data_4ED7
# 
_entry.id   4ED7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ED7         
NDB   NA1715       
RCSB  RCSB071469   
WWPDB D_1000071469 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED8 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ED7 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ED7 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ED7 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*G)-3')
;
3662.404  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*TP*GP*CP*GP*TP*CP*AP*T)-3')
;
2417.603  1   ?       ? ?                                     ? 
4 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
5 non-polymer syn GLYCEROL                                             92.094    2   ?       ? ? ? 
6 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
7 water       nat water                                                18.015    451 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DG)' CATTATGACGCG T ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' TGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DG  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ED7       4ED7   2 ? ? ? 
3 PDB 4ED7       4ED7   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ED7 A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ED7 T 1 ? 12  ? 4ED7   1 ? 12  ? 1 12  
3 3 4ED7 P 1 ? 8   ? 4ED7   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ED7 GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ED7 PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ED7 HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ED7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            283 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 283K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-08-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ED7 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.717 
_reflns.number_obs                   46860 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_netI_over_sigmaI        12.7 
_reflns.B_iso_Wilson_estimate        17.020 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.72 
_reflns_shell.d_res_low                   1.75 
_reflns_shell.percent_possible_all        98.5 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.693 
_reflns_shell.meanI_over_sigI_obs         1.7 
_reflns_shell.pdbx_redundancy             2.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ED7 
_refine.ls_number_reflns_obs                     46797 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.517 
_refine.ls_d_res_high                            1.717 
_refine.ls_percent_reflns_obs                    95.93 
_refine.ls_R_factor_obs                          0.1812 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1794 
_refine.ls_R_factor_R_free                       0.2140 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  2370 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               25.1097 
_refine.aniso_B[1][1]                            -0.7680 
_refine.aniso_B[2][2]                            -0.7680 
_refine.aniso_B[3][3]                            1.5359 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.334 
_refine.solvent_model_param_bsol                 38.518 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.21 
_refine.overall_FOM_work_R_set                   0.8635 
_refine.B_iso_max                                94.090 
_refine.B_iso_min                                5.040 
_refine.pdbx_overall_phase_error                 21.2700 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.200 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   388 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             451 
_refine_hist.number_atoms_total               4248 
_refine_hist.d_res_high                       1.717 
_refine_hist.d_res_low                        28.517 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           3992 0.005  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5489 1.067  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     611  0.064  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      633  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1560 18.092 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.7171 1.7521  17 87.0000 2360 . 0.2529 0.2967 . 119 . 2479 . 'X-RAY DIFFRACTION' . 
1.7521 1.7902  17 98.0000 2699 . 0.2239 0.2701 . 147 . 2846 . 'X-RAY DIFFRACTION' . 
1.7902 1.8319  17 98.0000 2656 . 0.2176 0.2579 . 138 . 2794 . 'X-RAY DIFFRACTION' . 
1.8319 1.8777  17 98.0000 2655 . 0.2164 0.2837 . 146 . 2801 . 'X-RAY DIFFRACTION' . 
1.8777 1.9284  17 98.0000 2661 . 0.2044 0.2569 . 125 . 2786 . 'X-RAY DIFFRACTION' . 
1.9284 1.9851  17 98.0000 2643 . 0.1932 0.2377 . 152 . 2795 . 'X-RAY DIFFRACTION' . 
1.9851 2.0492  17 98.0000 2670 . 0.1812 0.2418 . 124 . 2794 . 'X-RAY DIFFRACTION' . 
2.0492 2.1224  17 97.0000 2613 . 0.1687 0.1849 . 165 . 2778 . 'X-RAY DIFFRACTION' . 
2.1224 2.2074  17 97.0000 2640 . 0.1600 0.1978 . 150 . 2790 . 'X-RAY DIFFRACTION' . 
2.2074 2.3078  17 97.0000 2636 . 0.1654 0.2346 . 132 . 2768 . 'X-RAY DIFFRACTION' . 
2.3078 2.4294  17 97.0000 2637 . 0.1729 0.1870 . 131 . 2768 . 'X-RAY DIFFRACTION' . 
2.4294 2.5815  17 96.0000 2623 . 0.1833 0.2355 . 137 . 2760 . 'X-RAY DIFFRACTION' . 
2.5815 2.7807  17 96.0000 2585 . 0.1820 0.2330 . 156 . 2741 . 'X-RAY DIFFRACTION' . 
2.7807 3.0602  17 95.0000 2608 . 0.1870 0.2581 . 142 . 2750 . 'X-RAY DIFFRACTION' . 
3.0602 3.5024  17 94.0000 2578 . 0.1698 0.1894 . 140 . 2718 . 'X-RAY DIFFRACTION' . 
3.5024 4.4100  17 94.0000 2571 . 0.1469 0.1664 . 140 . 2711 . 'X-RAY DIFFRACTION' . 
4.4100 28.5210 17 92.0000 2592 . 0.1659 0.1753 . 126 . 2718 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ED7 
_struct.title                     'Human DNA polymerase eta - DNA ternary complex: TG crystal at pH 7.0 (K+ MES) with 1 Ca2+ ion' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ED7 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G DTP .   O3G ? ? ? 1_555 D CA . CA ? ? P DTP 501 A CA 502 1_555 ? ? ? ? ? ? ?               2.304 ? 
metalc2  metalc ? ? G DTP .   O1B ? ? ? 1_555 D CA . CA ? ? P DTP 501 A CA 502 1_555 ? ? ? ? ? ? ?               2.348 ? 
metalc3  metalc ? ? A ASP 16  OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 13  A CA 502 1_555 ? ? ? ? ? ? ?               2.355 ? 
metalc4  metalc ? ? A MET 17  O   ? ? ? 1_555 D CA . CA ? ? A MET 14  A CA 502 1_555 ? ? ? ? ? ? ?               2.367 ? 
metalc5  metalc ? ? A ASP 118 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 115 A CA 502 1_555 ? ? ? ? ? ? ?               2.374 ? 
metalc6  metalc ? ? G DTP .   O2A ? ? ? 1_555 D CA . CA ? ? P DTP 501 A CA 502 1_555 ? ? ? ? ? ? ?               2.376 ? 
hydrog1  hydrog ? ? B DA  5   N1  ? ? ? 1_555 C DT 8 N3 ? ? T DA  5   P DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? B DA  5   N6  ? ? ? 1_555 C DT 8 O4 ? ? T DA  5   P DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? B DT  6   N3  ? ? ? 1_555 C DA 7 N1 ? ? T DT  6   P DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? B DT  6   O4  ? ? ? 1_555 C DA 7 N6 ? ? T DT  6   P DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC 6 N3 ? ? T DG  7   P DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC 6 O2 ? ? T DG  7   P DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC 6 N4 ? ? T DG  7   P DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? B DA  8   N1  ? ? ? 1_555 C DT 5 N3 ? ? T DA  8   P DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? B DA  8   N6  ? ? ? 1_555 C DT 5 O4 ? ? T DA  8   P DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? B DC  9   N3  ? ? ? 1_555 C DG 4 N1 ? ? T DC  9   P DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? B DC  9   N4  ? ? ? 1_555 C DG 4 O6 ? ? T DC  9   P DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? B DC  9   O2  ? ? ? 1_555 C DG 4 N2 ? ? T DC  9   P DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? B DG  10  N1  ? ? ? 1_555 C DC 3 N3 ? ? T DG  10  P DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? B DG  10  N2  ? ? ? 1_555 C DC 3 O2 ? ? T DG  10  P DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? B DG  10  O6  ? ? ? 1_555 C DC 3 N4 ? ? T DG  10  P DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? B DC  11  N3  ? ? ? 1_555 C DG 2 N1 ? ? T DC  11  P DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? B DC  11  N4  ? ? ? 1_555 C DG 2 O6 ? ? T DC  11  P DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? B DC  11  O2  ? ? ? 1_555 C DG 2 N2 ? ? T DC  11  P DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? B DG  12  N1  A ? ? 1_555 C DT 1 O2 ? ? T DG  12  P DT 1   1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.74  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -1.53 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -6.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE DTP P 501' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 502'  
AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 503' 
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE GOL A 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 27 ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 27 MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 27 ASP A 18  ? ASP A 15  . ? 1_555 ? 
