . HOH J 8 .   ? 46.587 2.490   -4.339  1.00 32.02 ? 959 HOH A O     1 
HETATM 4259 O  O     . HOH J 8 .   ? 49.951 -16.038 -9.054  1.00 36.55 ? 960 HOH A O     1 
HETATM 4260 O  O     . HOH J 8 .   ? 69.687 -18.686 -9.543  1.00 36.47 ? 961 HOH A O     1 
HETATM 4261 O  O     . HOH J 8 .   ? 39.275 18.717  -15.108 1.00 34.24 ? 962 HOH A O     1 
HETATM 4262 O  O     . HOH J 8 .   ? 65.687 13.014  2.756   1.00 31.55 ? 963 HOH A O     1 
HETATM 4263 O  O     . HOH J 8 .   ? 11.674 4.510   -8.739  1.00 46.63 ? 964 HOH A O     1 
HETATM 4264 O  O     . HOH J 8 .   ? 62.133 -18.533 21.825  1.00 40.16 ? 965 HOH A O     1 
HETATM 4265 O  O     . HOH J 8 .   ? 62.379 12.053  9.448   1.00 35.88 ? 966 HOH A O     1 
HETATM 4266 O  O     . HOH J 8 .   ? 50.315 -14.860 -3.464  1.00 39.67 ? 967 HOH A O     1 
HETATM 4267 O  O     . HOH J 8 .   ? 61.766 -2.575  12.223  1.00 31.33 ? 968 HOH A O     1 
HETATM 4268 O  O     . HOH J 8 .   ? 51.048 -33.386 -3.843  1.00 33.41 ? 969 HOH A O     1 
HETATM 4269 O  O     . HOH J 8 .   ? 71.215 -22.253 -8.884  1.00 41.62 ? 970 HOH A O     1 
HETATM 4270 O  O     . HOH J 8 .   ? 39.894 -18.592 14.548  1.00 38.06 ? 971 HOH A O     1 
HETATM 4271 O  O     . HOH J 8 .   ? 45.702 11.513  -9.156  1.00 34.39 ? 972 HOH A O     1 
HETATM 4272 O  O     . HOH J 8 .   ? 28.513 21.139  -8.316  1.00 38.52 ? 973 HOH A O     1 
HETATM 4273 O  O     . HOH J 8 .   ? 83.796 -7.896  0.891   1.00 34.27 ? 974 HOH A O     1 
HETATM 4274 O  O     . HOH J 8 .   ? 37.764 7.920   21.759  1.00 35.49 ? 975 HOH A O     1 
HETATM 4275 O  O     . HOH J 8 .   ? 12.031 3.451   -5.914  1.00 42.54 ? 976 HOH A O     1 
HETATM 4276 O  O     . HOH J 8 .   ? 39.434 -2.118  -14.358 1.00 31.00 ? 977 HOH A O     1 
HETATM 4277 O  O     . HOH J 8 .   ? 68.002 -5.121  -17.282 1.00 38.41 ? 978 HOH A O     1 
HETATM 4278 O  O     . HOH J 8 .   ? 28.642 14.444  5.045   1.00 34.12 ? 979 HOH A O     1 
HETATM 4279 O  O     . HOH J 8 .   ? 53.029 1.683   16.352  1.00 34.56 ? 980 HOH A O     1 
HETATM 4280 O  O     . HOH J 8 .   ? 61.368 -17.469 -13.256 1.00 36.85 ? 981 HOH A O     1 
HETATM 4281 O  O     . HOH J 8 .   ? 43.390 17.489  18.042  1.00 31.46 ? 982 HOH A O     1 
HETATM 4282 O  O     . HOH J 8 .   ? 35.980 22.118  12.580  1.00 39.10 ? 983 HOH A O     1 
HETATM 4283 O  O     . HOH J 8 .   ? 50.334 -27.735 18.435  1.00 34.42 ? 984 HOH A O     1 
HETATM 4284 O  O     . HOH J 8 .   ? 51.783 -8.594  4.857   1.00 26.24 ? 985 HOH A O     1 
HETATM 4285 O  O     . HOH J 8 .   ? 51.369 21.812  7.214   1.00 23.05 ? 986 HOH A O     1 
HETATM 4286 O  O     . HOH J 8 .   ? 62.670 11.930  5.705   1.00 32.69 ? 987 HOH A O     1 
HETATM 4287 O  O     . HOH J 8 .   ? 39.432 19.674  -7.347  1.00 44.35 ? 988 HOH A O     1 
HETATM 4288 O  O     . HOH J 8 .   ? 38.818 -19.029 5.610   1.00 35.03 ? 989 HOH A O     1 
HETATM 4289 O  O     . HOH J 8 .   ? 38.432 -22.874 11.093  1.00 40.10 ? 990 HOH A O     1 
HETATM 4290 O  O     . HOH J 8 .   ? 49.413 -23.842 19.234  1.00 35.49 ? 991 HOH A O     1 
HETATM 4291 O  O     . HOH J 8 .   ? 40.755 -29.406 -2.329  1.00 25.86 ? 992 HOH A O     1 
HETATM 4292 O  O     . HOH J 8 .   ? 68.107 -26.693 -6.855  1.00 40.84 ? 993 HOH A O     1 
HETATM 4293 O  O     . HOH K 8 .   ? 42.070 8.191   3.284   1.00 17.35 ? 101 HOH T O     1 
HETATM 4294 O  O     . HOH K 8 .   ? 40.892 -3.605  -9.477  1.00 22.95 ? 102 HOH T O     1 
HETATM 4295 O  O     . HOH K 8 .   ? 41.909 -20.080 -3.438  1.00 28.40 ? 103 HOH T O     1 
HETATM 4296 O  O     . HOH K 8 .   ? 42.035 -7.355  -10.585 1.00 30.28 ? 104 HOH T O     1 
