data_4ED3
# 
_entry.id   4ED3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ED3         
NDB   NA1713       
RCSB  RCSB071465   
WWPDB D_1000071465 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ED3 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ED3 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ED3 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ?                                     ? 
4 non-polymer syn 'SODIUM ION'                                         22.990    1   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 water       nat water                                                18.015    456 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ED3       4ED3   2 ? ? ? 
3 PDB 4ED3       4ED3   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ED3 A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ED3 T 1 ? 12  ? 4ED3   1 ? 12  ? 1 12  
3 3 4ED3 P 1 ? 8   ? 4ED3   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ED3 GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ED3 PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ED3 HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
NA  non-polymer         . 'SODIUM ION'                         ?                               'Na 1'              22.990  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ED3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-07-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ED3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.791 
_reflns.number_obs                   42317 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.071 
_reflns.pdbx_netI_over_sigmaI        17.9 
_reflns.B_iso_Wilson_estimate        16.320 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.80 
_reflns_shell.d_res_low                   1.83 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.440 
_reflns_shell.meanI_over_sigI_obs         3.0 
_reflns_shell.pdbx_redundancy             3.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ED3 
_refine.ls_number_reflns_obs                     40864 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.07 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.517 
_refine.ls_d_res_high                            1.791 
_refine.ls_percent_reflns_obs                    95.07 
_refine.ls_R_factor_obs                          0.1690 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1665 
_refine.ls_R_factor_R_free                       0.2158 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  2064 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               23.0646 
_refine.aniso_B[1][1]                            0.8962 
_refine.aniso_B[2][2]                            0.8962 
_refine.aniso_B[3][3]                            -1.7925 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.346 
_refine.solvent_model_param_bsol                 36.937 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.21 
_refine.overall_FOM_work_R_set                   0.8722 
_refine.B_iso_max                                88.570 
_refine.B_iso_min                                4.730 
_refine.pdbx_overall_phase_error                 20.4100 
_refine.occupancy_max                            1.200 
_refine.occupancy_min                            0.500 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             456 
_refine_hist.number_atoms_total               4259 
_refine_hist.d_res_high                       1.791 
_refine_hist.d_res_low                        28.517 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           3998 0.007  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5492 1.122  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     614  0.069  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      631  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1578 18.267 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.7912 1.8329  15 70.0000  1890 . 0.1962 0.2567 . 89  . 1979 . 'X-RAY DIFFRACTION' . 
1.8329 1.8787  15 91.0000  2433 . 0.1837 0.2285 . 150 . 2583 . 'X-RAY DIFFRACTION' . 
1.8787 1.9295  15 92.0000  2486 . 0.1731 0.2302 . 142 . 2628 . 'X-RAY DIFFRACTION' . 
1.9295 1.9862  15 93.0000  2539 . 0.1676 0.2454 . 132 . 2671 . 'X-RAY DIFFRACTION' . 
1.9862 2.0503  15 95.0000  2581 . 0.1815 0.2157 . 121 . 2702 . 'X-RAY DIFFRACTION' . 
2.0503 2.1236  15 97.0000  2616 . 0.1622 0.2368 . 137 . 2753 . 'X-RAY DIFFRACTION' . 
2.1236 2.2086  15 97.0000  2651 . 0.1621 0.2067 . 159 . 2810 . 'X-RAY DIFFRACTION' . 
2.2086 2.3091  15 98.0000  2654 . 0.1601 0.1966 . 137 . 2791 . 'X-RAY DIFFRACTION' . 
2.3091 2.4307  15 98.0000  2672 . 0.1672 0.2673 . 142 . 2814 . 'X-RAY DIFFRACTION' . 
2.4307 2.5829  15 98.0000  2681 . 0.1805 0.2093 . 135 . 2816 . 'X-RAY DIFFRACTION' . 
2.5829 2.7822  15 99.0000  2693 . 0.1758 0.2383 . 132 . 2825 . 'X-RAY DIFFRACTION' . 
2.7822 3.0619  15 99.0000  2692 . 0.1819 0.2346 . 165 . 2857 . 'X-RAY DIFFRACTION' . 
3.0619 3.5043  15 100.0000 2732 . 0.1583 0.2021 . 134 . 2866 . 'X-RAY DIFFRACTION' . 
3.5043 4.4124  15 100.0000 2725 . 0.1401 0.1674 . 145 . 2870 . 'X-RAY DIFFRACTION' . 
4.4124 28.5207 15 99.0000  2755 . 0.1602 0.2050 . 144 . 2899 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ED3 
_struct.title                     
'Human DNA polymerase eta - DNA ternary complex: AT crystal at pH 7.5 (Na+ HEPES) with 1 Ca2+ ion' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ED3 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D NA  . NA ? ? A ASP 115 A NA  502 1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc2  metalc ? ? I DTP .   O1B   ? ? ? 1_555 E CA  . CA ? ? P DTP 501 A CA  503 1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc3  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA ? ? A MET 14  A CA  503 1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc4  metalc ? ? I DTP .   O2A   ? ? ? 1_555 D NA  . NA ? ? P DTP 501 A NA  502 1_555 ? ? ? ? ? ? ?            2.344 ? 
metalc5  metalc ? ? I DTP .   O3G   ? ? ? 1_555 E CA  . CA ? ? P DTP 501 A CA  503 1_555 ? ? ? ? ? ? ?            2.353 ? 
metalc6  metalc ? ? C DT  8   "O3'" ? ? ? 1_555 D NA  . NA ? ? P DT  8   A NA  502 1_555 ? ? ? ? ? ? ?            2.353 ? 
metalc7  metalc ? ? A GLU 119 OE1   ? ? ? 1_555 D NA  . NA ? ? A GLU 116 A NA  502 1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc8  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA ? ? A ASP 115 A CA  503 1_555 ? ? ? ? ? ? ?            2.407 ? 
metalc9  metalc ? ? I DTP .   O2A   ? ? ? 1_555 E CA  . CA ? ? P DTP 501 A CA  503 1_555 ? ? ? ? ? ? ?            2.412 ? 
metalc10 metalc ? ? A ASP 16  OD2   ? ? ? 1_555 D NA  . NA ? ? A ASP 13  A NA  502 1_555 ? ? ? ? ? ? ?            2.423 ? 
metalc11 metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.518 ? 
metalc12 metalc ? ? A ASP 16  OD2   ? ? ? 1_555 E CA  . CA ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.589 ? 
metalc13 metalc ? ? D NA  .   NA    ? ? ? 1_555 J HOH . O  ? ? A NA  502 A HOH 725 1_555 ? ? ? ? ? ? ?            3.068 ? 
hydrog1  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -0.32 
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -0.72 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -7.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
A 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE DTP P 501' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE NA A 502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 503'  
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 504' 
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 505' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 26 ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 26 MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 26 ASP A 18  ? ASP A 15  . ? 1_555 ? 
4  AC1 26 CYS A 19  ? CYS A 16  . ? 1_555 ? 
5  AC1 26 PHE A 20  ? PHE A 17  . ? 1_555 ? 
6  AC1 26 PHE A 21  ? PHE A 18  . ? 1_555 ? 
7  AC1 26 ILE A 51  ? ILE A 48  . ? 1_555 ? 
8  AC1 26 ALA A 52  ? ALA A 49  . ? 1_555 ? 
9  AC1 26 TYR A 55  ? TYR A 52  . ? 1_555 ? 
10 AC1 26 ARG A 58  ? ARG A 55  . ? 1_555 ? 
11 AC1 26 ARG A 64  ? ARG A 61  . ? 1_555 ? 
12 AC1 26 ASP A 118 ? ASP A 115 . ? 1_555 ? 
13 AC1 26 LYS A 234 ? LYS A 231 . ? 1_555 ? 
14 AC1 26 NA  D .   ? NA  A 502 . ? 1_555 ? 
15 AC1 26 CA  E .   ? CA  A 503 . ? 1_555 ? 
16 AC1 26 HOH J .   ? HOH A 604 . ? 1_555 ? 
17 AC1 26 HOH J .   ? HOH A 640 . ? 1_555 ? 
18 AC1 26 HOH J .   ? HOH A 647 . ? 1_555 ? 
19 AC1 26 HOH J .   ? HOH A 676 . ? 1_555 ? 
20 AC1 26 HOH J .   ? HOH A 709 . ? 1_555 ? 
21 AC1 26 HOH J .   ? HOH A 892 . ? 1_555 ? 
22 AC1 26 DT  C 8   ? DT  P 8   . ? 1_555 ? 
23 AC1 26 HOH L .   ? HOH P 101 . ? 1_555 ? 
24 AC1 26 DT  B 3   ? DT  T 3   . ? 1_555 ? 
25 AC1 26 DT  B 4   ? DT  T 4   . ? 1_555 ? 
26 AC1 26 DA  B 5   ? DA  T 5   . ? 1_555 ? 
27 AC2 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
28 AC2 8  SER A 116 ? SER A 113 . ? 1_555 ? 
29 AC2 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
30 AC2 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
31 AC2 8  CA  E .   ? CA  A 503 . ? 1_555 ? 
32 AC2 8  HOH J .   ? HOH A 725 . ? 1_555 ? 
33 AC2 8  DT  C 8   ? DT  P 8   . ? 1_555 ? 
34 AC2 8  DTP I .   ? DTP P 501 . ? 1_555 ? 
35 AC3 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
36 AC3 5  MET A 17  ? MET A 14  . ? 1_555 ? 
37 AC3 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
38 AC3 5  NA  D .   ? NA  A 502 . ? 1_555 ? 
39 AC3 5  DTP I .   ? DTP P 501 . ? 1_555 ? 
40 AC4 10 ARG A 27  ? ARG A 24  . ? 6_545 ? 
41 AC4 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
42 AC4 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
43 AC4 10 SER A 251 ? SER A 248 . ? 1_555 ? 
44 AC4 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
45 AC4 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
46 AC4 10 HOH J .   ? HOH A 602 . ? 1_555 ? 
47 AC4 10 HOH J .   ? HOH A 634 . ? 1_555 ? 
48 AC4 10 HOH J .   ? HOH A 669 . ? 1_555 ? 
49 AC4 10 HOH J .   ? HOH A 715 . ? 1_555 ? 
50 AC5 10 GLU A 97  ? GLU A 94  . ? 1_555 ? 
51 AC5 10 ALA A 98  ? ALA A 95  . ? 1_555 ? 
52 AC5 10 GLU A 101 ? GLU A 98  . ? 1_555 ? 
53 AC5 10 ARG A 306 ? ARG A 303 . ? 5_664 ? 
54 AC5 10 HOH J .   ? HOH A 648 . ? 1_555 ? 
55 AC5 10 HOH J .   ? HOH A 651 . ? 1_555 ? 
56 AC5 10 HOH J .   ? HOH A 736 . ? 5_664 ? 
57 AC5 10 HOH J .   ? HOH A 801 . ? 1_555 ? 
58 AC5 10 HOH J .   ? HOH A 829 . ? 1_555 ? 
59 AC5 10 HOH J .   ? HOH A 849 . ? 5_664 ? 
60 AC6 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
61 AC6 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
62 AC6 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
63 AC6 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
64 AC6 10 ILE A 275 ? ILE A 272 . ? 5_664 ? 
65 AC6 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
66 AC6 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
67 AC6 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
68 AC6 10 HOH J .   ? HOH A 807 . ? 1_555 ? 
69 AC6 10 HOH J .   ? HOH A 915 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4ED3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ED3 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.804 -34.325 -3.532  1.00 46.28 ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.197 -34.369 -3.939  1.00 48.44 ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.572 -33.320 -4.975  1.00 51.95 ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.351 -32.126 -4.768  1.00 51.44 ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.149 -33.766 -6.102  1.00 52.16 ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.621 -32.888 -7.181  1.00 52.71 ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.489 -32.249 -7.993  1.00 55.18 ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.705 -31.218 -8.638  1.00 58.05 ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.439 -33.837 -8.066  1.00 52.96 ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.832 -35.180 -7.831  1.00 53.73 ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.417 -35.188 -6.386  1.00 48.65 ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.302 -32.848 -7.957  1.00 47.25 ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.169 -32.348 -8.735  1.00 51.14 ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.231 -31.478 -7.899  1.00 54.71 ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.212 -30.997 -8.396  1.00 49.03 ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.396 -33.515 -9.361  1.00 43.59 ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.280 -34.570 -9.951  1.00 43.27 ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.956 -34.396 -11.137 1.00 44.13 ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.609 -35.807 -9.505  1.00 40.18 ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.661 -35.484 -11.405 1.00 39.49 ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.469 -36.352 -10.429 1.00 41.30 ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.581 -31.275 -6.631  1.00 55.36 ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.750 -30.489 -5.723  1.00 55.77 ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 64.006 -28.987 -5.875  1.00 53.98 ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.992 -28.465 -5.353  1.00 49.97 ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.999 -30.910 -4.273  1.00 56.74 ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.913 -30.460 -3.307  1.00 60.72 ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.400 -31.424 -3.496  1.00 78.84 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.923 -33.005 -2.829  1.00 66.20 ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 63.115 -28.301 -6.589  1.00 51.15 ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.238 -26.859 -6.802  1.00 44.19 ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.114 -26.095 -5.486  1.00 40.74 ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.349 -26.482 -4.603  1.00 35.50 ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 62.207 -26.374 -7.804  1.00 48.63 ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.868 -25.006 -5.371  1.00 27.21 ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.055 -24.316 -4.100  1.00 27.54 ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.622 -22.853 -4.163  1.00 22.54 ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.882 -22.078 -3.240  1.00 29.78 ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.528 -24.373 -3.672  1.00 27.47 ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.339 -23.780 -4.694  1.00 30.58 ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 65.963 -25.817 -3.462  1.00 29.96 ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.972 -22.480 -5.262  1.00 24.91 ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.453 -21.132 -5.420  1.00 27.36 ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.527 -20.070 -5.276  1.00 26.90 ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.365 -19.108 -4.512  1.00 25.17 ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.628 -20.252 -6.004  1.00 17.30 ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.766 -19.336 -5.938  1.00 14.36 ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.125 -18.761 -7.307  1.00 18.29 ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.205 -18.209 -7.490  1.00 18.87 ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.989 -20.044 -5.333  1.00 14.85 ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.901 -20.230 -3.821  1.00 21.26 ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.059 -21.030 -3.277  1.00 17.69 ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.127 -22.238 -3.478  1.00 21.30 ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.988 -20.361 -2.599  1.00 21.06 ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.193 -18.887 -8.247  1.00 20.74 ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.379 -18.502 -9.642  1.00 24.20 ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.356 -16.993 -9.918  1.00 23.24 ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.882 -16.544 -10.936 1.00 22.97 ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.299 -19.182 -10.508 1.00 25.52 ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.875 -18.966 -9.967  1.00 30.31 ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.602 -19.288 -8.786  1.00 30.41 ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 62.013 -18.478 -10.734 1.00 39.11 ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.734 -16.223 -9.032  1.00 15.80 ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.531 -14.785 -9.243  1.00 14.58 ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.128 -13.947 -8.128  1.00 13.84 ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.336 -14.436 -7.019  1.00 11.50 ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 63.025 -14.474 -9.278  1.00 15.16 ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.229 -15.172 -10.373 1.00 17.28 ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.734 -14.807 -10.275 1.00 16.41 ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.080 -15.408 -9.104  1.00 13.40 ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 59.012 -14.894 -8.496  1.00 13.72 ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.480 -15.507 -7.447  1.00 12.48 ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.472 -13.764 -8.937  1.00 13.53 ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.386 -12.672 -8.417  1.00 10.98 ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.676 -11.708 -7.364  1.00 7.24  ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.548 -10.671 -7.382  1.00 11.62 ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.324 -10.011 -8.401  1.00 10.93 ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 67.047 -11.016 -7.546  1.00 10.81 ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.276 -10.006 -6.424  1.00 11.38 ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.169 -12.041 -7.549  1.00 12.03 ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.829 -10.551 -6.269  1.00 8.70  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.657 -9.671  -6.200  1.00 8.08  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.822 -8.688  -5.050  1.00 10.50 ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.239 -9.069  -3.959  1.00 11.86 ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.348 -10.472 -6.013  1.00 8.96  ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.156 -9.540  -5.805  1.00 10.34 ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.107 -11.415 -7.208  1.00 9.92  ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.513 -7.411  -5.287  1.00 9.78  ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.540 -6.451  -4.187  1.00 8.27  ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.168 -5.837  -3.965  1.00 9.13  ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.347 -5.783  -4.880  1.00 10.89 ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.618 -5.367  -4.413  1.00 8.17  ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.907 -5.415  -2.733  1.00 6.40  ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.718 -4.644  -2.429  1.00 6.99  ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.209 -3.345  -1.782  1.00 13.22 ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.889 -3.371  -0.746  1.00 12.30 ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.789 -5.425  -1.497  1.00 7.19  ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.441 -4.822  -1.052  1.00 12.36 ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.625 -3.823  0.101   1.00 12.54 ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.717 -4.144  -2.223  1.00 12.49 ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.905 -2.218  -2.423  1.00 9.84  ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.337 -0.916  -1.926  1.00 10.90 ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 59.108 -0.184  -1.422  1.00 13.71 ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 58.122 -0.054  -2.146  1.00 11.89 ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.999 -0.085  -3.026  1.00 13.34 ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.376 1.311   -2.501  1.00 14.58 ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 62.228 -0.815  -3.585  1.00 16.42 ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 59.170 0.291   -0.180  1.00 9.82  ? 13   ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 58.016 0.919   0.451   1.00 12.76 ? 13   ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 58.410 2.212   1.158   1.00 10.78 ? 13   ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 59.333 2.217   1.966   1.00 11.72 ? 13   ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.434 -0.057  1.462   1.00 14.30 ? 13   ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 56.415 0.592   2.353   1.00 13.68 ? 13   ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 56.766 0.932   3.487   1.00 19.19 ? 13   ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 55.275 0.789   1.907   1.00 19.90 ? 13   ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.703 3.310   0.888   1.00 9.76  ? 14   MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 58.076 4.600   1.479   1.00 12.26 ? 14   MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.802 4.590   2.980   1.00 10.52 ? 14   MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.820 4.029   3.430   1.00 9.35  ? 14   MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 57.287 5.754   0.830   1.00 10.18 ? 14   MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 57.343 5.776   -0.696  1.00 12.33 ? 14   MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 59.024 5.746   -1.351  1.00 17.47 ? 14   MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.689 7.285   -0.786  1.00 19.04 ? 14   MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.677 5.194   3.765   1.00 9.29  ? 15   ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.413 5.313   5.193   1.00 10.66 ? 15   ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.320 6.353   5.467   1.00 10.44 ? 15   ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.320 7.433   4.858   1.00 8.99  ? 15   ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.692 5.695   5.928   1.00 10.73 ? 15   ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.815 4.665   5.743   1.00 11.82 ? 15   ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.529 3.460   5.568   1.00 12.26 ? 15   ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.989 5.074   5.804   1.00 16.07 ? 15   ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.422 6.033   6.401   1.00 8.72  ? 16   CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.298 6.907   6.788   1.00 9.37  ? 16   CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.923 7.888   5.674   1.00 8.30  ? 16   CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 55.054 9.093   5.822   1.00 7.80  ? 16   CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.582 7.657   8.102   1.00 9.78  ? 16   CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 57.148 8.559   8.216   1.00 14.08 ? 16   CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.422 7.353   4.573   1.00 6.99  ? 17   PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.415 8.093   3.312   1.00 8.79  ? 17   PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.700 9.447   3.358   1.00 7.04  ? 17   PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.304 10.462  3.015   1.00 7.34  ? 17   PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.872 7.236   2.172   1.00 7.83  ? 17   PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.906 7.918   0.837   1.00 9.16  ? 17   PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 55.067 8.525   0.382   1.00 9.97  ? 17   PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.779 7.951   0.037   1.00 13.01 ? 17   PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 55.106 9.141   -0.876  1.00 12.28 ? 17   PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.803 8.565   -1.205  1.00 13.32 ? 17   PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 53.965 9.158   -1.665  1.00 10.50 ? 17   PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.435 9.481   3.778   1.00 6.72  ? 18   PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.709 10.753  3.719   1.00 6.25  ? 18   PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.376 11.792  4.627   1.00 8.10  ? 18   PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.342 12.989  4.343   1.00 8.19  ? 18   PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.228 10.629  4.108   1.00 5.81  ? 18   PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.371 9.924   3.096   1.00 8.14  ? 18   PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 49.935 9.181   2.069   1.00 8.66  ? 18   PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 47.982 10.005  3.178   1.00 10.54 ? 18   PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 49.127 8.538   1.141   1.00 11.07 ? 18   PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 47.172 9.358   2.245   1.00 10.96 ? 18   PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.748 8.623   1.240   1.00 12.75 ? 18   PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.939 11.340  5.741   1.00 7.82  ? 19   VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.695 12.246  6.610   1.00 7.01  ? 19   VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.911 12.856  5.882   1.00 7.61  ? 19   VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 55.131 14.066  5.951   1.00 7.57  ? 19   VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 54.154 11.547  7.885   1.00 4.73  ? 19   VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 55.206 12.389  8.600   1.00 8.33  ? 19   VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.961 11.301  8.802   1.00 9.99  ? 19   VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.704 12.034  5.193   1.00 6.89  ? 20   GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.845 12.586  4.455   1.00 6.93  ? 20   GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.415 13.600  3.397   1.00 7.68  ? 20   GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 57.128 14.593  3.166   1.00 9.63  ? 20   GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.646 11.488  3.782   1.00 7.43  ? 20   GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.460 10.644  4.722   1.00 10.41 ? 20   GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.587 9.987   3.969   1.00 11.30 ? 20   GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.620 10.605  3.744   1.00 10.77 ? 20   GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.385 8.738   3.547   1.00 13.14 ? 20   GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.284 13.343  2.734   1.00 6.19  ? 21   VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.771 14.285  1.727   1.00 6.48  ? 21   VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.516 15.645  2.399   1.00 9.72  ? 21   VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.922 16.706  1.884   1.00 8.09  ? 21   VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.478 13.777  1.005   1.00 6.02  ? 21   VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.940 14.854  0.030   1.00 8.29  ? 21   VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.757 12.481  0.234   1.00 5.93  ? 21   VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.878 15.607  3.566   1.00 8.63  ? 22   GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.575 16.842  4.293   1.00 8.26  ? 22   GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.838 17.519  4.861   1.00 7.39  ? 22   GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.920 18.746  4.889   1.00 9.25  ? 22   GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.507 16.593  5.391   1.00 5.94  ? 22   GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 51.150 16.122  4.841   1.00 5.66  ? 22   GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.413 17.180  4.007   1.00 13.64 ? 22   GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.663 18.395  4.181   1.00 15.98 ? 22   GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.576 16.785  3.164   1.00 14.58 ? 22   GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.827 16.726  5.277   1.00 7.43  ? 23   GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 57.077 17.272  5.834   1.00 8.46  ? 23   GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.944 17.908  4.768   1.00 6.87  ? 23   GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.630 18.902  5.017   1.00 8.95  ? 23   GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.882 16.177  6.528   1.00 7.31  ? 23   GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 57.239 15.718  7.829   1.00 8.54  ? 23   GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.974 14.540  8.446   1.00 8.25  ? 23   GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.386 13.618  7.743   1.00 11.98 ? 23   GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 58.142 14.566  9.775   1.00 12.85 ? 23   GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.914 17.341  3.571   1.00 8.60  ? 24   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.649 17.952  2.477   1.00 10.83 ? 24   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 58.092 19.350  2.224   1.00 11.08 ? 24   ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.848 20.303  2.072   1.00 9.56  ? 24   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.560 17.112  1.206   1.00 10.37 ? 24   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 59.448 17.662  0.078   1.00 12.97 ? 24   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.441 16.763  -1.165  1.00 9.22  ? 24   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 58.142 16.733  -1.821  1.00 11.12 ? 24   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.912 16.142  -2.990  1.00 9.70  ? 24   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.900 15.523  -3.637  1.00 7.07  ? 24   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.696 16.171  -3.513  1.00 10.56 ? 24   ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.764 19.459  2.199   1.00 9.09  ? 25   GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 56.091 20.717  1.882   1.00 11.31 ? 25   GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 56.245 21.748  2.995   1.00 8.90  ? 25   GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 56.374 22.957  2.740   1.00 10.18 ? 25   GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.596 20.468  1.614   1.00 10.51 ? 25   GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.798 21.726  1.237   1.00 15.45 ? 25   GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 52.303 21.435  1.067   1.00 16.93 ? 25   GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 51.921 20.413  0.504   1.00 20.80 ? 25   GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.460 22.329  1.578   1.00 24.32 ? 25   GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 56.191 21.279  4.233   1.00 9.10  ? 26   ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 56.245 22.163  5.390   1.00 12.99 ? 26   ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.399 21.771  6.305   1.00 10.83 ? 26   ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 57.265 20.889  7.143   1.00 9.79  ? 26   ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.900 22.176  6.145   1.00 15.04 ? 26   ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.917 23.106  7.371   1.00 16.17 ? 26   ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.925 23.740  7.667   1.00 13.72 ? 26   ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.789 23.194  8.070   1.00 15.67 ? 26   ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.556 22.428  6.135   1.00 11.48 ? 27   PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.772 22.087  6.879   1.00 11.67 ? 27   PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.600 22.150  8.403   1.00 13.00 ? 27   PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 60.330 21.469  9.131   1.00 13.40 ? 27   PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.765 23.162  6.424   1.00 17.18 ? 27   PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 60.274 23.563  5.078   1.00 11.56 ? 27   PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.783 23.541  5.200   1.00 13.54 ? 27   PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.645 22.943  8.873   1.00 13.08 ? 28   HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.349 23.003  10.307  1.00 18.21 ? 28   HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.924 21.658  10.890  1.00 16.47 ? 28   HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 58.000 21.458  12.101  1.00 15.41 ? 28   HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 57.259 24.033  10.594  1.00 21.90 ? 28   HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.749 25.449  10.576  1.00 26.80 ? 28   HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 57.057 26.464  9.954   1.00 32.31 ? 28   HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.858 26.012  11.106  1.00 26.97 ? 28   HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.718 27.599  10.106  1.00 36.08 ? 28   HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.816 27.353  10.796  1.00 31.32 ? 28   HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.455 20.746  10.038  1.00 12.17 ? 29   LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 57.012 19.424  10.501  1.00 11.47 ? 29   LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 58.133 18.378  10.495  1.00 12.49 ? 29   LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 57.952 17.257  10.992  1.00 11.14 ? 29   LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.851 18.906  9.638   1.00 12.04 ? 29   LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.598 19.783  9.579   1.00 11.82 ? 29   LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.572 19.189  8.615   1.00 11.11 ? 29   LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 54.017 19.958  10.977  1.00 13.64 ? 29   LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 59.288 18.729  9.926   1.00 11.05 ? 30   ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.375 17.756  9.766   1.00 11.94 ? 30   ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 61.007 17.373  11.103  1.00 14.30 ? 30   ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 61.167 18.215  11.982  1.00 12.91 ? 30   ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.447 18.286  8.816   1.00 14.35 ? 30   ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.940 18.543  7.408   1.00 10.94 ? 30   ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 61.983 19.190  6.527   1.00 13.90 ? 30   ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.445 19.479  5.189   1.00 14.94 ? 30   ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 62.161 20.005  4.202   1.00 19.90 ? 30   ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.441 20.298  4.402   1.00 16.52 ? 30   ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.599 20.240  3.025   1.00 14.61 ? 30   ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.353 16.092  11.239  1.00 16.71 ? 31   ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 61.960 15.573  12.470  1.00 17.48 ? 31   ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 61.136 15.858  13.728  1.00 17.92 ? 31   ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.692 16.136  14.795  1.00 20.72 ? 31   ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.376 16.129  12.651  1.00 19.74 ? 31   ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 64.252 15.916  11.425  1.00 18.94 ? 31   ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.434 14.791  10.955  1.00 30.15 ? 31   ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.781 17.010  10.887  1.00 31.99 ? 31   ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.818 15.798  13.590  1.00 13.15 ? 32   LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.885 16.052  14.677  1.00 15.70 ? 32   LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.908 14.897  14.791  1.00 13.41 ? 32   LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.634 14.221  13.807  1.00 13.85 ? 32   LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 58.068 17.317  14.399  1.00 14.80 ? 32   LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 58.891 18.599  14.300  1.00 18.63 ? 32   LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 59.233 19.120  15.666  1.00 33.70 ? 32   LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 59.910 20.484  15.585  1.00 35.83 ? 32   LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 60.011 21.078  16.951  1.00 34.71 ? 32   LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 57.371 14.675  15.998  1.00 15.00 ? 33   PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 56.209 13.795  16.134  1.00 10.56 ? 33   PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 55.043 14.458  15.386  1.00 11.67 ? 33   PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 54.600 15.556  15.737  1.00 11.95 ? 33   PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 55.975 13.760  17.646  1.00 14.23 ? 33   PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 56.555 15.030  18.157  1.00 18.10 ? 33   PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 57.717 15.354  17.261  1.00 16.71 ? 33   PRO A CD    1 
ATOM   289  N  N     A CYS A 1 37  ? 54.575 13.804  14.338  0.50 11.33 ? 34   CYS A N     1 
ATOM   290  N  N     B CYS A 1 37  ? 54.551 13.782  14.356  0.50 11.33 ? 34   CYS A N     1 
ATOM   291  C  CA    A CYS A 1 37  ? 53.489 14.372  13.567  0.50 11.15 ? 34   CYS A CA    1 
ATOM   292  C  CA    B CYS A 1 37  ? 53.611 14.375  13.410  0.50 11.12 ? 34   CYS A CA    1 
ATOM   293  C  C     . CYS A 1 37  ? 52.673 13.286  12.895  1.00 8.86  ? 34   CYS A C     1 
ATOM   294  O  O     . CYS A 1 37  ? 53.068 12.125  12.825  1.00 10.98 ? 34   CYS A O     1 
ATOM   295  C  CB    A CYS A 1 37  ? 54.012 15.384  12.550  0.50 11.85 ? 34   CYS A CB    1 
ATOM   296  C  CB    B CYS A 1 37  ? 54.410 14.995  12.252  0.50 12.20 ? 34   CYS A CB    1 
ATOM   297  S  SG    A CYS A 1 37  ? 55.073 14.682  11.293  0.50 10.94 ? 34   CYS A SG    1 
ATOM   298  S  SG    B CYS A 1 37  ? 53.480 15.738  10.874  0.50 15.00 ? 34   CYS A SG    1 
ATOM   299  N  N     . ALA A 1 38  ? 51.473 13.659  12.491  1.00 8.07  ? 35   ALA A N     1 
ATOM   300  C  CA    . ALA A 1 38  ? 50.562 12.694  11.887  1.00 8.74  ? 35   ALA A CA    1 
ATOM   301  C  C     . ALA A 1 38  ? 49.727 13.412  10.858  1.00 9.82  ? 35   ALA A C     1 
ATOM   302  O  O     . ALA A 1 38  ? 49.582 14.629  10.917  1.00 9.33  ? 35   ALA A O     1 
ATOM   303  C  CB    . ALA A 1 38  ? 49.660 12.079  12.923  1.00 9.79  ? 35   ALA A CB    1 
ATOM   304  N  N     . VAL A 1 39  ? 49.175 12.640  9.929   1.00 7.62  ? 36   VAL A N     1 
ATOM   305  C  CA    . VAL A 1 39  ? 48.242 13.173  8.946   1.00 9.24  ? 36   VAL A CA    1 
ATOM   306  C  C     . VAL A 1 39  ? 46.845 12.705  9.313   1.00 12.11 ? 36   VAL A C     1 
ATOM   307  O  O     . VAL A 1 39  ? 46.644 11.525  9.626   1.00 9.47  ? 36   VAL A O     1 
ATOM   308  C  CB    . VAL A 1 39  ? 48.605 12.682  7.533   1.00 8.82  ? 36   VAL A CB    1 
ATOM   309  C  CG1   . VAL A 1 39  ? 47.571 13.165  6.503   1.00 7.13  ? 36   VAL A CG1   1 
ATOM   310  C  CG2   . VAL A 1 39  ? 50.017 13.133  7.171   1.00 9.43  ? 36   VAL A CG2   1 
ATOM   311  N  N     . VAL A 1 40  ? 45.889 13.630  9.275   1.00 10.28 ? 37   VAL A N     1 
ATOM   312  C  CA    . VAL A 1 40  ? 44.530 13.381  9.740   1.00 8.53  ? 37   VAL A CA    1 
ATOM   313  C  C     . VAL A 1 40  ? 43.518 13.720  8.665   1.00 12.62 ? 37   VAL A C     1 
ATOM   314  O  O     . VAL A 1 40  ? 43.765 14.593  7.832   1.00 13.23 ? 37   VAL A O     1 
ATOM   315  C  CB    . VAL A 1 40  ? 44.194 14.261  10.977  1.00 12.82 ? 37   VAL A CB    1 
ATOM   316  C  CG1   A VAL A 1 40  ? 45.027 13.821  12.187  0.50 11.43 ? 37   VAL A CG1   1 
ATOM   317  C  CG1   B VAL A 1 40  ? 44.082 15.729  10.575  0.50 12.81 ? 37   VAL A CG1   1 
ATOM   318  C  CG2   A VAL A 1 40  ? 44.381 15.747  10.666  0.50 13.18 ? 37   VAL A CG2   1 
ATOM   319  C  CG2   B VAL A 1 40  ? 42.935 13.813  11.631  0.50 12.56 ? 37   VAL A CG2   1 
ATOM   320  N  N     . GLN A 1 41  ? 42.370 13.054  8.682   1.00 11.68 ? 38   GLN A N     1 
ATOM   321  C  CA    . GLN A 1 41  ? 41.298 13.492  7.787   1.00 12.45 ? 38   GLN A CA    1 
ATOM   322  C  C     . GLN A 1 41  ? 40.051 13.914  8.547   1.00 12.67 ? 38   GLN A C     1 
ATOM   323  O  O     . GLN A 1 41  ? 39.653 13.270  9.519   1.00 12.43 ? 38   GLN A O     1 
ATOM   324  C  CB    . GLN A 1 41  ? 41.002 12.485  6.672   1.00 15.90 ? 38   GLN A CB    1 
ATOM   325  C  CG    . GLN A 1 41  ? 40.529 11.120  7.097   1.00 16.59 ? 38   GLN A CG    1 
ATOM   326  C  CD    . GLN A 1 41  ? 40.700 10.094  5.976   1.00 21.73 ? 38   GLN A CD    1 
ATOM   327  O  OE1   . GLN A 1 41  ? 41.133 10.422  4.867   1.00 19.93 ? 38   GLN A OE1   1 
ATOM   328  N  NE2   . GLN A 1 41  ? 40.375 8.850   6.273   1.00 20.76 ? 38   GLN A NE2   1 
ATOM   329  N  N     . TYR A 1 42  ? 39.455 15.012  8.084   1.00 15.34 ? 39   TYR A N     1 
ATOM   330  C  CA    . TYR A 1 42  ? 38.317 15.634  8.743   1.00 14.21 ? 39   TYR A CA    1 
ATOM   331  C  C     . TYR A 1 42  ? 38.844 16.125  10.095  1.00 25.51 ? 39   TYR A C     1 
ATOM   332  O  O     . TYR A 1 42  ? 40.012 15.897  10.425  1.00 27.71 ? 39   TYR A O     1 
ATOM   333  C  CB    . TYR A 1 42  ? 37.128 14.673  8.799   1.00 15.03 ? 39   TYR A CB    1 
ATOM   334  C  CG    . TYR A 1 42  ? 36.748 14.190  7.405   1.00 11.72 ? 39   TYR A CG    1 
ATOM   335  C  CD1   . TYR A 1 42  ? 36.420 15.100  6.400   1.00 14.93 ? 39   TYR A CD1   1 
ATOM   336  C  CD2   . TYR A 1 42  ? 36.754 12.835  7.084   1.00 12.82 ? 39   TYR A CD2   1 
ATOM   337  C  CE1   . TYR A 1 42  ? 36.093 14.664  5.115   1.00 16.22 ? 39   TYR A CE1   1 
ATOM   338  C  CE2   . TYR A 1 42  ? 36.429 12.393  5.808   1.00 10.27 ? 39   TYR A CE2   1 
ATOM   339  C  CZ    . TYR A 1 42  ? 36.092 13.312  4.832   1.00 14.53 ? 39   TYR A CZ    1 
ATOM   340  O  OH    . TYR A 1 42  ? 35.760 12.849  3.569   1.00 14.24 ? 39   TYR A OH    1 
ATOM   341  N  N     . LYS A 1 43  ? 38.045 16.858  10.845  1.00 26.62 ? 40   LYS A N     1 
ATOM   342  C  CA    . LYS A 1 43  ? 38.598 17.552  12.003  1.00 25.65 ? 40   LYS A CA    1 
ATOM   343  C  C     . LYS A 1 43  ? 37.540 17.689  13.062  1.00 26.36 ? 40   LYS A C     1 
ATOM   344  O  O     . LYS A 1 43  ? 37.839 17.717  14.256  1.00 22.74 ? 40   LYS A O     1 
ATOM   345  C  CB    . LYS A 1 43  ? 39.107 18.940  11.598  1.00 31.44 ? 40   LYS A CB    1 
ATOM   346  C  CG    . LYS A 1 43  ? 40.219 19.501  12.478  1.00 39.44 ? 40   LYS A CG    1 
ATOM   347  C  CD    . LYS A 1 43  ? 41.575 18.913  12.086  1.00 36.97 ? 40   LYS A CD    1 
ATOM   348  C  CE    . LYS A 1 43  ? 42.715 19.491  12.912  1.00 32.32 ? 40   LYS A CE    1 
ATOM   349  N  NZ    . LYS A 1 43  ? 42.707 19.002  14.319  1.00 28.24 ? 40   LYS A NZ    1 
ATOM   350  N  N     . SER A 1 44  ? 36.296 17.752  12.603  1.00 23.63 ? 41   SER A N     1 
ATOM   351  C  CA    . SER A 1 44  ? 35.149 17.996  13.459  1.00 23.74 ? 41   SER A CA    1 
ATOM   352  C  C     . SER A 1 44  ? 34.869 16.868  14.444  1.00 26.58 ? 41   SER A C     1 
ATOM   353  O  O     . SER A 1 44  ? 34.573 17.123  15.605  1.00 32.92 ? 41   SER A O     1 
ATOM   354  C  CB    . SER A 1 44  ? 33.921 18.272  12.595  1.00 28.47 ? 41   SER A CB    1 
ATOM   355  O  OG    . SER A 1 44  ? 34.164 19.417  11.801  1.00 41.62 ? 41   SER A OG    1 
ATOM   356  N  N     . TRP A 1 45  ? 34.963 15.624  13.985  1.00 26.12 ? 42   TRP A N     1 
ATOM   357  C  CA    . TRP A 1 45  ? 34.729 14.482  14.860  1.00 23.76 ? 42   TRP A CA    1 
ATOM   358  C  C     . TRP A 1 45  ? 36.037 14.029  15.519  1.00 23.54 ? 42   TRP A C     1 
ATOM   359  O  O     . TRP A 1 45  ? 36.901 13.424  14.874  1.00 18.82 ? 42   TRP A O     1 
ATOM   360  C  CB    . TRP A 1 45  ? 34.065 13.330  14.091  1.00 27.18 ? 42   TRP A CB    1 
ATOM   361  C  CG    . TRP A 1 45  ? 33.566 12.189  14.955  1.00 28.33 ? 42   TRP A CG    1 
ATOM   362  C  CD1   . TRP A 1 45  ? 34.244 11.053  15.283  1.00 25.60 ? 42   TRP A CD1   1 
ATOM   363  C  CD2   . TRP A 1 45  ? 32.276 12.078  15.571  1.00 34.91 ? 42   TRP A CD2   1 
ATOM   364  N  NE1   . TRP A 1 45  ? 33.463 10.243  16.076  1.00 32.12 ? 42   TRP A NE1   1 
ATOM   365  C  CE2   . TRP A 1 45  ? 32.249 10.850  16.266  1.00 31.63 ? 42   TRP A CE2   1 
ATOM   366  C  CE3   . TRP A 1 45  ? 31.142 12.898  15.608  1.00 36.65 ? 42   TRP A CE3   1 
ATOM   367  C  CZ2   . TRP A 1 45  ? 31.135 10.424  16.989  1.00 38.69 ? 42   TRP A CZ2   1 
ATOM   368  C  CZ3   . TRP A 1 45  ? 30.034 12.471  16.324  1.00 36.35 ? 42   TRP A CZ3   1 
ATOM   369  C  CH2   . TRP A 1 45  ? 30.038 11.243  17.003  1.00 29.29 ? 42   TRP A CH2   1 
ATOM   370  N  N     . LYS A 1 46  ? 36.168 14.359  16.804  1.00 28.64 ? 43   LYS A N     1 
ATOM   371  C  CA    . LYS A 1 46  ? 37.278 13.930  17.654  1.00 21.91 ? 43   LYS A CA    1 
ATOM   372  C  C     . LYS A 1 46  ? 38.663 14.323  17.131  1.00 15.78 ? 43   LYS A C     1 
ATOM   373  O  O     . LYS A 1 46  ? 39.641 13.615  17.352  1.00 19.57 ? 43   LYS A O     1 
ATOM   374  C  CB    . LYS A 1 46  ? 37.191 12.423  17.932  1.00 20.19 ? 43   LYS A CB    1 
ATOM   375  C  CG    . LYS A 1 46  ? 35.875 11.999  18.587  1.00 31.07 ? 43   LYS A CG    1 
ATOM   376  C  CD    . LYS A 1 46  ? 35.811 10.496  18.831  1.00 28.21 ? 43   LYS A CD    1 
ATOM   377  C  CE    . LYS A 1 46  ? 34.509 10.107  19.528  1.00 40.27 ? 43   LYS A CE    1 
ATOM   378  N  NZ    . LYS A 1 46  ? 34.478 8.655   19.864  1.00 39.32 ? 43   LYS A NZ    1 
ATOM   379  N  N     . GLY A 1 47  ? 38.723 15.460  16.442  1.00 16.67 ? 44   GLY A N     1 
ATOM   380  C  CA    . GLY A 1 47  ? 39.966 16.048  15.978  1.00 15.65 ? 44   GLY A CA    1 
ATOM   381  C  C     . GLY A 1 47  ? 40.441 15.493  14.647  1.00 14.98 ? 44   GLY A C     1 
ATOM   382  O  O     . GLY A 1 47  ? 41.481 15.897  14.141  1.00 15.90 ? 44   GLY A O     1 
ATOM   383  N  N     . GLY A 1 48  ? 39.673 14.562  14.091  1.00 16.03 ? 45   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 48  ? 40.036 13.924  12.839  1.00 16.65 ? 45   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 48  ? 40.605 12.528  13.040  1.00 16.06 ? 45   GLY A C     1 
ATOM   386  O  O     . GLY A 1 48  ? 41.116 12.197  14.110  1.00 15.96 ? 45   GLY A O     1 
ATOM   387  N  N     . GLY A 1 49  ? 40.530 11.707  12.001  1.00 14.30 ? 46   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 49  ? 41.025 10.344  12.080  1.00 12.61 ? 46   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 49  ? 42.430 10.290  11.518  1.00 13.31 ? 46   GLY A C     1 
ATOM   390  O  O     . GLY A 1 49  ? 42.670 10.791  10.423  1.00 13.38 ? 46   GLY A O     1 
ATOM   391  N  N     . ILE A 1 50  ? 43.359 9.688   12.256  1.00 10.90 ? 47   ILE A N     1 
ATOM   392  C  CA    . ILE A 1 50  ? 44.759 9.592   11.816  1.00 9.15  ? 47   ILE A CA    1 
ATOM   393  C  C     . ILE A 1 50  ? 44.958 8.527   10.741  1.00 11.49 ? 47   ILE A C     1 
ATOM   394  O  O     . ILE A 1 50  ? 44.505 7.401   10.893  1.00 11.26 ? 47   ILE A O     1 
ATOM   395  C  CB    . ILE A 1 50  ? 45.691 9.301   13.011  1.00 9.05  ? 47   ILE A CB    1 
ATOM   396  C  CG1   . ILE A 1 50  ? 45.707 10.501  13.950  1.00 15.19 ? 47   ILE A CG1   1 
ATOM   397  C  CG2   . ILE A 1 50  ? 47.122 8.940   12.562  1.00 8.67  ? 47   ILE A CG2   1 
ATOM   398  C  CD1   . ILE A 1 50  ? 46.505 10.250  15.216  1.00 22.15 ? 47   ILE A CD1   1 
ATOM   399  N  N     . ILE A 1 51  ? 45.612 8.898   9.647   1.00 8.94  ? 48   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 51  ? 45.907 7.921   8.594   1.00 11.03 ? 48   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 51  ? 47.403 7.640   8.355   1.00 11.17 ? 48   ILE A C     1 
ATOM   402  O  O     . ILE A 1 51  ? 47.742 6.684   7.655   1.00 12.06 ? 48   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 51  ? 45.196 8.257   7.267   1.00 11.73 ? 48   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 51  ? 45.617 9.634   6.736   1.00 10.51 ? 48   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 51  ? 43.666 8.199   7.451   1.00 18.54 ? 48   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 51  ? 45.127 9.903   5.319   1.00 15.23 ? 48   ILE A CD1   1 
ATOM   407  N  N     . ALA A 1 52  ? 48.289 8.451   8.938   1.00 10.42 ? 49   ALA A N     1 
ATOM   408  C  CA    . ALA A 1 52  ? 49.742 8.227   8.822   1.00 7.32  ? 49   ALA A CA    1 
ATOM   409  C  C     . ALA A 1 52  ? 50.463 8.850   10.007  1.00 9.34  ? 49   ALA A C     1 
ATOM   410  O  O     . ALA A 1 52  ? 50.048 9.896   10.484  1.00 9.40  ? 49   ALA A O     1 
ATOM   411  C  CB    . ALA A 1 52  ? 50.289 8.811   7.480   1.00 6.05  ? 49   ALA A CB    1 
ATOM   412  N  N     . VAL A 1 53  ? 51.536 8.209   10.480  1.00 7.10  ? 50   VAL A N     1 
ATOM   413  C  CA    . VAL A 1 53  ? 52.197 8.631   11.720  1.00 7.97  ? 50   VAL A CA    1 
ATOM   414  C  C     . VAL A 1 53  ? 53.720 8.596   11.579  1.00 8.19  ? 50   VAL A C     1 
ATOM   415  O  O     . VAL A 1 53  ? 54.274 7.596   11.118  1.00 6.73  ? 50   VAL A O     1 
ATOM   416  C  CB    . VAL A 1 53  ? 51.785 7.702   12.892  1.00 8.18  ? 50   VAL A CB    1 
ATOM   417  C  CG1   . VAL A 1 53  ? 52.362 8.212   14.210  1.00 10.47 ? 50   VAL A CG1   1 
ATOM   418  C  CG2   . VAL A 1 53  ? 50.274 7.576   12.969  1.00 11.56 ? 50   VAL A CG2   1 
ATOM   419  N  N     . SER A 1 54  ? 54.399 9.683   11.958  1.00 6.91  ? 51   SER A N     1 
ATOM   420  C  CA    . SER A 1 54  ? 55.859 9.735   11.850  1.00 10.40 ? 51   SER A CA    1 
ATOM   421  C  C     . SER A 1 54  ? 56.453 8.792   12.885  1.00 8.15  ? 51   SER A C     1 
ATOM   422  O  O     . SER A 1 54  ? 55.804 8.478   13.881  1.00 10.39 ? 51   SER A O     1 
ATOM   423  C  CB    . SER A 1 54  ? 56.411 11.151  12.068  1.00 11.28 ? 51   SER A CB    1 
ATOM   424  O  OG    . SER A 1 54  ? 56.376 11.522  13.448  1.00 9.46  ? 51   SER A OG    1 
ATOM   425  N  N     . TYR A 1 55  ? 57.677 8.334   12.642  1.00 8.42  ? 52   TYR A N     1 
ATOM   426  C  CA    . TYR A 1 55  ? 58.305 7.411   13.578  1.00 9.99  ? 52   TYR A CA    1 
ATOM   427  C  C     . TYR A 1 55  ? 58.525 8.035   14.953  1.00 12.59 ? 52   TYR A C     1 
ATOM   428  O  O     . TYR A 1 55  ? 58.392 7.353   15.962  1.00 11.39 ? 52   TYR A O     1 
ATOM   429  C  CB    . TYR A 1 55  ? 59.579 6.803   12.985  1.00 8.86  ? 52   TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 55  ? 59.214 5.727   11.986  1.00 14.23 ? 52   TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 55  ? 58.773 6.055   10.708  1.00 11.91 ? 52   TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 55  ? 59.228 4.394   12.349  1.00 13.24 ? 52   TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 55  ? 58.400 5.072   9.809   1.00 13.52 ? 52   TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 55  ? 58.866 3.404   11.463  1.00 10.93 ? 52   TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 55  ? 58.447 3.739   10.196  1.00 13.12 ? 52   TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 55  ? 58.088 2.722   9.329   1.00 13.50 ? 52   TYR A OH    1 
ATOM   437  N  N     . GLU A 1 56  ? 58.802 9.334   14.998  1.00 13.11 ? 53   GLU A N     1 
ATOM   438  C  CA    . GLU A 1 56  ? 58.885 10.038  16.273  1.00 15.28 ? 53   GLU A CA    1 
ATOM   439  C  C     . GLU A 1 56  ? 57.577 9.928   17.047  1.00 12.34 ? 53   GLU A C     1 
ATOM   440  O  O     . GLU A 1 56  ? 57.589 9.745   18.257  1.00 14.43 ? 53   GLU A O     1 
ATOM   441  C  CB    . GLU A 1 56  ? 59.243 11.514  16.068  1.00 16.65 ? 53   GLU A CB    1 
ATOM   442  C  CG    . GLU A 1 56  ? 60.624 11.752  15.470  1.00 23.44 ? 53   GLU A CG    1 
ATOM   443  C  CD    . GLU A 1 56  ? 60.667 11.676  13.942  1.00 29.96 ? 53   GLU A CD    1 
ATOM   444  O  OE1   . GLU A 1 56  ? 59.720 11.158  13.311  1.00 18.65 ? 53   GLU A OE1   1 
ATOM   445  O  OE2   . GLU A 1 56  ? 61.671 12.138  13.371  1.00 27.89 ? 53   GLU A OE2   1 
ATOM   446  N  N     . ALA A 1 57  ? 56.447 10.060  16.352  1.00 11.56 ? 54   ALA A N     1 
ATOM   447  C  CA    . ALA A 1 57  ? 55.144 9.965   17.006  1.00 10.98 ? 54   ALA A CA    1 
ATOM   448  C  C     . ALA A 1 57  ? 54.783 8.528   17.397  1.00 11.56 ? 54   ALA A C     1 
ATOM   449  O  O     . ALA A 1 57  ? 54.087 8.307   18.382  1.00 11.00 ? 54   ALA A O     1 
ATOM   450  C  CB    . ALA A 1 57  ? 54.036 10.578  16.114  1.00 11.57 ? 54   ALA A CB    1 
ATOM   451  N  N     . ARG A 1 58  ? 55.259 7.548   16.633  1.00 10.89 ? 55   ARG A N     1 
ATOM   452  C  CA    . ARG A 1 58  ? 54.989 6.148   16.987  1.00 11.18 ? 55   ARG A CA    1 
ATOM   453  C  C     . ARG A 1 58  ? 55.580 5.783   18.337  1.00 12.95 ? 55   ARG A C     1 
ATOM   454  O  O     . ARG A 1 58  ? 55.007 4.969   19.072  1.00 13.90 ? 55   ARG A O     1 
ATOM   455  C  CB    . ARG A 1 58  ? 55.540 5.203   15.931  1.00 8.82  ? 55   ARG A CB    1 
ATOM   456  C  CG    . ARG A 1 58  ? 54.862 5.412   14.599  1.00 12.33 ? 55   ARG A CG    1 
ATOM   457  C  CD    . ARG A 1 58  ? 55.406 4.489   13.552  1.00 11.67 ? 55   ARG A CD    1 
ATOM   458  N  NE    . ARG A 1 58  ? 54.959 4.948   12.238  1.00 12.24 ? 55   ARG A NE    1 
ATOM   459  C  CZ    . ARG A 1 58  ? 54.983 4.212   11.138  1.00 13.50 ? 55   ARG A CZ    1 
ATOM   460  N  NH1   . ARG A 1 58  ? 55.427 2.959   11.184  1.00 10.87 ? 55   ARG A NH1   1 
ATOM   461  N  NH2   . ARG A 1 58  ? 54.550 4.737   9.994   1.00 12.16 ? 55   ARG A NH2   1 
ATOM   462  N  N     . ALA A 1 59  ? 56.705 6.410   18.664  1.00 12.59 ? 56   ALA A N     1 
ATOM   463  C  CA    . ALA A 1 59  ? 57.385 6.161   19.934  1.00 15.23 ? 56   ALA A CA    1 
ATOM   464  C  C     . ALA A 1 59  ? 56.515 6.535   21.143  1.00 18.18 ? 56   ALA A C     1 
ATOM   465  O  O     . ALA A 1 59  ? 56.729 6.033   22.251  1.00 15.32 ? 56   ALA A O     1 
ATOM   466  C  CB    . ALA A 1 59  ? 58.733 6.881   19.974  1.00 16.02 ? 56   ALA A CB    1 
ATOM   467  N  N     . PHE A 1 60  ? 55.531 7.406   20.931  1.00 12.08 ? 57   PHE A N     1 
ATOM   468  C  CA    . PHE A 1 60  ? 54.561 7.751   21.970  1.00 12.69 ? 57   PHE A CA    1 
ATOM   469  C  C     . PHE A 1 60  ? 53.328 6.857   21.970  1.00 14.04 ? 57   PHE A C     1 
ATOM   470  O  O     . PHE A 1 60  ? 52.456 7.010   22.829  1.00 16.97 ? 57   PHE A O     1 
ATOM   471  C  CB    . PHE A 1 60  ? 54.074 9.196   21.811  1.00 13.75 ? 57   PHE A CB    1 