4  AC1 27 CYS A 19  ? CYS A 16  . ? 1_555 ? 
5  AC1 27 PHE A 20  ? PHE A 17  . ? 1_555 ? 
6  AC1 27 PHE A 21  ? PHE A 18  . ? 1_555 ? 
7  AC1 27 ILE A 51  ? ILE A 48  . ? 1_555 ? 
8  AC1 27 ALA A 52  ? ALA A 49  . ? 1_555 ? 
9  AC1 27 TYR A 55  ? TYR A 52  . ? 1_555 ? 
10 AC1 27 ARG A 58  ? ARG A 55  . ? 1_555 ? 
11 AC1 27 ARG A 64  ? ARG A 61  . ? 1_555 ? 
12 AC1 27 ASP A 118 ? ASP A 115 . ? 1_555 ? 
13 AC1 27 LYS A 234 ? LYS A 231 . ? 1_555 ? 
14 AC1 27 CA  D .   ? CA  A 502 . ? 1_555 ? 
15 AC1 27 HOH H .   ? HOH A 616 . ? 1_555 ? 
16 AC1 27 HOH H .   ? HOH A 617 . ? 1_555 ? 
17 AC1 27 HOH H .   ? HOH A 646 . ? 1_555 ? 
18 AC1 27 HOH H .   ? HOH A 800 . ? 1_555 ? 
19 AC1 27 HOH H .   ? HOH A 929 . ? 1_555 ? 
20 AC1 27 HOH H .   ? HOH A 943 . ? 1_555 ? 
21 AC1 27 HOH H .   ? HOH A 997 . ? 1_555 ? 
22 AC1 27 HOH H .   ? HOH A 998 . ? 1_555 ? 
23 AC1 27 DT  C 8   ? DT  P 8   . ? 1_555 ? 
24 AC1 27 HOH J .   ? HOH P 108 . ? 1_555 ? 
25 AC1 27 DT  B 3   ? DT  T 3   . ? 1_555 ? 
26 AC1 27 DT  B 4   ? DT  T 4   . ? 1_555 ? 
27 AC1 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
28 AC2 4  ASP A 16  ? ASP A 13  . ? 1_555 ? 
29 AC2 4  MET A 17  ? MET A 14  . ? 1_555 ? 
30 AC2 4  ASP A 118 ? ASP A 115 . ? 1_555 ? 
31 AC2 4  DTP G .   ? DTP P 501 . ? 1_555 ? 
32 AC3 11 ARG A 27  ? ARG A 24  . ? 6_545 ? 
33 AC3 11 PRO A 247 ? PRO A 244 . ? 1_555 ? 
34 AC3 11 PHE A 250 ? PHE A 247 . ? 1_555 ? 
35 AC3 11 SER A 251 ? SER A 248 . ? 1_555 ? 
36 AC3 11 GLY A 279 ? GLY A 276 . ? 1_555 ? 
37 AC3 11 GLU A 280 ? GLU A 277 . ? 1_555 ? 
38 AC3 11 HOH H .   ? HOH A 602 . ? 1_555 ? 
39 AC3 11 HOH H .   ? HOH A 647 . ? 1_555 ? 
40 AC3 11 HOH H .   ? HOH A 649 . ? 1_555 ? 
41 AC3 11 HOH H .   ? HOH A 752 . ? 1_555 ? 
42 AC3 11 HOH H .   ? HOH A 753 . ? 1_555 ? 
43 AC4 11 ASN A 29  ? ASN A 26  . ? 1_555 ? 
44 AC4 11 PRO A 30  ? PRO A 27  . ? 1_555 ? 
45 AC4 11 HIS A 31  ? HIS A 28  . ? 1_555 ? 
46 AC4 11 GLY A 274 ? GLY A 271 . ? 5_664 ? 
47 AC4 11 ILE A 275 ? ILE A 272 . ? 5_664 ? 
48 AC4 11 GLU A 276 ? GLU A 273 . ? 5_664 ? 
49 AC4 11 TYR A 277 ? TYR A 274 . ? 5_664 ? 
50 AC4 11 GLU A 280 ? GLU A 277 . ? 5_664 ? 
51 AC4 11 HOH H .   ? HOH A 684 . ? 5_664 ? 
52 AC4 11 HOH H .   ? HOH A 805 . ? 1_555 ? 
53 AC4 11 HOH H .   ? HOH A 890 . ? 5_664 ? 
# 
_database_PDB_matrix.entry_id          4ED7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ED7 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 66.356 -34.038 -3.355  1.00 49.68 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.747 -33.961 -3.767  1.00 54.82 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.984 -33.040 -4.951  1.00 47.88 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.813 -31.824 -4.843  1.00 52.32 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.378 -33.622 -6.096  1.00 49.97 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.716 -32.894 -7.326  1.00 42.69 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.491 -32.383 -8.087  1.00 51.45 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.641 -31.620 -9.044  1.00 58.95 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.439 -33.955 -8.161  1.00 47.40 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.819 -35.242 -7.728  1.00 48.72 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.545 -35.078 -6.254  1.00 46.46 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.300 -32.797 -7.667  1.00 32.99 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.075 -32.448 -8.382  1.00 44.07 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.129 -31.612 -7.529  1.00 48.66 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.046 -31.234 -7.976  1.00 41.84 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.365 -33.716 -8.861  1.00 34.78 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.248 -34.634 -9.643  1.00 28.49 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.784 -34.287 -10.865 1.00 28.45 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.697 -35.883 -9.376  1.00 28.14 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.522 -35.284 -11.319 1.00 34.41 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.487 -36.263 -10.433 1.00 29.96 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.544 -31.325 -6.299  1.00 44.67 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.719 -30.546 -5.386  1.00 50.16 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.946 -29.053 -5.595  1.00 53.09 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.998 -28.521 -5.237  1.00 48.20 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 64.010 -30.928 -3.932  1.00 59.49 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.934 -30.482 -2.952  1.00 59.16 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.330 -31.235 -3.307  1.00 77.88 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.707 -32.969 -3.062  1.00 54.89 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.956 -28.384 -6.183  1.00 44.85 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 63.042 -26.948 -6.425  1.00 46.17 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.241 -26.206 -5.110  1.00 35.77 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.784 -26.657 -4.058  1.00 37.99 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.797 -26.449 -7.139  1.00 50.63 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.934 -25.074 -5.165  1.00 27.08 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.251 -24.336 -3.950  1.00 25.22 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.751 -22.898 -4.011  1.00 21.48 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.964 -22.123 -3.081  1.00 25.62 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.763 -24.346 -3.665  1.00 31.80 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.456 -23.650 -4.709  1.00 24.77 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.273 -25.783 -3.583  1.00 31.52 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 63.087 -22.551 -5.110  1.00 23.51 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.516 -21.224 -5.264  1.00 25.52 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.561 -20.137 -5.099  1.00 26.84 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.339 -19.144 -4.407  1.00 21.99 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.711 -20.335 -5.732  1.00 18.73 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.803 -19.367 -5.677  1.00 11.94 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.110 -18.805 -7.063  1.00 15.14 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.212 -18.310 -7.316  1.00 16.48 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 67.062 -20.020 -5.099  1.00 14.08 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 67.003 -20.289 -3.610  1.00 19.27 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.216 -21.061 -3.126  1.00 18.20 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.385 -22.235 -3.456  1.00 21.62 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 69.074 -20.405 -2.353  1.00 21.72 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.117 -18.871 -7.945  1.00 20.12 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.271 -18.528 -9.359  1.00 23.11 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.258 -17.024 -9.667  1.00 16.52 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.763 -16.594 -10.703 1.00 23.09 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.178 -19.233 -10.179 1.00 31.23 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.776 -19.042 -9.590  1.00 38.93 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.502 -19.571 -8.489  1.00 31.85 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.936 -18.376 -10.236 1.00 37.61 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.694 -16.232 -8.764  1.00 17.86 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.493 -14.809 -9.008  1.00 15.87 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 65.102 -13.967 -7.900  1.00 14.82 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.323 -14.449 -6.790  1.00 13.64 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.997 -14.494 -9.061  1.00 15.13 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.235 -15.134 -10.201 1.00 13.50 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.755 -14.791 -10.078 1.00 15.92 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 60.134 -15.427 -8.915  1.00 14.88 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 59.056 -14.961 -8.301  1.00 10.93 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.548 -15.605 -7.252  1.00 11.69 ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.482 -13.843 -8.739  1.00 12.05 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.376 -12.702 -8.203  1.00 13.69 ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.657 -11.722 -7.160  1.00 7.43  ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.518 -10.699 -7.191  1.00 14.28 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.280 -10.067 -8.217  1.00 13.71 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 67.009 -11.018 -7.363  1.00 10.64 ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.245 -9.995  -6.256  1.00 11.50 ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.158 -12.041 -7.395  1.00 11.93 ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.799 -10.566 -6.079  1.00 10.44 ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.625 -9.690  -6.011  1.00 9.87  ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.788 -8.760  -4.822  1.00 13.23 ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.207 -9.186  -3.745  1.00 12.96 ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.310 -10.508 -5.818  1.00 8.93  ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 60.115 -9.602  -5.563  1.00 12.04 ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 61.047 -11.397 -7.021  1.00 9.22  ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.456 -7.487  -5.009  1.00 13.60 ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.501 -6.539  -3.909  1.00 11.90 ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.126 -5.937  -3.704  1.00 11.29 ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.296 -5.923  -4.620  1.00 12.42 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.538 -5.436  -4.172  1.00 9.52  ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.881 -5.481  -2.483  1.00 9.23  ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.677 -4.730  -2.166  1.00 8.72  ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.143 -3.452  -1.495  1.00 15.36 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.839 -3.498  -0.478  1.00 11.28 ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.753 -5.528  -1.244  1.00 9.91  ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.390 -4.981  -0.801  1.00 16.41 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.510 -4.137  0.473   1.00 12.47 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.650 -4.198  -1.925  1.00 10.40 ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.777 -2.319  -2.091  1.00 10.17 ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.111 -1.004  -1.552  1.00 10.65 ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.850 -0.412  -0.937  1.00 11.98 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.784 -0.436  -1.554  1.00 11.34 ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.638 -0.071  -2.653  1.00 13.51 ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 60.896 1.337   -2.101  1.00 14.71 ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.901 -0.649  -3.269  1.00 17.78 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 58.978 0.115   0.278   1.00 10.41 ? 