HETATM 4297 O  O     . HOH K 8 .   ? 36.469 2.496   4.721   1.00 25.80 ? 105 HOH T O     1 
HETATM 4298 O  O     . HOH K 8 .   ? 36.806 -23.070 -5.408  1.00 25.92 ? 106 HOH T O     1 
HETATM 4299 O  O     . HOH K 8 .   ? 38.830 -2.344  -6.605  1.00 29.88 ? 107 HOH T O     1 
HETATM 4300 O  O     . HOH K 8 .   ? 43.444 5.401   -9.100  1.00 21.59 ? 108 HOH T O     1 
HETATM 4301 O  O     . HOH K 8 .   ? 39.207 2.410   -7.007  1.00 32.11 ? 109 HOH T O     1 
HETATM 4302 O  O     . HOH K 8 .   ? 37.881 -12.901 -11.317 1.00 28.54 ? 110 HOH T O     1 
HETATM 4303 O  O     . HOH K 8 .   ? 44.388 -8.703  -3.691  1.00 22.25 ? 111 HOH T O     1 
HETATM 4304 O  O     . HOH K 8 .   ? 41.643 7.277   10.965  1.00 32.22 ? 112 HOH T O     1 
HETATM 4305 O  O     . HOH K 8 .   ? 45.591 -5.206  -3.357  1.00 33.14 ? 113 HOH T O     1 
HETATM 4306 O  O     . HOH K 8 .   ? 43.794 5.641   0.485   1.00 25.28 ? 114 HOH T O     1 
HETATM 4307 O  O     . HOH K 8 .   ? 33.959 9.050   11.555  1.00 31.38 ? 115 HOH T O     1 
HETATM 4308 O  O     . HOH K 8 .   ? 40.351 -0.654  7.962   1.00 30.76 ? 116 HOH T O     1 
HETATM 4309 O  O     . HOH K 8 .   ? 40.222 8.853   8.957   1.00 35.04 ? 117 HOH T O     1 
HETATM 4310 O  O     . HOH K 8 .   ? 43.728 0.697   10.708  1.00 40.52 ? 118 HOH T O     1 
HETATM 4311 O  O     . HOH K 8 .   ? 36.653 -2.228  -1.094  1.00 31.02 ? 119 HOH T O     1 
HETATM 4312 O  O     . HOH K 8 .   ? 38.513 -1.821  6.150   1.00 35.61 ? 120 HOH T O     1 
HETATM 4313 O  O     . HOH K 8 .   ? 44.745 -0.350  8.804   1.00 32.83 ? 121 HOH T O     1 
HETATM 4314 O  O     . HOH K 8 .   ? 25.846 -19.349 -6.758  1.00 32.38 ? 122 HOH T O     1 
HETATM 4315 O  O     . HOH K 8 .   ? 45.297 -2.598  -3.639  1.00 27.68 ? 123 HOH T O     1 
HETATM 4316 O  O     . HOH K 8 .   ? 36.955 -2.948  -4.219  1.00 25.18 ? 124 HOH T O     1 
HETATM 4317 O  O     . HOH K 8 .   ? 37.648 -0.098  4.580   1.00 30.75 ? 125 HOH T O     1 
HETATM 4318 O  O     . HOH K 8 .   ? 38.883 -10.331 -10.157 1.00 28.90 ? 126 HOH T O     1 
HETATM 4319 O  O     . HOH K 8 .   ? 32.087 14.045  10.757  1.00 28.27 ? 127 HOH T O     1 
HETATM 4320 O  O     . HOH K 8 .   ? 30.876 4.873   8.783   1.00 37.52 ? 128 HOH T O     1 
HETATM 4321 O  O     . HOH K 8 .   ? 36.661 -8.734  -9.842  1.00 39.13 ? 129 HOH T O     1 
HETATM 4322 O  O     . HOH K 8 .   ? 37.282 0.171   -3.115  1.00 29.14 ? 130 HOH T O     1 
HETATM 4323 O  O     . HOH K 8 .   ? 45.642 5.430   -4.989  1.00 31.19 ? 131 HOH T O     1 
HETATM 4324 O  O     . HOH K 8 .   ? 38.199 -4.351  -8.811  1.00 39.84 ? 132 HOH T O     1 
HETATM 4325 O  O     . HOH K 8 .   ? 37.878 -23.007 -7.891  1.00 34.13 ? 133 HOH T O     1 
HETATM 4326 O  O     . HOH K 8 .   ? 44.687 6.220   -2.824  1.00 33.18 ? 134 HOH T O     1 
HETATM 4327 O  O     . HOH K 8 .   ? 31.218 -16.136 -4.588  1.00 30.63 ? 135 HOH T O     1 
HETATM 4328 O  O     . HOH K 8 .   ? 42.497 -11.345 -3.560  1.00 31.64 ? 136 HOH T O     1 
HETATM 4329 O  O     . HOH K 8 .   ? 28.590 3.885   9.410   1.00 47.75 ? 137 HOH T O     1 
HETATM 4330 O  O     . HOH L 8 .   ? 44.969 -8.273  -1.019  1.00 22.60 ? 101 HOH P O     1 
HETATM 4331 O  O     . HOH L 8 .   ? 42.882 -9.046  7.078   1.00 18.58 ? 102 HOH P O     1 
HETATM 4332 O  O     . HOH L 8 .   ? 40.720 -5.322  5.652   1.00 23.28 ? 103 HOH P O     1 
HETATM 4333 O  O     . HOH L 8 .   ? 46.222 -2.689  -0.825  1.00 19.86 ? 104 HOH P O     1 
HETATM 4334 O  O     . HOH L 8 .   ? 49.481 -10.162 6.641   1.00 19.54 ? 105 HOH P O     1 