ATOM   472  C  CG    . PHE A 1 60  ? 55.114 10.235  22.105  1.00 14.75 ? 57   PHE A CG    1 
ATOM   473  C  CD1   . PHE A 1 60  ? 55.146 10.871  23.337  1.00 21.07 ? 57   PHE A CD1   1 
ATOM   474  C  CD2   . PHE A 1 60  ? 56.038 10.606  21.136  1.00 17.28 ? 57   PHE A CD2   1 
ATOM   475  C  CE1   . PHE A 1 60  ? 56.092 11.850  23.607  1.00 24.56 ? 57   PHE A CE1   1 
ATOM   476  C  CE2   . PHE A 1 60  ? 56.982 11.584  21.393  1.00 16.96 ? 57   PHE A CE2   1 
ATOM   477  C  CZ    . PHE A 1 60  ? 57.014 12.205  22.632  1.00 23.50 ? 57   PHE A CZ    1 
ATOM   478  N  N     . GLY A 1 61  ? 53.238 5.946   21.003  1.00 14.30 ? 58   GLY A N     1 
ATOM   479  C  CA    . GLY A 1 61  ? 52.107 5.041   20.894  1.00 15.81 ? 58   GLY A CA    1 
ATOM   480  C  C     . GLY A 1 61  ? 51.003 5.517   19.966  1.00 15.69 ? 58   GLY A C     1 
ATOM   481  O  O     . GLY A 1 61  ? 49.909 4.940   19.942  1.00 13.65 ? 58   GLY A O     1 
ATOM   482  N  N     . VAL A 1 62  ? 51.277 6.566   19.194  1.00 10.90 ? 59   VAL A N     1 
ATOM   483  C  CA    . VAL A 1 62  ? 50.293 7.070   18.237  1.00 10.86 ? 59   VAL A CA    1 
ATOM   484  C  C     . VAL A 1 62  ? 50.205 6.072   17.087  1.00 12.04 ? 59   VAL A C     1 
ATOM   485  O  O     . VAL A 1 62  ? 51.235 5.630   16.572  1.00 11.15 ? 59   VAL A O     1 
ATOM   486  C  CB    . VAL A 1 62  ? 50.682 8.476   17.685  1.00 12.71 ? 59   VAL A CB    1 
ATOM   487  C  CG1   . VAL A 1 62  ? 49.687 8.928   16.628  1.00 15.80 ? 59   VAL A CG1   1 
ATOM   488  C  CG2   . VAL A 1 62  ? 50.736 9.501   18.801  1.00 10.95 ? 59   VAL A CG2   1 
ATOM   489  N  N     . THR A 1 63  ? 48.982 5.722   16.684  1.00 15.02 ? 60   THR A N     1 
ATOM   490  C  CA    . THR A 1 63  ? 48.784 4.763   15.598  1.00 13.20 ? 60   THR A CA    1 
ATOM   491  C  C     . THR A 1 63  ? 47.742 5.223   14.600  1.00 14.66 ? 60   THR A C     1 
ATOM   492  O  O     . THR A 1 63  ? 46.924 6.087   14.894  1.00 15.52 ? 60   THR A O     1 
ATOM   493  C  CB    . THR A 1 63  ? 48.310 3.390   16.131  1.00 16.98 ? 60   THR A CB    1 
ATOM   494  O  OG1   . THR A 1 63  ? 46.983 3.510   16.660  1.00 19.34 ? 60   THR A OG1   1 
ATOM   495  C  CG2   . THR A 1 63  ? 49.252 2.884   17.215  1.00 16.64 ? 60   THR A CG2   1 
ATOM   496  N  N     . ARG A 1 64  ? 47.769 4.620   13.418  1.00 13.70 ? 61   ARG A N     1 
ATOM   497  C  CA    . ARG A 1 64  ? 46.687 4.766   12.456  1.00 17.11 ? 61   ARG A CA    1 
ATOM   498  C  C     . ARG A 1 64  ? 45.340 4.362   13.082  1.00 18.64 ? 61   ARG A C     1 
ATOM   499  O  O     . ARG A 1 64  ? 45.283 3.496   13.961  1.00 17.16 ? 61   ARG A O     1 
ATOM   500  C  CB    . ARG A 1 64  ? 47.000 3.919   11.211  1.00 17.56 ? 61   ARG A CB    1 
ATOM   501  C  CG    . ARG A 1 64  ? 45.881 3.810   10.197  1.00 27.15 ? 61   ARG A CG    1 
ATOM   502  C  CD    . ARG A 1 64  ? 46.380 3.091   8.942   1.00 23.88 ? 61   ARG A CD    1 
ATOM   503  N  NE    . ARG A 1 64  ? 47.464 3.841   8.321   1.00 15.55 ? 61   ARG A NE    1 
ATOM   504  C  CZ    . ARG A 1 64  ? 48.646 3.334   7.980   1.00 20.91 ? 61   ARG A CZ    1 
ATOM   505  N  NH1   . ARG A 1 64  ? 48.909 2.050   8.172   1.00 25.59 ? 61   ARG A NH1   1 
ATOM   506  N  NH2   . ARG A 1 64  ? 49.566 4.116   7.427   1.00 16.81 ? 61   ARG A NH2   1 
ATOM   507  N  N     . SER A 1 65  ? 44.266 5.009   12.633  1.00 16.51 ? 62   SER A N     1 
ATOM   508  C  CA    . SER A 1 65  ? 42.896 4.737   13.090  1.00 28.61 ? 62   SER A CA    1 
ATOM   509  C  C     . SER A 1 65  ? 42.518 5.435   14.404  1.00 23.40 ? 62   SER A C     1 
ATOM   510  O  O     . SER A 1 65  ? 41.350 5.497   14.770  1.00 36.88 ? 62   SER A O     1 
ATOM   511  C  CB    . SER A 1 65  ? 42.628 3.238   13.200  1.00 28.69 ? 62   SER A CB    1 
ATOM   512  O  OG    . SER A 1 65  ? 42.919 2.765   14.505  1.00 40.67 ? 62   SER A OG    1 
ATOM   513  N  N     . MET A 1 66  ? 43.514 5.956   15.101  1.00 20.63 ? 63   MET A N     1 
ATOM   514  C  CA    . MET A 1 66  ? 43.294 6.688   16.340  1.00 15.93 ? 63   MET A CA    1 
ATOM   515  C  C     . MET A 1 66  ? 42.679 8.046   16.007  1.00 17.31 ? 63   MET A C     1 
ATOM   516  O  O     . MET A 1 66  ? 43.027 8.646   14.997  1.00 15.46 ? 63   MET A O     1 
ATOM   517  C  CB    . MET A 1 66  ? 44.656 6.849   17.009  1.00 18.94 ? 63   MET A CB    1 
ATOM   518  C  CG    . MET A 1 66  ? 44.676 7.266   18.437  1.00 26.47 ? 63   MET A CG    1 
ATOM   519  S  SD    . MET A 1 66  ? 46.379 7.049   19.009  1.00 21.15 ? 63   MET A SD    1 
ATOM   520  C  CE    . MET A 1 66  ? 46.398 5.342   19.513  1.00 18.50 ? 63   MET A CE    1 
ATOM   521  N  N     . TRP A 1 67  ? 41.752 8.528   16.836  1.00 12.82 ? 64   TRP A N     1 
ATOM   522  C  CA    . TRP A 1 67  ? 41.262 9.901   16.688  1.00 15.17 ? 64   TRP A CA    1 
ATOM   523  C  C     . TRP A 1 67  ? 42.340 10.859  17.164  1.00 13.50 ? 64   TRP A C     1 
ATOM   524  O  O     . TRP A 1 67  ? 43.033 10.568  18.133  1.00 12.98 ? 64   TRP A O     1 
ATOM   525  C  CB    . TRP A 1 67  ? 39.990 10.125  17.503  1.00 13.95 ? 64   TRP A CB    1 
ATOM   526  C  CG    . TRP A 1 67  ? 38.866 9.257   17.062  1.00 15.11 ? 64   TRP A CG    1 
ATOM   527  C  CD1   . TRP A 1 67  ? 38.272 8.257   17.774  1.00 18.68 ? 64   TRP A CD1   1 
ATOM   528  C  CD2   . TRP A 1 67  ? 38.207 9.290   15.788  1.00 17.55 ? 64   TRP A CD2   1 
ATOM   529  N  NE1   . TRP A 1 67  ? 37.272 7.676   17.025  1.00 22.04 ? 64   TRP A NE1   1 
ATOM   530  C  CE2   . TRP A 1 67  ? 37.218 8.289   15.802  1.00 24.03 ? 64   TRP A CE2   1 
ATOM   531  C  CE3   . TRP A 1 67  ? 38.356 10.076  14.640  1.00 14.65 ? 64   TRP A CE3   1 
ATOM   532  C  CZ2   . TRP A 1 67  ? 36.383 8.047   14.708  1.00 24.06 ? 64   TRP A CZ2   1 
ATOM   533  C  CZ3   . TRP A 1 67  ? 37.526 9.833   13.557  1.00 20.94 ? 64   TRP A CZ3   1 
ATOM   534  C  CH2   . TRP A 1 67  ? 36.555 8.831   13.601  1.00 17.89 ? 64   TRP A CH2   1 
ATOM   535  N  N     . ALA A 1 68  ? 42.496 11.995  16.493  1.00 10.97 ? 65   ALA A N     1 
ATOM   536  C  CA    . ALA A 1 68  ? 43.555 12.930  16.875  1.00 12.79 ? 65   ALA A CA    1 
ATOM   537  C  C     . ALA A 1 68  ? 43.408 13.395  18.320  1.00 13.42 ? 65   ALA A C     1 
ATOM   538  O  O     . ALA A 1 68  ? 44.413 13.591  19.004  1.00 14.57 ? 65   ALA A O     1 
ATOM   539  C  CB    . ALA A 1 68  ? 43.606 14.130  15.939  1.00 14.19 ? 65   ALA A CB    1 
ATOM   540  N  N     . ASP A 1 69  ? 42.171 13.576  18.788  1.00 11.03 ? 66   ASP A N     1 
ATOM   541  C  CA    . ASP A 1 69  ? 41.982 14.003  20.183  1.00 13.55 ? 66   ASP A CA    1 
ATOM   542  C  C     . ASP A 1 69  ? 42.590 12.978  21.137  1.00 11.52 ? 66   ASP A C     1 
ATOM   543  O  O     . ASP A 1 69  ? 43.132 13.333  22.196  1.00 14.24 ? 66   ASP A O     1 
ATOM   544  C  CB    . ASP A 1 69  ? 40.505 14.199  20.528  1.00 15.96 ? 66   ASP A CB    1 
ATOM   545  C  CG    . ASP A 1 69  ? 39.903 15.447  19.889  1.00 18.96 ? 66   ASP A CG    1 
ATOM   546  O  OD1   . ASP A 1 69  ? 40.650 16.301  19.358  1.00 22.49 ? 66   ASP A OD1   1 
ATOM   547  O  OD2   . ASP A 1 69  ? 38.667 15.572  19.937  1.00 26.57 ? 66   ASP A OD2   1 
ATOM   548  N  N     . ASP A 1 70  ? 42.484 11.705  20.780  1.00 13.42 ? 67   ASP A N     1 
ATOM   549  C  CA    . ASP A 1 70  ? 43.040 10.639  21.610  1.00 12.38 ? 67   ASP A CA    1 
ATOM   550  C  C     . ASP A 1 70  ? 44.557 10.540  21.467  1.00 14.03 ? 67   ASP A C     1 
ATOM   551  O  O     . ASP A 1 70  ? 45.276 10.325  22.442  1.00 12.31 ? 67   ASP A O     1 
ATOM   552  C  CB    . ASP A 1 70  ? 42.353 9.308   21.283  1.00 12.49 ? 67   ASP A CB    1 
ATOM   553  C  CG    . ASP A 1 70  ? 40.852 9.350   21.575  1.00 20.56 ? 67   ASP A CG    1 
ATOM   554  O  OD1   . ASP A 1 70  ? 40.452 10.081  22.509  1.00 21.10 ? 67   ASP A OD1   1 
ATOM   555  O  OD2   . ASP A 1 70  ? 40.072 8.679   20.866  1.00 21.63 ? 67   ASP A OD2   1 
ATOM   556  N  N     . ALA A 1 71  ? 45.051 10.704  20.244  1.00 12.26 ? 68   ALA A N     1 
ATOM   557  C  CA    . ALA A 1 71  ? 46.487 10.751  20.018  1.00 10.74 ? 68   ALA A CA    1 
ATOM   558  C  C     . ALA A 1 71  ? 47.173 11.864  20.827  1.00 10.18 ? 68   ALA A C     1 
ATOM   559  O  O     . ALA A 1 71  ? 48.291 11.684  21.307  1.00 13.66 ? 68   ALA A O     1 
ATOM   560  C  CB    . ALA A 1 71  ? 46.799 10.900  18.506  1.00 10.51 ? 68   ALA A CB    1 
ATOM   561  N  N     . LYS A 1 72  ? 46.508 13.011  20.946  1.00 9.23  ? 69   LYS A N     1 
ATOM   562  C  CA    . LYS A 1 72  ? 47.025 14.152  21.699  1.00 11.95 ? 69   LYS A CA    1 
ATOM   563  C  C     . LYS A 1 72  ? 47.154 13.820  23.180  1.00 13.56 ? 69   LYS A C     1 
ATOM   564  O  O     . LYS A 1 72  ? 47.931 14.443  23.898  1.00 14.81 ? 69   LYS A O     1 
ATOM   565  C  CB    . LYS A 1 72  ? 46.105 15.369  21.521  1.00 15.44 ? 69   LYS A CB    1 
ATOM   566  C  CG    . LYS A 1 72  ? 46.428 16.219  20.287  1.00 17.18 ? 69   LYS A CG    1 
ATOM   567  C  CD    . LYS A 1 72  ? 47.709 17.016  20.550  1.00 14.45 ? 69   LYS A CD    1 
ATOM   568  C  CE    . LYS A 1 72  ? 47.998 18.048  19.471  1.00 24.57 ? 69   LYS A CE    1 
ATOM   569  N  NZ    . LYS A 1 72  ? 49.283 18.763  19.790  1.00 16.15 ? 69   LYS A NZ    1 
ATOM   570  N  N     . LYS A 1 73  ? 46.377 12.848  23.645  1.00 12.75 ? 70   LYS A N     1 
ATOM   571  C  CA    . LYS A 1 73  ? 46.500 12.424  25.042  1.00 13.23 ? 70   LYS A CA    1 
ATOM   572  C  C     . LYS A 1 73  ? 47.810 11.659  25.254  1.00 16.02 ? 70   LYS A C     1 
ATOM   573  O  O     . LYS A 1 73  ? 48.415 11.754  26.319  1.00 17.64 ? 70   LYS A O     1 
ATOM   574  C  CB    . LYS A 1 73  ? 45.283 11.592  25.480  1.00 9.45  ? 70   LYS A CB    1 
ATOM   575  C  CG    . LYS A 1 73  ? 43.962 12.312  25.270  1.00 11.03 ? 70   LYS A CG    1 
ATOM   576  C  CD    . LYS A 1 73  ? 42.789 11.370  25.489  1.00 13.21 ? 70   LYS A CD    1 
ATOM   577  C  CE    . LYS A 1 73  ? 41.465 12.087  25.210  1.00 16.18 ? 70   LYS A CE    1 
ATOM   578  N  NZ    . LYS A 1 73  ? 40.341 11.105  25.127  1.00 19.46 ? 70   LYS A NZ    1 
ATOM   579  N  N     . LEU A 1 74  ? 48.258 10.925  24.236  1.00 12.01 ? 71   LEU A N     1 
ATOM   580  C  CA    . LEU A 1 74  ? 49.524 10.191  24.324  1.00 12.65 ? 71   LEU A CA    1 
ATOM   581  C  C     . LEU A 1 74  ? 50.711 11.092  24.019  1.00 18.04 ? 71   LEU A C     1 
ATOM   582  O  O     . LEU A 1 74  ? 51.817 10.895  24.541  1.00 17.97 ? 71   LEU A O     1 
ATOM   583  C  CB    . LEU A 1 74  ? 49.532 9.031   23.332  1.00 10.33 ? 71   LEU A CB    1 
ATOM   584  C  CG    . LEU A 1 74  ? 48.465 7.955   23.532  1.00 16.22 ? 71   LEU A CG    1 
ATOM   585  C  CD1   . LEU A 1 74  ? 48.590 6.926   22.436  1.00 17.32 ? 71   LEU A CD1   1 
ATOM   586  C  CD2   . LEU A 1 74  ? 48.601 7.291   24.899  1.00 12.06 ? 71   LEU A CD2   1 
ATOM   587  N  N     . CYS A 1 75  ? 50.470 12.080  23.162  1.00 14.00 ? 72   CYS A N     1 
ATOM   588  C  CA    . CYS A 1 75  ? 51.534 12.900  22.590  1.00 13.18 ? 72   CYS A CA    1 
ATOM   589  C  C     . CYS A 1 75  ? 51.048 14.341  22.470  1.00 15.72 ? 72   CYS A C     1 
ATOM   590  O  O     . CYS A 1 75  ? 50.617 14.785  21.398  1.00 13.98 ? 72   CYS A O     1 
ATOM   591  C  CB    . CYS A 1 75  ? 51.922 12.349  21.219  1.00 13.83 ? 72   CYS A CB    1 
ATOM   592  S  SG    . CYS A 1 75  ? 53.363 13.152  20.499  1.00 18.55 ? 72   CYS A SG    1 
ATOM   593  N  N     . PRO A 1 76  ? 51.092 15.080  23.586  1.00 15.73 ? 73   PRO A N     1 
ATOM   594  C  CA    . PRO A 1 76  ? 50.526 16.429  23.643  1.00 16.09 ? 73   PRO A CA    1 
ATOM   595  C  C     . PRO A 1 76  ? 51.154 17.377  22.610  1.00 16.20 ? 73   PRO A C     1 
ATOM   596  O  O     . PRO A 1 76  ? 50.474 18.300  22.144  1.00 19.49 ? 73   PRO A O     1 
ATOM   597  C  CB    . PRO A 1 76  ? 50.842 16.885  25.080  1.00 20.41 ? 73   PRO A CB    1 
ATOM   598  C  CG    . PRO A 1 76  ? 51.027 15.602  25.850  1.00 24.49 ? 73   PRO A CG    1 
ATOM   599  C  CD    . PRO A 1 76  ? 51.640 14.640  24.882  1.00 19.34 ? 73   PRO A CD    1 
ATOM   600  N  N     . ASP A 1 77  ? 52.416 17.150  22.260  1.00 17.78 ? 74   ASP A N     1 
ATOM   601  C  CA    . ASP A 1 77  ? 53.099 18.001  21.280  1.00 20.41 ? 74   ASP A CA    1 
ATOM   602  C  C     . ASP A 1 77  ? 52.959 17.516  19.833  1.00 19.27 ? 74   ASP A C     1 
ATOM   603  O  O     . ASP A 1 77  ? 53.619 18.046  18.941  1.00 15.36 ? 74   ASP A O     1 
ATOM   604  C  CB    . ASP A 1 77  ? 54.584 18.145  21.616  1.00 19.73 ? 74   ASP A CB    1 
ATOM   605  C  CG    . ASP A 1 77  ? 54.819 18.937  22.885  1.00 37.68 ? 74   ASP A CG    1 
ATOM   606  O  OD1   . ASP A 1 77  ? 55.672 18.510  23.696  1.00 38.23 ? 74   ASP A OD1   1 
ATOM   607  O  OD2   . ASP A 1 77  ? 54.149 19.979  23.069  1.00 34.10 ? 74   ASP A OD2   1 
ATOM   608  N  N     . LEU A 1 78  ? 52.112 16.515  19.611  1.00 13.06 ? 75   LEU A N     1 
ATOM   609  C  CA    . LEU A 1 78  ? 51.897 15.975  18.263  1.00 11.86 ? 75   LEU A CA    1 
ATOM   610  C  C     . LEU A 1 78  ? 51.510 17.089  17.294  1.00 11.05 ? 75   LEU A C     1 
ATOM   611  O  O     . LEU A 1 78  ? 50.617 17.886  17.574  1.00 11.40 ? 75   LEU A O     1 
ATOM   612  C  CB    . LEU A 1 78  ? 50.796 14.914  18.304  1.00 11.51 ? 75   LEU A CB    1 
ATOM   613  C  CG    . LEU A 1 78  ? 50.466 14.183  17.000  1.00 11.54 ? 75   LEU A CG    1 
ATOM   614  C  CD1   . LEU A 1 78  ? 51.626 13.263  16.591  1.00 9.67  ? 75   LEU A CD1   1 
ATOM   615  C  CD2   . LEU A 1 78  ? 49.188 13.398  17.189  1.00 12.17 ? 75   LEU A CD2   1 
ATOM   616  N  N     . LEU A 1 79  ? 52.186 17.152  16.157  1.00 8.97  ? 76   LEU A N     1 
ATOM   617  C  CA    . LEU A 1 79  ? 51.814 18.105  15.122  1.00 8.12  ? 76   LEU A CA    1 
ATOM   618  C  C     . LEU A 1 79  ? 50.938 17.400  14.099  1.00 12.33 ? 76   LEU A C     1 
ATOM   619  O  O     . LEU A 1 79  ? 51.118 16.216  13.832  1.00 11.71 ? 76   LEU A O     1 
ATOM   620  C  CB    . LEU A 1 79  ? 53.060 18.673  14.431  1.00 8.42  ? 76   LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 79  ? 54.022 19.419  15.371  1.00 8.76  ? 76   LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 79  ? 55.244 19.982  14.646  1.00 14.71 ? 76   LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 79  ? 53.307 20.513  16.153  1.00 14.91 ? 76   LEU A CD2   1 
ATOM   624  N  N     . LEU A 1 80  ? 50.005 18.134  13.513  1.00 14.93 ? 77   LEU A N     1 
ATOM   625  C  CA    . LEU A 1 80  ? 49.073 17.530  12.572  1.00 12.10 ? 77   LEU A CA    1 
ATOM   626  C  C     . LEU A 1 80  ? 49.053 18.265  11.238  1.00 13.51 ? 77   LEU A C     1 
ATOM   627  O  O     . LEU A 1 80  ? 49.148 19.491  11.177  1.00 19.77 ? 77   LEU A O     1 
ATOM   628  C  CB    . LEU A 1 80  ? 47.670 17.495  13.165  1.00 11.51 ? 77   LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 80  ? 47.509 16.743  14.477  1.00 9.88  ? 77   LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 80  ? 46.107 16.952  15.016  1.00 14.65 ? 77   LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 80  ? 47.815 15.254  14.259  1.00 12.05 ? 77   LEU A CD2   1 
ATOM   632  N  N     . ALA A 1 81  ? 48.951 17.500  10.167  1.00 9.68  ? 78   ALA A N     1 
ATOM   633  C  CA    . ALA A 1 81  ? 48.662 18.061  8.853   1.00 10.24 ? 78   ALA A CA    1 
ATOM   634  C  C     . ALA A 1 81  ? 47.352 17.443  8.393   1.00 13.32 ? 78   ALA A C     1 
ATOM   635  O  O     . ALA A 1 81  ? 47.113 16.257  8.609   1.00 11.87 ? 78   ALA A O     1 
ATOM   636  C  CB    . ALA A 1 81  ? 49.786 17.749  7.885   1.00 12.99 ? 78   ALA A CB    1 
ATOM   637  N  N     . GLN A 1 82  ? 46.494 18.248  7.774   1.00 11.65 ? 79   GLN A N     1 
ATOM   638  C  CA    . GLN A 1 82  ? 45.171 17.784  7.367   1.00 13.72 ? 79   GLN A CA    1 
ATOM   639  C  C     . GLN A 1 82  ? 45.116 17.464  5.885   1.00 11.39 ? 79   GLN A C     1 
ATOM   640  O  O     . GLN A 1 82  ? 45.634 18.228  5.059   1.00 13.72 ? 79   GLN A O     1 
ATOM   641  C  CB    . GLN A 1 82  ? 44.123 18.866  7.634   1.00 16.04 ? 79   GLN A CB    1 
ATOM   642  C  CG    . GLN A 1 82  ? 43.712 19.042  9.059   1.00 29.89 ? 79   GLN A CG    1 
ATOM   643  C  CD    . GLN A 1 82  ? 42.852 20.275  9.221   1.00 34.22 ? 79   GLN A CD    1 
ATOM   644  O  OE1   . GLN A 1 82  ? 43.316 21.306  9.696   1.00 28.65 ? 79   GLN A OE1   1 
ATOM   645  N  NE2   . GLN A 1 82  ? 41.600 20.182  8.798   1.00 36.66 ? 79   GLN A NE2   1 
ATOM   646  N  N     . VAL A 1 83  ? 44.478 16.346  5.547   1.00 9.45  ? 80   VAL A N     1 
ATOM   647  C  CA    . VAL A 1 83  ? 44.195 16.030  4.152   1.00 10.50 ? 80   VAL A CA    1 
ATOM   648  C  C     . VAL A 1 83  ? 43.278 17.115  3.590   1.00 14.92 ? 80   VAL A C     1 
ATOM   649  O  O     . VAL A 1 83  ? 42.360 17.582  4.257   1.00 11.49 ? 80   VAL A O     1 
ATOM   650  C  CB    . VAL A 1 83  ? 43.495 14.666  3.989   1.00 10.15 ? 80   VAL A CB    1 
ATOM   651  C  CG1   . VAL A 1 83  ? 43.154 14.418  2.529   1.00 12.26 ? 80   VAL A CG1   1 
ATOM   652  C  CG2   . VAL A 1 83  ? 44.379 13.535  4.535   1.00 11.89 ? 80   VAL A CG2   1 
ATOM   653  N  N     . ARG A 1 84  ? 43.547 17.510  2.357   1.00 15.10 ? 81   ARG A N     1 
ATOM   654  C  CA    . ARG A 1 84  ? 42.777 18.549  1.696   1.00 13.83 ? 81   ARG A CA    1 
ATOM   655  C  C     . ARG A 1 84  ? 41.326 18.101  1.533   1.00 11.76 ? 81   ARG A C     1 
ATOM   656  O  O     . ARG A 1 84  ? 41.055 16.921  1.322   1.00 15.17 ? 81   ARG A O     1 
ATOM   657  C  CB    . ARG A 1 84  ? 43.403 18.820  0.330   1.00 17.80 ? 81   ARG A CB    1 
ATOM   658  C  CG    . ARG A 1 84  ? 42.571 19.680  -0.598  1.00 19.52 ? 81   ARG A CG    1 
ATOM   659  C  CD    . ARG A 1 84  ? 43.377 20.016  -1.835  1.00 31.06 ? 81   ARG A CD    1 
ATOM   660  N  NE    . ARG A 1 84  ? 42.596 20.724  -2.842  1.00 36.31 ? 81   ARG A NE    1 
ATOM   661  C  CZ    . ARG A 1 84  ? 42.944 20.803  -4.122  1.00 49.20 ? 81   ARG A CZ    1 
ATOM   662  N  NH1   . ARG A 1 84  ? 44.057 20.210  -4.543  1.00 41.24 ? 81   ARG A NH1   1 
ATOM   663  N  NH2   . ARG A 1 84  ? 42.179 21.464  -4.983  1.00 38.40 ? 81   ARG A NH2   1 
ATOM   664  N  N     . GLU A 1 85  ? 40.397 19.045  1.653   1.00 11.97 ? 82   GLU A N     1 
ATOM   665  C  CA    . GLU A 1 85  ? 38.990 18.787  1.354   1.00 15.63 ? 82   GLU A CA    1 
ATOM   666  C  C     . GLU A 1 85  ? 38.588 19.535  0.095   1.00 13.65 ? 82   GLU A C     1 
ATOM   667  O  O     . GLU A 1 85  ? 38.902 20.716  -0.053  1.00 15.35 ? 82   GLU A O     1 
ATOM   668  C  CB    . GLU A 1 85  ? 38.094 19.205  2.532   1.00 17.24 ? 82   GLU A CB    1 
ATOM   669  C  CG    A GLU A 1 85  ? 38.067 18.158  3.645   0.50 19.31 ? 82   GLU A CG    1 
ATOM   670  C  CG    B GLU A 1 85  ? 36.597 19.351  2.183   0.50 16.73 ? 82   GLU A CG    1 
ATOM   671  C  CD    A GLU A 1 85  ? 37.384 18.642  4.913   0.50 24.50 ? 82   GLU A CD    1 
ATOM   672  C  CD    B GLU A 1 85  ? 36.219 20.729  1.617   0.50 22.32 ? 82   GLU A CD    1 
ATOM   673  O  OE1   A GLU A 1 85  ? 36.144 18.809  4.907   0.50 24.20 ? 82   GLU A OE1   1 
ATOM   674  O  OE1   B GLU A 1 85  ? 35.530 20.783  0.574   0.50 15.86 ? 82   GLU A OE1   1 
ATOM   675  O  OE2   A GLU A 1 85  ? 38.096 18.846  5.920   0.50 29.12 ? 82   GLU A OE2   1 
ATOM   676  O  OE2   B GLU A 1 85  ? 36.581 21.760  2.225   0.50 20.26 ? 82   GLU A OE2   1 
ATOM   677  N  N     . SER A 1 86  ? 37.907 18.831  -0.807  1.00 14.04 ? 83   SER A N     1 
ATOM   678  C  CA    . SER A 1 86  ? 37.339 19.419  -2.011  1.00 16.74 ? 83   SER A CA    1 
ATOM   679  C  C     . SER A 1 86  ? 35.967 18.819  -2.234  1.00 16.00 ? 83   SER A C     1 
ATOM   680  O  O     . SER A 1 86  ? 35.773 17.619  -2.052  1.00 15.02 ? 83   SER A O     1 
ATOM   681  C  CB    . SER A 1 86  ? 38.198 19.122  -3.242  1.00 17.86 ? 83   SER A CB    1 
ATOM   682  O  OG    . SER A 1 86  ? 39.502 19.642  -3.110  1.00 23.87 ? 83   SER A OG    1 
ATOM   683  N  N     . ARG A 1 87  ? 35.023 19.653  -2.654  1.00 17.73 ? 84   ARG A N     1 
ATOM   684  C  CA    . ARG A 1 87  ? 33.652 19.210  -2.890  1.00 17.57 ? 84   ARG A CA    1 
ATOM   685  C  C     . ARG A 1 87  ? 33.055 18.453  -1.711  1.00 19.85 ? 84   ARG A C     1 
ATOM   686  O  O     . ARG A 1 87  ? 32.244 17.546  -1.894  1.00 23.22 ? 84   ARG A O     1 
ATOM   687  C  CB    . ARG A 1 87  ? 33.552 18.386  -4.186  1.00 23.49 ? 84   ARG A CB    1 
ATOM   688  C  CG    . ARG A 1 87  ? 33.994 19.147  -5.420  1.00 26.14 ? 84   ARG A CG    1 
ATOM   689  C  CD    . ARG A 1 87  ? 33.808 18.321  -6.683  1.00 23.86 ? 84   ARG A CD    1 
ATOM   690  N  NE    . ARG A 1 87  ? 35.071 18.165  -7.399  1.00 29.98 ? 84   ARG A NE    1 
ATOM   691  C  CZ    . ARG A 1 87  ? 35.486 18.987  -8.353  1.00 30.10 ? 84   ARG A CZ    1 
ATOM   692  N  NH1   . ARG A 1 87  ? 34.727 20.016  -8.712  1.00 40.50 ? 84   ARG A NH1   1 
ATOM   693  N  NH2   . ARG A 1 87  ? 36.653 18.784  -8.949  1.00 35.09 ? 84   ARG A NH2   1 
ATOM   694  N  N     . GLY A 1 88  ? 33.449 18.838  -0.500  1.00 15.73 ? 85   GLY A N     1 
ATOM   695  C  CA    . GLY A 1 88  ? 32.909 18.249  0.711   1.00 18.96 ? 85   GLY A CA    1 
ATOM   696  C  C     . GLY A 1 88  ? 33.528 16.932  1.153   1.00 19.71 ? 85   GLY A C     1 
ATOM   697  O  O     . GLY A 1 88  ? 33.024 16.294  2.081   1.00 15.56 ? 85   GLY A O     1 
ATOM   698  N  N     . LYS A 1 89  ? 34.610 16.518  0.493   1.00 14.87 ? 86   LYS A N     1 
ATOM   699  C  CA    . LYS A 1 89  ? 35.229 15.232  0.784   1.00 13.11 ? 86   LYS A CA    1 
ATOM   700  C  C     . LYS A 1 89  ? 36.752 15.288  0.801   1.00 12.32 ? 86   LYS A C     1 
ATOM   701  O  O     . LYS A 1 89  ? 37.366 16.186  0.235   1.00 11.82 ? 86   LYS A O     1 
ATOM   702  C  CB    . LYS A 1 89  ? 34.772 14.162  -0.214  1.00 15.06 ? 86   LYS A CB    1 
ATOM   703  C  CG    . LYS A 1 89  ? 35.237 14.366  -1.649  1.00 15.59 ? 86   LYS A CG    1 
ATOM   704  C  CD    . LYS A 1 89  ? 34.773 13.207  -2.559  1.00 17.97 ? 86   LYS A CD    1 
ATOM   705  C  CE    . LYS A 1 89  ? 35.413 11.866  -2.180  1.00 13.72 ? 86   LYS A CE    1 
ATOM   706  N  NZ    . LYS A 1 89  ? 36.898 11.890  -2.283  1.00 14.90 ? 86   LYS A NZ    1 
ATOM   707  N  N     . ALA A 1 90  ? 37.355 14.297  1.441   1.00 15.74 ? 87   ALA A N     1 
ATOM   708  C  CA    . ALA A 1 90  ? 38.802 14.222  1.481   1.00 13.28 ? 87   ALA A CA    1 
ATOM   709  C  C     . ALA A 1 90  ? 39.287 14.025  0.062   1.00 14.98 ? 87   ALA A C     1 
ATOM   710  O  O     . ALA A 1 90  ? 38.683 13.280  -0.711  1.00 17.76 ? 87   ALA A O     1 
ATOM   711  C  CB    . ALA A 1 90  ? 39.256 13.074  2.384   1.00 17.33 ? 87   ALA A CB    1 
ATOM   712  N  N     . ASN A 1 91  ? 40.361 14.724  -0.287  1.00 12.85 ? 88   ASN A N     1 
ATOM   713  C  CA    . ASN A 1 91  ? 40.936 14.633  -1.616  1.00 15.91 ? 88   ASN A CA    1 
ATOM   714  C  C     . ASN A 1 91  ? 42.408 14.237  -1.541  1.00 13.26 ? 88   ASN A C     1 
ATOM   715  O  O     . ASN A 1 91  ? 43.219 14.980  -1.008  1.00 16.36 ? 88   ASN A O     1 
ATOM   716  C  CB    . ASN A 1 91  ? 40.819 15.968  -2.330  1.00 14.75 ? 88   ASN A CB    1 
ATOM   717  C  CG    . ASN A 1 91  ? 41.190 15.862  -3.786  1.00 24.69 ? 88   ASN A CG    1 
ATOM   718  O  OD1   . ASN A 1 91  ? 42.315 15.505  -4.113  1.00 17.27 ? 88   ASN A OD1   1 
ATOM   719  N  ND2   . ASN A 1 91  ? 40.232 16.123  -4.671  1.00 27.59 ? 88   ASN A ND2   1 
ATOM   720  N  N     . LEU A 1 92  ? 42.742 13.060  -2.055  1.00 14.79 ? 89   LEU A N     1 
ATOM   721  C  CA    . LEU A 1 92  ? 44.094 12.517  -1.864  1.00 14.53 ? 89   LEU A CA    1 
ATOM   722  C  C     . LEU A 1 92  ? 45.063 12.839  -2.997  1.00 13.36 ? 89   LEU A C     1 
ATOM   723  O  O     . LEU A 1 92  ? 46.123 12.212  -3.108  1.00 11.66 ? 89   LEU A O     1 
ATOM   724  C  CB    . LEU A 1 92  ? 44.030 11.001  -1.660  1.00 12.41 ? 89   LEU A CB    1 
ATOM   725  C  CG    . LEU A 1 92  ? 43.121 10.574  -0.508  1.00 13.52 ? 89   LEU A CG    1 
ATOM   726  C  CD1   . LEU A 1 92  ? 43.021 9.075   -0.410  1.00 17.22 ? 89   LEU A CD1   1 
ATOM   727  C  CD2   . LEU A 1 92  ? 43.670 11.166  0.789   1.00 15.78 ? 89   LEU A CD2   1 
ATOM   728  N  N     . THR A 1 93  ? 44.717 13.811  -3.832  1.00 12.66 ? 90   THR A N     1 
ATOM   729  C  CA    . THR A 1 93  ? 45.546 14.112  -5.005  1.00 13.91 ? 90   THR A CA    1 
ATOM   730  C  C     . THR A 1 93  ? 47.032 14.349  -4.713  1.00 14.04 ? 90   THR A C     1 
ATOM   731  O  O     . THR A 1 93  ? 47.904 13.841  -5.437  1.00 12.96 ? 90   THR A O     1 
ATOM   732  C  CB    . THR A 1 93  ? 44.958 15.284  -5.826  1.00 20.46 ? 90   THR A CB    1 
ATOM   733  O  OG1   . THR A 1 93  ? 43.634 14.930  -6.253  1.00 20.04 ? 90   THR A OG1   1 
ATOM   734  C  CG2   . THR A 1 93  ? 45.822 15.575  -7.053  1.00 13.49 ? 90   THR A CG2   1 
ATOM   735  N  N     . LYS A 1 94  ? 47.330 15.110  -3.663  1.00 11.67 ? 91   LYS A N     1 
ATOM   736  C  CA    . LYS A 1 94  ? 48.720 15.429  -3.358  1.00 13.05 ? 91   LYS A CA    1 
ATOM   737  C  C     . LYS A 1 94  ? 49.576 14.174  -3.169  1.00 10.42 ? 91   LYS A C     1 
ATOM   738  O  O     . LYS A 1 94  ? 50.738 14.142  -3.587  1.00 12.66 ? 91   LYS A O     1 
ATOM   739  C  CB    . LYS A 1 94  ? 48.822 16.316  -2.120  1.00 15.88 ? 91   LYS A CB    1 
ATOM   740  C  CG    . LYS A 1 94  ? 50.236 16.818  -1.846  1.00 17.17 ? 91   LYS A CG    1 
ATOM   741  C  CD    . LYS A 1 94  ? 50.370 17.339  -0.423  1.00 19.25 ? 91   LYS A CD    1 
ATOM   742  C  CE    . LYS A 1 94  ? 49.343 18.418  -0.139  1.00 23.81 ? 91   LYS A CE    1 
ATOM   743  N  NZ    . LYS A 1 94  ? 49.541 19.006  1.213   1.00 14.90 ? 91   LYS A NZ    1 
ATOM   744  N  N     . TYR A 1 95  ? 48.999 13.143  -2.555  1.00 13.01 ? 92   TYR A N     1 
ATOM   745  C  CA    . TYR A 1 95  ? 49.724 11.911  -2.273  1.00 9.31  ? 92   TYR A CA    1 
ATOM   746  C  C     . TYR A 1 95  ? 49.812 11.040  -3.516  1.00 9.53  ? 92   TYR A C     1 
ATOM   747  O  O     . TYR A 1 95  ? 50.833 10.405  -3.755  1.00 10.69 ? 92   TYR A O     1 
ATOM   748  C  CB    . TYR A 1 95  ? 49.098 11.158  -1.093  1.00 8.78  ? 92   TYR A CB    1 
ATOM   749  C  CG    . TYR A 1 95  ? 48.768 12.130  0.006   1.00 8.73  ? 92   TYR A CG    1 
ATOM   750  C  CD1   . TYR A 1 95  ? 47.463 12.535  0.217   1.00 13.21 ? 92   TYR A CD1   1 
ATOM   751  C  CD2   . TYR A 1 95  ? 49.779 12.715  0.768   1.00 9.81  ? 92   TYR A CD2   1 
ATOM   752  C  CE1   . TYR A 1 95  ? 47.149 13.472  1.190   1.00 13.20 ? 92   TYR A CE1   1 
ATOM   753  C  CE2   . TYR A 1 95  ? 49.483 13.638  1.743   1.00 10.91 ? 92   TYR A CE2   1 
ATOM   754  C  CZ    . TYR A 1 95  ? 48.158 14.021  1.940   1.00 12.65 ? 92   TYR A CZ    1 
ATOM   755  O  OH    . TYR A 1 95  ? 47.842 14.957  2.892   1.00 13.79 ? 92   TYR A OH    1 
ATOM   756  N  N     . ARG A 1 96  ? 48.750 11.028  -4.316  1.00 11.02 ? 93   ARG A N     1 
ATOM   757  C  CA    . ARG A 1 96  ? 48.789 10.316  -5.599  1.00 12.91 ? 93   ARG A CA    1 
ATOM   758  C  C     . ARG A 1 96  ? 49.881 10.874  -6.511  1.00 13.63 ? 93   ARG A C     1 
ATOM   759  O  O     . ARG A 1 96  ? 50.577 10.114  -7.178  1.00 14.01 ? 93   ARG A O     1 
ATOM   760  C  CB    . ARG A 1 96  ? 47.429 10.335  -6.306  1.00 13.07 ? 93   ARG A CB    1 
ATOM   761  C  CG    . ARG A 1 96  ? 46.403 9.427   -5.640  1.00 16.76 ? 93   ARG A CG    1 
ATOM   762  C  CD    . ARG A 1 96  ? 45.129 9.275   -6.462  1.00 13.55 ? 93   ARG A CD    1 
ATOM   763  N  NE    . ARG A 1 96  ? 44.116 8.554   -5.698  1.00 18.90 ? 93   ARG A NE    1 
ATOM   764  C  CZ    . ARG A 1 96  ? 43.046 9.119   -5.140  1.00 13.98 ? 93   ARG A CZ    1 
ATOM   765  N  NH1   . ARG A 1 96  ? 42.198 8.363   -4.454  1.00 16.72 ? 93   ARG A NH1   1 
ATOM   766  N  NH2   . ARG A 1 96  ? 42.817 10.424  -5.283  1.00 13.62 ? 93   ARG A NH2   1 
ATOM   767  N  N     . GLU A 1 97  ? 50.035 12.194  -6.524  1.00 14.03 ? 94   GLU A N     1 
ATOM   768  C  CA    . GLU A 1 97  ? 51.037 12.838  -7.373  1.00 13.25 ? 94   GLU A CA    1 
ATOM   769  C  C     . GLU A 1 97  ? 52.453 12.570  -6.854  1.00 14.18 ? 94   GLU A C     1 
ATOM   770  O  O     . GLU A 1 97  ? 53.370 12.306  -7.641  1.00 12.30 ? 94   GLU A O     1 
ATOM   771  C  CB    . GLU A 1 97  ? 50.743 14.330  -7.530  1.00 15.11 ? 94   GLU A CB    1 
ATOM   772  C  CG    . GLU A 1 97  ? 49.409 14.576  -8.234  1.00 20.20 ? 94   GLU A CG    1 
ATOM   773  C  CD    . GLU A 1 97  ? 49.124 16.035  -8.536  1.00 32.76 ? 94   GLU A CD    1 
ATOM   774  O  OE1   . GLU A 1 97  ? 49.845 16.918  -8.020  1.00 40.03 ? 94   GLU A OE1   1 
ATOM   775  O  OE2   . GLU A 1 97  ? 48.166 16.298  -9.302  1.00 34.73 ? 94   GLU A OE2   1 
ATOM   776  N  N     . ALA A 1 98  ? 52.611 12.576  -5.530  1.00 12.53 ? 95   ALA A N     1 
ATOM   777  C  CA    . ALA A 1 98  ? 53.888 12.198  -4.914  1.00 11.88 ? 95   ALA A CA    1 
ATOM   778  C  C     . ALA A 1 98  ? 54.259 10.746  -5.237  1.00 10.07 ? 95   ALA A C     1 
ATOM   779  O  O     . ALA A 1 98  ? 55.433 10.430  -5.464  1.00 12.55 ? 95   ALA A O     1 
ATOM   780  C  CB    . ALA A 1 98  ? 53.846 12.414  -3.408  1.00 10.55 ? 95   ALA A CB    1 
ATOM   781  N  N     . SER A 1 99  ? 53.255 9.873   -5.249  1.00 9.39  ? 96   SER A N     1 
ATOM   782  C  CA    . SER A 1 99  ? 53.436 8.465   -5.593  1.00 10.93 ? 96   SER A CA    1 
ATOM   783  C  C     . SER A 1 99  ? 54.007 8.313   -7.001  1.00 12.63 ? 96   SER A C     1 
ATOM   784  O  O     . SER A 1 99  ? 54.952 7.555   -7.230  1.00 11.08 ? 96   SER A O     1 
ATOM   785  C  CB    . SER A 1 99  ? 52.092 7.730   -5.524  1.00 12.13 ? 96   SER A CB    1 
ATOM   786  O  OG    . SER A 1 99  ? 52.226 6.390   -5.945  1.00 18.98 ? 96   SER A OG    1 
ATOM   787  N  N     . VAL A 1 100 ? 53.409 9.030   -7.946  1.00 12.30 ? 97   VAL A N     1 
ATOM   788  C  CA    . VAL A 1 100 ? 53.899 9.034   -9.327  1.00 13.22 ? 97   VAL A CA    1 
ATOM   789  C  C     . VAL A 1 100 ? 55.384 9.409   -9.388  1.00 14.33 ? 97   VAL A C     1 
ATOM   790  O  O     . VAL A 1 100 ? 56.153 8.794   -10.136 1.00 12.36 ? 97   VAL A O     1 
ATOM   791  C  CB    . VAL A 1 100 ? 53.070 9.986   -10.213 1.00 14.54 ? 97   VAL A CB    1 
ATOM   792  C  CG1   . VAL A 1 100 ? 53.720 10.129  -11.606 1.00 19.36 ? 97   VAL A CG1   1 
ATOM   793  C  CG2   . VAL A 1 100 ? 51.638 9.454   -10.345 1.00 18.15 ? 97   VAL A CG2   1 
ATOM   794  N  N     . GLU A 1 101 ? 55.800 10.396  -8.593  1.00 9.57  ? 98   GLU A N     1 
ATOM   795  C  CA    . GLU A 1 101 ? 57.214 10.816  -8.598  1.00 12.79 ? 98   GLU A CA    1 
ATOM   796  C  C     . GLU A 1 101 ? 58.125 9.640   -8.289  1.00 14.21 ? 98   GLU A C     1 
ATOM   797  O  O     . GLU A 1 101 ? 59.169 9.435   -8.935  1.00 14.11 ? 98   GLU A O     1 
ATOM   798  C  CB    . GLU A 1 101 ? 57.503 11.890  -7.540  1.00 12.89 ? 98   GLU A CB    1 
ATOM   799  C  CG    . GLU A 1 101 ? 56.938 13.279  -7.796  1.00 20.25 ? 98   GLU A CG    1 
ATOM   800  C  CD    . GLU A 1 101 ? 57.316 14.245  -6.676  1.00 18.43 ? 98   GLU A CD    1 
ATOM   801  O  OE1   . GLU A 1 101 ? 58.518 14.579  -6.552  1.00 15.77 ? 98   GLU A OE1   1 
ATOM   802  O  OE2   . GLU A 1 101 ? 56.416 14.655  -5.910  1.00 19.48 ? 98   GLU A OE2   1 
ATOM   803  N  N     . VAL A 1 102 ? 57.739 8.873   -7.277  1.00 10.96 ? 99   VAL A N     1 
ATOM   804  C  CA    . VAL A 1 102 ? 58.569 7.769   -6.838  1.00 9.28  ? 99   VAL A CA    1 
ATOM   805  C  C     . VAL A 1 102 ? 58.537 6.611   -7.808  1.00 9.72  ? 99   VAL A C     1 
ATOM   806  O  O     . VAL A 1 102 ? 59.577 6.024   -8.110  1.00 11.79 ? 99   VAL A O     1 
ATOM   807  C  CB    . VAL A 1 102 ? 58.179 7.287   -5.432  1.00 10.57 ? 99   VAL A CB    1 
ATOM   808  C  CG1   . VAL A 1 102 ? 58.928 5.991   -5.087  1.00 16.77 ? 99   VAL A CG1   1 
ATOM   809  C  CG2   . VAL A 1 102 ? 58.481 8.394   -4.424  1.00 12.19 ? 99   VAL A CG2   1 
ATOM   810  N  N     . MET A 1 103 ? 57.353 6.294   -8.315  1.00 9.81  ? 100  MET A N     1 
ATOM   811  C  CA    . MET A 1 103 ? 57.218 5.169   -9.244  1.00 12.96 ? 100  MET A CA    1 
ATOM   812  C  C     . MET A 1 103 ? 58.037 5.413   -10.511 1.00 17.01 ? 100  MET A C     1 
ATOM   813  O  O     . MET A 1 103 ? 58.631 4.484   -11.061 1.00 12.60 ? 100  MET A O     1 
ATOM   814  C  CB    . MET A 1 103 ? 55.757 4.923   -9.605  1.00 15.13 ? 100  MET A CB    1 
ATOM   815  C  CG    . MET A 1 103 ? 54.857 4.626   -8.414  1.00 20.30 ? 100  MET A CG    1 
ATOM   816  S  SD    . MET A 1 103 ? 55.251 3.044   -7.652  1.00 21.58 ? 100  MET A SD    1 
ATOM   817  C  CE    . MET A 1 103 ? 54.380 3.145   -6.075  1.00 19.65 ? 100  MET A CE    1 
ATOM   818  N  N     . GLU A 1 104 ? 58.069 6.660   -10.971 1.00 10.65 ? 101  GLU A N     1 
ATOM   819  C  CA    . GLU A 1 104 ? 58.822 6.984   -12.183 1.00 14.97 ? 101  GLU A CA    1 
ATOM   820  C  C     . GLU A 1 104 ? 60.336 6.820   -12.007 1.00 15.01 ? 101  GLU A C     1 
ATOM   821  O  O     . GLU A 1 104 ? 61.024 6.376   -12.924 1.00 12.89 ? 101  GLU A O     1 
ATOM   822  C  CB    . GLU A 1 104 ? 58.440 8.374   -12.709 1.00 15.04 ? 101  GLU A CB    1 
ATOM   823  C  CG    . GLU A 1 104 ? 57.036 8.393   -13.327 1.00 21.61 ? 101  GLU A CG    1 
ATOM   824  C  CD    . GLU A 1 104 ? 56.653 9.739   -13.937 1.00 35.48 ? 101  GLU A CD    1 
ATOM   825  O  OE1   . GLU A 1 104 ? 57.372 10.739  -13.708 1.00 33.22 ? 101  GLU A OE1   1 
ATOM   826  O  OE2   . GLU A 1 104 ? 55.624 9.790   -14.645 1.00 33.33 ? 101  GLU A OE2   1 
ATOM   827  N  N     . ILE A 1 105 ? 60.849 7.135   -10.823 1.00 11.45 ? 102  ILE A N     1 
ATOM   828  C  CA    . ILE A 1 105 ? 62.257 6.880   -10.514 1.00 11.75 ? 102  ILE A CA    1 
ATOM   829  C  C     . ILE A 1 105 ? 62.559 5.378   -10.471 1.00 13.01 ? 102  ILE A C     1 
ATOM   830  O  O     . ILE A 1 105 ? 63.527 4.907   -11.079 1.00 13.23 ? 102  ILE A O     1 
ATOM   831  C  CB    . ILE A 1 105 ? 62.677 7.555   -9.190  1.00 12.44 ? 102  ILE A CB    1 
ATOM   832  C  CG1   . ILE A 1 105 ? 62.569 9.075   -9.326  1.00 12.37 ? 102  ILE A CG1   1 
ATOM   833  C  CG2   . ILE A 1 105 ? 64.096 7.135   -8.756  1.00 14.35 ? 102  ILE A CG2   1 
ATOM   834  C  CD1   . ILE A 1 105 ? 62.446 9.781   -8.004  1.00 15.60 ? 102  ILE A CD1   1 
ATOM   835  N  N     . MET A 1 106 ? 61.733 4.617   -9.763  1.00 12.46 ? 103  MET A N     1 
ATOM   836  C  CA    . MET A 1 106 ? 61.939 3.170   -9.706  1.00 13.67 ? 103  MET A CA    1 
ATOM   837  C  C     . MET A 1 106 ? 61.926 2.514   -11.080 1.00 11.41 ? 103  MET A C     1 
ATOM   838  O  O     . MET A 1 106 ? 62.691 1.592   -11.351 1.00 13.00 ? 103  MET A O     1 
ATOM   839  C  CB    . MET A 1 106 ? 60.890 2.514   -8.799  1.00 12.91 ? 103  MET A CB    1 
ATOM   840  C  CG    . MET A 1 106 ? 61.129 2.829   -7.344  1.00 14.40 ? 103  MET A CG    1 
ATOM   841  S  SD    . MET A 1 106 ? 59.936 1.961   -6.331  1.00 17.66 ? 103  MET A SD    1 
ATOM   842  C  CE    . MET A 1 106 ? 58.469 2.918   -6.627  1.00 20.35 ? 103  MET A CE    1 
ATOM   843  N  N     . SER A 1 107 ? 61.044 2.987   -11.943 1.00 12.42 ? 104  SER A N     1 
ATOM   844  C  CA    . SER A 1 107 ? 60.913 2.438   -13.278 1.00 14.86 ? 104  SER A CA    1 
ATOM   845  C  C     . SER A 1 107 ? 62.190 2.546   -14.116 1.00 16.34 ? 104  SER A C     1 
ATOM   846  O  O     . SER A 1 107 ? 62.345 1.816   -15.093 1.00 14.89 ? 104  SER A O     1 
ATOM   847  C  CB    . SER A 1 107 ? 59.744 3.105   -14.004 1.00 15.38 ? 104  SER A CB    1 
ATOM   848  O  OG    . SER A 1 107 ? 58.519 2.712   -13.420 1.00 24.65 ? 104  SER A OG    1 
ATOM   849  N  N     . ARG A 1 108 ? 63.099 3.444   -13.747 1.00 15.33 ? 105  ARG A N     1 
ATOM   850  C  CA    . ARG A 1 108 ? 64.360 3.573   -14.489 1.00 17.69 ? 105  ARG A CA    1 
ATOM   851  C  C     . ARG A 1 108 ? 65.266 2.363   -14.270 1.00 24.04 ? 105  ARG A C     1 
ATOM   852  O  O     . ARG A 1 108 ? 66.085 2.025   -15.128 1.00 17.10 ? 105  ARG A O     1 
ATOM   853  C  CB    . ARG A 1 108 ? 65.139 4.838   -14.105 1.00 20.50 ? 105  ARG A CB    1 
ATOM   854  C  CG    . ARG A 1 108 ? 64.394 6.142   -14.270 1.00 17.52 ? 105  ARG A CG    1 
ATOM   855  C  CD    . ARG A 1 108 ? 65.364 7.306   -14.451 1.00 27.61 ? 105  ARG A CD    1 
ATOM   856  N  NE    . ARG A 1 108 ? 66.399 7.367   -13.424 1.00 26.69 ? 105  ARG A NE    1 
ATOM   857  C  CZ    . ARG A 1 108 ? 66.403 8.240   -12.420 1.00 22.02 ? 105  ARG A CZ    1 
ATOM   858  N  NH1   . ARG A 1 108 ? 67.384 8.231   -11.532 1.00 25.37 ? 105  ARG A NH1   1 
ATOM   859  N  NH2   . ARG A 1 108 ? 65.419 9.122   -12.307 1.00 19.82 ? 105  ARG A NH2   1 
ATOM   860  N  N     . PHE A 1 109 ? 65.119 1.720   -13.117 1.00 17.19 ? 106  PHE A N     1 
ATOM   861  C  CA    . PHE A 1 109 ? 66.005 0.623   -12.734 1.00 19.34 ? 106  PHE A CA    1 
ATOM   862  C  C     . PHE A 1 109 ? 65.480 -0.718  -13.222 1.00 21.74 ? 106  PHE A C     1 
ATOM   863  O  O     . PHE A 1 109 ? 66.254 -1.603  -13.601 1.00 25.18 ? 106  PHE A O     1 
ATOM   864  C  CB    . PHE A 1 109 ? 66.197 0.599   -11.218 1.00 18.07 ? 106  PHE A CB    1 
ATOM   865  C  CG    . PHE A 1 109 ? 66.952 1.782   -10.683 1.00 22.38 ? 106  PHE A CG    1 
ATOM   866  C  CD1   . PHE A 1 109 ? 66.316 3.000   -10.485 1.00 13.11 ? 106  PHE A CD1   1 
ATOM   867  C  CD2   . PHE A 1 109 ? 68.299 1.674   -10.369 1.00 17.94 ? 106  PHE A CD2   1 
ATOM   868  C  CE1   . PHE A 1 109 ? 67.014 4.091   -9.985  1.00 18.93 ? 106  PHE A CE1   1 
ATOM   869  C  CE2   . PHE A 1 109 ? 69.003 2.755   -9.874  1.00 21.78 ? 106  PHE A CE2   1 
ATOM   870  C  CZ    . PHE A 1 109 ? 68.362 3.969   -9.678  1.00 16.63 ? 106  PHE A CZ    1 
ATOM   871  N  N     . ALA A 1 110 ? 64.162 -0.862  -13.235 1.00 20.95 ? 107  ALA A N     1 
ATOM   872  C  CA    . ALA A 1 110 ? 63.555 -2.124  -13.618 1.00 18.80 ? 107  ALA A CA    1 
ATOM   873  C  C     . ALA A 1 110 ? 62.053 -2.027  -13.756 1.00 19.02 ? 107  ALA A C     1 
ATOM   874  O  O     . ALA A 1 110 ? 61.433 -1.043  -13.351 1.00 21.60 ? 107  ALA A O     1 
ATOM   875  C  CB    . ALA A 1 110 ? 63.909 -3.206  -12.615 1.00 18.33 ? 107  ALA A CB    1 
ATOM   876  N  N     . VAL A 1 111 ? 61.480 -3.069  -14.342 1.00 25.58 ? 108  VAL A N     1 
ATOM   877  C  CA    . VAL A 1 111 ? 60.040 -3.247  -14.412 1.00 26.76 ? 108  VAL A CA    1 
ATOM   878  C  C     . VAL A 1 111 ? 59.460 -3.305  -13.005 1.00 19.65 ? 108  VAL A C     1 
ATOM   879  O  O     . VAL A 1 111 ? 59.975 -4.027  -12.141 1.00 26.32 ? 108  VAL A O     1 
ATOM   880  C  CB    . VAL A 1 111 ? 59.710 -4.561  -15.132 1.00 33.15 ? 108  VAL A CB    1 
ATOM   881  C  CG1   . VAL A 1 111 ? 58.270 -4.989  -14.855 1.00 29.90 ? 108  VAL A CG1   1 
ATOM   882  C  CG2   . VAL A 1 111 ? 59.979 -4.422  -16.623 1.00 34.97 ? 108  VAL A CG2   1 
ATOM   883  N  N     . ILE A 1 112 ? 58.408 -2.531  -12.759 1.00 22.30 ? 109  ILE A N     1 
ATOM   884  C  CA    . ILE A 1 112 ? 57.793 -2.541  -11.435 1.00 16.89 ? 109  ILE A CA    1 
ATOM   885  C  C     . ILE A 1 112 ? 56.321 -2.900  -11.477 1.00 13.66 ? 109  ILE A C     1 
ATOM   886  O  O     . ILE A 1 112 ? 55.641 -2.701  -12.490 1.00 12.84 ? 109  ILE A O     1 
ATOM   887  C  CB    . ILE A 1 112 ? 57.963 -1.185  -10.699 1.00 16.40 ? 109  ILE A CB    1 
ATOM   888  C  CG1   . ILE A 1 112 ? 57.078 -0.111  -11.326 1.00 17.63 ? 109  ILE A CG1   1 
ATOM   889  C  CG2   . ILE A 1 112 ? 59.431 -0.760  -10.682 1.00 17.71 ? 109  ILE A CG2   1 
ATOM   890  C  CD1   . ILE A 1 112 ? 57.009 1.182   -10.511 1.00 22.98 ? 109  ILE A CD1   1 
ATOM   891  N  N     . GLU A 1 113 ? 55.850 -3.460  -10.366 1.00 14.25 ? 110  GLU A N     1 
ATOM   892  C  CA    . GLU A 1 113 ? 54.432 -3.678  -10.115 1.00 14.42 ? 110  GLU A CA    1 
ATOM   893  C  C     . GLU A 1 113 ? 53.988 -2.759  -8.981  1.00 10.57 ? 110  GLU A C     1 
ATOM   894  O  O     . GLU A 1 113 ? 54.425 -2.898  -7.835  1.00 10.23 ? 110  GLU A O     1 
ATOM   895  C  CB    . GLU A 1 113 ? 54.144 -5.145  -9.738  1.00 13.72 ? 110  GLU A CB    1 
ATOM   896  C  CG    . GLU A 1 113 ? 52.673 -5.410  -9.406  1.00 13.39 ? 110  GLU A CG    1 
ATOM   897  C  CD    . GLU A 1 113 ? 52.404 -6.839  -8.941  1.00 23.59 ? 110  GLU A CD    1 
ATOM   898  O  OE1   . GLU A 1 113 ? 51.335 -7.081  -8.330  1.00 21.44 ? 110  GLU A OE1   1 
ATOM   899  O  OE2   . GLU A 1 113 ? 53.254 -7.723  -9.177  1.00 14.24 ? 110  GLU A OE2   1 
ATOM   900  N  N     . ARG A 1 114 ? 53.120 -1.808  -9.303  1.00 15.05 ? 111  ARG A N     1 
ATOM   901  C  CA    . ARG A 1 114 ? 52.557 -0.928  -8.278  1.00 14.32 ? 111  ARG A CA    1 
ATOM   902  C  C     . ARG A 1 114 ? 51.664 -1.738  -7.351  1.00 18.97 ? 111  ARG A C     1 
ATOM   903  O  O     . ARG A 1 114 ? 50.645 -2.278  -7.772  1.00 20.33 ? 111  ARG A O     1 
ATOM   904  C  CB    . ARG A 1 114 ? 51.756 0.208   -8.929  1.00 16.25 ? 111  ARG A CB    1 
ATOM   905  C  CG    . ARG A 1 114 ? 51.205 1.251   -7.938  1.00 17.21 ? 111  ARG A CG    1 
ATOM   906  C  CD    . ARG A 1 114 ? 50.125 2.102   -8.600  1.00 18.81 ? 111  ARG A CD    1 
ATOM   907  N  NE    . ARG A 1 114 ? 49.749 3.299   -7.842  1.00 24.62 ? 111  ARG A NE    1 
ATOM   908  C  CZ    . ARG A 1 114 ? 48.770 3.351   -6.938  1.00 26.76 ? 111  ARG A CZ    1 
ATOM   909  N  NH1   . ARG A 1 114 ? 48.060 2.267   -6.651  1.00 29.10 ? 111  ARG A NH1   1 
ATOM   910  N  NH2   . ARG A 1 114 ? 48.501 4.495   -6.313  1.00 23.24 ? 111  ARG A NH2   1 
ATOM   911  N  N     . ALA A 1 115 ? 52.043 -1.824  -6.081  1.00 16.13 ? 112  ALA A N     1 
ATOM   912  C  CA    . ALA A 1 115 ? 51.293 -2.637  -5.146  1.00 14.08 ? 112  ALA A CA    1 
ATOM   913  C  C     . ALA A 1 115 ? 50.342 -1.795  -4.305  1.00 16.11 ? 112  ALA A C     1 
ATOM   914  O  O     . ALA A 1 115 ? 49.356 -2.309  -3.784  1.00 19.43 ? 112  ALA A O     1 
ATOM   915  C  CB    . ALA A 1 115 ? 52.235 -3.419  -4.250  1.00 16.21 ? 112  ALA A CB    1 
ATOM   916  N  N     . SER A 1 116 ? 50.655 -0.511  -4.169  1.00 13.26 ? 113  SER A N     1 
ATOM   917  C  CA    . SER A 1 116 ? 49.832 0.407   -3.390  1.00 13.45 ? 113  SER A CA    1 
ATOM   918  C  C     . SER A 1 116 ? 50.289 1.824   -3.712  1.00 13.45 ? 113  SER A C     1 
ATOM   919  O  O     . SER A 1 116 ? 51.205 2.014   -4.500  1.00 13.77 ? 113  SER A O     1 
ATOM   920  C  CB    . SER A 1 116 ? 50.011 0.131   -1.900  1.00 20.26 ? 113  SER A CB    1 
ATOM   921  O  OG    A SER A 1 116 ? 51.274 0.590   -1.458  0.50 12.63 ? 113  SER A OG    1 
ATOM   922  O  OG    B SER A 1 116 ? 49.095 0.871   -1.113  0.50 21.31 ? 113  SER A OG    1 
ATOM   923  N  N     . ILE A 1 117 ? 49.681 2.821   -3.076  1.00 12.75 ? 114  ILE A N     1 
ATOM   924  C  CA    . ILE A 1 117 ? 50.074 4.198   -3.318  1.00 12.95 ? 114  ILE A CA    1 
ATOM   925  C  C     . ILE A 1 117 ? 51.564 4.453   -3.031  1.00 15.40 ? 114  ILE A C     1 
ATOM   926  O  O     . ILE A 1 117 ? 52.159 5.362   -3.604  1.00 14.56 ? 114  ILE A O     1 
ATOM   927  C  CB    . ILE A 1 117 ? 49.209 5.189   -2.498  1.00 12.21 ? 114  ILE A CB    1 
ATOM   928  C  CG1   . ILE A 1 117 ? 49.400 6.615   -3.016  1.00 15.19 ? 114  ILE A CG1   1 
ATOM   929  C  CG2   . ILE A 1 117 ? 49.545 5.098   -1.026  1.00 17.93 ? 114  ILE A CG2   1 
ATOM   930  C  CD1   . ILE A 1 117 ? 48.261 7.564   -2.639  1.00 16.87 ? 114  ILE A CD1   1 
ATOM   931  N  N     . ASP A 1 118 ? 52.182 3.659   -2.159  1.00 11.09 ? 115  ASP A N     1 
ATOM   932  C  CA    . ASP A 1 118 ? 53.558 3.987   -1.789  1.00 14.59 ? 115  ASP A CA    1 
ATOM   933  C  C     . ASP A 1 118 ? 54.537 2.817   -1.850  1.00 15.36 ? 115  ASP A C     1 
ATOM   934  O  O     . ASP A 1 118 ? 55.640 2.872   -1.273  1.00 15.05 ? 115  ASP A O     1 
ATOM   935  C  CB    . ASP A 1 118 ? 53.577 4.611   -0.401  1.00 11.38 ? 115  ASP A CB    1 
ATOM   936  C  CG    . ASP A 1 118 ? 53.583 3.579   0.690   1.00 13.78 ? 115  ASP A CG    1 
ATOM   937  O  OD1   . ASP A 1 118 ? 54.243 3.856   1.692   1.00 14.81 ? 115  ASP A OD1   1 
ATOM   938  O  OD2   . ASP A 1 118 ? 52.958 2.499   0.550   1.00 13.94 ? 115  ASP A OD2   1 
ATOM   939  N  N     . GLU A 1 119 ? 54.163 1.756   -2.554  1.00 15.42 ? 116  GLU A N     1 
ATOM   940  C  CA    . GLU A 1 119 ? 55.093 0.642   -2.662  1.00 14.77 ? 116  GLU A CA    1 
ATOM   941  C  C     . GLU A 1 119 ? 55.020 -0.064  -3.999  1.00 13.44 ? 116  GLU A C     1 
ATOM   942  O  O     . GLU A 1 119 ? 53.978 -0.063  -4.666  1.00 13.35 ? 116  GLU A O     1 
ATOM   943  C  CB    . GLU A 1 119 ? 54.880 -0.353  -1.535  1.00 15.39 ? 116  GLU A CB    1 
ATOM   944  C  CG    . GLU A 1 119 ? 53.719 -1.259  -1.727  1.00 18.02 ? 116  GLU A CG    1 
ATOM   945  C  CD    . GLU A 1 119 ? 53.339 -1.959  -0.445  1.00 27.51 ? 116  GLU A CD    1 
ATOM   946  O  OE1   . GLU A 1 119 ? 52.667 -1.326  0.394   1.00 26.01 ? 116  GLU A OE1   1 
ATOM   947  O  OE2   . GLU A 1 119 ? 53.722 -3.133  -0.267  1.00 29.31 ? 116  GLU A OE2   1 
ATOM   948  N  N     . ALA A 1 120 ? 56.146 -0.648  -4.386  1.00 12.01 ? 117  ALA A N     1 
ATOM   949  C  CA    . ALA A 1 120 ? 56.223 -1.375  -5.640  1.00 9.92  ? 117  ALA A CA    1 
ATOM   950  C  C     . ALA A 1 120 ? 57.158 -2.572  -5.503  1.00 10.27 ? 117  ALA A C     1 
ATOM   951  O  O     . ALA A 1 120 ? 58.169 -2.499  -4.814  1.00 10.47 ? 117  ALA A O     1 
ATOM   952  C  CB    . ALA A 1 120 ? 56.721 -0.462  -6.739  1.00 12.16 ? 117  ALA A CB    1 
ATOM   953  N  N     . TYR A 1 121 ? 56.815 -3.659  -6.181  1.00 12.12 ? 118  TYR A N     1 
ATOM   954  C  CA    . TYR A 1 121 ? 57.727 -4.783  -6.348  1.00 9.97  ? 118  TYR A CA    1 
ATOM   955  C  C     . TYR A 1 121 ? 58.576 -4.556  -7.571  1.00 12.81 ? 118  TYR A C     1 
ATOM   956  O  O     . TYR A 1 121 ? 58.142 -3.923  -8.525  1.00 11.56 ? 118  TYR A O     1 
ATOM   957  C  CB    . TYR A 1 121 ? 56.952 -6.087  -6.508  1.00 10.32 ? 118  TYR A CB    1 
ATOM   958  C  CG    . TYR A 1 121 ? 56.195 -6.463  -5.254  1.00 8.03  ? 118  TYR A CG    1 
ATOM   959  C  CD1   . TYR A 1 121 ? 54.875 -6.073  -5.075  1.00 10.94 ? 118  TYR A CD1   1 
ATOM   960  C  CD2   . TYR A 1 121 ? 56.817 -7.180  -4.231  1.00 10.21 ? 118  TYR A CD2   1 
ATOM   961  C  CE1   . TYR A 1 121 ? 54.184 -6.402  -3.926  1.00 12.75 ? 118  TYR A CE1   1 
ATOM   962  C  CE2   . TYR A 1 121 ? 56.130 -7.512  -3.072  1.00 12.71 ? 118  TYR A CE2   1 
ATOM   963  C  CZ    . TYR A 1 121 ? 54.819 -7.121  -2.931  1.00 16.25 ? 118  TYR A CZ    1 
ATOM   964  O  OH    . TYR A 1 121 ? 54.140 -7.461  -1.788  1.00 17.92 ? 118  TYR A OH    1 
ATOM   965  N  N     . VAL A 1 122 ? 59.781 -5.106  -7.537  1.00 9.59  ? 119  VAL A N     1 
ATOM   966  C  CA    . VAL A 1 122 ? 60.770 -4.911  -8.571  1.00 13.51 ? 119  VAL A CA    1 
ATOM   967  C  C     . VAL A 1 122 ? 61.316 -6.280  -8.911  1.00 13.91 ? 119  VAL A C     1 
ATOM   968  O  O     . VAL A 1 122 ? 61.757 -6.989  -8.018  1.00 12.88 ? 119  VAL A O     1 
ATOM   969  C  CB    . VAL A 1 122 ? 61.956 -4.085  -7.991  1.00 19.88 ? 119  VAL A CB    1 
ATOM   970  C  CG1   . VAL A 1 122 ? 62.868 -3.626  -9.083  1.00 23.63 ? 119  VAL A CG1   1 
ATOM   971  C  CG2   . VAL A 1 122 ? 61.442 -2.893  -7.192  1.00 21.78 ? 119  VAL A CG2   1 
ATOM   972  N  N     . ASP A 1 123 ? 61.316 -6.663  -10.186 1.00 11.90 ? 120  ASP A N     1 
ATOM   973  C  CA    . ASP A 1 123 ? 61.995 -7.896  -10.586 1.00 12.98 ? 120  ASP A CA    1 
ATOM   974  C  C     . ASP A 1 123 ? 63.417 -7.558  -11.036 1.00 15.79 ? 120  ASP A C     1 
ATOM   975  O  O     . ASP A 1 123 ? 63.609 -6.983  -12.102 1.00 16.61 ? 120  ASP A O     1 
ATOM   976  C  CB    . ASP A 1 123 ? 61.223 -8.576  -11.714 1.00 22.15 ? 120  ASP A CB    1 
ATOM   977  C  CG    . ASP A 1 123 ? 61.710 -9.983  -11.993 1.00 26.17 ? 120  ASP A CG    1 
ATOM   978  O  OD1   . ASP A 1 123 ? 62.931 -10.236 -11.905 1.00 22.86 ? 120  ASP A OD1   1 
ATOM   979  O  OD2   . ASP A 1 123 ? 60.858 -10.848 -12.300 1.00 39.72 ? 120  ASP A OD2   1 
ATOM   980  N  N     . LEU A 1 124 ? 64.405 -7.908  -10.219 1.00 14.91 ? 121  LEU A N     1 
ATOM   981  C  CA    . LEU A 1 124 ? 65.788 -7.498  -10.456 1.00 11.40 ? 121  LEU A CA    1 
ATOM   982  C  C     . LEU A 1 124 ? 66.630 -8.570  -11.131 1.00 11.66 ? 121  LEU A C     1 
ATOM   983  O  O     . LEU A 1 124 ? 67.838 -8.398  -11.290 1.00 12.11 ? 121  LEU A O     1 
ATOM   984  C  CB    . LEU A 1 124 ? 66.447 -7.103  -9.132  1.00 15.03 ? 121  LEU A CB    1 
ATOM   985  C  CG    . LEU A 1 124 ? 65.910 -5.822  -8.491  1.00 12.88 ? 121  LEU A CG    1 
ATOM   986  C  CD1   . LEU A 1 124 ? 66.471 -5.660  -7.089  1.00 16.33 ? 121  LEU A CD1   1 
ATOM   987  C  CD2   . LEU A 1 124 ? 66.219 -4.606  -9.359  1.00 18.67 ? 121  LEU A CD2   1 
ATOM   988  N  N     . THR A 1 125 ? 65.998 -9.680  -11.497 1.00 12.59 ? 122  THR A N     1 
ATOM   989  C  CA    . THR A 1 125 ? 66.746 -10.836 -11.974 1.00 14.41 ? 122  THR A CA    1 
ATOM   990  C  C     . THR A 1 125 ? 67.703 -10.465 -13.113 1.00 17.10 ? 122  THR A C     1 
ATOM   991  O  O     . THR A 1 125 ? 68.899 -10.749 -13.046 1.00 14.96 ? 122  THR A O     1 
ATOM   992  C  CB    . THR A 1 125 ? 65.813 -11.971 -12.399 1.00 14.15 ? 122  THR A CB    1 
ATOM   993  O  OG1   . THR A 1 125 ? 64.920 -12.269 -11.318 1.00 13.46 ? 122  THR A OG1   1 
ATOM   994  C  CG2   . THR A 1 125 ? 66.621 -13.220 -12.755 1.00 16.85 ? 122  THR A CG2   1 
ATOM   995  N  N     . SER A 1 126 ? 67.186 -9.789  -14.133 1.00 15.84 ? 123  SER A N     1 
ATOM   996  C  CA    . SER A 1 126 ? 68.022 -9.432  -15.289 1.00 18.00 ? 123  SER A CA    1 
ATOM   997  C  C     . SER A 1 126 ? 69.061 -8.357  -14.944 1.00 18.41 ? 123  SER A C     1 
ATOM   998  O  O     . SER A 1 126 ? 70.211 -8.434  -15.372 1.00 16.34 ? 123  SER A O     1 
ATOM   999  C  CB    . SER A 1 126 ? 67.165 -8.980  -16.469 1.00 20.90 ? 123  SER A CB    1 
ATOM   1000 O  OG    A SER A 1 126 ? 66.361 -10.036 -16.957 0.50 24.11 ? 123  SER A OG    1 
ATOM   1001 O  OG    B SER A 1 126 ? 66.334 -7.893  -16.122 0.50 21.46 ? 123  SER A OG    1 
ATOM   1002 N  N     . ALA A 1 127 ? 68.654 -7.362  -14.164 1.00 15.80 ? 124  ALA A N     1 
ATOM   1003 C  CA    . ALA A 1 127 ? 69.575 -6.309  -13.732 1.00 18.02 ? 124  ALA A CA    1 
ATOM   1004 C  C     . ALA A 1 127 ? 70.764 -6.888  -12.961 1.00 17.49 ? 124  ALA A C     1 
ATOM   1005 O  O     . ALA A 1 127 ? 71.895 -6.422  -13.102 1.00 16.20 ? 124  ALA A O     1 
ATOM   1006 C  CB    . ALA A 1 127 ? 68.853 -5.274  -12.889 1.00 13.50 ? 124  ALA A CB    1 
ATOM   1007 N  N     . VAL A 1 128 ? 70.498 -7.899  -12.134 1.00 15.51 ? 125  VAL A N     1 
ATOM   1008 C  CA    . VAL A 1 128 ? 71.551 -8.566  -11.370 1.00 16.13 ? 125  VAL A CA    1 
ATOM   1009 C  C     . VAL A 1 128 ? 72.541 -9.296  -12.277 1.00 17.66 ? 125  VAL A C     1 
ATOM   1010 O  O     . VAL A 1 128 ? 73.755 -9.178  -12.100 1.00 18.43 ? 125  VAL A O     1 
ATOM   1011 C  CB    . VAL A 1 128 ? 70.950 -9.529  -10.312 1.00 13.92 ? 125  VAL A CB    1 
ATOM   1012 C  CG1   . VAL A 1 128 ? 71.977 -10.577 -9.855  1.00 14.10 ? 125  VAL A CG1   1 
ATOM   1013 C  CG2   . VAL A 1 128 ? 70.443 -8.721  -9.144  1.00 12.24 ? 125  VAL A CG2   1 
ATOM   1014 N  N     . GLN A 1 129 ? 72.020 -10.036 -13.253 1.00 18.65 ? 126  GLN A N     1 
ATOM   1015 C  CA    . GLN A 1 129 ? 72.869 -10.697 -14.237 1.00 26.57 ? 126  GLN A CA    1 
ATOM   1016 C  C     . GLN A 1 129 ? 73.801 -9.697  -14.913 1.00 25.64 ? 126  GLN A C     1 
ATOM   1017 O  O     . GLN A 1 129 ? 75.006 -9.928  -15.007 1.00 27.86 ? 126  GLN A O     1 
ATOM   1018 C  CB    . GLN A 1 129 ? 72.025 -11.422 -15.286 1.00 24.31 ? 126  GLN A CB    1 
ATOM   1019 C  CG    . GLN A 1 129 ? 71.208 -12.581 -14.734 1.00 31.90 ? 126  GLN A CG    1 
ATOM   1020 C  CD    . GLN A 1 129 ? 72.076 -13.663 -14.117 1.00 47.59 ? 126  GLN A CD    1 
ATOM   1021 O  OE1   . GLN A 1 129 ? 72.064 -13.868 -12.901 1.00 50.42 ? 126  GLN A OE1   1 
ATOM   1022 N  NE2   . GLN A 1 129 ? 72.838 -14.361 -14.954 1.00 48.37 ? 126  GLN A NE2   1 
ATOM   1023 N  N     . GLU A 1 130 ? 73.242 -8.579  -15.370 1.00 24.33 ? 127  GLU A N     1 
ATOM   1024 C  CA    . GLU A 1 130 ? 74.043 -7.543  -16.015 1.00 27.90 ? 127  GLU A CA    1 
ATOM   1025 C  C     . GLU A 1 130 ? 75.170 -7.039  -15.116 1.00 28.65 ? 127  GLU A C     1 
ATOM   1026 O  O     . GLU A 1 130 ? 76.326 -6.951  -15.540 1.00 31.69 ? 127  GLU A O     1 
ATOM   1027 C  CB    . GLU A 1 130 ? 73.163 -6.368  -16.446 1.00 27.34 ? 127  GLU A CB    1 
ATOM   1028 C  CG    . GLU A 1 130 ? 72.182 -6.709  -17.553 1.00 38.53 ? 127  GLU A CG    1 
ATOM   1029 C  CD    . GLU A 1 130 ? 71.481 -5.481  -18.104 1.00 66.12 ? 127  GLU A CD    1 
ATOM   1030 O  OE1   . GLU A 1 130 ? 72.007 -4.359  -17.922 1.00 62.87 ? 127  GLU A OE1   1 
ATOM   1031 O  OE2   . GLU A 1 130 ? 70.401 -5.638  -18.716 1.00 74.31 ? 127  GLU A OE2   1 
ATOM   1032 N  N     . ARG A 1 131 ? 74.829 -6.708  -13.877 1.00 19.74 ? 128  ARG A N     1 
ATOM   1033 C  CA    . ARG A 1 131 ? 75.792 -6.151  -12.932 1.00 24.21 ? 128  ARG A CA    1 
ATOM   1034 C  C     . ARG A 1 131 ? 76.883 -7.170  -12.603 1.00 25.00 ? 128  ARG A C     1 
ATOM   1035 O  O     . ARG A 1 131 ? 78.057 -6.813  -12.464 1.00 30.47 ? 128  ARG A O     1 
ATOM   1036 C  CB    . ARG A 1 131 ? 75.067 -5.673  -11.664 1.00 20.20 ? 128  ARG A CB    1 
ATOM   1037 C  CG    A ARG A 1 131 ? 75.914 -4.888  -10.675 0.50 24.75 ? 128  ARG A CG    1 
ATOM   1038 C  CG    B ARG A 1 131 ? 75.965 -4.988  -10.638 0.50 24.79 ? 128  ARG A CG    1 
ATOM   1039 C  CD    A ARG A 1 131 ? 76.329 -3.533  -11.232 0.50 23.05 ? 128  ARG A CD    1 
ATOM   1040 C  CD    B ARG A 1 131 ? 76.602 -3.717  -11.199 0.50 23.39 ? 128  ARG A CD    1 
ATOM   1041 N  NE    A ARG A 1 131 ? 77.026 -2.743  -10.224 0.50 26.48 ? 128  ARG A NE    1 
ATOM   1042 N  NE    B ARG A 1 131 ? 75.588 -2.756  -11.612 0.50 21.08 ? 128  ARG A NE    1 
ATOM   1043 C  CZ    A ARG A 1 131 ? 76.427 -1.884  -9.405  0.50 23.31 ? 128  ARG A CZ    1 
ATOM   1044 C  CZ    B ARG A 1 131 ? 75.010 -1.891  -10.786 0.50 23.00 ? 128  ARG A CZ    1 
ATOM   1045 N  NH1   A ARG A 1 131 ? 77.137 -1.210  -8.513  0.50 19.54 ? 128  ARG A NH1   1 
ATOM   1046 N  NH1   B ARG A 1 131 ? 74.081 -1.058  -11.236 0.50 27.58 ? 128  ARG A NH1   1 
ATOM   1047 N  NH2   A ARG A 1 131 ? 75.119 -1.695  -9.488  0.50 24.19 ? 128  ARG A NH2   1 
ATOM   1048 N  NH2   B ARG A 1 131 ? 75.361 -1.860  -9.508  0.50 24.02 ? 128  ARG A NH2   1 
ATOM   1049 N  N     . LEU A 1 132 ? 76.499 -8.436  -12.487 1.00 21.38 ? 129  LEU A N     1 
ATOM   1050 C  CA    . LEU A 1 132 ? 77.466 -9.514  -12.276 1.00 24.79 ? 129  LEU A CA    1 
ATOM   1051 C  C     . LEU A 1 132 ? 78.523 -9.561  -13.381 1.00 35.20 ? 129  LEU A C     1 
ATOM   1052 O  O     . LEU A 1 132 ? 79.693 -9.810  -13.112 1.00 33.14 ? 129  LEU A O     1 
ATOM   1053 C  CB    . LEU A 1 132 ? 76.756 -10.868 -12.141 1.00 25.31 ? 129  LEU A CB    1 
ATOM   1054 C  CG    . LEU A 1 132 ? 76.293 -11.179 -10.709 1.00 24.61 ? 129  LEU A CG    1 
ATOM   1055 C  CD1   . LEU A 1 132 ? 75.256 -12.297 -10.657 1.00 22.50 ? 129  LEU A CD1   1 