13  ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 57.833 0.575   1.066   1.00 10.37 ? 13  ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 58.219 1.937   1.670   1.00 8.72  ? 13  ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 59.135 2.010   2.484   1.00 12.04 ? 13  ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 57.569 -0.477  2.160   1.00 9.44  ? 13  ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 56.288 -0.256  2.920   1.00 26.20 ? 13  ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 55.714 0.832   2.814   1.00 13.52 ? 13  ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 55.858 -1.185  3.643   1.00 28.21 ? 13  ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 57.548 3.020   1.273   1.00 10.60 ? 14  MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 57.936 4.341   1.778   1.00 10.08 ? 14  MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 57.697 4.406   3.287   1.00 11.80 ? 14  MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 56.711 3.885   3.780   1.00 10.19 ? 14  MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 57.153 5.474   1.078   1.00 10.80 ? 14  MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 57.230 5.447   -0.454  1.00 12.58 ? 14  MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 58.926 5.413   -1.107  1.00 16.00 ? 14  MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 59.542 6.964   -0.481  1.00 15.60 ? 14  MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 58.591 5.043   4.028   1.00 9.70  ? 15  ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 58.350 5.220   5.461   1.00 8.79  ? 15  ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 57.278 6.267   5.721   1.00 13.63 ? 15  ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 57.228 7.288   5.032   1.00 11.39 ? 15  ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 59.639 5.596   6.182   1.00 8.08  ? 15  ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 60.720 4.544   6.013   1.00 12.23 ? 15  ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 60.381 3.353   5.913   1.00 13.15 ? 15  ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 61.899 4.911   5.988   1.00 15.25 ? 15  ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 56.430 6.006   6.717   1.00 9.74  ? 16  CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 55.327 6.911   7.086   1.00 8.83  ? 16  CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 54.960 7.890   5.966   1.00 10.26 ? 16  CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 55.106 9.101   6.108   1.00 10.26 ? 16  CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 55.639 7.649   8.396   1.00 10.48 ? 16  CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 57.215 8.558   8.437   1.00 13.63 ? 16  CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 54.453 7.350   4.860   1.00 9.05  ? 17  PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 54.430 8.079   3.592   1.00 10.31 ? 17  PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 53.729 9.440   3.621   1.00 8.69  ? 17  PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 54.320 10.445  3.235   1.00 8.79  ? 17  PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 53.802 7.227   2.488   1.00 7.64  ? 17  PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 53.909 7.850   1.120   1.00 10.69 ? 17  PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 55.124 8.337   0.666   1.00 11.12 ? 17  PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 52.805 7.932   0.290   1.00 13.64 ? 17  PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 55.230 8.913   -0.598  1.00 12.99 ? 17  PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 52.911 8.502   -0.979  1.00 11.87 ? 17  PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 54.118 8.984   -1.414  1.00 12.57 ? 17  PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 52.466 9.470   4.035   1.00 8.38  ? 18  PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 51.727 10.737  3.961   1.00 8.88  ? 18  PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 52.395 11.788  4.850   1.00 9.68  ? 18  PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 52.376 12.974  4.546   1.00 9.41  ? 18  PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 50.247 10.593  4.341   1.00 8.82  ? 18  PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 49.404 9.884   3.312   1.00 10.31 ? 18  PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 49.980 9.120   2.318   1.00 9.04  ? 18  PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 48.026 9.993   3.350   1.00 9.36  ? 18  PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 49.192 8.469   1.377   1.00 11.06 ? 18  PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 47.228 9.342   2.408   1.00 11.55 ? 18  PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 47.820 8.580   1.432   1.00 11.35 ? 18  PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 52.952 11.342  5.968   1.00 8.56  ? 19  VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 53.712 12.219  6.850   1.00 7.52  ? 19  VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 54.917 12.836  6.134   1.00 10.77 ? 19  VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 55.133 14.042  6.210   1.00 10.28 ? 19  VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 54.162 11.486  8.126   1.00 11.60 ? 19  VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 55.243 12.285  8.864   1.00 10.80 ? 19  VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 52.954 11.223  9.038   1.00 11.87 ? 19  VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 55.694 12.015  5.436   1.00 6.66  ? 20  GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 56.842 12.543  4.710   1.00 6.44  ? 20  GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 56.417 13.550  3.648   1.00 8.72  ? 20  GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 57.123 14.539  3.417   1.00 10.33 ? 20  GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 57.643 11.434  4.053   1.00 7.72  ? 20  GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 58.454 10.581  5.003   1.00 10.03 ? 20  GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 59.556 9.869   4.251   1.00 14.61 ? 20  GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 60.610 10.445  4.015   1.00 12.77 ? 20  GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 59.300 8.631   3.825   1.00 13.63 ? 20  GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 55.287 13.292  2.990   1.00 8.91  ? 21  VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 54.793 14.218  1.972   1.00 5.71  ? 21  VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 54.521 15.581  2.610   1.00 11.62 ? 21  VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 54.905 16.630  2.071   1.00 10.08 ? 21  VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 53.526 13.700  1.267   1.00 7.91  ? 21  VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 52.984 14.756  0.290   1.00 10.27 ? 21  VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 53.833 12.405  0.514   1.00 6.96  ? 21  VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 53.871 15.557  3.766   1.00 10.15 ? 22  GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 53.563 16.796  4.479   1.00 10.55 ? 22  GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 54.813 17.464  5.063   1.00 9.04  ? 22  GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 54.885 18.691  5.139   1.00 9.38  ? 22  GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 52.512 16.538  5.572   1.00 6.67  ? 22  GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 51.169 16.069  5.026   1.00 9.21  ? 22  GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 50.472 17.098  4.145   1.00 17.29 ? 22  GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 50.753 18.309  4.285   1.00 15.04 ? 22  GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 49.619 16.692  3.324   1.00 13.76 ? 22  GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 55.800 16.666  5.469   1.00 10.86 ? 23  GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 57.033 17.210  6.044   1.00 8.16  ? 23  GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 57.937 17.842  4.996   1.00 9.85  ? 23  GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 58.644 18.818  5.281   1.00 11.33 ? 23  GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 57.818 16.121  6.773   1.00 9.75  ? 23  GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 57.208 15.703  8.095   1.00 10.06 ? 23  GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 57.958 14.532  8.710   1.00 13.43 ? 23  GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 58.383 13.616  8.005   1.00 11.86 ? 23  GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 58.151 14.574  10.020  1.00 12.98 ? 23  GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 57.931 17.282  3.790   1.00 9.47  ? 24  ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 58.695 17.884  2.700   1.00 9.74  ? 24  ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 58.132 19.270  2.429   1.00 13.47 ? 24  ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 58.883 20.232  2.262   1.00 11.13 ? 24  ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 58.636 17.035  1.424   1.00 11.03 ? 24  ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 59.421 17.657  0.255   1.00 13.85 ? 24  ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 59.441 16.756  -0.988  1.00 11.85 ? 24  ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 58.141 16.683  -1.653  1.00 11.27 ? 24  ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 57.934 16.072  -2.814  1.00 11.21 ? 24  ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 58.944 15.476  -3.440  1.00 7.77  ? 24  ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 56.721 16.061  -3.354  1.00 12.42 ? 24  ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 56.804 19.367  2.409   1.00 9.88  ? 25  GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 56.128 20.621  2.081   1.00 12.28 ? 25  GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 56.284 21.664  3.186   1.00 15.17 ? 25  GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 56.452 22.856  2.912   1.00 14.67 ? 25  GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 54.639 20.368  1.817   1.00 12.11 ? 25  GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 53.823 21.630  1.531   1.00 16.97 ? 25  GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 52.353 21.321  1.311   1.00 18.73 ? 25  GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 52.016 20.346  0.657   1.00 19.69 ? 25  GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 51.475 22.144  1.874   1.00 27.15 ? 25  GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 56.217 21.211  4.434   1.00 11.04 ? 26  ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 56.268 22.112  5.586   1.00 10.90 ? 26  ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 57.411 21.719  6.512   1.00 9.80  ? 26  ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 57.264 20.844  7.358   1.00 13.22 ? 26  ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 54.937 22.096  6.359   1.00 12.34 ? 