HETATM 4335 O  O     . HOH L 8 .   ? 40.524 -9.131  5.828   1.00 27.03 ? 106 HOH P O     1 
HETATM 4336 O  O     . HOH L 8 .   ? 41.742 -11.855 -1.116  1.00 25.11 ? 107 HOH P O     1 
HETATM 4337 O  O     . HOH L 8 .   ? 41.594 -15.700 1.736   1.00 20.62 ? 108 HOH P O     1 
HETATM 4338 O  O     . HOH L 8 .   ? 49.100 2.439   1.016   0.40 12.42 ? 109 HOH P O     1 
HETATM 4339 O  O     . HOH L 8 .   ? 32.407 -7.584  -11.764 1.00 32.49 ? 110 HOH P O     1 
HETATM 4340 O  O     . HOH L 8 .   ? 44.984 -6.325  5.938   1.00 30.96 ? 111 HOH P O     1 
HETATM 4341 O  O     . HOH L 8 .   ? 31.948 -6.033  -3.291  1.00 38.46 ? 112 HOH P O     1 
HETATM 4342 O  O     . HOH L 8 .   ? 38.426 -10.809 6.258   1.00 29.48 ? 113 HOH P O     1 
HETATM 4343 O  O     . HOH L 8 .   ? 38.656 -4.025  4.799   1.00 33.90 ? 114 HOH P O     1 
HETATM 4344 O  O     . HOH L 8 .   ? 34.552 -9.213  -11.266 1.00 33.90 ? 115 HOH P O     1 
HETATM 4345 O  O     . HOH L 8 .   ? 36.655 -4.675  3.203   1.00 27.23 ? 116 HOH P O     1 
HETATM 4346 O  O     . HOH L 8 .   ? 30.967 -6.405  -13.451 1.00 38.47 ? 117 HOH P O     1 
HETATM 4347 O  O     . HOH L 8 .   ? 40.209 -14.459 -0.175  1.00 30.12 ? 118 HOH P O     1 
HETATM 4348 O  O     . HOH L 8 .   ? 26.411 -4.787  -16.793 1.00 43.51 ? 119 HOH P O     1 
HETATM 4349 O  O     . HOH L 8 .   ? 38.932 -7.105  5.845   1.00 36.36 ? 120 HOH P O     1 
HETATM 4350 O  O     . HOH L 8 .   ? 35.137 -4.521  -1.092  1.00 29.23 ? 121 HOH P O     1 
HETATM 4351 O  O     . HOH L 8 .   ? 47.738 -2.146  6.995   1.00 29.05 ? 122 HOH P O     1 
HETATM 4352 O  O     . HOH L 8 .   ? 36.397 -13.719 -2.162  1.00 35.74 ? 123 HOH P O     1 
HETATM 4353 O  O     . HOH L 8 .   ? 46.510 3.773   1.050   1.00 29.59 ? 124 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NA  1   501 116 NA  NA  A . 
E 5 CA  1   503 502 CA  CA  A . 
F 6 GOL 1   504 436 GOL GOL A . 
G 6 GOL 1   505 437 GOL GOL A . 
H 6 GOL 1   506 438 GOL GOL A . 
I 7 DTP 1   502 9   DTP DTP P . 
J 8 HOH 1   601 1   HOH HOH A . 
J 8 HOH 2   602 2   HOH HOH A . 
J 8 HOH 3   603 3   HOH HOH A . 
J 8 HOH 4   604 4   HOH HOH A . 
J 8 HOH 5   605 5   HOH HOH A . 
J 8 HOH 6   606 6   HOH HOH A . 
J 8 HOH 7   607 7   HOH HOH A . 
J 8 HOH 8   608 8   HOH HOH A . 
J 8 HOH 9   609 9   HOH HOH A . 
J 8 HOH 10  610 10  HOH HOH A . 
J 8 HOH 11  611 12  HOH HOH A . 
J 8 HOH 12  612 13  HOH HOH A . 
J 8 HOH 13  613 14  HOH HOH A . 
J 8 HOH 14  614 15  HOH HOH A . 
J 8 HOH 15  615 16  HOH HOH A . 
J 8 HOH 16  616 17  HOH HOH A . 
J 8 HOH 17  617 18  HOH HOH A . 
J 8 HOH 18  618 19  HOH HOH A . 
J 8 HOH 19  619 20  HOH HOH A . 
J 8 HOH 20  620 21  HOH HOH A . 
J 8 HOH 21  621 22  HOH HOH A . 
J 8 HOH 22  622 23  HOH HOH A . 
J 8 HOH 23  623 24  HOH HOH A . 
J 8 HOH 24  624 25  HOH HOH A . 
J 8 HOH 25  625 26  HOH HOH A . 
J 8 HOH 26  626 27  HOH HOH A . 
J 8 HOH 27  627 28  HOH HOH A . 
J 8 HOH 28  628 29  HOH HOH A . 
J 8 HOH 29  629 30  HOH HOH A . 
J 8 HOH 30  630 31  HOH HOH A . 
J 8 HOH 31  631 32  HOH HOH A . 
J 8 HOH 32  632 33  HOH HOH A . 
J 8 HOH 33  633 34  HOH HOH A . 
J 8 HOH 34  634 35  HOH HOH A . 
J 8 HOH 35  635 36  HOH HOH A . 
J 8 HOH 36  636 37  HOH HOH A . 
J 8 HOH 37  637 38  HOH HOH A . 
J 8 HOH 38  638 40  HOH HOH A . 
J 8 HOH 39  639 41  HOH HOH A . 
J 8 HOH 40  640 42  HOH HOH A . 
J 8 HOH 41  641 43  HOH HOH A . 
J 8 HOH 42  642 44  HOH HOH A . 
J 8 HOH 43  643 45  HOH HOH A . 
J 8 HOH 44  644 46  HOH HOH A . 
J 8 HOH 45  645 47  HOH HOH A . 
J 8 HOH 46  646 48  HOH HOH A . 
J 8 HOH 47  647 49  HOH HOH A . 
J 8 HOH 48  648 50  HOH HOH A . 
J 8 HOH 49  649 51  HOH HOH A . 