ATOM   1056 C  CD2   . LEU A 1 132 ? 77.492 -11.508 -9.830  1.00 25.30 ? 129  LEU A CD2   1 
ATOM   1057 N  N     . GLN A 1 133 ? 78.107 -9.308  -14.620 1.00 36.09 ? 130  GLN A N     1 
ATOM   1058 C  CA    . GLN A 1 133 ? 79.034 -9.258  -15.749 1.00 35.16 ? 130  GLN A CA    1 
ATOM   1059 C  C     . GLN A 1 133 ? 80.054 -8.129  -15.599 1.00 44.43 ? 130  GLN A C     1 
ATOM   1060 O  O     . GLN A 1 133 ? 81.243 -8.326  -15.836 1.00 48.41 ? 130  GLN A O     1 
ATOM   1061 C  CB    . GLN A 1 133 ? 78.275 -9.106  -17.067 1.00 44.44 ? 130  GLN A CB    1 
ATOM   1062 C  CG    . GLN A 1 133 ? 77.322 -10.253 -17.369 1.00 46.05 ? 130  GLN A CG    1 
ATOM   1063 C  CD    . GLN A 1 133 ? 78.025 -11.596 -17.434 1.00 64.42 ? 130  GLN A CD    1 
ATOM   1064 O  OE1   . GLN A 1 133 ? 79.256 -11.669 -17.467 1.00 65.59 ? 130  GLN A OE1   1 
ATOM   1065 N  NE2   . GLN A 1 133 ? 77.242 -12.671 -17.453 1.00 64.08 ? 130  GLN A NE2   1 
ATOM   1066 N  N     . LYS A 1 134 ? 79.593 -6.948  -15.202 1.00 36.85 ? 131  LYS A N     1 
ATOM   1067 C  CA    . LYS A 1 134 ? 80.502 -5.819  -15.022 1.00 43.65 ? 131  LYS A CA    1 
ATOM   1068 C  C     . LYS A 1 134 ? 81.510 -6.069  -13.902 1.00 52.43 ? 131  LYS A C     1 
ATOM   1069 O  O     . LYS A 1 134 ? 82.688 -5.740  -14.035 1.00 56.71 ? 131  LYS A O     1 
ATOM   1070 C  CB    . LYS A 1 134 ? 79.730 -4.524  -14.762 1.00 48.01 ? 131  LYS A CB    1 
ATOM   1071 C  CG    . LYS A 1 134 ? 78.893 -4.057  -15.941 1.00 48.49 ? 131  LYS A CG    1 
ATOM   1072 C  CD    . LYS A 1 134 ? 78.429 -2.619  -15.757 1.00 51.45 ? 131  LYS A CD    1 
ATOM   1073 C  CE    . LYS A 1 134 ? 77.777 -2.419  -14.397 1.00 48.09 ? 131  LYS A CE    1 
ATOM   1074 N  NZ    . LYS A 1 134 ? 77.169 -1.065  -14.251 1.00 44.99 ? 131  LYS A NZ    1 
ATOM   1075 N  N     . LEU A 1 135 ? 81.044 -6.652  -12.802 1.00 43.49 ? 132  LEU A N     1 
ATOM   1076 C  CA    . LEU A 1 135 ? 81.903 -6.912  -11.650 1.00 52.39 ? 132  LEU A CA    1 
ATOM   1077 C  C     . LEU A 1 135 ? 83.068 -7.834  -12.002 1.00 55.29 ? 132  LEU A C     1 
ATOM   1078 O  O     . LEU A 1 135 ? 84.181 -7.661  -11.499 1.00 57.58 ? 132  LEU A O     1 
ATOM   1079 C  CB    . LEU A 1 135 ? 81.089 -7.505  -10.497 1.00 45.06 ? 132  LEU A CB    1 
ATOM   1080 C  CG    . LEU A 1 135 ? 80.484 -6.503  -9.511  1.00 46.80 ? 132  LEU A CG    1 
ATOM   1081 C  CD1   . LEU A 1 135 ? 80.011 -5.248  -10.227 1.00 47.33 ? 132  LEU A CD1   1 
ATOM   1082 C  CD2   . LEU A 1 135 ? 79.350 -7.142  -8.726  1.00 41.42 ? 132  LEU A CD2   1 
ATOM   1083 N  N     . GLN A 1 136 ? 82.798 -8.810  -12.866 1.00 54.08 ? 133  GLN A N     1 
ATOM   1084 C  CA    . GLN A 1 136 ? 83.804 -9.778  -13.299 1.00 56.06 ? 133  GLN A CA    1 
ATOM   1085 C  C     . GLN A 1 136 ? 84.538 -10.449 -12.135 1.00 54.03 ? 133  GLN A C     1 
ATOM   1086 O  O     . GLN A 1 136 ? 85.751 -10.289 -11.980 1.00 48.85 ? 133  GLN A O     1 
ATOM   1087 C  CB    . GLN A 1 136 ? 84.810 -9.128  -14.259 1.00 54.22 ? 133  GLN A CB    1 
ATOM   1088 C  CG    . GLN A 1 136 ? 84.225 -8.693  -15.603 1.00 59.52 ? 133  GLN A CG    1 
ATOM   1089 C  CD    . GLN A 1 136 ? 83.735 -9.862  -16.454 1.00 65.85 ? 133  GLN A CD    1 
ATOM   1090 O  OE1   . GLN A 1 136 ? 82.994 -10.729 -15.983 1.00 63.91 ? 133  GLN A OE1   1 
ATOM   1091 N  NE2   . GLN A 1 136 ? 84.149 -9.885  -17.716 1.00 70.67 ? 133  GLN A NE2   1 
ATOM   1092 N  N     . GLY A 1 137 ? 83.795 -11.200 -11.324 1.00 49.04 ? 134  GLY A N     1 
ATOM   1093 C  CA    . GLY A 1 137 ? 84.372 -11.981 -10.241 1.00 46.86 ? 134  GLY A CA    1 
ATOM   1094 C  C     . GLY A 1 137 ? 84.909 -11.177 -9.069  1.00 50.15 ? 134  GLY A C     1 
ATOM   1095 O  O     . GLY A 1 137 ? 85.331 -11.744 -8.060  1.00 54.61 ? 134  GLY A O     1 
ATOM   1096 N  N     . GLN A 1 138 ? 84.893 -9.855  -9.199  1.00 43.83 ? 135  GLN A N     1 
ATOM   1097 C  CA    . GLN A 1 138 ? 85.372 -8.967  -8.145  1.00 46.77 ? 135  GLN A CA    1 
ATOM   1098 C  C     . GLN A 1 138 ? 84.442 -8.959  -6.929  1.00 42.55 ? 135  GLN A C     1 
ATOM   1099 O  O     . GLN A 1 138 ? 83.222 -8.860  -7.072  1.00 43.13 ? 135  GLN A O     1 
ATOM   1100 C  CB    . GLN A 1 138 ? 85.525 -7.552  -8.699  1.00 49.84 ? 135  GLN A CB    1 
ATOM   1101 C  CG    . GLN A 1 138 ? 85.828 -6.492  -7.664  1.00 57.70 ? 135  GLN A CG    1 
ATOM   1102 C  CD    . GLN A 1 138 ? 85.745 -5.095  -8.246  1.00 65.68 ? 135  GLN A CD    1 
ATOM   1103 O  OE1   . GLN A 1 138 ? 85.465 -4.925  -9.435  1.00 67.80 ? 135  GLN A OE1   1 
ATOM   1104 N  NE2   . GLN A 1 138 ? 85.983 -4.089  -7.413  1.00 53.34 ? 135  GLN A NE2   1 
ATOM   1105 N  N     . PRO A 1 139 ? 85.025 -9.051  -5.724  1.00 44.82 ? 136  PRO A N     1 
ATOM   1106 C  CA    . PRO A 1 139 ? 84.282 -9.126  -4.460  1.00 40.41 ? 136  PRO A CA    1 
ATOM   1107 C  C     . PRO A 1 139 ? 83.382 -7.917  -4.235  1.00 38.35 ? 136  PRO A C     1 
ATOM   1108 O  O     . PRO A 1 139 ? 83.585 -6.863  -4.835  1.00 37.15 ? 136  PRO A O     1 
ATOM   1109 C  CB    . PRO A 1 139 ? 85.393 -9.154  -3.406  1.00 39.02 ? 136  PRO A CB    1 
ATOM   1110 C  CG    . PRO A 1 139 ? 86.572 -8.542  -4.079  1.00 42.92 ? 136  PRO A CG    1 
ATOM   1111 C  CD    . PRO A 1 139 ? 86.478 -8.996  -5.499  1.00 49.00 ? 136  PRO A CD    1 
ATOM   1112 N  N     . ILE A 1 140 ? 82.385 -8.081  -3.374  1.00 37.21 ? 137  ILE A N     1 
ATOM   1113 C  CA    . ILE A 1 140 ? 81.468 -7.000  -3.058  1.00 25.64 ? 137  ILE A CA    1 
ATOM   1114 C  C     . ILE A 1 140 ? 81.824 -6.369  -1.721  1.00 24.83 ? 137  ILE A C     1 
ATOM   1115 O  O     . ILE A 1 140 ? 81.841 -7.032  -0.688  1.00 28.88 ? 137  ILE A O     1 
ATOM   1116 C  CB    . ILE A 1 140 ? 80.009 -7.483  -3.064  1.00 26.08 ? 137  ILE A CB    1 
ATOM   1117 C  CG1   . ILE A 1 140 ? 79.666 -8.045  -4.448  1.00 32.93 ? 137  ILE A CG1   1 
ATOM   1118 C  CG2   . ILE A 1 140 ? 79.070 -6.346  -2.700  1.00 23.76 ? 137  ILE A CG2   1 
ATOM   1119 C  CD1   . ILE A 1 140 ? 78.280 -8.619  -4.565  1.00 35.61 ? 137  ILE A CD1   1 
ATOM   1120 N  N     . SER A 1 141 ? 82.118 -5.078  -1.760  1.00 27.80 ? 138  SER A N     1 
ATOM   1121 C  CA    . SER A 1 141 ? 82.544 -4.336  -0.582  1.00 23.36 ? 138  SER A CA    1 
ATOM   1122 C  C     . SER A 1 141 ? 81.353 -3.929  0.293   1.00 24.83 ? 138  SER A C     1 
ATOM   1123 O  O     . SER A 1 141 ? 80.294 -3.559  -0.222  1.00 24.27 ? 138  SER A O     1 
ATOM   1124 C  CB    . SER A 1 141 ? 83.329 -3.098  -1.028  1.00 27.68 ? 138  SER A CB    1 
ATOM   1125 O  OG    . SER A 1 141 ? 83.320 -2.084  -0.043  1.00 32.86 ? 138  SER A OG    1 
ATOM   1126 N  N     . ALA A 1 142 ? 81.529 -3.993  1.610   1.00 19.33 ? 139  ALA A N     1 
ATOM   1127 C  CA    . ALA A 1 142 ? 80.474 -3.568  2.529   1.00 20.82 ? 139  ALA A CA    1 
ATOM   1128 C  C     . ALA A 1 142 ? 80.071 -2.111  2.278   1.00 27.69 ? 139  ALA A C     1 
ATOM   1129 O  O     . ALA A 1 142 ? 78.966 -1.691  2.627   1.00 19.25 ? 139  ALA A O     1 
ATOM   1130 C  CB    . ALA A 1 142 ? 80.905 -3.767  3.973   1.00 24.00 ? 139  ALA A CB    1 
ATOM   1131 N  N     . ASP A 1 143 ? 80.970 -1.346  1.659   1.00 25.70 ? 140  ASP A N     1 
ATOM   1132 C  CA    . ASP A 1 143 ? 80.705 0.060   1.384   1.00 27.78 ? 140  ASP A CA    1 
ATOM   1133 C  C     . ASP A 1 143 ? 79.566 0.237   0.401   1.00 22.67 ? 140  ASP A C     1 
ATOM   1134 O  O     . ASP A 1 143 ? 78.934 1.289   0.371   1.00 21.97 ? 140  ASP A O     1 
ATOM   1135 C  CB    . ASP A 1 143 ? 81.949 0.755   0.838   1.00 25.72 ? 140  ASP A CB    1 
ATOM   1136 C  CG    . ASP A 1 143 ? 83.067 0.827   1.858   1.00 39.38 ? 140  ASP A CG    1 
ATOM   1137 O  OD1   . ASP A 1 143 ? 82.777 0.685   3.067   1.00 39.45 ? 140  ASP A OD1   1 
ATOM   1138 O  OD2   . ASP A 1 143 ? 84.232 1.034   1.453   1.00 49.03 ? 140  ASP A OD2   1 
ATOM   1139 N  N     . LEU A 1 144 ? 79.312 -0.791  -0.404  1.00 19.28 ? 141  LEU A N     1 
ATOM   1140 C  CA    . LEU A 1 144 ? 78.221 -0.753  -1.363  1.00 20.56 ? 141  LEU A CA    1 
ATOM   1141 C  C     . LEU A 1 144 ? 76.880 -1.074  -0.703  1.00 18.15 ? 141  LEU A C     1 
ATOM   1142 O  O     . LEU A 1 144 ? 75.839 -1.004  -1.343  1.00 16.21 ? 141  LEU A O     1 
ATOM   1143 C  CB    . LEU A 1 144 ? 78.484 -1.738  -2.492  1.00 14.54 ? 141  LEU A CB    1 
ATOM   1144 C  CG    . LEU A 1 144 ? 79.751 -1.467  -3.304  1.00 18.61 ? 141  LEU A CG    1 
ATOM   1145 C  CD1   . LEU A 1 144 ? 79.885 -2.448  -4.444  1.00 25.23 ? 141  LEU A CD1   1 
ATOM   1146 C  CD2   . LEU A 1 144 ? 79.699 -0.045  -3.817  1.00 27.74 ? 141  LEU A CD2   1 
ATOM   1147 N  N     . LEU A 1 145 ? 76.911 -1.430  0.574   1.00 15.98 ? 142  LEU A N     1 
ATOM   1148 C  CA    . LEU A 1 145 ? 75.701 -1.861  1.270   1.00 13.90 ? 142  LEU A CA    1 
ATOM   1149 C  C     . LEU A 1 145 ? 75.563 -1.151  2.610   1.00 13.73 ? 142  LEU A C     1 
ATOM   1150 O  O     . LEU A 1 145 ? 75.448 -1.788  3.660   1.00 14.17 ? 142  LEU A O     1 
ATOM   1151 C  CB    . LEU A 1 145 ? 75.729 -3.383  1.462   1.00 15.25 ? 142  LEU A CB    1 
ATOM   1152 C  CG    . LEU A 1 145 ? 75.702 -4.222  0.187   1.00 13.55 ? 142  LEU A CG    1 
ATOM   1153 C  CD1   . LEU A 1 145 ? 76.088 -5.689  0.454   1.00 15.30 ? 142  LEU A CD1   1 
ATOM   1154 C  CD2   . LEU A 1 145 ? 74.333 -4.151  -0.462  1.00 15.62 ? 142  LEU A CD2   1 
ATOM   1155 N  N     . PRO A 1 146 ? 75.563 0.192   2.583   1.00 17.89 ? 143  PRO A N     1 
ATOM   1156 C  CA    . PRO A 1 146 ? 75.622 1.004   3.806   1.00 18.79 ? 143  PRO A CA    1 
ATOM   1157 C  C     . PRO A 1 146 ? 74.367 0.989   4.673   1.00 14.47 ? 143  PRO A C     1 
ATOM   1158 O  O     . PRO A 1 146 ? 74.437 1.419   5.818   1.00 18.27 ? 143  PRO A O     1 
ATOM   1159 C  CB    . PRO A 1 146 ? 75.864 2.425   3.271   1.00 26.94 ? 143  PRO A CB    1 
ATOM   1160 C  CG    . PRO A 1 146 ? 75.315 2.406   1.890   1.00 20.18 ? 143  PRO A CG    1 
ATOM   1161 C  CD    . PRO A 1 146 ? 75.579 1.018   1.363   1.00 15.46 ? 143  PRO A CD    1 
ATOM   1162 N  N     . SER A 1 147 ? 73.241 0.512   4.151   1.00 14.48 ? 144  SER A N     1 
ATOM   1163 C  CA    . SER A 1 147 ? 72.011 0.504   4.940   1.00 12.16 ? 144  SER A CA    1 
ATOM   1164 C  C     . SER A 1 147 ? 71.319 -0.859  4.897   1.00 12.47 ? 144  SER A C     1 
ATOM   1165 O  O     . SER A 1 147 ? 70.122 -0.959  5.139   1.00 11.28 ? 144  SER A O     1 
ATOM   1166 C  CB    . SER A 1 147 ? 71.047 1.599   4.460   1.00 15.89 ? 144  SER A CB    1 
ATOM   1167 O  OG    . SER A 1 147 ? 70.594 1.348   3.138   1.00 18.53 ? 144  SER A OG    1 
ATOM   1168 N  N     . THR A 1 148 ? 72.095 -1.905  4.637   1.00 11.47 ? 145  THR A N     1 
ATOM   1169 C  CA    . THR A 1 148 ? 71.551 -3.248  4.440   1.00 11.56 ? 145  THR A CA    1 
ATOM   1170 C  C     . THR A 1 148 ? 71.728 -4.126  5.672   1.00 10.06 ? 145  THR A C     1 
ATOM   1171 O  O     . THR A 1 148 ? 72.804 -4.151  6.287   1.00 12.81 ? 145  THR A O     1 
ATOM   1172 C  CB    . THR A 1 148 ? 72.243 -3.945  3.240   1.00 13.42 ? 145  THR A CB    1 
ATOM   1173 O  OG1   . THR A 1 148 ? 71.891 -3.272  2.029   1.00 10.87 ? 145  THR A OG1   1 
ATOM   1174 C  CG2   . THR A 1 148 ? 71.830 -5.417  3.140   1.00 8.98  ? 145  THR A CG2   1 
ATOM   1175 N  N     . TYR A 1 149 ? 70.657 -4.830  6.026   1.00 10.82 ? 146  TYR A N     1 
ATOM   1176 C  CA    . TYR A 1 149 ? 70.678 -5.874  7.050   1.00 13.73 ? 146  TYR A CA    1 
ATOM   1177 C  C     . TYR A 1 149 ? 70.601 -7.236  6.397   1.00 13.70 ? 146  TYR A C     1 
ATOM   1178 O  O     . TYR A 1 149 ? 69.833 -7.437  5.451   1.00 11.75 ? 146  TYR A O     1 
ATOM   1179 C  CB    . TYR A 1 149 ? 69.472 -5.743  7.966   1.00 9.72  ? 146  TYR A CB    1 
ATOM   1180 C  CG    . TYR A 1 149 ? 69.651 -4.695  9.026   1.00 9.85  ? 146  TYR A CG    1 
ATOM   1181 C  CD1   . TYR A 1 149 ? 70.076 -5.052  10.298  1.00 12.24 ? 146  TYR A CD1   1 
ATOM   1182 C  CD2   . TYR A 1 149 ? 69.410 -3.352  8.755   1.00 13.42 ? 146  TYR A CD2   1 
ATOM   1183 C  CE1   . TYR A 1 149 ? 70.246 -4.094  11.284  1.00 14.62 ? 146  TYR A CE1   1 
ATOM   1184 C  CE2   . TYR A 1 149 ? 69.584 -2.382  9.737   1.00 17.55 ? 146  TYR A CE2   1 
ATOM   1185 C  CZ    . TYR A 1 149 ? 70.005 -2.767  10.997  1.00 20.22 ? 146  TYR A CZ    1 
ATOM   1186 O  OH    . TYR A 1 149 ? 70.180 -1.833  11.991  1.00 23.59 ? 146  TYR A OH    1 
ATOM   1187 N  N     . ILE A 1 150 ? 71.376 -8.183  6.915   1.00 10.74 ? 147  ILE A N     1 
ATOM   1188 C  CA    . ILE A 1 150 ? 71.262 -9.566  6.467   1.00 10.74 ? 147  ILE A CA    1 
ATOM   1189 C  C     . ILE A 1 150 ? 70.492 -10.351 7.529   1.00 10.88 ? 147  ILE A C     1 
ATOM   1190 O  O     . ILE A 1 150 ? 71.003 -10.595 8.623   1.00 13.48 ? 147  ILE A O     1 
ATOM   1191 C  CB    . ILE A 1 150 ? 72.640 -10.223 6.250   1.00 9.02  ? 147  ILE A CB    1 
ATOM   1192 C  CG1   . ILE A 1 150 ? 73.526 -9.366  5.331   1.00 11.57 ? 147  ILE A CG1   1 
ATOM   1193 C  CG2   . ILE A 1 150 ? 72.466 -11.629 5.649   1.00 10.50 ? 147  ILE A CG2   1 
ATOM   1194 C  CD1   . ILE A 1 150 ? 72.956 -9.153  3.913   1.00 10.02 ? 147  ILE A CD1   1 
ATOM   1195 N  N     . GLU A 1 151 ? 69.252 -10.724 7.223   1.00 9.65  ? 148  GLU A N     1 
ATOM   1196 C  CA    . GLU A 1 151 ? 68.412 -11.384 8.212   1.00 10.43 ? 148  GLU A CA    1 
ATOM   1197 C  C     . GLU A 1 151 ? 69.073 -12.675 8.703   1.00 11.97 ? 148  GLU A C     1 
ATOM   1198 O  O     . GLU A 1 151 ? 69.510 -13.488 7.895   1.00 12.10 ? 148  GLU A O     1 
ATOM   1199 C  CB    . GLU A 1 151 ? 67.028 -11.698 7.633   1.00 12.63 ? 148  GLU A CB    1 
ATOM   1200 C  CG    . GLU A 1 151 ? 66.096 -12.467 8.612   1.00 15.91 ? 148  GLU A CG    1 
ATOM   1201 C  CD    . GLU A 1 151 ? 65.862 -11.741 9.930   1.00 20.84 ? 148  GLU A CD    1 
ATOM   1202 O  OE1   . GLU A 1 151 ? 65.604 -12.421 10.950  1.00 19.65 ? 148  GLU A OE1   1 
ATOM   1203 O  OE2   . GLU A 1 151 ? 65.922 -10.493 9.952   1.00 22.23 ? 148  GLU A OE2   1 
ATOM   1204 N  N     . GLY A 1 152 ? 69.150 -12.832 10.027  1.00 10.19 ? 149  GLY A N     1 
ATOM   1205 C  CA    . GLY A 1 152 ? 69.680 -14.040 10.644  1.00 14.53 ? 149  GLY A CA    1 
ATOM   1206 C  C     . GLY A 1 152 ? 71.114 -13.891 11.116  1.00 16.04 ? 149  GLY A C     1 
ATOM   1207 O  O     . GLY A 1 152 ? 71.633 -14.732 11.846  1.00 17.95 ? 149  GLY A O     1 
ATOM   1208 N  N     . LEU A 1 153 ? 71.761 -12.816 10.688  1.00 13.05 ? 150  LEU A N     1 
ATOM   1209 C  CA    . LEU A 1 153 ? 73.143 -12.544 11.091  1.00 14.75 ? 150  LEU A CA    1 
ATOM   1210 C  C     . LEU A 1 153 ? 73.242 -11.225 11.859  1.00 18.72 ? 150  LEU A C     1 
ATOM   1211 O  O     . LEU A 1 153 ? 72.364 -10.379 11.744  1.00 14.39 ? 150  LEU A O     1 
ATOM   1212 C  CB    . LEU A 1 153 ? 74.045 -12.520 9.863   1.00 10.62 ? 150  LEU A CB    1 
ATOM   1213 C  CG    . LEU A 1 153 ? 74.079 -13.785 9.013   1.00 15.98 ? 150  LEU A CG    1 
ATOM   1214 C  CD1   . LEU A 1 153 ? 74.985 -13.568 7.793   1.00 9.45  ? 150  LEU A CD1   1 
ATOM   1215 C  CD2   . LEU A 1 153 ? 74.546 -14.974 9.870   1.00 18.92 ? 150  LEU A CD2   1 
ATOM   1216 N  N     . PRO A 1 154 ? 74.299 -11.060 12.680  1.00 15.74 ? 151  PRO A N     1 
ATOM   1217 C  CA    . PRO A 1 154 ? 75.367 -12.041 12.910  1.00 15.21 ? 151  PRO A CA    1 
ATOM   1218 C  C     . PRO A 1 154 ? 74.907 -13.220 13.765  1.00 16.90 ? 151  PRO A C     1 
ATOM   1219 O  O     . PRO A 1 154 ? 73.908 -13.134 14.484  1.00 17.21 ? 151  PRO A O     1 
ATOM   1220 C  CB    . PRO A 1 154 ? 76.421 -11.227 13.677  1.00 16.45 ? 151  PRO A CB    1 
ATOM   1221 C  CG    . PRO A 1 154 ? 75.614 -10.206 14.417  1.00 20.50 ? 151  PRO A CG    1 
ATOM   1222 C  CD    . PRO A 1 154 ? 74.499 -9.832  13.473  1.00 17.99 ? 151  PRO A CD    1 
ATOM   1223 N  N     . GLN A 1 155 ? 75.641 -14.323 13.674  1.00 20.08 ? 152  GLN A N     1 
ATOM   1224 C  CA    . GLN A 1 155 ? 75.358 -15.513 14.468  1.00 24.25 ? 152  GLN A CA    1 
ATOM   1225 C  C     . GLN A 1 155 ? 76.662 -16.234 14.791  1.00 35.92 ? 152  GLN A C     1 
ATOM   1226 O  O     . GLN A 1 155 ? 77.678 -16.021 14.126  1.00 33.50 ? 152  GLN A O     1 
ATOM   1227 C  CB    . GLN A 1 155 ? 74.441 -16.465 13.696  1.00 31.61 ? 152  GLN A CB    1 
ATOM   1228 C  CG    . GLN A 1 155 ? 74.771 -17.940 13.922  1.00 37.81 ? 152  GLN A CG    1 
ATOM   1229 C  CD    . GLN A 1 155 ? 74.887 -18.717 12.627  1.00 38.29 ? 152  GLN A CD    1 
ATOM   1230 O  OE1   . GLN A 1 155 ? 73.908 -18.868 11.898  1.00 40.87 ? 152  GLN A OE1   1 
ATOM   1231 N  NE2   . GLN A 1 155 ? 76.088 -19.207 12.329  1.00 28.67 ? 152  GLN A NE2   1 
ATOM   1232 N  N     . GLY A 1 156 ? 76.630 -17.089 15.808  1.00 38.11 ? 153  GLY A N     1 
ATOM   1233 C  CA    . GLY A 1 156 ? 77.748 -17.971 16.095  1.00 45.67 ? 153  GLY A CA    1 
ATOM   1234 C  C     . GLY A 1 156 ? 78.719 -17.426 17.121  1.00 48.29 ? 153  GLY A C     1 
ATOM   1235 O  O     . GLY A 1 156 ? 78.443 -16.411 17.765  1.00 43.51 ? 153  GLY A O     1 
ATOM   1236 N  N     . PRO A 1 157 ? 79.866 -18.110 17.283  1.00 52.91 ? 154  PRO A N     1 
ATOM   1237 C  CA    . PRO A 1 157 ? 80.927 -17.746 18.228  1.00 46.81 ? 154  PRO A CA    1 
ATOM   1238 C  C     . PRO A 1 157 ? 81.840 -16.654 17.675  1.00 45.10 ? 154  PRO A C     1 
ATOM   1239 O  O     . PRO A 1 157 ? 82.032 -16.586 16.459  1.00 50.56 ? 154  PRO A O     1 
ATOM   1240 C  CB    . PRO A 1 157 ? 81.709 -19.054 18.381  1.00 40.65 ? 154  PRO A CB    1 
ATOM   1241 C  CG    . PRO A 1 157 ? 81.560 -19.718 17.052  1.00 31.90 ? 154  PRO A CG    1 
ATOM   1242 C  CD    . PRO A 1 157 ? 80.167 -19.372 16.579  1.00 42.75 ? 154  PRO A CD    1 
ATOM   1243 N  N     . THR A 1 163 ? 79.978 -5.913  20.390  1.00 62.48 ? 160  THR A N     1 
ATOM   1244 C  CA    . THR A 1 163 ? 79.293 -4.632  20.249  1.00 61.87 ? 160  THR A CA    1 
ATOM   1245 C  C     . THR A 1 163 ? 77.858 -4.718  20.761  1.00 55.97 ? 160  THR A C     1 
ATOM   1246 O  O     . THR A 1 163 ? 77.220 -5.769  20.679  1.00 57.29 ? 160  THR A O     1 
ATOM   1247 C  CB    . THR A 1 163 ? 79.277 -4.148  18.782  1.00 60.32 ? 160  THR A CB    1 
ATOM   1248 O  OG1   . THR A 1 163 ? 78.658 -2.855  18.707  1.00 59.82 ? 160  THR A OG1   1 
ATOM   1249 C  CG2   . THR A 1 163 ? 78.506 -5.124  17.908  1.00 54.50 ? 160  THR A CG2   1 
ATOM   1250 N  N     . VAL A 1 164 ? 77.356 -3.607  21.287  1.00 48.70 ? 161  VAL A N     1 
ATOM   1251 C  CA    . VAL A 1 164 ? 76.016 -3.576  21.853  1.00 44.28 ? 161  VAL A CA    1 
ATOM   1252 C  C     . VAL A 1 164 ? 75.166 -2.480  21.205  1.00 50.71 ? 161  VAL A C     1 
ATOM   1253 O  O     . VAL A 1 164 ? 74.113 -2.108  21.727  1.00 51.21 ? 161  VAL A O     1 
ATOM   1254 C  CB    . VAL A 1 164 ? 76.066 -3.369  23.382  1.00 50.28 ? 161  VAL A CB    1 
ATOM   1255 C  CG1   . VAL A 1 164 ? 76.883 -4.478  24.041  1.00 39.84 ? 161  VAL A CG1   1 
ATOM   1256 C  CG2   . VAL A 1 164 ? 76.651 -2.001  23.719  1.00 44.42 ? 161  VAL A CG2   1 
ATOM   1257 N  N     . GLN A 1 165 ? 75.629 -1.976  20.062  1.00 39.73 ? 162  GLN A N     1 
ATOM   1258 C  CA    . GLN A 1 165 ? 74.949 -0.895  19.348  1.00 42.67 ? 162  GLN A CA    1 
ATOM   1259 C  C     . GLN A 1 165 ? 74.313 -1.407  18.058  1.00 38.18 ? 162  GLN A C     1 
ATOM   1260 O  O     . GLN A 1 165 ? 74.799 -2.361  17.450  1.00 34.35 ? 162  GLN A O     1 
ATOM   1261 C  CB    . GLN A 1 165 ? 75.932 0.227   19.023  1.00 46.52 ? 162  GLN A CB    1 
ATOM   1262 C  CG    . GLN A 1 165 ? 77.036 -0.198  18.066  1.00 49.01 ? 162  GLN A CG    1 
ATOM   1263 C  CD    . GLN A 1 165 ? 78.142 0.834   17.940  1.00 61.67 ? 162  GLN A CD    1 
ATOM   1264 O  OE1   . GLN A 1 165 ? 78.192 1.807   18.695  1.00 74.07 ? 162  GLN A OE1   1 
ATOM   1265 N  NE2   . GLN A 1 165 ? 79.039 0.625   16.981  1.00 57.80 ? 162  GLN A NE2   1 
ATOM   1266 N  N     . LYS A 1 166 ? 73.232 -0.760  17.640  1.00 30.83 ? 163  LYS A N     1 
ATOM   1267 C  CA    . LYS A 1 166 ? 72.451 -1.236  16.502  1.00 39.94 ? 163  LYS A CA    1 
ATOM   1268 C  C     . LYS A 1 166 ? 73.265 -1.289  15.211  1.00 24.15 ? 163  LYS A C     1 
ATOM   1269 O  O     . LYS A 1 166 ? 73.294 -2.313  14.523  1.00 25.02 ? 163  LYS A O     1 
ATOM   1270 C  CB    . LYS A 1 166 ? 71.215 -0.357  16.306  1.00 35.42 ? 163  LYS A CB    1 
ATOM   1271 C  CG    . LYS A 1 166 ? 70.277 -0.831  15.220  1.00 42.11 ? 163  LYS A CG    1 
ATOM   1272 C  CD    . LYS A 1 166 ? 69.090 0.112   15.091  1.00 53.77 ? 163  LYS A CD    1 
ATOM   1273 C  CE    . LYS A 1 166 ? 69.545 1.544   14.818  1.00 54.48 ? 163  LYS A CE    1 
ATOM   1274 N  NZ    . LYS A 1 166 ? 68.400 2.504   14.798  1.00 61.03 ? 163  LYS A NZ    1 
ATOM   1275 N  N     . GLU A 1 167 ? 73.906 -0.176  14.875  1.00 24.56 ? 164  GLU A N     1 
ATOM   1276 C  CA    . GLU A 1 167 ? 74.710 -0.093  13.660  1.00 26.62 ? 164  GLU A CA    1 
ATOM   1277 C  C     . GLU A 1 167 ? 75.893 -1.062  13.718  1.00 29.41 ? 164  GLU A C     1 
ATOM   1278 O  O     . GLU A 1 167 ? 76.350 -1.565  12.693  1.00 27.99 ? 164  GLU A O     1 
ATOM   1279 C  CB    . GLU A 1 167 ? 75.170 1.352   13.412  1.00 34.78 ? 164  GLU A CB    1 
ATOM   1280 C  CG    . GLU A 1 167 ? 76.150 1.550   12.247  1.00 24.02 ? 164  GLU A CG    1 
ATOM   1281 C  CD    . GLU A 1 167 ? 75.599 1.130   10.879  1.00 31.97 ? 164  GLU A CD    1 
ATOM   1282 O  OE1   . GLU A 1 167 ? 76.394 1.098   9.914   1.00 31.28 ? 164  GLU A OE1   1 
ATOM   1283 O  OE2   . GLU A 1 167 ? 74.387 0.842   10.757  1.00 26.95 ? 164  GLU A OE2   1 
ATOM   1284 N  N     . GLY A 1 168 ? 76.377 -1.337  14.922  1.00 30.75 ? 165  GLY A N     1 
ATOM   1285 C  CA    . GLY A 1 168 ? 77.468 -2.278  15.088  1.00 33.10 ? 165  GLY A CA    1 
ATOM   1286 C  C     . GLY A 1 168 ? 77.053 -3.690  14.724  1.00 28.18 ? 165  GLY A C     1 
ATOM   1287 O  O     . GLY A 1 168 ? 77.779 -4.409  14.033  1.00 25.70 ? 165  GLY A O     1 
ATOM   1288 N  N     . MET A 1 169 ? 75.880 -4.093  15.200  1.00 26.18 ? 166  MET A N     1 
ATOM   1289 C  CA    . MET A 1 169 ? 75.339 -5.404  14.875  1.00 22.23 ? 166  MET A CA    1 
ATOM   1290 C  C     . MET A 1 169 ? 75.116 -5.514  13.369  1.00 23.00 ? 166  MET A C     1 
ATOM   1291 O  O     . MET A 1 169 ? 75.477 -6.520  12.753  1.00 21.25 ? 166  MET A O     1 
ATOM   1292 C  CB    . MET A 1 169 ? 74.028 -5.653  15.626  1.00 25.57 ? 166  MET A CB    1 
ATOM   1293 C  CG    . MET A 1 169 ? 74.191 -5.879  17.132  1.00 46.45 ? 166  MET A CG    1 
ATOM   1294 S  SD    . MET A 1 169 ? 74.777 -7.537  17.564  1.00 52.66 ? 166  MET A SD    1 
ATOM   1295 C  CE    . MET A 1 169 ? 73.447 -8.555  16.915  1.00 37.01 ? 166  MET A CE    1 
ATOM   1296 N  N     . ARG A 1 170 ? 74.538 -4.477  12.765  1.00 19.50 ? 167  ARG A N     1 
ATOM   1297 C  CA    . ARG A 1 170 ? 74.277 -4.526  11.325  1.00 18.65 ? 167  ARG A CA    1 
ATOM   1298 C  C     . ARG A 1 170 ? 75.554 -4.849  10.565  1.00 17.03 ? 167  ARG A C     1 
ATOM   1299 O  O     . ARG A 1 170 ? 75.567 -5.703  9.678   1.00 15.08 ? 167  ARG A O     1 
ATOM   1300 C  CB    . ARG A 1 170 ? 73.694 -3.206  10.804  1.00 15.36 ? 167  ARG A CB    1 
ATOM   1301 C  CG    . ARG A 1 170 ? 73.309 -3.268  9.321   1.00 15.36 ? 167  ARG A CG    1 
ATOM   1302 C  CD    . ARG A 1 170 ? 73.099 -1.886  8.701   1.00 17.41 ? 167  ARG A CD    1 
ATOM   1303 N  NE    . ARG A 1 170 ? 74.374 -1.180  8.533   1.00 19.48 ? 167  ARG A NE    1 
ATOM   1304 C  CZ    . ARG A 1 170 ? 75.203 -1.342  7.505   1.00 18.90 ? 167  ARG A CZ    1 
ATOM   1305 N  NH1   . ARG A 1 170 ? 74.918 -2.187  6.518   1.00 18.51 ? 167  ARG A NH1   1 
ATOM   1306 N  NH2   . ARG A 1 170 ? 76.329 -0.644  7.459   1.00 26.30 ? 167  ARG A NH2   1 
ATOM   1307 N  N     . LYS A 1 171 ? 76.629 -4.144  10.902  1.00 16.41 ? 168  LYS A N     1 
ATOM   1308 C  CA    . LYS A 1 171 ? 77.900 -4.333  10.209  1.00 15.62 ? 168  LYS A CA    1 
ATOM   1309 C  C     . LYS A 1 171 ? 78.515 -5.714  10.453  1.00 17.82 ? 168  LYS A C     1 
ATOM   1310 O  O     . LYS A 1 171 ? 79.104 -6.299  9.542   1.00 18.57 ? 168  LYS A O     1 
ATOM   1311 C  CB    . LYS A 1 171 ? 78.909 -3.251  10.595  1.00 25.78 ? 168  LYS A CB    1 
ATOM   1312 C  CG    . LYS A 1 171 ? 78.774 -1.945  9.832   1.00 25.98 ? 168  LYS A CG    1 
ATOM   1313 C  CD    . LYS A 1 171 ? 80.053 -1.121  10.032  1.00 37.16 ? 168  LYS A CD    1 
ATOM   1314 C  CE    . LYS A 1 171 ? 80.046 0.170   9.234   1.00 44.09 ? 168  LYS A CE    1 
ATOM   1315 N  NZ    . LYS A 1 171 ? 79.259 1.236   9.916   1.00 49.48 ? 168  LYS A NZ    1 
ATOM   1316 N  N     . GLN A 1 172 ? 78.386 -6.233  11.673  1.00 20.33 ? 169  GLN A N     1 
ATOM   1317 C  CA    . GLN A 1 172 ? 78.928 -7.560  11.971  1.00 21.26 ? 169  GLN A CA    1 
ATOM   1318 C  C     . GLN A 1 172 ? 78.219 -8.593  11.110  1.00 19.02 ? 169  GLN A C     1 
ATOM   1319 O  O     . GLN A 1 172 ? 78.847 -9.487  10.549  1.00 15.69 ? 169  GLN A O     1 
ATOM   1320 C  CB    . GLN A 1 172 ? 78.764 -7.927  13.445  1.00 21.12 ? 169  GLN A CB    1 
ATOM   1321 C  CG    . GLN A 1 172 ? 79.717 -7.217  14.387  1.00 42.65 ? 169  GLN A CG    1 
ATOM   1322 C  CD    . GLN A 1 172 ? 79.958 -8.004  15.665  1.00 62.16 ? 169  GLN A CD    1 
ATOM   1323 O  OE1   . GLN A 1 172 ? 79.736 -9.218  15.714  1.00 62.38 ? 169  GLN A OE1   1 
ATOM   1324 N  NE2   . GLN A 1 172 ? 80.418 -7.316  16.708  1.00 57.61 ? 169  GLN A NE2   1 
ATOM   1325 N  N     . GLY A 1 173 ? 76.900 -8.462  11.010  1.00 20.50 ? 170  GLY A N     1 
ATOM   1326 C  CA    . GLY A 1 173 ? 76.116 -9.385  10.212  1.00 15.01 ? 170  GLY A CA    1 
ATOM   1327 C  C     . GLY A 1 173 ? 76.508 -9.309  8.754   1.00 11.71 ? 170  GLY A C     1 
ATOM   1328 O  O     . GLY A 1 173 ? 76.712 -10.328 8.088   1.00 12.67 ? 170  GLY A O     1 
ATOM   1329 N  N     . LEU A 1 174 ? 76.605 -8.086  8.244   1.00 13.48 ? 171  LEU A N     1 
ATOM   1330 C  CA    . LEU A 1 174 ? 77.003 -7.878  6.859   1.00 14.77 ? 171  LEU A CA    1 
ATOM   1331 C  C     . LEU A 1 174 ? 78.396 -8.465  6.583   1.00 17.62 ? 171  LEU A C     1 
ATOM   1332 O  O     . LEU A 1 174 ? 78.630 -9.087  5.544   1.00 15.03 ? 171  LEU A O     1 
ATOM   1333 C  CB    . LEU A 1 174 ? 76.973 -6.385  6.528   1.00 11.96 ? 171  LEU A CB    1 
ATOM   1334 C  CG    . LEU A 1 174 ? 77.317 -6.009  5.092   1.00 12.82 ? 171  LEU A CG    1 
ATOM   1335 C  CD1   . LEU A 1 174 ? 76.377 -6.729  4.111   1.00 14.39 ? 171  LEU A CD1   1 
ATOM   1336 C  CD2   . LEU A 1 174 ? 77.249 -4.481  4.911   1.00 16.48 ? 171  LEU A CD2   1 
ATOM   1337 N  N     . PHE A 1 175 ? 79.322 -8.274  7.515   1.00 16.89 ? 172  PHE A N     1 
ATOM   1338 C  CA    . PHE A 1 175 ? 80.671 -8.815  7.332   1.00 20.48 ? 172  PHE A CA    1 
ATOM   1339 C  C     . PHE A 1 175 ? 80.672 -10.346 7.253   1.00 16.92 ? 172  PHE A C     1 
ATOM   1340 O  O     . PHE A 1 175 ? 81.352 -10.922 6.406   1.00 21.05 ? 172  PHE A O     1 
ATOM   1341 C  CB    . PHE A 1 175 ? 81.618 -8.339  8.433   1.00 18.44 ? 172  PHE A CB    1 
ATOM   1342 C  CG    . PHE A 1 175 ? 82.032 -6.901  8.301   1.00 35.19 ? 172  PHE A CG    1 
ATOM   1343 C  CD1   . PHE A 1 175 ? 82.107 -6.295  7.057   1.00 40.98 ? 172  PHE A CD1   1 
ATOM   1344 C  CD2   . PHE A 1 175 ? 82.341 -6.152  9.427   1.00 39.48 ? 172  PHE A CD2   1 
ATOM   1345 C  CE1   . PHE A 1 175 ? 82.486 -4.969  6.936   1.00 47.34 ? 172  PHE A CE1   1 
ATOM   1346 C  CE2   . PHE A 1 175 ? 82.724 -4.825  9.314   1.00 47.43 ? 172  PHE A CE2   1 
ATOM   1347 C  CZ    . PHE A 1 175 ? 82.795 -4.233  8.068   1.00 43.74 ? 172  PHE A CZ    1 
ATOM   1348 N  N     . GLN A 1 176 ? 79.920 -11.001 8.135   1.00 19.59 ? 173  GLN A N     1 
ATOM   1349 C  CA    . GLN A 1 176 ? 79.839 -12.461 8.132   1.00 21.61 ? 173  GLN A CA    1 
ATOM   1350 C  C     . GLN A 1 176 ? 79.290 -12.953 6.809   1.00 19.09 ? 173  GLN A C     1 
ATOM   1351 O  O     . GLN A 1 176 ? 79.775 -13.932 6.240   1.00 18.95 ? 173  GLN A O     1 
ATOM   1352 C  CB    . GLN A 1 176 ? 78.965 -12.967 9.282   1.00 18.32 ? 173  GLN A CB    1 
ATOM   1353 C  CG    . GLN A 1 176 ? 79.536 -12.668 10.660  1.00 21.54 ? 173  GLN A CG    1 
ATOM   1354 C  CD    . GLN A 1 176 ? 78.767 -13.348 11.760  1.00 20.65 ? 173  GLN A CD    1 
ATOM   1355 O  OE1   . GLN A 1 176 ? 77.706 -13.912 11.528  1.00 21.79 ? 173  GLN A OE1   1 
ATOM   1356 N  NE2   . GLN A 1 176 ? 79.300 -13.298 12.976  1.00 30.81 ? 173  GLN A NE2   1 
ATOM   1357 N  N     . TRP A 1 177 ? 78.278 -12.247 6.311   1.00 15.54 ? 174  TRP A N     1 
ATOM   1358 C  CA    . TRP A 1 177 ? 77.653 -12.582 5.037   1.00 15.09 ? 174  TRP A CA    1 
ATOM   1359 C  C     . TRP A 1 177 ? 78.640 -12.429 3.882   1.00 16.92 ? 174  TRP A C     1 
ATOM   1360 O  O     . TRP A 1 177 ? 78.796 -13.332 3.049   1.00 17.61 ? 174  TRP A O     1 
ATOM   1361 C  CB    . TRP A 1 177 ? 76.427 -11.686 4.816   1.00 12.26 ? 174  TRP A CB    1 
ATOM   1362 C  CG    . TRP A 1 177 ? 75.738 -11.868 3.483   1.00 17.31 ? 174  TRP A CG    1 
ATOM   1363 C  CD1   . TRP A 1 177 ? 75.808 -11.031 2.404   1.00 16.01 ? 174  TRP A CD1   1 
ATOM   1364 C  CD2   . TRP A 1 177 ? 74.852 -12.932 3.102   1.00 14.06 ? 174  TRP A CD2   1 
ATOM   1365 N  NE1   . TRP A 1 177 ? 75.038 -11.509 1.380   1.00 13.09 ? 174  TRP A NE1   1 
ATOM   1366 C  CE2   . TRP A 1 177 ? 74.439 -12.678 1.778   1.00 17.64 ? 174  TRP A CE2   1 
ATOM   1367 C  CE3   . TRP A 1 177 ? 74.378 -14.083 3.750   1.00 14.80 ? 174  TRP A CE3   1 
ATOM   1368 C  CZ2   . TRP A 1 177 ? 73.572 -13.524 1.084   1.00 15.75 ? 174  TRP A CZ2   1 
ATOM   1369 C  CZ3   . TRP A 1 177 ? 73.521 -14.920 3.068   1.00 12.86 ? 174  TRP A CZ3   1 
ATOM   1370 C  CH2   . TRP A 1 177 ? 73.125 -14.638 1.741   1.00 17.31 ? 174  TRP A CH2   1 
ATOM   1371 N  N     . LEU A 1 178 ? 79.319 -11.289 3.828   1.00 15.17 ? 175  LEU A N     1 
ATOM   1372 C  CA    . LEU A 1 178 ? 80.224 -11.034 2.708   1.00 18.19 ? 175  LEU A CA    1 
ATOM   1373 C  C     . LEU A 1 178 ? 81.474 -11.905 2.810   1.00 24.63 ? 175  LEU A C     1 
ATOM   1374 O  O     . LEU A 1 178 ? 82.118 -12.203 1.804   1.00 24.88 ? 175  LEU A O     1 
ATOM   1375 C  CB    . LEU A 1 178 ? 80.618 -9.559  2.641   1.00 18.25 ? 175  LEU A CB    1 
ATOM   1376 C  CG    . LEU A 1 178 ? 79.459 -8.588  2.389   1.00 15.07 ? 175  LEU A CG    1 
ATOM   1377 C  CD1   . LEU A 1 178 ? 79.936 -7.164  2.548   1.00 23.62 ? 175  LEU A CD1   1 
ATOM   1378 C  CD2   . LEU A 1 178 ? 78.878 -8.809  1.003   1.00 16.54 ? 175  LEU A CD2   1 
ATOM   1379 N  N     . ASP A 1 179 ? 81.812 -12.303 4.030   1.00 21.83 ? 176  ASP A N     1 
ATOM   1380 C  CA    . ASP A 1 179 ? 82.970 -13.171 4.241   1.00 32.30 ? 176  ASP A CA    1 
ATOM   1381 C  C     . ASP A 1 179 ? 82.708 -14.542 3.657   1.00 29.54 ? 176  ASP A C     1 
ATOM   1382 O  O     . ASP A 1 179 ? 83.626 -15.204 3.166   1.00 33.99 ? 176  ASP A O     1 
ATOM   1383 C  CB    . ASP A 1 179 ? 83.302 -13.303 5.728   1.00 24.79 ? 176  ASP A CB    1 
ATOM   1384 C  CG    . ASP A 1 179 ? 84.083 -12.125 6.252   1.00 38.76 ? 176  ASP A CG    1 
ATOM   1385 O  OD1   . ASP A 1 179 ? 84.826 -11.509 5.457   1.00 51.94 ? 176  ASP A OD1   1 
ATOM   1386 O  OD2   . ASP A 1 179 ? 83.956 -11.813 7.458   1.00 44.06 ? 176  ASP A OD2   1 
ATOM   1387 N  N     . SER A 1 180 ? 81.444 -14.953 3.702   1.00 21.62 ? 177  SER A N     1 
ATOM   1388 C  CA    . SER A 1 180 ? 81.042 -16.289 3.278   1.00 29.67 ? 177  SER A CA    1 
ATOM   1389 C  C     . SER A 1 180 ? 80.639 -16.413 1.806   1.00 34.32 ? 177  SER A C     1 
ATOM   1390 O  O     . SER A 1 180 ? 80.349 -17.518 1.336   1.00 38.96 ? 177  SER A O     1 
ATOM   1391 C  CB    . SER A 1 180 ? 79.882 -16.777 4.150   1.00 25.13 ? 177  SER A CB    1 
ATOM   1392 O  OG    . SER A 1 180 ? 80.251 -16.812 5.515   1.00 38.72 ? 177  SER A OG    1 
ATOM   1393 N  N     . LEU A 1 181 ? 80.590 -15.295 1.086   1.00 22.47 ? 178  LEU A N     1 
ATOM   1394 C  CA    . LEU A 1 181 ? 80.096 -15.308 -0.297  1.00 20.77 ? 178  LEU A CA    1 
ATOM   1395 C  C     . LEU A 1 181 ? 81.032 -15.989 -1.297  1.00 36.35 ? 178  LEU A C     1 
ATOM   1396 O  O     . LEU A 1 181 ? 82.245 -15.845 -1.213  1.00 38.09 ? 178  LEU A O     1 
ATOM   1397 C  CB    . LEU A 1 181 ? 79.815 -13.884 -0.783  1.00 30.07 ? 178  LEU A CB    1 
ATOM   1398 C  CG    . LEU A 1 181 ? 78.464 -13.239 -0.492  1.00 28.78 ? 178  LEU A CG    1 
ATOM   1399 C  CD1   . LEU A 1 181 ? 78.358 -11.926 -1.273  1.00 19.18 ? 178  LEU A CD1   1 
ATOM   1400 C  CD2   . LEU A 1 181 ? 77.324 -14.178 -0.870  1.00 23.84 ? 178  LEU A CD2   1 
ATOM   1401 N  N     . GLN A 1 182 ? 80.465 -16.718 -2.257  1.00 38.97 ? 179  GLN A N     1 
ATOM   1402 C  CA    . GLN A 1 182 ? 81.264 -17.265 -3.354  1.00 47.24 ? 179  GLN A CA    1 
ATOM   1403 C  C     . GLN A 1 182 ? 81.083 -16.465 -4.644  1.00 50.36 ? 179  GLN A C     1 
ATOM   1404 O  O     . GLN A 1 182 ? 80.238 -16.799 -5.478  1.00 52.74 ? 179  GLN A O     1 
ATOM   1405 C  CB    . GLN A 1 182 ? 80.940 -18.741 -3.599  1.00 50.73 ? 179  GLN A CB    1 
ATOM   1406 C  CG    . GLN A 1 182 ? 81.770 -19.374 -4.718  1.00 57.97 ? 179  GLN A CG    1 
ATOM   1407 C  CD    . GLN A 1 182 ? 83.271 -19.194 -4.521  1.00 66.07 ? 179  GLN A CD    1 
ATOM   1408 O  OE1   . GLN A 1 182 ? 83.925 -18.469 -5.274  1.00 62.77 ? 179  GLN A OE1   1 
ATOM   1409 N  NE2   . GLN A 1 182 ? 83.824 -19.859 -3.508  1.00 62.74 ? 179  GLN A NE2   1 
ATOM   1410 N  N     . ILE A 1 183 ? 81.895 -15.423 -4.808  1.00 43.89 ? 180  ILE A N     1 
ATOM   1411 C  CA    . ILE A 1 183 ? 81.759 -14.500 -5.938  1.00 53.91 ? 180  ILE A CA    1 
ATOM   1412 C  C     . ILE A 1 183 ? 82.218 -15.074 -7.286  1.00 52.42 ? 180  ILE A C     1 
ATOM   1413 O  O     . ILE A 1 183 ? 82.047 -14.442 -8.331  1.00 52.06 ? 180  ILE A O     1 
ATOM   1414 C  CB    . ILE A 1 183 ? 82.476 -13.156 -5.663  1.00 49.32 ? 180  ILE A CB    1 
ATOM   1415 C  CG1   . ILE A 1 183 ? 83.888 -13.389 -5.118  1.00 51.92 ? 180  ILE A CG1   1 
ATOM   1416 C  CG2   . ILE A 1 183 ? 81.683 -12.338 -4.665  1.00 46.31 ? 180  ILE A CG2   1 
ATOM   1417 C  CD1   . ILE A 1 183 ? 84.839 -14.038 -6.095  1.00 53.29 ? 180  ILE A CD1   1 
ATOM   1418 N  N     . ASP A 1 184 ? 82.796 -16.271 -7.252  1.00 57.49 ? 181  ASP A N     1 
ATOM   1419 C  CA    . ASP A 1 184 ? 83.303 -16.925 -8.454  1.00 60.52 ? 181  ASP A CA    1 
ATOM   1420 C  C     . ASP A 1 184 ? 82.175 -17.595 -9.234  1.00 56.81 ? 181  ASP A C     1 
ATOM   1421 O  O     . ASP A 1 184 ? 82.330 -17.930 -10.408 1.00 60.46 ? 181  ASP A O     1 
ATOM   1422 C  CB    . ASP A 1 184 ? 84.366 -17.962 -8.075  1.00 68.80 ? 181  ASP A CB    1 
ATOM   1423 C  CG    . ASP A 1 184 ? 84.977 -18.646 -9.283  1.00 86.09 ? 181  ASP A CG    1 
ATOM   1424 O  OD1   . ASP A 1 184 ? 85.186 -17.969 -10.314 1.00 86.24 ? 181  ASP A OD1   1 
ATOM   1425 O  OD2   . ASP A 1 184 ? 85.253 -19.864 -9.199  1.00 88.57 ? 181  ASP A OD2   1 
ATOM   1426 N  N     . ASN A 1 185 ? 81.039 -17.790 -8.572  1.00 52.44 ? 182  ASN A N     1 
ATOM   1427 C  CA    . ASN A 1 185 ? 79.901 -18.457 -9.191  1.00 47.78 ? 182  ASN A CA    1 
ATOM   1428 C  C     . ASN A 1 185 ? 78.771 -17.486 -9.520  1.00 46.88 ? 182  ASN A C     1 
ATOM   1429 O  O     . ASN A 1 185 ? 78.023 -17.068 -8.637  1.00 34.28 ? 182  ASN A O     1 
ATOM   1430 C  CB    . ASN A 1 185 ? 79.391 -19.587 -8.292  1.00 45.16 ? 182  ASN A CB    1 
ATOM   1431 C  CG    . ASN A 1 185 ? 78.188 -20.295 -8.874  1.00 44.48 ? 182  ASN A CG    1 
ATOM   1432 O  OD1   . ASN A 1 185 ? 77.908 -20.190 -10.070 1.00 47.98 ? 182  ASN A OD1   1 
ATOM   1433 N  ND2   . ASN A 1 185 ? 77.463 -21.023 -8.029  1.00 50.09 ? 182  ASN A ND2   1 
ATOM   1434 N  N     . LEU A 1 186 ? 78.651 -17.133 -10.797 1.00 46.50 ? 183  LEU A N     1 
ATOM   1435 C  CA    . LEU A 1 186 ? 77.627 -16.190 -11.241 1.00 44.06 ? 183  LEU A CA    1 
ATOM   1436 C  C     . LEU A 1 186 ? 76.212 -16.680 -10.934 1.00 42.98 ? 183  LEU A C     1 
ATOM   1437 O  O     . LEU A 1 186 ? 75.256 -15.903 -10.973 1.00 42.25 ? 183  LEU A O     1 
ATOM   1438 C  CB    . LEU A 1 186 ? 77.762 -15.906 -12.741 1.00 47.34 ? 183  LEU A CB    1 
ATOM   1439 C  CG    . LEU A 1 186 ? 78.761 -14.831 -13.185 1.00 57.31 ? 183  LEU A CG    1 
ATOM   1440 C  CD1   . LEU A 1 186 ? 80.184 -15.191 -12.773 1.00 66.22 ? 183  LEU A CD1   1 
ATOM   1441 C  CD2   . LEU A 1 186 ? 78.674 -14.610 -14.690 1.00 48.71 ? 183  LEU A CD2   1 
ATOM   1442 N  N     . THR A 1 187 ? 76.081 -17.967 -10.629 1.00 41.41 ? 184  THR A N     1 
ATOM   1443 C  CA    . THR A 1 187 ? 74.765 -18.556 -10.410 1.00 41.92 ? 184  THR A CA    1 
ATOM   1444 C  C     . THR A 1 187 ? 74.451 -18.865 -8.942  1.00 34.11 ? 184  THR A C     1 
ATOM   1445 O  O     . THR A 1 187 ? 73.439 -19.500 -8.649  1.00 36.23 ? 184  THR A O     1 
ATOM   1446 C  CB    . THR A 1 187 ? 74.570 -19.835 -11.258 1.00 43.02 ? 184  THR A CB    1 
ATOM   1447 O  OG1   . THR A 1 187 ? 75.517 -20.833 -10.854 1.00 47.64 ? 184  THR A OG1   1 
ATOM   1448 C  CG2   . THR A 1 187 ? 74.763 -19.527 -12.737 1.00 51.81 ? 184  THR A CG2   1 
ATOM   1449 N  N     . SER A 1 188 ? 75.311 -18.436 -8.021  1.00 31.60 ? 185  SER A N     1 
ATOM   1450 C  CA    . SER A 1 188 ? 74.983 -18.572 -6.602  1.00 22.88 ? 185  SER A CA    1 
ATOM   1451 C  C     . SER A 1 188 ? 73.795 -17.679 -6.283  1.00 16.87 ? 185  SER A C     1 
ATOM   1452 O  O     . SER A 1 188 ? 73.860 -16.467 -6.471  1.00 17.09 ? 185  SER A O     1 
ATOM   1453 C  CB    . SER A 1 188 ? 76.160 -18.196 -5.709  1.00 28.47 ? 185  SER A CB    1 
ATOM   1454 O  OG    . SER A 1 188 ? 75.753 -18.118 -4.346  1.00 25.49 ? 185  SER A OG    1 
ATOM   1455 N  N     . PRO A 1 189 ? 72.694 -18.274 -5.822  1.00 17.11 ? 186  PRO A N     1 
ATOM   1456 C  CA    . PRO A 1 189 ? 71.535 -17.441 -5.463  1.00 15.02 ? 186  PRO A CA    1 
ATOM   1457 C  C     . PRO A 1 189 ? 71.874 -16.398 -4.395  1.00 14.35 ? 186  PRO A C     1 
ATOM   1458 O  O     . PRO A 1 189 ? 71.336 -15.285 -4.453  1.00 10.40 ? 186  PRO A O     1 
ATOM   1459 C  CB    . PRO A 1 189 ? 70.522 -18.465 -4.932  1.00 14.39 ? 186  PRO A CB    1 
ATOM   1460 C  CG    . PRO A 1 189 ? 70.895 -19.748 -5.661  1.00 16.82 ? 186  PRO A CG    1 
ATOM   1461 C  CD    . PRO A 1 189 ? 72.399 -19.715 -5.740  1.00 16.41 ? 186  PRO A CD    1 
ATOM   1462 N  N     . ASP A 1 190 ? 72.739 -16.732 -3.436  1.00 11.84 ? 187  ASP A N     1 
ATOM   1463 C  CA    . ASP A 1 190 ? 73.087 -15.763 -2.398  1.00 13.50 ? 187  ASP A CA    1 
ATOM   1464 C  C     . ASP A 1 190 ? 73.844 -14.581 -2.985  1.00 12.51 ? 187  ASP A C     1 
ATOM   1465 O  O     . ASP A 1 190 ? 73.664 -13.437 -2.549  1.00 12.13 ? 187  ASP A O     1 
ATOM   1466 C  CB    . ASP A 1 190 ? 73.931 -16.390 -1.281  1.00 12.85 ? 187  ASP A CB    1 
ATOM   1467 C  CG    . ASP A 1 190 ? 73.153 -17.387 -0.445  1.00 25.23 ? 187  ASP A CG    1 
ATOM   1468 O  OD1   . ASP A 1 190 ? 71.910 -17.308 -0.405  1.00 16.22 ? 187  ASP A OD1   1 
ATOM   1469 O  OD2   . ASP A 1 190 ? 73.792 -18.251 0.179   1.00 26.39 ? 187  ASP A OD2   1 
ATOM   1470 N  N     . LEU A 1 191 ? 74.715 -14.858 -3.949  1.00 11.59 ? 188  LEU A N     1 
ATOM   1471 C  CA    . LEU A 1 191 ? 75.445 -13.789 -4.608  1.00 16.53 ? 188  LEU A CA    1 
ATOM   1472 C  C     . LEU A 1 191 ? 74.456 -12.910 -5.369  1.00 10.10 ? 188  LEU A C     1 
ATOM   1473 O  O     . LEU A 1 191 ? 74.560 -11.689 -5.349  1.00 11.99 ? 188  LEU A O     1 
ATOM   1474 C  CB    . LEU A 1 191 ? 76.508 -14.352 -5.566  1.00 13.47 ? 188  LEU A CB    1 
ATOM   1475 C  CG    . LEU A 1 191 ? 77.295 -13.334 -6.407  1.00 19.13 ? 188  LEU A CG    1 
ATOM   1476 C  CD1   . LEU A 1 191 ? 77.992 -12.294 -5.541  1.00 18.69 ? 188  LEU A CD1   1 
ATOM   1477 C  CD2   . LEU A 1 191 ? 78.315 -14.051 -7.311  1.00 19.83 ? 188  LEU A CD2   1 
ATOM   1478 N  N     . GLN A 1 192 ? 73.499 -13.544 -6.034  1.00 10.14 ? 189  GLN A N     1 
ATOM   1479 C  CA    . GLN A 1 192 ? 72.515 -12.817 -6.823  1.00 13.20 ? 189  GLN A CA    1 
ATOM   1480 C  C     . GLN A 1 192 ? 71.694 -11.874 -5.952  1.00 12.70 ? 189  GLN A C     1 
ATOM   1481 O  O     . GLN A 1 192 ? 71.476 -10.716 -6.317  1.00 10.30 ? 189  GLN A O     1 
ATOM   1482 C  CB    . GLN A 1 192 ? 71.630 -13.791 -7.591  1.00 13.67 ? 189  GLN A CB    1 
ATOM   1483 C  CG    . GLN A 1 192 ? 72.398 -14.524 -8.699  1.00 18.35 ? 189  GLN A CG    1 
ATOM   1484 C  CD    . GLN A 1 192 ? 71.621 -15.668 -9.299  1.00 31.54 ? 189  GLN A CD    1 
ATOM   1485 O  OE1   . GLN A 1 192 ? 70.688 -16.189 -8.688  1.00 28.18 ? 189  GLN A OE1   1 
ATOM   1486 N  NE2   . GLN A 1 192 ? 72.006 -16.076 -10.504 1.00 43.19 ? 189  GLN A NE2   1 
ATOM   1487 N  N     . LEU A 1 193 ? 71.245 -12.370 -4.797  1.00 10.14 ? 190  LEU A N     1 
ATOM   1488 C  CA    . LEU A 1 193 ? 70.570 -11.520 -3.807  1.00 9.58  ? 190  LEU A CA    1 
ATOM   1489 C  C     . LEU A 1 193 ? 71.438 -10.330 -3.365  1.00 11.03 ? 190  LEU A C     1 
ATOM   1490 O  O     . LEU A 1 193 ? 70.950 -9.211  -3.198  1.00 10.84 ? 190  LEU A O     1 
ATOM   1491 C  CB    . LEU A 1 193 ? 70.154 -12.334 -2.571  1.00 8.62  ? 190  LEU A CB    1 
ATOM   1492 C  CG    . LEU A 1 193 ? 69.032 -13.362 -2.718  1.00 10.84 ? 190  LEU A CG    1 
ATOM   1493 C  CD1   . LEU A 1 193 ? 68.691 -13.950 -1.325  1.00 12.11 ? 190  LEU A CD1   1 
ATOM   1494 C  CD2   . LEU A 1 193 ? 67.808 -12.744 -3.342  1.00 9.87  ? 190  LEU A CD2   1 
ATOM   1495 N  N     . THR A 1 194 ? 72.725 -10.578 -3.161  1.00 8.51  ? 191  THR A N     1 
ATOM   1496 C  CA    . THR A 1 194 ? 73.625 -9.542  -2.683  1.00 10.00 ? 191  THR A CA    1 
ATOM   1497 C  C     . THR A 1 194 ? 73.781 -8.429  -3.705  1.00 11.60 ? 191  THR A C     1 
ATOM   1498 O  O     . THR A 1 194 ? 73.745 -7.246  -3.354  1.00 11.98 ? 191  THR A O     1 
ATOM   1499 C  CB    . THR A 1 194 ? 75.003 -10.113 -2.370  1.00 9.83  ? 191  THR A CB    1 
ATOM   1500 O  OG1   . THR A 1 194 ? 74.855 -11.164 -1.411  1.00 13.82 ? 191  THR A OG1   1 
ATOM   1501 C  CG2   . THR A 1 194 ? 75.903 -9.014  -1.815  1.00 12.63 ? 191  THR A CG2   1 
ATOM   1502 N  N     . VAL A 1 195 ? 73.953 -8.814  -4.963  1.00 13.66 ? 192  VAL A N     1 
ATOM   1503 C  CA    . VAL A 1 195 ? 74.016 -7.833  -6.036  1.00 12.70 ? 192  VAL A CA    1 
ATOM   1504 C  C     . VAL A 1 195 ? 72.672 -7.133  -6.146  1.00 10.50 ? 192  VAL A C     1 
ATOM   1505 O  O     . VAL A 1 195 ? 72.624 -5.927  -6.369  1.00 12.72 ? 192  VAL A O     1 
ATOM   1506 C  CB    . VAL A 1 195 ? 74.422 -8.464  -7.369  1.00 9.27  ? 192  VAL A CB    1 
ATOM   1507 C  CG1   . VAL A 1 195 ? 74.261 -7.445  -8.512  1.00 15.20 ? 192  VAL A CG1   1 
ATOM   1508 C  CG2   . VAL A 1 195 ? 75.871 -8.956  -7.277  1.00 13.49 ? 192  VAL A CG2   1 
ATOM   1509 N  N     . GLY A 1 196 ? 71.584 -7.882  -5.976  1.00 9.32  ? 193  GLY A N     1 
ATOM   1510 C  CA    . GLY A 1 196 ? 70.257 -7.274  -5.895  1.00 10.68 ? 193  GLY A CA    1 
ATOM   1511 C  C     . GLY A 1 196 ? 70.197 -6.172  -4.844  1.00 14.43 ? 193  GLY A C     1 
ATOM   1512 O  O     . GLY A 1 196 ? 69.664 -5.080  -5.085  1.00 13.85 ? 193  GLY A O     1 
ATOM   1513 N  N     . ALA A 1 197 ? 70.734 -6.450  -3.660  1.00 9.30  ? 194  ALA A N     1 
ATOM   1514 C  CA    . ALA A 1 197 ? 70.784 -5.448  -2.604  1.00 6.81  ? 194  ALA A CA    1 
ATOM   1515 C  C     . ALA A 1 197 ? 71.618 -4.216  -2.980  1.00 13.02 ? 194  ALA A C     1 
ATOM   1516 O  O     . ALA A 1 197 ? 71.285 -3.092  -2.587  1.00 9.63  ? 194  ALA A O     1 
ATOM   1517 C  CB    . ALA A 1 197 ? 71.301 -6.065  -1.288  1.00 10.85 ? 194  ALA A CB    1 
ATOM   1518 N  N     . VAL A 1 198 ? 72.706 -4.423  -3.715  1.00 10.12 ? 195  VAL A N     1 
ATOM   1519 C  CA    . VAL A 1 198 ? 73.540 -3.304  -4.151  1.00 12.78 ? 195  VAL A CA    1 
ATOM   1520 C  C     . VAL A 1 198 ? 72.725 -2.371  -5.040  1.00 12.06 ? 195  VAL A C     1 
ATOM   1521 O  O     . VAL A 1 198 ? 72.755 -1.144  -4.875  1.00 13.39 ? 195  VAL A O     1 
ATOM   1522 C  CB    . VAL A 1 198 ? 74.807 -3.790  -4.881  1.00 13.19 ? 195  VAL A CB    1 
ATOM   1523 C  CG1   . VAL A 1 198 ? 75.531 -2.625  -5.543  1.00 17.48 ? 195  VAL A CG1   1 
ATOM   1524 C  CG2   . VAL A 1 198 ? 75.726 -4.513  -3.884  1.00 15.69 ? 195  VAL A CG2   1 
ATOM   1525 N  N     . ILE A 1 199 ? 71.947 -2.965  -5.935  1.00 10.09 ? 196  ILE A N     1 
ATOM   1526 C  CA    . ILE A 1 199 ? 71.108 -2.188  -6.838  1.00 13.76 ? 196  ILE A CA    1 
ATOM   1527 C  C     . ILE A 1 199 ? 69.996 -1.444  -6.096  1.00 13.29 ? 196  ILE A C     1 
ATOM   1528 O  O     . ILE A 1 199 ? 69.698 -0.302  -6.422  1.00 10.02 ? 196  ILE A O     1 
ATOM   1529 C  CB    . ILE A 1 199 ? 70.531 -3.057  -7.961  1.00 12.11 ? 196  ILE A CB    1 
ATOM   1530 C  CG1   . ILE A 1 199 ? 71.661 -3.517  -8.893  1.00 9.45  ? 196  ILE A CG1   1 
ATOM   1531 C  CG2   . ILE A 1 199 ? 69.507 -2.281  -8.769  1.00 14.06 ? 196  ILE A CG2   1 
ATOM   1532 C  CD1   . ILE A 1 199 ? 71.252 -4.601  -9.875  1.00 13.69 ? 196  ILE A CD1   1 
ATOM   1533 N  N     . VAL A 1 200 ? 69.384 -2.093  -5.110  1.00 10.78 ? 197  VAL A N     1 
ATOM   1534 C  CA    . VAL A 1 200 ? 68.357 -1.445  -4.291  1.00 10.87 ? 197  VAL A CA    1 
ATOM   1535 C  C     . VAL A 1 200 ? 68.898 -0.268  -3.476  1.00 9.03  ? 197  VAL A C     1 
ATOM   1536 O  O     . VAL A 1 200 ? 68.219 0.766   -3.351  1.00 11.24 ? 197  VAL A O     1 
ATOM   1537 C  CB    . VAL A 1 200 ? 67.586 -2.477  -3.427  1.00 9.26  ? 197  VAL A CB    1 
ATOM   1538 C  CG1   . VAL A 1 200 ? 66.538 -1.783  -2.554  1.00 10.14 ? 197  VAL A CG1   1 
ATOM   1539 C  CG2   . VAL A 1 200 ? 66.929 -3.498  -4.334  1.00 10.39 ? 197  VAL A CG2   1 
ATOM   1540 N  N     . GLU A 1 201 ? 70.126 -0.380  -2.968  1.00 9.94  ? 198  GLU A N     1 
ATOM   1541 C  CA    . GLU A 1 201 ? 70.786 0.767   -2.339  1.00 12.80 ? 198  GLU A CA    1 
ATOM   1542 C  C     . GLU A 1 201 ? 70.801 1.939   -3.322  1.00 11.38 ? 198  GLU A C     1 
ATOM   1543 O  O     . GLU A 1 201 ? 70.529 3.083   -2.954  1.00 12.85 ? 198  GLU A O     1 
ATOM   1544 C  CB    . GLU A 1 201 ? 72.232 0.444   -1.904  1.00 12.57 ? 198  GLU A CB    1 
ATOM   1545 C  CG    . GLU A 1 201 ? 72.385 -0.558  -0.728  1.00 15.29 ? 198  GLU A CG    1 
ATOM   1546 C  CD    . GLU A 1 201 ? 72.251 0.065   0.656   1.00 17.72 ? 198  GLU A CD    1 
ATOM   1547 O  OE1   . GLU A 1 201 ? 71.908 1.262   0.760   1.00 18.01 ? 198  GLU A OE1   1 
ATOM   1548 O  OE2   . GLU A 1 201 ? 72.476 -0.652  1.661   1.00 15.84 ? 198  GLU A OE2   1 
ATOM   1549 N  N     . GLU A 1 202 ? 71.153 1.649   -4.565  1.00 10.99 ? 199  GLU A N     1 
ATOM   1550 C  CA    . GLU A 1 202 ? 71.244 2.698   -5.583  1.00 12.98 ? 199  GLU A CA    1 
ATOM   1551 C  C     . GLU A 1 202 ? 69.863 3.296   -5.874  1.00 15.20 ? 199  GLU A C     1 
ATOM   1552 O  O     . GLU A 1 202 ? 69.716 4.519   -5.993  1.00 10.06 ? 199  GLU A O     1 
ATOM   1553 C  CB    . GLU A 1 202 ? 71.921 2.159   -6.846  1.00 15.78 ? 199  GLU A CB    1 
ATOM   1554 C  CG    . GLU A 1 202 ? 73.392 1.819   -6.613  1.00 20.10 ? 199  GLU A CG    1 
ATOM   1555 C  CD    . GLU A 1 202 ? 74.013 0.936   -7.704  1.00 23.13 ? 199  GLU A CD    1 
ATOM   1556 O  OE1   . GLU A 1 202 ? 75.234 0.688   -7.639  1.00 27.62 ? 199  GLU A OE1   1 
ATOM   1557 O  OE2   . GLU A 1 202 ? 73.299 0.480   -8.615  1.00 26.93 ? 199  GLU A OE2   1 
ATOM   1558 N  N     . MET A 1 203 ? 68.853 2.432   -5.965  1.00 11.64 ? 200  MET A N     1 
ATOM   1559 C  CA    . MET A 1 203 ? 67.479 2.874   -6.207  1.00 11.29 ? 200  MET A CA    1 
ATOM   1560 C  C     . MET A 1 203 ? 66.997 3.758   -5.071  1.00 12.25 ? 200  MET A C     1 
ATOM   1561 O  O     . MET A 1 203 ? 66.385 4.813   -5.304  1.00 12.01 ? 200  MET A O     1 
ATOM   1562 C  CB    . MET A 1 203 ? 66.516 1.684   -6.357  1.00 12.68 ? 200  MET A CB    1 
ATOM   1563 C  CG    A MET A 1 203 ? 65.072 2.102   -6.499  0.50 12.59 ? 200  MET A CG    1 
ATOM   1564 C  CG    B MET A 1 203 ? 66.793 0.726   -7.503  0.50 12.24 ? 200  MET A CG    1 
ATOM   1565 S  SD    A MET A 1 203 ? 63.961 0.722   -6.798  0.50 22.26 ? 200  MET A SD    1 
ATOM   1566 S  SD    B MET A 1 203 ? 65.588 -0.635  -7.594  0.50 13.97 ? 200  MET A SD    1 
ATOM   1567 C  CE    A MET A 1 203 ? 64.610 0.034   -8.311  0.50 16.99 ? 200  MET A CE    1 
ATOM   1568 C  CE    B MET A 1 203 ? 64.058 0.276   -7.807  0.50 12.00 ? 200  MET A CE    1 
ATOM   1569 N  N     . ARG A 1 204 ? 67.262 3.336   -3.837  1.00 9.26  ? 201  ARG A N     1 
ATOM   1570 C  CA    . ARG A 1 204 ? 66.804 4.089   -2.676  1.00 9.93  ? 201  ARG A CA    1 
ATOM   1571 C  C     . ARG A 1 204 ? 67.537 5.438   -2.567  1.00 10.63 ? 201  ARG A C     1 
ATOM   1572 O  O     . ARG A 1 204 ? 66.939 6.455   -2.203  1.00 10.15 ? 201  ARG A O     1 
ATOM   1573 C  CB    . ARG A 1 204 ? 66.922 3.252   -1.402  1.00 9.60  ? 201  ARG A CB    1 
ATOM   1574 C  CG    . ARG A 1 204 ? 65.982 2.035   -1.433  1.00 9.58  ? 201  ARG A CG    1 
ATOM   1575 C  CD    . ARG A 1 204 ? 66.133 1.181   -0.198  1.00 12.15 ? 201  ARG A CD    1 
ATOM   1576 N  NE    . ARG A 1 204 ? 66.122 2.003   1.001   1.00 11.35 ? 201  ARG A NE    1 
ATOM   1577 C  CZ    . ARG A 1 204 ? 67.156 2.119   1.820   1.00 15.12 ? 201  ARG A CZ    1 
ATOM   1578 N  NH1   . ARG A 1 204 ? 67.077 2.909   2.885   1.00 13.54 ? 201  ARG A NH1   1 
ATOM   1579 N  NH2   . ARG A 1 204 ? 68.270 1.442   1.565   1.00 16.50 ? 201  ARG A NH2   1 
ATOM   1580 N  N     . ALA A 1 205 ? 68.815 5.450   -2.931  1.00 10.80 ? 202  ALA A N     1 
ATOM   1581 C  CA    . ALA A 1 205 ? 69.565 6.709   -2.961  1.00 11.87 ? 202  ALA A CA    1 
ATOM   1582 C  C     . ALA A 1 205 ? 68.974 7.687   -3.993  1.00 10.00 ? 202  ALA A C     1 
ATOM   1583 O  O     . ALA A 1 205 ? 68.839 8.893   -3.718  1.00 9.04  ? 202  ALA A O     1 
ATOM   1584 C  CB    . ALA A 1 205 ? 71.037 6.438   -3.260  1.00 14.26 ? 202  ALA A CB    1 
ATOM   1585 N  N     . ALA A 1 206 ? 68.604 7.159   -5.160  1.00 9.71  ? 203  ALA A N     1 
ATOM   1586 C  CA    . ALA A 1 206 ? 68.017 7.972   -6.216  1.00 14.40 ? 203  ALA A CA    1 
ATOM   1587 C  C     . ALA A 1 206 ? 66.668 8.533   -5.783  1.00 10.84 ? 203  ALA A C     1 
ATOM   1588 O  O     . ALA A 1 206 ? 66.356 9.699   -6.053  1.00 12.57 ? 203  ALA A O     1 
ATOM   1589 C  CB    . ALA A 1 206 ? 67.876 7.168   -7.513  1.00 13.04 ? 203  ALA A CB    1 
ATOM   1590 N  N     . ILE A 1 207 ? 65.862 7.707   -5.119  1.00 8.84  ? 204  ILE A N     1 
ATOM   1591 C  CA    . ILE A 1 207 ? 64.560 8.177   -4.667  1.00 12.46 ? 204  ILE A CA    1 
ATOM   1592 C  C     . ILE A 1 207 ? 64.757 9.316   -3.682  1.00 10.96 ? 204  ILE A C     1 
ATOM   1593 O  O     . ILE A 1 207 ? 64.067 10.342  -3.748  1.00 8.59  ? 204  ILE A O     1 
ATOM   1594 C  CB    . ILE A 1 207 ? 63.717 7.063   -4.011  1.00 8.71  ? 204  ILE A CB    1 
ATOM   1595 C  CG1   . ILE A 1 207 ? 63.254 6.061   -5.081  1.00 9.73  ? 204  ILE A CG1   1 
ATOM   1596 C  CG2   . ILE A 1 207 ? 62.518 7.669   -3.317  1.00 10.02 ? 204  ILE A CG2   1 
ATOM   1597 C  CD1   . ILE A 1 207 ? 62.679 4.741   -4.490  1.00 11.28 ? 204  ILE A CD1   1 
ATOM   1598 N  N     . GLU A 1 208 ? 65.690 9.142   -2.753  1.00 8.49  ? 205  GLU A N     1 
ATOM   1599 C  CA    . GLU A 1 208 ? 65.893 10.181  -1.743  1.00 9.20  ? 205  GLU A CA    1 
ATOM   1600 C  C     . GLU A 1 208 ? 66.490 11.449  -2.348  1.00 12.54 ? 205  GLU A C     1 
ATOM   1601 O  O     . GLU A 1 208 ? 66.048 12.557  -2.031  1.00 12.04 ? 205  GLU A O     1 
ATOM   1602 C  CB    . GLU A 1 208 ? 66.748 9.708   -0.571  1.00 10.96 ? 205  GLU A CB    1 
ATOM   1603 C  CG    . GLU A 1 208 ? 66.727 10.718  0.586   1.00 15.28 ? 205  GLU A CG    1 
ATOM   1604 C  CD    . GLU A 1 208 ? 67.530 10.279  1.799   1.00 20.07 ? 205  GLU A CD    1 
ATOM   1605 O  OE1   . GLU A 1 208 ? 67.510 11.016  2.805   1.00 18.15 ? 205  GLU A OE1   1 
ATOM   1606 O  OE2   . GLU A 1 208 ? 68.179 9.213   1.749   1.00 19.81 ? 205  GLU A OE2   1 
ATOM   1607 N  N     . ARG A 1 209 ? 67.482 11.299  -3.220  1.00 10.34 ? 206  ARG A N     1 
ATOM   1608 C  CA    . ARG A 1 209 ? 68.058 12.476  -3.880  1.00 13.23 ? 206  ARG A CA    1 
ATOM   1609 C  C     . ARG A 1 209 ? 67.019 13.285  -4.644  1.00 13.89 ? 206  ARG A C     1 
ATOM   1610 O  O     . ARG A 1 209 ? 66.999 14.512  -4.558  1.00 12.73 ? 206  ARG A O     1 
ATOM   1611 C  CB    . ARG A 1 209 ? 69.203 12.097  -4.838  1.00 12.52 ? 206  ARG A CB    1 
ATOM   1612 C  CG    . ARG A 1 209 ? 69.957 13.341  -5.371  1.00 14.39 ? 206  ARG A CG    1 
ATOM   1613 C  CD    . ARG A 1 209 ? 71.020 13.007  -6.436  1.00 17.81 ? 206  ARG A CD    1 
ATOM   1614 N  NE    . ARG A 1 209 ? 70.472 12.626  -7.747  1.00 21.82 ? 206  ARG A NE    1 
ATOM   1615 C  CZ    . ARG A 1 209 ? 70.097 13.489  -8.694  1.00 24.28 ? 206  ARG A CZ    1 
ATOM   1616 N  NH1   . ARG A 1 209 ? 69.631 13.050  -9.864  1.00 20.65 ? 206  ARG A NH1   1 
ATOM   1617 N  NH2   . ARG A 1 209 ? 70.187 14.791  -8.479  1.00 17.70 ? 206  ARG A NH2   1 
ATOM   1618 N  N     . GLU A 1 210 ? 66.158 12.597  -5.385  1.00 10.45 ? 207  GLU A N     1 
ATOM   1619 C  CA    . GLU A 1 210 ? 65.308 13.253  -6.379  1.00 8.42  ? 207  GLU A CA    1 
ATOM   1620 C  C     . GLU A 1 210 ? 63.929 13.651  -5.851  1.00 12.18 ? 207  GLU A C     1 
ATOM   1621 O  O     . GLU A 1 210 ? 63.206 14.416  -6.505  1.00 10.50 ? 207  GLU A O     1 
ATOM   1622 C  CB    . GLU A 1 210 ? 65.185 12.377  -7.625  1.00 12.36 ? 207  GLU A CB    1 
ATOM   1623 C  CG    . GLU A 1 210 ? 66.537 12.058  -8.234  1.00 13.94 ? 207  GLU A CG    1 
ATOM   1624 C  CD    . GLU A 1 210 ? 66.445 11.173  -9.452  1.00 17.05 ? 207  GLU A CD    1 
ATOM   1625 O  OE1   . GLU A 1 210 ? 65.413 11.223  -10.156 1.00 20.58 ? 207  GLU A OE1   1 
ATOM   1626 O  OE2   . GLU A 1 210 ? 67.413 10.427  -9.707  1.00 27.27 ? 207  GLU A OE2   1 
ATOM   1627 N  N     . THR A 1 211 ? 63.564 13.150  -4.670  1.00 9.21  ? 208  THR A N     1 
ATOM   1628 C  CA    . THR A 1 211 ? 62.251 13.478  -4.120  1.00 10.82 ? 208  THR A CA    1 
ATOM   1629 C  C     . THR A 1 211 ? 62.321 14.017  -2.713  1.00 10.51 ? 208  THR A C     1 
ATOM   1630 O  O     . THR A 1 211 ? 61.414 14.705  -2.276  1.00 13.30 ? 208  THR A O     1 
ATOM   1631 C  CB    . THR A 1 211 ? 61.278 12.264  -4.102  1.00 12.82 ? 208  THR A CB    1 
ATOM   1632 O  OG1   . THR A 1 211 ? 61.716 11.292  -3.146  1.00 14.19 ? 208  THR A OG1   1 
ATOM   1633 C  CG2   . THR A 1 211 ? 61.140 11.631  -5.478  1.00 9.16  ? 208  THR A CG2   1 
ATOM   1634 N  N     . GLY A 1 212 ? 63.386 13.684  -1.994  1.00 10.60 ? 209  GLY A N     1 
ATOM   1635 C  CA    . GLY A 1 212 ? 63.444 13.977  -0.574  1.00 13.30 ? 209  GLY A CA    1 
ATOM   1636 C  C     . GLY A 1 212 ? 62.877 12.871  0.318   1.00 12.51 ? 209  GLY A C     1 
ATOM   1637 O  O     . GLY A 1 212 ? 63.003 12.940  1.539   1.00 18.09 ? 209  GLY A O     1 
ATOM   1638 N  N     . PHE A 1 213 ? 62.263 11.856  -0.285  1.00 12.64 ? 210  PHE A N     1 
ATOM   1639 C  CA    . PHE A 1 213 ? 61.583 10.806  0.476   1.00 8.10  ? 210  PHE A CA    1 