26  ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 54.940 23.059  7.553   1.00 10.21 ? 26  ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 55.967 23.640  7.886   1.00 15.84 ? 26  ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 53.777 23.229  8.192   1.00 16.66 ? 26  ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 58.574 22.362  6.344   1.00 12.96 ? 27  PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 59.769 22.007  7.111   1.00 14.90 ? 27  PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 59.585 22.088  8.634   1.00 15.63 ? 27  PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 60.336 21.438  9.361   1.00 14.58 ? 27  PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? 60.797 23.046  6.645   1.00 16.56 ? 27  PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? 60.347 23.414  5.270   1.00 15.63 ? 27  PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? 58.848 23.420  5.355   1.00 12.82 ? 27  PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 58.618 22.869  9.102   1.00 13.59 ? 28  HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 58.308 22.929  10.535  1.00 17.15 ? 28  HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 57.917 21.566  11.107  1.00 20.04 ? 28  HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 58.016 21.337  12.319  1.00 19.71 ? 28  HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? 57.174 23.919  10.804  1.00 17.62 ? 28  HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? 57.590 25.353  10.739  1.00 29.07 ? 28  HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? 56.896 26.295  10.009  1.00 31.84 ? 28  HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? 58.619 26.012  11.323  1.00 22.81 ? 28  HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? 57.483 27.470  10.140  1.00 40.31 ? 28  HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? 58.534 27.326  10.928  1.00 28.20 ? 28  HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 57.457 20.668  10.243  1.00 14.15 ? 29  LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 57.022 19.339  10.683  1.00 15.32 ? 29  LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 58.165 18.328  10.719  1.00 17.27 ? 29  LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 58.015 17.240  11.280  1.00 11.98 ? 29  LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 55.894 18.802  9.781   1.00 9.40  ? 29  LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 54.653 19.685  9.686   1.00 13.42 ? 29  LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 53.630 19.074  8.754   1.00 10.87 ? 29  LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 54.054 19.936  11.070  1.00 16.09 ? 29  LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 59.304 18.673  10.118  1.00 10.45 ? 30  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 60.406 17.717  10.004  1.00 11.32 ? 30  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 61.021 17.354  11.357  1.00 12.53 ? 30  ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 61.165 18.206  12.230  1.00 14.91 ? 30  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 61.481 18.261  9.060   1.00 14.52 ? 30  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 60.956 18.489  7.654   1.00 12.77 ? 30  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 62.011 19.092  6.741   1.00 16.05 ? 30  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 61.457 19.412  5.426   1.00 13.23 ? 30  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 62.177 19.910  4.427   1.00 21.27 ? 30  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 63.472 20.135  4.597   1.00 17.57 ? 30  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 61.605 20.184  3.262   1.00 18.19 ? 30  ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 61.364 16.077  11.519  1.00 16.32 ? 31  ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 61.965 15.583  12.758  1.00 21.04 ? 31  ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 61.150 15.910  14.012  1.00 21.66 ? 31  ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 61.708 16.259  15.058  1.00 22.93 ? 31  ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 63.389 16.119  12.897  1.00 21.37 ? 31  ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 64.244 15.790  11.695  1.00 21.06 ? 31  ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 64.370 14.627  11.307  1.00 30.05 ? 31  ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 64.807 16.817  11.074  1.00 33.22 ? 31  ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 59.831 15.793  13.891  1.00 12.01 ? 32  LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 58.903 16.059  14.982  1.00 14.16 ? 32  LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 57.925 14.903  15.126  1.00 14.90 ? 32  LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 57.646 14.204  14.153  1.00 13.51 ? 32  LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 58.079 17.316  14.670  1.00 15.23 ? 32  LYS A CB    1 
ATOM   278  C  CG    A LYS A 1 35  ? 58.865 18.619  14.673  0.55 17.33 ? 32  LYS A CG    1 
ATOM   279  C  CG    B LYS A 1 35  ? 58.887 18.605  14.664  0.45 17.37 ? 32  LYS A CG    1 
ATOM   280  C  CD    A LYS A 1 35  ? 59.068 19.137  16.088  0.55 27.79 ? 32  LYS A CD    1 
ATOM   281  C  CD    B LYS A 1 35  ? 58.825 19.306  16.012  0.45 26.63 ? 32  LYS A CD    1 
ATOM   282  C  CE    A LYS A 1 35  ? 59.830 20.457  16.096  0.55 33.54 ? 32  LYS A CE    1 
ATOM   283  C  CE    B LYS A 1 35  ? 60.083 20.128  16.266  0.45 33.01 ? 32  LYS A CE    1 
ATOM   284  N  NZ    A LYS A 1 35  ? 60.038 20.980  17.478  0.55 22.86 ? 32  LYS A NZ    1 
ATOM   285  N  NZ    B LYS A 1 35  ? 60.484 20.940  15.081  0.45 25.23 ? 32  LYS A NZ    1 
ATOM   286  N  N     . PRO A 1 36  ? 57.368 14.722  16.333  1.00 15.51 ? 33  PRO A N     1 
ATOM   287  C  CA    . PRO A 1 36  ? 56.196 13.852  16.432  1.00 15.07 ? 33  PRO A CA    1 
ATOM   288  C  C     . PRO A 1 36  ? 55.063 14.529  15.669  1.00 14.23 ? 33  PRO A C     1 
ATOM   289  O  O     . PRO A 1 36  ? 54.616 15.621  16.026  1.00 13.46 ? 33  PRO A O     1 
ATOM   290  C  CB    . PRO A 1 36  ? 55.903 13.823  17.932  1.00 13.51 ? 33  PRO A CB    1 
ATOM   291  C  CG    . PRO A 1 36  ? 56.469 15.113  18.458  1.00 18.13 ? 33  PRO A CG    1 
ATOM   292  C  CD    . PRO A 1 36  ? 57.698 15.372  17.616  1.00 26.24 ? 33  PRO A CD    1 
ATOM   293  N  N     . CYS A 1 37  ? 54.622 13.899  14.593  1.00 12.08 ? 34  CYS A N     1 
ATOM   294  C  CA    A CYS A 1 37  ? 53.656 14.488  13.677  0.33 12.76 ? 34  CYS A CA    1 
ATOM   295  C  CA    B CYS A 1 37  ? 53.540 14.479  13.825  0.67 12.68 ? 34  CYS A CA    1 
ATOM   296  C  C     . CYS A 1 37  ? 52.714 13.400  13.157  1.00 8.19  ? 34  CYS A C     1 
ATOM   297  O  O     . CYS A 1 37  ? 53.108 12.233  13.084  1.00 11.75 ? 34  CYS A O     1 
ATOM   298  C  CB    A CYS A 1 37  ? 54.430 15.136  12.522  0.33 13.84 ? 34  CYS A CB    1 
ATOM   299  C  CB    B CYS A 1 37  ? 54.067 15.491  12.807  0.67 15.03 ? 34  CYS A CB    1 
ATOM   300  S  SG    A CYS A 1 37  ? 53.476 15.717  11.104  0.33 10.88 ? 34  CYS A SG    1 
ATOM   301  S  SG    B CYS A 1 37  ? 55.152 14.789  11.569  0.67 13.29 ? 34  CYS A SG    1 
ATOM   302  N  N     . ALA A 1 38  ? 51.506 13.774  12.760  1.00 7.97  ? 35  ALA A N     1 
ATOM   303  C  CA    . ALA A 1 38  ? 50.595 12.819  12.143  1.00 9.69  ? 35  ALA A CA    1 
ATOM   304  C  C     . ALA A 1 38  ? 49.797 13.524  11.079  1.00 11.33 ? 35  ALA A C     1 
ATOM   305  O  O     . ALA A 1 38  ? 49.697 14.752  11.086  1.00 12.82 ? 35  ALA A O     1 
ATOM   306  C  CB    . ALA A 1 38  ? 49.666 12.217  13.178  1.00 12.43 ? 35  ALA A CB    1 
ATOM   307  N  N     . VAL A 1 39  ? 49.248 12.740  10.160  1.00 10.12 ? 36  VAL A N     1 
ATOM   308  C  CA    . VAL A 1 39  ? 48.322 13.252  9.160   1.00 11.30 ? 36  VAL A CA    1 
ATOM   309  C  C     . VAL A 1 39  ? 46.922 12.817  9.554   1.00 13.70 ? 36  VAL A C     1 
ATOM   310  O  O     . VAL A 1 39  ? 46.699 11.653  9.904   1.00 12.99 ? 36  VAL A O     1 
ATOM   311  C  CB    . VAL A 1 39  ? 48.669 12.726  7.761   1.00 11.23 ? 36  VAL A CB    1 
ATOM   312  C  CG1   . VAL A 1 39  ? 47.613 13.158  6.723   1.00 11.06 ? 36  VAL A CG1   1 
ATOM   313  C  CG2   . VAL A 1 39  ? 50.078 13.207  7.369   1.00 11.04 ? 36  VAL A CG2   1 
ATOM   314  N  N     . VAL A 1 40  ? 45.987 13.758  9.495   1.00 13.62 ? 37  VAL A N     1 
ATOM   315  C  CA    . VAL A 1 40  ? 44.619 13.542  9.957   1.00 10.39 ? 37  VAL A CA    1 
ATOM   316  C  C     . VAL A 1 40  ? 43.636 13.913  8.854   1.00 15.74 ? 37  VAL A C     1 
ATOM   317  O  O     . VAL A 1 40  ? 43.916 14.784  8.033   1.00 15.08 ? 37  VAL A O     1 
ATOM   318  C  CB    . VAL A 1 40  ? 44.321 14.437  11.199  1.00 15.55 ? 37  VAL A CB    1 
ATOM   319  C  CG1   A VAL A 1 40  ? 45.112 13.959  12.409  0.57 12.12 ? 37  VAL A CG1   1 
ATOM   320  C  CG1   B VAL A 1 40  ? 44.197 15.903  10.788  0.43 15.90 ? 37  VAL A CG1   1 
ATOM   321  C  CG2   A VAL A 1 40  ? 44.608 15.912  10.890  0.57 15.79 ? 37  VAL A CG2   1 
ATOM   322  C  CG2   B VAL A 1 40  ? 43.084 13.980  11.905  0.43 13.71 ? 37  VAL A CG2   1 
ATOM   323  N  N     . GLN A 1 41  ? 42.479 13.264  8.829   1.00 14.76 ? 38  GLN A N     1 
ATOM   324  C  CA    . GLN A 1 41  ? 41.415 13.727  7.949   1.00 15.09 ? 38  GLN A CA    1 
ATOM   325  C  C     . GLN A 1 41  ? 40.175 14.121  8.733   1.00 14.78 ? 38  GLN A C     1 
ATOM   326  O  O     . GLN A 1 41  ? 39.781 13.429  9.675   1.00 14.95 ? 38  GLN A O     1 
ATOM   327  C  CB    . GLN A 1 41  ? 41.112 12.743  6.803   1.00 24.11 ? 38  GLN A CB    1 
ATOM   328  C  CG    . GLN A 1 41  ? 40.867 11.310  7.199   1.00 31.09 ? 38  GLN A CG    1 
ATOM   329  C  CD    . GLN A 1 41  ? 40.740 10.382  5.994   1.00 24.16 ? 38  GLN A CD    1 
ATOM   330  O  OE1   . GLN A 1 41  ? 41.175 10.703  4.882   1.00 24.48 ? 38  GLN A OE1   1 
ATOM   331  N  NE2   . GLN A 1 41  ? 40.145 9.223   6.215   1.00 26.55 ? 38  GLN A NE2   1 
ATOM   332  N  N     A TYR A 1 42  ? 39.561 15.259  8.401   0.57 15.57 ? 39  TYR A N     1 
ATOM   333  N  N     B TYR A 1 42  ? 39.595 15.230  8.276   0.43 15.69 ? 39  TYR A N     1 
ATOM   334  C  CA    A TYR A 1 42  ? 38.291 15.686  9.030   0.57 19.46 ? 39  TYR A CA    1 
ATOM   335  C  CA    B TYR A 1 42  ? 38.536 15.932  8.965   0.43 20.72 ? 39  TYR A CA    1 
ATOM   336  C  C     A TYR A 1 42  ? 38.370 16.142  10.502  0.57 18.36 ? 39  TYR A C     1 
ATOM   337  C  C     B TYR A 1 42  ? 39.122 16.433  10.283  0.43 19.18 ? 39  TYR A C     1 
ATOM   338  O  O     A TYR A 1 42  ? 38.048 15.384  11.408  0.57 21.72 ? 39  TYR A O     1 
ATOM   339  O  O     B TYR A 1 42  ? 40.193 15.994  10.696  0.43 13.82 ? 39  TYR A O     1 
ATOM   340  C  CB    A TYR A 1 42  ? 37.238 14.586  8.913   0.57 19.58 ? 39  TYR A CB    1 
ATOM   341  C  CB    B TYR A 1 42  ? 37.320 15.021  9.121   0.43 16.89 ? 39  TYR A CB    1 
ATOM   342  C  CG    A TYR A 1 42  ? 36.912 14.190  7.492   0.57 14.41 ? 39  TYR A CG    1 
ATOM   343  C  CG    B TYR A 1 42  ? 36.856 14.464  7.781   0.43 15.23 ? 39  TYR A CG    1 
ATOM   344  C  CD1   A TYR A 1 42  ? 36.760 15.147  6.499   0.57 18.10 ? 39  TYR A CD1   1 
ATOM   345  C  CD1   B TYR A 1 42  ? 36.562 15.311  6.721   0.43 16.75 ? 39  TYR A CD1   1 
ATOM   346  C  CD2   A TYR A 1 42  ? 36.772 12.850  7.142   0.57 16.81 ? 39  TYR A CD2   1 
ATOM   347  C  CD2   B TYR A 1 42  ? 36.755 13.093  7.568   0.43 17.12 ? 39  TYR A CD2   1 