J 8 HOH 50  650 52  HOH HOH A . 
J 8 HOH 51  651 53  HOH HOH A . 
J 8 HOH 52  652 54  HOH HOH A . 
J 8 HOH 53  653 56  HOH HOH A . 
J 8 HOH 54  654 57  HOH HOH A . 
J 8 HOH 55  655 58  HOH HOH A . 
J 8 HOH 56  656 59  HOH HOH A . 
J 8 HOH 57  657 60  HOH HOH A . 
J 8 HOH 58  658 61  HOH HOH A . 
J 8 HOH 59  659 62  HOH HOH A . 
J 8 HOH 60  660 63  HOH HOH A . 
J 8 HOH 61  661 64  HOH HOH A . 
J 8 HOH 62  662 67  HOH HOH A . 
J 8 HOH 63  663 68  HOH HOH A . 
J 8 HOH 64  664 70  HOH HOH A . 
J 8 HOH 65  665 71  HOH HOH A . 
J 8 HOH 66  666 72  HOH HOH A . 
J 8 HOH 67  667 73  HOH HOH A . 
J 8 HOH 68  668 74  HOH HOH A . 
J 8 HOH 69  669 75  HOH HOH A . 
J 8 HOH 70  670 76  HOH HOH A . 
J 8 HOH 71  671 77  HOH HOH A . 
J 8 HOH 72  672 78  HOH HOH A . 
J 8 HOH 73  673 79  HOH HOH A . 
J 8 HOH 74  674 80  HOH HOH A . 
J 8 HOH 75  675 81  HOH HOH A . 
J 8 HOH 76  676 82  HOH HOH A . 
J 8 HOH 77  677 83  HOH HOH A . 
J 8 HOH 78  678 84  HOH HOH A . 
J 8 HOH 79  679 86  HOH HOH A . 
J 8 HOH 80  680 87  HOH HOH A . 
J 8 HOH 81  681 88  HOH HOH A . 
J 8 HOH 82  682 89  HOH HOH A . 
J 8 HOH 83  683 90  HOH HOH A . 
J 8 HOH 84  684 91  HOH HOH A . 
J 8 HOH 85  685 92  HOH HOH A . 
J 8 HOH 86  686 93  HOH HOH A . 
J 8 HOH 87  687 94  HOH HOH A . 
J 8 HOH 88  688 95  HOH HOH A . 
J 8 HOH 89  689 96  HOH HOH A . 
J 8 HOH 90  690 98  HOH HOH A . 
J 8 HOH 91  691 99  HOH HOH A . 
J 8 HOH 92  692 100 HOH HOH A . 
J 8 HOH 93  693 101 HOH HOH A . 
J 8 HOH 94  694 102 HOH HOH A . 
J 8 HOH 95  695 103 HOH HOH A . 
J 8 HOH 96  696 105 HOH HOH A . 
J 8 HOH 97  697 107 HOH HOH A . 
J 8 HOH 98  698 108 HOH HOH A . 
J 8 HOH 99  699 109 HOH HOH A . 
J 8 HOH 100 700 110 HOH HOH A . 
J 8 HOH 101 701 111 HOH HOH A . 
J 8 HOH 102 702 112 HOH HOH A . 
J 8 HOH 103 703 114 HOH HOH A . 
J 8 HOH 104 704 115 HOH HOH A . 
J 8 HOH 105 705 116 HOH HOH A . 
J 8 HOH 106 706 117 HOH HOH A . 
J 8 HOH 107 707 118 HOH HOH A . 
J 8 HOH 108 708 119 HOH HOH A . 
J 8 HOH 109 709 120 HOH HOH A . 
J 8 HOH 110 710 121 HOH HOH A . 
J 8 HOH 111 711 122 HOH HOH A . 
J 8 HOH 112 712 123 HOH HOH A . 
J 8 HOH 113 713 124 HOH HOH A . 
J 8 HOH 114 714 125 HOH HOH A . 
J 8 HOH 115 715 127 HOH HOH A . 
J 8 HOH 116 716 129 HOH HOH A . 
J 8 HOH 117 717 130 HOH HOH A . 
J 8 HOH 118 718 131 HOH HOH A . 
J 8 HOH 119 719 132 HOH HOH A . 
J 8 HOH 120 720 133 HOH HOH A . 
J 8 HOH 121 721 134 HOH HOH A . 
J 8 HOH 122 722 135 HOH HOH A . 
J 8 HOH 123 723 136 HOH HOH A . 
J 8 HOH 124 724 137 HOH HOH A . 
J 8 HOH 125 725 138 HOH HOH A . 
J 8 HOH 126 726 141 HOH HOH A . 
J 8 HOH 127 727 143 HOH HOH A . 
J 8 HOH 128 728 144 HOH HOH A . 
J 8 HOH 129 729 145 HOH HOH A . 
J 8 HOH 130 730 146 HOH HOH A . 
J 8 HOH 131 731 147 HOH HOH A . 
J 8 HOH 132 732 148 HOH HOH A . 
J 8 HOH 133 733 149 HOH HOH A . 
J 8 HOH 134 734 150 HOH HOH A . 
J 8 HOH 135 735 151 HOH HOH A . 
J 8 HOH 136 736 152 HOH HOH A . 
J 8 HOH 137 737 153 HOH HOH A . 
J 8 HOH 138 738 154 HOH HOH A . 
J 8 HOH 139 739 155 HOH HOH A . 
J 8 HOH 140 740 156 HOH HOH A . 
J 8 HOH 141 741 157 HOH HOH A . 
J 8 HOH 142 742 158 HOH HOH A . 
J 8 HOH 143 743 159 HOH HOH A . 
J 8 HOH 144 744 160 HOH HOH A . 
J 8 HOH 145 745 161 HOH HOH A . 
J 8 HOH 146 746 162 HOH HOH A . 
J 8 HOH 147 747 163 HOH HOH A . 