ATOM   1640 C  C     . PHE A 1 213 ? 62.512 9.634   0.807   1.00 10.07 ? 210  PHE A C     1 
ATOM   1641 O  O     . PHE A 1 213 ? 63.255 9.163   -0.051  1.00 11.84 ? 210  PHE A O     1 
ATOM   1642 C  CB    . PHE A 1 213 ? 60.360 10.285  -0.280  1.00 9.31  ? 210  PHE A CB    1 
ATOM   1643 C  CG    . PHE A 1 213 ? 59.343 11.342  -0.618  1.00 10.05 ? 210  PHE A CG    1 
ATOM   1644 C  CD1   . PHE A 1 213 ? 58.634 11.273  -1.807  1.00 11.60 ? 210  PHE A CD1   1 
ATOM   1645 C  CD2   . PHE A 1 213 ? 59.074 12.385  0.259   1.00 11.95 ? 210  PHE A CD2   1 
ATOM   1646 C  CE1   . PHE A 1 213 ? 57.681 12.242  -2.127  1.00 12.36 ? 210  PHE A CE1   1 
ATOM   1647 C  CE2   . PHE A 1 213 ? 58.118 13.348  -0.063  1.00 11.45 ? 210  PHE A CE2   1 
ATOM   1648 C  CZ    . PHE A 1 213 ? 57.427 13.268  -1.264  1.00 9.57  ? 210  PHE A CZ    1 
ATOM   1649 N  N     . GLN A 1 214 ? 62.462 9.177   2.057   1.00 9.15  ? 211  GLN A N     1 
ATOM   1650 C  CA    . GLN A 1 214 ? 63.171 7.981   2.488   1.00 11.90 ? 211  GLN A CA    1 
ATOM   1651 C  C     . GLN A 1 214 ? 62.266 6.759   2.399   1.00 12.75 ? 211  GLN A C     1 
ATOM   1652 O  O     . GLN A 1 214 ? 61.054 6.859   2.548   1.00 9.92  ? 211  GLN A O     1 
ATOM   1653 C  CB    . GLN A 1 214 ? 63.655 8.150   3.931   1.00 12.57 ? 211  GLN A CB    1 
ATOM   1654 C  CG    . GLN A 1 214 ? 64.771 9.179   4.044   1.00 16.46 ? 211  GLN A CG    1 
ATOM   1655 C  CD    . GLN A 1 214 ? 65.326 9.286   5.439   1.00 19.07 ? 211  GLN A CD    1 
ATOM   1656 O  OE1   . GLN A 1 214 ? 64.740 8.784   6.393   1.00 16.21 ? 211  GLN A OE1   1 
ATOM   1657 N  NE2   . GLN A 1 214 ? 66.471 9.947   5.564   1.00 23.63 ? 211  GLN A NE2   1 
ATOM   1658 N  N     . CYS A 1 215 ? 62.860 5.596   2.169   1.00 11.57 ? 212  CYS A N     1 
ATOM   1659 C  CA    . CYS A 1 215 ? 62.072 4.383   2.089   1.00 9.46  ? 212  CYS A CA    1 
ATOM   1660 C  C     . CYS A 1 215 ? 62.860 3.210   2.636   1.00 11.49 ? 212  CYS A C     1 
ATOM   1661 O  O     . CYS A 1 215 ? 64.054 3.321   2.920   1.00 13.65 ? 212  CYS A O     1 
ATOM   1662 C  CB    . CYS A 1 215 ? 61.679 4.099   0.640   1.00 10.89 ? 212  CYS A CB    1 
ATOM   1663 S  SG    . CYS A 1 215 ? 63.103 3.858   -0.428  1.00 21.02 ? 212  CYS A SG    1 
ATOM   1664 N  N     . SER A 1 216 ? 62.165 2.095   2.804   1.00 11.00 ? 213  SER A N     1 
ATOM   1665 C  CA    . SER A 1 216 ? 62.802 0.846   3.191   1.00 9.73  ? 213  SER A CA    1 
ATOM   1666 C  C     . SER A 1 216 ? 62.593 -0.163  2.084   1.00 11.13 ? 213  SER A C     1 
ATOM   1667 O  O     . SER A 1 216 ? 61.777 0.060   1.181   1.00 12.74 ? 213  SER A O     1 
ATOM   1668 C  CB    . SER A 1 216 ? 62.192 0.347   4.487   1.00 12.04 ? 213  SER A CB    1 
ATOM   1669 O  OG    . SER A 1 216 ? 62.408 1.319   5.504   1.00 15.98 ? 213  SER A OG    1 
ATOM   1670 N  N     . ALA A 1 217 ? 63.328 -1.272  2.120   1.00 11.60 ? 214  ALA A N     1 
ATOM   1671 C  CA    . ALA A 1 217 ? 63.128 -2.283  1.087   1.00 8.51  ? 214  ALA A CA    1 
ATOM   1672 C  C     . ALA A 1 217 ? 63.442 -3.672  1.593   1.00 9.54  ? 214  ALA A C     1 
ATOM   1673 O  O     . ALA A 1 217 ? 64.220 -3.819  2.532   1.00 8.02  ? 214  ALA A O     1 
ATOM   1674 C  CB    . ALA A 1 217 ? 63.978 -1.986  -0.119  1.00 9.06  ? 214  ALA A CB    1 
ATOM   1675 N  N     . GLY A 1 218 ? 62.814 -4.672  0.982   1.00 7.31  ? 215  GLY A N     1 
ATOM   1676 C  CA    . GLY A 1 218 ? 63.207 -6.062  1.189   1.00 7.16  ? 215  GLY A CA    1 
ATOM   1677 C  C     . GLY A 1 218 ? 63.721 -6.665  -0.108  1.00 10.07 ? 215  GLY A C     1 
ATOM   1678 O  O     . GLY A 1 218 ? 63.183 -6.386  -1.190  1.00 9.76  ? 215  GLY A O     1 
ATOM   1679 N  N     . ILE A 1 219 ? 64.764 -7.490  -0.007  1.00 7.14  ? 216  ILE A N     1 
ATOM   1680 C  CA    . ILE A 1 219 ? 65.305 -8.198  -1.161  1.00 6.45  ? 216  ILE A CA    1 
ATOM   1681 C  C     . ILE A 1 219 ? 65.283 -9.695  -0.852  1.00 8.78  ? 216  ILE A C     1 
ATOM   1682 O  O     . ILE A 1 219 ? 65.862 -10.129 0.147   1.00 10.16 ? 216  ILE A O     1 
ATOM   1683 C  CB    . ILE A 1 219 ? 66.761 -7.745  -1.457  1.00 10.55 ? 216  ILE A CB    1 
ATOM   1684 C  CG1   . ILE A 1 219 ? 66.840 -6.222  -1.650  1.00 13.58 ? 216  ILE A CG1   1 
ATOM   1685 C  CG2   . ILE A 1 219 ? 67.334 -8.477  -2.680  1.00 12.75 ? 216  ILE A CG2   1 
ATOM   1686 C  CD1   . ILE A 1 219 ? 67.148 -5.460  -0.372  1.00 14.18 ? 216  ILE A CD1   1 
ATOM   1687 N  N     . SER A 1 220 ? 64.595 -10.472 -1.689  1.00 8.38  ? 217  SER A N     1 
ATOM   1688 C  CA    . SER A 1 220 ? 64.558 -11.922 -1.545  1.00 10.51 ? 217  SER A CA    1 
ATOM   1689 C  C     . SER A 1 220 ? 64.307 -12.571 -2.913  1.00 9.88  ? 217  SER A C     1 
ATOM   1690 O  O     . SER A 1 220 ? 64.605 -11.977 -3.939  1.00 10.95 ? 217  SER A O     1 
ATOM   1691 C  CB    . SER A 1 220 ? 63.490 -12.344 -0.527  1.00 12.30 ? 217  SER A CB    1 
ATOM   1692 O  OG    . SER A 1 220 ? 63.671 -13.694 -0.124  1.00 11.93 ? 217  SER A OG    1 
ATOM   1693 N  N     . HIS A 1 221 ? 63.797 -13.798 -2.912  1.00 10.29 ? 218  HIS A N     1 
ATOM   1694 C  CA    . HIS A 1 221 ? 63.611 -14.569 -4.133  1.00 9.61  ? 218  HIS A CA    1 
ATOM   1695 C  C     . HIS A 1 221 ? 62.161 -14.534 -4.635  1.00 9.84  ? 218  HIS A C     1 
ATOM   1696 O  O     . HIS A 1 221 ? 61.852 -15.051 -5.707  1.00 8.51  ? 218  HIS A O     1 
ATOM   1697 C  CB    . HIS A 1 221 ? 64.051 -16.027 -3.910  1.00 11.43 ? 218  HIS A CB    1 
ATOM   1698 C  CG    . HIS A 1 221 ? 65.540 -16.211 -3.811  1.00 12.69 ? 218  HIS A CG    1 
ATOM   1699 N  ND1   . HIS A 1 221 ? 66.394 -15.877 -4.837  1.00 11.79 ? 218  HIS A ND1   1 
ATOM   1700 C  CD2   . HIS A 1 221 ? 66.309 -16.718 -2.820  1.00 11.54 ? 218  HIS A CD2   1 
ATOM   1701 C  CE1   . HIS A 1 221 ? 67.639 -16.161 -4.478  1.00 13.10 ? 218  HIS A CE1   1 
ATOM   1702 N  NE2   . HIS A 1 221 ? 67.616 -16.673 -3.263  1.00 12.29 ? 218  HIS A NE2   1 
ATOM   1703 N  N     . ASN A 1 222 ? 61.275 -13.910 -3.871  1.00 6.12  ? 219  ASN A N     1 
ATOM   1704 C  CA    . ASN A 1 222 ? 59.878 -13.787 -4.282  1.00 7.57  ? 219  ASN A CA    1 
ATOM   1705 C  C     . ASN A 1 222 ? 59.210 -12.615 -3.575  1.00 9.59  ? 219  ASN A C     1 
ATOM   1706 O  O     . ASN A 1 222 ? 59.792 -12.016 -2.671  1.00 10.63 ? 219  ASN A O     1 
ATOM   1707 C  CB    . ASN A 1 222 ? 59.103 -15.082 -4.025  1.00 10.19 ? 219  ASN A CB    1 
ATOM   1708 C  CG    . ASN A 1 222 ? 59.176 -15.521 -2.566  1.00 10.04 ? 219  ASN A CG    1 
ATOM   1709 O  OD1   . ASN A 1 222 ? 58.638 -14.857 -1.699  1.00 9.14  ? 219  ASN A OD1   1 
ATOM   1710 N  ND2   . ASN A 1 222 ? 59.837 -16.651 -2.304  1.00 11.68 ? 219  ASN A ND2   1 
ATOM   1711 N  N     . LYS A 1 223 ? 57.987 -12.300 -3.983  1.00 10.53 ? 220  LYS A N     1 
ATOM   1712 C  CA    . LYS A 1 223 ? 57.298 -11.115 -3.472  1.00 9.17  ? 220  LYS A CA    1 
ATOM   1713 C  C     . LYS A 1 223 ? 56.935 -11.231 -1.999  1.00 10.32 ? 220  LYS A C     1 
ATOM   1714 O  O     . LYS A 1 223 ? 57.035 -10.255 -1.249  1.00 9.43  ? 220  LYS A O     1 
ATOM   1715 C  CB    . LYS A 1 223 ? 56.033 -10.837 -4.306  1.00 9.11  ? 220  LYS A CB    1 
ATOM   1716 C  CG    . LYS A 1 223 ? 56.304 -10.499 -5.767  1.00 11.10 ? 220  LYS A CG    1 
ATOM   1717 C  CD    . LYS A 1 223 ? 55.052 -10.724 -6.655  1.00 20.66 ? 220  LYS A CD    1 
ATOM   1718 C  CE    . LYS A 1 223 ? 53.988 -9.694  -6.415  1.00 22.98 ? 220  LYS A CE    1 
ATOM   1719 N  NZ    . LYS A 1 223 ? 52.852 -9.822  -7.399  1.00 18.08 ? 220  LYS A NZ    1 
ATOM   1720 N  N     . VAL A 1 224 ? 56.465 -12.404 -1.578  1.00 8.54  ? 221  VAL A N     1 
ATOM   1721 C  CA    . VAL A 1 224 ? 56.038 -12.553 -0.190  1.00 10.02 ? 221  VAL A CA    1 
ATOM   1722 C  C     . VAL A 1 224 ? 57.212 -12.367 0.772   1.00 8.33  ? 221  VAL A C     1 
ATOM   1723 O  O     . VAL A 1 224 ? 57.094 -11.639 1.770   1.00 11.40 ? 221  VAL A O     1 
ATOM   1724 C  CB    . VAL A 1 224 ? 55.323 -13.912 0.065   1.00 12.85 ? 221  VAL A CB    1 
ATOM   1725 C  CG1   . VAL A 1 224 ? 55.169 -14.156 1.551   1.00 14.36 ? 221  VAL A CG1   1 
ATOM   1726 C  CG2   . VAL A 1 224 ? 53.960 -13.907 -0.616  1.00 14.03 ? 221  VAL A CG2   1 
ATOM   1727 N  N     . LEU A 1 225 ? 58.346 -12.992 0.468   1.00 8.98  ? 222  LEU A N     1 
ATOM   1728 C  CA    . LEU A 1 225 ? 59.530 -12.834 1.318   1.00 9.95  ? 222  LEU A CA    1 
ATOM   1729 C  C     . LEU A 1 225 ? 60.081 -11.412 1.236   1.00 8.97  ? 222  LEU A C     1 
ATOM   1730 O  O     . LEU A 1 225 ? 60.557 -10.860 2.230   1.00 8.84  ? 222  LEU A O     1 
ATOM   1731 C  CB    . LEU A 1 225 ? 60.627 -13.847 0.963   1.00 8.23  ? 222  LEU A CB    1 
ATOM   1732 C  CG    . LEU A 1 225 ? 60.372 -15.299 1.394   1.00 9.46  ? 222  LEU A CG    1 
ATOM   1733 C  CD1   . LEU A 1 225 ? 61.603 -16.161 1.142   1.00 13.50 ? 222  LEU A CD1   1 
ATOM   1734 C  CD2   . LEU A 1 225 ? 59.994 -15.355 2.861   1.00 12.38 ? 222  LEU A CD2   1 
ATOM   1735 N  N     . ALA A 1 226 ? 60.029 -10.816 0.047   1.00 8.78  ? 223  ALA A N     1 
ATOM   1736 C  CA    . ALA A 1 226 ? 60.514 -9.447  -0.100  1.00 9.34  ? 223  ALA A CA    1 
ATOM   1737 C  C     . ALA A 1 226 ? 59.691 -8.483  0.757   1.00 8.30  ? 223  ALA A C     1 
ATOM   1738 O  O     . ALA A 1 226 ? 60.243 -7.609  1.423   1.00 7.85  ? 223  ALA A O     1 
ATOM   1739 C  CB    . ALA A 1 226 ? 60.494 -9.019  -1.558  1.00 8.71  ? 223  ALA A CB    1 
ATOM   1740 N  N     . LYS A 1 227 ? 58.369 -8.636  0.731   1.00 8.62  ? 224  LYS A N     1 
ATOM   1741 C  CA    . LYS A 1 227 ? 57.479 -7.815  1.557   1.00 11.20 ? 224  LYS A CA    1 
ATOM   1742 C  C     . LYS A 1 227 ? 57.748 -8.016  3.044   1.00 10.65 ? 224  LYS A C     1 
ATOM   1743 O  O     . LYS A 1 227 ? 57.851 -7.052  3.793   1.00 10.17 ? 224  LYS A O     1 
ATOM   1744 C  CB    . LYS A 1 227 ? 56.003 -8.121  1.249   1.00 9.61  ? 224  LYS A CB    1 
ATOM   1745 C  CG    . LYS A 1 227 ? 54.985 -7.343  2.111   1.00 13.45 ? 224  LYS A CG    1 
ATOM   1746 C  CD    . LYS A 1 227 ? 55.100 -5.827  1.936   1.00 17.50 ? 224  LYS A CD    1 
ATOM   1747 C  CE    . LYS A 1 227 ? 53.949 -5.107  2.643   1.00 27.52 ? 224  LYS A CE    1 
ATOM   1748 N  NZ    . LYS A 1 227 ? 54.121 -3.630  2.643   1.00 28.31 ? 224  LYS A NZ    1 
ATOM   1749 N  N     . LEU A 1 228 ? 57.855 -9.270  3.465   1.00 9.06  ? 225  LEU A N     1 
ATOM   1750 C  CA    . LEU A 1 228 ? 58.157 -9.577  4.861   1.00 9.57  ? 225  LEU A CA    1 
ATOM   1751 C  C     . LEU A 1 228 ? 59.497 -8.956  5.260   1.00 11.64 ? 225  LEU A C     1 
ATOM   1752 O  O     . LEU A 1 228 ? 59.611 -8.298  6.301   1.00 11.72 ? 225  LEU A O     1 
ATOM   1753 C  CB    . LEU A 1 228 ? 58.185 -11.093 5.061   1.00 12.61 ? 225  LEU A CB    1 
ATOM   1754 C  CG    . LEU A 1 228 ? 58.397 -11.579 6.497   1.00 17.97 ? 225  LEU A CG    1 
ATOM   1755 C  CD1   . LEU A 1 228 ? 57.251 -11.124 7.387   1.00 17.02 ? 225  LEU A CD1   1 
ATOM   1756 C  CD2   . LEU A 1 228 ? 58.564 -13.100 6.535   1.00 17.36 ? 225  LEU A CD2   1 
ATOM   1757 N  N     . ALA A 1 229 ? 60.510 -9.159  4.423   1.00 10.59 ? 226  ALA A N     1 
ATOM   1758 C  CA    . ALA A 1 229 ? 61.837 -8.572  4.648   1.00 8.50  ? 226  ALA A CA    1 
ATOM   1759 C  C     . ALA A 1 229 ? 61.805 -7.053  4.839   1.00 11.54 ? 226  ALA A C     1 
ATOM   1760 O  O     . ALA A 1 229 ? 62.468 -6.523  5.736   1.00 11.53 ? 226  ALA A O     1 
ATOM   1761 C  CB    . ALA A 1 229 ? 62.789 -8.933  3.489   1.00 8.24  ? 226  ALA A CB    1 
ATOM   1762 N  N     . CYS A 1 230 ? 61.050 -6.352  3.993   1.00 8.00  ? 227  CYS A N     1 
ATOM   1763 C  CA    . CYS A 1 230 ? 61.034 -4.892  4.028   1.00 9.62  ? 227  CYS A CA    1 
ATOM   1764 C  C     . CYS A 1 230 ? 60.680 -4.368  5.430   1.00 11.13 ? 227  CYS A C     1 
ATOM   1765 O  O     . CYS A 1 230 ? 61.280 -3.401  5.920   1.00 14.14 ? 227  CYS A O     1 
ATOM   1766 C  CB    . CYS A 1 230 ? 60.047 -4.354  2.978   1.00 11.07 ? 227  CYS A CB    1 
ATOM   1767 S  SG    . CYS A 1 230 ? 59.942 -2.561  2.891   1.00 13.08 ? 227  CYS A SG    1 
ATOM   1768 N  N     . GLY A 1 231 ? 59.715 -5.026  6.063   1.00 12.26 ? 228  GLY A N     1 
ATOM   1769 C  CA    . GLY A 1 231 ? 59.220 -4.630  7.372   1.00 12.86 ? 228  GLY A CA    1 
ATOM   1770 C  C     . GLY A 1 231 ? 60.130 -4.957  8.550   1.00 13.47 ? 228  GLY A C     1 
ATOM   1771 O  O     . GLY A 1 231 ? 59.867 -4.516  9.672   1.00 18.51 ? 228  GLY A O     1 
ATOM   1772 N  N     . LEU A 1 232 ? 61.202 -5.712  8.316   1.00 11.41 ? 229  LEU A N     1 
ATOM   1773 C  CA    . LEU A 1 232 ? 62.015 -6.205  9.434   1.00 10.79 ? 229  LEU A CA    1 
ATOM   1774 C  C     . LEU A 1 232 ? 62.895 -5.116  10.047  1.00 13.25 ? 229  LEU A C     1 
ATOM   1775 O  O     . LEU A 1 232 ? 63.223 -5.162  11.236  1.00 14.35 ? 229  LEU A O     1 
ATOM   1776 C  CB    . LEU A 1 232 ? 62.868 -7.407  9.006   1.00 13.19 ? 229  LEU A CB    1 
ATOM   1777 C  CG    . LEU A 1 232 ? 62.063 -8.658  8.646   1.00 15.10 ? 229  LEU A CG    1 
ATOM   1778 C  CD1   . LEU A 1 232 ? 63.004 -9.786  8.236   1.00 10.26 ? 229  LEU A CD1   1 
ATOM   1779 C  CD2   . LEU A 1 232 ? 61.160 -9.060  9.842   1.00 16.43 ? 229  LEU A CD2   1 
ATOM   1780 N  N     . ASN A 1 233 ? 63.275 -4.141  9.235   1.00 9.23  ? 230  ASN A N     1 
ATOM   1781 C  CA    . ASN A 1 233 ? 64.148 -3.061  9.675   1.00 10.41 ? 230  ASN A CA    1 
ATOM   1782 C  C     . ASN A 1 233 ? 63.681 -1.768  9.011   1.00 14.25 ? 230  ASN A C     1 
ATOM   1783 O  O     . ASN A 1 233 ? 64.129 -1.425  7.923   1.00 27.86 ? 230  ASN A O     1 
ATOM   1784 C  CB    . ASN A 1 233 ? 65.606 -3.352  9.290   1.00 12.30 ? 230  ASN A CB    1 
ATOM   1785 C  CG    . ASN A 1 233 ? 66.191 -4.559  10.034  1.00 14.13 ? 230  ASN A CG    1 
ATOM   1786 O  OD1   . ASN A 1 233 ? 66.511 -4.466  11.221  1.00 13.56 ? 230  ASN A OD1   1 
ATOM   1787 N  ND2   . ASN A 1 233 ? 66.363 -5.672  9.335   1.00 12.45 ? 230  ASN A ND2   1 
ATOM   1788 N  N     . LYS A 1 234 ? 62.719 -1.111  9.633   1.00 20.67 ? 231  LYS A N     1 
ATOM   1789 C  CA    . LYS A 1 234 ? 62.227 0.185   9.178   1.00 15.88 ? 231  LYS A CA    1 
ATOM   1790 C  C     . LYS A 1 234 ? 62.505 1.114   10.334  1.00 17.03 ? 231  LYS A C     1 
ATOM   1791 O  O     . LYS A 1 234 ? 62.556 0.659   11.479  1.00 21.97 ? 231  LYS A O     1 
ATOM   1792 C  CB    . LYS A 1 234 ? 60.713 0.133   8.936   1.00 22.84 ? 231  LYS A CB    1 
ATOM   1793 C  CG    . LYS A 1 234 ? 60.274 -0.251  7.529   1.00 22.95 ? 231  LYS A CG    1 
ATOM   1794 C  CD    . LYS A 1 234 ? 58.786 0.102   7.319   1.00 22.38 ? 231  LYS A CD    1 
ATOM   1795 C  CE    . LYS A 1 234 ? 58.390 0.142   5.844   1.00 26.39 ? 231  LYS A CE    1 
ATOM   1796 N  NZ    . LYS A 1 234 ? 58.442 1.531   5.253   1.00 14.82 ? 231  LYS A NZ    1 
ATOM   1797 N  N     . PRO A 1 235 ? 62.671 2.419   10.063  1.00 13.82 ? 232  PRO A N     1 
ATOM   1798 C  CA    . PRO A 1 235 ? 62.623 3.039   8.735   1.00 13.75 ? 232  PRO A CA    1 
ATOM   1799 C  C     . PRO A 1 235 ? 64.003 3.196   8.103   1.00 12.24 ? 232  PRO A C     1 
ATOM   1800 O  O     . PRO A 1 235 ? 65.031 2.987   8.766   1.00 12.50 ? 232  PRO A O     1 
ATOM   1801 C  CB    . PRO A 1 235 ? 62.067 4.432   9.046   1.00 12.55 ? 232  PRO A CB    1 
ATOM   1802 C  CG    . PRO A 1 235 ? 62.690 4.756   10.394  1.00 16.86 ? 232  PRO A CG    1 
ATOM   1803 C  CD    . PRO A 1 235 ? 62.774 3.429   11.133  1.00 17.64 ? 232  PRO A CD    1 
ATOM   1804 N  N     . ASN A 1 236 ? 64.008 3.570   6.825   1.00 12.13 ? 233  ASN A N     1 
ATOM   1805 C  CA    . ASN A 1 236 ? 65.225 3.982   6.133   1.00 12.29 ? 233  ASN A CA    1 
ATOM   1806 C  C     . ASN A 1 236 ? 66.326 2.920   6.102   1.00 11.70 ? 233  ASN A C     1 
ATOM   1807 O  O     . ASN A 1 236 ? 67.504 3.249   6.204   1.00 11.38 ? 233  ASN A O     1 
ATOM   1808 C  CB    . ASN A 1 236 ? 65.753 5.298   6.741   1.00 12.81 ? 233  ASN A CB    1 
ATOM   1809 C  CG    . ASN A 1 236 ? 66.832 5.949   5.887   1.00 17.75 ? 233  ASN A CG    1 
ATOM   1810 O  OD1   . ASN A 1 236 ? 66.800 5.857   4.666   1.00 15.51 ? 233  ASN A OD1   1 
ATOM   1811 N  ND2   . ASN A 1 236 ? 67.791 6.601   6.530   1.00 21.51 ? 233  ASN A ND2   1 
ATOM   1812 N  N     . ARG A 1 237 ? 65.945 1.648   5.969   1.00 9.97  ? 234  ARG A N     1 
ATOM   1813 C  CA    . ARG A 1 237 ? 66.916 0.549   5.898   1.00 9.55  ? 234  ARG A CA    1 
ATOM   1814 C  C     . ARG A 1 237 ? 66.386 -0.511  4.957   1.00 9.79  ? 234  ARG A C     1 
ATOM   1815 O  O     . ARG A 1 237 ? 65.195 -0.547  4.669   1.00 12.42 ? 234  ARG A O     1 
ATOM   1816 C  CB    . ARG A 1 237 ? 67.114 -0.104  7.273   1.00 12.85 ? 234  ARG A CB    1 
ATOM   1817 C  CG    . ARG A 1 237 ? 67.755 0.803   8.319   1.00 14.13 ? 234  ARG A CG    1 
ATOM   1818 C  CD    . ARG A 1 237 ? 69.196 1.105   7.945   1.00 19.59 ? 234  ARG A CD    1 
ATOM   1819 N  NE    . ARG A 1 237 ? 69.907 1.819   9.009   1.00 23.25 ? 234  ARG A NE    1 
ATOM   1820 C  CZ    . ARG A 1 237 ? 69.937 3.143   9.130   1.00 23.50 ? 234  ARG A CZ    1 
ATOM   1821 N  NH1   . ARG A 1 237 ? 69.294 3.910   8.258   1.00 22.89 ? 234  ARG A NH1   1 
ATOM   1822 N  NH2   . ARG A 1 237 ? 70.612 3.706   10.125  1.00 25.47 ? 234  ARG A NH2   1 
ATOM   1823 N  N     . GLN A 1 238 ? 67.262 -1.398  4.498   1.00 7.66  ? 235  GLN A N     1 
ATOM   1824 C  CA    . GLN A 1 238 ? 66.810 -2.507  3.664   1.00 7.33  ? 235  GLN A CA    1 
ATOM   1825 C  C     . GLN A 1 238 ? 67.312 -3.827  4.212   1.00 8.79  ? 235  GLN A C     1 
ATOM   1826 O  O     . GLN A 1 238 ? 68.332 -3.869  4.891   1.00 9.89  ? 235  GLN A O     1 
ATOM   1827 C  CB    . GLN A 1 238 ? 67.247 -2.335  2.211   1.00 8.91  ? 235  GLN A CB    1 
ATOM   1828 C  CG    . GLN A 1 238 ? 68.761 -2.178  2.025   1.00 11.71 ? 235  GLN A CG    1 
ATOM   1829 C  CD    . GLN A 1 238 ? 69.120 -1.904  0.575   1.00 14.29 ? 235  GLN A CD    1 
ATOM   1830 O  OE1   . GLN A 1 238 ? 68.724 -0.881  0.007   1.00 13.77 ? 235  GLN A OE1   1 
ATOM   1831 N  NE2   . GLN A 1 238 ? 69.848 -2.829  -0.040  1.00 9.77  ? 235  GLN A NE2   1 
ATOM   1832 N  N     . THR A 1 239 ? 66.580 -4.895  3.912   1.00 8.55  ? 236  THR A N     1 
ATOM   1833 C  CA    . THR A 1 239 ? 66.845 -6.197  4.510   1.00 10.49 ? 236  THR A CA    1 
ATOM   1834 C  C     . THR A 1 239 ? 66.884 -7.283  3.446   1.00 11.53 ? 236  THR A C     1 
ATOM   1835 O  O     . THR A 1 239 ? 65.981 -7.394  2.617   1.00 9.57  ? 236  THR A O     1 
ATOM   1836 C  CB    . THR A 1 239 ? 65.787 -6.527  5.570   1.00 8.88  ? 236  THR A CB    1 
ATOM   1837 O  OG1   . THR A 1 239 ? 65.770 -5.483  6.541   1.00 11.56 ? 236  THR A OG1   1 
ATOM   1838 C  CG2   . THR A 1 239 ? 66.105 -7.842  6.297   1.00 10.92 ? 236  THR A CG2   1 
ATOM   1839 N  N     . LEU A 1 240 ? 67.944 -8.089  3.487   1.00 9.10  ? 237  LEU A N     1 
ATOM   1840 C  CA    . LEU A 1 240 ? 68.099 -9.222  2.593   1.00 6.93  ? 237  LEU A CA    1 
ATOM   1841 C  C     . LEU A 1 240 ? 67.687 -10.498 3.327   1.00 10.68 ? 237  LEU A C     1 
ATOM   1842 O  O     . LEU A 1 240 ? 68.229 -10.817 4.382   1.00 10.29 ? 237  LEU A O     1 
ATOM   1843 C  CB    . LEU A 1 240 ? 69.556 -9.305  2.120   1.00 8.64  ? 237  LEU A CB    1 
ATOM   1844 C  CG    . LEU A 1 240 ? 69.935 -10.361 1.075   1.00 10.76 ? 237  LEU A CG    1 
ATOM   1845 C  CD1   . LEU A 1 240 ? 71.253 -9.985  0.389   1.00 10.68 ? 237  LEU A CD1   1 
ATOM   1846 C  CD2   . LEU A 1 240 ? 70.021 -11.774 1.671   1.00 13.32 ? 237  LEU A CD2   1 
ATOM   1847 N  N     . VAL A 1 241 ? 66.699 -11.200 2.782   1.00 8.65  ? 238  VAL A N     1 
ATOM   1848 C  CA    . VAL A 1 241 ? 66.259 -12.470 3.342   1.00 10.30 ? 238  VAL A CA    1 
ATOM   1849 C  C     . VAL A 1 241 ? 66.625 -13.575 2.358   1.00 12.85 ? 238  VAL A C     1 
ATOM   1850 O  O     . VAL A 1 241 ? 66.009 -13.697 1.303   1.00 10.37 ? 238  VAL A O     1 
ATOM   1851 C  CB    . VAL A 1 241 ? 64.741 -12.475 3.599   1.00 9.47  ? 238  VAL A CB    1 
ATOM   1852 C  CG1   . VAL A 1 241 ? 64.221 -13.923 3.767   1.00 12.54 ? 238  VAL A CG1   1 
ATOM   1853 C  CG2   . VAL A 1 241 ? 64.396 -11.606 4.803   1.00 8.45  ? 238  VAL A CG2   1 
ATOM   1854 N  N     . SER A 1 242 ? 67.650 -14.356 2.696   1.00 10.63 ? 239  SER A N     1 
ATOM   1855 C  CA    . SER A 1 242 ? 68.102 -15.449 1.840   1.00 12.85 ? 239  SER A CA    1 
ATOM   1856 C  C     . SER A 1 242 ? 67.242 -16.709 1.984   1.00 7.61  ? 239  SER A C     1 
ATOM   1857 O  O     . SER A 1 242 ? 66.492 -16.858 2.937   1.00 9.18  ? 239  SER A O     1 
ATOM   1858 C  CB    . SER A 1 242 ? 69.558 -15.793 2.159   1.00 14.45 ? 239  SER A CB    1 
ATOM   1859 O  OG    . SER A 1 242 ? 69.657 -16.245 3.497   1.00 12.10 ? 239  SER A OG    1 
ATOM   1860 N  N     . HIS A 1 243 ? 67.337 -17.615 1.020   1.00 9.02  ? 240  HIS A N     1 
ATOM   1861 C  CA    . HIS A 1 243 ? 66.600 -18.862 1.135   1.00 10.11 ? 240  HIS A CA    1 
ATOM   1862 C  C     . HIS A 1 243 ? 66.994 -19.604 2.419   1.00 12.82 ? 240  HIS A C     1 
ATOM   1863 O  O     . HIS A 1 243 ? 66.143 -20.165 3.115   1.00 9.26  ? 240  HIS A O     1 
ATOM   1864 C  CB    . HIS A 1 243 ? 66.822 -19.747 -0.098  1.00 11.28 ? 240  HIS A CB    1 
ATOM   1865 C  CG    . HIS A 1 243 ? 66.043 -21.027 -0.062  1.00 13.82 ? 240  HIS A CG    1 
ATOM   1866 N  ND1   . HIS A 1 243 ? 64.684 -21.072 -0.289  1.00 15.57 ? 240  HIS A ND1   1 
ATOM   1867 C  CD2   . HIS A 1 243 ? 66.431 -22.295 0.199   1.00 21.04 ? 240  HIS A CD2   1 
ATOM   1868 C  CE1   . HIS A 1 243 ? 64.272 -22.328 -0.185  1.00 19.88 ? 240  HIS A CE1   1 
ATOM   1869 N  NE2   . HIS A 1 243 ? 65.304 -23.086 0.116   1.00 18.64 ? 240  HIS A NE2   1 
ATOM   1870 N  N     . GLY A 1 244 ? 68.289 -19.580 2.732   1.00 12.21 ? 241  GLY A N     1 
ATOM   1871 C  CA    . GLY A 1 244 ? 68.808 -20.278 3.899   1.00 10.21 ? 241  GLY A CA    1 
ATOM   1872 C  C     . GLY A 1 244 ? 68.313 -19.714 5.217   1.00 11.08 ? 241  GLY A C     1 
ATOM   1873 O  O     . GLY A 1 244 ? 68.254 -20.430 6.215   1.00 12.87 ? 241  GLY A O     1 
ATOM   1874 N  N     . SER A 1 245 ? 67.941 -18.436 5.221   1.00 9.34  ? 242  SER A N     1 
ATOM   1875 C  CA    . SER A 1 245 ? 67.434 -17.787 6.424   1.00 8.79  ? 242  SER A CA    1 
ATOM   1876 C  C     . SER A 1 245 ? 66.002 -18.186 6.774   1.00 10.94 ? 242  SER A C     1 
ATOM   1877 O  O     . SER A 1 245 ? 65.542 -17.925 7.884   1.00 10.95 ? 242  SER A O     1 
ATOM   1878 C  CB    . SER A 1 245 ? 67.513 -16.260 6.299   1.00 9.94  ? 242  SER A CB    1 
ATOM   1879 O  OG    . SER A 1 245 ? 66.425 -15.753 5.534   1.00 11.48 ? 242  SER A OG    1 
ATOM   1880 N  N     . VAL A 1 246 ? 65.303 -18.828 5.846   1.00 9.42  ? 243  VAL A N     1 
ATOM   1881 C  CA    . VAL A 1 246 ? 63.876 -19.102 6.041   1.00 9.40  ? 243  VAL A CA    1 
ATOM   1882 C  C     . VAL A 1 246 ? 63.515 -20.042 7.210   1.00 8.69  ? 243  VAL A C     1 
ATOM   1883 O  O     . VAL A 1 246 ? 62.639 -19.721 8.002   1.00 9.04  ? 243  VAL A O     1 
ATOM   1884 C  CB    . VAL A 1 246 ? 63.189 -19.539 4.731   1.00 8.40  ? 243  VAL A CB    1 
ATOM   1885 C  CG1   . VAL A 1 246 ? 61.755 -20.067 5.011   1.00 12.51 ? 243  VAL A CG1   1 
ATOM   1886 C  CG2   . VAL A 1 246 ? 63.154 -18.370 3.777   1.00 9.78  ? 243  VAL A CG2   1 
ATOM   1887 N  N     . PRO A 1 247 ? 64.218 -21.177 7.349   1.00 10.27 ? 244  PRO A N     1 
ATOM   1888 C  CA    . PRO A 1 247 ? 63.798 -22.055 8.448   1.00 10.87 ? 244  PRO A CA    1 
ATOM   1889 C  C     . PRO A 1 247 ? 63.839 -21.397 9.835   1.00 9.90  ? 244  PRO A C     1 
ATOM   1890 O  O     . PRO A 1 247 ? 62.892 -21.556 10.597  1.00 10.77 ? 244  PRO A O     1 
ATOM   1891 C  CB    . PRO A 1 247 ? 64.783 -23.229 8.363   1.00 12.54 ? 244  PRO A CB    1 
ATOM   1892 C  CG    . PRO A 1 247 ? 65.169 -23.281 6.903   1.00 14.30 ? 244  PRO A CG    1 
ATOM   1893 C  CD    . PRO A 1 247 ? 65.209 -21.824 6.462   1.00 9.82  ? 244  PRO A CD    1 
ATOM   1894 N  N     . GLN A 1 248 ? 64.887 -20.649 10.152  1.00 10.37 ? 245  GLN A N     1 
ATOM   1895 C  CA    . GLN A 1 248 ? 64.947 -20.002 11.461  1.00 12.52 ? 245  GLN A CA    1 
ATOM   1896 C  C     . GLN A 1 248 ? 63.965 -18.831 11.545  1.00 12.23 ? 245  GLN A C     1 
ATOM   1897 O  O     . GLN A 1 248 ? 63.297 -18.629 12.565  1.00 9.90  ? 245  GLN A O     1 
ATOM   1898 C  CB    . GLN A 1 248 ? 66.366 -19.527 11.778  1.00 12.06 ? 245  GLN A CB    1 
ATOM   1899 C  CG    . GLN A 1 248 ? 67.351 -20.660 12.024  1.00 17.39 ? 245  GLN A CG    1 
ATOM   1900 C  CD    . GLN A 1 248 ? 68.473 -20.273 12.978  1.00 29.03 ? 245  GLN A CD    1 
ATOM   1901 O  OE1   . GLN A 1 248 ? 68.249 -20.126 14.183  1.00 35.92 ? 245  GLN A OE1   1 
ATOM   1902 N  NE2   . GLN A 1 248 ? 69.687 -20.118 12.446  1.00 21.74 ? 245  GLN A NE2   1 
ATOM   1903 N  N     . LEU A 1 249 ? 63.887 -18.048 10.471  1.00 9.14  ? 246  LEU A N     1 
ATOM   1904 C  CA    . LEU A 1 249 ? 62.929 -16.938 10.428  1.00 10.39 ? 246  LEU A CA    1 
ATOM   1905 C  C     . LEU A 1 249 ? 61.491 -17.411 10.660  1.00 9.77  ? 246  LEU A C     1 
ATOM   1906 O  O     . LEU A 1 249 ? 60.742 -16.813 11.439  1.00 10.54 ? 246  LEU A O     1 
ATOM   1907 C  CB    . LEU A 1 249 ? 63.039 -16.200 9.092   1.00 9.62  ? 246  LEU A CB    1 
ATOM   1908 C  CG    . LEU A 1 249 ? 62.166 -14.954 8.910   1.00 13.57 ? 246  LEU A CG    1 
ATOM   1909 C  CD1   . LEU A 1 249 ? 62.500 -13.897 9.960   1.00 16.45 ? 246  LEU A CD1   1 
ATOM   1910 C  CD2   . LEU A 1 249 ? 62.325 -14.378 7.505   1.00 12.79 ? 246  LEU A CD2   1 
ATOM   1911 N  N     . PHE A 1 250 ? 61.105 -18.489 9.989   1.00 10.16 ? 247  PHE A N     1 
ATOM   1912 C  CA    . PHE A 1 250 ? 59.720 -18.941 10.039  1.00 10.33 ? 247  PHE A CA    1 
ATOM   1913 C  C     . PHE A 1 250 ? 59.402 -19.721 11.298  1.00 10.67 ? 247  PHE A C     1 
ATOM   1914 O  O     . PHE A 1 250 ? 58.222 -19.918 11.626  1.00 10.51 ? 247  PHE A O     1 
ATOM   1915 C  CB    . PHE A 1 250 ? 59.376 -19.789 8.815   1.00 7.17  ? 247  PHE A CB    1 
ATOM   1916 C  CG    . PHE A 1 250 ? 58.990 -18.986 7.602   1.00 8.67  ? 247  PHE A CG    1 
ATOM   1917 C  CD1   . PHE A 1 250 ? 58.509 -19.618 6.473   1.00 9.53  ? 247  PHE A CD1   1 
ATOM   1918 C  CD2   . PHE A 1 250 ? 59.130 -17.601 7.594   1.00 11.23 ? 247  PHE A CD2   1 
ATOM   1919 C  CE1   . PHE A 1 250 ? 58.143 -18.890 5.349   1.00 12.76 ? 247  PHE A CE1   1 
ATOM   1920 C  CE2   . PHE A 1 250 ? 58.779 -16.860 6.476   1.00 12.09 ? 247  PHE A CE2   1 
ATOM   1921 C  CZ    . PHE A 1 250 ? 58.275 -17.510 5.351   1.00 11.96 ? 247  PHE A CZ    1 
ATOM   1922 N  N     . SER A 1 251 ? 60.443 -20.149 12.011  1.00 8.05  ? 248  SER A N     1 
ATOM   1923 C  CA    . SER A 1 251 ? 60.238 -21.025 13.158  1.00 8.59  ? 248  SER A CA    1 
ATOM   1924 C  C     . SER A 1 251 ? 59.475 -20.312 14.274  1.00 11.55 ? 248  SER A C     1 
ATOM   1925 O  O     . SER A 1 251 ? 58.816 -20.958 15.078  1.00 10.54 ? 248  SER A O     1 
ATOM   1926 C  CB    . SER A 1 251 ? 61.566 -21.603 13.680  1.00 10.29 ? 248  SER A CB    1 
ATOM   1927 O  OG    . SER A 1 251 ? 62.329 -20.630 14.379  1.00 10.10 ? 248  SER A OG    1 
ATOM   1928 N  N     . GLN A 1 252 ? 59.556 -18.986 14.320  1.00 11.70 ? 249  GLN A N     1 
ATOM   1929 C  CA    . GLN A 1 252 ? 58.778 -18.244 15.307  1.00 14.62 ? 249  GLN A CA    1 
ATOM   1930 C  C     . GLN A 1 252 ? 57.946 -17.131 14.675  1.00 13.76 ? 249  GLN A C     1 
ATOM   1931 O  O     . GLN A 1 252 ? 57.615 -16.151 15.335  1.00 15.26 ? 249  GLN A O     1 
ATOM   1932 C  CB    . GLN A 1 252 ? 59.697 -17.626 16.354  1.00 16.77 ? 249  GLN A CB    1 
ATOM   1933 C  CG    . GLN A 1 252 ? 60.630 -18.576 17.054  1.00 14.93 ? 249  GLN A CG    1 
ATOM   1934 C  CD    . GLN A 1 252 ? 61.368 -17.848 18.144  1.00 27.06 ? 249  GLN A CD    1 
ATOM   1935 O  OE1   . GLN A 1 252 ? 60.838 -17.643 19.241  1.00 24.48 ? 249  GLN A OE1   1 
ATOM   1936 N  NE2   . GLN A 1 252 ? 62.575 -17.392 17.831  1.00 22.37 ? 249  GLN A NE2   1 
ATOM   1937 N  N     . MET A 1 253 ? 57.631 -17.271 13.395  1.00 9.66  ? 250  MET A N     1 
ATOM   1938 C  CA    . MET A 1 253 ? 56.927 -16.222 12.682  1.00 14.96 ? 250  MET A CA    1 
ATOM   1939 C  C     . MET A 1 253 ? 55.437 -16.524 12.728  1.00 8.55  ? 250  MET A C     1 
ATOM   1940 O  O     . MET A 1 253 ? 54.993 -17.528 12.176  1.00 11.52 ? 250  MET A O     1 
ATOM   1941 C  CB    . MET A 1 253 ? 57.439 -16.147 11.237  1.00 14.00 ? 250  MET A CB    1 
ATOM   1942 C  CG    . MET A 1 253 ? 56.758 -15.089 10.345  1.00 17.71 ? 250  MET A CG    1 
ATOM   1943 S  SD    . MET A 1 253 ? 57.092 -13.400 10.868  1.00 19.16 ? 250  MET A SD    1 
ATOM   1944 C  CE    . MET A 1 253 ? 58.885 -13.247 10.725  1.00 14.59 ? 250  MET A CE    1 
ATOM   1945 N  N     . PRO A 1 254 ? 54.656 -15.660 13.394  1.00 13.76 ? 251  PRO A N     1 
ATOM   1946 C  CA    . PRO A 1 254 ? 53.211 -15.903 13.434  1.00 13.89 ? 251  PRO A CA    1 
ATOM   1947 C  C     . PRO A 1 254 ? 52.651 -15.917 12.012  1.00 10.85 ? 251  PRO A C     1 
ATOM   1948 O  O     . PRO A 1 254 ? 53.022 -15.096 11.183  1.00 9.21  ? 251  PRO A O     1 
ATOM   1949 C  CB    . PRO A 1 254 ? 52.665 -14.705 14.232  1.00 13.34 ? 251  PRO A CB    1 
ATOM   1950 C  CG    . PRO A 1 254 ? 53.841 -14.167 14.971  1.00 17.81 ? 251  PRO A CG    1 
ATOM   1951 C  CD    . PRO A 1 254 ? 55.021 -14.396 14.050  1.00 12.47 ? 251  PRO A CD    1 
ATOM   1952 N  N     . ILE A 1 255 ? 51.771 -16.873 11.749  1.00 12.90 ? 252  ILE A N     1 
ATOM   1953 C  CA    . ILE A 1 255 ? 51.157 -17.045 10.445  1.00 11.72 ? 252  ILE A CA    1 
ATOM   1954 C  C     . ILE A 1 255 ? 50.544 -15.746 9.894   1.00 10.18 ? 252  ILE A C     1 
ATOM   1955 O  O     . ILE A 1 255 ? 50.684 -15.459 8.707   1.00 11.13 ? 252  ILE A O     1 
ATOM   1956 C  CB    . ILE A 1 255 ? 50.165 -18.241 10.486  1.00 14.41 ? 252  ILE A CB    1 
ATOM   1957 C  CG1   . ILE A 1 255 ? 50.980 -19.550 10.548  1.00 17.58 ? 252  ILE A CG1   1 
ATOM   1958 C  CG2   . ILE A 1 255 ? 49.225 -18.248 9.281   1.00 13.18 ? 252  ILE A CG2   1 
ATOM   1959 C  CD1   . ILE A 1 255 ? 50.223 -20.719 11.100  1.00 17.85 ? 252  ILE A CD1   1 
ATOM   1960 N  N     . ARG A 1 256 ? 49.918 -14.943 10.759  1.00 9.25  ? 253  ARG A N     1 
ATOM   1961 C  CA    . ARG A 1 256 ? 49.235 -13.730 10.315  1.00 11.75 ? 253  ARG A CA    1 
ATOM   1962 C  C     . ARG A 1 256 ? 50.175 -12.674 9.735   1.00 16.53 ? 253  ARG A C     1 
ATOM   1963 O  O     . ARG A 1 256 ? 49.725 -11.709 9.116   1.00 13.18 ? 253  ARG A O     1 
ATOM   1964 C  CB    . ARG A 1 256 ? 48.433 -13.110 11.460  1.00 13.53 ? 253  ARG A CB    1 
ATOM   1965 C  CG    . ARG A 1 256 ? 49.317 -12.491 12.536  1.00 15.13 ? 253  ARG A CG    1 
ATOM   1966 C  CD    . ARG A 1 256 ? 48.510 -11.965 13.722  1.00 21.92 ? 253  ARG A CD    1 
ATOM   1967 N  NE    . ARG A 1 256 ? 49.390 -11.495 14.796  1.00 21.54 ? 253  ARG A NE    1 
ATOM   1968 C  CZ    . ARG A 1 256 ? 49.828 -12.257 15.795  1.00 25.63 ? 253  ARG A CZ    1 
ATOM   1969 N  NH1   . ARG A 1 256 ? 49.468 -13.533 15.859  1.00 24.94 ? 253  ARG A NH1   1 
ATOM   1970 N  NH2   . ARG A 1 256 ? 50.630 -11.747 16.727  1.00 23.45 ? 253  ARG A NH2   1 
ATOM   1971 N  N     . LYS A 1 257 ? 51.477 -12.836 9.944   1.00 14.10 ? 254  LYS A N     1 
ATOM   1972 C  CA    . LYS A 1 257 ? 52.437 -11.849 9.436   1.00 12.50 ? 254  LYS A CA    1 
ATOM   1973 C  C     . LYS A 1 257 ? 52.688 -11.947 7.941   1.00 14.27 ? 254  LYS A C     1 
ATOM   1974 O  O     . LYS A 1 257 ? 53.238 -11.019 7.327   1.00 12.98 ? 254  LYS A O     1 
ATOM   1975 C  CB    . LYS A 1 257 ? 53.774 -11.954 10.170  1.00 11.12 ? 254  LYS A CB    1 
ATOM   1976 C  CG    . LYS A 1 257 ? 53.667 -11.750 11.664  1.00 21.61 ? 254  LYS A CG    1 
ATOM   1977 C  CD    . LYS A 1 257 ? 53.029 -10.425 12.013  1.00 24.52 ? 254  LYS A CD    1 
ATOM   1978 C  CE    . LYS A 1 257 ? 53.145 -10.162 13.514  1.00 34.71 ? 254  LYS A CE    1 
ATOM   1979 N  NZ    . LYS A 1 257 ? 52.521 -8.864  13.914  1.00 33.01 ? 254  LYS A NZ    1 
ATOM   1980 N  N     . ILE A 1 258 ? 52.315 -13.080 7.354   1.00 10.74 ? 255  ILE A N     1 
ATOM   1981 C  CA    . ILE A 1 258 ? 52.622 -13.329 5.954   1.00 9.97  ? 255  ILE A CA    1 
ATOM   1982 C  C     . ILE A 1 258 ? 51.497 -12.751 5.110   1.00 12.40 ? 255  ILE A C     1 
ATOM   1983 O  O     . ILE A 1 258 ? 50.321 -12.919 5.436   1.00 13.48 ? 255  ILE A O     1 
ATOM   1984 C  CB    . ILE A 1 258 ? 52.779 -14.834 5.684   1.00 13.25 ? 255  ILE A CB    1 
ATOM   1985 C  CG1   . ILE A 1 258 ? 54.114 -15.341 6.251   1.00 17.42 ? 255  ILE A CG1   1 
ATOM   1986 C  CG2   . ILE A 1 258 ? 52.699 -15.125 4.208   1.00 12.21 ? 255  ILE A CG2   1 
ATOM   1987 C  CD1   . ILE A 1 258 ? 54.215 -15.253 7.741   1.00 22.60 ? 255  ILE A CD1   1 
ATOM   1988 N  N     . ARG A 1 259 ? 51.851 -12.055 4.038   1.00 14.19 ? 256  ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 259 ? 50.832 -11.381 3.238   1.00 11.75 ? 256  ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 259 ? 49.792 -12.374 2.700   1.00 15.15 ? 256  ARG A C     1 
ATOM   1991 O  O     . ARG A 1 259 ? 50.142 -13.411 2.127   1.00 13.80 ? 256  ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 259 ? 51.465 -10.564 2.102   1.00 12.97 ? 256  ARG A CB    1 
ATOM   1993 C  CG    . ARG A 1 259 ? 50.455 -9.753  1.310   1.00 18.14 ? 256  ARG A CG    1 
ATOM   1994 C  CD    . ARG A 1 259 ? 51.097 -9.048  0.110   1.00 22.14 ? 256  ARG A CD    1 
ATOM   1995 N  NE    . ARG A 1 259 ? 50.182 -8.056  -0.466  1.00 27.82 ? 256  ARG A NE    1 
ATOM   1996 C  CZ    . ARG A 1 259 ? 49.216 -8.348  -1.334  1.00 35.31 ? 256  ARG A CZ    1 
ATOM   1997 N  NH1   . ARG A 1 259 ? 49.036 -9.602  -1.727  1.00 35.92 ? 256  ARG A NH1   1 
ATOM   1998 N  NH2   . ARG A 1 259 ? 48.424 -7.392  -1.804  1.00 31.98 ? 256  ARG A NH2   1 
ATOM   1999 N  N     . SER A 1 260 ? 48.521 -12.027 2.912   1.00 15.70 ? 257  SER A N     1 
ATOM   2000 C  CA    . SER A 1 260 ? 47.339 -12.821 2.532   1.00 14.83 ? 257  SER A CA    1 
ATOM   2001 C  C     . SER A 1 260 ? 46.840 -13.751 3.644   1.00 16.59 ? 257  SER A C     1 
ATOM   2002 O  O     . SER A 1 260 ? 45.755 -14.324 3.531   1.00 14.67 ? 257  SER A O     1 
ATOM   2003 C  CB    . SER A 1 260 ? 47.551 -13.620 1.239   1.00 14.60 ? 257  SER A CB    1 
ATOM   2004 O  OG    . SER A 1 260 ? 48.151 -14.879 1.510   1.00 17.96 ? 257  SER A OG    1 
ATOM   2005 N  N     . LEU A 1 261 ? 47.631 -13.914 4.705   1.00 11.08 ? 258  LEU A N     1 
ATOM   2006 C  CA    . LEU A 1 261 ? 47.207 -14.743 5.832   1.00 9.61  ? 258  LEU A CA    1 
ATOM   2007 C  C     . LEU A 1 261 ? 46.789 -13.920 7.045   1.00 11.39 ? 258  LEU A C     1 
ATOM   2008 O  O     . LEU A 1 261 ? 46.646 -14.450 8.150   1.00 14.51 ? 258  LEU A O     1 
ATOM   2009 C  CB    . LEU A 1 261 ? 48.319 -15.725 6.226   1.00 11.24 ? 258  LEU A CB    1 
ATOM   2010 C  CG    . LEU A 1 261 ? 48.762 -16.655 5.093   1.00 11.29 ? 258  LEU A CG    1 
ATOM   2011 C  CD1   . LEU A 1 261 ? 49.890 -17.562 5.536   1.00 11.33 ? 258  LEU A CD1   1 
ATOM   2012 C  CD2   . LEU A 1 261 ? 47.601 -17.499 4.525   1.00 13.86 ? 258  LEU A CD2   1 
ATOM   2013 N  N     . GLY A 1 262 ? 46.571 -12.625 6.848   1.00 12.97 ? 259  GLY A N     1 
ATOM   2014 C  CA    . GLY A 1 262 ? 46.255 -11.757 7.969   1.00 12.83 ? 259  GLY A CA    1 
ATOM   2015 C  C     . GLY A 1 262 ? 44.792 -11.764 8.380   1.00 16.14 ? 259  GLY A C     1 
ATOM   2016 O  O     . GLY A 1 262 ? 44.419 -11.116 9.353   1.00 18.08 ? 259  GLY A O     1 
ATOM   2017 N  N     . GLY A 1 263 ? 43.970 -12.501 7.640   1.00 14.78 ? 260  GLY A N     1 
ATOM   2018 C  CA    . GLY A 1 263 ? 42.527 -12.479 7.820   1.00 12.28 ? 260  GLY A CA    1 
ATOM   2019 C  C     . GLY A 1 263 ? 41.939 -13.832 8.180   1.00 17.19 ? 260  GLY A C     1 
ATOM   2020 O  O     . GLY A 1 263 ? 42.517 -14.577 8.984   1.00 15.72 ? 260  GLY A O     1 
ATOM   2021 N  N     . LYS A 1 264 ? 40.790 -14.159 7.587   1.00 14.05 ? 261  LYS A N     1 
ATOM   2022 C  CA    . LYS A 1 264 ? 40.072 -15.383 7.934   1.00 15.24 ? 261  LYS A CA    1 
ATOM   2023 C  C     . LYS A 1 264 ? 40.815 -16.669 7.576   1.00 13.54 ? 261  LYS A C     1 
ATOM   2024 O  O     . LYS A 1 264 ? 40.789 -17.619 8.350   1.00 17.12 ? 261  LYS A O     1 
ATOM   2025 C  CB    . LYS A 1 264 ? 38.661 -15.391 7.326   1.00 15.40 ? 261  LYS A CB    1 
ATOM   2026 C  CG    . LYS A 1 264 ? 37.736 -14.359 7.957   1.00 23.96 ? 261  LYS A CG    1 
ATOM   2027 C  CD    . LYS A 1 264 ? 36.444 -14.211 7.151   1.00 29.52 ? 261  LYS A CD    1 
ATOM   2028 C  CE    . LYS A 1 264 ? 35.520 -13.180 7.780   1.00 44.78 ? 261  LYS A CE    1 
ATOM   2029 N  NZ    . LYS A 1 264 ? 34.263 -13.025 6.998   1.00 39.71 ? 261  LYS A NZ    1 
ATOM   2030 N  N     . LEU A 1 265 ? 41.469 -16.702 6.415   1.00 12.11 ? 262  LEU A N     1 
ATOM   2031 C  CA    . LEU A 1 265 ? 42.215 -17.894 6.010   1.00 14.84 ? 262  LEU A CA    1 
ATOM   2032 C  C     . LEU A 1 265 ? 43.295 -18.224 7.045   1.00 14.82 ? 262  LEU A C     1 
ATOM   2033 O  O     . LEU A 1 265 ? 43.418 -19.379 7.489   1.00 13.11 ? 262  LEU A O     1 
ATOM   2034 C  CB    . LEU A 1 265 ? 42.854 -17.710 4.632   1.00 14.58 ? 262  LEU A CB    1 
ATOM   2035 C  CG    . LEU A 1 265 ? 43.711 -18.871 4.103   1.00 11.63 ? 262  LEU A CG    1 
ATOM   2036 C  CD1   . LEU A 1 265 ? 42.911 -20.167 4.082   1.00 16.99 ? 262  LEU A CD1   1 
ATOM   2037 C  CD2   . LEU A 1 265 ? 44.276 -18.543 2.711   1.00 13.60 ? 262  LEU A CD2   1 
ATOM   2038 N  N     . GLY A 1 266 ? 44.074 -17.210 7.418   1.00 14.03 ? 263  GLY A N     1 
ATOM   2039 C  CA    . GLY A 1 266 ? 45.152 -17.384 8.379   1.00 14.88 ? 263  GLY A CA    1 
ATOM   2040 C  C     . GLY A 1 266 ? 44.631 -17.865 9.721   1.00 16.17 ? 263  GLY A C     1 
ATOM   2041 O  O     . GLY A 1 266 ? 45.260 -18.690 10.395  1.00 13.68 ? 263  GLY A O     1 
ATOM   2042 N  N     . ALA A 1 267 ? 43.468 -17.352 10.111  1.00 14.24 ? 264  ALA A N     1 
ATOM   2043 C  CA    . ALA A 1 267 ? 42.847 -17.780 11.353  1.00 15.87 ? 264  ALA A CA    1 
ATOM   2044 C  C     . ALA A 1 267 ? 42.431 -19.244 11.261  1.00 12.61 ? 264  ALA A C     1 
ATOM   2045 O  O     . ALA A 1 267 ? 42.531 -19.994 12.233  1.00 15.37 ? 264  ALA A O     1 
ATOM   2046 C  CB    . ALA A 1 267 ? 41.640 -16.898 11.676  1.00 16.13 ? 264  ALA A CB    1 
ATOM   2047 N  N     . SER A 1 268 ? 41.976 -19.658 10.084  1.00 14.73 ? 265  SER A N     1 
ATOM   2048 C  CA    . SER A 1 268 ? 41.532 -21.032 9.923   1.00 15.84 ? 265  SER A CA    1 
ATOM   2049 C  C     . SER A 1 268 ? 42.730 -21.989 9.892   1.00 15.64 ? 265  SER A C     1 
ATOM   2050 O  O     . SER A 1 268 ? 42.637 -23.104 10.392  1.00 13.27 ? 265  SER A O     1 
ATOM   2051 C  CB    . SER A 1 268 ? 40.641 -21.192 8.691   1.00 15.61 ? 265  SER A CB    1 
ATOM   2052 O  OG    . SER A 1 268 ? 41.370 -20.992 7.500   1.00 25.35 ? 265  SER A OG    1 
ATOM   2053 N  N     . VAL A 1 269 ? 43.858 -21.544 9.335   1.00 13.45 ? 266  VAL A N     1 
ATOM   2054 C  CA    . VAL A 1 269 ? 45.073 -22.364 9.360   1.00 11.84 ? 266  VAL A CA    1 
ATOM   2055 C  C     . VAL A 1 269 ? 45.447 -22.651 10.821  1.00 15.87 ? 266  VAL A C     1 
ATOM   2056 O  O     . VAL A 1 269 ? 45.683 -23.798 11.226  1.00 14.74 ? 266  VAL A O     1 
ATOM   2057 C  CB    . VAL A 1 269 ? 46.254 -21.673 8.626   1.00 12.28 ? 266  VAL A CB    1 
ATOM   2058 C  CG1   . VAL A 1 269 ? 47.563 -22.411 8.894   1.00 18.81 ? 266  VAL A CG1   1 
ATOM   2059 C  CG2   . VAL A 1 269 ? 45.976 -21.594 7.116   1.00 15.69 ? 266  VAL A CG2   1 
ATOM   2060 N  N     . ILE A 1 270 ? 45.476 -21.591 11.619  1.00 13.05 ? 267  ILE A N     1 
ATOM   2061 C  CA    . ILE A 1 270 ? 45.791 -21.713 13.032  1.00 13.44 ? 267  ILE A CA    1 
ATOM   2062 C  C     . ILE A 1 270 ? 44.811 -22.645 13.746  1.00 14.12 ? 267  ILE A C     1 
ATOM   2063 O  O     . ILE A 1 270 ? 45.231 -23.559 14.467  1.00 15.96 ? 267  ILE A O     1 
ATOM   2064 C  CB    . ILE A 1 270 ? 45.797 -20.335 13.690  1.00 12.99 ? 267  ILE A CB    1 
ATOM   2065 C  CG1   . ILE A 1 270 ? 47.052 -19.563 13.263  1.00 17.16 ? 267  ILE A CG1   1 
ATOM   2066 C  CG2   . ILE A 1 270 ? 45.740 -20.457 15.194  1.00 21.83 ? 267  ILE A CG2   1 
ATOM   2067 C  CD1   . ILE A 1 270 ? 46.965 -18.090 13.560  1.00 21.21 ? 267  ILE A CD1   1 
ATOM   2068 N  N     . GLU A 1 271 ? 43.510 -22.419 13.540  1.00 14.20 ? 268  GLU A N     1 
ATOM   2069 C  CA    . GLU A 1 271 ? 42.487 -23.181 14.250  1.00 18.74 ? 268  GLU A CA    1 
ATOM   2070 C  C     . GLU A 1 271 ? 42.451 -24.649 13.859  1.00 19.95 ? 268  GLU A C     1 
ATOM   2071 O  O     . GLU A 1 271 ? 42.519 -25.529 14.719  1.00 17.07 ? 268  GLU A O     1 
ATOM   2072 C  CB    . GLU A 1 271 ? 41.100 -22.553 14.075  1.00 21.80 ? 268  GLU A CB    1 
ATOM   2073 C  CG    . GLU A 1 271 ? 39.973 -23.402 14.664  1.00 38.49 ? 268  GLU A CG    1 
ATOM   2074 C  CD    . GLU A 1 271 ? 38.877 -22.571 15.320  1.00 50.44 ? 268  GLU A CD    1 
ATOM   2075 O  OE1   . GLU A 1 271 ? 37.731 -23.065 15.410  1.00 50.25 ? 268  GLU A OE1   1 
ATOM   2076 O  OE2   . GLU A 1 271 ? 39.162 -21.433 15.757  1.00 56.52 ? 268  GLU A OE2   1 
ATOM   2077 N  N     . ILE A 1 272 ? 42.355 -24.905 12.559  1.00 18.55 ? 269  ILE A N     1 
ATOM   2078 C  CA    . ILE A 1 272 ? 42.234 -26.262 12.043  1.00 16.11 ? 269  ILE A CA    1 
ATOM   2079 C  C     . ILE A 1 272 ? 43.469 -27.132 12.309  1.00 19.53 ? 269  ILE A C     1 
ATOM   2080 O  O     . ILE A 1 272 ? 43.354 -28.304 12.682  1.00 17.13 ? 269  ILE A O     1 
ATOM   2081 C  CB    . ILE A 1 272 ? 41.913 -26.242 10.530  1.00 15.26 ? 269  ILE A CB    1 
ATOM   2082 C  CG1   . ILE A 1 272 ? 40.503 -25.692 10.296  1.00 21.90 ? 269  ILE A CG1   1 
ATOM   2083 C  CG2   . ILE A 1 272 ? 42.048 -27.644 9.937   1.00 18.92 ? 269  ILE A CG2   1 
ATOM   2084 C  CD1   . ILE A 1 272 ? 40.153 -25.476 8.834   1.00 27.80 ? 269  ILE A CD1   1 
ATOM   2085 N  N     . LEU A 1 273 ? 44.657 -26.570 12.112  1.00 19.25 ? 270  LEU A N     1 
ATOM   2086 C  CA    . LEU A 1 273 ? 45.879 -27.357 12.259  1.00 16.23 ? 270  LEU A CA    1 
ATOM   2087 C  C     . LEU A 1 273 ? 46.448 -27.329 13.668  1.00 18.33 ? 270  LEU A C     1 
ATOM   2088 O  O     . LEU A 1 273 ? 47.326 -28.125 13.999  1.00 18.26 ? 270  LEU A O     1 
ATOM   2089 C  CB    . LEU A 1 273 ? 46.943 -26.891 11.274  1.00 12.59 ? 270  LEU A CB    1 
ATOM   2090 C  CG    . LEU A 1 273 ? 46.506 -26.934 9.819   1.00 15.52 ? 270  LEU A CG    1 
ATOM   2091 C  CD1   . LEU A 1 273 ? 47.658 -26.490 8.915   1.00 14.46 ? 270  LEU A CD1   1 
ATOM   2092 C  CD2   . LEU A 1 273 ? 46.051 -28.330 9.469   1.00 23.85 ? 270  LEU A CD2   1 
ATOM   2093 N  N     . GLY A 1 274 ? 45.956 -26.405 14.487  1.00 16.16 ? 271  GLY A N     1 
ATOM   2094 C  CA    . GLY A 1 274 ? 46.442 -26.239 15.842  1.00 12.90 ? 271  GLY A CA    1 
ATOM   2095 C  C     . GLY A 1 274 ? 47.907 -25.837 15.898  1.00 16.56 ? 271  GLY A C     1 
ATOM   2096 O  O     . GLY A 1 274 ? 48.666 -26.377 16.698  1.00 22.02 ? 271  GLY A O     1 
ATOM   2097 N  N     . ILE A 1 275 ? 48.307 -24.902 15.040  1.00 12.49 ? 272  ILE A N     1 
ATOM   2098 C  CA    . ILE A 1 275 ? 49.676 -24.375 15.027  1.00 10.75 ? 272  ILE A CA    1 
ATOM   2099 C  C     . ILE A 1 275 ? 49.674 -22.854 15.187  1.00 12.96 ? 272  ILE A C     1 
ATOM   2100 O  O     . ILE A 1 275 ? 48.615 -22.233 15.126  1.00 16.30 ? 272  ILE A O     1 
ATOM   2101 C  CB    . ILE A 1 275 ? 50.411 -24.744 13.719  1.00 14.81 ? 272  ILE A CB    1 
ATOM   2102 C  CG1   . ILE A 1 275 ? 49.684 -24.164 12.495  1.00 14.04 ? 272  ILE A CG1   1 
ATOM   2103 C  CG2   . ILE A 1 275 ? 50.541 -26.253 13.594  1.00 13.93 ? 272  ILE A CG2   1 
ATOM   2104 C  CD1   . ILE A 1 275 ? 50.381 -24.480 11.177  1.00 13.88 ? 272  ILE A CD1   1 
ATOM   2105 N  N     . GLU A 1 276 ? 50.853 -22.261 15.398  1.00 11.31 ? 273  GLU A N     1 
ATOM   2106 C  CA    . GLU A 1 276 ? 50.990 -20.805 15.536  1.00 11.55 ? 273  GLU A CA    1 
ATOM   2107 C  C     . GLU A 1 276 ? 51.952 -20.170 14.521  1.00 14.58 ? 273  GLU A C     1 
ATOM   2108 O  O     . GLU A 1 276 ? 51.765 -19.018 14.120  1.00 13.88 ? 273  GLU A O     1 
ATOM   2109 C  CB    . GLU A 1 276 ? 51.477 -20.443 16.945  1.00 14.43 ? 273  GLU A CB    1 
ATOM   2110 C  CG    . GLU A 1 276 ? 50.597 -20.984 18.066  1.00 27.96 ? 273  GLU A CG    1 
ATOM   2111 C  CD    . GLU A 1 276 ? 51.251 -20.866 19.441  1.00 37.80 ? 273  GLU A CD    1 
ATOM   2112 O  OE1   . GLU A 1 276 ? 50.852 -21.626 20.354  1.00 48.46 ? 273  GLU A OE1   1 
ATOM   2113 O  OE2   . GLU A 1 276 ? 52.155 -20.017 19.611  1.00 34.34 ? 273  GLU A OE2   1 
ATOM   2114 N  N     . TYR A 1 277 ? 52.986 -20.905 14.125  1.00 11.95 ? 274  TYR A N     1 
ATOM   2115 C  CA    . TYR A 1 277 ? 54.062 -20.320 13.311  1.00 12.85 ? 274  TYR A CA    1 
ATOM   2116 C  C     . TYR A 1 277 ? 54.140 -20.896 11.909  1.00 10.15 ? 274  TYR A C     1 
ATOM   2117 O  O     . TYR A 1 277 ? 53.804 -22.062 11.683  1.00 11.63 ? 274  TYR A O     1 
ATOM   2118 C  CB    . TYR A 1 277 ? 55.419 -20.508 13.992  1.00 11.04 ? 274  TYR A CB    1 
ATOM   2119 C  CG    . TYR A 1 277 ? 55.437 -20.014 15.410  1.00 12.81 ? 274  TYR A CG    1 
ATOM   2120 C  CD1   . TYR A 1 277 ? 55.664 -20.887 16.468  1.00 14.75 ? 274  TYR A CD1   1 
ATOM   2121 C  CD2   . TYR A 1 277 ? 55.202 -18.678 15.696  1.00 15.10 ? 274  TYR A CD2   1 
ATOM   2122 C  CE1   . TYR A 1 277 ? 55.671 -20.434 17.778  1.00 17.34 ? 274  TYR A CE1   1 
ATOM   2123 C  CE2   . TYR A 1 277 ? 55.207 -18.217 17.003  1.00 14.16 ? 274  TYR A CE2   1 
ATOM   2124 C  CZ    . TYR A 1 277 ? 55.435 -19.099 18.034  1.00 18.78 ? 274  TYR A CZ    1 
ATOM   2125 O  OH    . TYR A 1 277 ? 55.440 -18.637 19.329  1.00 17.94 ? 274  TYR A OH    1 
ATOM   2126 N  N     . MET A 1 278 ? 54.638 -20.085 10.981  1.00 8.81  ? 275  MET A N     1 
ATOM   2127 C  CA    . MET A 1 278 ? 54.767 -20.496 9.580   1.00 11.40 ? 275  MET A CA    1 
ATOM   2128 C  C     . MET A 1 278 ? 55.527 -21.816 9.414   1.00 11.13 ? 275  MET A C     1 
ATOM   2129 O  O     . MET A 1 278 ? 55.139 -22.670 8.621   1.00 11.28 ? 275  MET A O     1 
ATOM   2130 C  CB    . MET A 1 278 ? 55.479 -19.414 8.765   1.00 14.38 ? 275  MET A CB    1 
ATOM   2131 C  CG    . MET A 1 278 ? 54.578 -18.368 8.170   1.00 26.07 ? 275  MET A CG    1 
ATOM   2132 S  SD    . MET A 1 278 ? 53.239 -18.984 7.116   1.00 18.27 ? 275  MET A SD    1 
ATOM   2133 C  CE    . MET A 1 278 ? 54.092 -19.633 5.693   1.00 22.60 ? 275  MET A CE    1 
ATOM   2134 N  N     . GLY A 1 279 ? 56.616 -21.976 10.156  1.00 10.14 ? 276  GLY A N     1 
ATOM   2135 C  CA    . GLY A 1 279 ? 57.478 -23.125 9.969   1.00 10.03 ? 276  GLY A CA    1 
ATOM   2136 C  C     . GLY A 1 279 ? 56.783 -24.434 10.302  1.00 14.21 ? 276  GLY A C     1 
ATOM   2137 O  O     . GLY A 1 279 ? 57.115 -25.477 9.746   1.00 14.50 ? 276  GLY A O     1 
ATOM   2138 N  N     . GLU A 1 280 ? 55.802 -24.382 11.203  1.00 8.01  ? 277  GLU A N     1 
ATOM   2139 C  CA    . GLU A 1 280 ? 55.066 -25.586 11.577  1.00 8.90  ? 277  GLU A CA    1 
ATOM   2140 C  C     . GLU A 1 280 ? 54.269 -26.170 10.413  1.00 10.24 ? 277  GLU A C     1 
ATOM   2141 O  O     . GLU A 1 280 ? 53.858 -27.327 10.457  1.00 10.38 ? 277  GLU A O     1 
ATOM   2142 C  CB    . GLU A 1 280 ? 54.120 -25.311 12.744  1.00 11.87 ? 277  GLU A CB    1 
ATOM   2143 C  CG    . GLU A 1 280 ? 54.817 -25.015 14.068  1.00 12.20 ? 277  GLU A CG    1 
ATOM   2144 C  CD    . GLU A 1 280 ? 53.815 -24.727 15.168  1.00 18.06 ? 277  GLU A CD    1 
ATOM   2145 O  OE1   . GLU A 1 280 ? 53.468 -23.552 15.359  1.00 14.99 ? 277  GLU A OE1   1 
ATOM   2146 O  OE2   . GLU A 1 280 ? 53.357 -25.678 15.830  1.00 18.61 ? 277  GLU A OE2   1 
ATOM   2147 N  N     . LEU A 1 281 ? 54.040 -25.372 9.376   1.00 10.06 ? 278  LEU A N     1 
ATOM   2148 C  CA    . LEU A 1 281 ? 53.331 -25.881 8.207   1.00 9.02  ? 278  LEU A CA    1 
ATOM   2149 C  C     . LEU A 1 281 ? 54.086 -26.991 7.478   1.00 10.79 ? 278  LEU A C     1 
ATOM   2150 O  O     . LEU A 1 281 ? 53.471 -27.776 6.760   1.00 11.94 ? 278  LEU A O     1 
ATOM   2151 C  CB    . LEU A 1 281 ? 52.994 -24.739 7.236   1.00 9.33  ? 278  LEU A CB    1 
ATOM   2152 C  CG    . LEU A 1 281 ? 51.819 -23.843 7.648   1.00 14.16 ? 278  LEU A CG    1 
ATOM   2153 C  CD1   . LEU A 1 281 ? 51.876 -22.511 6.877   1.00 16.11 ? 278  LEU A CD1   1 
ATOM   2154 C  CD2   . LEU A 1 281 ? 50.496 -24.557 7.391   1.00 11.31 ? 278  LEU A CD2   1 
ATOM   2155 N  N     . THR A 1 282 ? 55.408 -27.052 7.639   1.00 11.92 ? 279  THR A N     1 
ATOM   2156 C  CA    . THR A 1 282 ? 56.208 -28.013 6.859   1.00 13.48 ? 279  THR A CA    1 
ATOM   2157 C  C     . THR A 1 282 ? 55.861 -29.462 7.179   1.00 14.12 ? 279  THR A C     1 
ATOM   2158 O  O     . THR A 1 282 ? 56.195 -30.348 6.422   1.00 13.70 ? 279  THR A O     1 
ATOM   2159 C  CB    . THR A 1 282 ? 57.739 -27.845 7.058   1.00 15.11 ? 279  THR A CB    1 
ATOM   2160 O  OG1   . THR A 1 282 ? 58.075 -28.154 8.421   1.00 13.01 ? 279  THR A OG1   1 
ATOM   2161 C  CG2   . THR A 1 282 ? 58.194 -26.433 6.697   1.00 12.31 ? 279  THR A CG2   1 
ATOM   2162 N  N     . GLN A 1 283 ? 55.196 -29.711 8.300   1.00 11.82 ? 280  GLN A N     1 
ATOM   2163 C  CA    . GLN A 1 283 ? 54.937 -31.093 8.688   1.00 15.44 ? 280  GLN A CA    1 
ATOM   2164 C  C     . GLN A 1 283 ? 53.691 -31.703 8.056   1.00 19.36 ? 280  GLN A C     1 
ATOM   2165 O  O     . GLN A 1 283 ? 53.363 -32.853 8.316   1.00 25.76 ? 280  GLN A O     1 
ATOM   2166 C  CB    . GLN A 1 283 ? 54.883 -31.209 10.207  1.00 19.31 ? 280  GLN A CB    1 
ATOM   2167 C  CG    A GLN A 1 283 ? 56.203 -30.873 10.838  0.50 16.63 ? 280  GLN A CG    1 
ATOM   2168 C  CG    B GLN A 1 283 ? 53.752 -30.450 10.803  0.50 15.20 ? 280  GLN A CG    1 
ATOM   2169 C  CD    A GLN A 1 283 ? 57.328 -31.619 10.152  0.50 17.52 ? 280  GLN A CD    1 
ATOM   2170 C  CD    B GLN A 1 283 ? 53.955 -30.197 12.275  0.50 21.08 ? 280  GLN A CD    1 
ATOM   2171 O  OE1   A GLN A 1 283 ? 57.377 -32.848 10.192  0.50 18.67 ? 280  GLN A OE1   1 
ATOM   2172 O  OE1   B GLN A 1 283 ? 54.528 -31.024 12.991  0.50 22.79 ? 280  GLN A OE1   1 
ATOM   2173 N  NE2   A GLN A 1 283 ? 58.223 -30.886 9.493   0.50 15.79 ? 280  GLN A NE2   1 
ATOM   2174 N  NE2   B GLN A 1 283 ? 53.490 -29.050 12.736  0.50 11.87 ? 280  GLN A NE2   1 
ATOM   2175 N  N     . PHE A 1 284 ? 52.998 -30.938 7.224   1.00 12.63 ? 281  PHE A N     1 
ATOM   2176 C  CA    . PHE A 1 284 ? 51.821 -31.449 6.549   1.00 12.12 ? 281  PHE A CA    1 
ATOM   2177 C  C     . PHE A 1 284 ? 52.133 -31.735 5.083   1.00 15.24 ? 281  PHE A C     1 
ATOM   2178 O  O     . PHE A 1 284 ? 53.003 -31.097 4.484   1.00 15.73 ? 281  PHE A O     1 
ATOM   2179 C  CB    . PHE A 1 284 ? 50.672 -30.458 6.678   1.00 13.52 ? 281  PHE A CB    1 
ATOM   2180 C  CG    . PHE A 1 284 ? 50.333 -30.149 8.095   1.00 12.34 ? 281  PHE A CG    1 
ATOM   2181 C  CD1   . PHE A 1 284 ? 49.442 -30.939 8.792   1.00 18.44 ? 281  PHE A CD1   1 
ATOM   2182 C  CD2   . PHE A 1 284 ? 50.950 -29.090 8.749   1.00 12.15 ? 281  PHE A CD2   1 
ATOM   2183 C  CE1   . PHE A 1 284 ? 49.148 -30.666 10.119  1.00 21.57 ? 281  PHE A CE1   1 
ATOM   2184 C  CE2   . PHE A 1 284 ? 50.670 -28.819 10.063  1.00 13.68 ? 281  PHE A CE2   1 
ATOM   2185 C  CZ    . PHE A 1 284 ? 49.767 -29.606 10.756  1.00 17.59 ? 281  PHE A CZ    1 
ATOM   2186 N  N     . THR A 1 285 ? 51.444 -32.712 4.512   1.00 14.90 ? 282  THR A N     1 
ATOM   2187 C  CA    . THR A 1 285 ? 51.626 -32.997 3.099   1.00 15.23 ? 282  THR A CA    1 
ATOM   2188 C  C     . THR A 1 285 ? 50.860 -31.964 2.290   1.00 10.46 ? 282  THR A C     1 
ATOM   2189 O  O     . THR A 1 285 ? 49.960 -31.301 2.799   1.00 12.96 ? 282  THR A O     1 
ATOM   2190 C  CB    . THR A 1 285 ? 51.092 -34.388 2.720   1.00 11.81 ? 282  THR A CB    1 
ATOM   2191 O  OG1   . THR A 1 285 ? 49.672 -34.388 2.852   1.00 13.99 ? 282  THR A OG1   1 
ATOM   2192 C  CG2   . THR A 1 285 ? 51.682 -35.449 3.621   1.00 19.40 ? 282  THR A CG2   1 
ATOM   2193 N  N     . GLU A 1 286 ? 51.212 -31.834 1.021   1.00 11.64 ? 283  GLU A N     1 
ATOM   2194 C  CA    . GLU A 1 286 ? 50.507 -30.896 0.163   1.00 13.87 ? 283  GLU A CA    1 
ATOM   2195 C  C     . GLU A 1 286 ? 49.025 -31.271 0.089   1.00 16.47 ? 283  GLU A C     1 
ATOM   2196 O  O     . GLU A 1 286 ? 48.160 -30.401 0.162   1.00 11.71 ? 283  GLU A O     1 
ATOM   2197 C  CB    . GLU A 1 286 ? 51.138 -30.859 -1.225  1.00 12.10 ? 283  GLU A CB    1 
ATOM   2198 C  CG    . GLU A 1 286 ? 50.554 -29.789 -2.116  1.00 13.24 ? 283  GLU A CG    1 
ATOM   2199 C  CD    . GLU A 1 286 ? 51.258 -29.720 -3.454  1.00 24.71 ? 283  GLU A CD    1 
ATOM   2200 O  OE1   . GLU A 1 286 ? 52.177 -30.532 -3.692  1.00 24.89 ? 283  GLU A OE1   1 
ATOM   2201 O  OE2   . GLU A 1 286 ? 50.894 -28.848 -4.264  1.00 24.31 ? 283  GLU A OE2   1 
ATOM   2202 N  N     . SER A 1 287 ? 48.729 -32.570 -0.017  1.00 14.43 ? 284  SER A N     1 
ATOM   2203 C  CA    . SER A 1 287 ? 47.332 -33.016 -0.079  1.00 18.25 ? 284  SER A CA    1 
ATOM   2204 C  C     . SER A 1 287 ? 46.573 -32.689 1.207   1.00 14.97 ? 284  SER A C     1 
ATOM   2205 O  O     . SER A 1 287 ? 45.406 -32.301 1.170   1.00 11.99 ? 284  SER A O     1 
ATOM   2206 C  CB    . SER A 1 287 ? 47.224 -34.517 -0.401  1.00 14.96 ? 284  SER A CB    1 
ATOM   2207 O  OG    A SER A 1 287 ? 47.891 -34.849 -1.599  0.50 16.51 ? 284  SER A OG    1 
ATOM   2208 O  OG    B SER A 1 287 ? 47.964 -35.296 0.510   0.50 19.03 ? 284  SER A OG    1 
ATOM   2209 N  N     . GLN A 1 288 ? 47.242 -32.824 2.349   1.00 14.01 ? 285  GLN A N     1 
ATOM   2210 C  CA    . GLN A 1 288 ? 46.599 -32.482 3.609   1.00 15.04 ? 285  GLN A CA    1 
ATOM   2211 C  C     . GLN A 1 288 ? 46.177 -31.017 3.612   1.00 15.63 ? 285  GLN A C     1 
ATOM   2212 O  O     . GLN A 1 288 ? 45.051 -30.673 3.975   1.00 13.10 ? 285  GLN A O     1 
ATOM   2213 C  CB    . GLN A 1 288 ? 47.540 -32.739 4.775   1.00 13.38 ? 285  GLN A CB    1 
ATOM   2214 C  CG    . GLN A 1 288 ? 47.635 -34.186 5.185   1.00 22.13 ? 285  GLN A CG    1 
ATOM   2215 C  CD    . GLN A 1 288 ? 48.527 -34.357 6.387   1.00 26.09 ? 285  GLN A CD    1 
ATOM   2216 O  OE1   . GLN A 1 288 ? 49.684 -33.951 6.367   1.00 16.34 ? 285  GLN A OE1   1 
ATOM   2217 N  NE2   . GLN A 1 288 ? 47.982 -34.929 7.458   1.00 26.69 ? 285  GLN A NE2   1 
ATOM   2218 N  N     . LEU A 1 289 ? 47.093 -30.145 3.215   1.00 13.38 ? 286  LEU A N     1 
ATOM   2219 C  CA    . LEU A 1 289 ? 46.789 -28.711 3.193   1.00 12.75 ? 286  LEU A CA    1 
ATOM   2220 C  C     . LEU A 1 289 ? 45.694 -28.376 2.183   1.00 13.66 ? 286  LEU A C     1 
ATOM   2221 O  O     . LEU A 1 289 ? 44.830 -27.536 2.442   1.00 14.55 ? 286  LEU A O     1 
ATOM   2222 C  CB    . LEU A 1 289 ? 48.047 -27.891 2.904   1.00 11.28 ? 286  LEU A CB    1 
ATOM   2223 C  CG    . LEU A 1 289 ? 49.153 -27.960 3.960   1.00 10.37 ? 286  LEU A CG    1 
ATOM   2224 C  CD1   . LEU A 1 289 ? 50.375 -27.153 3.496   1.00 10.78 ? 286  LEU A CD1   1 