ATOM   348  C  CE1   A TYR A 1 42  ? 36.463 14.781  5.193   0.57 18.95 ? 39  TYR A CE1   1 
ATOM   349  C  CE1   B TYR A 1 42  ? 36.151 14.811  5.490   0.43 20.91 ? 39  TYR A CE1   1 
ATOM   350  C  CE2   A TYR A 1 42  ? 36.478 12.474  5.845   0.57 14.14 ? 39  TYR A CE2   1 
ATOM   351  C  CE2   B TYR A 1 42  ? 36.347 12.581  6.340   0.43 15.42 ? 39  TYR A CE2   1 
ATOM   352  C  CZ    A TYR A 1 42  ? 36.324 13.446  4.874   0.57 17.92 ? 39  TYR A CZ    1 
ATOM   353  C  CZ    B TYR A 1 42  ? 36.044 13.448  5.305   0.43 18.54 ? 39  TYR A CZ    1 
ATOM   354  O  OH    A TYR A 1 42  ? 36.022 13.078  3.581   0.57 14.05 ? 39  TYR A OH    1 
ATOM   355  O  OH    B TYR A 1 42  ? 35.635 12.951  4.082   0.43 16.91 ? 39  TYR A OH    1 
ATOM   356  N  N     A LYS A 1 43  ? 38.734 17.399  10.722  0.52 26.50 ? 40  LYS A N     1 
ATOM   357  N  N     B LYS A 1 43  ? 38.466 17.393  10.915  0.48 26.59 ? 40  LYS A N     1 
ATOM   358  C  CA    A LYS A 1 43  ? 39.044 17.923  12.059  0.52 25.05 ? 40  LYS A CA    1 
ATOM   359  C  CA    B LYS A 1 43  ? 39.004 17.951  12.148  0.48 24.98 ? 40  LYS A CA    1 
ATOM   360  C  C     A LYS A 1 43  ? 37.907 17.915  13.105  0.52 25.49 ? 40  LYS A C     1 
ATOM   361  C  C     B LYS A 1 43  ? 37.896 18.045  13.163  0.48 25.60 ? 40  LYS A C     1 
ATOM   362  O  O     A LYS A 1 43  ? 38.155 17.715  14.296  0.52 28.00 ? 40  LYS A O     1 
ATOM   363  O  O     B LYS A 1 43  ? 38.134 18.032  14.372  0.48 27.71 ? 40  LYS A O     1 
ATOM   364  C  CB    . LYS A 1 43  ? 39.598 19.344  11.914  1.00 30.27 ? 40  LYS A CB    1 
ATOM   365  C  CG    . LYS A 1 43  ? 40.577 19.780  13.004  1.00 31.18 ? 40  LYS A CG    1 
ATOM   366  C  CD    . LYS A 1 43  ? 41.925 19.084  12.827  1.00 37.90 ? 40  LYS A CD    1 
ATOM   367  C  CE    . LYS A 1 43  ? 42.909 19.443  13.932  1.00 27.94 ? 40  LYS A CE    1 
ATOM   368  N  NZ    . LYS A 1 43  ? 42.555 18.807  15.229  1.00 37.21 ? 40  LYS A NZ    1 
ATOM   369  N  N     . SER A 1 44  ? 36.672 18.133  12.659  1.00 26.09 ? 41  SER A N     1 
ATOM   370  C  CA    . SER A 1 44  ? 35.523 18.365  13.535  1.00 27.69 ? 41  SER A CA    1 
ATOM   371  C  C     . SER A 1 44  ? 35.144 17.243  14.498  1.00 38.69 ? 41  SER A C     1 
ATOM   372  O  O     . SER A 1 44  ? 34.768 17.507  15.641  1.00 34.70 ? 41  SER A O     1 
ATOM   373  C  CB    . SER A 1 44  ? 34.306 18.760  12.698  1.00 35.40 ? 41  SER A CB    1 
ATOM   374  O  OG    . SER A 1 44  ? 34.632 19.851  11.856  1.00 46.84 ? 41  SER A OG    1 
ATOM   375  N  N     . TRP A 1 45  ? 35.226 15.998  14.044  1.00 27.20 ? 42  TRP A N     1 
ATOM   376  C  CA    . TRP A 1 45  ? 34.811 14.882  14.881  1.00 28.65 ? 42  TRP A CA    1 
ATOM   377  C  C     . TRP A 1 45  ? 35.997 14.306  15.642  1.00 34.29 ? 42  TRP A C     1 
ATOM   378  O  O     . TRP A 1 45  ? 36.795 13.556  15.082  1.00 20.56 ? 42  TRP A O     1 
ATOM   379  C  CB    . TRP A 1 45  ? 34.127 13.789  14.052  1.00 33.74 ? 42  TRP A CB    1 
ATOM   380  C  CG    . TRP A 1 45  ? 33.668 12.606  14.870  1.00 43.18 ? 42  TRP A CG    1 
ATOM   381  C  CD1   . TRP A 1 45  ? 34.396 11.493  15.183  1.00 37.65 ? 42  TRP A CD1   1 
ATOM   382  C  CD2   . TRP A 1 45  ? 32.379 12.421  15.472  1.00 42.52 ? 42  TRP A CD2   1 
ATOM   383  N  NE1   . TRP A 1 45  ? 33.644 10.631  15.943  1.00 42.69 ? 42  TRP A NE1   1 
ATOM   384  C  CE2   . TRP A 1 45  ? 32.402 11.176  16.135  1.00 43.87 ? 42  TRP A CE2   1 
ATOM   385  C  CE3   . TRP A 1 45  ? 31.209 13.185  15.514  1.00 48.32 ? 42  TRP A CE3   1 
ATOM   386  C  CZ2   . TRP A 1 45  ? 31.302 10.681  16.833  1.00 48.38 ? 42  TRP A CZ2   1 
ATOM   387  C  CZ3   . TRP A 1 45  ? 30.115 12.689  16.207  1.00 43.81 ? 42  TRP A CZ3   1 
ATOM   388  C  CH2   . TRP A 1 45  ? 30.171 11.450  16.857  1.00 47.35 ? 42  TRP A CH2   1 
ATOM   389  N  N     . LYS A 1 46  ? 36.105 14.675  16.916  1.00 31.29 ? 43  LYS A N     1 
ATOM   390  C  CA    . LYS A 1 46  ? 37.133 14.142  17.808  1.00 23.38 ? 43  LYS A CA    1 
ATOM   391  C  C     . LYS A 1 46  ? 38.551 14.488  17.360  1.00 17.71 ? 43  LYS A C     1 
ATOM   392  O  O     . LYS A 1 46  ? 39.493 13.723  17.592  1.00 21.02 ? 43  LYS A O     1 
ATOM   393  C  CB    . LYS A 1 46  ? 36.969 12.629  17.954  1.00 22.62 ? 43  LYS A CB    1 
ATOM   394  C  CG    . LYS A 1 46  ? 35.673 12.206  18.635  1.00 29.47 ? 43  LYS A CG    1 
ATOM   395  C  CD    . LYS A 1 46  ? 35.600 10.693  18.772  1.00 35.14 ? 43  LYS A CD    1 
ATOM   396  C  CE    . LYS A 1 46  ? 34.396 10.262  19.599  1.00 50.22 ? 43  LYS A CE    1 
ATOM   397  N  NZ    . LYS A 1 46  ? 34.326 8.779   19.738  1.00 40.37 ? 43  LYS A NZ    1 
ATOM   398  N  N     . GLY A 1 47  ? 38.692 15.642  16.713  1.00 19.05 ? 44  GLY A N     1 
ATOM   399  C  CA    . GLY A 1 47  ? 39.984 16.137  16.290  1.00 16.81 ? 44  GLY A CA    1 
ATOM   400  C  C     . GLY A 1 47  ? 40.440 15.618  14.939  1.00 14.33 ? 44  GLY A C     1 
ATOM   401  O  O     . GLY A 1 47  ? 41.449 16.076  14.410  1.00 20.11 ? 44  GLY A O     1 
ATOM   402  N  N     . GLY A 1 48  ? 39.700 14.663  14.387  1.00 19.49 ? 45  GLY A N     1 
ATOM   403  C  CA    . GLY A 1 48  ? 40.051 14.081  13.104  1.00 18.29 ? 45  GLY A CA    1 
ATOM   404  C  C     . GLY A 1 48  ? 40.629 12.686  13.245  1.00 15.86 ? 45  GLY A C     1 
ATOM   405  O  O     . GLY A 1 48  ? 41.153 12.324  14.297  1.00 15.76 ? 45  GLY A O     1 
ATOM   406  N  N     . GLY A 1 49  ? 40.543 11.899  12.177  1.00 13.47 ? 46  GLY A N     1 
ATOM   407  C  CA    . GLY A 1 49  ? 41.028 10.527  12.221  1.00 13.28 ? 46  GLY A CA    1 
ATOM   408  C  C     . GLY A 1 49  ? 42.461 10.472  11.725  1.00 12.84 ? 46  GLY A C     1 
ATOM   409  O  O     . GLY A 1 49  ? 42.754 10.967  10.646  1.00 15.54 ? 46  GLY A O     1 
ATOM   410  N  N     . ILE A 1 50  ? 43.352 9.871   12.509  1.00 12.81 ? 47  ILE A N     1 
ATOM   411  C  CA    . ILE A 1 50  ? 44.764 9.779   12.119  1.00 10.88 ? 47  ILE A CA    1 
ATOM   412  C  C     . ILE A 1 50  ? 44.961 8.696   11.063  1.00 13.40 ? 47  ILE A C     1 
ATOM   413  O  O     . ILE A 1 50  ? 44.482 7.568   11.219  1.00 15.04 ? 47  ILE A O     1 
ATOM   414  C  CB    . ILE A 1 50  ? 45.663 9.508   13.338  1.00 11.42 ? 47  ILE A CB    1 
ATOM   415  C  CG1   . ILE A 1 50  ? 45.690 10.748  14.244  1.00 18.44 ? 47  ILE A CG1   1 
ATOM   416  C  CG2   . ILE A 1 50  ? 47.080 9.090   12.896  1.00 11.74 ? 47  ILE A CG2   1 
ATOM   417  C  CD1   . ILE A 1 50  ? 46.479 10.558  15.503  1.00 24.97 ? 47  ILE A CD1   1 
ATOM   418  N  N     . ILE A 1 51  ? 45.654 9.035   9.979   1.00 11.81 ? 48  ILE A N     1 
ATOM   419  C  CA    . ILE A 1 51  ? 45.889 8.048   8.931   1.00 9.33  ? 48  ILE A CA    1 
ATOM   420  C  C     . ILE A 1 51  ? 47.365 7.743   8.678   1.00 11.41 ? 48  ILE A C     1 
ATOM   421  O  O     . ILE A 1 51  ? 47.684 6.763   8.011   1.00 13.82 ? 48  ILE A O     1 
ATOM   422  C  CB    . ILE A 1 51  ? 45.179 8.398   7.613   1.00 14.58 ? 48  ILE A CB    1 
ATOM   423  C  CG1   . ILE A 1 51  ? 45.685 9.718   7.046   1.00 11.73 ? 48  ILE A CG1   1 
ATOM   424  C  CG2   . ILE A 1 51  ? 43.667 8.473   7.827   1.00 16.30 ? 48  ILE A CG2   1 
ATOM   425  C  CD1   . ILE A 1 51  ? 45.139 10.002  5.656   1.00 19.89 ? 48  ILE A CD1   1 
ATOM   426  N  N     . ALA A 1 52  ? 48.255 8.577   9.213   1.00 11.74 ? 49  ALA A N     1 
ATOM   427  C  CA    . ALA A 1 52  ? 49.698 8.320   9.141   1.00 6.63  ? 49  ALA A CA    1 
ATOM   428  C  C     . ALA A 1 52  ? 50.415 8.964   10.326  1.00 11.58 ? 49  ALA A C     1 
ATOM   429  O  O     . ALA A 1 52  ? 49.986 10.014  10.821  1.00 10.84 ? 49  ALA A O     1 
ATOM   430  C  CB    . ALA A 1 52  ? 50.281 8.828   7.820   1.00 8.49  ? 49  ALA A CB    1 
ATOM   431  N  N     . VAL A 1 53  ? 51.514 8.347   10.763  1.00 10.14 ? 50  VAL A N     1 
ATOM   432  C  CA    . VAL A 1 53  ? 52.191 8.756   11.991  1.00 7.44  ? 50  VAL A CA    1 
ATOM   433  C  C     . VAL A 1 53  ? 53.718 8.696   11.875  1.00 6.70  ? 50  VAL A C     1 
ATOM   434  O  O     . VAL A 1 53  ? 54.270 7.668   11.480  1.00 9.82  ? 50  VAL A O     1 
ATOM   435  C  CB    . VAL A 1 53  ? 51.765 7.833   13.171  1.00 9.51  ? 50  VAL A CB    1 
ATOM   436  C  CG1   . VAL A 1 53  ? 52.285 8.381   14.474  1.00 11.15 ? 50  VAL A CG1   1 
ATOM   437  C  CG2   . VAL A 1 53  ? 50.261 7.695   13.215  1.00 14.17 ? 50  VAL A CG2   1 
ATOM   438  N  N     . SER A 1 54  ? 54.397 9.792   12.215  1.00 10.58 ? 51  SER A N     1 
ATOM   439  C  CA    . SER A 1 54  ? 55.856 9.813   12.166  1.00 13.28 ? 51  SER A CA    1 
ATOM   440  C  C     . SER A 1 54  ? 56.419 8.892   13.236  1.00 13.04 ? 51  SER A C     1 
ATOM   441  O  O     . SER A 1 54  ? 55.764 8.640   14.253  1.00 12.80 ? 51  SER A O     1 
ATOM   442  C  CB    . SER A 1 54  ? 56.403 11.233  12.366  1.00 11.77 ? 51  SER A CB    1 
ATOM   443  O  OG    . SER A 1 54  ? 56.429 11.584  13.747  1.00 12.30 ? 51  SER A OG    1 
ATOM   444  N  N     . TYR A 1 55  ? 57.630 8.392   13.007  1.00 11.77 ? 52  TYR A N     1 
ATOM   445  C  CA    . TYR A 1 55  ? 58.246 7.472   13.951  1.00 14.02 ? 52  TYR A CA    1 
ATOM   446  C  C     . TYR A 1 55  ? 58.465 8.121   15.318  1.00 16.60 ? 52  TYR A C     1 
ATOM   447  O  O     . TYR A 1 55  ? 58.338 7.456   16.343  1.00 13.49 ? 52  TYR A O     1 
ATOM   448  C  CB    . TYR A 1 55  ? 59.521 6.847   13.363  1.00 14.10 ? 52  TYR A CB    1 
ATOM   449  C  CG    . TYR A 1 55  ? 59.164 5.765   12.362  1.00 12.42 ? 52  TYR A CG    1 
ATOM   450  C  CD1   . TYR A 1 55  ? 58.764 6.089   11.067  1.00 15.67 ? 52  TYR A CD1   1 
ATOM   451  C  CD2   . TYR A 1 55  ? 59.156 4.433   12.731  1.00 14.87 ? 52  TYR A CD2   1 
ATOM   452  C  CE1   . TYR A 1 55  ? 58.401 5.095   10.159  1.00 11.20 ? 52  TYR A CE1   1 
ATOM   453  C  CE2   . TYR A 1 55  ? 58.806 3.446   11.837  1.00 16.74 ? 52  TYR A CE2   1 
ATOM   454  C  CZ    . TYR A 1 55  ? 58.429 3.773   10.559  1.00 15.85 ? 52  TYR A CZ    1 
ATOM   455  O  OH    . TYR A 1 55  ? 58.073 2.765   9.682   1.00 16.65 ? 52  TYR A OH    1 
ATOM   456  N  N     . GLU A 1 56  ? 58.746 9.421   15.334  1.00 16.43 ? 53  GLU A N     1 
ATOM   457  C  CA    . GLU A 1 56  ? 58.827 10.161  16.594  1.00 15.19 ? 53  GLU A CA    1 
ATOM   458  C  C     . GLU A 1 56  ? 57.523 10.083  17.390  1.00 16.64 ? 53  GLU A C     1 
ATOM   459  O  O     . GLU A 1 56  ? 57.540 9.898   18.611  1.00 14.78 ? 53  GLU A O     1 
ATOM   460  C  CB    . GLU A 1 56  ? 59.200 11.630  16.344  1.00 11.17 ? 53  GLU A CB    1 
ATOM   461  C  CG    . GLU A 1 56  ? 60.604 11.855  15.776  1.00 18.27 ? 53  GLU A CG    1 
ATOM   462  C  CD    . GLU A 1 56  ? 60.697 11.696  14.258  1.00 27.38 ? 53  GLU A CD    1 
ATOM   463  O  OE1   . GLU A 1 56  ? 59.734 11.209  13.617  1.00 23.13 ? 53  GLU A OE1   1 
ATOM   464  O  OE2   . GLU A 1 56  ? 61.753 12.062  13.701  1.00 36.69 ? 53  GLU A OE2   1 
ATOM   465  N  N     . ALA A 1 57  ? 56.395 10.243  16.703  1.00 10.42 ? 54  ALA A N     1 
ATOM   466  C  CA    . ALA A 1 57  ? 55.084 10.143  17.349  1.00 11.12 ? 54  ALA A CA    1 
ATOM   467  C  C     . ALA A 1 57  ? 54.733 8.710   17.750  1.00 8.35  ? 54  ALA A C     1 
ATOM   468  O  O     . ALA A 1 57  ? 54.076 8.500   18.762  1.00 12.70 ? 54  ALA A O     1 
ATOM   469  C  CB    . ALA A 1 57  ? 53.983 10.726  16.442  1.00 16.11 ? 54  ALA A CB    1 
ATOM   470  N  N     . ARG A 1 58  ? 55.163 7.725   16.966  1.00 12.62 ? 55  ARG A N     1 