J 8 HOH 148 748 164 HOH HOH A . 
J 8 HOH 149 749 165 HOH HOH A . 
J 8 HOH 150 750 167 HOH HOH A . 
J 8 HOH 151 751 168 HOH HOH A . 
J 8 HOH 152 752 169 HOH HOH A . 
J 8 HOH 153 753 170 HOH HOH A . 
J 8 HOH 154 754 171 HOH HOH A . 
J 8 HOH 155 755 172 HOH HOH A . 
J 8 HOH 156 756 173 HOH HOH A . 
J 8 HOH 157 757 174 HOH HOH A . 
J 8 HOH 158 758 175 HOH HOH A . 
J 8 HOH 159 759 176 HOH HOH A . 
J 8 HOH 160 760 177 HOH HOH A . 
J 8 HOH 161 761 178 HOH HOH A . 
J 8 HOH 162 762 179 HOH HOH A . 
J 8 HOH 163 763 180 HOH HOH A . 
J 8 HOH 164 764 181 HOH HOH A . 
J 8 HOH 165 765 182 HOH HOH A . 
J 8 HOH 166 766 183 HOH HOH A . 
J 8 HOH 167 767 185 HOH HOH A . 
J 8 HOH 168 768 186 HOH HOH A . 
J 8 HOH 169 769 187 HOH HOH A . 
J 8 HOH 170 770 188 HOH HOH A . 
J 8 HOH 171 771 189 HOH HOH A . 
J 8 HOH 172 772 190 HOH HOH A . 
J 8 HOH 173 773 191 HOH HOH A . 
J 8 HOH 174 774 192 HOH HOH A . 
J 8 HOH 175 775 193 HOH HOH A . 
J 8 HOH 176 776 194 HOH HOH A . 
J 8 HOH 177 777 195 HOH HOH A . 
J 8 HOH 178 778 196 HOH HOH A . 
J 8 HOH 179 779 197 HOH HOH A . 
J 8 HOH 180 780 198 HOH HOH A . 
J 8 HOH 181 781 200 HOH HOH A . 
J 8 HOH 182 782 202 HOH HOH A . 
J 8 HOH 183 783 203 HOH HOH A . 
J 8 HOH 184 784 204 HOH HOH A . 
J 8 HOH 185 785 205 HOH HOH A . 
J 8 HOH 186 786 206 HOH HOH A . 
J 8 HOH 187 787 207 HOH HOH A . 
J 8 HOH 188 788 208 HOH HOH A . 
J 8 HOH 189 789 209 HOH HOH A . 
J 8 HOH 190 790 211 HOH HOH A . 
J 8 HOH 191 791 212 HOH HOH A . 
J 8 HOH 192 792 213 HOH HOH A . 
J 8 HOH 193 793 214 HOH HOH A . 
J 8 HOH 194 794 216 HOH HOH A . 
J 8 HOH 195 795 217 HOH HOH A . 
J 8 HOH 196 796 218 HOH HOH A . 
J 8 HOH 197 797 219 HOH HOH A . 
J 8 HOH 198 798 220 HOH HOH A . 
J 8 HOH 199 799 221 HOH HOH A . 
J 8 HOH 200 800 222 HOH HOH A . 
J 8 HOH 201 801 223 HOH HOH A . 
J 8 HOH 202 802 224 HOH HOH A . 
J 8 HOH 203 803 225 HOH HOH A . 
J 8 HOH 204 804 226 HOH HOH A . 
J 8 HOH 205 805 227 HOH HOH A . 
J 8 HOH 206 806 229 HOH HOH A . 
J 8 HOH 207 807 230 HOH HOH A . 
J 8 HOH 208 808 231 HOH HOH A . 
J 8 HOH 209 809 232 HOH HOH A . 
J 8 HOH 210 810 233 HOH HOH A . 
J 8 HOH 211 811 234 HOH HOH A . 
J 8 HOH 212 812 236 HOH HOH A . 
J 8 HOH 213 813 237 HOH HOH A . 
J 8 HOH 214 814 238 HOH HOH A . 
J 8 HOH 215 815 239 HOH HOH A . 
J 8 HOH 216 816 240 HOH HOH A . 
J 8 HOH 217 817 241 HOH HOH A . 
J 8 HOH 218 818 242 HOH HOH A . 
J 8 HOH 219 819 243 HOH HOH A . 
J 8 HOH 220 820 245 HOH HOH A . 
J 8 HOH 221 821 246 HOH HOH A . 
J 8 HOH 222 822 247 HOH HOH A . 
J 8 HOH 223 823 248 HOH HOH A . 
J 8 HOH 224 824 249 HOH HOH A . 
J 8 HOH 225 825 250 HOH HOH A . 
J 8 HOH 226 826 251 HOH HOH A . 
J 8 HOH 227 827 252 HOH HOH A . 
J 8 HOH 228 828 253 HOH HOH A . 
J 8 HOH 229 829 254 HOH HOH A . 
J 8 HOH 230 830 255 HOH HOH A . 
J 8 HOH 231 831 256 HOH HOH A . 
J 8 HOH 232 832 257 HOH HOH A . 
J 8 HOH 233 833 258 HOH HOH A . 
J 8 HOH 234 834 259 HOH HOH A . 
J 8 HOH 235 835 260 HOH HOH A . 
J 8 HOH 236 836 261 HOH HOH A . 
J 8 HOH 237 837 262 HOH HOH A . 
J 8 HOH 238 838 263 HOH HOH A . 
J 8 HOH 239 839 264 HOH HOH A . 
J 8 HOH 240 840 266 HOH HOH A . 
J 8 HOH 241 841 267 HOH HOH A . 
J 8 HOH 242 842 268 HOH HOH A . 
J 8 HOH 243 843 269 HOH HOH A . 
J 8 HOH 244 844 272 HOH HOH A . 
J 8 HOH 245 845 274 HOH HOH A . 