ATOM   2225 C  CD2   . LEU A 1 289 ? 48.656 -27.506 5.332   1.00 12.02 ? 286  LEU A CD2   1 
ATOM   2226 N  N     . GLN A 1 290 ? 45.743 -29.017 1.022   1.00 13.29 ? 287  GLN A N     1 
ATOM   2227 C  CA    . GLN A 1 290 ? 44.709 -28.814 0.018   1.00 16.28 ? 287  GLN A CA    1 
ATOM   2228 C  C     . GLN A 1 290 ? 43.343 -29.265 0.535   1.00 15.14 ? 287  GLN A C     1 
ATOM   2229 O  O     . GLN A 1 290 ? 42.308 -28.657 0.230   1.00 16.79 ? 287  GLN A O     1 
ATOM   2230 C  CB    . GLN A 1 290 ? 45.066 -29.560 -1.270  1.00 15.08 ? 287  GLN A CB    1 
ATOM   2231 C  CG    . GLN A 1 290 ? 46.154 -28.889 -2.109  1.00 17.21 ? 287  GLN A CG    1 
ATOM   2232 C  CD    . GLN A 1 290 ? 46.590 -29.766 -3.265  1.00 16.90 ? 287  GLN A CD    1 
ATOM   2233 O  OE1   . GLN A 1 290 ? 46.629 -30.994 -3.145  1.00 19.60 ? 287  GLN A OE1   1 
ATOM   2234 N  NE2   . GLN A 1 290 ? 46.928 -29.146 -4.388  1.00 17.30 ? 287  GLN A NE2   1 
ATOM   2235 N  N     . SER A 1 291 ? 43.335 -30.328 1.331   1.00 15.72 ? 288  SER A N     1 
ATOM   2236 C  CA    . SER A 1 291 ? 42.078 -30.829 1.884   1.00 13.05 ? 288  SER A CA    1 
ATOM   2237 C  C     . SER A 1 291 ? 41.380 -29.798 2.779   1.00 20.36 ? 288  SER A C     1 
ATOM   2238 O  O     . SER A 1 291 ? 40.164 -29.650 2.737   1.00 20.43 ? 288  SER A O     1 
ATOM   2239 C  CB    . SER A 1 291 ? 42.259 -32.177 2.609   1.00 12.55 ? 288  SER A CB    1 
ATOM   2240 O  OG    A SER A 1 291 ? 42.814 -32.038 3.916   0.50 12.86 ? 288  SER A OG    1 
ATOM   2241 O  OG    B SER A 1 291 ? 40.997 -32.763 2.841   0.50 14.96 ? 288  SER A OG    1 
ATOM   2242 N  N     . HIS A 1 292 ? 42.153 -29.064 3.569   1.00 17.84 ? 289  HIS A N     1 
ATOM   2243 C  CA    . HIS A 1 292 ? 41.567 -28.092 4.480   1.00 17.96 ? 289  HIS A CA    1 
ATOM   2244 C  C     . HIS A 1 292 ? 41.305 -26.733 3.823   1.00 21.95 ? 289  HIS A C     1 
ATOM   2245 O  O     . HIS A 1 292 ? 40.296 -26.082 4.101   1.00 24.70 ? 289  HIS A O     1 
ATOM   2246 C  CB    . HIS A 1 292 ? 42.474 -27.896 5.696   1.00 20.26 ? 289  HIS A CB    1 
ATOM   2247 C  CG    . HIS A 1 292 ? 42.633 -29.122 6.546   1.00 19.58 ? 289  HIS A CG    1 
ATOM   2248 N  ND1   . HIS A 1 292 ? 41.590 -29.679 7.247   1.00 26.38 ? 289  HIS A ND1   1 
ATOM   2249 C  CD2   . HIS A 1 292 ? 43.725 -29.871 6.829   1.00 20.69 ? 289  HIS A CD2   1 
ATOM   2250 C  CE1   . HIS A 1 292 ? 42.028 -30.729 7.925   1.00 22.89 ? 289  HIS A CE1   1 
ATOM   2251 N  NE2   . HIS A 1 292 ? 43.319 -30.868 7.683   1.00 25.70 ? 289  HIS A NE2   1 
ATOM   2252 N  N     . PHE A 1 293 ? 42.213 -26.300 2.954   1.00 16.77 ? 290  PHE A N     1 
ATOM   2253 C  CA    . PHE A 1 293 ? 42.192 -24.913 2.489   1.00 16.26 ? 290  PHE A CA    1 
ATOM   2254 C  C     . PHE A 1 293 ? 41.926 -24.748 0.996   1.00 21.03 ? 290  PHE A C     1 
ATOM   2255 O  O     . PHE A 1 293 ? 41.934 -23.631 0.478   1.00 22.37 ? 290  PHE A O     1 
ATOM   2256 C  CB    . PHE A 1 293 ? 43.497 -24.224 2.915   1.00 14.73 ? 290  PHE A CB    1 
ATOM   2257 C  CG    . PHE A 1 293 ? 43.828 -24.465 4.355   1.00 16.01 ? 290  PHE A CG    1 
ATOM   2258 C  CD1   . PHE A 1 293 ? 43.004 -23.957 5.355   1.00 17.82 ? 290  PHE A CD1   1 
ATOM   2259 C  CD2   . PHE A 1 293 ? 44.916 -25.240 4.713   1.00 12.44 ? 290  PHE A CD2   1 
ATOM   2260 C  CE1   . PHE A 1 293 ? 43.269 -24.195 6.687   1.00 15.32 ? 290  PHE A CE1   1 
ATOM   2261 C  CE2   . PHE A 1 293 ? 45.189 -25.494 6.054   1.00 16.22 ? 290  PHE A CE2   1 
ATOM   2262 C  CZ    . PHE A 1 293 ? 44.362 -24.970 7.040   1.00 16.09 ? 290  PHE A CZ    1 
ATOM   2263 N  N     . GLY A 1 294 ? 41.676 -25.858 0.306   1.00 15.71 ? 291  GLY A N     1 
ATOM   2264 C  CA    . GLY A 1 294 ? 41.412 -25.805 -1.119  1.00 19.39 ? 291  GLY A CA    1 
ATOM   2265 C  C     . GLY A 1 294 ? 42.662 -26.082 -1.921  1.00 17.66 ? 291  GLY A C     1 
ATOM   2266 O  O     . GLY A 1 294 ? 43.777 -25.980 -1.412  1.00 16.97 ? 291  GLY A O     1 
ATOM   2267 N  N     . GLU A 1 295 ? 42.478 -26.445 -3.184  1.00 16.17 ? 292  GLU A N     1 
ATOM   2268 C  CA    . GLU A 1 295 ? 43.587 -26.792 -4.063  1.00 16.35 ? 292  GLU A CA    1 
ATOM   2269 C  C     . GLU A 1 295 ? 44.630 -25.681 -4.197  1.00 18.07 ? 292  GLU A C     1 
ATOM   2270 O  O     . GLU A 1 295 ? 45.824 -25.927 -4.092  1.00 12.76 ? 292  GLU A O     1 
ATOM   2271 C  CB    . GLU A 1 295 ? 43.044 -27.138 -5.445  1.00 21.29 ? 292  GLU A CB    1 
ATOM   2272 C  CG    . GLU A 1 295 ? 44.074 -27.642 -6.413  1.00 25.52 ? 292  GLU A CG    1 
ATOM   2273 C  CD    . GLU A 1 295 ? 43.486 -27.877 -7.788  1.00 43.39 ? 292  GLU A CD    1 
ATOM   2274 O  OE1   . GLU A 1 295 ? 44.230 -27.746 -8.784  1.00 39.88 ? 292  GLU A OE1   1 
ATOM   2275 O  OE2   . GLU A 1 295 ? 42.277 -28.187 -7.867  1.00 34.58 ? 292  GLU A OE2   1 
ATOM   2276 N  N     . LYS A 1 296 ? 44.173 -24.462 -4.453  1.00 15.30 ? 293  LYS A N     1 
ATOM   2277 C  CA    . LYS A 1 296 ? 45.088 -23.353 -4.708  1.00 17.93 ? 293  LYS A CA    1 
ATOM   2278 C  C     . LYS A 1 296 ? 45.806 -22.901 -3.419  1.00 14.69 ? 293  LYS A C     1 
ATOM   2279 O  O     . LYS A 1 296 ? 47.039 -22.807 -3.379  1.00 13.58 ? 293  LYS A O     1 
ATOM   2280 C  CB    . LYS A 1 296 ? 44.329 -22.197 -5.374  1.00 17.33 ? 293  LYS A CB    1 
ATOM   2281 C  CG    . LYS A 1 296 ? 45.192 -21.050 -5.862  1.00 36.48 ? 293  LYS A CG    1 
ATOM   2282 C  CD    . LYS A 1 296 ? 44.349 -20.035 -6.632  1.00 37.09 ? 293  LYS A CD    1 
ATOM   2283 C  CE    . LYS A 1 296 ? 45.086 -18.711 -6.795  1.00 45.08 ? 293  LYS A CE    1 
ATOM   2284 N  NZ    . LYS A 1 296 ? 44.249 -17.695 -7.491  1.00 39.68 ? 293  LYS A NZ    1 
ATOM   2285 N  N     . ASN A 1 297 ? 45.037 -22.645 -2.369  1.00 13.23 ? 294  ASN A N     1 
ATOM   2286 C  CA    . ASN A 1 297 ? 45.612 -22.255 -1.075  1.00 13.22 ? 294  ASN A CA    1 
ATOM   2287 C  C     . ASN A 1 297 ? 46.531 -23.325 -0.492  1.00 17.85 ? 294  ASN A C     1 
ATOM   2288 O  O     . ASN A 1 297 ? 47.541 -23.004 0.124   1.00 12.83 ? 294  ASN A O     1 
ATOM   2289 C  CB    . ASN A 1 297 ? 44.513 -21.975 -0.060  1.00 17.63 ? 294  ASN A CB    1 
ATOM   2290 C  CG    . ASN A 1 297 ? 43.783 -20.693 -0.336  1.00 17.61 ? 294  ASN A CG    1 
ATOM   2291 O  OD1   . ASN A 1 297 ? 44.347 -19.757 -0.901  1.00 19.41 ? 294  ASN A OD1   1 
ATOM   2292 N  ND2   . ASN A 1 297 ? 42.521 -20.635 0.072   1.00 20.45 ? 294  ASN A ND2   1 
ATOM   2293 N  N     . GLY A 1 298 ? 46.165 -24.591 -0.666  1.00 16.38 ? 295  GLY A N     1 
ATOM   2294 C  CA    . GLY A 1 298 ? 46.956 -25.686 -0.119  1.00 15.10 ? 295  GLY A CA    1 
ATOM   2295 C  C     . GLY A 1 298 ? 48.334 -25.782 -0.757  1.00 13.77 ? 295  GLY A C     1 
ATOM   2296 O  O     . GLY A 1 298 ? 49.352 -25.934 -0.058  1.00 12.20 ? 295  GLY A O     1 
ATOM   2297 N  N     . SER A 1 299 ? 48.374 -25.690 -2.087  1.00 11.04 ? 296  SER A N     1 
ATOM   2298 C  CA    . SER A 1 299 ? 49.631 -25.731 -2.816  1.00 13.04 ? 296  SER A CA    1 
ATOM   2299 C  C     . SER A 1 299 ? 50.485 -24.520 -2.473  1.00 11.92 ? 296  SER A C     1 
ATOM   2300 O  O     . SER A 1 299 ? 51.698 -24.634 -2.309  1.00 11.47 ? 296  SER A O     1 
ATOM   2301 C  CB    . SER A 1 299 ? 49.380 -25.757 -4.326  1.00 18.19 ? 296  SER A CB    1 
ATOM   2302 O  OG    . SER A 1 299 ? 49.051 -27.063 -4.757  1.00 22.70 ? 296  SER A OG    1 
ATOM   2303 N  N     . TRP A 1 300 ? 49.834 -23.362 -2.383  1.00 11.70 ? 297  TRP A N     1 
ATOM   2304 C  CA    . TRP A 1 300 ? 50.522 -22.125 -2.053  1.00 12.16 ? 297  TRP A CA    1 
ATOM   2305 C  C     . TRP A 1 300 ? 51.167 -22.228 -0.667  1.00 11.48 ? 297  TRP A C     1 
ATOM   2306 O  O     . TRP A 1 300 ? 52.342 -21.874 -0.491  1.00 13.51 ? 297  TRP A O     1 
ATOM   2307 C  CB    . TRP A 1 300 ? 49.543 -20.948 -2.105  1.00 13.85 ? 297  TRP A CB    1 
ATOM   2308 C  CG    . TRP A 1 300 ? 50.200 -19.613 -1.921  1.00 15.94 ? 297  TRP A CG    1 
ATOM   2309 C  CD1   . TRP A 1 300 ? 50.756 -18.833 -2.892  1.00 20.31 ? 297  TRP A CD1   1 
ATOM   2310 C  CD2   . TRP A 1 300 ? 50.361 -18.894 -0.687  1.00 14.55 ? 297  TRP A CD2   1 
ATOM   2311 N  NE1   . TRP A 1 300 ? 51.256 -17.675 -2.339  1.00 16.66 ? 297  TRP A NE1   1 
ATOM   2312 C  CE2   . TRP A 1 300 ? 51.028 -17.689 -0.989  1.00 16.85 ? 297  TRP A CE2   1 
ATOM   2313 C  CE3   . TRP A 1 300 ? 50.005 -19.154 0.639   1.00 16.03 ? 297  TRP A CE3   1 
ATOM   2314 C  CZ2   . TRP A 1 300 ? 51.336 -16.738 -0.012  1.00 18.28 ? 297  TRP A CZ2   1 
ATOM   2315 C  CZ3   . TRP A 1 300 ? 50.318 -18.211 1.610   1.00 19.33 ? 297  TRP A CZ3   1 
ATOM   2316 C  CH2   . TRP A 1 300 ? 50.979 -17.022 1.277   1.00 13.48 ? 297  TRP A CH2   1 
ATOM   2317 N  N     . LEU A 1 301 ? 50.404 -22.725 0.305   1.00 11.08 ? 298  LEU A N     1 
ATOM   2318 C  CA    . LEU A 1 301 ? 50.919 -22.901 1.670   1.00 13.07 ? 298  LEU A CA    1 
ATOM   2319 C  C     . LEU A 1 301 ? 52.064 -23.898 1.751   1.00 13.51 ? 298  LEU A C     1 
ATOM   2320 O  O     . LEU A 1 301 ? 53.051 -23.677 2.457   1.00 10.98 ? 298  LEU A O     1 
ATOM   2321 C  CB    . LEU A 1 301 ? 49.805 -23.305 2.640   1.00 8.32  ? 298  LEU A CB    1 
ATOM   2322 C  CG    . LEU A 1 301 ? 48.758 -22.216 2.930   1.00 13.73 ? 298  LEU A CG    1 
ATOM   2323 C  CD1   . LEU A 1 301 ? 47.485 -22.805 3.506   1.00 14.19 ? 298  LEU A CD1   1 
ATOM   2324 C  CD2   . LEU A 1 301 ? 49.338 -21.169 3.886   1.00 16.81 ? 298  LEU A CD2   1 
ATOM   2325 N  N     . TYR A 1 302 ? 51.936 -25.004 1.034   1.00 9.56  ? 299  TYR A N     1 
ATOM   2326 C  CA    . TYR A 1 302 ? 52.973 -26.024 1.069   1.00 9.81  ? 299  TYR A CA    1 
ATOM   2327 C  C     . TYR A 1 302 ? 54.315 -25.444 0.617   1.00 13.67 ? 299  TYR A C     1 
ATOM   2328 O  O     . TYR A 1 302 ? 55.359 -25.674 1.249   1.00 10.69 ? 299  TYR A O     1 
ATOM   2329 C  CB    . TYR A 1 302 ? 52.570 -27.216 0.196   1.00 11.84 ? 299  TYR A CB    1 
ATOM   2330 C  CG    . TYR A 1 302 ? 53.590 -28.325 0.198   1.00 10.87 ? 299  TYR A CG    1 
ATOM   2331 C  CD1   . TYR A 1 302 ? 53.549 -29.331 1.163   1.00 12.26 ? 299  TYR A CD1   1 
ATOM   2332 C  CD2   . TYR A 1 302 ? 54.617 -28.357 -0.748  1.00 15.17 ? 299  TYR A CD2   1 
ATOM   2333 C  CE1   . TYR A 1 302 ? 54.500 -30.349 1.171   1.00 14.37 ? 299  TYR A CE1   1 
ATOM   2334 C  CE2   . TYR A 1 302 ? 55.564 -29.363 -0.740  1.00 19.24 ? 299  TYR A CE2   1 
ATOM   2335 C  CZ    . TYR A 1 302 ? 55.498 -30.355 0.218   1.00 17.48 ? 299  TYR A CZ    1 
ATOM   2336 O  OH    . TYR A 1 302 ? 56.452 -31.353 0.227   1.00 24.39 ? 299  TYR A OH    1 
ATOM   2337 N  N     . ALA A 1 303 ? 54.282 -24.671 -0.467  1.00 11.01 ? 300  ALA A N     1 
ATOM   2338 C  CA    . ALA A 1 303 ? 55.495 -24.054 -0.990  1.00 10.32 ? 300  ALA A CA    1 
ATOM   2339 C  C     . ALA A 1 303 ? 55.939 -22.877 -0.137  1.00 9.44  ? 300  ALA A C     1 
ATOM   2340 O  O     . ALA A 1 303 ? 57.136 -22.700 0.104   1.00 10.83 ? 300  ALA A O     1 
ATOM   2341 C  CB    . ALA A 1 303 ? 55.292 -23.606 -2.457  1.00 12.12 ? 300  ALA A CB    1 
ATOM   2342 N  N     . MET A 1 304 ? 54.982 -22.083 0.337   1.00 8.74  ? 301  MET A N     1 
ATOM   2343 C  CA    . MET A 1 304 ? 55.328 -20.842 1.045   1.00 10.83 ? 301  MET A CA    1 
ATOM   2344 C  C     . MET A 1 304 ? 56.030 -21.079 2.374   1.00 9.31  ? 301  MET A C     1 
ATOM   2345 O  O     . MET A 1 304 ? 56.952 -20.331 2.724   1.00 9.66  ? 301  MET A O     1 
ATOM   2346 C  CB    . MET A 1 304 ? 54.098 -19.959 1.256   1.00 10.98 ? 301  MET A CB    1 
ATOM   2347 C  CG    . MET A 1 304 ? 54.430 -18.546 1.759   1.00 13.78 ? 301  MET A CG    1 
ATOM   2348 S  SD    . MET A 1 304 ? 55.183 -17.545 0.465   1.00 16.36 ? 301  MET A SD    1 
ATOM   2349 C  CE    . MET A 1 304 ? 56.916 -17.547 0.949   1.00 14.22 ? 301  MET A CE    1 
ATOM   2350 N  N     . CYS A 1 305 ? 55.607 -22.102 3.120   1.00 8.37  ? 302  CYS A N     1 
ATOM   2351 C  CA    . CYS A 1 305 ? 56.260 -22.399 4.401   1.00 12.81 ? 302  CYS A CA    1 
ATOM   2352 C  C     . CYS A 1 305 ? 57.712 -22.885 4.218   1.00 11.63 ? 302  CYS A C     1 
ATOM   2353 O  O     . CYS A 1 305 ? 58.485 -22.951 5.179   1.00 10.64 ? 302  CYS A O     1 
ATOM   2354 C  CB    . CYS A 1 305 ? 55.437 -23.416 5.211   1.00 9.05  ? 302  CYS A CB    1 
ATOM   2355 S  SG    . CYS A 1 305 ? 55.446 -25.079 4.522   1.00 10.53 ? 302  CYS A SG    1 
ATOM   2356 N  N     . ARG A 1 306 ? 58.066 -23.210 2.981   1.00 10.47 ? 303  ARG A N     1 
ATOM   2357 C  CA    . ARG A 1 306 ? 59.438 -23.560 2.593   1.00 11.08 ? 303  ARG A CA    1 
ATOM   2358 C  C     . ARG A 1 306 ? 60.204 -22.386 1.947   1.00 11.32 ? 303  ARG A C     1 
ATOM   2359 O  O     . ARG A 1 306 ? 61.369 -22.525 1.548   1.00 13.40 ? 303  ARG A O     1 
ATOM   2360 C  CB    . ARG A 1 306 ? 59.424 -24.782 1.665   1.00 12.15 ? 303  ARG A CB    1 
ATOM   2361 C  CG    . ARG A 1 306 ? 58.904 -26.038 2.367   1.00 9.75  ? 303  ARG A CG    1 
ATOM   2362 C  CD    . ARG A 1 306 ? 58.625 -27.201 1.424   1.00 12.98 ? 303  ARG A CD    1 
ATOM   2363 N  NE    . ARG A 1 306 ? 58.481 -28.425 2.211   1.00 19.46 ? 303  ARG A NE    1 
ATOM   2364 C  CZ    . ARG A 1 306 ? 57.386 -28.753 2.893   1.00 15.80 ? 303  ARG A CZ    1 
ATOM   2365 N  NH1   . ARG A 1 306 ? 57.359 -29.880 3.605   1.00 12.47 ? 303  ARG A NH1   1 
ATOM   2366 N  NH2   . ARG A 1 306 ? 56.316 -27.963 2.859   1.00 11.80 ? 303  ARG A NH2   1 
ATOM   2367 N  N     . GLY A 1 307 ? 59.567 -21.223 1.892   1.00 9.59  ? 304  GLY A N     1 
ATOM   2368 C  CA    . GLY A 1 307 ? 60.207 -20.025 1.381   1.00 10.87 ? 304  GLY A CA    1 
ATOM   2369 C  C     . GLY A 1 307 ? 60.012 -19.889 -0.118  1.00 10.36 ? 304  GLY A C     1 
ATOM   2370 O  O     . GLY A 1 307 ? 60.679 -19.079 -0.765  1.00 11.26 ? 304  GLY A O     1 
ATOM   2371 N  N     . ILE A 1 308 ? 59.101 -20.682 -0.671  1.00 10.23 ? 305  ILE A N     1 
ATOM   2372 C  CA    . ILE A 1 308 ? 58.929 -20.752 -2.135  1.00 11.54 ? 305  ILE A CA    1 
ATOM   2373 C  C     . ILE A 1 308 ? 57.588 -20.178 -2.587  1.00 13.23 ? 305  ILE A C     1 
ATOM   2374 O  O     . ILE A 1 308 ? 56.558 -20.534 -2.044  1.00 9.22  ? 305  ILE A O     1 
ATOM   2375 C  CB    . ILE A 1 308 ? 59.043 -22.211 -2.633  1.00 14.85 ? 305  ILE A CB    1 
ATOM   2376 C  CG1   . ILE A 1 308 ? 60.425 -22.777 -2.302  1.00 14.03 ? 305  ILE A CG1   1 
ATOM   2377 C  CG2   . ILE A 1 308 ? 58.759 -22.313 -4.139  1.00 14.69 ? 305  ILE A CG2   1 
ATOM   2378 C  CD1   . ILE A 1 308 ? 60.530 -24.273 -2.517  1.00 19.40 ? 305  ILE A CD1   1 
ATOM   2379 N  N     . GLU A 1 309 ? 57.602 -19.304 -3.594  1.00 10.79 ? 306  GLU A N     1 
ATOM   2380 C  CA    . GLU A 1 309 ? 56.374 -18.659 -4.063  1.00 14.70 ? 306  GLU A CA    1 
ATOM   2381 C  C     . GLU A 1 309 ? 56.619 -18.159 -5.480  1.00 20.76 ? 306  GLU A C     1 
ATOM   2382 O  O     . GLU A 1 309 ? 57.686 -17.632 -5.774  1.00 15.63 ? 306  GLU A O     1 
ATOM   2383 C  CB    . GLU A 1 309 ? 56.005 -17.487 -3.150  1.00 16.89 ? 306  GLU A CB    1 
ATOM   2384 C  CG    . GLU A 1 309 ? 54.544 -17.128 -3.201  1.00 21.59 ? 306  GLU A CG    1 
ATOM   2385 C  CD    . GLU A 1 309 ? 54.275 -15.681 -3.576  1.00 28.36 ? 306  GLU A CD    1 
ATOM   2386 O  OE1   . GLU A 1 309 ? 55.236 -14.878 -3.696  1.00 24.38 ? 306  GLU A OE1   1 
ATOM   2387 O  OE2   . GLU A 1 309 ? 53.081 -15.352 -3.747  1.00 31.67 ? 306  GLU A OE2   1 
ATOM   2388 N  N     . HIS A 1 310 ? 55.648 -18.329 -6.371  1.00 15.16 ? 307  HIS A N     1 
ATOM   2389 C  CA    . HIS A 1 310 ? 55.932 -18.097 -7.780  1.00 18.53 ? 307  HIS A CA    1 
ATOM   2390 C  C     . HIS A 1 310 ? 55.177 -16.937 -8.415  1.00 16.36 ? 307  HIS A C     1 
ATOM   2391 O  O     . HIS A 1 310 ? 55.307 -16.718 -9.619  1.00 19.82 ? 307  HIS A O     1 
ATOM   2392 C  CB    . HIS A 1 310 ? 55.702 -19.374 -8.595  1.00 24.71 ? 307  HIS A CB    1 
ATOM   2393 C  CG    . HIS A 1 310 ? 56.611 -20.502 -8.215  1.00 35.09 ? 307  HIS A CG    1 
ATOM   2394 N  ND1   . HIS A 1 310 ? 57.987 -20.406 -8.286  1.00 35.82 ? 307  HIS A ND1   1 
ATOM   2395 C  CD2   . HIS A 1 310 ? 56.346 -21.746 -7.753  1.00 34.14 ? 307  HIS A CD2   1 
ATOM   2396 C  CE1   . HIS A 1 310 ? 58.526 -21.544 -7.886  1.00 35.83 ? 307  HIS A CE1   1 
ATOM   2397 N  NE2   . HIS A 1 310 ? 57.553 -22.375 -7.561  1.00 35.51 ? 307  HIS A NE2   1 
ATOM   2398 N  N     . ASP A 1 311 ? 54.393 -16.204 -7.630  1.00 14.32 ? 308  ASP A N     1 
ATOM   2399 C  CA    . ASP A 1 311 ? 53.603 -15.114 -8.203  1.00 17.57 ? 308  ASP A CA    1 
ATOM   2400 C  C     . ASP A 1 311 ? 54.540 -14.139 -8.919  1.00 16.16 ? 308  ASP A C     1 
ATOM   2401 O  O     . ASP A 1 311 ? 55.494 -13.652 -8.321  1.00 11.94 ? 308  ASP A O     1 
ATOM   2402 C  CB    . ASP A 1 311 ? 52.809 -14.389 -7.118  1.00 16.80 ? 308  ASP A CB    1 
ATOM   2403 C  CG    . ASP A 1 311 ? 51.847 -13.361 -7.692  1.00 24.26 ? 308  ASP A CG    1 
ATOM   2404 O  OD1   . ASP A 1 311 ? 51.722 -12.263 -7.118  1.00 30.61 ? 308  ASP A OD1   1 
ATOM   2405 O  OD2   . ASP A 1 311 ? 51.204 -13.658 -8.720  1.00 29.48 ? 308  ASP A OD2   1 
ATOM   2406 N  N     . PRO A 1 312 ? 54.278 -13.846 -10.207 1.00 15.44 ? 309  PRO A N     1 
ATOM   2407 C  CA    . PRO A 1 312 ? 55.223 -12.953 -10.880 1.00 14.53 ? 309  PRO A CA    1 
ATOM   2408 C  C     . PRO A 1 312 ? 55.055 -11.486 -10.513 1.00 10.37 ? 309  PRO A C     1 
ATOM   2409 O  O     . PRO A 1 312 ? 53.989 -11.048 -10.072 1.00 12.89 ? 309  PRO A O     1 
ATOM   2410 C  CB    . PRO A 1 312 ? 54.906 -13.162 -12.369 1.00 17.47 ? 309  PRO A CB    1 
ATOM   2411 C  CG    . PRO A 1 312 ? 53.504 -13.614 -12.399 1.00 18.20 ? 309  PRO A CG    1 
ATOM   2412 C  CD    . PRO A 1 312 ? 53.303 -14.432 -11.148 1.00 16.16 ? 309  PRO A CD    1 
ATOM   2413 N  N     . VAL A 1 313 ? 56.143 -10.738 -10.660 1.00 11.51 ? 310  VAL A N     1 
ATOM   2414 C  CA    . VAL A 1 313 ? 56.094 -9.288  -10.572 1.00 10.34 ? 310  VAL A CA    1 
ATOM   2415 C  C     . VAL A 1 313 ? 55.423 -8.837  -11.868 1.00 13.62 ? 310  VAL A C     1 
ATOM   2416 O  O     . VAL A 1 313 ? 56.005 -8.957  -12.940 1.00 17.50 ? 310  VAL A O     1 
ATOM   2417 C  CB    . VAL A 1 313 ? 57.502 -8.684  -10.499 1.00 13.60 ? 310  VAL A CB    1 
ATOM   2418 C  CG1   . VAL A 1 313 ? 57.444 -7.155  -10.552 1.00 12.57 ? 310  VAL A CG1   1 
ATOM   2419 C  CG2   . VAL A 1 313 ? 58.197 -9.132  -9.228  1.00 10.44 ? 310  VAL A CG2   1 
ATOM   2420 N  N     . LYS A 1 314 ? 54.189 -8.360  -11.770 1.00 13.41 ? 311  LYS A N     1 
ATOM   2421 C  CA    . LYS A 1 314 ? 53.438 -7.993  -12.967 1.00 13.72 ? 311  LYS A CA    1 
ATOM   2422 C  C     . LYS A 1 314 ? 53.855 -6.620  -13.463 1.00 13.83 ? 311  LYS A C     1 
ATOM   2423 O  O     . LYS A 1 314 ? 54.058 -5.701  -12.667 1.00 15.26 ? 311  LYS A O     1 
ATOM   2424 C  CB    . LYS A 1 314 ? 51.934 -8.052  -12.685 1.00 15.02 ? 311  LYS A CB    1 
ATOM   2425 C  CG    . LYS A 1 314 ? 51.482 -9.466  -12.320 1.00 23.39 ? 311  LYS A CG    1 
ATOM   2426 C  CD    . LYS A 1 314 ? 50.124 -9.503  -11.651 1.00 33.45 ? 311  LYS A CD    1 
ATOM   2427 C  CE    . LYS A 1 314 ? 49.762 -10.940 -11.265 1.00 37.86 ? 311  LYS A CE    1 
ATOM   2428 N  NZ    . LYS A 1 314 ? 50.804 -11.603 -10.409 1.00 29.01 ? 311  LYS A NZ    1 
ATOM   2429 N  N     . PRO A 1 315 ? 54.004 -6.482  -14.784 1.00 12.51 ? 312  PRO A N     1 
ATOM   2430 C  CA    . PRO A 1 315 ? 54.408 -5.212  -15.377 1.00 13.07 ? 312  PRO A CA    1 
ATOM   2431 C  C     . PRO A 1 315 ? 53.220 -4.256  -15.409 1.00 15.17 ? 312  PRO A C     1 
ATOM   2432 O  O     . PRO A 1 315 ? 52.496 -4.171  -16.407 1.00 17.97 ? 312  PRO A O     1 
ATOM   2433 C  CB    . PRO A 1 315 ? 54.841 -5.614  -16.789 1.00 20.13 ? 312  PRO A CB    1 
ATOM   2434 C  CG    . PRO A 1 315 ? 54.040 -6.825  -17.086 1.00 18.27 ? 312  PRO A CG    1 
ATOM   2435 C  CD    . PRO A 1 315 ? 53.908 -7.558  -15.791 1.00 16.62 ? 312  PRO A CD    1 
ATOM   2436 N  N     . ARG A 1 316 ? 53.015 -3.541  -14.309 1.00 15.97 ? 313  ARG A N     1 
ATOM   2437 C  CA    . ARG A 1 316 ? 51.871 -2.633  -14.200 1.00 14.04 ? 313  ARG A CA    1 
ATOM   2438 C  C     . ARG A 1 316 ? 52.198 -1.520  -13.220 1.00 18.13 ? 313  ARG A C     1 
ATOM   2439 O  O     . ARG A 1 316 ? 52.291 -1.758  -12.026 1.00 18.44 ? 313  ARG A O     1 
ATOM   2440 C  CB    . ARG A 1 316 ? 50.620 -3.371  -13.727 1.00 18.86 ? 313  ARG A CB    1 
ATOM   2441 C  CG    A ARG A 1 316 ? 49.365 -2.513  -13.630 0.50 18.73 ? 313  ARG A CG    1 
ATOM   2442 C  CG    B ARG A 1 316 ? 49.399 -2.454  -13.685 0.50 18.72 ? 313  ARG A CG    1 
ATOM   2443 C  CD    A ARG A 1 316 ? 48.242 -3.256  -12.907 0.50 20.36 ? 313  ARG A CD    1 
ATOM   2444 C  CD    B ARG A 1 316 ? 48.163 -3.121  -13.105 0.50 20.31 ? 313  ARG A CD    1 
ATOM   2445 N  NE    A ARG A 1 316 ? 48.479 -3.332  -11.467 0.50 21.45 ? 313  ARG A NE    1 
ATOM   2446 N  NE    B ARG A 1 316 ? 48.388 -3.582  -11.741 0.50 21.28 ? 313  ARG A NE    1 
ATOM   2447 C  CZ    A ARG A 1 316 ? 48.751 -4.450  -10.797 0.50 25.66 ? 313  ARG A CZ    1 
ATOM   2448 C  CZ    B ARG A 1 316 ? 48.417 -2.793  -10.669 0.50 22.15 ? 313  ARG A CZ    1 
ATOM   2449 N  NH1   A ARG A 1 316 ? 48.951 -4.400  -9.485  0.50 23.09 ? 313  ARG A NH1   1 
ATOM   2450 N  NH1   B ARG A 1 316 ? 48.630 -3.323  -9.471  0.50 19.00 ? 313  ARG A NH1   1 
ATOM   2451 N  NH2   A ARG A 1 316 ? 48.815 -5.615  -11.430 0.50 25.56 ? 313  ARG A NH2   1 
ATOM   2452 N  NH2   B ARG A 1 316 ? 48.234 -1.480  -10.790 0.50 13.17 ? 313  ARG A NH2   1 
ATOM   2453 N  N     . GLN A 1 317 ? 52.358 -0.308  -13.743 1.00 18.21 ? 314  GLN A N     1 
ATOM   2454 C  CA    . GLN A 1 317 ? 52.775 0.834   -12.939 1.00 22.39 ? 314  GLN A CA    1 
ATOM   2455 C  C     . GLN A 1 317 ? 51.596 1.745   -12.606 1.00 24.08 ? 314  GLN A C     1 
ATOM   2456 O  O     . GLN A 1 317 ? 51.681 2.587   -11.707 1.00 22.69 ? 314  GLN A O     1 
ATOM   2457 C  CB    . GLN A 1 317 ? 53.838 1.616   -13.704 1.00 27.13 ? 314  GLN A CB    1 
ATOM   2458 C  CG    . GLN A 1 317 ? 54.494 2.723   -12.930 1.00 34.75 ? 314  GLN A CG    1 
ATOM   2459 C  CD    . GLN A 1 317 ? 55.440 3.530   -13.790 1.00 30.22 ? 314  GLN A CD    1 
ATOM   2460 O  OE1   . GLN A 1 317 ? 55.677 3.194   -14.954 1.00 37.83 ? 314  GLN A OE1   1 
ATOM   2461 N  NE2   . GLN A 1 317 ? 55.991 4.601   -13.224 1.00 28.95 ? 314  GLN A NE2   1 
ATOM   2462 N  N     . LEU A 1 318 ? 50.495 1.566   -13.330 1.00 16.03 ? 315  LEU A N     1 
ATOM   2463 C  CA    . LEU A 1 318 ? 49.301 2.390   -13.159 1.00 23.01 ? 315  LEU A CA    1 
ATOM   2464 C  C     . LEU A 1 318 ? 48.145 1.617   -12.526 1.00 16.80 ? 315  LEU A C     1 
ATOM   2465 O  O     . LEU A 1 318 ? 47.931 0.443   -12.823 1.00 17.58 ? 315  LEU A O     1 
ATOM   2466 C  CB    . LEU A 1 318 ? 48.830 2.922   -14.522 1.00 18.60 ? 315  LEU A CB    1 
ATOM   2467 C  CG    . LEU A 1 318 ? 49.833 3.723   -15.351 1.00 18.25 ? 315  LEU A CG    1 
ATOM   2468 C  CD1   . LEU A 1 318 ? 49.246 4.065   -16.723 1.00 20.74 ? 315  LEU A CD1   1 
ATOM   2469 C  CD2   . LEU A 1 318 ? 50.285 4.987   -14.614 1.00 19.23 ? 315  LEU A CD2   1 
ATOM   2470 N  N     . PRO A 1 319 ? 47.356 2.295   -11.684 1.00 16.55 ? 316  PRO A N     1 
ATOM   2471 C  CA    . PRO A 1 319 ? 46.164 1.647   -11.114 1.00 16.34 ? 316  PRO A CA    1 
ATOM   2472 C  C     . PRO A 1 319 ? 45.178 1.196   -12.199 1.00 18.19 ? 316  PRO A C     1 
ATOM   2473 O  O     . PRO A 1 319 ? 45.095 1.864   -13.220 1.00 23.55 ? 316  PRO A O     1 
ATOM   2474 C  CB    . PRO A 1 319 ? 45.553 2.737   -10.221 1.00 20.76 ? 316  PRO A CB    1 
ATOM   2475 C  CG    . PRO A 1 319 ? 46.188 4.026   -10.662 1.00 26.60 ? 316  PRO A CG    1 
ATOM   2476 C  CD    . PRO A 1 319 ? 47.535 3.684   -11.226 1.00 18.47 ? 316  PRO A CD    1 
ATOM   2477 N  N     . LYS A 1 320 ? 44.469 0.083   -11.974 1.00 19.09 ? 317  LYS A N     1 
ATOM   2478 C  CA    . LYS A 1 320 ? 43.488 -0.480  -12.915 1.00 16.21 ? 317  LYS A CA    1 
ATOM   2479 C  C     . LYS A 1 320 ? 42.094 0.122   -12.774 1.00 20.21 ? 317  LYS A C     1 
ATOM   2480 O  O     . LYS A 1 320 ? 41.222 -0.108  -13.617 1.00 18.71 ? 317  LYS A O     1 
ATOM   2481 C  CB    . LYS A 1 320 ? 43.294 -1.984  -12.660 1.00 22.25 ? 317  LYS A CB    1 
ATOM   2482 C  CG    . LYS A 1 320 ? 44.504 -2.879  -12.789 1.00 26.15 ? 317  LYS A CG    1 
ATOM   2483 C  CD    . LYS A 1 320 ? 44.048 -4.336  -12.734 1.00 23.27 ? 317  LYS A CD    1 
ATOM   2484 C  CE    . LYS A 1 320 ? 45.153 -5.286  -13.164 1.00 36.08 ? 317  LYS A CE    1 
ATOM   2485 N  NZ    . LYS A 1 320 ? 44.635 -6.668  -13.367 1.00 36.79 ? 317  LYS A NZ    1 
ATOM   2486 N  N     . THR A 1 321 ? 41.858 0.815   -11.666 1.00 19.63 ? 318  THR A N     1 
ATOM   2487 C  CA    . THR A 1 321 ? 40.557 1.422   -11.415 1.00 18.87 ? 318  THR A CA    1 
ATOM   2488 C  C     . THR A 1 321 ? 40.805 2.797   -10.844 1.00 14.91 ? 318  THR A C     1 
ATOM   2489 O  O     . THR A 1 321 ? 41.878 3.065   -10.291 1.00 20.31 ? 318  THR A O     1 
ATOM   2490 C  CB    . THR A 1 321 ? 39.682 0.597   -10.435 1.00 22.37 ? 318  THR A CB    1 
ATOM   2491 O  OG1   . THR A 1 321 ? 40.373 0.422   -9.189  1.00 20.69 ? 318  THR A OG1   1 
ATOM   2492 C  CG2   . THR A 1 321 ? 39.331 -0.762  -11.014 1.00 21.01 ? 318  THR A CG2   1 
ATOM   2493 N  N     . ILE A 1 322 ? 39.834 3.686   -11.015 1.00 14.14 ? 319  ILE A N     1 
ATOM   2494 C  CA    . ILE A 1 322 ? 39.899 5.015   -10.438 1.00 15.97 ? 319  ILE A CA    1 
ATOM   2495 C  C     . ILE A 1 322 ? 38.573 5.269   -9.733  1.00 16.33 ? 319  ILE A C     1 
ATOM   2496 O  O     . ILE A 1 322 ? 37.527 5.330   -10.371 1.00 17.74 ? 319  ILE A O     1 
ATOM   2497 C  CB    . ILE A 1 322 ? 40.150 6.087   -11.513 1.00 11.89 ? 319  ILE A CB    1 
ATOM   2498 C  CG1   . ILE A 1 322 ? 41.513 5.867   -12.168 1.00 20.78 ? 319  ILE A CG1   1 
ATOM   2499 C  CG2   . ILE A 1 322 ? 40.077 7.494   -10.906 1.00 17.00 ? 319  ILE A CG2   1 
ATOM   2500 C  CD1   . ILE A 1 322 ? 41.804 6.843   -13.302 1.00 19.90 ? 319  ILE A CD1   1 
ATOM   2501 N  N     . GLY A 1 323 ? 38.613 5.386   -8.413  1.00 16.58 ? 320  GLY A N     1 
ATOM   2502 C  CA    . GLY A 1 323 ? 37.381 5.476   -7.652  1.00 16.89 ? 320  GLY A CA    1 
ATOM   2503 C  C     . GLY A 1 323 ? 37.310 6.649   -6.700  1.00 14.61 ? 320  GLY A C     1 
ATOM   2504 O  O     . GLY A 1 323 ? 38.331 7.241   -6.346  1.00 14.19 ? 320  GLY A O     1 
ATOM   2505 N  N     . CYS A 1 324 ? 36.086 6.947   -6.261  1.00 13.45 ? 321  CYS A N     1 
ATOM   2506 C  CA    . CYS A 1 324 ? 35.792 8.062   -5.365  1.00 13.54 ? 321  CYS A CA    1 
ATOM   2507 C  C     . CYS A 1 324 ? 34.759 7.548   -4.367  1.00 11.05 ? 321  CYS A C     1 
ATOM   2508 O  O     . CYS A 1 324 ? 33.732 6.996   -4.762  1.00 14.06 ? 321  CYS A O     1 
ATOM   2509 C  CB    . CYS A 1 324 ? 35.184 9.221   -6.179  1.00 16.02 ? 321  CYS A CB    1 
ATOM   2510 S  SG    A CYS A 1 324 ? 35.491 10.822  -5.491  0.50 26.72 ? 321  CYS A SG    1 
ATOM   2511 S  SG    B CYS A 1 324 ? 36.338 10.094  -7.270  0.50 15.62 ? 321  CYS A SG    1 
ATOM   2512 N  N     . SER A 1 325 ? 35.011 7.700   -3.074  1.00 14.46 ? 322  SER A N     1 
ATOM   2513 C  CA    A SER A 1 325 ? 34.069 7.164   -2.104  0.50 15.94 ? 322  SER A CA    1 
ATOM   2514 C  CA    B SER A 1 325 ? 34.160 7.095   -2.053  0.50 16.00 ? 322  SER A CA    1 
ATOM   2515 C  C     . SER A 1 325 ? 33.943 8.035   -0.870  1.00 18.01 ? 322  SER A C     1 
ATOM   2516 O  O     . SER A 1 325 ? 34.874 8.718   -0.467  1.00 14.33 ? 322  SER A O     1 
ATOM   2517 C  CB    A SER A 1 325 ? 34.444 5.735   -1.702  0.50 17.68 ? 322  SER A CB    1 
ATOM   2518 C  CB    B SER A 1 325 ? 34.825 5.803   -1.557  0.50 16.54 ? 322  SER A CB    1 
ATOM   2519 O  OG    A SER A 1 325 ? 35.632 5.721   -0.943  0.50 13.84 ? 322  SER A OG    1 
ATOM   2520 O  OG    B SER A 1 325 ? 34.134 5.223   -0.466  0.50 15.83 ? 322  SER A OG    1 
ATOM   2521 N  N     . LYS A 1 326 ? 32.743 8.031   -0.293  1.00 13.21 ? 323  LYS A N     1 
ATOM   2522 C  CA    . LYS A 1 326 ? 32.507 8.786   0.933   1.00 15.18 ? 323  LYS A CA    1 
ATOM   2523 C  C     . LYS A 1 326 ? 31.539 8.070   1.852   1.00 14.57 ? 323  LYS A C     1 
ATOM   2524 O  O     . LYS A 1 326 ? 30.490 7.601   1.408   1.00 12.85 ? 323  LYS A O     1 
ATOM   2525 C  CB    . LYS A 1 326 ? 31.979 10.191  0.640   1.00 13.62 ? 323  LYS A CB    1 
ATOM   2526 C  CG    . LYS A 1 326 ? 31.883 11.026  1.928   1.00 16.28 ? 323  LYS A CG    1 
ATOM   2527 C  CD    . LYS A 1 326 ? 31.556 12.475  1.667   1.00 18.71 ? 323  LYS A CD    1 
ATOM   2528 C  CE    . LYS A 1 326 ? 31.379 13.202  2.991   1.00 21.77 ? 323  LYS A CE    1 
ATOM   2529 N  NZ    . LYS A 1 326 ? 32.539 12.949  3.864   1.00 23.60 ? 323  LYS A NZ    1 
ATOM   2530 N  N     . ASN A 1 327 ? 31.908 7.975   3.128   1.00 14.22 ? 324  ASN A N     1 
ATOM   2531 C  CA    . ASN A 1 327 ? 31.016 7.468   4.161   1.00 17.84 ? 324  ASN A CA    1 
ATOM   2532 C  C     . ASN A 1 327 ? 30.144 8.573   4.727   1.00 17.05 ? 324  ASN A C     1 
ATOM   2533 O  O     . ASN A 1 327 ? 30.513 9.750   4.730   1.00 15.63 ? 324  ASN A O     1 
ATOM   2534 C  CB    . ASN A 1 327 ? 31.800 6.849   5.325   1.00 16.70 ? 324  ASN A CB    1 
ATOM   2535 C  CG    . ASN A 1 327 ? 32.486 5.555   4.956   1.00 23.00 ? 324  ASN A CG    1 
ATOM   2536 O  OD1   . ASN A 1 327 ? 32.289 5.007   3.871   1.00 24.87 ? 324  ASN A OD1   1 
ATOM   2537 N  ND2   . ASN A 1 327 ? 33.300 5.048   5.877   1.00 23.31 ? 324  ASN A ND2   1 
ATOM   2538 N  N     . PHE A 1 328 ? 28.985 8.171   5.225   1.00 17.87 ? 325  PHE A N     1 
ATOM   2539 C  CA    . PHE A 1 328 ? 28.046 9.085   5.849   1.00 19.41 ? 325  PHE A CA    1 
ATOM   2540 C  C     . PHE A 1 328 ? 27.551 8.407   7.115   1.00 26.58 ? 325  PHE A C     1 
ATOM   2541 O  O     . PHE A 1 328 ? 26.441 7.867   7.155   1.00 24.97 ? 325  PHE A O     1 
ATOM   2542 C  CB    . PHE A 1 328 ? 26.898 9.385   4.885   1.00 19.40 ? 325  PHE A CB    1 
ATOM   2543 C  CG    . PHE A 1 328 ? 27.349 9.966   3.586   1.00 18.47 ? 325  PHE A CG    1 
ATOM   2544 C  CD1   . PHE A 1 328 ? 27.571 9.147   2.485   1.00 17.45 ? 325  PHE A CD1   1 
ATOM   2545 C  CD2   . PHE A 1 328 ? 27.588 11.326  3.465   1.00 13.84 ? 325  PHE A CD2   1 
ATOM   2546 C  CE1   . PHE A 1 328 ? 27.997 9.685   1.281   1.00 15.92 ? 325  PHE A CE1   1 
ATOM   2547 C  CE2   . PHE A 1 328 ? 28.014 11.871  2.265   1.00 18.17 ? 325  PHE A CE2   1 
ATOM   2548 C  CZ    . PHE A 1 328 ? 28.223 11.044  1.166   1.00 17.58 ? 325  PHE A CZ    1 
ATOM   2549 N  N     . PRO A 1 329 ? 28.396 8.417   8.154   1.00 25.54 ? 326  PRO A N     1 
ATOM   2550 C  CA    . PRO A 1 329 ? 28.183 7.662   9.390   1.00 35.97 ? 326  PRO A CA    1 
ATOM   2551 C  C     . PRO A 1 329 ? 27.090 8.240   10.277  1.00 28.45 ? 326  PRO A C     1 
ATOM   2552 O  O     . PRO A 1 329 ? 26.760 9.427   10.191  1.00 27.42 ? 326  PRO A O     1 
ATOM   2553 C  CB    . PRO A 1 329 ? 29.537 7.776   10.098  1.00 28.77 ? 326  PRO A CB    1 
ATOM   2554 C  CG    . PRO A 1 329 ? 30.089 9.069   9.619   1.00 32.18 ? 326  PRO A CG    1 
ATOM   2555 C  CD    . PRO A 1 329 ? 29.680 9.139   8.171   1.00 29.64 ? 326  PRO A CD    1 
ATOM   2556 N  N     . GLY A 1 330 ? 26.548 7.378   11.131  1.00 42.40 ? 327  GLY A N     1 
ATOM   2557 C  CA    . GLY A 1 330 ? 25.569 7.765   12.126  1.00 42.12 ? 327  GLY A CA    1 
ATOM   2558 C  C     . GLY A 1 330 ? 24.524 8.737   11.627  1.00 31.67 ? 327  GLY A C     1 
ATOM   2559 O  O     . GLY A 1 330 ? 23.750 8.434   10.719  1.00 37.65 ? 327  GLY A O     1 
ATOM   2560 N  N     . LYS A 1 331 ? 24.517 9.922   12.224  1.00 30.44 ? 328  LYS A N     1 
ATOM   2561 C  CA    . LYS A 1 331 ? 23.432 10.868  12.027  1.00 37.36 ? 328  LYS A CA    1 
ATOM   2562 C  C     . LYS A 1 331 ? 23.552 11.636  10.715  1.00 36.41 ? 328  LYS A C     1 
ATOM   2563 O  O     . LYS A 1 331 ? 22.674 12.425  10.369  1.00 38.05 ? 328  LYS A O     1 
ATOM   2564 C  CB    . LYS A 1 331 ? 23.355 11.825  13.226  1.00 47.72 ? 328  LYS A CB    1 
ATOM   2565 C  CG    . LYS A 1 331 ? 22.096 12.676  13.280  1.00 63.36 ? 328  LYS A CG    1 
ATOM   2566 C  CD    . LYS A 1 331 ? 21.965 13.397  14.616  1.00 61.14 ? 328  LYS A CD    1 
ATOM   2567 C  CE    . LYS A 1 331 ? 21.026 14.594  14.507  1.00 56.29 ? 328  LYS A CE    1 
ATOM   2568 N  NZ    . LYS A 1 331 ? 21.554 15.624  13.560  1.00 52.35 ? 328  LYS A NZ    1 
ATOM   2569 N  N     . THR A 1 332 ? 24.630 11.404  9.973   1.00 35.08 ? 329  THR A N     1 
ATOM   2570 C  CA    . THR A 1 332 ? 24.819 12.114  8.709   1.00 31.27 ? 329  THR A CA    1 
ATOM   2571 C  C     . THR A 1 332 ? 24.341 11.318  7.493   1.00 22.39 ? 329  THR A C     1 
ATOM   2572 O  O     . THR A 1 332 ? 24.396 11.816  6.373   1.00 27.83 ? 329  THR A O     1 
ATOM   2573 C  CB    . THR A 1 332 ? 26.288 12.552  8.488   1.00 27.08 ? 329  THR A CB    1 
ATOM   2574 O  OG1   . THR A 1 332 ? 27.099 11.401  8.229   1.00 26.10 ? 329  THR A OG1   1 
ATOM   2575 C  CG2   . THR A 1 332 ? 26.822 13.296  9.707   1.00 30.11 ? 329  THR A CG2   1 
ATOM   2576 N  N     . ALA A 1 333 ? 23.870 10.094  7.718   1.00 27.24 ? 330  ALA A N     1 
ATOM   2577 C  CA    . ALA A 1 333 ? 23.344 9.254   6.635   1.00 23.49 ? 330  ALA A CA    1 
ATOM   2578 C  C     . ALA A 1 333 ? 22.344 9.987   5.749   1.00 30.63 ? 330  ALA A C     1 
ATOM   2579 O  O     . ALA A 1 333 ? 21.528 10.766  6.233   1.00 33.73 ? 330  ALA A O     1 
ATOM   2580 C  CB    . ALA A 1 333 ? 22.732 7.989   7.196   1.00 22.52 ? 330  ALA A CB    1 
ATOM   2581 N  N     . LEU A 1 334 ? 22.406 9.730   4.445   1.00 26.65 ? 331  LEU A N     1 
ATOM   2582 C  CA    . LEU A 1 334 ? 21.600 10.475  3.484   1.00 29.30 ? 331  LEU A CA    1 
ATOM   2583 C  C     . LEU A 1 334 ? 20.157 9.953   3.467   1.00 27.46 ? 331  LEU A C     1 
ATOM   2584 O  O     . LEU A 1 334 ? 19.910 8.790   3.147   1.00 28.81 ? 331  LEU A O     1 
ATOM   2585 C  CB    . LEU A 1 334 ? 22.231 10.412  2.090   1.00 28.63 ? 331  LEU A CB    1 
ATOM   2586 C  CG    . LEU A 1 334 ? 23.745 10.653  2.025   1.00 23.20 ? 331  LEU A CG    1 
ATOM   2587 C  CD1   . LEU A 1 334 ? 24.225 10.691  0.578   1.00 19.40 ? 331  LEU A CD1   1 
ATOM   2588 C  CD2   . LEU A 1 334 ? 24.128 11.944  2.747   1.00 24.87 ? 331  LEU A CD2   1 
ATOM   2589 N  N     . ALA A 1 335 ? 19.215 10.822  3.825   1.00 35.71 ? 332  ALA A N     1 
ATOM   2590 C  CA    . ALA A 1 335 ? 17.830 10.402  4.044   1.00 34.59 ? 332  ALA A CA    1 
ATOM   2591 C  C     . ALA A 1 335 ? 16.840 11.048  3.077   1.00 34.85 ? 332  ALA A C     1 
ATOM   2592 O  O     . ALA A 1 335 ? 15.641 10.773  3.134   1.00 38.71 ? 332  ALA A O     1 
ATOM   2593 C  CB    . ALA A 1 335 ? 17.418 10.679  5.486   1.00 36.11 ? 332  ALA A CB    1 
ATOM   2594 N  N     . THR A 1 336 ? 17.339 11.912  2.202   1.00 27.05 ? 333  THR A N     1 
ATOM   2595 C  CA    . THR A 1 336 ? 16.505 12.524  1.177   1.00 33.35 ? 333  THR A CA    1 
ATOM   2596 C  C     . THR A 1 336 ? 17.087 12.301  -0.216  1.00 42.74 ? 333  THR A C     1 
ATOM   2597 O  O     . THR A 1 336 ? 18.296 12.128  -0.378  1.00 36.94 ? 333  THR A O     1 
ATOM   2598 C  CB    . THR A 1 336 ? 16.341 14.033  1.395   1.00 37.64 ? 333  THR A CB    1 
ATOM   2599 O  OG1   . THR A 1 336 ? 17.520 14.720  0.950   1.00 32.40 ? 333  THR A OG1   1 
ATOM   2600 C  CG2   . THR A 1 336 ? 16.074 14.345  2.865   1.00 29.61 ? 333  THR A CG2   1 
ATOM   2601 N  N     . ARG A 1 337 ? 16.219 12.318  -1.222  1.00 41.56 ? 334  ARG A N     1 
ATOM   2602 C  CA    . ARG A 1 337 ? 16.644 12.151  -2.603  1.00 39.32 ? 334  ARG A CA    1 
ATOM   2603 C  C     . ARG A 1 337 ? 17.586 13.273  -3.019  1.00 37.01 ? 334  ARG A C     1 
ATOM   2604 O  O     . ARG A 1 337 ? 18.584 13.039  -3.700  1.00 35.32 ? 334  ARG A O     1 
ATOM   2605 C  CB    . ARG A 1 337 ? 15.431 12.108  -3.534  1.00 45.47 ? 334  ARG A CB    1 
ATOM   2606 C  CG    . ARG A 1 337 ? 15.780 11.936  -5.005  1.00 49.73 ? 334  ARG A CG    1 
ATOM   2607 C  CD    . ARG A 1 337 ? 14.528 11.904  -5.878  1.00 51.01 ? 334  ARG A CD    1 
ATOM   2608 N  NE    . ARG A 1 337 ? 13.617 12.999  -5.558  1.00 61.21 ? 334  ARG A NE    1 
ATOM   2609 C  CZ    . ARG A 1 337 ? 13.828 14.268  -5.892  1.00 61.11 ? 334  ARG A CZ    1 
ATOM   2610 N  NH1   . ARG A 1 337 ? 14.925 14.607  -6.559  1.00 55.91 ? 334  ARG A NH1   1 
ATOM   2611 N  NH2   . ARG A 1 337 ? 12.945 15.200  -5.556  1.00 64.01 ? 334  ARG A NH2   1 
ATOM   2612 N  N     . GLU A 1 338 ? 17.268 14.494  -2.605  1.00 39.14 ? 335  GLU A N     1 
ATOM   2613 C  CA    . GLU A 1 338 ? 18.103 15.646  -2.923  1.00 38.25 ? 335  GLU A CA    1 
ATOM   2614 C  C     . GLU A 1 338 ? 19.517 15.479  -2.379  1.00 30.24 ? 335  GLU A C     1 
ATOM   2615 O  O     . GLU A 1 338 ? 20.491 15.874  -3.022  1.00 30.50 ? 335  GLU A O     1 
ATOM   2616 C  CB    . GLU A 1 338 ? 17.490 16.926  -2.355  1.00 39.87 ? 335  GLU A CB    1 
ATOM   2617 C  CG    . GLU A 1 338 ? 16.245 17.398  -3.082  1.00 56.21 ? 335  GLU A CG    1 
ATOM   2618 C  CD    . GLU A 1 338 ? 16.539 17.880  -4.489  1.00 65.91 ? 335  GLU A CD    1 
ATOM   2619 O  OE1   . GLU A 1 338 ? 17.733 17.971  -4.851  1.00 59.93 ? 335  GLU A OE1   1 
ATOM   2620 O  OE2   . GLU A 1 338 ? 15.575 18.170  -5.232  1.00 71.14 ? 335  GLU A OE2   1 
ATOM   2621 N  N     . GLN A 1 339 ? 19.626 14.922  -1.178  1.00 31.91 ? 336  GLN A N     1 
ATOM   2622 C  CA    . GLN A 1 339 ? 20.934 14.663  -0.585  1.00 33.07 ? 336  GLN A CA    1 
ATOM   2623 C  C     . GLN A 1 339 ? 21.711 13.670  -1.434  1.00 30.86 ? 336  GLN A C     1 
ATOM   2624 O  O     . GLN A 1 339 ? 22.856 13.915  -1.812  1.00 26.66 ? 336  GLN A O     1 
ATOM   2625 C  CB    . GLN A 1 339 ? 20.782 14.075  0.809   1.00 30.29 ? 336  GLN A CB    1 
ATOM   2626 C  CG    . GLN A 1 339 ? 20.823 15.073  1.934   1.00 27.24 ? 336  GLN A CG    1 
ATOM   2627 C  CD    . GLN A 1 339 ? 20.928 14.382  3.270   1.00 24.76 ? 336  GLN A CD    1 
ATOM   2628 O  OE1   . GLN A 1 339 ? 20.145 13.483  3.584   1.00 29.76 ? 336  GLN A OE1   1 
ATOM   2629 N  NE2   . GLN A 1 339 ? 21.911 14.787  4.065   1.00 28.19 ? 336  GLN A NE2   1 
ATOM   2630 N  N     . VAL A 1 340 ? 21.079 12.537  -1.713  1.00 27.04 ? 337  VAL A N     1 
ATOM   2631 C  CA    . VAL A 1 340 ? 21.707 11.475  -2.483  1.00 29.92 ? 337  VAL A CA    1 
ATOM   2632 C  C     . VAL A 1 340 ? 22.204 11.969  -3.839  1.00 30.28 ? 337  VAL A C     1 
ATOM   2633 O  O     . VAL A 1 340 ? 23.297 11.612  -4.276  1.00 26.51 ? 337  VAL A O     1 
ATOM   2634 C  CB    . VAL A 1 340 ? 20.751 10.285  -2.672  1.00 34.40 ? 337  VAL A CB    1 
ATOM   2635 C  CG1   . VAL A 1 340 ? 21.329 9.286   -3.662  1.00 23.83 ? 337  VAL A CG1   1 
ATOM   2636 C  CG2   . VAL A 1 340 ? 20.471 9.618   -1.332  1.00 28.98 ? 337  VAL A CG2   1 
ATOM   2637 N  N     . GLN A 1 341 ? 21.407 12.797  -4.501  1.00 27.00 ? 338  GLN A N     1 
ATOM   2638 C  CA    . GLN A 1 341 ? 21.779 13.310  -5.810  1.00 29.17 ? 338  GLN A CA    1 
ATOM   2639 C  C     . GLN A 1 341 ? 22.904 14.324  -5.705  1.00 28.23 ? 338  GLN A C     1 
ATOM   2640 O  O     . GLN A 1 341 ? 23.788 14.375  -6.556  1.00 22.90 ? 338  GLN A O     1 
ATOM   2641 C  CB    . GLN A 1 341 ? 20.563 13.907  -6.524  1.00 32.18 ? 338  GLN A CB    1 
ATOM   2642 C  CG    . GLN A 1 341 ? 19.471 12.879  -6.754  1.00 30.95 ? 338  GLN A CG    1 
ATOM   2643 C  CD    . GLN A 1 341 ? 18.244 13.456  -7.434  1.00 43.47 ? 338  GLN A CD    1 
ATOM   2644 O  OE1   . GLN A 1 341 ? 17.998 14.664  -7.388  1.00 38.11 ? 338  GLN A OE1   1 
ATOM   2645 N  NE2   . GLN A 1 341 ? 17.470 12.589  -8.079  1.00 39.72 ? 338  GLN A NE2   1 
ATOM   2646 N  N     . TRP A 1 342 ? 22.886 15.122  -4.647  1.00 24.19 ? 339  TRP A N     1 
ATOM   2647 C  CA    . TRP A 1 342 ? 23.914 16.128  -4.475  1.00 24.95 ? 339  TRP A CA    1 
ATOM   2648 C  C     . TRP A 1 342 ? 25.289 15.499  -4.253  1.00 16.81 ? 339  TRP A C     1 
ATOM   2649 O  O     . TRP A 1 342 ? 26.282 15.953  -4.816  1.00 21.25 ? 339  TRP A O     1 
ATOM   2650 C  CB    . TRP A 1 342 ? 23.573 17.068  -3.316  1.00 18.45 ? 339  TRP A CB    1 
ATOM   2651 C  CG    . TRP A 1 342 ? 24.507 18.227  -3.256  1.00 24.81 ? 339  TRP A CG    1 
ATOM   2652 C  CD1   . TRP A 1 342 ? 24.441 19.375  -3.995  1.00 28.24 ? 339  TRP A CD1   1 
ATOM   2653 C  CD2   . TRP A 1 342 ? 25.664 18.349  -2.427  1.00 21.71 ? 339  TRP A CD2   1 
ATOM   2654 N  NE1   . TRP A 1 342 ? 25.483 20.202  -3.674  1.00 27.28 ? 339  TRP A NE1   1 
ATOM   2655 C  CE2   . TRP A 1 342 ? 26.249 19.597  -2.712  1.00 22.95 ? 339  TRP A CE2   1 
ATOM   2656 C  CE3   . TRP A 1 342 ? 26.266 17.520  -1.480  1.00 20.34 ? 339  TRP A CE3   1 
ATOM   2657 C  CZ2   . TRP A 1 342 ? 27.405 20.042  -2.077  1.00 28.41 ? 339  TRP A CZ2   1 
ATOM   2658 C  CZ3   . TRP A 1 342 ? 27.408 17.959  -0.849  1.00 27.03 ? 339  TRP A CZ3   1 
ATOM   2659 C  CH2   . TRP A 1 342 ? 27.970 19.209  -1.149  1.00 27.30 ? 339  TRP A CH2   1 
ATOM   2660 N  N     . TRP A 1 343 ? 25.343 14.463  -3.424  1.00 17.75 ? 340  TRP A N     1 
ATOM   2661 C  CA    . TRP A 1 343 ? 26.613 13.802  -3.142  1.00 18.57 ? 340  TRP A CA    1 
ATOM   2662 C  C     . TRP A 1 343 ? 27.084 12.938  -4.304  1.00 18.20 ? 340  TRP A C     1 
ATOM   2663 O  O     . TRP A 1 343 ? 28.273 12.864  -4.567  1.00 18.95 ? 340  TRP A O     1 
ATOM   2664 C  CB    . TRP A 1 343 ? 26.538 12.983  -1.856  1.00 14.07 ? 340  TRP A CB    1 
ATOM   2665 C  CG    . TRP A 1 343 ? 26.655 13.835  -0.627  1.00 22.48 ? 340  TRP A CG    1 
ATOM   2666 C  CD1   . TRP A 1 343 ? 25.658 14.159  0.248   1.00 22.51 ? 340  TRP A CD1   1 
ATOM   2667 C  CD2   . TRP A 1 343 ? 27.840 14.479  -0.143  1.00 18.70 ? 340  TRP A CD2   1 
ATOM   2668 N  NE1   . TRP A 1 343 ? 26.153 14.969  1.250   1.00 20.73 ? 340  TRP A NE1   1 
ATOM   2669 C  CE2   . TRP A 1 343 ? 27.493 15.174  1.034   1.00 21.50 ? 340  TRP A CE2   1 
ATOM   2670 C  CE3   . TRP A 1 343 ? 29.165 14.534  -0.589  1.00 17.22 ? 340  TRP A CE3   1 
ATOM   2671 C  CZ2   . TRP A 1 343 ? 28.419 15.909  1.771   1.00 18.02 ? 340  TRP A CZ2   1 
ATOM   2672 C  CZ3   . TRP A 1 343 ? 30.079 15.268  0.136   1.00 19.88 ? 340  TRP A CZ3   1 
ATOM   2673 C  CH2   . TRP A 1 343 ? 29.703 15.949  1.306   1.00 21.10 ? 340  TRP A CH2   1 
ATOM   2674 N  N     . LEU A 1 344 ? 26.156 12.292  -5.007  1.00 16.20 ? 341  LEU A N     1 
ATOM   2675 C  CA    . LEU A 1 344 ? 26.544 11.574  -6.218  1.00 22.81 ? 341  LEU A CA    1 
ATOM   2676 C  C     . LEU A 1 344 ? 27.211 12.548  -7.169  1.00 18.25 ? 341  LEU A C     1 
ATOM   2677 O  O     . LEU A 1 344 ? 28.207 12.215  -7.814  1.00 16.97 ? 341  LEU A O     1 
ATOM   2678 C  CB    . LEU A 1 344 ? 25.346 10.898  -6.900  1.00 17.49 ? 341  LEU A CB    1 
ATOM   2679 C  CG    . LEU A 1 344 ? 24.834 9.594   -6.287  1.00 24.13 ? 341  LEU A CG    1 
ATOM   2680 C  CD1   . LEU A 1 344 ? 23.523 9.192   -6.942  1.00 25.11 ? 341  LEU A CD1   1 
ATOM   2681 C  CD2   . LEU A 1 344 ? 25.876 8.480   -6.403  1.00 22.29 ? 341  LEU A CD2   1 
ATOM   2682 N  N     . LEU A 1 345 ? 26.677 13.765  -7.249  1.00 14.28 ? 342  LEU A N     1 
ATOM   2683 C  CA    . LEU A 1 345 ? 27.282 14.783  -8.091  1.00 16.88 ? 342  LEU A CA    1 
ATOM   2684 C  C     . LEU A 1 345 ? 28.681 15.179  -7.622  1.00 15.99 ? 342  LEU A C     1 
ATOM   2685 O  O     . LEU A 1 345 ? 29.582 15.349  -8.432  1.00 14.10 ? 342  LEU A O     1 
ATOM   2686 C  CB    . LEU A 1 345 ? 26.398 16.032  -8.200  1.00 19.48 ? 342  LEU A CB    1 
ATOM   2687 C  CG    . LEU A 1 345 ? 26.932 17.090  -9.165  1.00 26.20 ? 342  LEU A CG    1 
ATOM   2688 C  CD1   . LEU A 1 345 ? 27.051 16.532  -10.593 1.00 22.22 ? 342  LEU A CD1   1 
ATOM   2689 C  CD2   . LEU A 1 345 ? 26.061 18.337  -9.149  1.00 26.77 ? 342  LEU A CD2   1 
ATOM   2690 N  N     . GLN A 1 346 ? 28.868 15.348  -6.318  1.00 16.65 ? 343  GLN A N     1 
ATOM   2691 C  CA    . GLN A 1 346 ? 30.188 15.728  -5.828  1.00 15.98 ? 343  GLN A CA    1 
ATOM   2692 C  C     . GLN A 1 346 ? 31.224 14.669  -6.207  1.00 16.19 ? 343  GLN A C     1 
ATOM   2693 O  O     . GLN A 1 346 ? 32.313 15.005  -6.686  1.00 13.50 ? 343  GLN A O     1 
ATOM   2694 C  CB    . GLN A 1 346 ? 30.186 15.938  -4.305  1.00 20.11 ? 343  GLN A CB    1 
ATOM   2695 C  CG    . GLN A 1 346 ? 29.199 17.002  -3.818  1.00 21.77 ? 343  GLN A CG    1 
ATOM   2696 C  CD    . GLN A 1 346 ? 29.159 18.234  -4.703  1.00 21.88 ? 343  GLN A CD    1 
ATOM   2697 O  OE1   . GLN A 1 346 ? 30.106 19.030  -4.742  1.00 23.78 ? 343  GLN A OE1   1 
ATOM   2698 N  NE2   . GLN A 1 346 ? 28.052 18.402  -5.423  1.00 20.78 ? 343  GLN A NE2   1 
ATOM   2699 N  N     . LEU A 1 347 ? 30.875 13.407  -5.962  1.00 15.72 ? 344  LEU A N     1 
ATOM   2700 C  CA    . LEU A 1 347 ? 31.742 12.269  -6.269  1.00 16.90 ? 344  LEU A CA    1 
ATOM   2701 C  C     . LEU A 1 347 ? 32.033 12.206  -7.759  1.00 18.95 ? 344  LEU A C     1 
ATOM   2702 O  O     . LEU A 1 347 ? 33.178 12.003  -8.170  1.00 15.16 ? 344  LEU A O     1 
ATOM   2703 C  CB    . LEU A 1 347 ? 31.111 10.952  -5.803  1.00 13.88 ? 344  LEU A CB    1 
ATOM   2704 C  CG    . LEU A 1 347 ? 31.155 10.649  -4.302  1.00 18.30 ? 344  LEU A CG    1 
ATOM   2705 C  CD1   . LEU A 1 347 ? 30.481 9.313   -3.988  1.00 21.02 ? 344  LEU A CD1   1 
ATOM   2706 C  CD2   . LEU A 1 347 ? 32.575 10.638  -3.812  1.00 22.62 ? 344  LEU A CD2   1 
ATOM   2707 N  N     . ALA A 1 348 ? 30.988 12.386  -8.562  1.00 17.54 ? 345  ALA A N     1 
ATOM   2708 C  CA    . ALA A 1 348 ? 31.117 12.348  -10.012 1.00 13.78 ? 345  ALA A CA    1 
ATOM   2709 C  C     . ALA A 1 348 ? 32.038 13.446  -10.536 1.00 17.71 ? 345  ALA A C     1 
ATOM   2710 O  O     . ALA A 1 348 ? 32.772 13.240  -11.504 1.00 16.67 ? 345  ALA A O     1 
ATOM   2711 C  CB    . ALA A 1 348 ? 29.735 12.446  -10.676 1.00 11.00 ? 345  ALA A CB    1 
ATOM   2712 N  N     . GLN A 1 349 ? 31.989 14.618  -9.906  1.00 16.14 ? 346  GLN A N     1 
ATOM   2713 C  CA    . GLN A 1 349 ? 32.847 15.718  -10.303 1.00 12.72 ? 346  GLN A CA    1 
ATOM   2714 C  C     . GLN A 1 349 ? 34.313 15.436  -9.991  1.00 15.75 ? 346  GLN A C     1 
ATOM   2715 O  O     . GLN A 1 349 ? 35.191 15.750  -10.787 1.00 14.07 ? 346  GLN A O     1 
ATOM   2716 C  CB    . GLN A 1 349 ? 32.402 17.033  -9.658  1.00 16.79 ? 346  GLN A CB    1 
ATOM   2717 C  CG    . GLN A 1 349 ? 31.220 17.664  -10.388 1.00 22.67 ? 346  GLN A CG    1 
ATOM   2718 C  CD    . GLN A 1 349 ? 30.637 18.868  -9.663  1.00 27.16 ? 346  GLN A CD    1 
ATOM   2719 O  OE1   . GLN A 1 349 ? 31.158 19.309  -8.642  1.00 31.46 ? 346  GLN A OE1   1 
ATOM   2720 N  NE2   . GLN A 1 349 ? 29.541 19.397  -10.194 1.00 29.14 ? 346  GLN A NE2   1 
ATOM   2721 N  N     . GLU A 1 350 ? 34.581 14.837  -8.839  1.00 10.46 ? 347  GLU A N     1 
ATOM   2722 C  CA    . GLU A 1 350 ? 35.966 14.487  -8.530  1.00 14.87 ? 347  GLU A CA    1 
ATOM   2723 C  C     . GLU A 1 350 ? 36.429 13.412  -9.504  1.00 14.22 ? 347  GLU A C     1 
ATOM   2724 O  O     . GLU A 1 350 ? 37.560 13.458  -9.995  1.00 15.79 ? 347  GLU A O     1 
ATOM   2725 C  CB    . GLU A 1 350 ? 36.159 13.998  -7.088  1.00 13.75 ? 347  GLU A CB    1 
ATOM   2726 C  CG    . GLU A 1 350 ? 37.646 13.715  -6.793  1.00 20.23 ? 347  GLU A CG    1 
ATOM   2727 C  CD    . GLU A 1 350 ? 37.897 13.076  -5.437  1.00 25.20 ? 347  GLU A CD    1 
ATOM   2728 O  OE1   . GLU A 1 350 ? 37.174 13.401  -4.476  1.00 23.17 ? 347  GLU A OE1   1 
ATOM   2729 O  OE2   . GLU A 1 350 ? 38.821 12.244  -5.335  1.00 24.39 ? 347  GLU A OE2   1 
ATOM   2730 N  N     . LEU A 1 351 ? 35.547 12.451  -9.765  1.00 13.14 ? 348  LEU A N     1 
ATOM   2731 C  CA    . LEU A 1 351 ? 35.864 11.325  -10.633 1.00 13.07 ? 348  LEU A CA    1 
ATOM   2732 C  C     . LEU A 1 351 ? 36.155 11.822  -12.047 1.00 17.65 ? 348  LEU A C     1 
ATOM   2733 O  O     . LEU A 1 351 ? 37.125 11.406  -12.664 1.00 14.19 ? 348  LEU A O     1 
ATOM   2734 C  CB    . LEU A 1 351 ? 34.725 10.307  -10.649 1.00 16.16 ? 348  LEU A CB    1 
ATOM   2735 C  CG    . LEU A 1 351 ? 34.956 9.012   -11.450 1.00 16.78 ? 348  LEU A CG    1 
ATOM   2736 C  CD1   . LEU A 1 351 ? 36.264 8.343   -11.010 1.00 21.31 ? 348  LEU A CD1   1 
ATOM   2737 C  CD2   . LEU A 1 351 ? 33.781 8.055   -11.296 1.00 20.40 ? 348  LEU A CD2   1 
ATOM   2738 N  N     . GLU A 1 352 ? 35.327 12.735  -12.550 1.00 16.05 ? 349  GLU A N     1 
ATOM   2739 C  CA    . GLU A 1 352 ? 35.555 13.300  -13.884 1.00 16.74 ? 349  GLU A CA    1 
ATOM   2740 C  C     . GLU A 1 352 ? 36.907 13.988  -13.977 1.00 16.43 ? 349  GLU A C     1 
ATOM   2741 O  O     . GLU A 1 352 ? 37.610 13.885  -14.981 1.00 14.61 ? 349  GLU A O     1 
ATOM   2742 C  CB    . GLU A 1 352 ? 34.440 14.283  -14.273 1.00 15.42 ? 349  GLU A CB    1 
ATOM   2743 C  CG    . GLU A 1 352 ? 34.809 15.147  -15.477 1.00 23.11 ? 349  GLU A CG    1 
ATOM   2744 C  CD    . GLU A 1 352 ? 33.645 15.957  -16.024 1.00 42.93 ? 349  GLU A CD    1 
ATOM   2745 O  OE1   . GLU A 1 352 ? 33.795 16.524  -17.132 1.00 44.27 ? 349  GLU A OE1   1 
ATOM   2746 O  OE2   . GLU A 1 352 ? 32.585 16.029  -15.357 1.00 35.69 ? 349  GLU A OE2   1 
ATOM   2747 N  N     . GLU A 1 353 ? 37.274 14.701  -12.924 1.00 17.17 ? 350  GLU A N     1 
ATOM   2748 C  CA    . GLU A 1 353 ? 38.547 15.399  -12.901 1.00 15.09 ? 350  GLU A CA    1 
ATOM   2749 C  C     . GLU A 1 353 ? 39.706 14.407  -13.010 1.00 16.80 ? 350  GLU A C     1 
ATOM   2750 O  O     . GLU A 1 353 ? 40.637 14.577  -13.814 1.00 17.34 ? 350  GLU A O     1 
ATOM   2751 C  CB    . GLU A 1 353 ? 38.655 16.193  -11.605 1.00 20.56 ? 350  GLU A CB    1 
ATOM   2752 C  CG    . GLU A 1 353 ? 39.777 17.193  -11.567 1.00 31.48 ? 350  GLU A CG    1 
ATOM   2753 C  CD    . GLU A 1 353 ? 39.636 18.135  -10.392 1.00 41.78 ? 350  GLU A CD    1 
ATOM   2754 O  OE1   . GLU A 1 353 ? 39.380 17.644  -9.271  1.00 48.65 ? 350  GLU A OE1   1 
ATOM   2755 O  OE2   . GLU A 1 353 ? 39.757 19.362  -10.592 1.00 48.47 ? 350  GLU A OE2   1 
ATOM   2756 N  N     . ARG A 1 354 ? 39.653 13.361  -12.198 1.00 16.54 ? 351  ARG A N     1 
ATOM   2757 C  CA    . ARG A 1 354 ? 40.731 12.374  -12.211 1.00 19.28 ? 351  ARG A CA    1 
ATOM   2758 C  C     . ARG A 1 354 ? 40.780 11.586  -13.512 1.00 16.93 ? 351  ARG A C     1 
ATOM   2759 O  O     . ARG A 1 354 ? 41.868 11.285  -14.005 1.00 13.21 ? 351  ARG A O     1 
ATOM   2760 C  CB    . ARG A 1 354 ? 40.620 11.428  -11.017 1.00 13.72 ? 351  ARG A CB    1 
ATOM   2761 C  CG    A ARG A 1 354 ? 40.936 12.150  -9.710  0.50 17.74 ? 351  ARG A CG    1 
ATOM   2762 C  CG    B ARG A 1 354 ? 40.882 12.064  -9.660  0.50 17.79 ? 351  ARG A CG    1 
ATOM   2763 C  CD    A ARG A 1 354 ? 40.384 11.422  -8.501  0.50 17.90 ? 351  ARG A CD    1 
ATOM   2764 C  CD    B ARG A 1 354 ? 40.803 11.001  -8.565  0.50 16.31 ? 351  ARG A CD    1 
ATOM   2765 N  NE    A ARG A 1 354 ? 40.977 10.103  -8.338  0.50 11.89 ? 351  ARG A NE    1 
ATOM   2766 N  NE    B ARG A 1 354 ? 41.782 9.939   -8.776  0.50 16.78 ? 351  ARG A NE    1 
ATOM   2767 C  CZ    A ARG A 1 354 ? 40.648 9.255   -7.372  0.50 16.95 ? 351  ARG A CZ    1 
ATOM   2768 C  CZ    B ARG A 1 354 ? 41.684 8.707   -8.283  0.50 18.19 ? 351  ARG A CZ    1 
ATOM   2769 N  NH1   A ARG A 1 354 ? 39.721 9.591   -6.478  0.50 13.26 ? 351  ARG A NH1   1 
ATOM   2770 N  NH1   B ARG A 1 354 ? 40.636 8.357   -7.554  0.50 17.89 ? 351  ARG A NH1   1 
ATOM   2771 N  NH2   A ARG A 1 354 ? 41.244 8.068   -7.307  0.50 15.10 ? 351  ARG A NH2   1 
ATOM   2772 N  NH2   B ARG A 1 354 ? 42.631 7.816   -8.533  0.50 16.15 ? 351  ARG A NH2   1 
ATOM   2773 N  N     . LEU A 1 355 ? 39.609 11.250  -14.057 1.00 14.56 ? 352  LEU A N     1 
ATOM   2774 C  CA    . LEU A 1 355 ? 39.523 10.511  -15.321 1.00 15.66 ? 352  LEU A CA    1 
ATOM   2775 C  C     . LEU A 1 355 ? 40.080 11.306  -16.497 1.00 14.91 ? 352  LEU A C     1 
ATOM   2776 O  O     . LEU A 1 355 ? 40.775 10.755  -17.344 1.00 15.69 ? 352  LEU A O     1 
ATOM   2777 C  CB    . LEU A 1 355 ? 38.079 10.104  -15.619 1.00 13.29 ? 352  LEU A CB    1 
ATOM   2778 C  CG    . LEU A 1 355 ? 37.503 8.927   -14.829 1.00 15.06 ? 352  LEU A CG    1 
ATOM   2779 C  CD1   . LEU A 1 355 ? 36.033 8.738   -15.148 1.00 14.94 ? 352  LEU A CD1   1 
ATOM   2780 C  CD2   . LEU A 1 355 ? 38.284 7.657   -15.146 1.00 18.86 ? 352  LEU A CD2   1 
ATOM   2781 N  N     . THR A 1 356 ? 39.746 12.595  -16.558 1.00 17.03 ? 353  THR A N     1 
ATOM   2782 C  CA    . THR A 1 356 ? 40.228 13.450  -17.637 1.00 17.62 ? 353  THR A CA    1 
ATOM   2783 C  C     . THR A 1 356 ? 41.755 13.564  -17.607 1.00 17.47 ? 353  THR A C     1 
ATOM   2784 O  O     . THR A 1 356 ? 42.427 13.434  -18.639 1.00 17.78 ? 353  THR A O     1 
ATOM   2785 C  CB    . THR A 1 356 ? 39.541 14.842  -17.603 1.00 18.85 ? 353  THR A CB    1 
ATOM   2786 O  OG1   . THR A 1 356 ? 38.132 14.661  -17.766 1.00 21.84 ? 353  THR A OG1   1 
ATOM   2787 C  CG2   . THR A 1 356 ? 40.048 15.720  -18.711 1.00 25.37 ? 353  THR A CG2   1 
ATOM   2788 N  N     . LYS A 1 357 ? 42.306 13.785  -16.420 1.00 18.03 ? 354  LYS A N     1 
ATOM   2789 C  CA    . LYS A 1 357 ? 43.749 13.816  -16.264 1.00 15.26 ? 354  LYS A CA    1 
ATOM   2790 C  C     . LYS A 1 357 ? 44.354 12.461  -16.651 1.00 16.27 ? 354  LYS A C     1 
ATOM   2791 O  O     . LYS A 1 357 ? 45.386 12.399  -17.331 1.00 19.01 ? 354  LYS A O     1 
ATOM   2792 C  CB    . LYS A 1 357 ? 44.123 14.190  -14.831 1.00 20.14 ? 354  LYS A CB    1 
ATOM   2793 C  CG    . LYS A 1 357 ? 45.610 14.084  -14.529 1.00 26.32 ? 354  LYS A CG    1 
ATOM   2794 C  CD    . LYS A 1 357 ? 46.403 15.079  -15.364 1.00 36.26 ? 354  LYS A CD    1 
ATOM   2795 C  CE    . LYS A 1 357 ? 47.448 15.811  -14.527 1.00 46.11 ? 354  LYS A CE    1 
ATOM   2796 N  NZ    . LYS A 1 357 ? 48.503 14.898  -14.012 1.00 41.72 ? 354  LYS A NZ    1 
ATOM   2797 N  N     . ASP A 1 358 ? 43.696 11.376  -16.250 1.00 14.77 ? 355  ASP A N     1 
ATOM   2798 C  CA    . ASP A 1 358 ? 44.201 10.037  -16.565 1.00 18.12 ? 355  ASP A CA    1 
ATOM   2799 C  C     . ASP A 1 358 ? 44.260 9.816   -18.066 1.00 17.03 ? 355  ASP A C     1 
ATOM   2800 O  O     . ASP A 1 358 ? 45.240 9.270   -18.568 1.00 21.30 ? 355  ASP A O     1 
ATOM   2801 C  CB    . ASP A 1 358 ? 43.353 8.941   -15.907 1.00 17.98 ? 355  ASP A CB    1 
ATOM   2802 C  CG    . ASP A 1 358 ? 43.902 7.546   -16.167 1.00 22.84 ? 355  ASP A CG    1 
ATOM   2803 O  OD1   . ASP A 1 358 ? 44.893 7.157   -15.516 1.00 19.32 ? 355  ASP A OD1   1 
ATOM   2804 O  OD2   . ASP A 1 358 ? 43.346 6.836   -17.026 1.00 22.51 ? 355  ASP A OD2   1 
ATOM   2805 N  N     . ARG A 1 359 ? 43.212 10.233  -18.779 1.00 18.14 ? 356  ARG A N     1 
ATOM   2806 C  CA    . ARG A 1 359 ? 43.156 10.078  -20.229 1.00 18.61 ? 356  ARG A CA    1 
ATOM   2807 C  C     . ARG A 1 359 ? 44.299 10.827  -20.917 1.00 20.04 ? 356  ARG A C     1 
ATOM   2808 O  O     . ARG A 1 359 ? 44.907 10.308  -21.843 1.00 19.58 ? 356  ARG A O     1 