ATOM   471  C  CA    . ARG A 1 58  ? 54.881 6.329   17.328  1.00 12.38 ? 55  ARG A CA    1 
ATOM   472  C  C     . ARG A 1 58  ? 55.475 5.959   18.682  1.00 16.36 ? 55  ARG A C     1 
ATOM   473  O  O     . ARG A 1 58  ? 54.912 5.126   19.404  1.00 18.19 ? 55  ARG A O     1 
ATOM   474  C  CB    . ARG A 1 58  ? 55.391 5.364   16.259  1.00 14.64 ? 55  ARG A CB    1 
ATOM   475  C  CG    . ARG A 1 58  ? 54.739 5.578   14.923  1.00 15.86 ? 55  ARG A CG    1 
ATOM   476  C  CD    . ARG A 1 58  ? 55.295 4.623   13.884  1.00 17.54 ? 55  ARG A CD    1 
ATOM   477  N  NE    . ARG A 1 58  ? 54.892 5.073   12.561  1.00 12.77 ? 55  ARG A NE    1 
ATOM   478  C  CZ    . ARG A 1 58  ? 54.906 4.324   11.468  1.00 12.95 ? 55  ARG A CZ    1 
ATOM   479  N  NH1   . ARG A 1 58  ? 55.303 3.053   11.527  1.00 13.97 ? 55  ARG A NH1   1 
ATOM   480  N  NH2   . ARG A 1 58  ? 54.509 4.854   10.314  1.00 13.51 ? 55  ARG A NH2   1 
ATOM   481  N  N     . ALA A 1 59  ? 56.608 6.573   19.019  1.00 15.05 ? 56  ALA A N     1 
ATOM   482  C  CA    . ALA A 1 59  ? 57.265 6.329   20.303  1.00 16.68 ? 56  ALA A CA    1 
ATOM   483  C  C     . ALA A 1 59  ? 56.356 6.665   21.486  1.00 22.18 ? 56  ALA A C     1 
ATOM   484  O  O     . ALA A 1 59  ? 56.513 6.113   22.578  1.00 21.24 ? 56  ALA A O     1 
ATOM   485  C  CB    . ALA A 1 59  ? 58.580 7.105   20.398  1.00 15.89 ? 56  ALA A CB    1 
ATOM   486  N  N     . PHE A 1 60  ? 55.412 7.572   21.265  1.00 14.46 ? 57  PHE A N     1 
ATOM   487  C  CA    . PHE A 1 60  ? 54.445 7.949   22.293  1.00 14.20 ? 57  PHE A CA    1 
ATOM   488  C  C     . PHE A 1 60  ? 53.223 7.033   22.307  1.00 21.08 ? 57  PHE A C     1 
ATOM   489  O  O     . PHE A 1 60  ? 52.365 7.156   23.181  1.00 18.07 ? 57  PHE A O     1 
ATOM   490  C  CB    . PHE A 1 60  ? 53.959 9.381   22.069  1.00 16.35 ? 57  PHE A CB    1 
ATOM   491  C  CG    . PHE A 1 60  ? 54.978 10.430  22.372  1.00 14.04 ? 57  PHE A CG    1 
ATOM   492  C  CD1   . PHE A 1 60  ? 55.010 11.043  23.619  1.00 23.14 ? 57  PHE A CD1   1 
ATOM   493  C  CD2   . PHE A 1 60  ? 55.896 10.820  21.415  1.00 12.61 ? 57  PHE A CD2   1 
ATOM   494  C  CE1   . PHE A 1 60  ? 55.943 12.025  23.906  1.00 23.70 ? 57  PHE A CE1   1 
ATOM   495  C  CE2   . PHE A 1 60  ? 56.833 11.813  21.690  1.00 19.31 ? 57  PHE A CE2   1 
ATOM   496  C  CZ    . PHE A 1 60  ? 56.857 12.412  22.938  1.00 23.99 ? 57  PHE A CZ    1 
ATOM   497  N  N     . GLY A 1 61  ? 53.126 6.139   21.323  1.00 15.42 ? 58  GLY A N     1 
ATOM   498  C  CA    . GLY A 1 61  ? 51.979 5.247   21.216  1.00 16.56 ? 58  GLY A CA    1 
ATOM   499  C  C     . GLY A 1 61  ? 50.876 5.736   20.294  1.00 15.94 ? 58  GLY A C     1 
ATOM   500  O  O     . GLY A 1 61  ? 49.783 5.173   20.257  1.00 14.01 ? 58  GLY A O     1 
ATOM   501  N  N     . VAL A 1 62  ? 51.158 6.788   19.533  1.00 13.27 ? 59  VAL A N     1 
ATOM   502  C  CA    . VAL A 1 62  ? 50.209 7.268   18.541  1.00 16.06 ? 59  VAL A CA    1 
ATOM   503  C  C     . VAL A 1 62  ? 50.140 6.265   17.398  1.00 14.66 ? 59  VAL A C     1 
ATOM   504  O  O     . VAL A 1 62  ? 51.173 5.772   16.924  1.00 13.38 ? 59  VAL A O     1 
ATOM   505  C  CB    . VAL A 1 62  ? 50.599 8.662   18.009  1.00 10.79 ? 59  VAL A CB    1 
ATOM   506  C  CG1   . VAL A 1 62  ? 49.590 9.124   16.972  1.00 12.69 ? 59  VAL A CG1   1 
ATOM   507  C  CG2   . VAL A 1 62  ? 50.658 9.654   19.156  1.00 15.61 ? 59  VAL A CG2   1 
ATOM   508  N  N     . THR A 1 63  ? 48.921 5.937   16.982  1.00 13.10 ? 60  THR A N     1 
ATOM   509  C  CA    . THR A 1 63  ? 48.724 4.997   15.891  1.00 11.75 ? 60  THR A CA    1 
ATOM   510  C  C     . THR A 1 63  ? 47.676 5.454   14.894  1.00 15.38 ? 60  THR A C     1 
ATOM   511  O  O     . THR A 1 63  ? 46.878 6.350   15.164  1.00 18.48 ? 60  THR A O     1 
ATOM   512  C  CB    . THR A 1 63  ? 48.267 3.627   16.414  1.00 20.34 ? 60  THR A CB    1 
ATOM   513  O  OG1   . THR A 1 63  ? 46.983 3.770   17.033  1.00 19.61 ? 60  THR A OG1   1 
ATOM   514  C  CG2   . THR A 1 63  ? 49.259 3.088   17.425  1.00 15.94 ? 60  THR A CG2   1 
ATOM   515  N  N     . ARG A 1 64  ? 47.675 4.810   13.733  1.00 12.95 ? 61  ARG A N     1 
ATOM   516  C  CA    . ARG A 1 64  ? 46.602 4.983   12.760  1.00 16.13 ? 61  ARG A CA    1 
ATOM   517  C  C     . ARG A 1 64  ? 45.265 4.545   13.358  1.00 23.60 ? 61  ARG A C     1 
ATOM   518  O  O     . ARG A 1 64  ? 45.224 3.663   14.212  1.00 19.97 ? 61  ARG A O     1 
ATOM   519  C  CB    . ARG A 1 64  ? 46.927 4.175   11.502  1.00 18.85 ? 61  ARG A CB    1 
ATOM   520  C  CG    . ARG A 1 64  ? 45.769 3.887   10.577  1.00 27.45 ? 61  ARG A CG    1 
ATOM   521  C  CD    . ARG A 1 64  ? 46.300 3.184   9.330   1.00 28.39 ? 61  ARG A CD    1 
ATOM   522  N  NE    . ARG A 1 64  ? 47.334 4.002   8.705   1.00 23.56 ? 61  ARG A NE    1 
ATOM   523  C  CZ    . ARG A 1 64  ? 48.513 3.558   8.285   1.00 26.10 ? 61  ARG A CZ    1 
ATOM   524  N  NH1   . ARG A 1 64  ? 48.831 2.274   8.398   1.00 24.24 ? 61  ARG A NH1   1 
ATOM   525  N  NH2   . ARG A 1 64  ? 49.374 4.408   7.741   1.00 17.61 ? 61  ARG A NH2   1 
ATOM   526  N  N     . SER A 1 65  ? 44.186 5.181   12.904  1.00 20.00 ? 62  SER A N     1 
ATOM   527  C  CA    . SER A 1 65  ? 42.819 4.896   13.347  1.00 26.55 ? 62  SER A CA    1 
ATOM   528  C  C     . SER A 1 65  ? 42.442 5.624   14.638  1.00 24.51 ? 62  SER A C     1 
ATOM   529  O  O     . SER A 1 65  ? 41.269 5.701   15.006  1.00 47.84 ? 62  SER A O     1 
ATOM   530  C  CB    . SER A 1 65  ? 42.586 3.397   13.510  1.00 28.89 ? 62  SER A CB    1 
ATOM   531  O  OG    . SER A 1 65  ? 42.613 3.039   14.879  1.00 40.71 ? 62  SER A OG    1 
ATOM   532  N  N     . MET A 1 66  ? 43.444 6.148   15.323  1.00 21.58 ? 63  MET A N     1 
ATOM   533  C  CA    . MET A 1 66  ? 43.238 6.875   16.562  1.00 16.57 ? 63  MET A CA    1 
ATOM   534  C  C     . MET A 1 66  ? 42.631 8.226   16.231  1.00 21.23 ? 63  MET A C     1 
ATOM   535  O  O     . MET A 1 66  ? 42.986 8.819   15.211  1.00 18.72 ? 63  MET A O     1 
ATOM   536  C  CB    . MET A 1 66  ? 44.596 7.069   17.215  1.00 19.44 ? 63  MET A CB    1 
ATOM   537  C  CG    . MET A 1 66  ? 44.592 7.480   18.653  1.00 22.79 ? 63  MET A CG    1 
ATOM   538  S  SD    . MET A 1 66  ? 46.278 7.312   19.263  1.00 21.66 ? 63  MET A SD    1 
ATOM   539  C  CE    . MET A 1 66  ? 46.377 5.563   19.592  1.00 18.34 ? 63  MET A CE    1 
ATOM   540  N  N     . TRP A 1 67  ? 41.722 8.719   17.075  1.00 17.65 ? 64  TRP A N     1 
ATOM   541  C  CA    . TRP A 1 67  ? 41.239 10.100  16.948  1.00 16.34 ? 64  TRP A CA    1 
ATOM   542  C  C     . TRP A 1 67  ? 42.314 11.063  17.432  1.00 16.00 ? 64  TRP A C     1 
ATOM   543  O  O     . TRP A 1 67  ? 42.991 10.781  18.410  1.00 17.22 ? 64  TRP A O     1 
ATOM   544  C  CB    . TRP A 1 67  ? 39.966 10.321  17.769  1.00 16.58 ? 64  TRP A CB    1 
ATOM   545  C  CG    . TRP A 1 67  ? 38.817 9.483   17.322  1.00 21.38 ? 64  TRP A CG    1 
ATOM   546  C  CD1   . TRP A 1 67  ? 38.159 8.534   18.053  1.00 22.84 ? 64  TRP A CD1   1 
ATOM   547  C  CD2   . TRP A 1 67  ? 38.184 9.510   16.036  1.00 21.44 ? 64  TRP A CD2   1 
ATOM   548  N  NE1   . TRP A 1 67  ? 37.157 7.968   17.299  1.00 28.61 ? 64  TRP A NE1   1 
ATOM   549  C  CE2   . TRP A 1 67  ? 37.152 8.548   16.057  1.00 32.57 ? 64  TRP A CE2   1 
ATOM   550  C  CE3   . TRP A 1 67  ? 38.389 10.256  14.869  1.00 15.74 ? 64  TRP A CE3   1 
ATOM   551  C  CZ2   . TRP A 1 67  ? 36.324 8.313   14.956  1.00 30.02 ? 64  TRP A CZ2   1 
ATOM   552  C  CZ3   . TRP A 1 67  ? 37.569 10.020  13.775  1.00 20.79 ? 64  TRP A CZ3   1 
ATOM   553  C  CH2   . TRP A 1 67  ? 36.546 9.054   13.828  1.00 24.97 ? 64  TRP A CH2   1 
ATOM   554  N  N     . ALA A 1 68  ? 42.476 12.202  16.762  1.00 12.44 ? 65  ALA A N     1 
ATOM   555  C  CA    . ALA A 1 68  ? 43.547 13.123  17.146  1.00 14.76 ? 65  ALA A CA    1 
ATOM   556  C  C     . ALA A 1 68  ? 43.403 13.606  18.593  1.00 16.04 ? 65  ALA A C     1 
ATOM   557  O  O     . ALA A 1 68  ? 44.400 13.825  19.282  1.00 16.91 ? 65  ALA A O     1 
ATOM   558  C  CB    . ALA A 1 68  ? 43.632 14.300  16.181  1.00 18.42 ? 65  ALA A CB    1 
ATOM   559  N  N     . ASP A 1 69  ? 42.164 13.765  19.059  1.00 17.29 ? 66  ASP A N     1 
ATOM   560  C  CA    . ASP A 1 69  ? 41.946 14.171  20.445  1.00 15.45 ? 66  ASP A CA    1 
ATOM   561  C  C     . ASP A 1 69  ? 42.591 13.161  21.389  1.00 16.57 ? 66  ASP A C     1 
ATOM   562  O  O     . ASP A 1 69  ? 43.176 13.530  22.415  1.00 16.64 ? 66  ASP A O     1 
ATOM   563  C  CB    . ASP A 1 69  ? 40.459 14.292  20.760  1.00 27.04 ? 66  ASP A CB    1 
ATOM   564  C  CG    . ASP A 1 69  ? 39.848 15.569  20.219  1.00 24.18 ? 66  ASP A CG    1 
ATOM   565  O  OD1   . ASP A 1 69  ? 40.605 16.462  19.774  1.00 27.92 ? 66  ASP A OD1   1 
ATOM   566  O  OD2   . ASP A 1 69  ? 38.607 15.683  20.258  1.00 29.28 ? 66  ASP A OD2   1 
ATOM   567  N  N     . ASP A 1 70  ? 42.485 11.885  21.028  1.00 14.51 ? 67  ASP A N     1 
ATOM   568  C  CA    . ASP A 1 70  ? 43.027 10.810  21.848  1.00 16.13 ? 67  ASP A CA    1 
ATOM   569  C  C     . ASP A 1 70  ? 44.545 10.713  21.683  1.00 16.26 ? 67  ASP A C     1 
ATOM   570  O  O     . ASP A 1 70  ? 45.265 10.459  22.642  1.00 12.09 ? 67  ASP A O     1 
ATOM   571  C  CB    . ASP A 1 70  ? 42.341 9.484   21.506  1.00 18.51 ? 67  ASP A CB    1 
ATOM   572  C  CG    . ASP A 1 70  ? 40.850 9.500   21.823  1.00 26.61 ? 67  ASP A CG    1 
ATOM   573  O  OD1   . ASP A 1 70  ? 40.453 10.152  22.816  1.00 22.59 ? 67  ASP A OD1   1 
ATOM   574  O  OD2   . ASP A 1 70  ? 40.073 8.867   21.076  1.00 23.64 ? 67  ASP A OD2   1 
ATOM   575  N  N     . ALA A 1 71  ? 45.036 10.941  20.469  1.00 16.06 ? 68  ALA A N     1 
ATOM   576  C  CA    . ALA A 1 71  ? 46.475 10.981  20.249  1.00 16.56 ? 68  ALA A CA    1 
ATOM   577  C  C     . ALA A 1 71  ? 47.135 12.067  21.099  1.00 12.66 ? 68  ALA A C     1 
ATOM   578  O  O     . ALA A 1 71  ? 48.225 11.873  21.628  1.00 15.15 ? 68  ALA A O     1 
ATOM   579  C  CB    . ALA A 1 71  ? 46.792 11.199  18.774  1.00 12.48 ? 68  ALA A CB    1 
ATOM   580  N  N     . LYS A 1 72  ? 46.471 13.214  21.205  1.00 11.07 ? 69  LYS A N     1 
ATOM   581  C  CA    . LYS A 1 72  ? 46.972 14.336  21.996  1.00 12.96 ? 69  LYS A CA    1 
ATOM   582  C  C     . LYS A 1 72  ? 47.116 13.983  23.473  1.00 17.10 ? 69  LYS A C     1 
ATOM   583  O  O     . LYS A 1 72  ? 47.943 14.558  24.177  1.00 11.88 ? 69  LYS A O     1 
ATOM   584  C  CB    . LYS A 1 72  ? 46.057 15.556  21.835  1.00 16.29 ? 69  LYS A CB    1 
ATOM   585  C  CG    . LYS A 1 72  ? 46.368 16.405  20.589  1.00 17.38 ? 69  LYS A CG    1 
ATOM   586  C  CD    . LYS A 1 72  ? 47.691 17.147  20.740  1.00 20.45 ? 69  LYS A CD    1 
ATOM   587  C  CE    . LYS A 1 72  ? 47.891 18.165  19.623  1.00 29.58 ? 69  LYS A CE    1 
ATOM   588  N  NZ    . LYS A 1 72  ? 49.156 18.945  19.804  1.00 20.90 ? 69  LYS A NZ    1 
ATOM   589  N  N     . LYS A 1 73  ? 46.300 13.045  23.947  1.00 16.81 ? 70  LYS A N     1 
ATOM   590  C  CA    . LYS A 1 73  ? 46.418 12.581  25.328  1.00 17.14 ? 70  LYS A CA    1 
ATOM   591  C  C     . LYS A 1 73  ? 47.746 11.867  25.557  1.00 21.39 ? 70  LYS A C     1 
ATOM   592  O  O     . LYS A 1 73  ? 48.366 12.012  26.614  1.00 18.29 ? 70  LYS A O     1 
ATOM   593  C  CB    . LYS A 1 73  ? 45.247 11.665  25.683  1.00 11.89 ? 70  LYS A CB    1 
ATOM   594  C  CG    . LYS A 1 73  ? 43.914 12.353  25.541  1.00 11.28 ? 70  LYS A CG    1 