J 8 HOH 246 846 275 HOH HOH A . 
J 8 HOH 247 847 276 HOH HOH A . 
J 8 HOH 248 848 277 HOH HOH A . 
J 8 HOH 249 849 278 HOH HOH A . 
J 8 HOH 250 850 280 HOH HOH A . 
J 8 HOH 251 851 281 HOH HOH A . 
J 8 HOH 252 852 283 HOH HOH A . 
J 8 HOH 253 853 284 HOH HOH A . 
J 8 HOH 254 854 285 HOH HOH A . 
J 8 HOH 255 855 287 HOH HOH A . 
J 8 HOH 256 856 288 HOH HOH A . 
J 8 HOH 257 857 290 HOH HOH A . 
J 8 HOH 258 858 291 HOH HOH A . 
J 8 HOH 259 859 292 HOH HOH A . 
J 8 HOH 260 860 293 HOH HOH A . 
J 8 HOH 261 861 294 HOH HOH A . 
J 8 HOH 262 862 295 HOH HOH A . 
J 8 HOH 263 863 296 HOH HOH A . 
J 8 HOH 264 864 297 HOH HOH A . 
J 8 HOH 265 865 299 HOH HOH A . 
J 8 HOH 266 866 300 HOH HOH A . 
J 8 HOH 267 867 301 HOH HOH A . 
J 8 HOH 268 868 303 HOH HOH A . 
J 8 HOH 269 869 304 HOH HOH A . 
J 8 HOH 270 870 305 HOH HOH A . 
J 8 HOH 271 871 306 HOH HOH A . 
J 8 HOH 272 872 307 HOH HOH A . 
J 8 HOH 273 873 308 HOH HOH A . 
J 8 HOH 274 874 309 HOH HOH A . 
J 8 HOH 275 875 310 HOH HOH A . 
J 8 HOH 276 876 311 HOH HOH A . 
J 8 HOH 277 877 312 HOH HOH A . 
J 8 HOH 278 878 313 HOH HOH A . 
J 8 HOH 279 879 319 HOH HOH A . 
J 8 HOH 280 880 320 HOH HOH A . 
J 8 HOH 281 881 321 HOH HOH A . 
J 8 HOH 282 882 322 HOH HOH A . 
J 8 HOH 283 883 323 HOH HOH A . 
J 8 HOH 284 884 325 HOH HOH A . 
J 8 HOH 285 885 326 HOH HOH A . 
J 8 HOH 286 886 327 HOH HOH A . 
J 8 HOH 287 887 328 HOH HOH A . 
J 8 HOH 288 888 329 HOH HOH A . 
J 8 HOH 289 889 330 HOH HOH A . 
J 8 HOH 290 890 333 HOH HOH A . 
J 8 HOH 291 891 334 HOH HOH A . 
J 8 HOH 292 892 335 HOH HOH A . 
J 8 HOH 293 893 336 HOH HOH A . 
J 8 HOH 294 894 337 HOH HOH A . 
J 8 HOH 295 895 338 HOH HOH A . 
J 8 HOH 296 896 339 HOH HOH A . 
J 8 HOH 297 897 341 HOH HOH A . 
J 8 HOH 298 898 342 HOH HOH A . 
J 8 HOH 299 899 343 HOH HOH A . 
J 8 HOH 300 900 344 HOH HOH A . 
J 8 HOH 301 901 345 HOH HOH A . 
J 8 HOH 302 902 347 HOH HOH A . 
J 8 HOH 303 903 348 HOH HOH A . 
J 8 HOH 304 904 349 HOH HOH A . 
J 8 HOH 305 905 350 HOH HOH A . 
J 8 HOH 306 906 351 HOH HOH A . 
J 8 HOH 307 907 352 HOH HOH A . 
J 8 HOH 308 908 353 HOH HOH A . 
J 8 HOH 309 909 355 HOH HOH A . 
J 8 HOH 310 910 356 HOH HOH A . 
J 8 HOH 311 911 357 HOH HOH A . 
J 8 HOH 312 912 359 HOH HOH A . 
J 8 HOH 313 913 360 HOH HOH A . 
J 8 HOH 314 914 361 HOH HOH A . 
J 8 HOH 315 915 363 HOH HOH A . 
J 8 HOH 316 916 364 HOH HOH A . 
J 8 HOH 317 917 365 HOH HOH A . 
J 8 HOH 318 918 367 HOH HOH A . 
J 8 HOH 319 919 368 HOH HOH A . 
J 8 HOH 320 920 369 HOH HOH A . 
J 8 HOH 321 921 370 HOH HOH A . 
J 8 HOH 322 922 371 HOH HOH A . 
J 8 HOH 323 923 372 HOH HOH A . 
J 8 HOH 324 924 373 HOH HOH A . 
J 8 HOH 325 925 374 HOH HOH A . 
J 8 HOH 326 926 376 HOH HOH A . 
J 8 HOH 327 927 377 HOH HOH A . 
J 8 HOH 328 928 378 HOH HOH A . 
J 8 HOH 329 929 379 HOH HOH A . 
J 8 HOH 330 930 380 HOH HOH A . 
J 8 HOH 331 931 382 HOH HOH A . 
J 8 HOH 332 932 383 HOH HOH A . 
J 8 HOH 333 933 384 HOH HOH A . 
J 8 HOH 334 934 385 HOH HOH A . 
J 8 HOH 335 935 386 HOH HOH A . 
J 8 HOH 336 936 387 HOH HOH A . 
J 8 HOH 337 937 389 HOH HOH A . 
J 8 HOH 338 938 390 HOH HOH A . 
J 8 HOH 339 939 391 HOH HOH A . 
J 8 HOH 340 940 393 HOH HOH A . 
J 8 HOH 341 941 394 HOH HOH A . 
J 8 HOH 342 942 395 HOH HOH A . 
J 8 HOH 343 943 397 HOH HOH A . 