ATOM   2809 C  CB    . ARG A 1 359 ? 41.806 10.560  -20.778 1.00 20.67 ? 356  ARG A CB    1 
ATOM   2810 C  CG    . ARG A 1 359 ? 41.534 10.172  -22.239 1.00 20.06 ? 356  ARG A CG    1 
ATOM   2811 C  CD    . ARG A 1 359 ? 40.144 10.652  -22.674 1.00 28.63 ? 356  ARG A CD    1 
ATOM   2812 N  NE    . ARG A 1 359 ? 40.044 12.106  -22.547 1.00 29.37 ? 356  ARG A NE    1 
ATOM   2813 C  CZ    . ARG A 1 359 ? 38.924 12.783  -22.309 1.00 28.14 ? 356  ARG A CZ    1 
ATOM   2814 N  NH1   . ARG A 1 359 ? 37.761 12.152  -22.169 1.00 24.75 ? 356  ARG A NH1   1 
ATOM   2815 N  NH2   . ARG A 1 359 ? 38.976 14.105  -22.211 1.00 29.84 ? 356  ARG A NH2   1 
ATOM   2816 N  N     . ASN A 1 360 ? 44.588 12.041  -20.460 1.00 19.91 ? 357  ASN A N     1 
ATOM   2817 C  CA    . ASN A 1 360 ? 45.660 12.851  -21.040 1.00 19.93 ? 357  ASN A CA    1 
ATOM   2818 C  C     . ASN A 1 360 ? 47.055 12.301  -20.740 1.00 23.91 ? 357  ASN A C     1 
ATOM   2819 O  O     . ASN A 1 360 ? 47.935 12.292  -21.603 1.00 24.00 ? 357  ASN A O     1 
ATOM   2820 C  CB    . ASN A 1 360 ? 45.571 14.288  -20.527 1.00 21.29 ? 357  ASN A CB    1 
ATOM   2821 C  CG    . ASN A 1 360 ? 44.480 15.083  -21.212 1.00 25.93 ? 357  ASN A CG    1 
ATOM   2822 O  OD1   . ASN A 1 360 ? 44.098 14.795  -22.351 1.00 28.16 ? 357  ASN A OD1   1 
ATOM   2823 N  ND2   . ASN A 1 360 ? 43.977 16.096  -20.526 1.00 24.63 ? 357  ASN A ND2   1 
ATOM   2824 N  N     . ASP A 1 361 ? 47.255 11.858  -19.504 1.00 18.28 ? 358  ASP A N     1 
ATOM   2825 C  CA    . ASP A 1 361 ? 48.550 11.343  -19.068 1.00 26.55 ? 358  ASP A CA    1 
ATOM   2826 C  C     . ASP A 1 361 ? 48.859 9.959   -19.608 1.00 20.09 ? 358  ASP A C     1 
ATOM   2827 O  O     . ASP A 1 361 ? 49.992 9.675   -19.989 1.00 21.47 ? 358  ASP A O     1 
ATOM   2828 C  CB    . ASP A 1 361 ? 48.611 11.273  -17.536 1.00 29.63 ? 358  ASP A CB    1 
ATOM   2829 C  CG    . ASP A 1 361 ? 48.730 12.635  -16.889 1.00 36.50 ? 358  ASP A CG    1 
ATOM   2830 O  OD1   . ASP A 1 361 ? 49.089 13.612  -17.588 1.00 29.04 ? 358  ASP A OD1   1 
ATOM   2831 O  OD2   . ASP A 1 361 ? 48.475 12.719  -15.670 1.00 37.99 ? 358  ASP A OD2   1 
ATOM   2832 N  N     . ASN A 1 362 ? 47.852 9.095   -19.628 1.00 19.98 ? 359  ASN A N     1 
ATOM   2833 C  CA    . ASN A 1 362 ? 48.094 7.666   -19.795 1.00 23.01 ? 359  ASN A CA    1 
ATOM   2834 C  C     . ASN A 1 362 ? 47.488 7.022   -21.043 1.00 21.85 ? 359  ASN A C     1 
ATOM   2835 O  O     . ASN A 1 362 ? 47.557 5.805   -21.204 1.00 23.29 ? 359  ASN A O     1 
ATOM   2836 C  CB    . ASN A 1 362 ? 47.674 6.919   -18.514 1.00 18.45 ? 359  ASN A CB    1 
ATOM   2837 C  CG    . ASN A 1 362 ? 48.462 7.381   -17.290 1.00 22.73 ? 359  ASN A CG    1 
ATOM   2838 O  OD1   . ASN A 1 362 ? 49.679 7.544   -17.353 1.00 22.37 ? 359  ASN A OD1   1 
ATOM   2839 N  ND2   . ASN A 1 362 ? 47.768 7.597   -16.172 1.00 17.40 ? 359  ASN A ND2   1 
ATOM   2840 N  N     . ASP A 1 363 ? 46.898 7.835   -21.920 1.00 20.78 ? 360  ASP A N     1 
ATOM   2841 C  CA    . ASP A 1 363 ? 46.388 7.352   -23.203 1.00 22.09 ? 360  ASP A CA    1 
ATOM   2842 C  C     . ASP A 1 363 ? 45.422 6.191   -23.069 1.00 29.70 ? 360  ASP A C     1 
ATOM   2843 O  O     . ASP A 1 363 ? 45.562 5.176   -23.753 1.00 25.25 ? 360  ASP A O     1 
ATOM   2844 C  CB    . ASP A 1 363 ? 47.541 6.920   -24.113 1.00 29.97 ? 360  ASP A CB    1 
ATOM   2845 C  CG    . ASP A 1 363 ? 48.435 8.070   -24.500 1.00 37.39 ? 360  ASP A CG    1 
ATOM   2846 O  OD1   . ASP A 1 363 ? 47.900 9.148   -24.846 1.00 33.54 ? 360  ASP A OD1   1 
ATOM   2847 O  OD2   . ASP A 1 363 ? 49.673 7.894   -24.457 1.00 38.04 ? 360  ASP A OD2   1 
ATOM   2848 N  N     . ARG A 1 364 ? 44.438 6.338   -22.190 1.00 27.59 ? 361  ARG A N     1 
ATOM   2849 C  CA    . ARG A 1 364 ? 43.439 5.298   -21.996 1.00 27.21 ? 361  ARG A CA    1 
ATOM   2850 C  C     . ARG A 1 364 ? 42.133 5.920   -21.534 1.00 19.83 ? 361  ARG A C     1 
ATOM   2851 O  O     . ARG A 1 364 ? 42.120 7.055   -21.046 1.00 22.96 ? 361  ARG A O     1 
ATOM   2852 C  CB    . ARG A 1 364 ? 43.923 4.275   -20.968 1.00 25.67 ? 361  ARG A CB    1 
ATOM   2853 C  CG    . ARG A 1 364 ? 44.173 4.873   -19.590 1.00 23.62 ? 361  ARG A CG    1 
ATOM   2854 C  CD    . ARG A 1 364 ? 44.653 3.821   -18.607 1.00 18.70 ? 361  ARG A CD    1 
ATOM   2855 N  NE    . ARG A 1 364 ? 44.737 4.346   -17.245 1.00 21.07 ? 361  ARG A NE    1 
ATOM   2856 C  CZ    . ARG A 1 364 ? 44.961 3.599   -16.164 1.00 24.52 ? 361  ARG A CZ    1 
ATOM   2857 N  NH1   . ARG A 1 364 ? 45.022 4.160   -14.957 1.00 20.17 ? 361  ARG A NH1   1 
ATOM   2858 N  NH2   . ARG A 1 364 ? 45.139 2.296   -16.287 1.00 24.54 ? 361  ARG A NH2   1 
ATOM   2859 N  N     . VAL A 1 365 ? 41.048 5.178   -21.716 1.00 19.72 ? 362  VAL A N     1 
ATOM   2860 C  CA    . VAL A 1 365 ? 39.708 5.599   -21.317 1.00 25.08 ? 362  VAL A CA    1 
ATOM   2861 C  C     . VAL A 1 365 ? 38.985 4.485   -20.575 1.00 23.47 ? 362  VAL A C     1 
ATOM   2862 O  O     . VAL A 1 365 ? 39.037 3.322   -20.972 1.00 20.97 ? 362  VAL A O     1 
ATOM   2863 C  CB    . VAL A 1 365 ? 38.854 5.990   -22.536 1.00 26.89 ? 362  VAL A CB    1 
ATOM   2864 C  CG1   . VAL A 1 365 ? 39.393 7.259   -23.174 1.00 38.98 ? 362  VAL A CG1   1 
ATOM   2865 C  CG2   . VAL A 1 365 ? 38.820 4.855   -23.548 1.00 34.40 ? 362  VAL A CG2   1 
ATOM   2866 N  N     . ALA A 1 366 ? 38.302 4.840   -19.494 1.00 18.57 ? 363  ALA A N     1 
ATOM   2867 C  CA    . ALA A 1 366 ? 37.513 3.864   -18.756 1.00 19.09 ? 363  ALA A CA    1 
ATOM   2868 C  C     . ALA A 1 366 ? 36.201 3.607   -19.488 1.00 23.74 ? 363  ALA A C     1 
ATOM   2869 O  O     . ALA A 1 366 ? 35.662 4.506   -20.134 1.00 28.72 ? 363  ALA A O     1 
ATOM   2870 C  CB    . ALA A 1 366 ? 37.244 4.370   -17.351 1.00 15.34 ? 363  ALA A CB    1 
ATOM   2871 N  N     . THR A 1 367 ? 35.676 2.389   -19.389 1.00 20.29 ? 364  THR A N     1 
ATOM   2872 C  CA    . THR A 1 367 ? 34.470 2.059   -20.136 1.00 22.51 ? 364  THR A CA    1 
ATOM   2873 C  C     . THR A 1 367 ? 33.302 1.581   -19.280 1.00 21.35 ? 364  THR A C     1 
ATOM   2874 O  O     . THR A 1 367 ? 32.194 1.382   -19.780 1.00 20.76 ? 364  THR A O     1 
ATOM   2875 C  CB    . THR A 1 367 ? 34.760 0.994   -21.214 1.00 23.60 ? 364  THR A CB    1 
ATOM   2876 O  OG1   . THR A 1 367 ? 35.090 -0.246  -20.580 1.00 21.07 ? 364  THR A OG1   1 
ATOM   2877 C  CG2   . THR A 1 367 ? 35.921 1.438   -22.091 1.00 21.79 ? 364  THR A CG2   1 
ATOM   2878 N  N     . GLN A 1 368 ? 33.542 1.389   -17.989 1.00 21.38 ? 365  GLN A N     1 
ATOM   2879 C  CA    . GLN A 1 368 ? 32.493 0.901   -17.113 1.00 19.31 ? 365  GLN A CA    1 
ATOM   2880 C  C     . GLN A 1 368 ? 32.465 1.741   -15.845 1.00 20.87 ? 365  GLN A C     1 
ATOM   2881 O  O     . GLN A 1 368 ? 33.507 2.088   -15.305 1.00 18.88 ? 365  GLN A O     1 
ATOM   2882 C  CB    . GLN A 1 368 ? 32.734 -0.559  -16.749 1.00 23.81 ? 365  GLN A CB    1 
ATOM   2883 C  CG    . GLN A 1 368 ? 31.540 -1.236  -16.123 1.00 29.98 ? 365  GLN A CG    1 
ATOM   2884 C  CD    . GLN A 1 368 ? 31.833 -2.667  -15.725 1.00 35.15 ? 365  GLN A CD    1 
ATOM   2885 O  OE1   . GLN A 1 368 ? 32.780 -2.936  -14.986 1.00 43.06 ? 365  GLN A OE1   1 
ATOM   2886 N  NE2   . GLN A 1 368 ? 31.027 -3.596  -16.221 1.00 33.05 ? 365  GLN A NE2   1 
ATOM   2887 N  N     . LEU A 1 369 ? 31.267 2.063   -15.383 1.00 20.80 ? 366  LEU A N     1 
ATOM   2888 C  CA    . LEU A 1 369 ? 31.107 2.802   -14.131 1.00 24.58 ? 366  LEU A CA    1 
ATOM   2889 C  C     . LEU A 1 369 ? 30.433 1.897   -13.113 1.00 21.07 ? 366  LEU A C     1 
ATOM   2890 O  O     . LEU A 1 369 ? 29.354 1.369   -13.360 1.00 24.48 ? 366  LEU A O     1 
ATOM   2891 C  CB    . LEU A 1 369 ? 30.268 4.062   -14.357 1.00 19.31 ? 366  LEU A CB    1 
ATOM   2892 C  CG    . LEU A 1 369 ? 29.953 4.930   -13.136 1.00 23.55 ? 366  LEU A CG    1 
ATOM   2893 C  CD1   . LEU A 1 369 ? 31.226 5.632   -12.667 1.00 22.11 ? 366  LEU A CD1   1 
ATOM   2894 C  CD2   . LEU A 1 369 ? 28.856 5.947   -13.445 1.00 28.93 ? 366  LEU A CD2   1 
ATOM   2895 N  N     . VAL A 1 370 ? 31.079 1.699   -11.972 1.00 19.90 ? 367  VAL A N     1 
ATOM   2896 C  CA    . VAL A 1 370 ? 30.521 0.861   -10.924 1.00 17.39 ? 367  VAL A CA    1 
ATOM   2897 C  C     . VAL A 1 370 ? 29.979 1.738   -9.796  1.00 22.96 ? 367  VAL A C     1 
ATOM   2898 O  O     . VAL A 1 370 ? 30.650 2.661   -9.354  1.00 21.64 ? 367  VAL A O     1 
ATOM   2899 C  CB    . VAL A 1 370 ? 31.584 -0.107  -10.378 1.00 24.44 ? 367  VAL A CB    1 
ATOM   2900 C  CG1   . VAL A 1 370 ? 31.036 -0.886  -9.198  1.00 24.66 ? 367  VAL A CG1   1 
ATOM   2901 C  CG2   . VAL A 1 370 ? 32.045 -1.045  -11.481 1.00 25.95 ? 367  VAL A CG2   1 
ATOM   2902 N  N     . VAL A 1 371 ? 28.758 1.458   -9.350  1.00 20.30 ? 368  VAL A N     1 
ATOM   2903 C  CA    . VAL A 1 371 ? 28.134 2.249   -8.293  1.00 22.12 ? 368  VAL A CA    1 
ATOM   2904 C  C     . VAL A 1 371 ? 27.849 1.358   -7.116  1.00 20.06 ? 368  VAL A C     1 
ATOM   2905 O  O     . VAL A 1 371 ? 27.238 0.307   -7.263  1.00 21.33 ? 368  VAL A O     1 
ATOM   2906 C  CB    . VAL A 1 371 ? 26.812 2.877   -8.760  1.00 23.26 ? 368  VAL A CB    1 
ATOM   2907 C  CG1   . VAL A 1 371 ? 26.247 3.802   -7.682  1.00 21.60 ? 368  VAL A CG1   1 
ATOM   2908 C  CG2   . VAL A 1 371 ? 27.025 3.626   -10.060 1.00 21.90 ? 368  VAL A CG2   1 
ATOM   2909 N  N     . SER A 1 372 ? 28.316 1.765   -5.943  1.00 19.24 ? 369  SER A N     1 
ATOM   2910 C  CA    . SER A 1 372 ? 28.165 0.945   -4.759  1.00 19.01 ? 369  SER A CA    1 
ATOM   2911 C  C     . SER A 1 372 ? 27.617 1.786   -3.618  1.00 17.63 ? 369  SER A C     1 
ATOM   2912 O  O     . SER A 1 372 ? 27.962 2.962   -3.476  1.00 20.18 ? 369  SER A O     1 
ATOM   2913 C  CB    . SER A 1 372 ? 29.511 0.331   -4.361  1.00 22.54 ? 369  SER A CB    1 
ATOM   2914 O  OG    . SER A 1 372 ? 29.413 -0.350  -3.121  1.00 32.42 ? 369  SER A OG    1 
ATOM   2915 N  N     . ILE A 1 373 ? 26.739 1.189   -2.827  1.00 20.13 ? 370  ILE A N     1 
ATOM   2916 C  CA    . ILE A 1 373 ? 26.201 1.871   -1.660  1.00 20.04 ? 370  ILE A CA    1 
ATOM   2917 C  C     . ILE A 1 373 ? 26.190 0.953   -0.451  1.00 21.90 ? 370  ILE A C     1 
ATOM   2918 O  O     . ILE A 1 373 ? 26.301 -0.270  -0.568  1.00 21.97 ? 370  ILE A O     1 
ATOM   2919 C  CB    . ILE A 1 373 ? 24.777 2.428   -1.897  1.00 26.34 ? 370  ILE A CB    1 
ATOM   2920 C  CG1   . ILE A 1 373 ? 23.761 1.289   -2.028  1.00 30.24 ? 370  ILE A CG1   1 
ATOM   2921 C  CG2   . ILE A 1 373 ? 24.750 3.366   -3.113  1.00 17.83 ? 370  ILE A CG2   1 
ATOM   2922 C  CD1   . ILE A 1 373 ? 22.341 1.769   -2.246  1.00 36.44 ? 370  ILE A CD1   1 
ATOM   2923 N  N     . ARG A 1 374 ? 26.093 1.564   0.722   1.00 23.38 ? 371  ARG A N     1 
ATOM   2924 C  CA    . ARG A 1 374 ? 25.819 0.825   1.935   1.00 23.63 ? 371  ARG A CA    1 
ATOM   2925 C  C     . ARG A 1 374 ? 24.541 1.424   2.494   1.00 26.15 ? 371  ARG A C     1 
ATOM   2926 O  O     . ARG A 1 374 ? 24.313 2.630   2.371   1.00 21.68 ? 371  ARG A O     1 
ATOM   2927 C  CB    . ARG A 1 374 ? 26.967 0.952   2.929   1.00 27.58 ? 371  ARG A CB    1 
ATOM   2928 C  CG    . ARG A 1 374 ? 26.940 -0.079  4.044   1.00 30.73 ? 371  ARG A CG    1 
ATOM   2929 C  CD    . ARG A 1 374 ? 27.914 0.296   5.143   1.00 35.97 ? 371  ARG A CD    1 
ATOM   2930 N  NE    . ARG A 1 374 ? 28.005 -0.722  6.182   1.00 42.97 ? 371  ARG A NE    1 
ATOM   2931 C  CZ    . ARG A 1 374 ? 28.751 -0.600  7.275   1.00 52.59 ? 371  ARG A CZ    1 
ATOM   2932 N  NH1   . ARG A 1 374 ? 29.460 0.505   7.476   1.00 43.31 ? 371  ARG A NH1   1 
ATOM   2933 N  NH2   . ARG A 1 374 ? 28.783 -1.577  8.171   1.00 54.42 ? 371  ARG A NH2   1 
ATOM   2934 N  N     . VAL A 1 375 ? 23.682 0.572   3.044   1.00 29.66 ? 372  VAL A N     1 
ATOM   2935 C  CA    . VAL A 1 375 ? 22.479 1.043   3.719   1.00 37.00 ? 372  VAL A CA    1 
ATOM   2936 C  C     . VAL A 1 375 ? 22.650 0.906   5.226   1.00 30.51 ? 372  VAL A C     1 
ATOM   2937 O  O     . VAL A 1 375 ? 23.383 0.037   5.705   1.00 28.70 ? 372  VAL A O     1 
ATOM   2938 C  CB    . VAL A 1 375 ? 21.229 0.271   3.271   1.00 38.40 ? 372  VAL A CB    1 
ATOM   2939 C  CG1   . VAL A 1 375 ? 20.912 0.577   1.819   1.00 37.95 ? 372  VAL A CG1   1 
ATOM   2940 C  CG2   . VAL A 1 375 ? 21.427 -1.216  3.488   1.00 44.27 ? 372  VAL A CG2   1 
ATOM   2941 N  N     . GLN A 1 376 ? 21.986 1.776   5.978   1.00 33.48 ? 373  GLN A N     1 
ATOM   2942 C  CA    . GLN A 1 376 ? 22.117 1.750   7.430   1.00 35.15 ? 373  GLN A CA    1 
ATOM   2943 C  C     . GLN A 1 376 ? 21.606 0.439   8.022   1.00 34.72 ? 373  GLN A C     1 
ATOM   2944 O  O     . GLN A 1 376 ? 20.455 0.069   7.821   1.00 45.11 ? 373  GLN A O     1 
ATOM   2945 C  CB    . GLN A 1 376 ? 21.384 2.931   8.060   1.00 34.82 ? 373  GLN A CB    1 
ATOM   2946 C  CG    . GLN A 1 376 ? 21.817 3.213   9.495   1.00 42.81 ? 373  GLN A CG    1 
ATOM   2947 C  CD    . GLN A 1 376 ? 21.791 4.692   9.819   1.00 45.18 ? 373  GLN A CD    1 
ATOM   2948 O  OE1   . GLN A 1 376 ? 20.746 5.335   9.730   1.00 40.62 ? 373  GLN A OE1   1 
ATOM   2949 N  NE2   . GLN A 1 376 ? 22.950 5.246   10.181  1.00 49.96 ? 373  GLN A NE2   1 
ATOM   2950 N  N     . GLY A 1 377 ? 22.469 -0.257  8.752   1.00 36.74 ? 374  GLY A N     1 
ATOM   2951 C  CA    . GLY A 1 377 ? 22.096 -1.512  9.376   1.00 49.38 ? 374  GLY A CA    1 
ATOM   2952 C  C     . GLY A 1 377 ? 23.004 -2.662  8.984   1.00 52.35 ? 374  GLY A C     1 
ATOM   2953 O  O     . GLY A 1 377 ? 23.196 -3.602  9.753   1.00 49.61 ? 374  GLY A O     1 
ATOM   2954 N  N     . ASP A 1 378 ? 23.572 -2.580  7.784   1.00 45.06 ? 375  ASP A N     1 
ATOM   2955 C  CA    . ASP A 1 378 ? 24.394 -3.659  7.251   1.00 43.97 ? 375  ASP A CA    1 
ATOM   2956 C  C     . ASP A 1 378 ? 25.801 -3.665  7.845   1.00 53.15 ? 375  ASP A C     1 
ATOM   2957 O  O     . ASP A 1 378 ? 26.495 -2.650  7.817   1.00 53.87 ? 375  ASP A O     1 
ATOM   2958 C  CB    . ASP A 1 378 ? 24.478 -3.543  5.731   1.00 42.28 ? 375  ASP A CB    1 
ATOM   2959 C  CG    . ASP A 1 378 ? 25.046 -4.787  5.086   1.00 46.20 ? 375  ASP A CG    1 
ATOM   2960 O  OD1   . ASP A 1 378 ? 25.759 -5.544  5.778   1.00 45.20 ? 375  ASP A OD1   1 
ATOM   2961 O  OD2   . ASP A 1 378 ? 24.771 -5.008  3.890   1.00 43.15 ? 375  ASP A OD2   1 
ATOM   2962 N  N     . LYS A 1 379 ? 26.226 -4.810  8.373   1.00 55.70 ? 376  LYS A N     1 
ATOM   2963 C  CA    . LYS A 1 379 ? 27.576 -4.928  8.919   1.00 62.52 ? 376  LYS A CA    1 
ATOM   2964 C  C     . LYS A 1 379 ? 28.617 -4.959  7.804   1.00 61.55 ? 376  LYS A C     1 
ATOM   2965 O  O     . LYS A 1 379 ? 29.783 -4.615  8.016   1.00 59.26 ? 376  LYS A O     1 
ATOM   2966 C  CB    . LYS A 1 379 ? 27.720 -6.171  9.803   1.00 60.91 ? 376  LYS A CB    1 
ATOM   2967 C  CG    . LYS A 1 379 ? 29.125 -6.339  10.370  1.00 61.00 ? 376  LYS A CG    1 
ATOM   2968 C  CD    . LYS A 1 379 ? 29.288 -7.641  11.134  1.00 67.59 ? 376  LYS A CD    1 
ATOM   2969 C  CE    . LYS A 1 379 ? 30.737 -7.842  11.568  1.00 68.32 ? 376  LYS A CE    1 
ATOM   2970 N  NZ    . LYS A 1 379 ? 31.681 -7.832  10.409  1.00 56.22 ? 376  LYS A NZ    1 
ATOM   2971 N  N     . ARG A 1 380 ? 28.189 -5.381  6.619   1.00 56.56 ? 377  ARG A N     1 
ATOM   2972 C  CA    . ARG A 1 380 ? 29.069 -5.423  5.456   1.00 56.74 ? 377  ARG A CA    1 
ATOM   2973 C  C     . ARG A 1 380 ? 29.452 -4.014  5.022   1.00 56.41 ? 377  ARG A C     1 
ATOM   2974 O  O     . ARG A 1 380 ? 28.659 -3.081  5.150   1.00 53.50 ? 377  ARG A O     1 
ATOM   2975 C  CB    . ARG A 1 380 ? 28.386 -6.143  4.295   1.00 55.22 ? 377  ARG A CB    1 
ATOM   2976 C  CG    . ARG A 1 380 ? 28.053 -7.598  4.563   1.00 53.23 ? 377  ARG A CG    1 
ATOM   2977 C  CD    . ARG A 1 380 ? 27.283 -8.182  3.394   1.00 45.57 ? 377  ARG A CD    1 
ATOM   2978 N  NE    . ARG A 1 380 ? 25.997 -7.515  3.206   1.00 45.51 ? 377  ARG A NE    1 
ATOM   2979 C  CZ    . ARG A 1 380 ? 25.234 -7.657  2.127   1.00 41.67 ? 377  ARG A CZ    1 
ATOM   2980 N  NH1   . ARG A 1 380 ? 25.630 -8.437  1.132   1.00 41.97 ? 377  ARG A NH1   1 
ATOM   2981 N  NH2   . ARG A 1 380 ? 24.078 -7.018  2.039   1.00 39.60 ? 377  ARG A NH2   1 
ATOM   2982 N  N     . LEU A 1 381 ? 30.667 -3.862  4.505   1.00 57.06 ? 378  LEU A N     1 
ATOM   2983 C  CA    . LEU A 1 381 ? 31.117 -2.563  4.024   1.00 52.74 ? 378  LEU A CA    1 
ATOM   2984 C  C     . LEU A 1 381 ? 30.351 -2.129  2.775   1.00 49.67 ? 378  LEU A C     1 
ATOM   2985 O  O     . LEU A 1 381 ? 30.016 -0.955  2.624   1.00 51.43 ? 378  LEU A O     1 
ATOM   2986 C  CB    . LEU A 1 381 ? 32.627 -2.557  3.778   1.00 56.47 ? 378  LEU A CB    1 
ATOM   2987 C  CG    . LEU A 1 381 ? 33.498 -2.108  4.959   1.00 59.36 ? 378  LEU A CG    1 
ATOM   2988 C  CD1   . LEU A 1 381 ? 33.253 -2.970  6.194   1.00 59.21 ? 378  LEU A CD1   1 
ATOM   2989 C  CD2   . LEU A 1 381 ? 34.978 -2.109  4.581   1.00 53.97 ? 378  LEU A CD2   1 
ATOM   2990 N  N     . SER A 1 382 ? 30.070 -3.071  1.882   1.00 51.35 ? 379  SER A N     1 
ATOM   2991 C  CA    . SER A 1 382 ? 29.231 -2.771  0.724   1.00 42.64 ? 379  SER A CA    1 
ATOM   2992 C  C     . SER A 1 382 ? 27.932 -3.548  0.779   1.00 33.91 ? 379  SER A C     1 
ATOM   2993 O  O     . SER A 1 382 ? 27.924 -4.734  1.104   1.00 40.81 ? 379  SER A O     1 
ATOM   2994 C  CB    . SER A 1 382 ? 29.946 -3.084  -0.588  1.00 43.61 ? 379  SER A CB    1 
ATOM   2995 O  OG    . SER A 1 382 ? 29.018 -3.071  -1.663  1.00 42.25 ? 379  SER A OG    1 
ATOM   2996 N  N     . SER A 1 383 ? 26.834 -2.879  0.441   1.00 37.12 ? 380  SER A N     1 
ATOM   2997 C  CA    . SER A 1 383 ? 25.521 -3.509  0.467   1.00 37.90 ? 380  SER A CA    1 
ATOM   2998 C  C     . SER A 1 383 ? 25.080 -3.932  -0.922  1.00 45.30 ? 380  SER A C     1 
ATOM   2999 O  O     . SER A 1 383 ? 24.505 -5.005  -1.101  1.00 32.80 ? 380  SER A O     1 
ATOM   3000 C  CB    . SER A 1 383 ? 24.474 -2.562  1.066   1.00 38.68 ? 380  SER A CB    1 
ATOM   3001 O  OG    . SER A 1 383 ? 24.662 -2.403  2.464   1.00 35.01 ? 380  SER A OG    1 
ATOM   3002 N  N     . LEU A 1 384 ? 25.348 -3.079  -1.904  1.00 42.45 ? 381  LEU A N     1 
ATOM   3003 C  CA    . LEU A 1 384 ? 24.860 -3.303  -3.256  1.00 36.86 ? 381  LEU A CA    1 
ATOM   3004 C  C     . LEU A 1 384 ? 25.770 -2.668  -4.300  1.00 36.77 ? 381  LEU A C     1 
ATOM   3005 O  O     . LEU A 1 384 ? 26.130 -1.498  -4.196  1.00 25.96 ? 381  LEU A O     1 
ATOM   3006 C  CB    . LEU A 1 384 ? 23.442 -2.752  -3.395  1.00 38.44 ? 381  LEU A CB    1 
ATOM   3007 C  CG    . LEU A 1 384 ? 22.853 -2.737  -4.808  1.00 40.40 ? 381  LEU A CG    1 
ATOM   3008 C  CD1   . LEU A 1 384 ? 21.361 -3.015  -4.774  1.00 44.79 ? 381  LEU A CD1   1 
ATOM   3009 C  CD2   . LEU A 1 384 ? 23.137 -1.422  -5.510  1.00 38.73 ? 381  LEU A CD2   1 
ATOM   3010 N  N     . ARG A 1 385 ? 26.133 -3.441  -5.315  1.00 25.83 ? 382  ARG A N     1 
ATOM   3011 C  CA    . ARG A 1 385 ? 27.009 -2.933  -6.355  1.00 23.28 ? 382  ARG A CA    1 
ATOM   3012 C  C     . ARG A 1 385 ? 26.368 -3.187  -7.706  1.00 30.19 ? 382  ARG A C     1 
ATOM   3013 O  O     . ARG A 1 385 ? 25.961 -4.307  -8.004  1.00 32.69 ? 382  ARG A O     1 
ATOM   3014 C  CB    . ARG A 1 385 ? 28.375 -3.618  -6.285  1.00 32.81 ? 382  ARG A CB    1 
ATOM   3015 C  CG    . ARG A 1 385 ? 29.504 -2.774  -6.839  1.00 35.12 ? 382  ARG A CG    1 
ATOM   3016 C  CD    . ARG A 1 385 ? 30.629 -3.621  -7.406  1.00 46.72 ? 382  ARG A CD    1 
ATOM   3017 N  NE    . ARG A 1 385 ? 30.230 -4.302  -8.637  1.00 44.93 ? 382  ARG A NE    1 
ATOM   3018 C  CZ    . ARG A 1 385 ? 31.075 -4.700  -9.586  1.00 39.38 ? 382  ARG A CZ    1 
ATOM   3019 N  NH1   . ARG A 1 385 ? 30.611 -5.312  -10.662 1.00 38.93 ? 382  ARG A NH1   1 
ATOM   3020 N  NH2   . ARG A 1 385 ? 32.380 -4.480  -9.464  1.00 45.12 ? 382  ARG A NH2   1 
ATOM   3021 N  N     . ARG A 1 386 ? 26.254 -2.137  -8.508  1.00 20.48 ? 383  ARG A N     1 
ATOM   3022 C  CA    . ARG A 1 386 ? 25.679 -2.248  -9.843  1.00 27.53 ? 383  ARG A CA    1 
ATOM   3023 C  C     . ARG A 1 386 ? 26.590 -1.552  -10.837 1.00 27.84 ? 383  ARG A C     1 
ATOM   3024 O  O     . ARG A 1 386 ? 27.195 -0.529  -10.517 1.00 21.19 ? 383  ARG A O     1 
ATOM   3025 C  CB    . ARG A 1 386 ? 24.302 -1.592  -9.889  1.00 32.19 ? 383  ARG A CB    1 
ATOM   3026 C  CG    . ARG A 1 386 ? 23.253 -2.255  -9.028  1.00 30.04 ? 383  ARG A CG    1 
ATOM   3027 C  CD    . ARG A 1 386 ? 22.845 -3.586  -9.615  1.00 28.42 ? 383  ARG A CD    1 
ATOM   3028 N  NE    . ARG A 1 386 ? 21.662 -4.135  -8.960  1.00 25.62 ? 383  ARG A NE    1 
ATOM   3029 C  CZ    . ARG A 1 386 ? 21.691 -5.032  -7.982  1.00 34.98 ? 383  ARG A CZ    1 
ATOM   3030 N  NH1   . ARG A 1 386 ? 22.852 -5.492  -7.530  1.00 33.31 ? 383  ARG A NH1   1 
ATOM   3031 N  NH2   . ARG A 1 386 ? 20.554 -5.475  -7.459  1.00 38.69 ? 383  ARG A NH2   1 
ATOM   3032 N  N     . CYS A 1 387 ? 26.685 -2.093  -12.047 1.00 26.69 ? 384  CYS A N     1 
ATOM   3033 C  CA    . CYS A 1 387 ? 27.462 -1.431  -13.088 1.00 27.10 ? 384  CYS A CA    1 
ATOM   3034 C  C     . CYS A 1 387 ? 26.573 -0.862  -14.178 1.00 34.64 ? 384  CYS A C     1 
ATOM   3035 O  O     . CYS A 1 387 ? 25.480 -1.361  -14.431 1.00 31.77 ? 384  CYS A O     1 
ATOM   3036 C  CB    . CYS A 1 387 ? 28.485 -2.389  -13.710 1.00 29.18 ? 384  CYS A CB    1 
ATOM   3037 S  SG    A CYS A 1 387 ? 27.784 -3.832  -14.560 0.50 28.44 ? 384  CYS A SG    1 
ATOM   3038 S  SG    B CYS A 1 387 ? 29.549 -3.188  -12.523 0.50 37.55 ? 384  CYS A SG    1 
ATOM   3039 N  N     . CYS A 1 388 ? 27.057 0.184   -14.830 1.00 33.04 ? 385  CYS A N     1 
ATOM   3040 C  CA    . CYS A 1 388 ? 26.418 0.685   -16.036 1.00 39.96 ? 385  CYS A CA    1 
ATOM   3041 C  C     . CYS A 1 388 ? 27.519 1.133   -16.981 1.00 32.46 ? 385  CYS A C     1 
ATOM   3042 O  O     . CYS A 1 388 ? 28.684 1.175   -16.591 1.00 28.55 ? 385  CYS A O     1 
ATOM   3043 C  CB    . CYS A 1 388 ? 25.471 1.841   -15.716 1.00 35.96 ? 385  CYS A CB    1 
ATOM   3044 S  SG    . CYS A 1 388 ? 26.284 3.335   -15.115 1.00 38.18 ? 385  CYS A SG    1 
ATOM   3045 N  N     . ALA A 1 389 ? 27.160 1.467   -18.217 1.00 29.83 ? 386  ALA A N     1 
ATOM   3046 C  CA    . ALA A 1 389 ? 28.154 1.884   -19.194 1.00 30.52 ? 386  ALA A CA    1 
ATOM   3047 C  C     . ALA A 1 389 ? 28.706 3.257   -18.854 1.00 29.73 ? 386  ALA A C     1 
ATOM   3048 O  O     . ALA A 1 389 ? 27.984 4.130   -18.372 1.00 32.83 ? 386  ALA A O     1 
ATOM   3049 C  CB    . ALA A 1 389 ? 27.572 1.880   -20.598 1.00 29.01 ? 386  ALA A CB    1 
ATOM   3050 N  N     . LEU A 1 390 ? 29.995 3.441   -19.103 1.00 22.73 ? 387  LEU A N     1 
ATOM   3051 C  CA    . LEU A 1 390 ? 30.626 4.740   -18.936 1.00 24.11 ? 387  LEU A CA    1 
ATOM   3052 C  C     . LEU A 1 390 ? 31.080 5.180   -20.315 1.00 29.34 ? 387  LEU A C     1 
ATOM   3053 O  O     . LEU A 1 390 ? 32.134 4.763   -20.786 1.00 30.72 ? 387  LEU A O     1 
ATOM   3054 C  CB    . LEU A 1 390 ? 31.825 4.636   -17.987 1.00 27.04 ? 387  LEU A CB    1 
ATOM   3055 C  CG    . LEU A 1 390 ? 32.288 5.881   -17.219 1.00 26.55 ? 387  LEU A CG    1 
ATOM   3056 C  CD1   . LEU A 1 390 ? 33.532 5.565   -16.384 1.00 22.78 ? 387  LEU A CD1   1 
ATOM   3057 C  CD2   . LEU A 1 390 ? 32.554 7.055   -18.133 1.00 26.43 ? 387  LEU A CD2   1 
ATOM   3058 N  N     . THR A 1 391 ? 30.278 6.015   -20.966 1.00 29.01 ? 388  THR A N     1 
ATOM   3059 C  CA    . THR A 1 391 ? 30.525 6.386   -22.356 1.00 32.54 ? 388  THR A CA    1 
ATOM   3060 C  C     . THR A 1 391 ? 31.051 7.808   -22.529 1.00 31.80 ? 388  THR A C     1 
ATOM   3061 O  O     . THR A 1 391 ? 31.585 8.145   -23.583 1.00 29.43 ? 388  THR A O     1 
ATOM   3062 C  CB    . THR A 1 391 ? 29.247 6.244   -23.198 1.00 34.98 ? 388  THR A CB    1 
ATOM   3063 O  OG1   . THR A 1 391 ? 28.284 7.217   -22.773 1.00 37.50 ? 388  THR A OG1   1 
ATOM   3064 C  CG2   . THR A 1 391 ? 28.656 4.852   -23.038 1.00 30.04 ? 388  THR A CG2   1 
ATOM   3065 N  N     . ARG A 1 392 ? 30.883 8.636   -21.500 1.00 27.54 ? 389  ARG A N     1 
ATOM   3066 C  CA    . ARG A 1 392 ? 31.300 10.033  -21.542 1.00 29.15 ? 389  ARG A CA    1 
ATOM   3067 C  C     . ARG A 1 392 ? 31.836 10.503  -20.186 1.00 23.69 ? 389  ARG A C     1 
ATOM   3068 O  O     . ARG A 1 392 ? 31.228 10.254  -19.147 1.00 34.94 ? 389  ARG A O     1 
ATOM   3069 C  CB    . ARG A 1 392 ? 30.136 10.934  -21.964 1.00 33.85 ? 389  ARG A CB    1 
ATOM   3070 C  CG    . ARG A 1 392 ? 29.678 10.732  -23.397 1.00 42.33 ? 389  ARG A CG    1 
ATOM   3071 C  CD    . ARG A 1 392 ? 28.649 11.777  -23.804 1.00 49.29 ? 389  ARG A CD    1 
ATOM   3072 N  NE    . ARG A 1 392 ? 29.147 13.135  -23.595 1.00 48.52 ? 389  ARG A NE    1 
ATOM   3073 C  CZ    . ARG A 1 392 ? 28.647 13.986  -22.703 1.00 59.77 ? 389  ARG A CZ    1 
ATOM   3074 N  NH1   . ARG A 1 392 ? 29.167 15.202  -22.579 1.00 56.37 ? 389  ARG A NH1   1 
ATOM   3075 N  NH2   . ARG A 1 392 ? 27.622 13.626  -21.940 1.00 53.47 ? 389  ARG A NH2   1 
ATOM   3076 N  N     . TYR A 1 393 ? 32.979 11.173  -20.210 1.00 25.06 ? 390  TYR A N     1 
ATOM   3077 C  CA    . TYR A 1 393 ? 33.538 11.780  -19.015 1.00 27.14 ? 390  TYR A CA    1 
ATOM   3078 C  C     . TYR A 1 393 ? 32.783 13.073  -18.707 1.00 26.98 ? 390  TYR A C     1 
ATOM   3079 O  O     . TYR A 1 393 ? 33.262 14.177  -18.991 1.00 25.34 ? 390  TYR A O     1 
ATOM   3080 C  CB    . TYR A 1 393 ? 35.031 12.050  -19.208 1.00 24.79 ? 390  TYR A CB    1 
ATOM   3081 C  CG    . TYR A 1 393 ? 35.909 10.806  -19.147 1.00 18.24 ? 390  TYR A CG    1 
ATOM   3082 C  CD1   . TYR A 1 393 ? 37.290 10.909  -19.165 1.00 20.71 ? 390  TYR A CD1   1 
ATOM   3083 C  CD2   . TYR A 1 393 ? 35.348 9.534   -19.067 1.00 26.48 ? 390  TYR A CD2   1 
ATOM   3084 C  CE1   . TYR A 1 393 ? 38.096 9.779   -19.101 1.00 19.71 ? 390  TYR A CE1   1 
ATOM   3085 C  CE2   . TYR A 1 393 ? 36.145 8.402   -19.003 1.00 22.68 ? 390  TYR A CE2   1 
ATOM   3086 C  CZ    . TYR A 1 393 ? 37.520 8.534   -19.015 1.00 22.30 ? 390  TYR A CZ    1 
ATOM   3087 O  OH    . TYR A 1 393 ? 38.324 7.415   -18.942 1.00 21.90 ? 390  TYR A OH    1 
ATOM   3088 N  N     . ASP A 1 394 ? 31.591 12.920  -18.138 1.00 27.41 ? 391  ASP A N     1 
ATOM   3089 C  CA    . ASP A 1 394 ? 30.738 14.052  -17.803 1.00 27.48 ? 391  ASP A CA    1 
ATOM   3090 C  C     . ASP A 1 394 ? 30.095 13.772  -16.455 1.00 17.80 ? 391  ASP A C     1 
ATOM   3091 O  O     . ASP A 1 394 ? 29.387 12.781  -16.305 1.00 20.22 ? 391  ASP A O     1 
ATOM   3092 C  CB    . ASP A 1 394 ? 29.662 14.233  -18.876 1.00 27.05 ? 391  ASP A CB    1 
ATOM   3093 C  CG    . ASP A 1 394 ? 28.853 15.498  -18.681 1.00 32.61 ? 391  ASP A CG    1 
ATOM   3094 O  OD1   . ASP A 1 394 ? 27.934 15.490  -17.839 1.00 29.77 ? 391  ASP A OD1   1 
ATOM   3095 O  OD2   . ASP A 1 394 ? 29.137 16.502  -19.369 1.00 48.92 ? 391  ASP A OD2   1 
ATOM   3096 N  N     . ALA A 1 395 ? 30.362 14.627  -15.470 1.00 20.90 ? 392  ALA A N     1 
ATOM   3097 C  CA    . ALA A 1 395 ? 29.924 14.361  -14.093 1.00 20.62 ? 392  ALA A CA    1 
ATOM   3098 C  C     . ALA A 1 395 ? 28.403 14.319  -13.932 1.00 18.16 ? 392  ALA A C     1 
ATOM   3099 O  O     . ALA A 1 395 ? 27.868 13.486  -13.198 1.00 20.55 ? 392  ALA A O     1 
ATOM   3100 C  CB    . ALA A 1 395 ? 30.550 15.371  -13.115 1.00 19.53 ? 392  ALA A CB    1 
ATOM   3101 N  N     . HIS A 1 396 ? 27.707 15.224  -14.611 1.00 25.85 ? 393  HIS A N     1 
ATOM   3102 C  CA    . HIS A 1 396 ? 26.253 15.266  -14.514 1.00 26.63 ? 393  HIS A CA    1 
ATOM   3103 C  C     . HIS A 1 396 ? 25.646 13.983  -15.061 1.00 21.50 ? 393  HIS A C     1 
ATOM   3104 O  O     . HIS A 1 396 ? 24.741 13.406  -14.457 1.00 26.33 ? 393  HIS A O     1 
ATOM   3105 C  CB    . HIS A 1 396 ? 25.697 16.519  -15.203 1.00 27.54 ? 393  HIS A CB    1 
ATOM   3106 C  CG    . HIS A 1 396 ? 26.013 17.787  -14.478 1.00 31.42 ? 393  HIS A CG    1 
ATOM   3107 N  ND1   . HIS A 1 396 ? 27.142 18.545  -14.746 1.00 43.21 ? 393  HIS A ND1   1 
ATOM   3108 C  CD2   . HIS A 1 396 ? 25.374 18.431  -13.472 1.00 37.55 ? 393  HIS A CD2   1 
ATOM   3109 C  CE1   . HIS A 1 396 ? 27.170 19.592  -13.952 1.00 37.86 ? 393  HIS A CE1   1 
ATOM   3110 N  NE2   . HIS A 1 396 ? 26.105 19.550  -13.163 1.00 34.48 ? 393  HIS A NE2   1 
ATOM   3111 N  N     . LYS A 1 397 ? 26.168 13.511  -16.191 1.00 23.35 ? 394  LYS A N     1 
ATOM   3112 C  CA    . LYS A 1 397 ? 25.728 12.225  -16.729 1.00 21.41 ? 394  LYS A CA    1 
ATOM   3113 C  C     . LYS A 1 397 ? 26.086 11.056  -15.825 1.00 21.71 ? 394  LYS A C     1 
ATOM   3114 O  O     . LYS A 1 397 ? 25.263 10.188  -15.573 1.00 23.78 ? 394  LYS A O     1 
ATOM   3115 C  CB    . LYS A 1 397 ? 26.295 11.960  -18.121 1.00 26.14 ? 394  LYS A CB    1 
ATOM   3116 C  CG    . LYS A 1 397 ? 25.981 10.546  -18.600 1.00 30.17 ? 394  LYS A CG    1 
ATOM   3117 C  CD    . LYS A 1 397 ? 26.375 10.307  -20.052 1.00 38.49 ? 394  LYS A CD    1 
ATOM   3118 C  CE    . LYS A 1 397 ? 26.115 8.857   -20.449 1.00 37.89 ? 394  LYS A CE    1 
ATOM   3119 N  NZ    . LYS A 1 397 ? 24.716 8.409   -20.160 1.00 41.70 ? 394  LYS A NZ    1 
ATOM   3120 N  N     . MET A 1 398 ? 27.324 11.015  -15.352 1.00 19.99 ? 395  MET A N     1 
ATOM   3121 C  CA    . MET A 1 398 ? 27.714 9.919   -14.479 1.00 22.49 ? 395  MET A CA    1 
ATOM   3122 C  C     . MET A 1 398 ? 26.845 9.873   -13.221 1.00 21.38 ? 395  MET A C     1 
ATOM   3123 O  O     . MET A 1 398 ? 26.439 8.797   -12.784 1.00 22.53 ? 395  MET A O     1 
ATOM   3124 C  CB    . MET A 1 398 ? 29.197 10.003  -14.130 1.00 21.61 ? 395  MET A CB    1 
ATOM   3125 C  CG    . MET A 1 398 ? 30.091 9.625   -15.293 1.00 19.96 ? 395  MET A CG    1 
ATOM   3126 S  SD    . MET A 1 398 ? 31.797 9.388   -14.789 1.00 31.99 ? 395  MET A SD    1 
ATOM   3127 C  CE    . MET A 1 398 ? 32.326 11.089  -14.597 1.00 21.96 ? 395  MET A CE    1 
ATOM   3128 N  N     . SER A 1 399 ? 26.550 11.040  -12.653 1.00 22.71 ? 396  SER A N     1 
ATOM   3129 C  CA    . SER A 1 399 ? 25.759 11.092  -11.426 1.00 21.81 ? 396  SER A CA    1 
ATOM   3130 C  C     . SER A 1 399 ? 24.301 10.712  -11.700 1.00 20.31 ? 396  SER A C     1 
ATOM   3131 O  O     . SER A 1 399 ? 23.656 10.054  -10.885 1.00 20.61 ? 396  SER A O     1 
ATOM   3132 C  CB    . SER A 1 399 ? 25.862 12.463  -10.740 1.00 24.47 ? 396  SER A CB    1 
ATOM   3133 O  OG    . SER A 1 399 ? 25.323 13.508  -11.537 1.00 27.55 ? 396  SER A OG    1 
ATOM   3134 N  N     . HIS A 1 400 ? 23.795 11.110  -12.861 1.00 24.34 ? 397  HIS A N     1 
ATOM   3135 C  CA    . HIS A 1 400 ? 22.429 10.755  -13.241 1.00 25.54 ? 397  HIS A CA    1 
ATOM   3136 C  C     . HIS A 1 400 ? 22.320 9.242   -13.444 1.00 21.34 ? 397  HIS A C     1 
ATOM   3137 O  O     . HIS A 1 400 ? 21.382 8.601   -12.971 1.00 26.03 ? 397  HIS A O     1 
ATOM   3138 C  CB    . HIS A 1 400 ? 22.012 11.514  -14.504 1.00 29.93 ? 397  HIS A CB    1 
ATOM   3139 C  CG    . HIS A 1 400 ? 20.598 11.256  -14.919 1.00 41.93 ? 397  HIS A CG    1 
ATOM   3140 N  ND1   . HIS A 1 400 ? 20.215 10.108  -15.582 1.00 41.50 ? 397  HIS A ND1   1 
ATOM   3141 C  CD2   . HIS A 1 400 ? 19.473 11.990  -14.757 1.00 43.56 ? 397  HIS A CD2   1 
ATOM   3142 C  CE1   . HIS A 1 400 ? 18.916 10.150  -15.814 1.00 42.40 ? 397  HIS A CE1   1 
ATOM   3143 N  NE2   . HIS A 1 400 ? 18.441 11.281  -15.322 1.00 48.59 ? 397  HIS A NE2   1 
ATOM   3144 N  N     . ASP A 1 401 ? 23.314 8.670   -14.119 1.00 26.51 ? 398  ASP A N     1 
ATOM   3145 C  CA    . ASP A 1 401 ? 23.353 7.235   -14.361 1.00 26.47 ? 398  ASP A CA    1 
ATOM   3146 C  C     . ASP A 1 401 ? 23.475 6.432   -13.073 1.00 25.73 ? 398  ASP A C     1 
ATOM   3147 O  O     . ASP A 1 401 ? 22.863 5.375   -12.935 1.00 24.38 ? 398  ASP A O     1 
ATOM   3148 C  CB    . ASP A 1 401 ? 24.499 6.879   -15.307 1.00 24.35 ? 398  ASP A CB    1 
ATOM   3149 C  CG    . ASP A 1 401 ? 24.240 7.338   -16.732 1.00 34.42 ? 398  ASP A CG    1 
ATOM   3150 O  OD1   . ASP A 1 401 ? 23.105 7.776   -17.019 1.00 29.04 ? 398  ASP A OD1   1 
ATOM   3151 O  OD2   . ASP A 1 401 ? 25.167 7.254   -17.566 1.00 32.93 ? 398  ASP A OD2   1 
ATOM   3152 N  N     . ALA A 1 402 ? 24.268 6.936   -12.131 1.00 24.86 ? 399  ALA A N     1 
ATOM   3153 C  CA    . ALA A 1 402 ? 24.472 6.254   -10.860 1.00 19.71 ? 399  ALA A CA    1 
ATOM   3154 C  C     . ALA A 1 402 ? 23.174 6.219   -10.071 1.00 20.28 ? 399  ALA A C     1 
ATOM   3155 O  O     . ALA A 1 402 ? 22.826 5.206   -9.461  1.00 23.95 ? 399  ALA A O     1 
ATOM   3156 C  CB    . ALA A 1 402 ? 25.571 6.955   -10.054 1.00 20.82 ? 399  ALA A CB    1 
ATOM   3157 N  N     . PHE A 1 403 ? 22.460 7.338   -10.090 1.00 24.53 ? 400  PHE A N     1 
ATOM   3158 C  CA    . PHE A 1 403 ? 21.179 7.422   -9.411  1.00 27.86 ? 400  PHE A CA    1 
ATOM   3159 C  C     . PHE A 1 403 ? 20.215 6.427   -10.038 1.00 28.30 ? 400  PHE A C     1 
ATOM   3160 O  O     . PHE A 1 403 ? 19.597 5.626   -9.345  1.00 27.79 ? 400  PHE A O     1 
ATOM   3161 C  CB    . PHE A 1 403 ? 20.611 8.834   -9.510  1.00 26.84 ? 400  PHE A CB    1 
ATOM   3162 C  CG    . PHE A 1 403 ? 19.341 9.026   -8.735  1.00 37.35 ? 400  PHE A CG    1 
ATOM   3163 C  CD1   . PHE A 1 403 ? 18.142 9.265   -9.390  1.00 41.18 ? 400  PHE A CD1   1 
ATOM   3164 C  CD2   . PHE A 1 403 ? 19.344 8.957   -7.350  1.00 30.52 ? 400  PHE A CD2   1 
ATOM   3165 C  CE1   . PHE A 1 403 ? 16.970 9.441   -8.676  1.00 44.30 ? 400  PHE A CE1   1 
ATOM   3166 C  CE2   . PHE A 1 403 ? 18.176 9.132   -6.631  1.00 41.85 ? 400  PHE A CE2   1 
ATOM   3167 C  CZ    . PHE A 1 403 ? 16.987 9.375   -7.296  1.00 44.04 ? 400  PHE A CZ    1 
ATOM   3168 N  N     . THR A 1 404 ? 20.102 6.480   -11.357 1.00 31.12 ? 401  THR A N     1 
ATOM   3169 C  CA    . THR A 1 404 ? 19.258 5.540   -12.083 1.00 28.65 ? 401  THR A CA    1 
ATOM   3170 C  C     . THR A 1 404 ? 19.483 4.087   -11.655 1.00 32.26 ? 401  THR A C     1 
ATOM   3171 O  O     . THR A 1 404 ? 18.525 3.342   -11.460 1.00 34.43 ? 401  THR A O     1 
ATOM   3172 C  CB    . THR A 1 404 ? 19.451 5.667   -13.606 1.00 28.14 ? 401  THR A CB    1 
ATOM   3173 O  OG1   . THR A 1 404 ? 19.131 7.000   -14.023 1.00 29.75 ? 401  THR A OG1   1 
ATOM   3174 C  CG2   . THR A 1 404 ? 18.562 4.681   -14.345 1.00 30.11 ? 401  THR A CG2   1 
ATOM   3175 N  N     . VAL A 1 405 ? 20.737 3.670   -11.499 1.00 28.46 ? 402  VAL A N     1 
ATOM   3176 C  CA    . VAL A 1 405 ? 20.984 2.263   -11.189 1.00 27.32 ? 402  VAL A CA    1 
ATOM   3177 C  C     . VAL A 1 405 ? 20.710 1.882   -9.734  1.00 27.74 ? 402  VAL A C     1 
ATOM   3178 O  O     . VAL A 1 405 ? 20.483 0.710   -9.450  1.00 33.28 ? 402  VAL A O     1 
ATOM   3179 C  CB    . VAL A 1 405 ? 22.391 1.773   -11.622 1.00 31.94 ? 402  VAL A CB    1 
ATOM   3180 C  CG1   . VAL A 1 405 ? 22.583 1.973   -13.127 1.00 34.48 ? 402  VAL A CG1   1 
ATOM   3181 C  CG2   . VAL A 1 405 ? 23.483 2.468   -10.830 1.00 32.81 ? 402  VAL A CG2   1 
ATOM   3182 N  N     . ILE A 1 406 ? 20.722 2.859   -8.825  1.00 29.43 ? 403  ILE A N     1 
ATOM   3183 C  CA    . ILE A 1 406 ? 20.474 2.586   -7.404  1.00 36.66 ? 403  ILE A CA    1 
ATOM   3184 C  C     . ILE A 1 406 ? 19.098 3.034   -6.903  1.00 34.77 ? 403  ILE A C     1 
ATOM   3185 O  O     . ILE A 1 406 ? 18.690 2.668   -5.801  1.00 42.92 ? 403  ILE A O     1 
ATOM   3186 C  CB    . ILE A 1 406 ? 21.530 3.254   -6.476  1.00 31.21 ? 403  ILE A CB    1 
ATOM   3187 C  CG1   . ILE A 1 406 ? 21.316 4.771   -6.410  1.00 32.06 ? 403  ILE A CG1   1 
ATOM   3188 C  CG2   . ILE A 1 406 ? 22.937 2.879   -6.905  1.00 30.40 ? 403  ILE A CG2   1 
ATOM   3189 C  CD1   . ILE A 1 406 ? 22.016 5.449   -5.220  1.00 30.61 ? 403  ILE A CD1   1 
ATOM   3190 N  N     . LYS A 1 407 ? 18.393 3.827   -7.702  1.00 32.22 ? 404  LYS A N     1 
ATOM   3191 C  CA    . LYS A 1 407 ? 17.170 4.474   -7.236  1.00 39.34 ? 404  LYS A CA    1 
ATOM   3192 C  C     . LYS A 1 407 ? 16.100 3.480   -6.776  1.00 45.21 ? 404  LYS A C     1 
ATOM   3193 O  O     . LYS A 1 407 ? 15.225 3.823   -5.981  1.00 43.29 ? 404  LYS A O     1 
ATOM   3194 C  CB    . LYS A 1 407 ? 16.613 5.418   -8.307  1.00 35.49 ? 404  LYS A CB    1 
ATOM   3195 C  CG    . LYS A 1 407 ? 16.089 4.724   -9.558  1.00 38.65 ? 404  LYS A CG    1 
ATOM   3196 C  CD    . LYS A 1 407 ? 15.717 5.745   -10.627 1.00 37.28 ? 404  LYS A CD    1 
ATOM   3197 C  CE    . LYS A 1 407 ? 14.964 5.103   -11.785 1.00 45.64 ? 404  LYS A CE    1 
ATOM   3198 N  NZ    . LYS A 1 407 ? 15.762 4.031   -12.451 1.00 52.69 ? 404  LYS A NZ    1 
ATOM   3199 N  N     . ASN A 1 408 ? 16.185 2.248   -7.266  1.00 42.72 ? 405  ASN A N     1 
ATOM   3200 C  CA    . ASN A 1 408 ? 15.218 1.213   -6.920  1.00 51.10 ? 405  ASN A CA    1 
ATOM   3201 C  C     . ASN A 1 408 ? 15.474 0.603   -5.544  1.00 50.59 ? 405  ASN A C     1 
ATOM   3202 O  O     . ASN A 1 408 ? 14.755 -0.298  -5.114  1.00 48.53 ? 405  ASN A O     1 
ATOM   3203 C  CB    . ASN A 1 408 ? 15.231 0.111   -7.978  1.00 49.64 ? 405  ASN A CB    1 
ATOM   3204 C  CG    . ASN A 1 408 ? 16.486 -0.741  -7.909  1.00 58.82 ? 405  ASN A CG    1 
ATOM   3205 O  OD1   . ASN A 1 408 ? 17.596 -0.254  -8.143  1.00 44.92 ? 405  ASN A OD1   1 
ATOM   3206 N  ND2   . ASN A 1 408 ? 16.318 -2.020  -7.582  1.00 57.73 ? 405  ASN A ND2   1 
ATOM   3207 N  N     . CYS A 1 409 ? 16.507 1.086   -4.862  1.00 47.61 ? 406  CYS A N     1 
ATOM   3208 C  CA    . CYS A 1 409 ? 16.845 0.579   -3.536  1.00 49.08 ? 406  CYS A CA    1 
ATOM   3209 C  C     . CYS A 1 409 ? 16.050 1.308   -2.471  1.00 45.53 ? 406  CYS A C     1 
ATOM   3210 O  O     . CYS A 1 409 ? 15.988 0.877   -1.321  1.00 50.98 ? 406  CYS A O     1 
ATOM   3211 C  CB    . CYS A 1 409 ? 18.336 0.751   -3.256  1.00 50.04 ? 406  CYS A CB    1 
ATOM   3212 S  SG    . CYS A 1 409 ? 19.379 -0.371  -4.174  1.00 59.53 ? 406  CYS A SG    1 
ATOM   3213 N  N     . ASN A 1 410 ? 15.449 2.421   -2.866  1.00 44.72 ? 407  ASN A N     1 
ATOM   3214 C  CA    . ASN A 1 410 ? 14.711 3.263   -1.942  1.00 41.83 ? 407  ASN A CA    1 
ATOM   3215 C  C     . ASN A 1 410 ? 13.413 2.609   -1.452  1.00 52.66 ? 407  ASN A C     1 
ATOM   3216 O  O     . ASN A 1 410 ? 12.385 2.660   -2.127  1.00 52.33 ? 407  ASN A O     1 
ATOM   3217 C  CB    . ASN A 1 410 ? 14.430 4.613   -2.600  1.00 37.95 ? 407  ASN A CB    1 
ATOM   3218 C  CG    . ASN A 1 410 ? 13.854 5.614   -1.639  1.00 37.10 ? 407  ASN A CG    1 
ATOM   3219 O  OD1   . ASN A 1 410 ? 13.641 5.308   -0.468  1.00 43.50 ? 407  ASN A OD1   1 
ATOM   3220 N  ND2   . ASN A 1 410 ? 13.610 6.829   -2.121  1.00 38.19 ? 407  ASN A ND2   1 
ATOM   3221 N  N     . THR A 1 411 ? 13.481 1.992   -0.275  1.00 52.71 ? 408  THR A N     1 
ATOM   3222 C  CA    . THR A 1 411 ? 12.323 1.372   0.369   1.00 52.00 ? 408  THR A CA    1 
ATOM   3223 C  C     . THR A 1 411 ? 11.177 2.359   0.562   1.00 50.51 ? 408  THR A C     1 
ATOM   3224 O  O     . THR A 1 411 ? 10.007 1.983   0.505   1.00 59.12 ? 408  THR A O     1 
ATOM   3225 C  CB    . THR A 1 411 ? 12.705 0.785   1.746   1.00 49.63 ? 408  THR A CB    1 
ATOM   3226 O  OG1   . THR A 1 411 ? 13.309 -0.503  1.569   1.00 61.80 ? 408  THR A OG1   1 
ATOM   3227 C  CG2   . THR A 1 411 ? 11.483 0.643   2.638   1.00 59.39 ? 408  THR A CG2   1 
ATOM   3228 N  N     . SER A 1 412 ? 11.524 3.622   0.786   1.00 54.90 ? 409  SER A N     1 
ATOM   3229 C  CA    . SER A 1 412 ? 10.540 4.668   1.062   1.00 57.33 ? 409  SER A CA    1 
ATOM   3230 C  C     . SER A 1 412 ? 9.397  4.701   0.058   1.00 60.91 ? 409  SER A C     1 
ATOM   3231 O  O     . SER A 1 412 ? 9.618  4.712   -1.153  1.00 65.89 ? 409  SER A O     1 
ATOM   3232 C  CB    . SER A 1 412 ? 11.215 6.043   1.110   1.00 56.21 ? 409  SER A CB    1 
ATOM   3233 O  OG    . SER A 1 412 ? 10.256 7.088   1.129   1.00 58.45 ? 409  SER A OG    1 
ATOM   3234 N  N     . GLY A 1 413 ? 8.172  4.722   0.572   1.00 67.81 ? 410  GLY A N     1 
ATOM   3235 C  CA    . GLY A 1 413 ? 7.007  4.913   -0.268  1.00 65.88 ? 410  GLY A CA    1 
ATOM   3236 C  C     . GLY A 1 413 ? 7.003  6.332   -0.801  1.00 66.91 ? 410  GLY A C     1 
ATOM   3237 O  O     . GLY A 1 413 ? 6.642  6.577   -1.953  1.00 63.07 ? 410  GLY A O     1 
ATOM   3238 N  N     . ILE A 1 414 ? 7.417  7.268   0.048   1.00 62.03 ? 411  ILE A N     1 
ATOM   3239 C  CA    . ILE A 1 414 ? 7.519  8.669   -0.337  1.00 61.69 ? 411  ILE A CA    1 
ATOM   3240 C  C     . ILE A 1 414 ? 8.639  8.847   -1.358  1.00 64.84 ? 411  ILE A C     1 
ATOM   3241 O  O     . ILE A 1 414 ? 9.712  8.257   -1.224  1.00 62.57 ? 411  ILE A O     1 
ATOM   3242 C  CB    . ILE A 1 414 ? 7.797  9.567   0.888   1.00 60.08 ? 411  ILE A CB    1 
ATOM   3243 C  CG1   . ILE A 1 414 ? 7.025  9.057   2.110   1.00 59.22 ? 411  ILE A CG1   1 
ATOM   3244 C  CG2   . ILE A 1 414 ? 7.453  11.017  0.580   1.00 54.80 ? 411  ILE A CG2   1 
ATOM   3245 C  CD1   . ILE A 1 414 ? 7.295  9.842   3.378   1.00 57.56 ? 411  ILE A CD1   1 
ATOM   3246 N  N     . GLN A 1 415 ? 8.383  9.664   -2.376  1.00 69.40 ? 412  GLN A N     1 
ATOM   3247 C  CA    . GLN A 1 415 ? 9.334  9.872   -3.466  1.00 63.39 ? 412  GLN A CA    1 
ATOM   3248 C  C     . GLN A 1 415 ? 10.560 10.659  -3.011  1.00 64.07 ? 412  GLN A C     1 
ATOM   3249 O  O     . GLN A 1 415 ? 11.693 10.331  -3.371  1.00 64.34 ? 412  GLN A O     1 
ATOM   3250 C  CB    . GLN A 1 415 ? 8.652  10.607  -4.624  1.00 61.96 ? 412  GLN A CB    1 
ATOM   3251 C  CG    . GLN A 1 415 ? 9.507  10.752  -5.875  1.00 65.49 ? 412  GLN A CG    1 
ATOM   3252 C  CD    . GLN A 1 415 ? 9.669  9.446   -6.636  1.00 71.63 ? 412  GLN A CD    1 
ATOM   3253 O  OE1   . GLN A 1 415 ? 9.907  8.391   -6.046  1.00 71.65 ? 412  GLN A OE1   1 
ATOM   3254 N  NE2   . GLN A 1 415 ? 9.534  9.512   -7.957  1.00 62.78 ? 412  GLN A NE2   1 
ATOM   3255 N  N     . THR A 1 416 ? 10.319 11.698  -2.218  1.00 57.80 ? 413  THR A N     1 
ATOM   3256 C  CA    . THR A 1 416 ? 11.368 12.617  -1.794  1.00 55.01 ? 413  THR A CA    1 
ATOM   3257 C  C     . THR A 1 416 ? 12.252 12.048  -0.685  1.00 50.64 ? 413  THR A C     1 
ATOM   3258 O  O     . THR A 1 416 ? 13.391 12.477  -0.513  1.00 46.86 ? 413  THR A O     1 
ATOM   3259 C  CB    . THR A 1 416 ? 10.764 13.952  -1.323  1.00 56.00 ? 413  THR A CB    1 
ATOM   3260 O  OG1   . THR A 1 416 ? 9.948  14.497  -2.367  1.00 60.27 ? 413  THR A OG1   1 
ATOM   3261 C  CG2   . THR A 1 416 ? 11.860 14.947  -0.970  1.00 57.38 ? 413  THR A CG2   1 
ATOM   3262 N  N     . GLU A 1 417 ? 11.724 11.088  0.067   1.00 51.86 ? 414  GLU A N     1 
ATOM   3263 C  CA    . GLU A 1 417 ? 12.477 10.475  1.154   1.00 47.13 ? 414  GLU A CA    1 
ATOM   3264 C  C     . GLU A 1 417 ? 13.290 9.288   0.667   1.00 53.53 ? 414  GLU A C     1 
ATOM   3265 O  O     . GLU A 1 417 ? 12.894 8.591   -0.272  1.00 49.49 ? 414  GLU A O     1 
ATOM   3266 C  CB    . GLU A 1 417 ? 11.540 10.024  2.277   1.00 51.07 ? 414  GLU A CB    1 
ATOM   3267 C  CG    . GLU A 1 417 ? 10.597 11.110  2.762   1.00 55.81 ? 414  GLU A CG    1 
ATOM   3268 C  CD    . GLU A 1 417 ? 11.307 12.427  2.989   1.00 51.61 ? 414  GLU A CD    1 
ATOM   3269 O  OE1   . GLU A 1 417 ? 11.986 12.566  4.029   1.00 49.21 ? 414  GLU A OE1   1 
ATOM   3270 O  OE2   . GLU A 1 417 ? 11.190 13.318  2.121   1.00 46.82 ? 414  GLU A OE2   1 
ATOM   3271 N  N     . TRP A 1 418 ? 14.431 9.063   1.309   1.00 38.68 ? 415  TRP A N     1 
ATOM   3272 C  CA    . TRP A 1 418 ? 15.233 7.884   1.029   1.00 36.30 ? 415  TRP A CA    1 
ATOM   3273 C  C     . TRP A 1 418 ? 15.351 7.001   2.267   1.00 40.44 ? 415  TRP A C     1 
ATOM   3274 O  O     . TRP A 1 418 ? 15.831 7.439   3.313   1.00 36.72 ? 415  TRP A O     1 
ATOM   3275 C  CB    . TRP A 1 418 ? 16.632 8.262   0.524   1.00 34.96 ? 415  TRP A CB    1 
ATOM   3276 C  CG    . TRP A 1 418 ? 17.332 7.084   -0.058  1.00 28.17 ? 415  TRP A CG    1 
ATOM   3277 C  CD1   . TRP A 1 418 ? 17.824 6.012   0.618   1.00 33.15 ? 415  TRP A CD1   1 
ATOM   3278 C  CD2   . TRP A 1 418 ? 17.582 6.836   -1.445  1.00 32.90 ? 415  TRP A CD2   1 
ATOM   3279 N  NE1   . TRP A 1 418 ? 18.374 5.109   -0.260  1.00 35.36 ? 415  TRP A NE1   1 
ATOM   3280 C  CE2   . TRP A 1 418 ? 18.238 5.593   -1.534  1.00 33.04 ? 415  TRP A CE2   1 
ATOM   3281 C  CE3   . TRP A 1 418 ? 17.319 7.547   -2.619  1.00 38.66 ? 415  TRP A CE3   1 
ATOM   3282 C  CZ2   . TRP A 1 418 ? 18.641 5.047   -2.751  1.00 38.65 ? 415  TRP A CZ2   1 
ATOM   3283 C  CZ3   . TRP A 1 418 ? 17.719 7.001   -3.830  1.00 31.47 ? 415  TRP A CZ3   1 
ATOM   3284 C  CH2   . TRP A 1 418 ? 18.368 5.764   -3.884  1.00 36.78 ? 415  TRP A CH2   1 
ATOM   3285 N  N     . SER A 1 419 ? 14.914 5.753   2.148   1.00 41.26 ? 416  SER A N     1 
ATOM   3286 C  CA    . SER A 1 419 ? 15.046 4.809   3.250   1.00 40.47 ? 416  SER A CA    1 
ATOM   3287 C  C     . SER A 1 419 ? 15.361 3.408   2.743   1.00 41.40 ? 416  SER A C     1 
ATOM   3288 O  O     . SER A 1 419 ? 14.908 3.022   1.670   1.00 45.20 ? 416  SER A O     1 
ATOM   3289 C  CB    . SER A 1 419 ? 13.779 4.795   4.109   1.00 48.69 ? 416  SER A CB    1 
ATOM   3290 O  OG    . SER A 1 419 ? 12.635 4.509   3.325   1.00 55.59 ? 416  SER A OG    1 
ATOM   3291 N  N     . PRO A 1 420 ? 16.172 2.657   3.503   1.00 43.54 ? 417  PRO A N     1 
ATOM   3292 C  CA    . PRO A 1 420 ? 16.851 3.213   4.679   1.00 44.35 ? 417  PRO A CA    1 
ATOM   3293 C  C     . PRO A 1 420 ? 17.913 4.207   4.236   1.00 34.57 ? 417  PRO A C     1 
ATOM   3294 O  O     . PRO A 1 420 ? 18.305 4.188   3.068   1.00 43.42 ? 417  PRO A O     1 
ATOM   3295 C  CB    . PRO A 1 420 ? 17.505 1.986   5.321   1.00 39.27 ? 417  PRO A CB    1 
ATOM   3296 C  CG    . PRO A 1 420 ? 17.648 1.006   4.208   1.00 49.46 ? 417  PRO A CG    1 
ATOM   3297 C  CD    . PRO A 1 420 ? 16.460 1.225   3.322   1.00 42.30 ? 417  PRO A CD    1 
ATOM   3298 N  N     . PRO A 1 421 ? 18.355 5.086   5.145   1.00 34.15 ? 418  PRO A N     1 
ATOM   3299 C  CA    . PRO A 1 421 ? 19.352 6.093   4.777   1.00 31.64 ? 418  PRO A CA    1 
ATOM   3300 C  C     . PRO A 1 421 ? 20.646 5.434   4.308   1.00 23.05 ? 418  PRO A C     1 
ATOM   3301 O  O     . PRO A 1 421 ? 20.945 4.311   4.720   1.00 27.57 ? 418  PRO A O     1 
ATOM   3302 C  CB    . PRO A 1 421 ? 19.578 6.855   6.088   1.00 30.01 ? 418  PRO A CB    1 
ATOM   3303 C  CG    . PRO A 1 421 ? 18.329 6.629   6.877   1.00 37.38 ? 418  PRO A CG    1 
ATOM   3304 C  CD    . PRO A 1 421 ? 17.906 5.233   6.540   1.00 37.59 ? 418  PRO A CD    1 
ATOM   3305 N  N     . LEU A 1 422 ? 21.388 6.130   3.455   1.00 27.73 ? 419  LEU A N     1 
ATOM   3306 C  CA    . LEU A 1 422 ? 22.627 5.605   2.896   1.00 24.88 ? 419  LEU A CA    1 
ATOM   3307 C  C     . LEU A 1 422 ? 23.818 6.059   3.730   1.00 19.99 ? 419  LEU A C     1 
ATOM   3308 O  O     . LEU A 1 422 ? 23.945 7.237   4.050   1.00 27.72 ? 419  LEU A O     1 
ATOM   3309 C  CB    . LEU A 1 422 ? 22.799 6.073   1.447   1.00 21.33 ? 419  LEU A CB    1 
ATOM   3310 C  CG    . LEU A 1 422 ? 21.655 5.712   0.502   1.00 27.37 ? 419  LEU A CG    1 
ATOM   3311 C  CD1   . LEU A 1 422 ? 21.977 6.141   -0.929  1.00 24.84 ? 419  LEU A CD1   1 
ATOM   3312 C  CD2   . LEU A 1 422 ? 21.386 4.226   0.583   1.00 24.94 ? 419  LEU A CD2   1 
ATOM   3313 N  N     . THR A 1 423 ? 24.686 5.116   4.074   1.00 23.17 ? 420  THR A N     1 
ATOM   3314 C  CA    . THR A 1 423 ? 25.853 5.409   4.899   1.00 23.37 ? 420  THR A CA    1 
ATOM   3315 C  C     . THR A 1 423 ? 27.160 5.400   4.093   1.00 20.73 ? 420  THR A C     1 
ATOM   3316 O  O     . THR A 1 423 ? 28.232 5.695   4.633   1.00 20.24 ? 420  THR A O     1 
ATOM   3317 C  CB    . THR A 1 423 ? 25.962 4.404   6.048   1.00 26.61 ? 420  THR A CB    1 
ATOM   3318 O  OG1   . THR A 1 423 ? 25.808 3.079   5.524   1.00 30.50 ? 420  THR A OG1   1 
ATOM   3319 C  CG2   . THR A 1 423 ? 24.859 4.664   7.078   1.00 28.42 ? 420  THR A CG2   1 
ATOM   3320 N  N     . MET A 1 424 ? 27.067 5.051   2.812   1.00 17.58 ? 421  MET A N     1 
ATOM   3321 C  CA    . MET A 1 424 ? 28.232 5.086   1.926   1.00 16.36 ? 421  MET A CA    1 
ATOM   3322 C  C     . MET A 1 424 ? 27.820 5.232   0.460   1.00 18.70 ? 421  MET A C     1 
ATOM   3323 O  O     . MET A 1 424 ? 26.816 4.665   0.034   1.00 17.02 ? 421  MET A O     1 
ATOM   3324 C  CB    . MET A 1 424 ? 29.094 3.837   2.132   1.00 20.00 ? 421  MET A CB    1 
ATOM   3325 C  CG    . MET A 1 424 ? 30.381 3.787   1.307   1.00 22.50 ? 421  MET A CG    1 
ATOM   3326 S  SD    . MET A 1 424 ? 30.104 3.143   -0.355  1.00 25.18 ? 421  MET A SD    1 
ATOM   3327 C  CE    . MET A 1 424 ? 29.560 1.477   0.019   1.00 24.57 ? 421  MET A CE    1 
ATOM   3328 N  N     . LEU A 1 425 ? 28.573 6.036   -0.288  1.00 10.83 ? 422  LEU A N     1 
ATOM   3329 C  CA    . LEU A 1 425 ? 28.442 6.127   -1.734  1.00 14.04 ? 422  LEU A CA    1 
ATOM   3330 C  C     . LEU A 1 425 ? 29.821 5.885   -2.326  1.00 19.33 ? 422  LEU A C     1 
ATOM   3331 O  O     . LEU A 1 425 ? 30.829 6.315   -1.763  1.00 18.76 ? 422  LEU A O     1 
ATOM   3332 C  CB    . LEU A 1 425 ? 27.970 7.515   -2.173  1.00 16.34 ? 422  LEU A CB    1 
ATOM   3333 C  CG    . LEU A 1 425 ? 26.558 7.990   -1.828  1.00 21.83 ? 422  LEU A CG    1 
ATOM   3334 C  CD1   . LEU A 1 425 ? 26.321 9.338   -2.492  1.00 22.82 ? 422  LEU A CD1   1 
ATOM   3335 C  CD2   . LEU A 1 425 ? 25.503 6.974   -2.267  1.00 18.49 ? 422  LEU A CD2   1 
ATOM   3336 N  N     . PHE A 1 426 ? 29.861 5.213   -3.469  1.00 13.32 ? 423  PHE A N     1 
ATOM   3337 C  CA    . PHE A 1 426 ? 31.123 4.860   -4.109  1.00 13.53 ? 423  PHE A CA    1 
ATOM   3338 C  C     . PHE A 1 426 ? 30.878 4.888   -5.609  1.00 17.76 ? 423  PHE A C     1 
ATOM   3339 O  O     . PHE A 1 426 ? 29.886 4.327   -6.082  1.00 20.10 ? 423  PHE A O     1 
ATOM   3340 C  CB    . PHE A 1 426 ? 31.532 3.449   -3.653  1.00 19.10 ? 423  PHE A CB    1 
ATOM   3341 C  CG    . PHE A 1 426 ? 32.892 3.005   -4.131  1.00 22.04 ? 423  PHE A CG    1 
ATOM   3342 C  CD1   . PHE A 1 426 ? 33.166 1.655   -4.288  1.00 43.49 ? 423  PHE A CD1   1 
ATOM   3343 C  CD2   . PHE A 1 426 ? 33.899 3.922   -4.404  1.00 23.84 ? 423  PHE A CD2   1 
ATOM   3344 C  CE1   . PHE A 1 426 ? 34.411 1.227   -4.724  1.00 36.54 ? 423  PHE A CE1   1 
ATOM   3345 C  CE2   . PHE A 1 426 ? 35.149 3.503   -4.831  1.00 24.98 ? 423  PHE A CE2   1 
ATOM   3346 C  CZ    . PHE A 1 426 ? 35.405 2.153   -4.989  1.00 27.00 ? 423  PHE A CZ    1 
ATOM   3347 N  N     . LEU A 1 427 ? 31.742 5.582   -6.345  1.00 12.66 ? 424  LEU A N     1 
ATOM   3348 C  CA    . LEU A 1 427 ? 31.732 5.568   -7.802  1.00 15.34 ? 424  LEU A CA    1 
ATOM   3349 C  C     . LEU A 1 427 ? 33.094 5.117   -8.265  1.00 17.16 ? 424  LEU A C     1 
ATOM   3350 O  O     . LEU A 1 427 ? 34.104 5.660   -7.828  1.00 14.77 ? 424  LEU A O     1 
ATOM   3351 C  CB    . LEU A 1 427 ? 31.466 6.959   -8.374  1.00 15.95 ? 424  LEU A CB    1 
ATOM   3352 C  CG    . LEU A 1 427 ? 30.070 7.531   -8.186  1.00 19.00 ? 424  LEU A CG    1 
ATOM   3353 C  CD1   . LEU A 1 427 ? 29.975 8.931   -8.797  1.00 21.25 ? 424  LEU A CD1   1 
ATOM   3354 C  CD2   . LEU A 1 427 ? 29.031 6.594   -8.799  1.00 18.41 ? 424  LEU A CD2   1 
ATOM   3355 N  N     . CYS A 1 428 ? 33.139 4.137   -9.160  1.00 16.15 ? 425  CYS A N     1 
ATOM   3356 C  CA    . CYS A 1 428 ? 34.428 3.626   -9.615  1.00 16.95 ? 425  CYS A CA    1 
ATOM   3357 C  C     . CYS A 1 428 ? 34.439 3.414   -11.129 1.00 23.31 ? 425  CYS A C     1 
ATOM   3358 O  O     . CYS A 1 428 ? 33.557 2.743   -11.670 1.00 19.31 ? 425  CYS A O     1 
ATOM   3359 C  CB    . CYS A 1 428 ? 34.754 2.316   -8.901  1.00 23.29 ? 425  CYS A CB    1 
ATOM   3360 S  SG    . CYS A 1 428 ? 36.420 1.678   -9.242  1.00 28.09 ? 425  CYS A SG    1 
ATOM   3361 N  N     . ALA A 1 429 ? 35.435 3.996   -11.794 1.00 15.39 ? 426  ALA A N     1 
ATOM   3362 C  CA    . ALA A 1 429 ? 35.632 3.800   -13.223 1.00 19.31 ? 426  ALA A CA    1 
ATOM   3363 C  C     . ALA A 1 429 ? 36.582 2.626   -13.452 1.00 20.86 ? 426  ALA A C     1 
ATOM   3364 O  O     . ALA A 1 429 ? 37.657 2.551   -12.842 1.00 17.50 ? 426  ALA A O     1 
ATOM   3365 C  CB    . ALA A 1 429 ? 36.189 5.062   -13.861 1.00 17.72 ? 426  ALA A CB    1 
ATOM   3366 N  N     . THR A 1 430 ? 36.181 1.720   -14.340 1.00 18.92 ? 427  THR A N     1 
ATOM   3367 C  CA    . THR A 1 430 ? 36.918 0.482   -14.566 1.00 20.86 ? 427  THR A CA    1 
ATOM   3368 C  C     . THR A 1 430 ? 36.947 0.126   -16.046 1.00 21.65 ? 427  THR A C     1 
ATOM   3369 O  O     . THR A 1 430 ? 36.388 0.844   -16.875 1.00 15.82 ? 427  THR A O     1 
ATOM   3370 C  CB    . THR A 1 430 ? 36.269 -0.701  -13.815 1.00 21.92 ? 427  THR A CB    1 
ATOM   3371 O  OG1   . THR A 1 430 ? 34.974 -0.962  -14.371 1.00 26.82 ? 427  THR A OG1   1 
ATOM   3372 C  CG2   . THR A 1 430 ? 36.113 -0.385  -12.335 1.00 29.51 ? 427  THR A CG2   1 
ATOM   3373 N  N     . LYS A 1 431 ? 37.592 -1.000  -16.352 1.00 20.51 ? 428  LYS A N     1 
ATOM   3374 C  CA    . LYS A 1 431 ? 37.655 -1.554  -17.703 1.00 24.50 ? 428  LYS A CA    1 
ATOM   3375 C  C     . LYS A 1 431 ? 38.243 -0.575  -18.711 1.00 14.85 ? 428  LYS A C     1 
ATOM   3376 O  O     . LYS A 1 431 ? 37.558 -0.132  -19.639 1.00 20.85 ? 428  LYS A O     1 
ATOM   3377 C  CB    . LYS A 1 431 ? 36.276 -2.034  -18.162 1.00 20.48 ? 428  LYS A CB    1 
ATOM   3378 C  CG    . LYS A 1 431 ? 35.722 -3.156  -17.315 1.00 31.00 ? 428  LYS A CG    1 
ATOM   3379 C  CD    . LYS A 1 431 ? 34.542 -3.828  -18.000 1.00 40.25 ? 428  LYS A CD    1 
ATOM   3380 C  CE    . LYS A 1 431 ? 34.013 -4.980  -17.163 1.00 43.84 ? 428  LYS A CE    1 
ATOM   3381 N  NZ    . LYS A 1 431 ? 35.119 -5.856  -16.688 1.00 47.68 ? 428  LYS A NZ    1 
ATOM   3382 N  N     . PHE A 1 432 ? 39.516 -0.252  -18.531 1.00 19.70 ? 429  PHE A N     1 
ATOM   3383 C  CA    . PHE A 1 432 ? 40.183 0.719   -19.386 1.00 21.25 ? 429  PHE A CA    1 
ATOM   3384 C  C     . PHE A 1 432 ? 40.540 0.143   -20.751 1.00 27.14 ? 429  PHE A C     1 
ATOM   3385 O  O     . PHE A 1 432 ? 40.855 -1.043  -20.872 1.00 24.73 ? 429  PHE A O     1 
ATOM   3386 C  CB    . PHE A 1 432 ? 41.442 1.252   -18.700 1.00 20.61 ? 429  PHE A CB    1 
ATOM   3387 C  CG    . PHE A 1 432 ? 41.157 2.225   -17.594 1.00 19.94 ? 429  PHE A CG    1 
ATOM   3388 C  CD1   . PHE A 1 432 ? 41.145 3.585   -17.839 1.00 18.51 ? 429  PHE A CD1   1 
ATOM   3389 C  CD2   . PHE A 1 432 ? 40.894 1.780   -16.307 1.00 24.95 ? 429  PHE A CD2   1 
ATOM   3390 C  CE1   . PHE A 1 432 ? 40.881 4.489   -16.822 1.00 18.90 ? 429  PHE A CE1   1 
ATOM   3391 C  CE2   . PHE A 1 432 ? 40.628 2.679   -15.283 1.00 29.37 ? 429  PHE A CE2   1 
ATOM   3392 C  CZ    . PHE A 1 432 ? 40.626 4.038   -15.541 1.00 22.15 ? 429  PHE A CZ    1 
ATOM   3393 N  N     . SER A 1 433 ? 40.482 1.003   -21.767 1.00 22.43 ? 430  SER A N     1 