ATOM   595  C  CD    . LYS A 1 73  ? 42.758 11.396  25.752  1.00 15.89 ? 70  LYS A CD    1 
ATOM   596  C  CE    . LYS A 1 73  ? 41.433 12.116  25.518  1.00 20.92 ? 70  LYS A CE    1 
ATOM   597  N  NZ    . LYS A 1 73  ? 40.296 11.162  25.410  1.00 18.65 ? 70  LYS A NZ    1 
ATOM   598  N  N     . LEU A 1 74  ? 48.182 11.103  24.558  1.00 15.22 ? 71  LEU A N     1 
ATOM   599  C  CA    . LEU A 1 74  ? 49.457 10.392  24.631  1.00 17.17 ? 71  LEU A CA    1 
ATOM   600  C  C     . LEU A 1 74  ? 50.644 11.297  24.302  1.00 21.37 ? 71  LEU A C     1 
ATOM   601  O  O     . LEU A 1 74  ? 51.743 11.114  24.827  1.00 21.23 ? 71  LEU A O     1 
ATOM   602  C  CB    . LEU A 1 74  ? 49.455 9.204   23.663  1.00 10.54 ? 71  LEU A CB    1 
ATOM   603  C  CG    . LEU A 1 74  ? 48.389 8.126   23.892  1.00 16.15 ? 71  LEU A CG    1 
ATOM   604  C  CD1   . LEU A 1 74  ? 48.443 7.097   22.771  1.00 17.85 ? 71  LEU A CD1   1 
ATOM   605  C  CD2   . LEU A 1 74  ? 48.576 7.456   25.246  1.00 15.59 ? 71  LEU A CD2   1 
ATOM   606  N  N     . CYS A 1 75  ? 50.415 12.265  23.423  1.00 16.99 ? 72  CYS A N     1 
ATOM   607  C  CA    . CYS A 1 75  ? 51.490 13.088  22.886  1.00 13.79 ? 72  CYS A CA    1 
ATOM   608  C  C     . CYS A 1 75  ? 50.993 14.525  22.717  1.00 14.96 ? 72  CYS A C     1 
ATOM   609  O  O     . CYS A 1 75  ? 50.555 14.919  21.633  1.00 17.24 ? 72  CYS A O     1 
ATOM   610  C  CB    . CYS A 1 75  ? 51.936 12.511  21.541  1.00 15.41 ? 72  CYS A CB    1 
ATOM   611  S  SG    . CYS A 1 75  ? 53.307 13.378  20.781  1.00 17.49 ? 72  CYS A SG    1 
ATOM   612  N  N     . PRO A 1 76  ? 51.044 15.313  23.800  1.00 14.32 ? 73  PRO A N     1 
ATOM   613  C  CA    . PRO A 1 76  ? 50.453 16.657  23.816  1.00 24.04 ? 73  PRO A CA    1 
ATOM   614  C  C     . PRO A 1 76  ? 51.102 17.607  22.807  1.00 15.98 ? 73  PRO A C     1 
ATOM   615  O  O     . PRO A 1 76  ? 50.451 18.547  22.347  1.00 20.95 ? 73  PRO A O     1 
ATOM   616  C  CB    . PRO A 1 76  ? 50.712 17.137  25.247  1.00 24.51 ? 73  PRO A CB    1 
ATOM   617  C  CG    . PRO A 1 76  ? 50.861 15.882  26.045  1.00 28.72 ? 73  PRO A CG    1 
ATOM   618  C  CD    . PRO A 1 76  ? 51.529 14.902  25.128  1.00 20.74 ? 73  PRO A CD    1 
ATOM   619  N  N     . ASP A 1 77  ? 52.359 17.362  22.466  1.00 17.47 ? 74  ASP A N     1 
ATOM   620  C  CA    . ASP A 1 77  ? 53.043 18.203  21.490  1.00 17.60 ? 74  ASP A CA    1 
ATOM   621  C  C     . ASP A 1 77  ? 52.926 17.681  20.062  1.00 22.91 ? 74  ASP A C     1 
ATOM   622  O  O     . ASP A 1 77  ? 53.622 18.160  19.166  1.00 16.85 ? 74  ASP A O     1 
ATOM   623  C  CB    . ASP A 1 77  ? 54.519 18.348  21.854  1.00 23.65 ? 74  ASP A CB    1 
ATOM   624  C  CG    . ASP A 1 77  ? 54.722 19.107  23.139  1.00 34.08 ? 74  ASP A CG    1 
ATOM   625  O  OD1   . ASP A 1 77  ? 55.581 18.694  23.944  1.00 37.73 ? 74  ASP A OD1   1 
ATOM   626  O  OD2   . ASP A 1 77  ? 54.016 20.115  23.340  1.00 32.99 ? 74  ASP A OD2   1 
ATOM   627  N  N     . LEU A 1 78  ? 52.049 16.707  19.851  1.00 12.18 ? 75  LEU A N     1 
ATOM   628  C  CA    . LEU A 1 78  ? 51.853 16.133  18.517  1.00 12.11 ? 75  LEU A CA    1 
ATOM   629  C  C     . LEU A 1 78  ? 51.488 17.217  17.506  1.00 11.87 ? 75  LEU A C     1 
ATOM   630  O  O     . LEU A 1 78  ? 50.546 17.967  17.720  1.00 15.35 ? 75  LEU A O     1 
ATOM   631  C  CB    . LEU A 1 78  ? 50.747 15.075  18.560  1.00 14.28 ? 75  LEU A CB    1 
ATOM   632  C  CG    . LEU A 1 78  ? 50.408 14.378  17.245  1.00 9.73  ? 75  LEU A CG    1 
ATOM   633  C  CD1   . LEU A 1 78  ? 51.584 13.508  16.801  1.00 12.29 ? 75  LEU A CD1   1 
ATOM   634  C  CD2   . LEU A 1 78  ? 49.145 13.552  17.406  1.00 13.80 ? 75  LEU A CD2   1 
ATOM   635  N  N     . LEU A 1 79  ? 52.225 17.294  16.399  1.00 10.09 ? 76  LEU A N     1 
ATOM   636  C  CA    . LEU A 1 79  ? 51.879 18.236  15.340  1.00 10.36 ? 76  LEU A CA    1 
ATOM   637  C  C     . LEU A 1 79  ? 51.009 17.539  14.307  1.00 15.62 ? 76  LEU A C     1 
ATOM   638  O  O     . LEU A 1 79  ? 51.128 16.338  14.105  1.00 14.55 ? 76  LEU A O     1 
ATOM   639  C  CB    . LEU A 1 79  ? 53.133 18.784  14.665  1.00 8.17  ? 76  LEU A CB    1 
ATOM   640  C  CG    . LEU A 1 79  ? 54.119 19.480  15.601  1.00 12.55 ? 76  LEU A CG    1 
ATOM   641  C  CD1   . LEU A 1 79  ? 55.296 20.045  14.815  1.00 13.82 ? 76  LEU A CD1   1 
ATOM   642  C  CD2   . LEU A 1 79  ? 53.410 20.566  16.407  1.00 13.15 ? 76  LEU A CD2   1 
ATOM   643  N  N     . LEU A 1 80  ? 50.138 18.292  13.645  1.00 13.02 ? 77  LEU A N     1 
ATOM   644  C  CA    . LEU A 1 80  ? 49.181 17.666  12.741  1.00 15.49 ? 77  LEU A CA    1 
ATOM   645  C  C     . LEU A 1 80  ? 49.191 18.323  11.369  1.00 18.12 ? 77  LEU A C     1 
ATOM   646  O  O     . LEU A 1 80  ? 49.336 19.541  11.261  1.00 20.87 ? 77  LEU A O     1 
ATOM   647  C  CB    . LEU A 1 80  ? 47.767 17.709  13.341  1.00 10.58 ? 77  LEU A CB    1 
ATOM   648  C  CG    . LEU A 1 80  ? 47.520 16.918  14.629  1.00 12.81 ? 77  LEU A CG    1 
ATOM   649  C  CD1   . LEU A 1 80  ? 46.096 17.123  15.130  1.00 16.10 ? 77  LEU A CD1   1 
ATOM   650  C  CD2   . LEU A 1 80  ? 47.823 15.427  14.418  1.00 15.77 ? 77  LEU A CD2   1 
ATOM   651  N  N     . ALA A 1 81  ? 49.055 17.518  10.319  1.00 8.08  ? 78  ALA A N     1 
ATOM   652  C  CA    . ALA A 1 81  ? 48.807 18.066  8.992   1.00 10.88 ? 78  ALA A CA    1 
ATOM   653  C  C     . ALA A 1 81  ? 47.489 17.493  8.494   1.00 17.35 ? 78  ALA A C     1 
ATOM   654  O  O     . ALA A 1 81  ? 47.227 16.307  8.669   1.00 17.53 ? 78  ALA A O     1 
ATOM   655  C  CB    . ALA A 1 81  ? 49.953 17.727  8.037   1.00 13.09 ? 78  ALA A CB    1 
ATOM   656  N  N     . GLN A 1 82  ? 46.648 18.337  7.901   1.00 10.80 ? 79  GLN A N     1 
ATOM   657  C  CA    . GLN A 1 82  ? 45.309 17.911  7.493   1.00 14.65 ? 79  GLN A CA    1 
ATOM   658  C  C     . GLN A 1 82  ? 45.270 17.517  6.028   1.00 11.12 ? 79  GLN A C     1 
ATOM   659  O  O     . GLN A 1 82  ? 45.856 18.192  5.185   1.00 14.30 ? 79  GLN A O     1 
ATOM   660  C  CB    . GLN A 1 82  ? 44.302 19.049  7.695   1.00 14.73 ? 79  GLN A CB    1 
ATOM   661  C  CG    . GLN A 1 82  ? 44.042 19.443  9.125   1.00 27.83 ? 79  GLN A CG    1 
ATOM   662  C  CD    . GLN A 1 82  ? 43.172 20.686  9.209   1.00 25.39 ? 79  GLN A CD    1 
ATOM   663  O  OE1   . GLN A 1 82  ? 42.652 21.163  8.199   1.00 37.54 ? 79  GLN A OE1   1 
ATOM   664  N  NE2   . GLN A 1 82  ? 43.010 21.211  10.407  1.00 27.69 ? 79  GLN A NE2   1 
ATOM   665  N  N     . VAL A 1 83  ? 44.549 16.439  5.729   1.00 9.99  ? 80  VAL A N     1 
ATOM   666  C  CA    . VAL A 1 83  ? 44.264 16.082  4.348   1.00 10.41 ? 80  VAL A CA    1 
ATOM   667  C  C     . VAL A 1 83  ? 43.390 17.164  3.725   1.00 17.19 ? 80  VAL A C     1 
ATOM   668  O  O     . VAL A 1 83  ? 42.454 17.661  4.358   1.00 13.16 ? 80  VAL A O     1 
ATOM   669  C  CB    . VAL A 1 83  ? 43.520 14.743  4.254   1.00 9.67  ? 80  VAL A CB    1 
ATOM   670  C  CG1   . VAL A 1 83  ? 43.196 14.419  2.808   1.00 13.30 ? 80  VAL A CG1   1 
ATOM   671  C  CG2   . VAL A 1 83  ? 44.350 13.621  4.883   1.00 13.07 ? 80  VAL A CG2   1 
ATOM   672  N  N     . ARG A 1 84  ? 43.705 17.523  2.485   1.00 13.55 ? 81  ARG A N     1 
ATOM   673  C  CA    . ARG A 1 84  ? 42.941 18.523  1.736   1.00 11.74 ? 81  ARG A CA    1 
ATOM   674  C  C     . ARG A 1 84  ? 41.488 18.095  1.635   1.00 15.40 ? 81  ARG A C     1 
ATOM   675  O  O     . ARG A 1 84  ? 41.189 16.908  1.558   1.00 13.33 ? 81  ARG A O     1 
ATOM   676  C  CB    . ARG A 1 84  ? 43.544 18.675  0.337   1.00 17.29 ? 81  ARG A CB    1 
ATOM   677  C  CG    . ARG A 1 84  ? 42.645 19.365  -0.699  1.00 25.77 ? 81  ARG A CG    1 
ATOM   678  C  CD    . ARG A 1 84  ? 43.212 19.199  -2.124  1.00 32.89 ? 81  ARG A CD    1 
ATOM   679  N  NE    . ARG A 1 84  ? 42.307 19.713  -3.155  1.00 46.10 ? 81  ARG A NE    1 
ATOM   680  C  CZ    . ARG A 1 84  ? 42.489 19.576  -4.470  1.00 55.65 ? 81  ARG A CZ    1 
ATOM   681  N  NH1   . ARG A 1 84  ? 43.553 18.937  -4.945  1.00 29.37 ? 81  ARG A NH1   1 
ATOM   682  N  NH2   . ARG A 1 84  ? 41.599 20.081  -5.319  1.00 39.48 ? 81  ARG A NH2   1 
ATOM   683  N  N     . GLU A 1 85  ? 40.581 19.064  1.644   1.00 14.21 ? 82  GLU A N     1 
ATOM   684  C  CA    . GLU A 1 85  ? 39.176 18.766  1.439   1.00 15.38 ? 82  GLU A CA    1 
ATOM   685  C  C     . GLU A 1 85  ? 38.692 19.567  0.251   1.00 17.68 ? 82  GLU A C     1 
ATOM   686  O  O     . GLU A 1 85  ? 38.992 20.758  0.132   1.00 17.45 ? 82  GLU A O     1 
ATOM   687  C  CB    . GLU A 1 85  ? 38.358 19.096  2.685   1.00 17.34 ? 82  GLU A CB    1 
ATOM   688  C  CG    . GLU A 1 85  ? 38.612 18.140  3.836   1.00 19.05 ? 82  GLU A CG    1 
ATOM   689  C  CD    . GLU A 1 85  ? 37.785 18.471  5.060   1.00 25.55 ? 82  GLU A CD    1 
ATOM   690  O  OE1   . GLU A 1 85  ? 36.671 19.016  4.904   1.00 30.42 ? 82  GLU A OE1   1 
ATOM   691  O  OE2   . GLU A 1 85  ? 38.265 18.195  6.176   1.00 26.94 ? 82  GLU A OE2   1 
ATOM   692  N  N     . SER A 1 86  ? 37.963 18.897  -0.637  1.00 14.16 ? 83  SER A N     1 
ATOM   693  C  CA    . SER A 1 86  ? 37.393 19.531  -1.810  1.00 17.00 ? 83  SER A CA    1 
ATOM   694  C  C     . SER A 1 86  ? 36.039 18.906  -2.075  1.00 23.42 ? 83  SER A C     1 
ATOM   695  O  O     . SER A 1 86  ? 35.863 17.707  -1.901  1.00 21.01 ? 83  SER A O     1 
ATOM   696  C  CB    . SER A 1 86  ? 38.293 19.334  -3.027  1.00 16.96 ? 83  SER A CB    1 
ATOM   697  O  OG    . SER A 1 86  ? 39.602 19.801  -2.774  1.00 29.12 ? 83  SER A OG    1 
ATOM   698  N  N     . ARG A 1 87  ? 35.081 19.724  -2.490  1.00 24.52 ? 84  ARG A N     1 
ATOM   699  C  CA    . ARG A 1 87  ? 33.739 19.232  -2.775  1.00 23.49 ? 84  ARG A CA    1 
ATOM   700  C  C     . ARG A 1 87  ? 33.149 18.444  -1.618  1.00 21.27 ? 84  ARG A C     1 
ATOM   701  O  O     . ARG A 1 87  ? 32.437 17.460  -1.831  1.00 27.37 ? 84  ARG A O     1 
ATOM   702  C  CB    . ARG A 1 87  ? 33.745 18.368  -4.040  1.00 24.66 ? 84  ARG A CB    1 
ATOM   703  C  CG    . ARG A 1 87  ? 34.305 19.069  -5.253  1.00 29.38 ? 84  ARG A CG    1 
ATOM   704  C  CD    . ARG A 1 87  ? 34.120 18.228  -6.500  1.00 33.56 ? 84  ARG A CD    1 
ATOM   705  N  NE    . ARG A 1 87  ? 34.961 18.698  -7.594  1.00 33.57 ? 84  ARG A NE    1 
ATOM   706  C  CZ    . ARG A 1 87  ? 36.256 18.424  -7.708  1.00 36.83 ? 84  ARG A CZ    1 
ATOM   707  N  NH1   . ARG A 1 87  ? 36.872 17.692  -6.783  1.00 39.50 ? 84  ARG A NH1   1 
ATOM   708  N  NH2   . ARG A 1 87  ? 36.940 18.894  -8.740  1.00 35.64 ? 84  ARG A NH2   1 
ATOM   709  N  N     . GLY A 1 88  ? 33.444 18.870  -0.393  1.00 15.15 ? 85  GLY A N     1 
ATOM   710  C  CA    . GLY A 1 88  ? 32.870 18.249  0.783   1.00 21.55 ? 85  GLY A CA    1 
ATOM   711  C  C     . GLY A 1 88  ? 33.485 16.928  1.205   1.00 14.91 ? 85  GLY A C     1 
ATOM   712  O  O     . GLY A 1 88  ? 32.946 16.249  2.078   1.00 19.09 ? 85  GLY A O     1 
ATOM   713  N  N     . LYS A 1 89  ? 34.621 16.562  0.610   1.00 15.76 ? 86  LYS A N     1 
ATOM   714  C  CA    . LYS A 1 89  ? 35.260 15.285  0.943   1.00 12.73 ? 86  LYS A CA    1 
ATOM   715  C  C     . LYS A 1 89  ? 36.786 15.386  0.994   1.00 11.99 ? 86  LYS A C     1 
ATOM   716  O  O     . LYS A 1 89  ? 37.378 16.289  0.414   1.00 12.89 ? 86  LYS A O     1 
ATOM   717  C  CB    . LYS A 1 89  ? 34.848 14.202  -0.056  1.00 18.01 ? 86  LYS A CB    1 