J 8 HOH 344 944 398 HOH HOH A . 
J 8 HOH 345 945 400 HOH HOH A . 
J 8 HOH 346 946 401 HOH HOH A . 
J 8 HOH 347 947 402 HOH HOH A . 
J 8 HOH 348 948 403 HOH HOH A . 
J 8 HOH 349 949 404 HOH HOH A . 
J 8 HOH 350 950 405 HOH HOH A . 
J 8 HOH 351 951 406 HOH HOH A . 
J 8 HOH 352 952 407 HOH HOH A . 
J 8 HOH 353 953 409 HOH HOH A . 
J 8 HOH 354 954 410 HOH HOH A . 
J 8 HOH 355 955 411 HOH HOH A . 
J 8 HOH 356 956 412 HOH HOH A . 
J 8 HOH 357 957 413 HOH HOH A . 
J 8 HOH 358 958 414 HOH HOH A . 
J 8 HOH 359 959 415 HOH HOH A . 
J 8 HOH 360 960 416 HOH HOH A . 
J 8 HOH 361 961 417 HOH HOH A . 
J 8 HOH 362 962 420 HOH HOH A . 
J 8 HOH 363 963 421 HOH HOH A . 
J 8 HOH 364 964 424 HOH HOH A . 
J 8 HOH 365 965 425 HOH HOH A . 
J 8 HOH 366 966 426 HOH HOH A . 
J 8 HOH 367 967 427 HOH HOH A . 
J 8 HOH 368 968 428 HOH HOH A . 
J 8 HOH 369 969 429 HOH HOH A . 
J 8 HOH 370 970 431 HOH HOH A . 
J 8 HOH 371 971 433 HOH HOH A . 
J 8 HOH 372 972 434 HOH HOH A . 
J 8 HOH 373 973 435 HOH HOH A . 
J 8 HOH 374 974 436 HOH HOH A . 
J 8 HOH 375 975 437 HOH HOH A . 
J 8 HOH 376 976 438 HOH HOH A . 
J 8 HOH 377 977 439 HOH HOH A . 
J 8 HOH 378 978 440 HOH HOH A . 
J 8 HOH 379 979 443 HOH HOH A . 
J 8 HOH 380 980 444 HOH HOH A . 
J 8 HOH 381 981 445 HOH HOH A . 
J 8 HOH 382 982 446 HOH HOH A . 
J 8 HOH 383 983 447 HOH HOH A . 
J 8 HOH 384 984 448 HOH HOH A . 
J 8 HOH 385 985 449 HOH HOH A . 
J 8 HOH 386 986 451 HOH HOH A . 
J 8 HOH 387 987 452 HOH HOH A . 
J 8 HOH 388 988 453 HOH HOH A . 
J 8 HOH 389 989 454 HOH HOH A . 
J 8 HOH 390 990 455 HOH HOH A . 
J 8 HOH 391 991 456 HOH HOH A . 
J 8 HOH 392 992 457 HOH HOH A . 
J 8 HOH 393 993 459 HOH HOH A . 
K 8 HOH 1   101 39  HOH HOH T . 
K 8 HOH 2   102 65  HOH HOH T . 
K 8 HOH 3   103 66  HOH HOH T . 
K 8 HOH 4   104 85  HOH HOH T . 
K 8 HOH 5   105 128 HOH HOH T . 
K 8 HOH 6   106 139 HOH HOH T . 
K 8 HOH 7   107 140 HOH HOH T . 
K 8 HOH 8   108 184 HOH HOH T . 
K 8 HOH 9   109 201 HOH HOH T . 
K 8 HOH 10  110 210 HOH HOH T . 
K 8 HOH 11  111 215 HOH HOH T . 
K 8 HOH 12  112 228 HOH HOH T . 
K 8 HOH 13  113 235 HOH HOH T . 
K 8 HOH 14  114 244 HOH HOH T . 
K 8 HOH 15  115 265 HOH HOH T . 
K 8 HOH 16  116 273 HOH HOH T . 
K 8 HOH 17  117 279 HOH HOH T . 
K 8 HOH 18  118 282 HOH HOH T . 
K 8 HOH 19  119 315 HOH HOH T . 
K 8 HOH 20  120 316 HOH HOH T . 
K 8 HOH 21  121 317 HOH HOH T . 
K 8 HOH 22  122 318 HOH HOH T . 
K 8 HOH 23  123 324 HOH HOH T . 
K 8 HOH 24  124 331 HOH HOH T . 
K 8 HOH 25  125 332 HOH HOH T . 
K 8 HOH 26  126 340 HOH HOH T . 
K 8 HOH 27  127 346 HOH HOH T . 
K 8 HOH 28  128 358 HOH HOH T . 
K 8 HOH 29  129 381 HOH HOH T . 
K 8 HOH 30  130 392 HOH HOH T . 
K 8 HOH 31  131 396 HOH HOH T . 
K 8 HOH 32  132 399 HOH HOH T . 
K 8 HOH 33  133 408 HOH HOH T . 
K 8 HOH 34  134 418 HOH HOH T . 
K 8 HOH 35  135 432 HOH HOH T . 
K 8 HOH 36  136 441 HOH HOH T . 
K 8 HOH 37  137 458 HOH HOH T . 
L 8 HOH 1   101 55  HOH HOH P . 
L 8 HOH 2   102 69  HOH HOH P . 
L 8 HOH 3   103 97  HOH HOH P . 
L 8 HOH 4   104 104 HOH HOH P . 
L 8 HOH 5   105 106 HOH HOH P . 
L 8 HOH 6   106 113 HOH HOH P . 
L 8 HOH 7   107 126 HOH HOH P . 
L 8 HOH 8   108 142 HOH HOH P . 
L 8 HOH 9   109 166 HOH HOH P . 
L 8 HOH 10  110 199 HOH HOH P . 
L 8 HOH 11  111 270 HOH HOH P . 