ATOM   3394 C  CA    . SER A 1 433 ? 40.885 0.665   -23.134 1.00 23.51 ? 430  SER A CA    1 
ATOM   3395 C  C     . SER A 1 433 ? 41.833 1.735   -23.650 1.00 27.56 ? 430  SER A C     1 
ATOM   3396 O  O     . SER A 1 433 ? 41.707 2.912   -23.296 1.00 22.22 ? 430  SER A O     1 
ATOM   3397 C  CB    . SER A 1 433 ? 39.666 0.592   -24.059 1.00 26.74 ? 430  SER A CB    1 
ATOM   3398 O  OG    . SER A 1 433 ? 38.853 -0.529  -23.768 1.00 40.18 ? 430  SER A OG    1 
ATOM   3399 N  N     . ALA A 1 434 ? 42.784 1.329   -24.487 1.00 27.02 ? 431  ALA A N     1 
ATOM   3400 C  CA    . ALA A 1 434 ? 43.739 2.270   -25.053 1.00 28.20 ? 431  ALA A CA    1 
ATOM   3401 C  C     . ALA A 1 434 ? 43.004 3.361   -25.823 1.00 31.27 ? 431  ALA A C     1 
ATOM   3402 O  O     . ALA A 1 434 ? 41.932 3.127   -26.386 1.00 30.13 ? 431  ALA A O     1 
ATOM   3403 C  CB    . ALA A 1 434 ? 44.738 1.550   -25.951 1.00 29.74 ? 431  ALA A CB    1 
ATOM   3404 N  N     . SER A 1 435 ? 43.574 4.560   -25.826 1.00 30.96 ? 432  SER A N     1 
ATOM   3405 C  CA    . SER A 1 435 ? 42.991 5.680   -26.551 1.00 36.89 ? 432  SER A CA    1 
ATOM   3406 C  C     . SER A 1 435 ? 44.093 6.604   -27.056 1.00 42.18 ? 432  SER A C     1 
ATOM   3407 O  O     . SER A 1 435 ? 43.827 7.629   -27.680 1.00 48.71 ? 432  SER A O     1 
ATOM   3408 C  CB    . SER A 1 435 ? 42.024 6.452   -25.655 1.00 33.67 ? 432  SER A CB    1 
ATOM   3409 O  OG    . SER A 1 435 ? 42.712 7.025   -24.555 1.00 46.82 ? 432  SER A OG    1 
ATOM   3410 O  OXT   . SER A 1 435 ? 45.281 6.347   -26.848 1.00 48.89 ? 432  SER A OXT   1 
ATOM   3411 O  "O3'" . DC  B 2 1   ? 27.832 4.668   11.525  1.00 47.67 ? 1    DC  T "O3'" 1 
ATOM   3412 P  P     . DA  B 2 2   ? 28.138 4.421   13.085  1.00 74.51 ? 2    DA  T P     1 
ATOM   3413 O  OP1   . DA  B 2 2   ? 28.220 2.957   13.309  1.00 62.68 ? 2    DA  T OP1   1 
ATOM   3414 O  OP2   . DA  B 2 2   ? 27.185 5.237   13.872  1.00 58.60 ? 2    DA  T OP2   1 
ATOM   3415 O  "O5'" . DA  B 2 2   ? 29.592 5.062   13.291  1.00 53.18 ? 2    DA  T "O5'" 1 
ATOM   3416 C  "C5'" . DA  B 2 2   ? 30.719 4.590   12.563  1.00 47.97 ? 2    DA  T "C5'" 1 
ATOM   3417 C  "C4'" . DA  B 2 2   ? 31.953 5.382   12.960  1.00 40.60 ? 2    DA  T "C4'" 1 
ATOM   3418 O  "O4'" . DA  B 2 2   ? 31.743 6.777   12.643  1.00 40.53 ? 2    DA  T "O4'" 1 
ATOM   3419 C  "C3'" . DA  B 2 2   ? 32.277 5.344   14.452  1.00 44.38 ? 2    DA  T "C3'" 1 
ATOM   3420 O  "O3'" . DA  B 2 2   ? 33.683 5.287   14.637  1.00 42.14 ? 2    DA  T "O3'" 1 
ATOM   3421 C  "C2'" . DA  B 2 2   ? 31.698 6.645   14.999  1.00 43.25 ? 2    DA  T "C2'" 1 
ATOM   3422 C  "C1'" . DA  B 2 2   ? 31.871 7.573   13.806  1.00 41.33 ? 2    DA  T "C1'" 1 
ATOM   3423 N  N9    . DA  B 2 2   ? 30.855 8.620   13.762  1.00 37.69 ? 2    DA  T N9    1 
ATOM   3424 C  C8    . DA  B 2 2   ? 29.606 8.596   14.324  1.00 38.73 ? 2    DA  T C8    1 
ATOM   3425 N  N7    . DA  B 2 2   ? 28.915 9.691   14.113  1.00 38.70 ? 2    DA  T N7    1 
ATOM   3426 C  C5    . DA  B 2 2   ? 29.774 10.482  13.362  1.00 33.21 ? 2    DA  T C5    1 
ATOM   3427 C  C6    . DA  B 2 2   ? 29.648 11.773  12.816  1.00 39.36 ? 2    DA  T C6    1 
ATOM   3428 N  N6    . DA  B 2 2   ? 28.550 12.523  12.948  1.00 39.79 ? 2    DA  T N6    1 
ATOM   3429 N  N1    . DA  B 2 2   ? 30.697 12.263  12.122  1.00 35.82 ? 2    DA  T N1    1 
ATOM   3430 C  C2    . DA  B 2 2   ? 31.798 11.511  11.988  1.00 30.68 ? 2    DA  T C2    1 
ATOM   3431 N  N3    . DA  B 2 2   ? 32.032 10.290  12.457  1.00 34.77 ? 2    DA  T N3    1 
ATOM   3432 C  C4    . DA  B 2 2   ? 30.972 9.836   13.142  1.00 32.33 ? 2    DA  T C4    1 
ATOM   3433 P  P     . DT  B 2 3   ? 34.377 3.913   15.094  1.00 42.61 ? 3    DT  T P     1 
ATOM   3434 O  OP1   . DT  B 2 3   ? 33.347 3.076   15.745  1.00 50.68 ? 3    DT  T OP1   1 
ATOM   3435 O  OP2   . DT  B 2 3   ? 35.626 4.250   15.815  1.00 45.85 ? 3    DT  T OP2   1 
ATOM   3436 O  "O5'" . DT  B 2 3   ? 34.758 3.206   13.711  1.00 45.58 ? 3    DT  T "O5'" 1 
ATOM   3437 C  "C5'" . DT  B 2 3   ? 36.059 3.373   13.165  1.00 40.35 ? 3    DT  T "C5'" 1 
ATOM   3438 C  "C4'" . DT  B 2 3   ? 36.163 4.665   12.381  1.00 40.58 ? 3    DT  T "C4'" 1 
ATOM   3439 O  "O4'" . DT  B 2 3   ? 37.563 4.959   12.146  1.00 34.50 ? 3    DT  T "O4'" 1 
ATOM   3440 C  "C3'" . DT  B 2 3   ? 35.497 4.637   11.010  1.00 40.07 ? 3    DT  T "C3'" 1 
ATOM   3441 O  "O3'" . DT  B 2 3   ? 34.858 5.870   10.773  1.00 34.28 ? 3    DT  T "O3'" 1 
ATOM   3442 C  "C2'" . DT  B 2 3   ? 36.655 4.425   10.039  1.00 36.90 ? 3    DT  T "C2'" 1 
ATOM   3443 C  "C1'" . DT  B 2 3   ? 37.797 5.133   10.757  1.00 38.18 ? 3    DT  T "C1'" 1 
ATOM   3444 N  N1    . DT  B 2 3   ? 39.142 4.555   10.466  1.00 40.84 ? 3    DT  T N1    1 
ATOM   3445 C  C2    . DT  B 2 3   ? 40.139 5.358   9.941   1.00 38.08 ? 3    DT  T C2    1 
ATOM   3446 O  O2    . DT  B 2 3   ? 39.986 6.543   9.686   1.00 47.77 ? 3    DT  T O2    1 
ATOM   3447 N  N3    . DT  B 2 3   ? 41.336 4.719   9.726   1.00 33.66 ? 3    DT  T N3    1 
ATOM   3448 C  C4    . DT  B 2 3   ? 41.617 3.382   9.983   1.00 36.78 ? 3    DT  T C4    1 
ATOM   3449 O  O4    . DT  B 2 3   ? 42.720 2.892   9.760   1.00 36.23 ? 3    DT  T O4    1 
ATOM   3450 C  C5    . DT  B 2 3   ? 40.529 2.603   10.532  1.00 33.12 ? 3    DT  T C5    1 
ATOM   3451 C  C7    . DT  B 2 3   ? 40.717 1.147   10.852  1.00 42.26 ? 3    DT  T C7    1 
ATOM   3452 C  C6    . DT  B 2 3   ? 39.360 3.220   10.751  1.00 35.41 ? 3    DT  T C6    1 
ATOM   3453 P  P     . DT  B 2 4   ? 34.141 6.145   9.365   1.00 44.78 ? 4    DT  T P     1 
ATOM   3454 O  OP1   . DT  B 2 4   ? 33.247 7.309   9.526   1.00 37.93 ? 4    DT  T OP1   1 
ATOM   3455 O  OP2   . DT  B 2 4   ? 33.619 4.856   8.858   1.00 44.32 ? 4    DT  T OP2   1 
ATOM   3456 O  "O5'" . DT  B 2 4   ? 35.346 6.571   8.410   1.00 30.84 ? 4    DT  T "O5'" 1 
ATOM   3457 C  "C5'" . DT  B 2 4   ? 35.911 7.873   8.501   1.00 23.60 ? 4    DT  T "C5'" 1 
ATOM   3458 C  "C4'" . DT  B 2 4   ? 36.685 8.126   7.222   1.00 21.89 ? 4    DT  T "C4'" 1 
ATOM   3459 O  "O4'" . DT  B 2 4   ? 37.864 7.290   7.186   1.00 21.38 ? 4    DT  T "O4'" 1 
ATOM   3460 C  "C3'" . DT  B 2 4   ? 35.928 7.814   5.940   1.00 19.85 ? 4    DT  T "C3'" 1 
ATOM   3461 O  "O3'" . DT  B 2 4   ? 36.259 8.885   5.093   1.00 21.19 ? 4    DT  T "O3'" 1 
ATOM   3462 C  "C2'" . DT  B 2 4   ? 36.491 6.464   5.475   1.00 19.66 ? 4    DT  T "C2'" 1 
ATOM   3463 C  "C1'" . DT  B 2 4   ? 37.930 6.593   5.953   1.00 22.54 ? 4    DT  T "C1'" 1 
ATOM   3464 N  N1    . DT  B 2 4   ? 38.660 5.350   6.280   1.00 18.13 ? 4    DT  T N1    1 
ATOM   3465 C  C2    . DT  B 2 4   ? 39.995 5.335   5.959   1.00 15.51 ? 4    DT  T C2    1 
ATOM   3466 O  O2    . DT  B 2 4   ? 40.565 6.265   5.404   1.00 15.65 ? 4    DT  T O2    1 
ATOM   3467 N  N3    . DT  B 2 4   ? 40.638 4.185   6.302   1.00 20.81 ? 4    DT  T N3    1 
ATOM   3468 C  C4    . DT  B 2 4   ? 40.112 3.079   6.932   1.00 17.06 ? 4    DT  T C4    1 
ATOM   3469 O  O4    . DT  B 2 4   ? 40.804 2.101   7.197   1.00 18.37 ? 4    DT  T O4    1 
ATOM   3470 C  C5    . DT  B 2 4   ? 38.711 3.159   7.256   1.00 21.17 ? 4    DT  T C5    1 
ATOM   3471 C  C7    . DT  B 2 4   ? 38.055 1.990   7.940   1.00 23.92 ? 4    DT  T C7    1 
ATOM   3472 C  C6    . DT  B 2 4   ? 38.054 4.286   6.927   1.00 21.41 ? 4    DT  T C6    1 
ATOM   3473 P  P     . DA  B 2 5   ? 35.679 8.953   3.605   1.00 16.66 ? 5    DA  T P     1 
ATOM   3474 O  OP1   . DA  B 2 5   ? 35.427 10.364  3.280   1.00 18.36 ? 5    DA  T OP1   1 
ATOM   3475 O  OP2   . DA  B 2 5   ? 34.627 7.930   3.470   1.00 15.45 ? 5    DA  T OP2   1 
ATOM   3476 O  "O5'" . DA  B 2 5   ? 36.899 8.431   2.716   1.00 13.94 ? 5    DA  T "O5'" 1 
ATOM   3477 C  "C5'" . DA  B 2 5   ? 38.061 9.257   2.579   1.00 14.83 ? 5    DA  T "C5'" 1 
ATOM   3478 C  "C4'" . DA  B 2 5   ? 39.019 8.613   1.595   1.00 12.66 ? 5    DA  T "C4'" 1 
ATOM   3479 O  "O4'" . DA  B 2 5   ? 39.584 7.405   2.171   1.00 14.80 ? 5    DA  T "O4'" 1 
ATOM   3480 C  "C3'" . DA  B 2 5   ? 38.369 8.194   0.280   1.00 13.72 ? 5    DA  T "C3'" 1 
ATOM   3481 O  "O3'" . DA  B 2 5   ? 39.263 8.514   -0.777  1.00 15.48 ? 5    DA  T "O3'" 1 
ATOM   3482 C  "C2'" . DA  B 2 5   ? 38.207 6.685   0.437   1.00 17.11 ? 5    DA  T "C2'" 1 
ATOM   3483 C  "C1'" . DA  B 2 5   ? 39.461 6.347   1.252   1.00 14.43 ? 5    DA  T "C1'" 1 
ATOM   3484 N  N9    . DA  B 2 5   ? 39.371 5.103   2.003   1.00 15.99 ? 5    DA  T N9    1 
ATOM   3485 C  C8    . DA  B 2 5   ? 38.279 4.597   2.643   1.00 16.61 ? 5    DA  T C8    1 
ATOM   3486 N  N7    . DA  B 2 5   ? 38.511 3.450   3.249   1.00 17.96 ? 5    DA  T N7    1 
ATOM   3487 C  C5    . DA  B 2 5   ? 39.849 3.201   2.993   1.00 15.81 ? 5    DA  T C5    1 
ATOM   3488 C  C6    . DA  B 2 5   ? 40.700 2.138   3.352   1.00 17.78 ? 5    DA  T C6    1 
ATOM   3489 N  N6    . DA  B 2 5   ? 40.296 1.095   4.082   1.00 14.17 ? 5    DA  T N6    1 
ATOM   3490 N  N1    . DA  B 2 5   ? 41.978 2.192   2.931   1.00 17.64 ? 5    DA  T N1    1 
ATOM   3491 C  C2    . DA  B 2 5   ? 42.373 3.243   2.200   1.00 16.56 ? 5    DA  T C2    1 
ATOM   3492 N  N3    . DA  B 2 5   ? 41.665 4.295   1.794   1.00 14.23 ? 5    DA  T N3    1 
ATOM   3493 C  C4    . DA  B 2 5   ? 40.396 4.208   2.232   1.00 15.24 ? 5    DA  T C4    1 
ATOM   3494 P  P     . DT  B 2 6   ? 38.770 8.471   -2.309  1.00 15.55 ? 6    DT  T P     1 
ATOM   3495 O  OP1   . DT  B 2 6   ? 39.890 8.922   -3.150  1.00 18.73 ? 6    DT  T OP1   1 
ATOM   3496 O  OP2   . DT  B 2 6   ? 37.473 9.166   -2.394  1.00 16.50 ? 6    DT  T OP2   1 
ATOM   3497 O  "O5'" . DT  B 2 6   ? 38.452 6.930   -2.552  1.00 16.32 ? 6    DT  T "O5'" 1 
ATOM   3498 C  "C5'" . DT  B 2 6   ? 39.150 6.131   -3.475  1.00 20.55 ? 6    DT  T "C5'" 1 
ATOM   3499 C  "C4'" . DT  B 2 6   ? 40.392 5.501   -2.874  1.00 17.94 ? 6    DT  T "C4'" 1 
ATOM   3500 O  "O4'" . DT  B 2 6   ? 40.084 4.815   -1.645  1.00 19.58 ? 6    DT  T "O4'" 1 
ATOM   3501 C  "C3'" . DT  B 2 6   ? 40.912 4.430   -3.812  1.00 19.90 ? 6    DT  T "C3'" 1 
ATOM   3502 O  "O3'" . DT  B 2 6   ? 41.937 5.008   -4.560  1.00 20.24 ? 6    DT  T "O3'" 1 
ATOM   3503 C  "C2'" . DT  B 2 6   ? 41.431 3.304   -2.920  1.00 20.92 ? 6    DT  T "C2'" 1 
ATOM   3504 C  "C1'" . DT  B 2 6   ? 40.958 3.713   -1.533  1.00 20.79 ? 6    DT  T "C1'" 1 
ATOM   3505 N  N1    . DT  B 2 6   ? 40.252 2.654   -0.794  1.00 19.35 ? 6    DT  T N1    1 
ATOM   3506 C  C2    . DT  B 2 6   ? 40.987 1.565   -0.389  1.00 16.17 ? 6    DT  T C2    1 
ATOM   3507 O  O2    . DT  B 2 6   ? 42.165 1.427   -0.656  1.00 19.39 ? 6    DT  T O2    1 
ATOM   3508 N  N3    . DT  B 2 6   ? 40.287 0.637   0.325   1.00 15.91 ? 6    DT  T N3    1 
ATOM   3509 C  C4    . DT  B 2 6   ? 38.956 0.699   0.675   1.00 18.04 ? 6    DT  T C4    1 
ATOM   3510 O  O4    . DT  B 2 6   ? 38.418 -0.183  1.331   1.00 19.23 ? 6    DT  T O4    1 
ATOM   3511 C  C5    . DT  B 2 6   ? 38.246 1.873   0.236   1.00 18.78 ? 6    DT  T C5    1 
ATOM   3512 C  C7    . DT  B 2 6   ? 36.786 2.012   0.575   1.00 21.90 ? 6    DT  T C7    1 
ATOM   3513 C  C6    . DT  B 2 6   ? 38.917 2.791   -0.473  1.00 18.74 ? 6    DT  T C6    1 
ATOM   3514 P  P     . DG  B 2 7   ? 42.110 4.630   -6.107  1.00 18.81 ? 7    DG  T P     1 
ATOM   3515 O  OP1   . DG  B 2 7   ? 43.288 5.355   -6.611  1.00 21.82 ? 7    DG  T OP1   1 
ATOM   3516 O  OP2   . DG  B 2 7   ? 40.795 4.753   -6.762  1.00 18.01 ? 7    DG  T OP2   1 
ATOM   3517 O  "O5'" . DG  B 2 7   ? 42.421 3.050   -6.077  1.00 21.24 ? 7    DG  T "O5'" 1 
ATOM   3518 C  "C5'" . DG  B 2 7   ? 43.745 2.589   -5.903  1.00 23.63 ? 7    DG  T "C5'" 1 
ATOM   3519 C  "C4'" . DG  B 2 7   ? 43.760 1.078   -5.751  1.00 16.27 ? 7    DG  T "C4'" 1 
ATOM   3520 O  "O4'" . DG  B 2 7   ? 43.045 0.721   -4.558  1.00 19.75 ? 7    DG  T "O4'" 1 
ATOM   3521 C  "C3'" . DG  B 2 7   ? 43.110 0.276   -6.882  1.00 22.59 ? 7    DG  T "C3'" 1 
ATOM   3522 O  "O3'" . DG  B 2 7   ? 44.166 -0.381  -7.545  1.00 22.08 ? 7    DG  T "O3'" 1 
ATOM   3523 C  "C2'" . DG  B 2 7   ? 42.193 -0.710  -6.166  1.00 23.50 ? 7    DG  T "C2'" 1 
ATOM   3524 C  "C1'" . DG  B 2 7   ? 42.638 -0.608  -4.712  1.00 23.71 ? 7    DG  T "C1'" 1 
ATOM   3525 N  N9    . DG  B 2 7   ? 41.554 -0.926  -3.791  1.00 18.72 ? 7    DG  T N9    1 
ATOM   3526 C  C8    . DG  B 2 7   ? 40.360 -0.269  -3.611  1.00 16.24 ? 7    DG  T C8    1 
ATOM   3527 N  N7    . DG  B 2 7   ? 39.590 -0.837  -2.717  1.00 16.18 ? 7    DG  T N7    1 
ATOM   3528 C  C5    . DG  B 2 7   ? 40.331 -1.946  -2.305  1.00 16.72 ? 7    DG  T C5    1 
ATOM   3529 C  C6    . DG  B 2 7   ? 40.030 -2.950  -1.358  1.00 17.32 ? 7    DG  T C6    1 
ATOM   3530 O  O6    . DG  B 2 7   ? 39.009 -3.048  -0.679  1.00 17.79 ? 7    DG  T O6    1 
ATOM   3531 N  N1    . DG  B 2 7   ? 41.053 -3.901  -1.246  1.00 13.48 ? 7    DG  T N1    1 
ATOM   3532 C  C2    . DG  B 2 7   ? 42.230 -3.872  -1.954  1.00 17.67 ? 7    DG  T C2    1 
ATOM   3533 N  N2    . DG  B 2 7   ? 43.111 -4.865  -1.719  1.00 18.87 ? 7    DG  T N2    1 
ATOM   3534 N  N3    . DG  B 2 7   ? 42.526 -2.929  -2.841  1.00 19.52 ? 7    DG  T N3    1 
ATOM   3535 C  C4    . DG  B 2 7   ? 41.530 -2.014  -2.957  1.00 17.53 ? 7    DG  T C4    1 
ATOM   3536 P  P     . DA  B 2 8   ? 43.888 -1.320  -8.819  1.00 19.92 ? 8    DA  T P     1 
ATOM   3537 O  OP1   . DA  B 2 8   ? 44.939 -1.055  -9.809  1.00 25.06 ? 8    DA  T OP1   1 
ATOM   3538 O  OP2   . DA  B 2 8   ? 42.447 -1.246  -9.166  1.00 22.52 ? 8    DA  T OP2   1 
ATOM   3539 O  "O5'" . DA  B 2 8   ? 44.162 -2.791  -8.260  1.00 22.84 ? 8    DA  T "O5'" 1 
ATOM   3540 C  "C5'" . DA  B 2 8   ? 45.439 -3.073  -7.677  1.00 18.49 ? 8    DA  T "C5'" 1 
ATOM   3541 C  "C4'" . DA  B 2 8   ? 45.506 -4.537  -7.281  1.00 19.67 ? 8    DA  T "C4'" 1 
ATOM   3542 O  "O4'" . DA  B 2 8   ? 44.655 -4.734  -6.130  1.00 24.73 ? 8    DA  T "O4'" 1 
ATOM   3543 C  "C3'" . DA  B 2 8   ? 45.029 -5.496  -8.373  1.00 23.06 ? 8    DA  T "C3'" 1 
ATOM   3544 O  "O3'" . DA  B 2 8   ? 45.895 -6.611  -8.408  1.00 20.95 ? 8    DA  T "O3'" 1 
ATOM   3545 C  "C2'" . DA  B 2 8   ? 43.629 -5.886  -7.917  1.00 23.93 ? 8    DA  T "C2'" 1 
ATOM   3546 C  "C1'" . DA  B 2 8   ? 43.715 -5.750  -6.398  1.00 24.92 ? 8    DA  T "C1'" 1 
ATOM   3547 N  N9    . DA  B 2 8   ? 42.416 -5.382  -5.850  1.00 23.88 ? 8    DA  T N9    1 
ATOM   3548 C  C8    . DA  B 2 8   ? 41.619 -4.356  -6.273  1.00 23.91 ? 8    DA  T C8    1 
ATOM   3549 N  N7    . DA  B 2 8   ? 40.493 -4.270  -5.615  1.00 18.29 ? 8    DA  T N7    1 
ATOM   3550 C  C5    . DA  B 2 8   ? 40.551 -5.306  -4.708  1.00 20.60 ? 8    DA  T C5    1 
ATOM   3551 C  C6    . DA  B 2 8   ? 39.652 -5.747  -3.721  1.00 18.62 ? 8    DA  T C6    1 
ATOM   3552 N  N6    . DA  B 2 8   ? 38.467 -5.167  -3.473  1.00 16.39 ? 8    DA  T N6    1 
ATOM   3553 N  N1    . DA  B 2 8   ? 40.022 -6.825  -2.989  1.00 19.26 ? 8    DA  T N1    1 
ATOM   3554 C  C2    . DA  B 2 8   ? 41.205 -7.401  -3.236  1.00 16.71 ? 8    DA  T C2    1 
ATOM   3555 N  N3    . DA  B 2 8   ? 42.135 -7.073  -4.130  1.00 16.83 ? 8    DA  T N3    1 
ATOM   3556 C  C4    . DA  B 2 8   ? 41.733 -6.008  -4.843  1.00 22.40 ? 8    DA  T C4    1 
ATOM   3557 P  P     . DC  B 2 9   ? 45.754 -7.723  -9.564  1.00 26.13 ? 9    DC  T P     1 
ATOM   3558 O  OP1   . DC  B 2 9   ? 47.110 -8.181  -9.912  1.00 29.37 ? 9    DC  T OP1   1 
ATOM   3559 O  OP2   . DC  B 2 9   ? 44.866 -7.192  -10.617 1.00 27.29 ? 9    DC  T OP2   1 
ATOM   3560 O  "O5'" . DC  B 2 9   ? 44.920 -8.888  -8.860  1.00 21.06 ? 9    DC  T "O5'" 1 
ATOM   3561 C  "C5'" . DC  B 2 9   ? 45.454 -9.550  -7.733  1.00 24.12 ? 9    DC  T "C5'" 1 
ATOM   3562 C  "C4'" . DC  B 2 9   ? 44.370 -10.401 -7.110  1.00 21.68 ? 9    DC  T "C4'" 1 
ATOM   3563 O  "O4'" . DC  B 2 9   ? 43.296 -9.564  -6.606  1.00 25.82 ? 9    DC  T "O4'" 1 
ATOM   3564 C  "C3'" . DC  B 2 9   ? 43.715 -11.387 -8.071  1.00 25.05 ? 9    DC  T "C3'" 1 
ATOM   3565 O  "O3'" . DC  B 2 9   ? 43.713 -12.623 -7.426  1.00 31.19 ? 9    DC  T "O3'" 1 
ATOM   3566 C  "C2'" . DC  B 2 9   ? 42.296 -10.863 -8.230  1.00 21.96 ? 9    DC  T "C2'" 1 
ATOM   3567 C  "C1'" . DC  B 2 9   ? 42.088 -10.241 -6.855  1.00 26.14 ? 9    DC  T "C1'" 1 
ATOM   3568 N  N1    . DC  B 2 9   ? 40.965 -9.287  -6.826  1.00 21.58 ? 9    DC  T N1    1 
ATOM   3569 C  C2    . DC  B 2 9   ? 40.024 -9.404  -5.809  1.00 18.90 ? 9    DC  T C2    1 
ATOM   3570 O  O2    . DC  B 2 9   ? 40.178 -10.302 -4.971  1.00 21.34 ? 9    DC  T O2    1 
ATOM   3571 N  N3    . DC  B 2 9   ? 38.984 -8.542  -5.778  1.00 20.12 ? 9    DC  T N3    1 
ATOM   3572 C  C4    . DC  B 2 9   ? 38.879 -7.595  -6.715  1.00 23.16 ? 9    DC  T C4    1 
ATOM   3573 N  N4    . DC  B 2 9   ? 37.840 -6.767  -6.646  1.00 22.41 ? 9    DC  T N4    1 
ATOM   3574 C  C5    . DC  B 2 9   ? 39.832 -7.461  -7.767  1.00 27.47 ? 9    DC  T C5    1 
ATOM   3575 C  C6    . DC  B 2 9   ? 40.854 -8.325  -7.784  1.00 25.16 ? 9    DC  T C6    1 
ATOM   3576 P  P     . DG  B 2 10  ? 43.410 -13.972 -8.245  1.00 28.14 ? 10   DG  T P     1 
ATOM   3577 O  OP1   . DG  B 2 10  ? 44.656 -14.761 -8.291  1.00 38.47 ? 10   DG  T OP1   1 
ATOM   3578 O  OP2   . DG  B 2 10  ? 42.706 -13.614 -9.490  1.00 27.80 ? 10   DG  T OP2   1 
ATOM   3579 O  "O5'" . DG  B 2 10  ? 42.352 -14.727 -7.325  1.00 25.50 ? 10   DG  T "O5'" 1 
ATOM   3580 C  "C5'" . DG  B 2 10  ? 42.507 -14.686 -5.929  1.00 24.35 ? 10   DG  T "C5'" 1 
ATOM   3581 C  "C4'" . DG  B 2 10  ? 41.320 -15.338 -5.255  1.00 27.59 ? 10   DG  T "C4'" 1 
ATOM   3582 O  "O4'" . DG  B 2 10  ? 40.263 -14.367 -5.046  1.00 30.03 ? 10   DG  T "O4'" 1 
ATOM   3583 C  "C3'" . DG  B 2 10  ? 40.697 -16.484 -6.040  1.00 30.46 ? 10   DG  T "C3'" 1 
ATOM   3584 O  "O3'" . DG  B 2 10  ? 40.219 -17.442 -5.092  1.00 36.37 ? 10   DG  T "O3'" 1 
ATOM   3585 C  "C2'" . DG  B 2 10  ? 39.590 -15.781 -6.824  1.00 30.87 ? 10   DG  T "C2'" 1 
ATOM   3586 C  "C1'" . DG  B 2 10  ? 39.145 -14.693 -5.852  1.00 29.74 ? 10   DG  T "C1'" 1 
ATOM   3587 N  N9    . DG  B 2 10  ? 38.633 -13.474 -6.490  1.00 23.04 ? 10   DG  T N9    1 
ATOM   3588 C  C8    . DG  B 2 10  ? 39.235 -12.665 -7.430  1.00 23.52 ? 10   DG  T C8    1 
ATOM   3589 N  N7    . DG  B 2 10  ? 38.503 -11.643 -7.786  1.00 20.25 ? 10   DG  T N7    1 
ATOM   3590 C  C5    . DG  B 2 10  ? 37.340 -11.792 -7.044  1.00 24.66 ? 10   DG  T C5    1 
ATOM   3591 C  C6    . DG  B 2 10  ? 36.170 -10.995 -7.002  1.00 21.69 ? 10   DG  T C6    1 
ATOM   3592 O  O6    . DG  B 2 10  ? 35.921 -9.962  -7.637  1.00 25.39 ? 10   DG  T O6    1 
ATOM   3593 N  N1    . DG  B 2 10  ? 35.239 -11.506 -6.099  1.00 25.78 ? 10   DG  T N1    1 
ATOM   3594 C  C2    . DG  B 2 10  ? 35.407 -12.645 -5.340  1.00 25.51 ? 10   DG  T C2    1 
ATOM   3595 N  N2    . DG  B 2 10  ? 34.395 -12.982 -4.529  1.00 27.01 ? 10   DG  T N2    1 
ATOM   3596 N  N3    . DG  B 2 10  ? 36.496 -13.403 -5.365  1.00 23.38 ? 10   DG  T N3    1 
ATOM   3597 C  C4    . DG  B 2 10  ? 37.414 -12.907 -6.234  1.00 21.86 ? 10   DG  T C4    1 
ATOM   3598 P  P     . DC  B 2 11  ? 39.426 -18.752 -5.585  1.00 39.97 ? 11   DC  T P     1 
ATOM   3599 O  OP1   . DC  B 2 11  ? 39.677 -19.830 -4.608  1.00 50.99 ? 11   DC  T OP1   1 
ATOM   3600 O  OP2   . DC  B 2 11  ? 39.729 -18.971 -7.011  1.00 27.81 ? 11   DC  T OP2   1 
ATOM   3601 O  "O5'" . DC  B 2 11  ? 37.898 -18.323 -5.470  1.00 28.77 ? 11   DC  T "O5'" 1 
ATOM   3602 C  "C5'" . DC  B 2 11  ? 37.276 -18.267 -4.206  1.00 30.25 ? 11   DC  T "C5'" 1 
ATOM   3603 C  "C4'" . DC  B 2 11  ? 35.777 -18.195 -4.407  1.00 27.42 ? 11   DC  T "C4'" 1 
ATOM   3604 O  "O4'" . DC  B 2 11  ? 35.430 -16.941 -5.041  1.00 24.17 ? 11   DC  T "O4'" 1 
ATOM   3605 C  "C3'" . DC  B 2 11  ? 35.181 -19.305 -5.276  1.00 18.12 ? 11   DC  T "C3'" 1 
ATOM   3606 O  "O3'" . DC  B 2 11  ? 34.133 -19.890 -4.508  1.00 20.29 ? 11   DC  T "O3'" 1 
ATOM   3607 C  "C2'" . DC  B 2 11  ? 34.687 -18.598 -6.546  1.00 18.56 ? 11   DC  T "C2'" 1 
ATOM   3608 C  "C1'" . DC  B 2 11  ? 34.486 -17.166 -6.073  1.00 27.26 ? 11   DC  T "C1'" 1 
ATOM   3609 N  N1    . DC  B 2 11  ? 34.729 -16.091 -7.080  1.00 15.92 ? 11   DC  T N1    1 
ATOM   3610 C  C2    . DC  B 2 11  ? 33.721 -15.151 -7.296  1.00 21.51 ? 11   DC  T C2    1 
ATOM   3611 O  O2    . DC  B 2 11  ? 32.651 -15.254 -6.680  1.00 18.99 ? 11   DC  T O2    1 
ATOM   3612 N  N3    . DC  B 2 11  ? 33.934 -14.156 -8.192  1.00 19.85 ? 11   DC  T N3    1 
ATOM   3613 C  C4    . DC  B 2 11  ? 35.100 -14.088 -8.840  1.00 20.15 ? 11   DC  T C4    1 
ATOM   3614 N  N4    . DC  B 2 11  ? 35.249 -13.076 -9.703  1.00 17.58 ? 11   DC  T N4    1 
ATOM   3615 C  C5    . DC  B 2 11  ? 36.151 -15.035 -8.622  1.00 19.44 ? 11   DC  T C5    1 
ATOM   3616 C  C6    . DC  B 2 11  ? 35.924 -16.017 -7.730  1.00 16.28 ? 11   DC  T C6    1 
ATOM   3617 P  P     . DT  B 2 12  ? 33.425 -21.251 -5.002  1.00 21.32 ? 12   DT  T P     1 
ATOM   3618 O  OP1   . DT  B 2 12  ? 32.852 -21.923 -3.820  1.00 22.75 ? 12   DT  T OP1   1 
ATOM   3619 O  OP2   . DT  B 2 12  ? 34.358 -21.964 -5.886  1.00 20.29 ? 12   DT  T OP2   1 
ATOM   3620 O  "O5'" . DT  B 2 12  ? 32.222 -20.725 -5.902  1.00 21.48 ? 12   DT  T "O5'" 1 
ATOM   3621 C  "C5'" . DT  B 2 12  ? 31.131 -20.170 -5.220  1.00 15.11 ? 12   DT  T "C5'" 1 
ATOM   3622 C  "C4'" . DT  B 2 12  ? 30.106 -19.689 -6.216  1.00 22.61 ? 12   DT  T "C4'" 1 
ATOM   3623 O  "O4'" . DT  B 2 12  ? 30.675 -18.563 -6.923  1.00 20.85 ? 12   DT  T "O4'" 1 
ATOM   3624 C  "C3'" . DT  B 2 12  ? 29.751 -20.744 -7.265  1.00 21.81 ? 12   DT  T "C3'" 1 
ATOM   3625 O  "O3'" . DT  B 2 12  ? 28.337 -20.804 -7.443  1.00 18.80 ? 12   DT  T "O3'" 1 
ATOM   3626 C  "C2'" . DT  B 2 12  ? 30.482 -20.258 -8.510  1.00 24.56 ? 12   DT  T "C2'" 1 
ATOM   3627 C  "C1'" . DT  B 2 12  ? 30.406 -18.752 -8.296  1.00 24.93 ? 12   DT  T "C1'" 1 
ATOM   3628 N  N1    . DT  B 2 12  ? 31.381 -17.948 -9.087  1.00 25.13 ? 12   DT  T N1    1 
ATOM   3629 C  C2    . DT  B 2 12  ? 31.000 -16.688 -9.486  1.00 22.73 ? 12   DT  T C2    1 
ATOM   3630 O  O2    . DT  B 2 12  ? 29.918 -16.197 -9.230  1.00 30.69 ? 12   DT  T O2    1 
ATOM   3631 N  N3    . DT  B 2 12  ? 31.937 -16.004 -10.201 1.00 23.25 ? 12   DT  T N3    1 
ATOM   3632 C  C4    . DT  B 2 12  ? 33.186 -16.447 -10.572 1.00 20.90 ? 12   DT  T C4    1 
ATOM   3633 O  O4    . DT  B 2 12  ? 33.934 -15.743 -11.240 1.00 24.00 ? 12   DT  T O4    1 
ATOM   3634 C  C5    . DT  B 2 12  ? 33.527 -17.775 -10.130 1.00 24.32 ? 12   DT  T C5    1 
ATOM   3635 C  C7    . DT  B 2 12  ? 34.864 -18.361 -10.464 1.00 20.91 ? 12   DT  T C7    1 
ATOM   3636 C  C6    . DT  B 2 12  ? 32.620 -18.458 -9.412  1.00 22.96 ? 12   DT  T C6    1 
ATOM   3637 O  "O5'" A DA  C 3 1   ? 29.015 -7.622  -15.213 0.50 32.57 ? 1    DA  P "O5'" 1 
ATOM   3638 O  "O5'" B DA  C 3 1   ? 29.394 -8.128  -15.662 0.50 32.64 ? 1    DA  P "O5'" 1 
ATOM   3639 C  "C5'" A DA  C 3 1   ? 27.704 -7.939  -15.675 0.50 28.78 ? 1    DA  P "C5'" 1 
ATOM   3640 C  "C5'" B DA  C 3 1   ? 27.989 -8.009  -15.846 0.50 28.54 ? 1    DA  P "C5'" 1 
ATOM   3641 C  "C4'" A DA  C 3 1   ? 26.911 -8.652  -14.597 0.50 27.98 ? 1    DA  P "C4'" 1 
ATOM   3642 C  "C4'" B DA  C 3 1   ? 27.224 -8.505  -14.629 0.50 27.83 ? 1    DA  P "C4'" 1 
ATOM   3643 O  "O4'" A DA  C 3 1   ? 27.492 -9.961  -14.387 0.50 32.00 ? 1    DA  P "O4'" 1 
ATOM   3644 O  "O4'" B DA  C 3 1   ? 27.545 -9.897  -14.400 0.50 31.98 ? 1    DA  P "O4'" 1 
ATOM   3645 C  "C3'" A DA  C 3 1   ? 26.862 -7.953  -13.237 0.50 25.28 ? 1    DA  P "C3'" 1 
ATOM   3646 C  "C3'" B DA  C 3 1   ? 27.477 -7.754  -13.322 0.50 23.05 ? 1    DA  P "C3'" 1 
ATOM   3647 O  "O3'" A DA  C 3 1   ? 25.513 -7.902  -12.746 0.50 21.24 ? 1    DA  P "O3'" 1 
ATOM   3648 O  "O3'" B DA  C 3 1   ? 26.257 -7.185  -12.891 0.50 27.01 ? 1    DA  P "O3'" 1 
ATOM   3649 C  "C2'" A DA  C 3 1   ? 27.804 -8.773  -12.346 0.50 27.04 ? 1    DA  P "C2'" 1 
ATOM   3650 C  "C2'" B DA  C 3 1   ? 27.923 -8.798  -12.305 0.50 27.06 ? 1    DA  P "C2'" 1 
ATOM   3651 C  "C1'" A DA  C 3 1   ? 27.933 -10.127 -13.053 0.50 27.34 ? 1    DA  P "C1'" 1 
ATOM   3652 C  "C1'" B DA  C 3 1   ? 27.950 -10.118 -13.064 0.50 27.35 ? 1    DA  P "C1'" 1 
ATOM   3653 N  N9    . DA  C 3 1   ? 29.289 -10.684 -13.108 1.00 27.86 ? 1    DA  P N9    1 
ATOM   3654 C  C8    . DA  C 3 1   ? 30.327 -10.278 -13.900 1.00 29.44 ? 1    DA  P C8    1 
ATOM   3655 N  N7    . DA  C 3 1   ? 31.426 -10.980 -13.730 1.00 29.42 ? 1    DA  P N7    1 
ATOM   3656 C  C5    . DA  C 3 1   ? 31.076 -11.908 -12.762 1.00 26.40 ? 1    DA  P C5    1 
ATOM   3657 C  C6    . DA  C 3 1   ? 31.792 -12.948 -12.141 1.00 25.29 ? 1    DA  P C6    1 
ATOM   3658 N  N6    . DA  C 3 1   ? 33.065 -13.221 -12.423 1.00 24.99 ? 1    DA  P N6    1 
ATOM   3659 N  N1    . DA  C 3 1   ? 31.149 -13.693 -11.219 1.00 27.09 ? 1    DA  P N1    1 
ATOM   3660 C  C2    . DA  C 3 1   ? 29.872 -13.418 -10.942 1.00 23.06 ? 1    DA  P C2    1 
ATOM   3661 N  N3    A DA  C 3 1   ? 29.094 -12.471 -11.459 0.50 25.25 ? 1    DA  P N3    1 
ATOM   3662 N  N3    B DA  C 3 1   ? 29.095 -12.468 -11.459 0.50 25.25 ? 1    DA  P N3    1 
ATOM   3663 C  C4    . DA  C 3 1   ? 29.765 -11.743 -12.369 1.00 22.62 ? 1    DA  P C4    1 
ATOM   3664 P  P     A DG  C 3 2   ? 25.016 -6.650  -11.864 0.50 18.61 ? 2    DG  P P     1 
ATOM   3665 P  P     B DG  C 3 2   ? 26.227 -6.187  -11.631 0.50 25.76 ? 2    DG  P P     1 
ATOM   3666 O  OP1   A DG  C 3 2   ? 23.547 -6.592  -11.938 0.50 22.29 ? 2    DG  P OP1   1 
ATOM   3667 O  OP1   B DG  C 3 2   ? 24.905 -5.520  -11.612 0.50 31.40 ? 2    DG  P OP1   1 
ATOM   3668 O  OP2   A DG  C 3 2   ? 25.822 -5.465  -12.253 0.50 25.03 ? 2    DG  P OP2   1 
ATOM   3669 O  OP2   B DG  C 3 2   ? 27.474 -5.396  -11.641 0.50 25.47 ? 2    DG  P OP2   1 
ATOM   3670 O  "O5'" A DG  C 3 2   ? 25.419 -7.057  -10.378 0.50 21.40 ? 2    DG  P "O5'" 1 
ATOM   3671 O  "O5'" B DG  C 3 2   ? 26.327 -7.166  -10.375 0.50 23.79 ? 2    DG  P "O5'" 1 
ATOM   3672 C  "C5'" A DG  C 3 2   ? 24.755 -8.132  -9.735  0.50 27.26 ? 2    DG  P "C5'" 1 
ATOM   3673 C  "C5'" B DG  C 3 2   ? 25.206 -7.900  -9.933  0.50 26.51 ? 2    DG  P "C5'" 1 
ATOM   3674 C  "C4'" A DG  C 3 2   ? 25.574 -8.680  -8.577  0.50 24.56 ? 2    DG  P "C4'" 1 
ATOM   3675 C  "C4'" B DG  C 3 2   ? 25.598 -8.606  -8.652  0.50 24.56 ? 2    DG  P "C4'" 1 
ATOM   3676 O  "O4'" A DG  C 3 2   ? 26.823 -9.251  -9.043  0.50 20.85 ? 2    DG  P "O4'" 1 
ATOM   3677 O  "O4'" B DG  C 3 2   ? 26.776 -9.408  -8.925  0.50 20.88 ? 2    DG  P "O4'" 1 
ATOM   3678 C  "C3'" A DG  C 3 2   ? 25.948 -7.688  -7.476  0.50 24.86 ? 2    DG  P "C3'" 1 
ATOM   3679 C  "C3'" B DG  C 3 2   ? 25.955 -7.680  -7.489  0.50 24.86 ? 2    DG  P "C3'" 1 
ATOM   3680 O  "O3'" A DG  C 3 2   ? 25.358 -8.209  -6.303  0.50 26.02 ? 2    DG  P "O3'" 1 
ATOM   3681 O  "O3'" B DG  C 3 2   ? 25.361 -8.210  -6.307  0.50 26.01 ? 2    DG  P "O3'" 1 
ATOM   3682 C  "C2'" A DG  C 3 2   ? 27.481 -7.715  -7.441  0.50 23.51 ? 2    DG  P "C2'" 1 
ATOM   3683 C  "C2'" B DG  C 3 2   ? 27.486 -7.708  -7.468  0.50 23.50 ? 2    DG  P "C2'" 1 
ATOM   3684 C  "C1'" A DG  C 3 2   ? 27.783 -9.093  -8.019  0.50 22.11 ? 2    DG  P "C1'" 1 
ATOM   3685 C  "C1'" B DG  C 3 2   ? 27.790 -9.110  -7.989  0.50 22.09 ? 2    DG  P "C1'" 1 
ATOM   3686 N  N9    . DG  C 3 2   ? 29.113 -9.256  -8.611  1.00 23.32 ? 2    DG  P N9    1 
ATOM   3687 C  C8    . DG  C 3 2   ? 29.777 -8.387  -9.447  1.00 25.21 ? 2    DG  P C8    1 
ATOM   3688 N  N7    . DG  C 3 2   ? 30.956 -8.814  -9.820  1.00 21.74 ? 2    DG  P N7    1 
ATOM   3689 C  C5    . DG  C 3 2   ? 31.087 -10.053 -9.195  1.00 20.17 ? 2    DG  P C5    1 
ATOM   3690 C  C6    . DG  C 3 2   ? 32.142 -11.002 -9.208  1.00 18.28 ? 2    DG  P C6    1 
ATOM   3691 O  O6    . DG  C 3 2   ? 33.227 -10.954 -9.805  1.00 21.78 ? 2    DG  P O6    1 
ATOM   3692 N  N1    . DG  C 3 2   ? 31.849 -12.120 -8.430  1.00 21.28 ? 2    DG  P N1    1 
ATOM   3693 C  C2    . DG  C 3 2   ? 30.688 -12.297 -7.728  1.00 19.63 ? 2    DG  P C2    1 
ATOM   3694 N  N2    . DG  C 3 2   ? 30.571 -13.438 -7.029  1.00 26.04 ? 2    DG  P N2    1 
ATOM   3695 N  N3    . DG  C 3 2   ? 29.697 -11.421 -7.704  1.00 26.34 ? 2    DG  P N3    1 
ATOM   3696 C  C4    . DG  C 3 2   ? 29.963 -10.328 -8.454  1.00 21.80 ? 2    DG  P C4    1 
ATOM   3697 P  P     . DC  C 3 3   ? 25.490 -7.436  -4.900  1.00 30.02 ? 3    DC  P P     1 
ATOM   3698 O  OP1   . DC  C 3 3   ? 24.177 -7.487  -4.230  1.00 36.61 ? 3    DC  P OP1   1 
ATOM   3699 O  OP2   . DC  C 3 3   ? 26.190 -6.158  -5.136  1.00 32.08 ? 3    DC  P OP2   1 
ATOM   3700 O  "O5'" . DC  C 3 3   ? 26.504 -8.348  -4.068  1.00 39.18 ? 3    DC  P "O5'" 1 
ATOM   3701 C  "C5'" . DC  C 3 3   ? 26.231 -9.732  -3.898  1.00 41.48 ? 3    DC  P "C5'" 1 
ATOM   3702 C  "C4'" . DC  C 3 3   ? 27.483 -10.454 -3.442  1.00 38.95 ? 3    DC  P "C4'" 1 
ATOM   3703 O  "O4'" . DC  C 3 3   ? 28.461 -10.404 -4.509  1.00 38.17 ? 3    DC  P "O4'" 1 
ATOM   3704 C  "C3'" . DC  C 3 3   ? 28.144 -9.840  -2.205  1.00 34.53 ? 3    DC  P "C3'" 1 
ATOM   3705 O  "O3'" . DC  C 3 3   ? 28.023 -10.719 -1.094  1.00 41.04 ? 3    DC  P "O3'" 1 
ATOM   3706 C  "C2'" . DC  C 3 3   ? 29.606 -9.638  -2.589  1.00 34.62 ? 3    DC  P "C2'" 1 
ATOM   3707 C  "C1'" . DC  C 3 3   ? 29.738 -10.393 -3.907  1.00 37.03 ? 3    DC  P "C1'" 1 
ATOM   3708 N  N1    . DC  C 3 3   ? 30.711 -9.726  -4.803  1.00 29.07 ? 3    DC  P N1    1 
ATOM   3709 C  C2    . DC  C 3 3   ? 31.884 -10.412 -5.098  1.00 18.99 ? 3    DC  P C2    1 
ATOM   3710 O  O2    . DC  C 3 3   ? 32.040 -11.538 -4.617  1.00 27.97 ? 3    DC  P O2    1 
ATOM   3711 N  N3    . DC  C 3 3   ? 32.801 -9.831  -5.901  1.00 25.97 ? 3    DC  P N3    1 
ATOM   3712 C  C4    . DC  C 3 3   ? 32.575 -8.615  -6.390  1.00 25.04 ? 3    DC  P C4    1 
ATOM   3713 N  N4    . DC  C 3 3   ? 33.519 -8.087  -7.176  1.00 23.20 ? 3    DC  P N4    1 
ATOM   3714 C  C5    . DC  C 3 3   ? 31.379 -7.891  -6.092  1.00 28.58 ? 3    DC  P C5    1 
ATOM   3715 C  C6    . DC  C 3 3   ? 30.480 -8.478  -5.291  1.00 28.64 ? 3    DC  P C6    1 
ATOM   3716 P  P     . DG  C 3 4   ? 28.606 -10.295 0.344   1.00 40.76 ? 4    DG  P P     1 
ATOM   3717 O  OP1   . DG  C 3 4   ? 27.854 -11.041 1.375   1.00 46.19 ? 4    DG  P OP1   1 
ATOM   3718 O  OP2   . DG  C 3 4   ? 28.666 -8.812  0.400   1.00 31.65 ? 4    DG  P OP2   1 
ATOM   3719 O  "O5'" . DG  C 3 4   ? 30.115 -10.840 0.312   1.00 34.97 ? 4    DG  P "O5'" 1 
ATOM   3720 C  "C5'" . DG  C 3 4   ? 30.338 -12.222 0.067   1.00 34.22 ? 4    DG  P "C5'" 1 
ATOM   3721 C  "C4'" . DG  C 3 4   ? 31.821 -12.543 0.120   1.00 42.77 ? 4    DG  P "C4'" 1 
ATOM   3722 O  "O4'" . DG  C 3 4   ? 32.493 -11.943 -1.017  1.00 39.46 ? 4    DG  P "O4'" 1 
ATOM   3723 C  "C3'" . DG  C 3 4   ? 32.520 -12.028 1.377   1.00 34.25 ? 4    DG  P "C3'" 1 
ATOM   3724 O  "O3'" . DG  C 3 4   ? 33.269 -13.094 1.964   1.00 41.06 ? 4    DG  P "O3'" 1 
ATOM   3725 C  "C2'" . DG  C 3 4   ? 33.387 -10.875 0.872   1.00 29.22 ? 4    DG  P "C2'" 1 
ATOM   3726 C  "C1'" . DG  C 3 4   ? 33.656 -11.275 -0.573  1.00 29.11 ? 4    DG  P "C1'" 1 
ATOM   3727 N  N9    . DG  C 3 4   ? 33.892 -10.162 -1.489  1.00 24.83 ? 4    DG  P N9    1 
ATOM   3728 C  C8    . DG  C 3 4   ? 33.070 -9.092  -1.772  1.00 26.38 ? 4    DG  P C8    1 
ATOM   3729 N  N7    . DG  C 3 4   ? 33.573 -8.269  -2.661  1.00 27.07 ? 4    DG  P N7    1 
ATOM   3730 C  C5    . DG  C 3 4   ? 34.804 -8.830  -2.982  1.00 20.51 ? 4    DG  P C5    1 
ATOM   3731 C  C6    . DG  C 3 4   ? 35.803 -8.404  -3.878  1.00 22.20 ? 4    DG  P C6    1 
ATOM   3732 O  O6    . DG  C 3 4   ? 35.816 -7.394  -4.602  1.00 27.75 ? 4    DG  P O6    1 
ATOM   3733 N  N1    . DG  C 3 4   ? 36.887 -9.281  -3.886  1.00 21.66 ? 4    DG  P N1    1 
ATOM   3734 C  C2    . DG  C 3 4   ? 36.988 -10.427 -3.136  1.00 20.86 ? 4    DG  P C2    1 
ATOM   3735 N  N2    . DG  C 3 4   ? 38.105 -11.154 -3.275  1.00 20.17 ? 4    DG  P N2    1 
ATOM   3736 N  N3    . DG  C 3 4   ? 36.059 -10.841 -2.296  1.00 26.54 ? 4    DG  P N3    1 
ATOM   3737 C  C4    . DG  C 3 4   ? 35.004 -9.995  -2.274  1.00 24.57 ? 4    DG  P C4    1 
ATOM   3738 P  P     . DT  C 3 5   ? 33.988 -12.889 3.388   1.00 42.57 ? 5    DT  P P     1 
ATOM   3739 O  OP1   . DT  C 3 5   ? 33.831 -14.138 4.164   1.00 39.33 ? 5    DT  P OP1   1 
ATOM   3740 O  OP2   . DT  C 3 5   ? 33.537 -11.600 3.949   1.00 31.14 ? 5    DT  P OP2   1 
ATOM   3741 O  "O5'" . DT  C 3 5   ? 35.527 -12.688 2.999   1.00 33.71 ? 5    DT  P "O5'" 1 
ATOM   3742 C  "C5'" . DT  C 3 5   ? 36.128 -13.573 2.080   1.00 27.98 ? 5    DT  P "C5'" 1 
ATOM   3743 C  "C4'" . DT  C 3 5   ? 37.541 -13.114 1.775   1.00 25.06 ? 5    DT  P "C4'" 1 
ATOM   3744 O  "O4'" . DT  C 3 5   ? 37.541 -12.064 0.778   1.00 20.45 ? 5    DT  P "O4'" 1 
ATOM   3745 C  "C3'" . DT  C 3 5   ? 38.326 -12.587 2.971   1.00 18.57 ? 5    DT  P "C3'" 1 
ATOM   3746 O  "O3'" . DT  C 3 5   ? 39.493 -13.399 3.050   1.00 20.47 ? 5    DT  P "O3'" 1 
ATOM   3747 C  "C2'" . DT  C 3 5   ? 38.649 -11.124 2.623   1.00 15.00 ? 5    DT  P "C2'" 1 
ATOM   3748 C  "C1'" . DT  C 3 5   ? 38.552 -11.121 1.102   1.00 18.71 ? 5    DT  P "C1'" 1 
ATOM   3749 N  N1    . DT  C 3 5   ? 38.125 -9.842  0.466   1.00 17.75 ? 5    DT  P N1    1 
ATOM   3750 C  C2    . DT  C 3 5   ? 38.944 -9.271  -0.478  1.00 18.04 ? 5    DT  P C2    1 
ATOM   3751 O  O2    . DT  C 3 5   ? 40.012 -9.744  -0.811  1.00 17.87 ? 5    DT  P O2    1 
ATOM   3752 N  N3    . DT  C 3 5   ? 38.469 -8.111  -1.023  1.00 17.75 ? 5    DT  P N3    1 
ATOM   3753 C  C4    . DT  C 3 5   ? 37.277 -7.483  -0.736  1.00 16.15 ? 5    DT  P C4    1 
ATOM   3754 O  O4    . DT  C 3 5   ? 36.959 -6.429  -1.291  1.00 16.67 ? 5    DT  P O4    1 
ATOM   3755 C  C5    . DT  C 3 5   ? 36.461 -8.131  0.265   1.00 20.43 ? 5    DT  P C5    1 
ATOM   3756 C  C7    . DT  C 3 5   ? 35.146 -7.536  0.675   1.00 21.77 ? 5    DT  P C7    1 
ATOM   3757 C  C6    . DT  C 3 5   ? 36.919 -9.269  0.817   1.00 22.37 ? 5    DT  P C6    1 
ATOM   3758 P  P     . DC  C 3 6   ? 40.476 -13.289 4.314   1.00 16.05 ? 6    DC  P P     1 
ATOM   3759 O  OP1   . DC  C 3 6   ? 41.199 -14.588 4.436   1.00 18.69 ? 6    DC  P OP1   1 
ATOM   3760 O  OP2   . DC  C 3 6   ? 39.718 -12.722 5.427   1.00 15.63 ? 6    DC  P OP2   1 
ATOM   3761 O  "O5'" . DC  C 3 6   ? 41.523 -12.159 3.882   1.00 15.53 ? 6    DC  P "O5'" 1 
ATOM   3762 C  "C5'" . DC  C 3 6   ? 42.434 -12.375 2.829   1.00 13.27 ? 6    DC  P "C5'" 1 
ATOM   3763 C  "C4'" . DC  C 3 6   ? 43.143 -11.065 2.524   1.00 17.88 ? 6    DC  P "C4'" 1 
ATOM   3764 O  "O4'" . DC  C 3 6   ? 42.238 -10.161 1.849   1.00 16.63 ? 6    DC  P "O4'" 1 
ATOM   3765 C  "C3'" . DC  C 3 6   ? 43.674 -10.300 3.735   1.00 13.86 ? 6    DC  P "C3'" 1 
ATOM   3766 O  "O3'" . DC  C 3 6   ? 45.091 -10.509 3.725   1.00 14.47 ? 6    DC  P "O3'" 1 
ATOM   3767 C  "C2'" . DC  C 3 6   ? 43.213 -8.845  3.492   1.00 13.36 ? 6    DC  P "C2'" 1 
ATOM   3768 C  "C1'" . DC  C 3 6   ? 42.721 -8.858  2.048   1.00 13.75 ? 6    DC  P "C1'" 1 
ATOM   3769 N  N1    . DC  C 3 6   ? 41.609 -7.904  1.836   1.00 12.61 ? 6    DC  P N1    1 
ATOM   3770 C  C2    . DC  C 3 6   ? 41.678 -6.970  0.796   1.00 17.49 ? 6    DC  P C2    1 
ATOM   3771 O  O2    . DC  C 3 6   ? 42.660 -6.983  0.034   1.00 15.64 ? 6    DC  P O2    1 
ATOM   3772 N  N3    . DC  C 3 6   ? 40.645 -6.100  0.636   1.00 15.63 ? 6    DC  P N3    1 
ATOM   3773 C  C4    . DC  C 3 6   ? 39.606 -6.130  1.476   1.00 18.08 ? 6    DC  P C4    1 
ATOM   3774 N  N4    . DC  C 3 6   ? 38.622 -5.250  1.275   1.00 17.98 ? 6    DC  P N4    1 
ATOM   3775 C  C5    . DC  C 3 6   ? 39.518 -7.067  2.544   1.00 16.88 ? 6    DC  P C5    1 
ATOM   3776 C  C6    . DC  C 3 6   ? 40.533 -7.928  2.686   1.00 15.96 ? 6    DC  P C6    1 
ATOM   3777 P  P     . DA  C 3 7   ? 46.052 -9.696  4.724   1.00 14.84 ? 7    DA  P P     1 
ATOM   3778 O  OP1   . DA  C 3 7   ? 47.290 -10.485 4.909   1.00 15.67 ? 7    DA  P OP1   1 
ATOM   3779 O  OP2   . DA  C 3 7   ? 45.271 -9.321  5.918   1.00 15.47 ? 7    DA  P OP2   1 
ATOM   3780 O  "O5'" A DA  C 3 7   ? 46.339 -8.321  3.956   0.50 16.57 ? 7    DA  P "O5'" 1 
ATOM   3781 O  "O5'" B DA  C 3 7   ? 46.364 -8.336  3.936   0.50 16.57 ? 7    DA  P "O5'" 1 
ATOM   3782 C  "C5'" A DA  C 3 7   ? 47.033 -8.260  2.724   0.50 20.37 ? 7    DA  P "C5'" 1 
ATOM   3783 C  "C5'" B DA  C 3 7   ? 46.922 -8.333  2.626   0.50 20.29 ? 7    DA  P "C5'" 1 
ATOM   3784 C  "C4'" A DA  C 3 7   ? 46.961 -6.836  2.194   0.50 24.75 ? 7    DA  P "C4'" 1 
ATOM   3785 C  "C4'" B DA  C 3 7   ? 46.938 -6.912  2.082   0.50 24.74 ? 7    DA  P "C4'" 1 
ATOM   3786 O  "O4'" A DA  C 3 7   ? 45.595 -6.531  1.827   0.50 22.07 ? 7    DA  P "O4'" 1 
ATOM   3787 O  "O4'" B DA  C 3 7   ? 45.603 -6.527  1.665   0.50 22.11 ? 7    DA  P "O4'" 1 
ATOM   3788 C  "C3'" A DA  C 3 7   ? 47.292 -5.719  3.179   0.50 22.62 ? 7    DA  P "C3'" 1 
ATOM   3789 C  "C3'" B DA  C 3 7   ? 47.287 -5.826  3.098   0.50 22.57 ? 7    DA  P "C3'" 1 
ATOM   3790 O  "O3'" A DA  C 3 7   ? 48.700 -5.512  3.305   0.50 29.93 ? 7    DA  P "O3'" 1 
ATOM   3791 O  "O3'" B DA  C 3 7   ? 48.694 -5.828  3.506   0.50 29.81 ? 7    DA  P "O3'" 1 
ATOM   3792 C  "C2'" A DA  C 3 7   ? 46.627 -4.513  2.525   0.50 20.61 ? 7    DA  P "C2'" 1 
ATOM   3793 C  "C2'" B DA  C 3 7   ? 46.731 -4.559  2.437   0.50 20.62 ? 7    DA  P "C2'" 1 
ATOM   3794 C  "C1'" A DA  C 3 7   ? 45.505 -5.129  1.698   0.50 22.50 ? 7    DA  P "C1'" 1 
ATOM   3795 C  "C1'" B DA  C 3 7   ? 45.520 -5.111  1.669   0.50 22.50 ? 7    DA  P "C1'" 1 
ATOM   3796 N  N9    . DA  C 3 7   ? 44.191 -4.687  2.142   1.00 15.88 ? 7    DA  P N9    1 
ATOM   3797 C  C8    . DA  C 3 7   ? 43.377 -5.268  3.079   1.00 17.72 ? 7    DA  P C8    1 
ATOM   3798 N  N7    . DA  C 3 7   ? 42.243 -4.618  3.262   1.00 16.89 ? 7    DA  P N7    1 
ATOM   3799 C  C5    . DA  C 3 7   ? 42.326 -3.546  2.389   1.00 17.71 ? 7    DA  P C5    1 
ATOM   3800 C  C6    . DA  C 3 7   ? 41.451 -2.478  2.095   1.00 17.48 ? 7    DA  P C6    1 
ATOM   3801 N  N6    . DA  C 3 7   ? 40.267 -2.326  2.683   1.00 18.68 ? 7    DA  P N6    1 
ATOM   3802 N  N1    . DA  C 3 7   ? 41.850 -1.576  1.177   1.00 14.31 ? 7    DA  P N1    1 
ATOM   3803 C  C2    . DA  C 3 7   ? 43.041 -1.742  0.596   1.00 19.47 ? 7    DA  P C2    1 
ATOM   3804 N  N3    . DA  C 3 7   ? 43.946 -2.698  0.792   1.00 16.45 ? 7    DA  P N3    1 
ATOM   3805 C  C4    . DA  C 3 7   ? 43.519 -3.575  1.704   1.00 17.77 ? 7    DA  P C4    1 
ATOM   3806 P  P     A DT  C 3 8   ? 49.266 -4.257  4.141   0.50 20.46 ? 8    DT  P P     1 
ATOM   3807 P  P     B DT  C 3 8   ? 49.836 -5.169  2.576   0.50 26.10 ? 8    DT  P P     1 
ATOM   3808 O  OP1   A DT  C 3 8   ? 50.731 -4.438  4.307   0.50 22.14 ? 8    DT  P OP1   1 
ATOM   3809 O  OP1   B DT  C 3 8   ? 49.735 -5.764  1.237   0.50 24.13 ? 8    DT  P OP1   1 
ATOM   3810 O  OP2   A DT  C 3 8   ? 48.399 -4.066  5.331   0.50 19.12 ? 8    DT  P OP2   1 
ATOM   3811 O  OP2   B DT  C 3 8   ? 51.111 -5.232  3.318   0.50 28.11 ? 8    DT  P OP2   1 
ATOM   3812 O  "O5'" A DT  C 3 8   ? 49.015 -3.007  3.170   0.50 23.90 ? 8    DT  P "O5'" 1 
ATOM   3813 O  "O5'" B DT  C 3 8   ? 49.423 -3.629  2.514   0.50 24.16 ? 8    DT  P "O5'" 1 
ATOM   3814 C  "C5'" A DT  C 3 8   ? 49.576 -2.861  1.851   0.50 21.54 ? 8    DT  P "C5'" 1 
ATOM   3815 C  "C5'" B DT  C 3 8   ? 49.742 -2.885  1.368   0.50 20.03 ? 8    DT  P "C5'" 1 
ATOM   3816 C  "C4'" . DT  C 3 8   ? 49.227 -1.451  1.425   1.00 19.00 ? 8    DT  P "C4'" 1 
ATOM   3817 O  "O4'" . DT  C 3 8   ? 47.799 -1.372  1.624   1.00 19.62 ? 8    DT  P "O4'" 1 
ATOM   3818 C  "C3'" . DT  C 3 8   ? 49.839 -0.473  2.420   1.00 21.44 ? 8    DT  P "C3'" 1 
ATOM   3819 O  "O3'" . DT  C 3 8   ? 50.514 0.526   1.678   1.00 17.36 ? 8    DT  P "O3'" 1 
ATOM   3820 C  "C2'" . DT  C 3 8   ? 48.649 0.095   3.211   1.00 20.20 ? 8    DT  P "C2'" 1 
ATOM   3821 C  "C1'" . DT  C 3 8   ? 47.484 -0.156  2.258   1.00 21.12 ? 8    DT  P "C1'" 1 
ATOM   3822 N  N1    . DT  C 3 8   ? 46.174 -0.333  2.929   1.00 15.43 ? 8    DT  P N1    1 
ATOM   3823 C  C2    . DT  C 3 8   ? 45.172 0.580   2.666   1.00 18.66 ? 8    DT  P C2    1 
ATOM   3824 O  O2    . DT  C 3 8   ? 45.315 1.511   1.908   1.00 18.43 ? 8    DT  P O2    1 
ATOM   3825 N  N3    . DT  C 3 8   ? 43.993 0.354   3.322   1.00 17.21 ? 8    DT  P N3    1 
ATOM   3826 C  C4    . DT  C 3 8   ? 43.730 -0.685  4.191   1.00 15.51 ? 8    DT  P C4    1 
ATOM   3827 O  O4    . DT  C 3 8   ? 42.651 -0.815  4.748   1.00 16.57 ? 8    DT  P O4    1 
ATOM   3828 C  C5    . DT  C 3 8   ? 44.822 -1.595  4.427   1.00 19.59 ? 8    DT  P C5    1 
ATOM   3829 C  C7    . DT  C 3 8   ? 44.646 -2.757  5.360   1.00 19.08 ? 8    DT  P C7    1 
ATOM   3830 C  C6    . DT  C 3 8   ? 45.977 -1.382  3.791   1.00 17.06 ? 8    DT  P C6    1 
HETATM 3831 NA NA    . NA  D 4 .   ? 52.865 0.590   1.758   1.00 21.05 ? 502  NA  A NA    1 
HETATM 3832 CA CA    . CA  E 5 .   ? 54.948 2.665   3.661   1.00 12.35 ? 503  CA  A CA    1 
HETATM 3833 C  C1    . GOL F 6 .   ? 60.612 -24.936 12.257  1.00 17.20 ? 504  GOL A C1    1 
HETATM 3834 O  O1    . GOL F 6 .   ? 59.204 -24.886 12.338  1.00 15.44 ? 504  GOL A O1    1 
HETATM 3835 C  C2    . GOL F 6 .   ? 61.119 -24.386 10.915  1.00 17.84 ? 504  GOL A C2    1 
HETATM 3836 O  O2    . GOL F 6 .   ? 60.655 -23.080 10.651  1.00 16.07 ? 504  GOL A O2    1 
HETATM 3837 C  C3    . GOL F 6 .   ? 60.808 -25.309 9.737   1.00 18.13 ? 504  GOL A C3    1 
HETATM 3838 O  O3    . GOL F 6 .   ? 61.585 -24.895 8.624   1.00 15.56 ? 504  GOL A O3    1 
HETATM 3839 C  C1    . GOL G 6 .   ? 54.113 16.845  -7.063  1.00 33.10 ? 505  GOL A C1    1 
HETATM 3840 O  O1    . GOL G 6 .   ? 54.131 15.534  -6.541  1.00 21.38 ? 505  GOL A O1    1 
HETATM 3841 C  C2    . GOL G 6 .   ? 54.824 16.829  -8.414  1.00 32.39 ? 505  GOL A C2    1 
HETATM 3842 O  O2    . GOL G 6 .   ? 53.911 16.441  -9.412  1.00 30.04 ? 505  GOL A O2    1 
HETATM 3843 C  C3    . GOL G 6 .   ? 55.387 18.208  -8.749  1.00 27.71 ? 505  GOL A C3    1 
HETATM 3844 O  O3    . GOL G 6 .   ? 56.082 18.127  -9.975  1.00 36.88 ? 505  GOL A O3    1 
HETATM 3845 C  C1    . GOL H 6 .   ? 54.681 28.432  4.630   1.00 31.83 ? 506  GOL A C1    1 
HETATM 3846 O  O1    . GOL H 6 .   ? 53.386 28.147  4.134   1.00 33.02 ? 506  GOL A O1    1 
HETATM 3847 C  C2    . GOL H 6 .   ? 55.073 27.376  5.665   1.00 40.77 ? 506  GOL A C2    1 
HETATM 3848 O  O2    . GOL H 6 .   ? 54.347 26.192  5.426   1.00 40.83 ? 506  GOL A O2    1 
HETATM 3849 C  C3    . GOL H 6 .   ? 56.562 27.063  5.560   1.00 37.86 ? 506  GOL A C3    1 
HETATM 3850 O  O3    . GOL H 6 .   ? 56.941 26.125  6.553   1.00 28.63 ? 506  GOL A O3    1 
HETATM 3851 P  PG    . DTP I 7 .   ? 55.300 2.655   7.182   1.00 12.00 ? 501  DTP P PG    1 
HETATM 3852 O  O1G   . DTP I 7 .   ? 54.981 1.765   8.358   1.00 14.10 ? 501  DTP P O1G   1 
HETATM 3853 O  O2G   . DTP I 7 .   ? 56.587 3.432   7.326   1.00 10.75 ? 501  DTP P O2G   1 
HETATM 3854 O  O3G   . DTP I 7 .   ? 55.193 1.916   5.878   1.00 11.41 ? 501  DTP P O3G   1 
HETATM 3855 P  PB    . DTP I 7 .   ? 53.144 4.225   6.062   1.00 11.31 ? 501  DTP P PB    1 
HETATM 3856 O  O1B   . DTP I 7 .   ? 53.916 4.405   4.784   1.00 8.19  ? 501  DTP P O1B   1 
HETATM 3857 O  O2B   . DTP I 7 .   ? 52.314 5.377   6.571   1.00 11.69 ? 501  DTP P O2B   1 
HETATM 3858 O  O3B   . DTP I 7 .   ? 54.108 3.764   7.273   1.00 11.93 ? 501  DTP P O3B   1 
HETATM 3859 P  PA    . DTP I 7 .   ? 51.632 2.098   4.724   1.00 11.68 ? 501  DTP P PA    1 
HETATM 3860 O  O1A   . DTP I 7 .   ? 50.773 0.979   5.302   1.00 13.60 ? 501  DTP P O1A   1 
HETATM 3861 O  O2A   . DTP I 7 .   ? 52.738 1.710   3.813   1.00 11.53 ? 501  DTP P O2A   1 
HETATM 3862 O  O3A   . DTP I 7 .   ? 52.181 2.918   6.015   1.00 14.84 ? 501  DTP P O3A   1 
HETATM 3863 O  "O5'" . DTP I 7 .   ? 50.621 3.045   3.931   1.00 9.57  ? 501  DTP P "O5'" 1 
HETATM 3864 C  "C5'" . DTP I 7 .   ? 51.082 4.033   3.024   1.00 9.16  ? 501  DTP P "C5'" 1 
HETATM 3865 C  "C4'" . DTP I 7 .   ? 50.143 5.232   3.047   1.00 12.65 ? 501  DTP P "C4'" 1 
HETATM 3866 O  "O4'" . DTP I 7 .   ? 48.818 4.862   2.649   1.00 13.66 ? 501  DTP P "O4'" 1 
HETATM 3867 C  "C3'" . DTP I 7 .   ? 49.996 5.853   4.425   1.00 12.76 ? 501  DTP P "C3'" 1 
HETATM 3868 O  "O3'" . DTP I 7 .   ? 51.002 6.860   4.612   1.00 9.14  ? 501  DTP P "O3'" 1 
HETATM 3869 C  "C2'" . DTP I 7 .   ? 48.586 6.434   4.395   1.00 9.01  ? 501  DTP P "C2'" 1 
HETATM 3870 C  "C1'" . DTP I 7 .   ? 47.821 5.493   3.467   1.00 10.95 ? 501  DTP P "C1'" 1 
HETATM 3871 N  N9    . DTP I 7 .   ? 47.093 4.441   4.231   1.00 13.69 ? 501  DTP P N9    1 
HETATM 3872 C  C8    . DTP I 7 .   ? 47.599 3.284   4.694   1.00 11.24 ? 501  DTP P C8    1 
HETATM 3873 N  N7    . DTP I 7 .   ? 46.610 2.597   5.330   1.00 12.71 ? 501  DTP P N7    1 
HETATM 3874 C  C5    . DTP I 7 .   ? 45.480 3.343   5.260   1.00 14.93 ? 501  DTP P C5    1 
HETATM 3875 C  C6    . DTP I 7 .   ? 44.173 3.175   5.722   1.00 16.38 ? 501  DTP P C6    1 
HETATM 3876 N  N6    . DTP I 7 .   ? 43.829 2.059   6.404   1.00 18.25 ? 501  DTP P N6    1 
HETATM 3877 N  N1    . DTP I 7 .   ? 43.241 4.135   5.493   1.00 15.63 ? 501  DTP P N1    1 
HETATM 3878 C  C2    . DTP I 7 .   ? 43.585 5.240   4.816   1.00 13.46 ? 501  DTP P C2    1 
HETATM 3879 N  N3    . DTP I 7 .   ? 44.838 5.428   4.357   1.00 14.36 ? 501  DTP P N3    1 
HETATM 3880 C  C4    . DTP I 7 .   ? 45.797 4.495   4.567   1.00 12.64 ? 501  DTP P C4    1 
HETATM 3881 O  O     . HOH J 8 .   ? 64.124 -3.358  6.069   1.00 10.39 ? 601  HOH A O     1 
HETATM 3882 O  O     . HOH J 8 .   ? 57.904 -23.554 14.192  1.00 11.19 ? 602  HOH A O     1 
HETATM 3883 O  O     . HOH J 8 .   ? 56.484 -13.882 -5.898  1.00 10.56 ? 603  HOH A O     1 
HETATM 3884 O  O     . HOH J 8 .   ? 51.835 5.743   9.231   1.00 11.12 ? 604  HOH A O     1 
HETATM 3885 O  O     . HOH J 8 .   ? 53.968 -28.568 4.143   1.00 14.65 ? 605  HOH A O     1 
HETATM 3886 O  O     . HOH J 8 .   ? 73.218 -7.366  8.990   1.00 14.34 ? 606  HOH A O     1 
HETATM 3887 O  O     . HOH J 8 .   ? 69.233 -17.558 -1.171  1.00 11.65 ? 607  HOH A O     1 
HETATM 3888 O  O     . HOH J 8 .   ? 67.468 -20.639 8.783   1.00 11.64 ? 608  HOH A O     1 
HETATM 3889 O  O     . HOH J 8 .   ? 67.162 -16.571 9.684   1.00 12.94 ? 609  HOH A O     1 
HETATM 3890 O  O     . HOH J 8 .   ? 55.457 17.421  -0.661  1.00 12.82 ? 610  HOH A O     1 
HETATM 3891 O  O     . HOH J 8 .   ? 62.554 7.521   7.129   1.00 11.98 ? 611  HOH A O     1 
HETATM 3892 O  O     . HOH J 8 .   ? 59.549 9.566   10.733  1.00 13.89 ? 612  HOH A O     1 
HETATM 3893 O  O     . HOH J 8 .   ? 69.002 16.340  -3.949  1.00 14.19 ? 613  HOH A O     1 
HETATM 3894 O  O     . HOH J 8 .   ? 40.734 11.650  -3.478  1.00 15.39 ? 614  HOH A O     1 
HETATM 3895 O  O     . HOH J 8 .   ? 43.432 -33.131 -0.568  1.00 17.68 ? 615  HOH A O     1 
HETATM 3896 O  O     . HOH J 8 .   ? 53.880 -20.350 -2.426  1.00 15.38 ? 616  HOH A O     1 
HETATM 3897 O  O     . HOH J 8 .   ? 60.522 -18.457 -4.569  1.00 11.37 ? 617  HOH A O     1 
HETATM 3898 O  O     . HOH J 8 .   ? 46.130 16.859  1.131   1.00 11.57 ? 618  HOH A O     1 
HETATM 3899 O  O     . HOH J 8 .   ? 69.331 -13.480 5.138   1.00 10.83 ? 619  HOH A O     1 
HETATM 3900 O  O     . HOH J 8 .   ? 70.841 -19.105 1.428   1.00 17.54 ? 620  HOH A O     1 
HETATM 3901 O  O     . HOH J 8 .   ? 59.253 11.171  8.529   1.00 15.42 ? 621  HOH A O     1 
HETATM 3902 O  O     . HOH J 8 .   ? 54.742 -11.351 3.506   1.00 13.25 ? 622  HOH A O     1 
HETATM 3903 O  O     . HOH J 8 .   ? 43.651 12.304  -7.102  1.00 16.66 ? 623  HOH A O     1 
HETATM 3904 O  O     . HOH J 8 .   ? 70.601 -16.046 7.879   1.00 18.03 ? 624  HOH A O     1 
HETATM 3905 O  O     . HOH J 8 .   ? 71.173 3.614   -0.301  1.00 15.98 ? 625  HOH A O     1 
HETATM 3906 O  O     . HOH J 8 .   ? 62.755 14.887  -9.116  1.00 14.35 ? 626  HOH A O     1 
HETATM 3907 O  O     . HOH J 8 .   ? 41.150 6.899   19.045  1.00 14.48 ? 627  HOH A O     1 
HETATM 3908 O  O     . HOH J 8 .   ? 49.163 -15.552 13.634  1.00 16.84 ? 628  HOH A O     1 
HETATM 3909 O  O     . HOH J 8 .   ? 65.909 -15.181 11.782  1.00 17.27 ? 629  HOH A O     1 
HETATM 3910 O  O     . HOH J 8 .   ? 65.705 -22.889 3.302   1.00 13.26 ? 630  HOH A O     1 
HETATM 3911 O  O     . HOH J 8 .   ? 50.194 -17.199 15.488  1.00 15.82 ? 631  HOH A O     1 
HETATM 3912 O  O     . HOH J 8 .   ? 58.699 -12.158 -11.419 1.00 12.97 ? 632  HOH A O     1 
HETATM 3913 O  O     . HOH J 8 .   ? 35.134 5.546   1.958   1.00 17.91 ? 633  HOH A O     1 
HETATM 3914 O  O     . HOH J 8 .   ? 60.765 -23.345 6.437   1.00 20.11 ? 634  HOH A O     1 
HETATM 3915 O  O     . HOH J 8 .   ? 42.161 -22.589 -2.545  1.00 17.25 ? 635  HOH A O     1 
HETATM 3916 O  O     . HOH J 8 .   ? 49.923 -3.194  -17.298 1.00 17.71 ? 636  HOH A O     1 
HETATM 3917 O  O     . HOH J 8 .   ? 45.588 16.207  -1.536  1.00 13.78 ? 637  HOH A O     1 
HETATM 3918 O  O     . HOH J 8 .   ? 44.142 -15.119 1.354   1.00 19.47 ? 638  HOH A O     1 
HETATM 3919 O  O     . HOH J 8 .   ? 54.273 -9.437  5.366   1.00 19.16 ? 639  HOH A O     1 
HETATM 3920 O  O     . HOH J 8 .   ? 52.673 1.291   9.519   1.00 15.73 ? 640  HOH A O     1 
HETATM 3921 O  O     . HOH J 8 .   ? 65.858 -6.675  -13.821 1.00 16.62 ? 641  HOH A O     1 
HETATM 3922 O  O     . HOH J 8 .   ? 60.117 11.582  -10.288 1.00 15.71 ? 642  HOH A O     1 
HETATM 3923 O  O     . HOH J 8 .   ? 49.056 6.866   -11.763 1.00 21.73 ? 643  HOH A O     1 
HETATM 3924 O  O     . HOH J 8 .   ? 64.212 -9.395  -14.380 1.00 18.43 ? 644  HOH A O     1 
HETATM 3925 O  O     . HOH J 8 .   ? 43.933 9.998   -10.078 1.00 21.56 ? 645  HOH A O     1 
HETATM 3926 O  O     . HOH J 8 .   ? 68.574 -15.894 -7.623  1.00 23.10 ? 646  HOH A O     1 
HETATM 3927 O  O     . HOH J 8 .   ? 44.457 7.397   2.263   1.00 16.91 ? 647  HOH A O     1 
HETATM 3928 O  O     . HOH J 8 .   ? 52.370 15.973  -4.568  1.00 17.22 ? 648  HOH A O     1 
HETATM 3929 O  O     . HOH J 8 .   ? 50.007 2.818   12.794  1.00 19.96 ? 649  HOH A O     1 
HETATM 3930 O  O     . HOH J 8 .   ? 53.371 -33.471 -0.048  1.00 23.51 ? 650  HOH A O     1 
HETATM 3931 O  O     . HOH J 8 .   ? 53.774 13.636  -9.918  1.00 21.18 ? 651  HOH A O     1 
HETATM 3932 O  O     . HOH J 8 .   ? 51.482 5.588   -8.368  1.00 20.66 ? 652  HOH A O     1 
HETATM 3933 O  O     . HOH J 8 .   ? 53.382 -28.313 15.310  1.00 21.59 ? 653  HOH A O     1 
HETATM 3934 O  O     . HOH J 8 .   ? 71.666 6.042   -7.231  1.00 16.86 ? 654  HOH A O     1 
HETATM 3935 O  O     . HOH J 8 .   ? 51.240 3.461   10.516  1.00 19.57 ? 655  HOH A O     1 
HETATM 3936 O  O     . HOH J 8 .   ? 54.009 17.502  -2.990  1.00 20.84 ? 656  HOH A O     1 
HETATM 3937 O  O     . HOH J 8 .   ? 41.236 7.655   -18.532 1.00 18.39 ? 657  HOH A O     1 
HETATM 3938 O  O     . HOH J 8 .   ? 41.773 -30.506 -6.524  1.00 26.18 ? 658  HOH A O     1 
HETATM 3939 O  O     . HOH J 8 .   ? 52.438 20.221  4.998   1.00 19.20 ? 659  HOH A O     1 
HETATM 3940 O  O     . HOH J 8 .   ? 44.157 10.861  -12.609 1.00 22.10 ? 660  HOH A O     1 
HETATM 3941 O  O     . HOH J 8 .   ? 33.145 10.816  5.440   1.00 25.29 ? 661  HOH A O     1 
HETATM 3942 O  O     . HOH J 8 .   ? 41.465 17.019  -14.836 1.00 20.44 ? 662  HOH A O     1 
HETATM 3943 O  O     . HOH J 8 .   ? 47.939 -27.041 -7.196  1.00 27.65 ? 663  HOH A O     1 
HETATM 3944 O  O     . HOH J 8 .   ? 60.032 14.194  -8.676  1.00 18.98 ? 664  HOH A O     1 
HETATM 3945 O  O     . HOH J 8 .   ? 50.554 -34.626 -0.903  1.00 23.97 ? 665  HOH A O     1 
HETATM 3946 O  O     . HOH J 8 .   ? 59.881 10.418  19.702  1.00 19.26 ? 666  HOH A O     1 
HETATM 3947 O  O     . HOH J 8 .   ? 58.544 -9.127  -14.135 1.00 21.61 ? 667  HOH A O     1 
HETATM 3948 O  O     . HOH J 8 .   ? 48.552 -36.804 2.516   1.00 24.03 ? 668  HOH A O     1 
HETATM 3949 O  O     . HOH J 8 .   ? 63.157 -26.576 7.109   1.00 22.17 ? 669  HOH A O     1 
HETATM 3950 O  O     . HOH J 8 .   ? 48.883 2.757   21.210  1.00 20.89 ? 670  HOH A O     1 
HETATM 3951 O  O     . HOH J 8 .   ? 42.734 15.665  23.694  1.00 20.65 ? 671  HOH A O     1 
HETATM 3952 O  O     . HOH J 8 .   ? 46.762 -0.287  -15.150 1.00 21.62 ? 672  HOH A O     1 
HETATM 3953 O  O     . HOH J 8 .   ? 78.242 -0.866  5.385   1.00 19.29 ? 673  HOH A O     1 
HETATM 3954 O  O     . HOH J 8 .   ? 83.985 -5.134  2.580   1.00 27.82 ? 674  HOH A O     1 
HETATM 3955 O  O     . HOH J 8 .   ? 45.846 -10.722 -0.118  1.00 23.74 ? 675  HOH A O     1 
HETATM 3956 O  O     . HOH J 8 .   ? 54.856 -0.763  5.665   1.00 25.44 ? 676  HOH A O     1 
HETATM 3957 O  O     . HOH J 8 .   ? 51.408 8.789   -15.436 1.00 29.58 ? 677  HOH A O     1 
HETATM 3958 O  O     . HOH J 8 .   ? 45.119 7.487   -10.377 1.00 22.26 ? 678  HOH A O     1 
HETATM 3959 O  O     . HOH J 8 .   ? 44.942 -14.363 10.433  1.00 16.93 ? 679  HOH A O     1 
HETATM 3960 O  O     . HOH J 8 .   ? 63.478 12.843  -10.743 1.00 24.29 ? 680  HOH A O     1 
HETATM 3961 O  O     . HOH J 8 .   ? 58.111 -14.376 -12.944 1.00 22.25 ? 681  HOH A O     1 
HETATM 3962 O  O     . HOH J 8 .   ? 36.851 16.189  -4.395  1.00 26.19 ? 682  HOH A O     1 
HETATM 3963 O  O     . HOH J 8 .   ? 61.713 8.159   9.971   1.00 22.56 ? 683  HOH A O     1 
HETATM 3964 O  O     . HOH J 8 .   ? 40.517 16.662  5.951   1.00 20.39 ? 684  HOH A O     1 
HETATM 3965 O  O     . HOH J 8 .   ? 48.980 13.562  28.219  1.00 27.96 ? 685  HOH A O     1 
HETATM 3966 O  O     . HOH J 8 .   ? 72.362 -3.753  -13.744 1.00 20.71 ? 686  HOH A O     1 
HETATM 3967 O  O     . HOH J 8 .   ? 60.431 -17.885 -7.343  1.00 24.97 ? 687  HOH A O     1 
HETATM 3968 O  O     . HOH J 8 .   ? 49.639 8.457   -13.647 1.00 29.68 ? 688  HOH A O     1 
HETATM 3969 O  O     . HOH J 8 .   ? 61.675 14.584  8.749   1.00 23.24 ? 689  HOH A O     1 
HETATM 3970 O  O     . HOH J 8 .   ? 36.048 10.979  0.593   1.00 20.13 ? 690  HOH A O     1 
HETATM 3971 O  O     . HOH J 8 .   ? 48.919 -9.436  10.447  1.00 28.09 ? 691  HOH A O     1 
HETATM 3972 O  O     . HOH J 8 .   ? 47.403 -0.283  -8.487  1.00 25.18 ? 692  HOH A O     1 
HETATM 3973 O  O     . HOH J 8 .   ? 63.072 9.465   -13.273 1.00 28.96 ? 693  HOH A O     1 
HETATM 3974 O  O     . HOH J 8 .   ? 42.254 -19.017 14.802  1.00 24.96 ? 694  HOH A O     1 
HETATM 3975 O  O     . HOH J 8 .   ? 46.231 -9.681  11.004  1.00 29.73 ? 695  HOH A O     1 
HETATM 3976 O  O     . HOH J 8 .   ? 64.792 6.713   -0.263  1.00 19.67 ? 696  HOH A O     1 
HETATM 3977 O  O     . HOH J 8 .   ? 53.041 -26.392 -3.880  1.00 22.50 ? 697  HOH A O     1 
HETATM 3978 O  O     . HOH J 8 .   ? 46.786 -14.521 14.848  1.00 31.45 ? 698  HOH A O     1 
HETATM 3979 O  O     . HOH J 8 .   ? 29.055 8.370   -18.948 1.00 27.77 ? 699  HOH A O     1 
HETATM 3980 O  O     . HOH J 8 .   ? 59.450 4.816   16.537  1.00 20.59 ? 700  HOH A O     1 
HETATM 3981 O  O     . HOH J 8 .   ? 63.405 -18.778 -1.306  1.00 20.21 ? 701  HOH A O     1 
HETATM 3982 O  O     . HOH J 8 .   ? 58.287 -17.843 19.908  1.00 28.42 ? 702  HOH A O     1 
HETATM 3983 O  O     . HOH J 8 .   ? 23.314 14.299  -9.110  1.00 24.60 ? 703  HOH A O     1 
HETATM 3984 O  O     . HOH J 8 .   ? 29.665 3.867   6.274   1.00 35.66 ? 704  HOH A O     1 
HETATM 3985 O  O     . HOH J 8 .   ? 70.583 -17.196 12.409  1.00 26.47 ? 705  HOH A O     1 
HETATM 3986 O  O     . HOH J 8 .   ? 47.949 10.680  -9.702  1.00 30.11 ? 706  HOH A O     1 
HETATM 3987 O  O     . HOH J 8 .   ? 51.616 5.189   -10.992 1.00 23.22 ? 707  HOH A O     1 
HETATM 3988 O  O     . HOH J 8 .   ? 67.494 -6.390  12.907  1.00 17.80 ? 708  HOH A O     1 
HETATM 3989 O  O     . HOH J 8 .   ? 46.358 0.267   6.876   1.00 22.75 ? 709  HOH A O     1 
HETATM 3990 O  O     . HOH J 8 .   ? 51.132 0.362   -16.104 1.00 29.86 ? 710  HOH A O     1 
HETATM 3991 O  O     . HOH J 8 .   ? 48.669 -22.117 -5.639  1.00 22.01 ? 711  HOH A O     1 
HETATM 3992 O  O     . HOH J 8 .   ? 51.222 -8.669  -5.179  1.00 24.84 ? 712  HOH A O     1 
HETATM 3993 O  O     . HOH J 8 .   ? 70.764 0.596   11.471  1.00 32.41 ? 713  HOH A O     1 
HETATM 3994 O  O     . HOH J 8 .   ? 48.265 -17.978 17.261  1.00 29.77 ? 714  HOH A O     1 
HETATM 3995 O  O     . HOH J 8 .   ? 58.222 -27.527 11.367  1.00 20.40 ? 715  HOH A O     1 
HETATM 3996 O  O     . HOH J 8 .   ? 58.916 4.710   23.153  1.00 23.86 ? 716  HOH A O     1 
HETATM 3997 O  O     . HOH J 8 .   ? 71.989 -18.983 13.983  1.00 31.57 ? 717  HOH A O     1 
HETATM 3998 O  O     . HOH J 8 .   ? 44.424 10.098  -24.621 1.00 33.84 ? 718  HOH A O     1 
HETATM 3999 O  O     . HOH J 8 .   ? 56.269 18.768  18.098  1.00 24.86 ? 719  HOH A O     1 
HETATM 4000 O  O     . HOH J 8 .   ? 55.766 -32.788 5.106   1.00 26.07 ? 720  HOH A O     1 
HETATM 4001 O  O     . HOH J 8 .   ? 47.016 -8.627  -4.516  1.00 29.91 ? 721  HOH A O     1 
HETATM 4002 O  O     . HOH J 8 .   ? 57.797 -7.433  8.185   1.00 22.25 ? 722  HOH A O     1 
HETATM 4003 O  O     . HOH J 8 .   ? 24.256 16.287  3.275   1.00 28.49 ? 723  HOH A O     1 
HETATM 4004 O  O     . HOH J 8 .   ? 61.232 21.073  11.784  1.00 28.82 ? 724  HOH A O     1 
HETATM 4005 O  O     . HOH J 8 .   ? 52.770 -1.406  4.086   1.00 25.40 ? 725  HOH A O     1 
HETATM 4006 O  O     . HOH J 8 .   ? 62.907 -17.151 -7.270  1.00 26.24 ? 726  HOH A O     1 
HETATM 4007 O  O     . HOH J 8 .   ? 33.307 2.580   -0.517  1.00 28.62 ? 727  HOH A O     1 
HETATM 4008 O  O     . HOH J 8 .   ? 66.086 -4.305  -15.126 1.00 26.56 ? 728  HOH A O     1 
HETATM 4009 O  O     . HOH J 8 .   ? 21.604 13.747  6.719   1.00 29.09 ? 729  HOH A O     1 
HETATM 4010 O  O     . HOH J 8 .   ? 67.313 -8.278  10.046  1.00 21.27 ? 730  HOH A O     1 
HETATM 4011 O  O     . HOH J 8 .   ? 49.321 7.554   -7.753  1.00 25.99 ? 731  HOH A O     1 
HETATM 4012 O  O     . HOH J 8 .   ? 51.444 6.265   -18.937 1.00 35.58 ? 732  HOH A O     1 
HETATM 4013 O  O     . HOH J 8 .   ? 41.384 -23.789 -5.002  1.00 23.61 ? 733  HOH A O     1 
HETATM 4014 O  O     . HOH J 8 .   ? 57.314 -16.466 -11.237 1.00 26.04 ? 734  HOH A O     1 
HETATM 4015 O  O     . HOH J 8 .   ? 68.259 -14.595 -9.967  1.00 26.10 ? 735  HOH A O     1 
HETATM 4016 O  O     . HOH J 8 .   ? 60.585 -28.367 8.457   1.00 25.02 ? 736  HOH A O     1 
HETATM 4017 O  O     . HOH J 8 .   ? 71.426 -12.083 14.468  1.00 31.87 ? 737  HOH A O     1 
HETATM 4018 O  O     . HOH J 8 .   ? 42.052 -8.983  9.548   1.00 34.56 ? 738  HOH A O     1 
HETATM 4019 O  O     . HOH J 8 .   ? 66.066 3.499   -17.718 1.00 27.93 ? 739  HOH A O     1 
HETATM 4020 O  O     . HOH J 8 .   ? 46.987 16.389  25.605  1.00 25.38 ? 740  HOH A O     1 
HETATM 4021 O  O     . HOH J 8 .   ? 75.324 -22.435 -6.306  1.00 38.86 ? 741  HOH A O     1 
HETATM 4022 O  O     . HOH J 8 .   ? 68.869 -10.785 12.251  1.00 33.65 ? 742  HOH A O     1 
HETATM 4023 O  O     . HOH J 8 .   ? 39.124 -3.523  -20.192 1.00 31.78 ? 743  HOH A O     1 
HETATM 4024 O  O     . HOH J 8 .   ? 37.065 12.962  11.924  1.00 25.75 ? 744  HOH A O     1 
HETATM 4025 O  O     . HOH J 8 .   ? 34.590 5.903   -21.971 1.00 29.86 ? 745  HOH A O     1 
HETATM 4026 O  O     . HOH J 8 .   ? 46.815 19.486  1.431   1.00 25.03 ? 746  HOH A O     1 
HETATM 4027 O  O     . HOH J 8 .   ? 59.919 13.072  11.224  1.00 23.59 ? 747  HOH A O     1 
HETATM 4028 O  O     . HOH J 8 .   ? 51.196 21.784  7.281   1.00 28.78 ? 748  HOH A O     1 
HETATM 4029 O  O     . HOH J 8 .   ? 62.377 11.958  5.635   1.00 31.83 ? 749  HOH A O     1 
HETATM 4030 O  O     . HOH J 8 .   ? 18.815 14.226  6.699   1.00 38.20 ? 750  HOH A O     1 
HETATM 4031 O  O     . HOH J 8 .   ? 75.278 0.360   -3.709  1.00 22.45 ? 751  HOH A O     1 
HETATM 4032 O  O     . HOH J 8 .   ? 76.502 2.731   6.869   1.00 26.54 ? 752  HOH A O     1 
HETATM 4033 O  O     . HOH J 8 .   ? 48.455 -33.491 -3.669  1.00 31.15 ? 753  HOH A O     1 
HETATM 4034 O  O     . HOH J 8 .   ? 69.443 4.394   3.981   1.00 23.66 ? 754  HOH A O     1 
HETATM 4035 O  O     . HOH J 8 .   ? 66.631 -2.438  12.757  1.00 25.15 ? 755  HOH A O     1 
HETATM 4036 O  O     . HOH J 8 .   ? 62.023 16.190  2.442   1.00 29.43 ? 756  HOH A O     1 
HETATM 4037 O  O     . HOH J 8 .   ? 60.636 6.372   -15.558 1.00 26.16 ? 757  HOH A O     1 
HETATM 4038 O  O     . HOH J 8 .   ? 65.716 13.083  2.902   1.00 27.43 ? 758  HOH A O     1 
HETATM 4039 O  O     . HOH J 8 .   ? 54.374 15.438  23.268  1.00 29.79 ? 759  HOH A O     1 
HETATM 4040 O  O     . HOH J 8 .   ? 44.319 15.747  26.123  1.00 28.99 ? 760  HOH A O     1 
HETATM 4041 O  O     . HOH J 8 .   ? 53.720 -8.464  8.777   1.00 27.93 ? 761  HOH A O     1 
HETATM 4042 O  O     . HOH J 8 .   ? 60.193 14.378  3.393   1.00 28.87 ? 762  HOH A O     1 
HETATM 4043 O  O     . HOH J 8 .   ? 55.877 13.608  -11.554 1.00 28.83 ? 763  HOH A O     1 
HETATM 4044 O  O     . HOH J 8 .   ? 47.288 2.555   -1.469  1.00 24.42 ? 764  HOH A O     1 
HETATM 4045 O  O     . HOH J 8 .   ? 79.099 3.546   1.809   1.00 32.09 ? 765  HOH A O     1 
HETATM 4046 O  O     . HOH J 8 .   ? 59.448 -32.729 7.903   1.00 29.70 ? 766  HOH A O     1 
HETATM 4047 O  O     . HOH J 8 .   ? 59.082 -30.335 -1.116  1.00 31.97 ? 767  HOH A O     1 
HETATM 4048 O  O     . HOH J 8 .   ? 61.160 9.942   7.065   1.00 26.85 ? 768  HOH A O     1 
HETATM 4049 O  O     . HOH J 8 .   ? 45.269 0.498   -18.433 1.00 25.42 ? 769  HOH A O     1 
HETATM 4050 O  O     . HOH J 8 .   ? 49.964 -8.724  13.211  1.00 33.27 ? 770  HOH A O     1 
HETATM 4051 O  O     . HOH J 8 .   ? 41.068 -1.593  -16.268 1.00 34.40 ? 771  HOH A O     1 
HETATM 4052 O  O     . HOH J 8 .   ? 84.025 -18.278 -0.846  1.00 45.81 ? 772  HOH A O     1 
HETATM 4053 O  O     . HOH J 8 .   ? 39.415 -2.086  -14.229 1.00 30.10 ? 773  HOH A O     1 
HETATM 4054 O  O     . HOH J 8 .   ? 55.610 -7.346  6.391   1.00 33.49 ? 774  HOH A O     1 
HETATM 4055 O  O     . HOH J 8 .   ? 58.827 15.354  -10.752 1.00 31.18 ? 775  HOH A O     1 
HETATM 4056 O  O     . HOH J 8 .   ? 39.716 4.467   18.206  1.00 33.90 ? 776  HOH A O     1 
HETATM 4057 O  O     . HOH J 8 .   ? 40.657 -28.713 -9.870  1.00 30.80 ? 777  HOH A O     1 
HETATM 4058 O  O     . HOH J 8 .   ? 37.078 18.645  16.595  1.00 33.51 ? 778  HOH A O     1 
HETATM 4059 O  O     . HOH J 8 .   ? 47.739 8.047   -9.717  1.00 30.58 ? 779  HOH A O     1 
HETATM 4060 O  O     . HOH J 8 .   ? 51.564 13.571  -11.491 1.00 28.68 ? 780  HOH A O     1 
HETATM 4061 O  O     . HOH J 8 .   ? 33.562 7.585   17.438  1.00 31.65 ? 781  HOH A O     1 
HETATM 4062 O  O     . HOH J 8 .   ? 38.883 -20.014 12.396  1.00 32.98 ? 782  HOH A O     1 
HETATM 4063 O  O     . HOH J 8 .   ? 73.753 4.546   -0.932  1.00 34.30 ? 783  HOH A O     1 
HETATM 4064 O  O     . HOH J 8 .   ? 47.318 3.180   -23.899 1.00 40.02 ? 784  HOH A O     1 
HETATM 4065 O  O     . HOH J 8 .   ? 69.883 -12.860 -11.485 1.00 30.28 ? 785  HOH A O     1 
HETATM 4066 O  O     . HOH J 8 .   ? 37.926 10.847  21.566  1.00 39.17 ? 786  HOH A O     1 
HETATM 4067 O  O     . HOH J 8 .   ? 40.935 14.055  -6.527  1.00 30.34 ? 787  HOH A O     1 
HETATM 4068 O  O     . HOH J 8 .   ? 50.634 -12.737 -0.780  1.00 23.79 ? 788  HOH A O     1 
HETATM 4069 O  O     . HOH J 8 .   ? 51.120 -22.614 -5.563  1.00 31.08 ? 789  HOH A O     1 
HETATM 4070 O  O     . HOH J 8 .   ? 72.252 -7.615  11.758  1.00 18.53 ? 790  HOH A O     1 
HETATM 4071 O  O     . HOH J 8 .   ? 52.844 -12.671 -4.116  1.00 28.21 ? 791  HOH A O     1 
HETATM 4072 O  O     . HOH J 8 .   ? 38.494 -18.066 10.118  1.00 23.88 ? 792  HOH A O     1 
HETATM 4073 O  O     . HOH J 8 .   ? 52.634 8.339   25.333  1.00 28.58 ? 793  HOH A O     1 
HETATM 4074 O  O     . HOH J 8 .   ? 47.436 -20.262 18.425  1.00 30.42 ? 794  HOH A O     1 
HETATM 4075 O  O     . HOH J 8 .   ? 81.582 -10.953 -8.199  1.00 40.85 ? 795  HOH A O     1 
HETATM 4076 O  O     . HOH J 8 .   ? 54.644 -33.994 12.597  1.00 29.56 ? 796  HOH A O     1 
HETATM 4077 O  O     . HOH J 8 .   ? 22.344 -4.317  3.569   1.00 41.24 ? 797  HOH A O     1 
HETATM 4078 O  O     . HOH J 8 .   ? 73.065 2.189   8.103   1.00 29.20 ? 798  HOH A O     1 
HETATM 4079 O  O     . HOH J 8 .   ? 57.699 23.597  14.018  1.00 30.59 ? 799  HOH A O     1 
HETATM 4080 O  O     . HOH J 8 .   ? 48.587 -12.103 -6.999  1.00 38.38 ? 800  HOH A O     1 
HETATM 4081 O  O     . HOH J 8 .   ? 51.877 18.094  -9.816  1.00 31.32 ? 801  HOH A O     1 
HETATM 4082 O  O     . HOH J 8 .   ? 39.803 7.079   13.525  1.00 28.61 ? 802  HOH A O     1 
HETATM 4083 O  O     . HOH J 8 .   ? 52.622 3.524   17.634  1.00 25.92 ? 803  HOH A O     1 
HETATM 4084 O  O     . HOH J 8 .   ? 48.553 22.123  2.896   1.00 36.62 ? 804  HOH A O     1 
HETATM 4085 O  O     . HOH J 8 .   ? 25.562 14.752  5.214   1.00 26.80 ? 805  HOH A O     1 
HETATM 4086 O  O     . HOH J 8 .   ? 35.538 22.535  -3.227  1.00 33.58 ? 806  HOH A O     1 
HETATM 4087 O  O     . HOH J 8 .   ? 53.365 24.258  4.164   1.00 30.14 ? 807  HOH A O     1 
HETATM 4088 O  O     . HOH J 8 .   ? 50.689 -6.337  -5.474  1.00 34.24 ? 808  HOH A O     1 
HETATM 4089 O  O     . HOH J 8 .   ? 83.198 -3.058  -4.071  1.00 33.49 ? 809  HOH A O     1 
HETATM 4090 O  O     . HOH J 8 .   ? 41.129 -3.028  -23.122 1.00 25.42 ? 810  HOH A O     1 
HETATM 4091 O  O     . HOH J 8 .   ? 19.997 10.343  8.667   1.00 38.22 ? 811  HOH A O     1 
HETATM 4092 O  O     . HOH J 8 .   ? 41.135 21.779  2.134   1.00 25.71 ? 812  HOH A O     1 
HETATM 4093 O  O     . HOH J 8 .   ? 34.770 17.614  -12.822 1.00 30.57 ? 813  HOH A O     1 
HETATM 4094 O  O     . HOH J 8 .   ? 41.465 20.387  4.936   1.00 24.06 ? 814  HOH A O     1 
HETATM 4095 O  O     . HOH J 8 .   ? 66.596 3.970   10.679  1.00 29.15 ? 815  HOH A O     1 
HETATM 4096 O  O     . HOH J 8 .   ? 81.180 -10.510 -11.131 1.00 43.76 ? 816  HOH A O     1 
HETATM 4097 O  O     . HOH J 8 .   ? 56.345 1.084   13.062  1.00 29.24 ? 817  HOH A O     1 
HETATM 4098 O  O     . HOH J 8 .   ? 52.450 -5.439  -1.054  1.00 23.73 ? 818  HOH A O     1 
HETATM 4099 O  O     . HOH J 8 .   ? 45.325 17.109  -18.241 1.00 33.71 ? 819  HOH A O     1 
HETATM 4100 O  O     . HOH J 8 .   ? 36.681 21.530  4.756   1.00 33.82 ? 820  HOH A O     1 
HETATM 4101 O  O     . HOH J 8 .   ? 82.549 -10.304 -0.658  1.00 35.73 ? 821  HOH A O     1 
HETATM 4102 O  O     . HOH J 8 .   ? 55.631 -1.082  -14.733 1.00 28.04 ? 822  HOH A O     1 
HETATM 4103 O  O     . HOH J 8 .   ? 69.801 10.101  -8.555  1.00 27.21 ? 823  HOH A O     1 
HETATM 4104 O  O     . HOH J 8 .   ? 57.284 -34.627 8.460   1.00 36.50 ? 824  HOH A O     1 
HETATM 4105 O  O     . HOH J 8 .   ? 40.665 -18.465 0.881   1.00 32.82 ? 825  HOH A O     1 
HETATM 4106 O  O     . HOH J 8 .   ? 57.528 0.095   10.802  1.00 30.39 ? 826  HOH A O     1 
HETATM 4107 O  O     . HOH J 8 .   ? 17.721 -3.180  -5.675  1.00 47.11 ? 827  HOH A O     1 
HETATM 4108 O  O     . HOH J 8 .   ? 48.312 19.822  4.624   1.00 33.32 ? 828  HOH A O     1 
HETATM 4109 O  O     . HOH J 8 .   ? 54.658 17.651  -12.188 1.00 34.98 ? 829  HOH A O     1 
HETATM 4110 O  O     . HOH J 8 .   ? 40.987 -29.644 13.161  1.00 28.29 ? 830  HOH A O     1 
HETATM 4111 O  O     . HOH J 8 .   ? 38.853 23.078  2.229   1.00 33.43 ? 831  HOH A O     1 
HETATM 4112 O  O     . HOH J 8 .   ? 37.562 15.160  -20.300 1.00 32.63 ? 832  HOH A O     1 
HETATM 4113 O  O     . HOH J 8 .   ? 50.306 -16.208 -9.346  1.00 32.93 ? 833  HOH A O     1 
HETATM 4114 O  O     . HOH J 8 .   ? 46.635 -18.732 -2.130  1.00 33.62 ? 834  HOH A O     1 
HETATM 4115 O  O     . HOH J 8 .   ? 62.965 -7.429  12.826  1.00 27.71 ? 835  HOH A O     1 
HETATM 4116 O  O     . HOH J 8 .   ? 83.872 -7.991  0.973   1.00 38.04 ? 836  HOH A O     1 
HETATM 4117 O  O     . HOH J 8 .   ? 49.709 -14.714 18.530  1.00 29.54 ? 837  HOH A O     1 
HETATM 4118 O  O     . HOH J 8 .   ? 36.401 21.308  15.377  1.00 36.38 ? 838  HOH A O     1 
HETATM 4119 O  O     . HOH J 8 .   ? 83.026 -4.604  -5.924  1.00 43.33 ? 839  HOH A O     1 
HETATM 4120 O  O     . HOH J 8 .   ? 67.947 1.706   12.156  1.00 37.16 ? 840  HOH A O     1 
HETATM 4121 O  O     . HOH J 8 .   ? 83.219 -13.913 -0.262  1.00 33.98 ? 841  HOH A O     1 
HETATM 4122 O  O     . HOH J 8 .   ? 21.773 11.665  -9.522  1.00 27.76 ? 842  HOH A O     1 
HETATM 4123 O  O     . HOH J 8 .   ? 57.411 -18.911 22.199  1.00 30.93 ? 843  HOH A O     1 
HETATM 4124 O  O     . HOH J 8 .   ? 34.205 15.804  18.383  1.00 35.75 ? 844  HOH A O     1 
HETATM 4125 O  O     . HOH J 8 .   ? 47.486 -11.626 -2.044  1.00 33.49 ? 845  HOH A O     1 
HETATM 4126 O  O     . HOH J 8 .   ? 42.646 -30.244 -3.875  1.00 31.75 ? 846  HOH A O     1 
HETATM 4127 O  O     . HOH J 8 .   ? 59.445 -19.799 23.526  1.00 28.63 ? 847  HOH A O     1 
HETATM 4128 O  O     . HOH J 8 .   ? 56.508 -2.437  3.696   1.00 24.00 ? 848  HOH A O     1 
HETATM 4129 O  O     . HOH J 8 .   ? 62.220 -25.420 4.919   1.00 27.11 ? 849  HOH A O     1 
HETATM 4130 O  O     . HOH J 8 .   ? 41.627 15.717  -22.985 1.00 27.58 ? 850  HOH A O     1 
HETATM 4131 O  O     . HOH J 8 .   ? 46.944 -38.294 4.379   1.00 28.26 ? 851  HOH A O     1 
HETATM 4132 O  O     . HOH J 8 .   ? 64.375 19.871  11.326  1.00 33.68 ? 852  HOH A O     1 
HETATM 4133 O  O     . HOH J 8 .   ? 51.675 -15.819 17.424  1.00 27.06 ? 853  HOH A O     1 
HETATM 4134 O  O     . HOH J 8 .   ? 62.370 -13.266 -13.338 1.00 31.65 ? 854  HOH A O     1 
HETATM 4135 O  O     . HOH J 8 .   ? 69.613 5.387   1.040   1.00 29.85 ? 855  HOH A O     1 
HETATM 4136 O  O     . HOH J 8 .   ? 40.049 18.574  7.825   1.00 34.56 ? 856  HOH A O     1 
HETATM 4137 O  O     . HOH J 8 .   ? 44.683 -17.013 -0.562  1.00 32.56 ? 857  HOH A O     1 
HETATM 4138 O  O     . HOH J 8 .   ? 71.377 9.128   -6.578  1.00 27.41 ? 858  HOH A O     1 
HETATM 4139 O  O     . HOH J 8 .   ? 80.657 -3.866  14.117  1.00 31.60 ? 859  HOH A O     1 
HETATM 4140 O  O     . HOH J 8 .   ? 70.757 -21.611 0.917   1.00 29.05 ? 860  HOH A O     1 
HETATM 4141 O  O     . HOH J 8 .   ? 59.116 -29.578 12.317  1.00 26.37 ? 861  HOH A O     1 
HETATM 4142 O  O     . HOH J 8 .   ? 53.736 6.106   -12.394 1.00 31.33 ? 862  HOH A O     1 
HETATM 4143 O  O     . HOH J 8 .   ? 53.159 -0.033  11.999  1.00 32.11 ? 863  HOH A O     1 
HETATM 4144 O  O     . HOH J 8 .   ? 39.301 18.774  18.184  1.00 27.00 ? 864  HOH A O     1 
HETATM 4145 O  O     . HOH J 8 .   ? 69.797 -8.843  10.707  1.00 27.31 ? 865  HOH A O     1 
HETATM 4146 O  O     . HOH J 8 .   ? 34.653 13.883  21.861  1.00 35.30 ? 866  HOH A O     1 
HETATM 4147 O  O     . HOH J 8 .   ? 76.681 0.754   -5.896  1.00 31.26 ? 867  HOH A O     1 
HETATM 4148 O  O     . HOH J 8 .   ? 37.516 17.617  -6.668  1.00 34.70 ? 868  HOH A O     1 
HETATM 4149 O  O     . HOH J 8 .   ? 52.858 -19.860 22.278  1.00 34.45 ? 869  HOH A O     1 
HETATM 4150 O  O     . HOH J 8 .   ? 49.027 -0.619  -17.015 1.00 27.24 ? 870  HOH A O     1 
HETATM 4151 O  O     . HOH J 8 .   ? 38.154 10.442  9.590   1.00 25.63 ? 871  HOH A O     1 
HETATM 4152 O  O     . HOH J 8 .   ? 56.387 -33.099 1.840   1.00 22.07 ? 872  HOH A O     1 
HETATM 4153 O  O     . HOH J 8 .   ? 52.927 -24.642 -5.840  1.00 41.92 ? 873  HOH A O     1 
HETATM 4154 O  O     . HOH J 8 .   ? 60.446 13.815  6.039   1.00 30.70 ? 874  HOH A O     1 
HETATM 4155 O  O     . HOH J 8 .   ? 35.882 10.820  10.389  1.00 29.96 ? 875  HOH A O     1 
HETATM 4156 O  O     . HOH J 8 .   ? 63.031 -23.885 3.106   1.00 27.12 ? 876  HOH A O     1 
HETATM 4157 O  O     . HOH J 8 .   ? 33.971 3.181   2.710   1.00 30.00 ? 877  HOH A O     1 
HETATM 4158 O  O     . HOH J 8 .   ? 73.453 -20.616 1.258   1.00 31.13 ? 878  HOH A O     1 
HETATM 4159 O  O     . HOH J 8 .   ? 60.430 13.401  19.278  1.00 32.63 ? 879  HOH A O     1 
HETATM 4160 O  O     . HOH J 8 .   ? 47.853 16.782  28.103  1.00 29.52 ? 880  HOH A O     1 
HETATM 4161 O  O     . HOH J 8 .   ? 27.770 6.746   -17.144 1.00 28.12 ? 881  HOH A O     1 
HETATM 4162 O  O     . HOH J 8 .   ? 38.760 13.827  24.417  1.00 32.74 ? 882  HOH A O     1 
HETATM 4163 O  O     . HOH J 8 .   ? 34.645 14.930  11.440  1.00 25.07 ? 883  HOH A O     1 
HETATM 4164 O  O     . HOH J 8 .   ? 65.239 20.203  6.907   1.00 28.09 ? 884  HOH A O     1 
HETATM 4165 O  O     . HOH J 8 .   ? 61.937 11.556  -12.322 1.00 33.66 ? 885  HOH A O     1 
HETATM 4166 O  O     . HOH J 8 .   ? 55.461 2.786   21.088  1.00 31.62 ? 886  HOH A O     1 
HETATM 4167 O  O     . HOH J 8 .   ? 58.486 18.127  19.497  1.00 37.98 ? 887  HOH A O     1 
HETATM 4168 O  O     . HOH J 8 .   ? 51.822 -17.786 -6.133  1.00 37.61 ? 888  HOH A O     1 
HETATM 4169 O  O     . HOH J 8 .   ? 33.349 10.995  8.589   1.00 35.49 ? 889  HOH A O     1 
HETATM 4170 O  O     . HOH J 8 .   ? 50.113 0.757   20.316  1.00 34.91 ? 890  HOH A O     1 
HETATM 4171 O  O     . HOH J 8 .   ? 47.083 -22.719 17.292  1.00 26.76 ? 891  HOH A O     1 
HETATM 4172 O  O     . HOH J 8 .   ? 55.570 -0.714  8.917   1.00 31.41 ? 892  HOH A O     1 
HETATM 4173 O  O     . HOH J 8 .   ? 48.259 0.041   9.768   1.00 41.22 ? 893  HOH A O     1 
HETATM 4174 O  O     . HOH J 8 .   ? 30.837 1.459   3.316   1.00 37.68 ? 894  HOH A O     1 
HETATM 4175 O  O     . HOH J 8 .   ? 43.395 -15.990 -2.926  1.00 37.00 ? 895  HOH A O     1 
HETATM 4176 O  O     . HOH J 8 .   ? 69.130 1.752   -15.940 1.00 39.57 ? 896  HOH A O     1 
HETATM 4177 O  O     . HOH J 8 .   ? 41.712 15.744  -8.805  1.00 37.08 ? 897  HOH A O     1 
HETATM 4178 O  O     . HOH J 8 .   ? 28.516 21.072  -7.912  1.00 35.73 ? 898  HOH A O     1 
HETATM 4179 O  O     . HOH J 8 .   ? 49.381 12.206  -11.584 1.00 30.80 ? 899  HOH A O     1 
HETATM 4180 O  O     . HOH J 8 .   ? 61.663 -31.562 -10.602 1.00 38.23 ? 900  HOH A O     1 
HETATM 4181 O  O     . HOH J 8 .   ? 56.462 -4.455  5.088   1.00 34.18 ? 901  HOH A O     1 
HETATM 4182 O  O     . HOH J 8 .   ? 77.892 -17.338 -3.242  1.00 38.53 ? 902  HOH A O     1 
HETATM 4183 O  O     . HOH J 8 .   ? 44.720 -0.373  8.575   1.00 38.25 ? 903  HOH A O     1 
HETATM 4184 O  O     . HOH J 8 .   ? 59.793 15.357  -13.229 1.00 37.14 ? 904  HOH A O     1 
HETATM 4185 O  O     . HOH J 8 .   ? 61.146 -16.068 13.822  1.00 31.46 ? 905  HOH A O     1 
HETATM 4186 O  O     . HOH J 8 .   ? 29.598 18.106  -16.103 1.00 37.04 ? 906  HOH A O     1 
HETATM 4187 O  O     . HOH J 8 .   ? 37.791 -24.451 12.760  1.00 44.89 ? 907  HOH A O     1 
HETATM 4188 O  O     . HOH J 8 .   ? 81.042 -15.731 7.688   1.00 28.27 ? 908  HOH A O     1 
HETATM 4189 O  O     . HOH J 8 .   ? 38.626 4.842   15.728  1.00 39.76 ? 909  HOH A O     1 
HETATM 4190 O  O     . HOH J 8 .   ? 44.484 -23.116 17.491  1.00 34.73 ? 910  HOH A O     1 
HETATM 4191 O  O     . HOH J 8 .   ? 30.874 1.968   -22.141 1.00 35.16 ? 911  HOH A O     1 
HETATM 4192 O  O     . HOH J 8 .   ? 64.327 -15.651 13.879  1.00 34.07 ? 912  HOH A O     1 
HETATM 4193 O  O     . HOH J 8 .   ? 37.341 13.756  21.710  1.00 32.24 ? 913  HOH A O     1 
HETATM 4194 O  O     . HOH J 8 .   ? 51.925 -18.566 -8.927  1.00 32.38 ? 914  HOH A O     1 
HETATM 4195 O  O     . HOH J 8 .   ? 59.289 27.150  7.459   1.00 36.23 ? 915  HOH A O     1 
HETATM 4196 O  O     . HOH J 8 .   ? 46.310 0.664   14.048  1.00 35.74 ? 916  HOH A O     1 
HETATM 4197 O  O     . HOH J 8 .   ? 63.595 -11.399 12.694  1.00 43.69 ? 917  HOH A O     1 
HETATM 4198 O  O     . HOH J 8 .   ? 70.010 -9.896  14.953  1.00 40.23 ? 918  HOH A O     1 
HETATM 4199 O  O     . HOH J 8 .   ? 82.693 -16.237 13.808  1.00 46.51 ? 919  HOH A O     1 
HETATM 4200 O  O     . HOH J 8 .   ? 42.730 11.623  -25.701 1.00 40.38 ? 920  HOH A O     1 
HETATM 4201 O  O     . HOH J 8 .   ? 68.261 10.513  7.717   1.00 37.52 ? 921  HOH A O     1 
HETATM 4202 O  O     . HOH J 8 .   ? 65.691 8.600   8.869   1.00 27.22 ? 922  HOH A O     1 
HETATM 4203 O  O     . HOH J 8 .   ? 42.473 5.679   21.152  1.00 34.51 ? 923  HOH A O     1 
HETATM 4204 O  O     . HOH J 8 .   ? 67.612 6.505   9.713   1.00 29.72 ? 924  HOH A O     1 
HETATM 4205 O  O     . HOH J 8 .   ? 45.850 1.899   18.499  1.00 35.63 ? 925  HOH A O     1 
HETATM 4206 O  O     . HOH J 8 .   ? 32.056 -1.412  -2.864  1.00 32.04 ? 926  HOH A O     1 
HETATM 4207 O  O     . HOH J 8 .   ? 83.315 -10.929 9.717   1.00 40.17 ? 927  HOH A O     1 
HETATM 4208 O  O     . HOH J 8 .   ? 43.223 3.195   18.287  1.00 40.23 ? 928  HOH A O     1 
HETATM 4209 O  O     . HOH J 8 .   ? 71.920 1.547   19.080  1.00 39.30 ? 929  HOH A O     1 
HETATM 4210 O  O     . HOH J 8 .   ? 47.456 -3.591  -4.903  1.00 35.72 ? 930  HOH A O     1 
HETATM 4211 O  O     . HOH J 8 .   ? 55.648 5.670   24.931  1.00 36.02 ? 931  HOH A O     1 
HETATM 4212 O  O     . HOH J 8 .   ? 53.864 7.630   -14.669 1.00 30.59 ? 932  HOH A O     1 
HETATM 4213 O  O     . HOH J 8 .   ? 54.743 -29.781 -5.484  1.00 36.90 ? 933  HOH A O     1 
HETATM 4214 O  O     . HOH J 8 .   ? 79.841 -17.502 12.851  1.00 40.28 ? 934  HOH A O     1 
HETATM 4215 O  O     . HOH J 8 .   ? 44.557 -12.750 14.680  1.00 38.44 ? 935  HOH A O     1 
HETATM 4216 O  O     . HOH J 8 .   ? 69.916 -18.734 -9.170  1.00 38.12 ? 936  HOH A O     1 
HETATM 4217 O  O     . HOH J 8 .   ? 34.137 22.739  -0.773  1.00 37.13 ? 937  HOH A O     1 
HETATM 4218 O  O     . HOH J 8 .   ? 60.235 9.744   22.354  1.00 35.35 ? 938  HOH A O     1 
HETATM 4219 O  O     . HOH J 8 .   ? 69.389 7.746   3.758   1.00 36.92 ? 939  HOH A O     1 
HETATM 4220 O  O     . HOH J 8 .   ? 35.003 8.962   -22.137 1.00 36.31 ? 940  HOH A O     1 
HETATM 4221 O  O     . HOH J 8 .   ? 43.125 -25.441 17.411  1.00 36.07 ? 941  HOH A O     1 
HETATM 4222 O  O     . HOH J 8 .   ? 39.252 21.507  15.129  1.00 40.63 ? 942  HOH A O     1 
HETATM 4223 O  O     . HOH J 8 .   ? 55.887 -27.481 -3.868  1.00 36.61 ? 943  HOH A O     1 
HETATM 4224 O  O     . HOH J 8 .   ? 42.172 -20.796 16.917  1.00 43.64 ? 944  HOH A O     1 
HETATM 4225 O  O     . HOH J 8 .   ? 46.866 18.986  24.322  1.00 36.15 ? 945  HOH A O     1 
HETATM 4226 O  O     . HOH J 8 .   ? 53.146 -18.060 -11.614 1.00 32.58 ? 946  HOH A O     1 
HETATM 4227 O  O     . HOH J 8 .   ? 43.984 -1.243  -16.643 1.00 37.32 ? 947  HOH A O     1 
HETATM 4228 O  O     . HOH J 8 .   ? 77.778 3.201   -1.455  1.00 35.68 ? 948  HOH A O     1 
HETATM 4229 O  O     . HOH J 8 .   ? 51.803 -35.245 7.620   1.00 34.46 ? 949  HOH A O     1 
HETATM 4230 O  O     . HOH J 8 .   ? 50.809 16.534  -11.766 1.00 41.63 ? 950  HOH A O     1 
HETATM 4231 O  O     . HOH J 8 .   ? 32.685 3.056   -23.923 1.00 35.92 ? 951  HOH A O     1 
HETATM 4232 O  O     . HOH J 8 .   ? 61.863 8.919   18.663  1.00 31.85 ? 952  HOH A O     1 
HETATM 4233 O  O     . HOH J 8 .   ? 38.292 -15.504 11.634  1.00 38.77 ? 953  HOH A O     1 
HETATM 4234 O  O     . HOH J 8 .   ? 61.704 1.866   14.047  1.00 31.71 ? 954  HOH A O     1 
HETATM 4235 O  O     . HOH J 8 .   ? 76.782 -17.661 0.818   1.00 33.68 ? 955  HOH A O     1 
HETATM 4236 O  O     . HOH J 8 .   ? 53.361 -20.208 -5.032  1.00 23.30 ? 956  HOH A O     1 
HETATM 4237 O  O     . HOH J 8 .   ? 55.983 -35.704 11.036  1.00 27.68 ? 957  HOH A O     1 
HETATM 4238 O  O     . HOH J 8 .   ? 45.817 7.750   -13.041 1.00 31.53 ? 958  HOH A O     1 
HETATM 4239 O  O     . HOH J 8 .   ? 70.570 -6.873  13.804  1.00 31.34 ? 959  HOH A O     1 
HETATM 4240 O  O     . HOH J 8 .   ? 40.736 -29.463 -2.332  1.00 33.42 ? 960  HOH A O     1 
HETATM 4241 O  O     . HOH J 8 .   ? 72.537 3.182   -11.003 1.00 32.72 ? 961  HOH A O     1 
HETATM 4242 O  O     . HOH J 8 .   ? 64.987 -34.726 -6.199  1.00 43.32 ? 962  HOH A O     1 
HETATM 4243 O  O     . HOH J 8 .   ? 65.695 -21.563 14.699  1.00 32.82 ? 963  HOH A O     1 
HETATM 4244 O  O     . HOH J 8 .   ? 47.398 -16.720 -0.400  1.00 33.25 ? 964  HOH A O     1 
HETATM 4245 O  O     . HOH J 8 .   ? 43.261 15.497  -10.907 1.00 37.04 ? 965  HOH A O     1 
HETATM 4246 O  O     . HOH J 8 .   ? 84.896 -15.963 -0.153  1.00 46.17 ? 966  HOH A O     1 
HETATM 4247 O  O     . HOH J 8 .   ? 20.386 7.216   -16.543 1.00 39.20 ? 967  HOH A O     1 
HETATM 4248 O  O     . HOH J 8 .   ? 37.698 7.668   21.890  1.00 36.03 ? 968  HOH A O     1 
HETATM 4249 O  O     . HOH J 8 .   ? 60.990 13.219  -14.480 1.00 33.42 ? 969  HOH A O     1 
HETATM 4250 O  O     . HOH J 8 .   ? 67.322 5.772   -17.222 1.00 38.14 ? 970  HOH A O     1 
HETATM 4251 O  O     . HOH J 8 .   ? 53.654 -29.810 -8.014  1.00 35.96 ? 971  HOH A O     1 
HETATM 4252 O  O     . HOH J 8 .   ? 39.400 -22.814 5.906   1.00 31.54 ? 972  HOH A O     1 
HETATM 4253 O  O     . HOH J 8 .   ? 48.618 -13.939 -2.459  1.00 37.07 ? 973  HOH A O     1 
HETATM 4254 O  O     . HOH J 8 .   ? 62.035 7.942   15.869  1.00 35.00 ? 974  HOH A O     1 
HETATM 4255 O  O     . HOH J 8 .   ? 57.968 0.297   -14.691 1.00 31.77 ? 975  HOH A O     1 
HETATM 4256 O  O     . HOH J 8 .   ? 70.145 6.902   -11.886 1.00 38.08 ? 976  HOH A O     1 
HETATM 4257 O  O     . HOH J 8 .   ? 46.587 2.259   -4.362  1.00 32.08 ? 977  HOH A O     1 
HETATM 4258 O  O     . HOH J 8 .   ? 51.865 1.476   14.062  1.00 41.64 ? 978  HOH A O     1 
HETATM 4259 O  O     . HOH J 8 .   ? 71.821 5.511   -10.398 1.00 36.93 ? 979  HOH A O     1 
HETATM 4260 O  O     . HOH J 8 .   ? 56.586 -25.475 -5.507  1.00 42.74 ? 980  HOH A O     1 
HETATM 4261 O  O     . HOH J 8 .   ? 77.439 3.072   -6.208  1.00 44.89 ? 981  HOH A O     1 
HETATM 4262 O  O     . HOH J 8 .   ? 55.256 -17.496 -13.313 1.00 38.28 ? 982  HOH A O     1 
HETATM 4263 O  O     . HOH J 8 .   ? 39.628 -18.744 14.343  1.00 36.17 ? 983  HOH A O     1 
HETATM 4264 O  O     . HOH J 8 .   ? 52.958 2.256   -17.542 1.00 37.86 ? 984  HOH A O     1 
HETATM 4265 O  O     . HOH J 8 .   ? 53.175 5.108   -16.934 1.00 36.98 ? 985  HOH A O     1 
HETATM 4266 O  O     . HOH J 8 .   ? 61.741 22.838  13.868  1.00 42.74 ? 986  HOH A O     1 
HETATM 4267 O  O     . HOH J 8 .   ? 62.313 12.063  9.383   1.00 35.27 ? 987  HOH A O     1 
HETATM 4268 O  O     . HOH J 8 .   ? 85.397 -9.718  7.993   1.00 44.93 ? 988  HOH A O     1 
HETATM 4269 O  O     . HOH J 8 .   ? 59.469 -18.732 25.987  1.00 38.20 ? 989  HOH A O     1 
HETATM 4270 O  O     . HOH J 8 .   ? 44.412 13.243  -10.302 1.00 35.01 ? 990  HOH A O     1 
HETATM 4271 O  O     . HOH J 8 .   ? 71.516 0.167   -10.962 1.00 40.14 ? 991  HOH A O     1 
HETATM 4272 O  O     . HOH J 8 .   ? 65.480 5.858   12.762  1.00 39.15 ? 992  HOH A O     1 
HETATM 4273 O  O     . HOH J 8 .   ? 57.006 18.212  -14.150 1.00 37.95 ? 993  HOH A O     1 
HETATM 4274 O  O     . HOH J 8 .   ? 43.551 17.440  -12.767 1.00 34.57 ? 994  HOH A O     1 
HETATM 4275 O  O     . HOH J 8 .   ? 71.093 7.837   -9.362  1.00 39.09 ? 995  HOH A O     1 
HETATM 4276 O  O     . HOH J 8 .   ? 61.630 15.224  17.447  1.00 38.67 ? 996  HOH A O     1 
HETATM 4277 O  O     . HOH J 8 .   ? 56.058 -31.291 -3.936  1.00 41.46 ? 997  HOH A O     1 
HETATM 4278 O  O     . HOH J 8 .   ? 48.217 2.919   -26.772 1.00 45.77 ? 998  HOH A O     1 
HETATM 4279 O  O     . HOH J 8 .   ? 55.728 1.375   16.033  1.00 28.01 ? 999  HOH A O     1 
HETATM 4280 O  O     . HOH J 8 .   ? 73.335 -19.759 -2.700  1.00 21.72 ? 1000 HOH A O     1 
HETATM 4281 O  O     . HOH J 8 .   ? 64.992 -19.226 15.640  1.00 25.15 ? 1001 HOH A O     1 
HETATM 4282 O  O     . HOH J 8 .   ? 46.201 3.927   0.965   1.00 27.98 ? 1002 HOH A O     1 
HETATM 4283 O  O     . HOH K 8 .   ? 49.759 -9.238  -8.447  1.00 26.21 ? 101  HOH T O     1 
HETATM 4284 O  O     . HOH K 8 .   ? 41.021 -3.441  -9.409  1.00 28.95 ? 102  HOH T O     1 
HETATM 4285 O  O     . HOH K 8 .   ? 41.965 8.257   3.235   1.00 19.88 ? 103  HOH T O     1 
HETATM 4286 O  O     . HOH K 8 .   ? 42.081 -7.499  -10.649 1.00 32.48 ? 104  HOH T O     1 
HETATM 4287 O  O     . HOH K 8 .   ? 38.851 -2.395  -6.539  1.00 26.05 ? 105  HOH T O     1 
HETATM 4288 O  O     . HOH K 8 .   ? 37.017 -23.018 -5.308  1.00 27.57 ? 106  HOH T O     1 
HETATM 4289 O  O     . HOH K 8 .   ? 36.230 2.541   4.641   1.00 25.96 ? 107  HOH T O     1 
HETATM 4290 O  O     . HOH K 8 .   ? 44.314 -8.660  -3.678  1.00 24.07 ? 108  HOH T O     1 
HETATM 4291 O  O     . HOH K 8 .   ? 45.084 -2.614  -3.785  1.00 25.98 ? 109  HOH T O     1 
HETATM 4292 O  O     . HOH K 8 .   ? 41.730 -20.083 -3.464  1.00 29.10 ? 110  HOH T O     1 
HETATM 4293 O  O     . HOH K 8 .   ? 37.564 0.034   4.555   1.00 28.27 ? 111  HOH T O     1 
HETATM 4294 O  O     . HOH K 8 .   ? 43.488 5.315   -9.122  1.00 25.66 ? 112  HOH T O     1 
HETATM 4295 O  O     . HOH K 8 .   ? 33.931 8.935   11.510  1.00 37.01 ? 113  HOH T O     1 
HETATM 4296 O  O     . HOH K 8 .   ? 32.243 14.041  10.770  1.00 34.86 ? 114  HOH T O     1 
HETATM 4297 O  O     . HOH K 8 .   ? 37.744 -12.933 -11.171 1.00 26.90 ? 115  HOH T O     1 
HETATM 4298 O  O     . HOH K 8 .   ? 45.451 -5.227  -3.311  1.00 30.68 ? 116  HOH T O     1 
HETATM 4299 O  O     . HOH K 8 .   ? 40.191 -18.188 -1.564  1.00 32.57 ? 117  HOH T O     1 
HETATM 4300 O  O     . HOH K 8 .   ? 38.425 -1.777  6.232   1.00 39.52 ? 118  HOH T O     1 
HETATM 4301 O  O     . HOH K 8 .   ? 43.825 0.677   10.530  1.00 37.03 ? 119  HOH T O     1 
HETATM 4302 O  O     . HOH K 8 .   ? 36.668 -1.783  -1.056  1.00 30.82 ? 120  HOH T O     1 
HETATM 4303 O  O     . HOH K 8 .   ? 35.106 5.456   18.075  1.00 40.25 ? 121  HOH T O     1 
HETATM 4304 O  O     . HOH K 8 .   ? 36.737 -2.948  -4.292  1.00 29.96 ? 122  HOH T O     1 
HETATM 4305 O  O     . HOH K 8 .   ? 34.638 1.283   17.860  1.00 42.21 ? 123  HOH T O     1 
HETATM 4306 O  O     . HOH K 8 .   ? 44.480 1.112   -2.050  1.00 33.69 ? 124  HOH T O     1 
HETATM 4307 O  O     . HOH K 8 .   ? 43.742 5.712   0.434   1.00 26.38 ? 125  HOH T O     1 
HETATM 4308 O  O     . HOH K 8 .   ? 38.957 -10.167 -10.058 1.00 32.02 ? 126  HOH T O     1 
HETATM 4309 O  O     . HOH K 8 .   ? 36.674 -8.592  -9.997  1.00 37.73 ? 127  HOH T O     1 
HETATM 4310 O  O     . HOH K 8 .   ? 38.040 -4.306  -8.532  1.00 38.33 ? 128  HOH T O     1 
HETATM 4311 O  O     . HOH K 8 .   ? 41.067 -10.091 -11.608 1.00 36.52 ? 129  HOH T O     1 
HETATM 4312 O  O     . HOH K 8 .   ? 42.556 -11.220 -3.585  1.00 30.00 ? 130  HOH T O     1 
HETATM 4313 O  O     . HOH K 8 .   ? 29.201 0.496   13.691  1.00 46.42 ? 131  HOH T O     1 
HETATM 4314 O  O     . HOH K 8 .   ? 40.214 -22.103 -6.672  1.00 35.65 ? 132  HOH T O     1 
HETATM 4315 O  O     . HOH K 8 .   ? 38.022 -21.789 -3.012  1.00 33.85 ? 133  HOH T O     1 
HETATM 4316 O  O     . HOH K 8 .   ? 35.877 -1.331  7.549   1.00 38.16 ? 134  HOH T O     1 
HETATM 4317 O  O     . HOH L 8 .   ? 49.045 2.456   0.895   0.50 15.25 ? 101  HOH P O     1 
HETATM 4318 O  O     . HOH L 8 .   ? 43.778 -14.513 5.571   1.00 12.65 ? 102  HOH P O     1 
HETATM 4319 O  O     . HOH L 8 .   ? 41.612 -15.746 1.681   1.00 21.09 ? 103  HOH P O     1 
HETATM 4320 O  O     . HOH L 8 .   ? 44.848 -8.243  -1.047  1.00 24.12 ? 104  HOH P O     1 
HETATM 4321 O  O     . HOH L 8 .   ? 42.830 -8.991  6.992   1.00 19.97 ? 105  HOH P O     1 
HETATM 4322 O  O     . HOH L 8 .   ? 46.223 -2.603  -0.686  1.00 23.31 ? 106  HOH P O     1 
HETATM 4323 O  O     . HOH L 8 .   ? 44.166 -12.877 -0.297  1.00 23.58 ? 107  HOH P O     1 
HETATM 4324 O  O     . HOH L 8 .   ? 51.679 -8.210  4.635   1.00 26.36 ? 108  HOH P O     1 
HETATM 4325 O  O     . HOH L 8 .   ? 41.802 -11.761 -1.039  1.00 23.43 ? 109  HOH P O     1 
HETATM 4326 O  O     . HOH L 8 .   ? 49.382 -10.046 6.694   1.00 20.52 ? 110  HOH P O     1 
HETATM 4327 O  O     . HOH L 8 .   ? 40.524 -5.344  5.613   1.00 28.55 ? 111  HOH P O     1 
HETATM 4328 O  O     . HOH L 8 .   ? 40.409 -9.121  5.957   1.00 27.25 ? 112  HOH P O     1 
HETATM 4329 O  O     . HOH L 8 .   ? 35.096 -4.499  -1.155  1.00 29.63 ? 113  HOH P O     1 
HETATM 4330 O  O     . HOH L 8 .   ? 38.612 -3.918  4.578   1.00 33.13 ? 114  HOH P O     1 
HETATM 4331 O  O     . HOH L 8 .   ? 38.953 -10.715 9.221   1.00 38.70 ? 115  HOH P O     1 
HETATM 4332 O  O     . HOH L 8 .   ? 36.566 -4.726  3.219   1.00 26.78 ? 116  HOH P O     1 
HETATM 4333 O  O     . HOH L 8 .   ? 38.230 -10.781 6.184   1.00 30.26 ? 117  HOH P O     1 
HETATM 4334 O  O     . HOH L 8 .   ? 32.239 -5.696  -3.508  1.00 38.77 ? 118  HOH P O     1 
HETATM 4335 O  O     . HOH L 8 .   ? 47.966 -2.004  6.900   1.00 33.00 ? 119  HOH P O     1 
HETATM 4336 O  O     . HOH L 8 .   ? 40.312 -14.512 -0.296  1.00 35.62 ? 120  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NA  1   502  501 NA  NA  A . 
E 5 CA  1   503  502 CA  CA  A . 
F 6 GOL 1   504  436 GOL GOL A . 
G 6 GOL 1   505  437 GOL GOL A . 
H 6 GOL 1   506  438 GOL GOL A . 
I 7 DTP 1   501  9   DTP DTP P . 
J 8 HOH 1   601  2   HOH HOH A . 
J 8 HOH 2   602  3   HOH HOH A . 
J 8 HOH 3   603  4   HOH HOH A . 
J 8 HOH 4   604  6   HOH HOH A . 
J 8 HOH 5   605  7   HOH HOH A . 
J 8 HOH 6   606  8   HOH HOH A . 
J 8 HOH 7   607  9   HOH HOH A . 
J 8 HOH 8   608  10  HOH HOH A . 
J 8 HOH 9   609  11  HOH HOH A . 
J 8 HOH 10  610  12  HOH HOH A . 
J 8 HOH 11  611  13  HOH HOH A . 
J 8 HOH 12  612  14  HOH HOH A . 
J 8 HOH 13  613  15  HOH HOH A . 
J 8 HOH 14  614  16  HOH HOH A . 
J 8 HOH 15  615  17  HOH HOH A . 
J 8 HOH 16  616  18  HOH HOH A . 
J 8 HOH 17  617  19  HOH HOH A . 
J 8 HOH 18  618  20  HOH HOH A . 
J 8 HOH 19  619  21  HOH HOH A . 
J 8 HOH 20  620  22  HOH HOH A . 
J 8 HOH 21  621  23  HOH HOH A . 
J 8 HOH 22  622  24  HOH HOH A . 
J 8 HOH 23  623  25  HOH HOH A . 
J 8 HOH 24  624  26  HOH HOH A . 
J 8 HOH 25  625  27  HOH HOH A . 
J 8 HOH 26  626  28  HOH HOH A . 
J 8 HOH 27  627  29  HOH HOH A . 
J 8 HOH 28  628  30  HOH HOH A . 
J 8 HOH 29  629  31  HOH HOH A . 
J 8 HOH 30  630  32  HOH HOH A . 
J 8 HOH 31  631  33  HOH HOH A . 
J 8 HOH 32  632  34  HOH HOH A . 
J 8 HOH 33  633  35  HOH HOH A . 
J 8 HOH 34  634  36  HOH HOH A . 
J 8 HOH 35  635  37  HOH HOH A . 
J 8 HOH 36  636  38  HOH HOH A . 
J 8 HOH 37  637  39  HOH HOH A . 
J 8 HOH 38  638  40  HOH HOH A . 
J 8 HOH 39  639  41  HOH HOH A . 
J 8 HOH 40  640  42  HOH HOH A . 
J 8 HOH 41  641  44  HOH HOH A . 
J 8 HOH 42  642  45  HOH HOH A . 
J 8 HOH 43  643  46  HOH HOH A . 
J 8 HOH 44  644  47  HOH HOH A . 
J 8 HOH 45  645  48  HOH HOH A . 
J 8 HOH 46  646  49  HOH HOH A . 
J 8 HOH 47  647  51  HOH HOH A . 
J 8 HOH 48  648  52  HOH HOH A . 
J 8 HOH 49  649  53  HOH HOH A . 
J 8 HOH 50  650  54  HOH HOH A . 
J 8 HOH 51  651  55  HOH HOH A . 
J 8 HOH 52  652  56  HOH HOH A . 
J 8 HOH 53  653  57  HOH HOH A . 
J 8 HOH 54  654  58  HOH HOH A . 
J 8 HOH 55  655  59  HOH HOH A . 
J 8 HOH 56  656  60  HOH HOH A . 
J 8 HOH 57  657  61  HOH HOH A . 
J 8 HOH 58  658  63  HOH HOH A . 
J 8 HOH 59  659  64  HOH HOH A . 
J 8 HOH 60  660  66  HOH HOH A . 
J 8 HOH 61  661  67  HOH HOH A . 
J 8 HOH 62  662  68  HOH HOH A . 
J 8 HOH 63  663  69  HOH HOH A . 
J 8 HOH 64  664  71  HOH HOH A . 
J 8 HOH 65  665  72  HOH HOH A . 
J 8 HOH 66  666  73  HOH HOH A . 
J 8 HOH 67  667  74  HOH HOH A . 
J 8 HOH 68  668  75  HOH HOH A . 
J 8 HOH 69  669  76  HOH HOH A . 
J 8 HOH 70  670  78  HOH HOH A . 
J 8 HOH 71  671  79  HOH HOH A . 
J 8 HOH 72  672  80  HOH HOH A . 
J 8 HOH 73  673  82  HOH HOH A . 
J 8 HOH 74  674  83  HOH HOH A . 
J 8 HOH 75  675  84  HOH HOH A . 
J 8 HOH 76  676  85  HOH HOH A . 
J 8 HOH 77  677  87  HOH HOH A . 
J 8 HOH 78  678  88  HOH HOH A . 
J 8 HOH 79  679  89  HOH HOH A . 
J 8 HOH 80  680  90  HOH HOH A . 
J 8 HOH 81  681  91  HOH HOH A . 
J 8 HOH 82  682  92  HOH HOH A . 
J 8 HOH 83  683  94  HOH HOH A . 
J 8 HOH 84  684  95  HOH HOH A . 
J 8 HOH 85  685  96  HOH HOH A . 
J 8 HOH 86  686  97  HOH HOH A . 
J 8 HOH 87  687  99  HOH HOH A . 
J 8 HOH 88  688  100 HOH HOH A . 
J 8 HOH 89  689  101 HOH HOH A . 
J 8 HOH 90  690  102 HOH HOH A . 
J 8 HOH 91  691  104 HOH HOH A . 
J 8 HOH 92  692  107 HOH HOH A . 
J 8 HOH 93  693  108 HOH HOH A . 
J 8 HOH 94  694  109 HOH HOH A . 
J 8 HOH 95  695  110 HOH HOH A . 
J 8 HOH 96  696  111 HOH HOH A . 
J 8 HOH 97  697  112 HOH HOH A . 
J 8 HOH 98  698  113 HOH HOH A . 
J 8 HOH 99  699  114 HOH HOH A . 
J 8 HOH 100 700  115 HOH HOH A . 
J 8 HOH 101 701  116 HOH HOH A . 
J 8 HOH 102 702  117 HOH HOH A . 
J 8 HOH 103 703  118 HOH HOH A . 
J 8 HOH 104 704  119 HOH HOH A . 
J 8 HOH 105 705  120 HOH HOH A . 
J 8 HOH 106 706  121 HOH HOH A . 
J 8 HOH 107 707  122 HOH HOH A . 
J 8 HOH 108 708  123 HOH HOH A . 
J 8 HOH 109 709  124 HOH HOH A . 
J 8 HOH 110 710  125 HOH HOH A . 
J 8 HOH 111 711  126 HOH HOH A . 
J 8 HOH 112 712  128 HOH HOH A . 
J 8 HOH 113 713  130 HOH HOH A . 
J 8 HOH 114 714  131 HOH HOH A . 
J 8 HOH 115 715  132 HOH HOH A . 
J 8 HOH 116 716  133 HOH HOH A . 
J 8 HOH 117 717  134 HOH HOH A . 
J 8 HOH 118 718  135 HOH HOH A . 
J 8 HOH 119 719  136 HOH HOH A . 
J 8 HOH 120 720  137 HOH HOH A . 
J 8 HOH 121 721  138 HOH HOH A . 
J 8 HOH 122 722  140 HOH HOH A . 
J 8 HOH 123 723  141 HOH HOH A . 
J 8 HOH 124 724  142 HOH HOH A . 
J 8 HOH 125 725  143 HOH HOH A . 
J 8 HOH 126 726  144 HOH HOH A . 
J 8 HOH 127 727  145 HOH HOH A . 
J 8 HOH 128 728  146 HOH HOH A . 
J 8 HOH 129 729  147 HOH HOH A . 
J 8 HOH 130 730  148 HOH HOH A . 
J 8 HOH 131 731  149 HOH HOH A . 
J 8 HOH 132 732  150 HOH HOH A . 
J 8 HOH 133 733  151 HOH HOH A . 
J 8 HOH 134 734  152 HOH HOH A . 
J 8 HOH 135 735  153 HOH HOH A . 
J 8 HOH 136 736  154 HOH HOH A . 
J 8 HOH 137 737  155 HOH HOH A . 
J 8 HOH 138 738  156 HOH HOH A . 
J 8 HOH 139 739  157 HOH HOH A . 
J 8 HOH 140 740  158 HOH HOH A . 
J 8 HOH 141 741  159 HOH HOH A . 
J 8 HOH 142 742  160 HOH HOH A . 
J 8 HOH 143 743  161 HOH HOH A . 
J 8 HOH 144 744  162 HOH HOH A . 
J 8 HOH 145 745  164 HOH HOH A . 
J 8 HOH 146 746  165 HOH HOH A . 
J 8 HOH 147 747  166 HOH HOH A . 
J 8 HOH 148 748  167 HOH HOH A . 
J 8 HOH 149 749  168 HOH HOH A . 
J 8 HOH 150 750  169 HOH HOH A . 
J 8 HOH 151 751  170 HOH HOH A . 
J 8 HOH 152 752  171 HOH HOH A . 
J 8 HOH 153 753  172 HOH HOH A . 
J 8 HOH 154 754  173 HOH HOH A . 
J 8 HOH 155 755  174 HOH HOH A . 
J 8 HOH 156 756  175 HOH HOH A . 
J 8 HOH 157 757  176 HOH HOH A . 
J 8 HOH 158 758  177 HOH HOH A . 
J 8 HOH 159 759  180 HOH HOH A . 
J 8 HOH 160 760  181 HOH HOH A . 
J 8 HOH 161 761  182 HOH HOH A . 
J 8 HOH 162 762  183 HOH HOH A . 
J 8 HOH 163 763  184 HOH HOH A . 
J 8 HOH 164 764  185 HOH HOH A . 
J 8 HOH 165 765  186 HOH HOH A . 
J 8 HOH 166 766  188 HOH HOH A . 
J 8 HOH 167 767  189 HOH HOH A . 
J 8 HOH 168 768  190 HOH HOH A . 
J 8 HOH 169 769  191 HOH HOH A . 
J 8 HOH 170 770  192 HOH HOH A . 
J 8 HOH 171 771  193 HOH HOH A . 
J 8 HOH 172 772  194 HOH HOH A . 
J 8 HOH 173 773  196 HOH HOH A . 
J 8 HOH 174 774  197 HOH HOH A . 
J 8 HOH 175 775  198 HOH HOH A . 
J 8 HOH 176 776  199 HOH HOH A . 
J 8 HOH 177 777  200 HOH HOH A . 
J 8 HOH 178 778  201 HOH HOH A . 
J 8 HOH 179 779  202 HOH HOH A . 
J 8 HOH 180 780  204 HOH HOH A . 
J 8 HOH 181 781  205 HOH HOH A . 
J 8 HOH 182 782  206 HOH HOH A . 
J 8 HOH 183 783  207 HOH HOH A . 
J 8 HOH 184 784  208 HOH HOH A . 
J 8 HOH 185 785  209 HOH HOH A . 
J 8 HOH 186 786  210 HOH HOH A . 
J 8 HOH 187 787  211 HOH HOH A . 
J 8 HOH 188 788  212 HOH HOH A . 
J 8 HOH 189 789  214 HOH HOH A . 
J 8 HOH 190 790  215 HOH HOH A . 
J 8 HOH 191 791  217 HOH HOH A . 
J 8 HOH 192 792  218 HOH HOH A . 
J 8 HOH 193 793  219 HOH HOH A . 
J 8 HOH 194 794  220 HOH HOH A . 
J 8 HOH 195 795  221 HOH HOH A . 
J 8 HOH 196 796  222 HOH HOH A . 
J 8 HOH 197 797  223 HOH HOH A . 
J 8 HOH 198 798  224 HOH HOH A . 
J 8 HOH 199 799  227 HOH HOH A . 
J 8 HOH 200 800  229 HOH HOH A . 
J 8 HOH 201 801  230 HOH HOH A . 
J 8 HOH 202 802  231 HOH HOH A . 
J 8 HOH 203 803  232 HOH HOH A . 
J 8 HOH 204 804  233 HOH HOH A . 
J 8 HOH 205 805  234 HOH HOH A . 
J 8 HOH 206 806  235 HOH HOH A . 
J 8 HOH 207 807  236 HOH HOH A . 
J 8 HOH 208 808  237 HOH HOH A . 
J 8 HOH 209 809  238 HOH HOH A . 
J 8 HOH 210 810  239 HOH HOH A . 
J 8 HOH 211 811  240 HOH HOH A . 
J 8 HOH 212 812  241 HOH HOH A . 
J 8 HOH 213 813  242 HOH HOH A . 
J 8 HOH 214 814  244 HOH HOH A . 
J 8 HOH 215 815  245 HOH HOH A . 
J 8 HOH 216 816  247 HOH HOH A . 
J 8 HOH 217 817  248 HOH HOH A . 
J 8 HOH 218 818  249 HOH HOH A . 
J 8 HOH 219 819  250 HOH HOH A . 
J 8 HOH 220 820  251 HOH HOH A . 
J 8 HOH 221 821  252 HOH HOH A . 
J 8 HOH 222 822  253 HOH HOH A . 
J 8 HOH 223 823  255 HOH HOH A . 
J 8 HOH 224 824  256 HOH HOH A . 
J 8 HOH 225 825  257 HOH HOH A . 
J 8 HOH 226 826  259 HOH HOH A . 
J 8 HOH 227 827  260 HOH HOH A . 
J 8 HOH 228 828  263 HOH HOH A . 
J 8 HOH 229 829  264 HOH HOH A . 
J 8 HOH 230 830  265 HOH HOH A . 
J 8 HOH 231 831  266 HOH HOH A . 
J 8 HOH 232 832  268 HOH HOH A . 
J 8 HOH 233 833  269 HOH HOH A . 
J 8 HOH 234 834  270 HOH HOH A . 
J 8 HOH 235 835  272 HOH HOH A . 
J 8 HOH 236 836  277 HOH HOH A . 
J 8 HOH 237 837  278 HOH HOH A . 
J 8 HOH 238 838  279 HOH HOH A . 
J 8 HOH 239 839  280 HOH HOH A . 
J 8 HOH 240 840  281 HOH HOH A . 
J 8 HOH 241 841  282 HOH HOH A . 
J 8 HOH 242 842  283 HOH HOH A . 
J 8 HOH 243 843  284 HOH HOH A . 
J 8 HOH 244 844  285 HOH HOH A . 
J 8 HOH 245 845  287 HOH HOH A . 
J 8 HOH 246 846  288 HOH HOH A . 
J 8 HOH 247 847  289 HOH HOH A . 
J 8 HOH 248 848  290 HOH HOH A . 
J 8 HOH 249 849  291 HOH HOH A . 
J 8 HOH 250 850  292 HOH HOH A . 
J 8 HOH 251 851  293 HOH HOH A . 
J 8 HOH 252 852  294 HOH HOH A . 
J 8 HOH 253 853  295 HOH HOH A . 
J 8 HOH 254 854  296 HOH HOH A . 
J 8 HOH 255 855  297 HOH HOH A . 
J 8 HOH 256 856  298 HOH HOH A . 
J 8 HOH 257 857  299 HOH HOH A . 
J 8 HOH 258 858  300 HOH HOH A . 
J 8 HOH 259 859  301 HOH HOH A . 
J 8 HOH 260 860  302 HOH HOH A . 
J 8 HOH 261 861  303 HOH HOH A . 
J 8 HOH 262 862  304 HOH HOH A . 
J 8 HOH 263 863  305 HOH HOH A . 
J 8 HOH 264 864  306 HOH HOH A . 
J 8 HOH 265 865  307 HOH HOH A . 
J 8 HOH 266 866  308 HOH HOH A . 
J 8 HOH 267 867  309 HOH HOH A . 
J 8 HOH 268 868  310 HOH HOH A . 
J 8 HOH 269 869  311 HOH HOH A . 
J 8 HOH 270 870  313 HOH HOH A . 
J 8 HOH 271 871  314 HOH HOH A . 
J 8 HOH 272 872  315 HOH HOH A . 
J 8 HOH 273 873  316 HOH HOH A . 
J 8 HOH 274 874  317 HOH HOH A . 
J 8 HOH 275 875  318 HOH HOH A . 
J 8 HOH 276 876  319 HOH HOH A . 
J 8 HOH 277 877  320 HOH HOH A . 
J 8 HOH 278 878  321 HOH HOH A . 
J 8 HOH 279 879  322 HOH HOH A . 
J 8 HOH 280 880  324 HOH HOH A . 
J 8 HOH 281 881  325 HOH HOH A . 
J 8 HOH 282 882  326 HOH HOH A . 
J 8 HOH 283 883  327 HOH HOH A . 
J 8 HOH 284 884  328 HOH HOH A . 
J 8 HOH 285 885  329 HOH HOH A . 
J 8 HOH 286 886  330 HOH HOH A . 
J 8 HOH 287 887  331 HOH HOH A . 
J 8 HOH 288 888  332 HOH HOH A . 
J 8 HOH 289 889  333 HOH HOH A . 
J 8 HOH 290 890  334 HOH HOH A . 
J 8 HOH 291 891  335 HOH HOH A . 
J 8 HOH 292 892  336 HOH HOH A . 
J 8 HOH 293 893  337 HOH HOH A . 
J 8 HOH 294 894  338 HOH HOH A . 
J 8 HOH 295 895  339 HOH HOH A . 
J 8 HOH 296 896  340 HOH HOH A . 
J 8 HOH 297 897  341 HOH HOH A . 
J 8 HOH 298 898  342 HOH HOH A . 
J 8 HOH 299 899  343 HOH HOH A . 
J 8 HOH 300 900  344 HOH HOH A . 
J 8 HOH 301 901  345 HOH HOH A . 
J 8 HOH 302 902  346 HOH HOH A . 
J 8 HOH 303 903  347 HOH HOH A . 
J 8 HOH 304 904  348 HOH HOH A . 
J 8 HOH 305 905  349 HOH HOH A . 
J 8 HOH 306 906  350 HOH HOH A . 
J 8 HOH 307 907  351 HOH HOH A . 
J 8 HOH 308 908  352 HOH HOH A . 
J 8 HOH 309 909  353 HOH HOH A . 
J 8 HOH 310 910  354 HOH HOH A . 
J 8 HOH 311 911  355 HOH HOH A . 
J 8 HOH 312 912  356 HOH HOH A . 
J 8 HOH 313 913  357 HOH HOH A . 
J 8 HOH 314 914  358 HOH HOH A . 
J 8 HOH 315 915  359 HOH HOH A . 
J 8 HOH 316 916  360 HOH HOH A . 
J 8 HOH 317 917  361 HOH HOH A . 
J 8 HOH 318 918  362 HOH HOH A . 
J 8 HOH 319 919  363 HOH HOH A . 
J 8 HOH 320 920  364 HOH HOH A . 
J 8 HOH 321 921  365 HOH HOH A . 
J 8 HOH 322 922  366 HOH HOH A . 
J 8 HOH 323 923  367 HOH HOH A . 
J 8 HOH 324 924  369 HOH HOH A . 
J 8 HOH 325 925  370 HOH HOH A . 
J 8 HOH 326 926  372 HOH HOH A . 
J 8 HOH 327 927  373 HOH HOH A . 
J 8 HOH 328 928  374 HOH HOH A . 
J 8 HOH 329 929  376 HOH HOH A . 
J 8 HOH 330 930  377 HOH HOH A . 
J 8 HOH 331 931  378 HOH HOH A . 
J 8 HOH 332 932  379 HOH HOH A . 
J 8 HOH 333 933  380 HOH HOH A . 
J 8 HOH 334 934  382 HOH HOH A . 
J 8 HOH 335 935  383 HOH HOH A . 
J 8 HOH 336 936  384 HOH HOH A . 
J 8 HOH 337 937  385 HOH HOH A . 
J 8 HOH 338 938  386 HOH HOH A . 
J 8 HOH 339 939  387 HOH HOH A . 
J 8 HOH 340 940  388 HOH HOH A . 
J 8 HOH 341 941  389 HOH HOH A . 
J 8 HOH 342 942  390 HOH HOH A . 
J 8 HOH 343 943  391 HOH HOH A . 
J 8 HOH 344 944  392 HOH HOH A . 
J 8 HOH 345 945  393 HOH HOH A . 
J 8 HOH 346 946  394 HOH HOH A . 
J 8 HOH 347 947  395 HOH HOH A . 
J 8 HOH 348 948  397 HOH HOH A . 
J 8 HOH 349 949  398 HOH HOH A . 
J 8 HOH 350 950  399 HOH HOH A . 
J 8 HOH 351 951  401 HOH HOH A . 
J 8 HOH 352 952  402 HOH HOH A . 
J 8 HOH 353 953  404 HOH HOH A . 
J 8 HOH 354 954  406 HOH HOH A . 
J 8 HOH 355 955  407 HOH HOH A . 
J 8 HOH 356 956  408 HOH HOH A . 
J 8 HOH 357 957  409 HOH HOH A . 
J 8 HOH 358 958  410 HOH HOH A . 
J 8 HOH 359 959  411 HOH HOH A . 
J 8 HOH 360 960  412 HOH HOH A . 
J 8 HOH 361 961  413 HOH HOH A . 
J 8 HOH 362 962  414 HOH HOH A . 
J 8 HOH 363 963  415 HOH HOH A . 
J 8 HOH 364 964  416 HOH HOH A . 
J 8 HOH 365 965  417 HOH HOH A . 
J 8 HOH 366 966  418 HOH HOH A . 
J 8 HOH 367 967  420 HOH HOH A . 
J 8 HOH 368 968  421 HOH HOH A . 
J 8 HOH 369 969  423 HOH HOH A . 
J 8 HOH 370 970  424 HOH HOH A . 
J 8 HOH 371 971  425 HOH HOH A . 
J 8 HOH 372 972  426 HOH HOH A . 
J 8 HOH 373 973  427 HOH HOH A . 
J 8 HOH 374 974  428 HOH HOH A . 
J 8 HOH 375 975  429 HOH HOH A . 
J 8 HOH 376 976  430 HOH HOH A . 
J 8 HOH 377 977  431 HOH HOH A . 
J 8 HOH 378 978  432 HOH HOH A . 
J 8 HOH 379 979  433 HOH HOH A . 
J 8 HOH 380 980  434 HOH HOH A . 
J 8 HOH 381 981  435 HOH HOH A . 
J 8 HOH 382 982  437 HOH HOH A . 
J 8 HOH 383 983  438 HOH HOH A . 
J 8 HOH 384 984  439 HOH HOH A . 
J 8 HOH 385 985  440 HOH HOH A . 
J 8 HOH 386 986  441 HOH HOH A . 
J 8 HOH 387 987  442 HOH HOH A . 
J 8 HOH 388 988  443 HOH HOH A . 
J 8 HOH 389 989  446 HOH HOH A . 
J 8 HOH 390 990  447 HOH HOH A . 
J 8 HOH 391 991  448 HOH HOH A . 
J 8 HOH 392 992  449 HOH HOH A . 
J 8 HOH 393 993  450 HOH HOH A . 
J 8 HOH 394 994  451 HOH HOH A . 
J 8 HOH 395 995  452 HOH HOH A . 
J 8 HOH 396 996  453 HOH HOH A . 
J 8 HOH 397 997  454 HOH HOH A . 
J 8 HOH 398 998  455 HOH HOH A . 
J 8 HOH 399 999  457 HOH HOH A . 
J 8 HOH 400 1000 458 HOH HOH A . 
J 8 HOH 401 1001 459 HOH HOH A . 
J 8 HOH 402 1002 93  HOH HOH A . 
K 8 HOH 1   101  129 HOH HOH T . 
K 8 HOH 2   102  50  HOH HOH T . 
K 8 HOH 3   103  77  HOH HOH T . 
K 8 HOH 4   104  86  HOH HOH T . 
K 8 HOH 5   105  98  HOH HOH T . 
K 8 HOH 6   106  127 HOH HOH T . 
K 8 HOH 7   107  139 HOH HOH T . 
K 8 HOH 8   108  163 HOH HOH T . 
K 8 HOH 9   109  179 HOH HOH T . 
K 8 HOH 10  110  203 HOH HOH T . 
K 8 HOH 11  111  213 HOH HOH T . 
K 8 HOH 12  112  216 HOH HOH T . 
K 8 HOH 13  113  225 HOH HOH T . 
K 8 HOH 14  114  226 HOH HOH T . 
K 8 HOH 15  115  228 HOH HOH T . 
K 8 HOH 16  116  243 HOH HOH T . 
K 8 HOH 17  117  254 HOH HOH T . 
K 8 HOH 18  118  258 HOH HOH T . 
K 8 HOH 19  119  261 HOH HOH T . 
K 8 HOH 20  120  262 HOH HOH T . 
K 8 HOH 21  121  267 HOH HOH T . 
K 8 HOH 22  122  271 HOH HOH T . 
K 8 HOH 23  123  273 HOH HOH T . 
K 8 HOH 24  124  286 HOH HOH T . 
K 8 HOH 25  125  312 HOH HOH T . 
K 8 HOH 26  126  323 HOH HOH T . 
K 8 HOH 27  127  368 HOH HOH T . 
K 8 HOH 28  128  396 HOH HOH T . 
K 8 HOH 29  129  400 HOH HOH T . 
K 8 HOH 30  130  422 HOH HOH T . 
K 8 HOH 31  131  436 HOH HOH T . 
K 8 HOH 32  132  444 HOH HOH T . 
K 8 HOH 33  133  445 HOH HOH T . 
K 8 HOH 34  134  456 HOH HOH T . 
L 8 HOH 1   101  1   HOH HOH P . 
L 8 HOH 2   102  5   HOH HOH P . 
L 8 HOH 3   103  43  HOH HOH P . 
L 8 HOH 4   104  62  HOH HOH P . 
L 8 HOH 5   105  65  HOH HOH P . 
L 8 HOH 6   106  70  HOH HOH P . 
L 8 HOH 7   107  81  HOH HOH P . 
L 8 HOH 8   108  103 HOH HOH P . 
L 8 HOH 9   109  105 HOH HOH P . 
L 8 HOH 10  110  106 HOH HOH P . 
L 8 HOH 11  111  178 HOH HOH P . 
L 8 HOH 12  112  187 HOH HOH P . 
L 8 HOH 13  113  195 HOH HOH P . 
L 8 HOH 14  114  246 HOH HOH P . 
L 8 HOH 15  115  274 HOH HOH P . 
L 8 HOH 16  116  275 HOH HOH P . 
L 8 HOH 17  117  276 HOH HOH P . 
L 8 HOH 18  118  371 HOH HOH P . 
L 8 HOH 19  119  403 HOH HOH P . 
L 8 HOH 20  120  405 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5750  ? 
1 MORE         -57   ? 
1 'SSA (A^2)'  22090 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 93.9  ? 
2  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 92.6  ? 
3  O2A   ? I DTP .   ? P DTP 501 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 89.4  ? 
4  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 112.3 ? 
5  O2A   ? I DTP .   ? P DTP 501 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 152.9 ? 
6  "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 82.8  ? 
7  OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 85.6  ? 
8  O2A   ? I DTP .   ? P DTP 501 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 87.7  ? 
9  "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 176.5 ? 
10 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 100.7 ? 
11 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 O     ? J HOH .   ? A HOH 725 ? 1_555 162.9 ? 
12 O2A   ? I DTP .   ? P DTP 501 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 O     ? J HOH .   ? A HOH 725 ? 1_555 69.1  ? 
13 "O3'" ? C DT  8   ? P DT  8   ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 O     ? J HOH .   ? A HOH 725 ? 1_555 88.7  ? 
14 OE1   ? A GLU 119 ? A GLU 116 ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 O     ? J HOH .   ? A HOH 725 ? 1_555 84.7  ? 
15 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 NA ? D NA . ? A NA 502 ? 1_555 O     ? J HOH .   ? A HOH 725 ? 1_555 92.2  ? 
16 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 88.1  ? 
17 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O3G   ? I DTP .   ? P DTP 501 ? 1_555 80.1  ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O3G   ? I DTP .   ? P DTP 501 ? 1_555 101.3 ? 
19 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 83.9  ? 
20 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 82.2  ? 
21 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 163.5 ? 
22 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 81.9  ? 
23 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 167.2 ? 
24 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 84.8  ? 
25 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 88.8  ? 
26 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 150.8 ? 
27 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 79.4  ? 
28 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 76.8  ? 
29 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 119.7 ? 
30 O2A   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 113.2 ? 
31 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 158.4 ? 
32 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 104.8 ? 
33 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 113.2 ? 
34 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 80.9  ? 
35 O2A   ? I DTP .   ? P DTP 501 ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 82.6  ? 
36 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 503 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 50.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 7 ? ? "C1'" T DG 7 ? ? N9 T DG 7 ? ? 110.75 108.30 2.45 0.30 N 
2 1 "O4'" P DG 2 ? B "C1'" P DG 2 ? B N9 P DG 2 ? ? 110.19 108.30 1.89 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 23.80   66.33   
2 1 TYR A 39  ? ? 64.93   173.00  
3 1 LYS A 40  ? ? -150.27 -28.91  
4 1 SER A 62  ? ? 82.53   -13.39  
5 1 SER A 217 ? ? -153.09 -157.55 
6 1 SER A 257 ? ? 92.61   -11.22  
7 1 ASN A 407 ? ? -69.57  96.87   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ED3 'double helix'        
4ED3 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 6  1_555 C DA 7 1_555 0.009  -0.093 0.211  -1.446 -13.324 2.642 1 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.158 -0.095 -0.346 -8.521 -3.014  0.336 2 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.189  -0.130 0.026  3.541  -4.122  0.491 3 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.342  -0.126 -0.311 10.777 -6.667  1.079 4 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.506 -0.090 -0.058 -4.433 -8.566  3.264 5 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.177  -0.071 0.193  -7.919 -3.484  1.085 6 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.120 -0.239 -0.160 17.063 -0.681  4.146 7 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.312 -1.174 3.453 6.272  8.477  29.254 -3.819 1.786  2.882 16.137 
-11.939 31.058 1 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.664 -0.376 3.122 -2.307 0.750  35.221 -0.727 0.767  3.149 1.237  3.808 
35.302 2 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.413  -0.731 3.230 3.266  0.453  31.336 -1.430 -0.157 3.245 0.836  -6.026 
31.505 3 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.384 -0.690 3.728 -5.110 7.883  33.109 -2.554 -0.249 3.496 13.499 8.750 
34.380 4 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.582 -0.566 3.493 -2.596 -0.502 37.239 -0.814 0.541  3.531 -0.785 4.059 
37.329 5 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.170  0.181  2.904 -0.829 3.211  26.214 -0.365 -0.568 2.898 7.044  1.819 
26.419 6 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION'                        NA  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 water                               HOH 
#