L 8 HOH 12  112 271 HOH HOH P . 
L 8 HOH 13  113 289 HOH HOH P . 
L 8 HOH 14  114 298 HOH HOH P . 
L 8 HOH 15  115 302 HOH HOH P . 
L 8 HOH 16  116 314 HOH HOH P . 
L 8 HOH 17  117 354 HOH HOH P . 
L 8 HOH 18  118 366 HOH HOH P . 
L 8 HOH 19  119 375 HOH HOH P . 
L 8 HOH 20  120 388 HOH HOH P . 
L 8 HOH 21  121 419 HOH HOH P . 
L 8 HOH 22  122 423 HOH HOH P . 
L 8 HOH 23  123 442 HOH HOH P . 
L 8 HOH 24  124 450 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5690  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  22020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 88.2  ? 
2  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OE1   B A GLU 119 ? A GLU 116 ? 1_555 114.1 ? 
3  "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OE1   B A GLU 119 ? A GLU 116 ? 1_555 83.6  ? 
4  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 94.8  ? 
5  "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 88.4  ? 
6  OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 149.6 ? 
7  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 87.6  ? 
8  "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 173.7 ? 
9  OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 102.3 ? 
10 O2A   ? I DTP .   ? P DTP 502 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 87.4  ? 
11 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 847 ? 1_555 162.8 ? 
12 "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 847 ? 1_555 93.8  ? 
13 OE1   B A GLU 119 ? A GLU 116 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 847 ? 1_555 83.1  ? 
14 O2A   ? I DTP .   ? P DTP 502 ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 847 ? 1_555 68.2  ? 
15 OD2   B A ASP 16  ? A ASP 13  ? 1_555 NA B D NA . ? A NA 501 ? 1_555 O     ? J HOH .   ? A HOH 847 ? 1_555 88.9  ? 
16 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 89.0  ? 
17 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O3G   ? I DTP .   ? P DTP 502 ? 1_555 81.0  ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O3G   ? I DTP .   ? P DTP 502 ? 1_555 100.2 ? 
19 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 83.2  ? 
20 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 169.8 ? 
21 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 502 ? 1_555 85.0  ? 
22 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 83.2  ? 
23 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 82.9  ? 
24 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 163.9 ? 
25 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 89.7  ? 
26 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 152.5 ? 
27 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 71.1  ? 
28 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 84.0  ? 
29 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 118.4 ? 
30 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 111.8 ? 
31 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 158.5 ? 
32 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 101.6 ? 
33 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 114.8 ? 
34 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 83.9  ? 
35 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 79.6  ? 
36 OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   B A ASP 16  ? A ASP 13  ? 1_555 48.4  ? 
37 O1B   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 152.5 ? 
38 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 86.7  ? 
39 O3G   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 73.0  ? 
40 O2A   ? I DTP .   ? P DTP 502 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 103.2 ? 
41 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 123.0 ? 
42 OD2   A A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 17.3  ? 
43 OD2   B A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   B A ASP 16  ? A ASP 13  ? 1_555 48.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ED2 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;GLU A 116 HAS THE FOLLOWING ALTERNATE CONFIGURATION.
ALTERNATE A HAS GLU 116 (OCCUPANCY 0.20), 
ALTERNATE B HAS GLU 116 (OCCUPANCY 0.80) + NA 501.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 7 ? ? "C1'" T DG 7 ? ? N9    T DG 7 ? ? 111.01 108.30 2.71  0.30 N 
2 1 "O4'" P DG 2 ? B "C1'" P DG 2 ? B N9    P DG 2 ? ? 110.57 108.30 2.27  0.30 N 
3 1 "O4'" P DA 7 ? A "C4'" P DA 7 ? A "C3'" P DA 7 ? A 101.84 104.50 -2.66 0.40 N 
4 1 "O4'" P DA 7 ? B "C4'" P DA 7 ? B "C3'" P DA 7 ? B 100.45 104.50 -4.05 0.40 N 
5 1 "O4'" P DA 7 ? B "C1'" P DA 7 ? B N9    P DA 7 ? ? 110.52 108.30 2.22  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 23.96   64.93   
2 1 TYR A 39  ? ? 65.83   174.95  
3 1 LYS A 40  ? ? -150.44 -29.63  
4 1 SER A 62  ? ? 81.87   -9.18   
5 1 SER A 217 ? ? -156.44 -158.38 
6 1 SER A 257 ? ? 94.37   -10.23  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ED2 'double helix'        
4ED2 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 6  1_555 C DA 7 1_555 0.060  -0.069 0.226  -1.093 -14.014 2.010  1 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.162 -0.104 -0.275 -7.018 -3.681  -1.424 2 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.057  -0.076 0.060  2.714  -2.100  1.043  3 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.320  -0.113 -0.251 12.115 -7.369  1.244  4 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.597 -0.049 0.009  -3.113 -6.892  6.177  5 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.145  -0.064 0.181  -5.826 -3.062  -0.599 6 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.130 -0.266 -0.161 18.763 -3.724  5.633  7 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.359 -1.182 3.421 5.920  9.290  28.744 -4.019 1.816  2.786 17.904 
-11.409 30.741 1 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.679 -0.455 3.170 -2.327 0.377  34.485 -0.822 0.793  3.202 0.634  3.920 
34.563 2 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.446  -0.686 3.220 3.091  0.714  31.750 -1.376 -0.256 3.232 1.301  -5.633 
31.904 3 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.306 -0.669 3.713 -5.392 6.109  32.265 -2.318 -0.479 3.534 10.779 9.514 
33.252 4 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.655 -0.590 3.504 -1.774 -0.084 37.901 -0.896 0.764  3.531 -0.129 2.730 
37.941 5 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.296  0.168  2.884 -0.611 3.673  26.502 -0.480 -0.781 2.873 7.962  1.325 
26.758 6 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION'                        NA  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 water                               HOH 
#