ATOM   718  C  CG    . LYS A 1 89  ? 35.276 14.482  -1.490  1.00 17.88 ? 86  LYS A CG    1 
ATOM   719  C  CD    . LYS A 1 89  ? 34.849 13.359  -2.443  1.00 23.05 ? 86  LYS A CD    1 
ATOM   720  C  CE    . LYS A 1 89  ? 35.405 11.995  -2.029  1.00 18.61 ? 86  LYS A CE    1 
ATOM   721  N  NZ    . LYS A 1 89  ? 36.900 11.918  -2.092  1.00 12.75 ? 86  LYS A NZ    1 
ATOM   722  N  N     . ALA A 1 90  ? 37.416 14.451  1.696   1.00 14.85 ? 87  ALA A N     1 
ATOM   723  C  CA    . ALA A 1 90  ? 38.867 14.350  1.675   1.00 13.83 ? 87  ALA A CA    1 
ATOM   724  C  C     . ALA A 1 90  ? 39.296 14.130  0.242   1.00 12.13 ? 87  ALA A C     1 
ATOM   725  O  O     . ALA A 1 90  ? 38.616 13.447  -0.520  1.00 17.95 ? 87  ALA A O     1 
ATOM   726  C  CB    . ALA A 1 90  ? 39.337 13.196  2.551   1.00 19.90 ? 87  ALA A CB    1 
ATOM   727  N  N     . ASN A 1 91  ? 40.418 14.732  -0.126  1.00 12.07 ? 88  ASN A N     1 
ATOM   728  C  CA    . ASN A 1 91  ? 40.953 14.600  -1.471  1.00 20.73 ? 88  ASN A CA    1 
ATOM   729  C  C     . ASN A 1 91  ? 42.425 14.219  -1.385  1.00 16.30 ? 88  ASN A C     1 
ATOM   730  O  O     . ASN A 1 91  ? 43.230 14.967  -0.837  1.00 14.53 ? 88  ASN A O     1 
ATOM   731  C  CB    . ASN A 1 91  ? 40.789 15.914  -2.226  1.00 17.69 ? 88  ASN A CB    1 
ATOM   732  C  CG    . ASN A 1 91  ? 41.197 15.798  -3.673  1.00 28.04 ? 88  ASN A CG    1 
ATOM   733  O  OD1   . ASN A 1 91  ? 42.348 15.503  -3.974  1.00 18.04 ? 88  ASN A OD1   1 
ATOM   734  N  ND2   . ASN A 1 91  ? 40.250 16.022  -4.582  1.00 22.84 ? 88  ASN A ND2   1 
ATOM   735  N  N     . LEU A 1 92  ? 42.773 13.050  -1.915  1.00 14.65 ? 89  LEU A N     1 
ATOM   736  C  CA    . LEU A 1 92  ? 44.107 12.483  -1.704  1.00 13.67 ? 89  LEU A CA    1 
ATOM   737  C  C     . LEU A 1 92  ? 45.102 12.782  -2.830  1.00 11.76 ? 89  LEU A C     1 
ATOM   738  O  O     . LEU A 1 92  ? 46.137 12.127  -2.937  1.00 11.54 ? 89  LEU A O     1 
ATOM   739  C  CB    . LEU A 1 92  ? 44.005 10.965  -1.500  1.00 13.36 ? 89  LEU A CB    1 
ATOM   740  C  CG    . LEU A 1 92  ? 43.022 10.590  -0.391  1.00 13.64 ? 89  LEU A CG    1 
ATOM   741  C  CD1   . LEU A 1 92  ? 42.778 9.090   -0.341  1.00 18.41 ? 89  LEU A CD1   1 
ATOM   742  C  CD2   . LEU A 1 92  ? 43.541 11.116  0.944   1.00 17.65 ? 89  LEU A CD2   1 
ATOM   743  N  N     . THR A 1 93  ? 44.796 13.775  -3.659  1.00 12.10 ? 90  THR A N     1 
ATOM   744  C  CA    . THR A 1 93  ? 45.620 14.045  -4.838  1.00 12.37 ? 90  THR A CA    1 
ATOM   745  C  C     . THR A 1 93  ? 47.108 14.267  -4.534  1.00 15.29 ? 90  THR A C     1 
ATOM   746  O  O     . THR A 1 93  ? 47.981 13.734  -5.231  1.00 13.87 ? 90  THR A O     1 
ATOM   747  C  CB    . THR A 1 93  ? 45.059 15.238  -5.649  1.00 18.19 ? 90  THR A CB    1 
ATOM   748  O  OG1   . THR A 1 93  ? 43.728 14.928  -6.082  1.00 19.53 ? 90  THR A OG1   1 
ATOM   749  C  CG2   . THR A 1 93  ? 45.938 15.515  -6.862  1.00 16.92 ? 90  THR A CG2   1 
ATOM   750  N  N     . LYS A 1 94  ? 47.402 15.040  -3.494  1.00 12.54 ? 91  LYS A N     1 
ATOM   751  C  CA    . LYS A 1 94  ? 48.791 15.318  -3.146  1.00 13.70 ? 91  LYS A CA    1 
ATOM   752  C  C     . LYS A 1 94  ? 49.614 14.040  -2.962  1.00 15.36 ? 91  LYS A C     1 
ATOM   753  O  O     . LYS A 1 94  ? 50.778 13.966  -3.374  1.00 14.27 ? 91  LYS A O     1 
ATOM   754  C  CB    . LYS A 1 94  ? 48.869 16.138  -1.863  1.00 12.62 ? 91  LYS A CB    1 
ATOM   755  C  CG    . LYS A 1 94  ? 50.273 16.640  -1.580  1.00 15.54 ? 91  LYS A CG    1 
ATOM   756  C  CD    . LYS A 1 94  ? 50.387 17.212  -0.172  1.00 14.90 ? 91  LYS A CD    1 
ATOM   757  C  CE    . LYS A 1 94  ? 49.409 18.348  0.040   1.00 20.05 ? 91  LYS A CE    1 
ATOM   758  N  NZ    . LYS A 1 94  ? 49.550 18.932  1.400   1.00 13.80 ? 91  LYS A NZ    1 
ATOM   759  N  N     . TYR A 1 95  ? 49.002 13.051  -2.322  1.00 10.28 ? 92  TYR A N     1 
ATOM   760  C  CA    . TYR A 1 95  ? 49.667 11.781  -2.033  1.00 9.09  ? 92  TYR A CA    1 
ATOM   761  C  C     . TYR A 1 95  ? 49.746 10.900  -3.271  1.00 10.10 ? 92  TYR A C     1 
ATOM   762  O  O     . TYR A 1 95  ? 50.751 10.226  -3.481  1.00 12.54 ? 92  TYR A O     1 
ATOM   763  C  CB    . TYR A 1 95  ? 48.966 11.061  -0.876  1.00 10.88 ? 92  TYR A CB    1 
ATOM   764  C  CG    . TYR A 1 95  ? 48.674 12.042  0.217   1.00 9.92  ? 92  TYR A CG    1 
ATOM   765  C  CD1   . TYR A 1 95  ? 47.378 12.468  0.460   1.00 11.03 ? 92  TYR A CD1   1 
ATOM   766  C  CD2   . TYR A 1 95  ? 49.705 12.604  0.960   1.00 10.32 ? 92  TYR A CD2   1 
ATOM   767  C  CE1   . TYR A 1 95  ? 47.110 13.408  1.432   1.00 14.34 ? 92  TYR A CE1   1 
ATOM   768  C  CE2   . TYR A 1 95  ? 49.446 13.538  1.935   1.00 11.37 ? 92  TYR A CE2   1 
ATOM   769  C  CZ    . TYR A 1 95  ? 48.142 13.938  2.165   1.00 12.15 ? 92  TYR A CZ    1 
ATOM   770  O  OH    . TYR A 1 95  ? 47.862 14.882  3.137   1.00 15.65 ? 92  TYR A OH    1 
ATOM   771  N  N     . ARG A 1 96  ? 48.711 10.931  -4.110  1.00 11.50 ? 93  ARG A N     1 
ATOM   772  C  CA    . ARG A 1 96  ? 48.779 10.198  -5.382  1.00 14.70 ? 93  ARG A CA    1 
ATOM   773  C  C     . ARG A 1 96  ? 49.892 10.751  -6.274  1.00 15.08 ? 93  ARG A C     1 
ATOM   774  O  O     . ARG A 1 96  ? 50.617 9.989   -6.927  1.00 14.93 ? 93  ARG A O     1 
ATOM   775  C  CB    . ARG A 1 96  ? 47.433 10.203  -6.121  1.00 12.19 ? 93  ARG A CB    1 
ATOM   776  C  CG    . ARG A 1 96  ? 46.363 9.376   -5.431  1.00 11.84 ? 93  ARG A CG    1 
ATOM   777  C  CD    . ARG A 1 96  ? 45.129 9.132   -6.310  1.00 14.82 ? 93  ARG A CD    1 
ATOM   778  N  NE    . ARG A 1 96  ? 44.072 8.478   -5.535  1.00 18.28 ? 93  ARG A NE    1 
ATOM   779  C  CZ    . ARG A 1 96  ? 43.076 9.120   -4.924  1.00 14.71 ? 93  ARG A CZ    1 
ATOM   780  N  NH1   . ARG A 1 96  ? 42.180 8.435   -4.222  1.00 14.00 ? 93  ARG A NH1   1 
ATOM   781  N  NH2   . ARG A 1 96  ? 42.975 10.445  -5.014  1.00 12.03 ? 93  ARG A NH2   1 
ATOM   782  N  N     . GLU A 1 97  ? 50.042 12.071  -6.299  1.00 10.87 ? 94  GLU A N     1 
ATOM   783  C  CA    . GLU A 1 97  ? 51.080 12.673  -7.135  1.00 14.10 ? 94  GLU A CA    1 
ATOM   784  C  C     . GLU A 1 97  ? 52.480 12.384  -6.599  1.00 16.17 ? 94  GLU A C     1 
ATOM   785  O  O     . GLU A 1 97  ? 53.407 12.137  -7.377  1.00 12.39 ? 94  GLU A O     1 
ATOM   786  C  CB    . GLU A 1 97  ? 50.831 14.171  -7.351  1.00 15.51 ? 94  GLU A CB    1 
ATOM   787  C  CG    . GLU A 1 97  ? 49.594 14.401  -8.205  1.00 12.00 ? 94  GLU A CG    1 
ATOM   788  C  CD    . GLU A 1 97  ? 49.205 15.857  -8.345  1.00 28.23 ? 94  GLU A CD    1 
ATOM   789  O  OE1   . GLU A 1 97  ? 49.807 16.716  -7.667  1.00 32.25 ? 94  GLU A OE1   1 
ATOM   790  O  OE2   . GLU A 1 97  ? 48.283 16.136  -9.138  1.00 25.52 ? 94  GLU A OE2   1 
ATOM   791  N  N     . ALA A 1 98  ? 52.628 12.399  -5.276  1.00 14.36 ? 95  ALA A N     1 
ATOM   792  C  CA    . ALA A 1 98  ? 53.903 12.050  -4.653  1.00 11.99 ? 95  ALA A CA    1 
ATOM   793  C  C     . ALA A 1 98  ? 54.281 10.603  -4.965  1.00 10.75 ? 95  ALA A C     1 
ATOM   794  O  O     . ALA A 1 98  ? 55.462 10.277  -5.146  1.00 13.20 ? 95  ALA A O     1 
ATOM   795  C  CB    . ALA A 1 98  ? 53.837 12.259  -3.138  1.00 9.65  ? 95  ALA A CB    1 
ATOM   796  N  N     . SER A 1 99  ? 53.270 9.747   -5.021  1.00 10.82 ? 96  SER A N     1 
ATOM   797  C  CA    . SER A 1 99  ? 53.463 8.331   -5.329  1.00 10.32 ? 96  SER A CA    1 
ATOM   798  C  C     . SER A 1 99  ? 53.995 8.173   -6.751  1.00 11.72 ? 96  SER A C     1 
ATOM   799  O  O     . SER A 1 99  ? 54.918 7.394   -7.010  1.00 11.59 ? 96  SER A O     1 
ATOM   800  C  CB    . SER A 1 99  ? 52.144 7.582   -5.191  1.00 14.80 ? 96  SER A CB    1 
ATOM   801  O  OG    . SER A 1 99  ? 52.270 6.231   -5.589  1.00 18.08 ? 96  SER A OG    1 
ATOM   802  N  N     . VAL A 1 100 ? 53.406 8.912   -7.680  1.00 12.34 ? 97  VAL A N     1 
ATOM   803  C  CA    . VAL A 1 100 ? 53.909 8.881   -9.052  1.00 15.02 ? 97  VAL A CA    1 
ATOM   804  C  C     . VAL A 1 100 ? 55.387 9.275   -9.112  1.00 12.48 ? 97  VAL A C     1 
ATOM   805  O  O     . VAL A 1 100 ? 56.168 8.671   -9.851  1.00 12.24 ? 97  VAL A O     1 
ATOM   806  C  CB    . VAL A 1 100 ? 53.057 9.779   -9.982  1.00 13.44 ? 97  VAL A CB    1 
ATOM   807  C  CG1   . VAL A 1 100 ? 53.736 9.946   -11.339 1.00 21.72 ? 97  VAL A CG1   1 
ATOM   808  C  CG2   . VAL A 1 100 ? 51.669 9.172   -10.138 1.00 12.63 ? 97  VAL A CG2   1 
ATOM   809  N  N     . GLU A 1 101 ? 55.787 10.268  -8.316  1.00 10.57 ? 98  GLU A N     1 
ATOM   810  C  CA    . GLU A 1 101 ? 57.200 10.670  -8.279  1.00 11.69 ? 98  GLU A CA    1 
ATOM   811  C  C     . GLU A 1 101 ? 58.106 9.480   -7.991  1.00 11.99 ? 98  GLU A C     1 
ATOM   812  O  O     . GLU A 1 101 ? 59.113 9.267   -8.670  1.00 13.46 ? 98  GLU A O     1 
ATOM   813  C  CB    . GLU A 1 101 ? 57.471 11.724  -7.204  1.00 13.79 ? 98  GLU A CB    1 
ATOM   814  C  CG    . GLU A 1 101 ? 57.008 13.128  -7.523  1.00 16.23 ? 98  GLU A CG    1 
ATOM   815  C  CD    . GLU A 1 101 ? 57.342 14.083  -6.390  1.00 12.99 ? 98  GLU A CD    1 
ATOM   816  O  OE1   . GLU A 1 101 ? 58.525 14.470  -6.262  1.00 14.41 ? 98  GLU A OE1   1 
ATOM   817  O  OE2   . GLU A 1 101 ? 56.423 14.431  -5.618  1.00 18.52 ? 98  GLU A OE2   1 
ATOM   818  N  N     . VAL A 1 102 ? 57.754 8.726   -6.957  1.00 9.95  ? 99  VAL A N     1 
ATOM   819  C  CA    . VAL A 1 102 ? 58.571 7.591   -6.554  1.00 9.38  ? 99  VAL A CA    1 
ATOM   820  C  C     . VAL A 1 102 ? 58.511 6.439   -7.547  1.00 10.80 ? 99  VAL A C     1 
ATOM   821  O  O     . VAL A 1 102 ? 59.540 5.836   -7.872  1.00 14.23 ? 99  VAL A O     1 
ATOM   822  C  CB    . VAL A 1 102 ? 58.161 7.077   -5.168  1.00 9.45  ? 99  VAL A CB    1 
ATOM   823  C  CG1   . VAL A 1 102 ? 58.947 5.823   -4.827  1.00 19.07 ? 99  VAL A CG1   1 
ATOM   824  C  CG2   . VAL A 1 102 ? 58.406 8.166   -4.130  1.00 14.82 ? 99  VAL A CG2   1 
ATOM   825  N  N     . MET A 1 103 ? 57.311 6.122   -8.016  1.00 9.29  ? 100 MET A N     1 
ATOM   826  C  CA    . MET A 1 103 ? 57.152 5.013   -8.948  1.00 9.75  ? 100 MET A CA    1 
ATOM   827  C  C     . MET A 1 103 ? 57.944 5.254   -10.231 1.00 14.93 ? 100 MET A C     1 
ATOM   828  O  O     . MET A 1 103 ? 58.517 4.324   -10.792 1.00 14.52 ? 100 MET A O     1 
ATOM   829  C  CB    . MET A 1 103 ? 55.675 4.773   -9.278  1.00 12.64 ? 100 MET A CB    1 
ATOM   830  C  CG    . MET A 1 103 ? 54.792 4.548   -8.067  1.00 23.48 ? 100 MET A CG    1 
ATOM   831  S  SD    . MET A 1 103 ? 55.092 2.939   -7.313  1.00 24.01 ? 100 MET A SD    1 
ATOM   832  C  CE    . MET A 1 103 ? 54.069 3.015   -5.825  1.00 14.61 ? 100 MET A CE    1 
ATOM   833  N  N     . GLU A 1 104 ? 57.981 6.502   -10.696 1.00 14.01 ? 101 GLU A N     1 
ATOM   834  C  CA    . GLU A 1 104 ? 58.693 6.801   -11.933 1.00 14.93 ? 101 GLU A CA    1 
ATOM   835  C  C     . GLU A 1 104 ? 60.204 6.642   -11.773 1.00 13.65 ? 101 GLU A C     1 
ATOM   836  O  O     . GLU A 1 104 ? 60.885 6.159   -12.685 1.00 14.40 ? 101 GLU A O     1 
ATOM   837  C  CB    . GLU A 1 104 ? 58.299 8.185   -12.470 1.00 16.05 ? 101 GLU A CB    1 
ATOM   838  C  CG    . GLU A 1 104 ? 56.870 8.211   -13.016 1.00 14.32 ? 101 GLU A CG    1 
ATOM   839  C  CD    . GLU A 1 104 ? 56.519 9.542   -13.673 1.00 31.49 ? 101 GLU A CD    1 
ATOM   840  O  OE1   . GLU A 1 104 ? 57.334 10.483  -13.587 1.00 35.10 ? 101 GLU A OE1   1 
ATOM   841  O  OE2   . GLU A 1 104 ? 55.430 9.644   -14.276 1.00 30.64 ? 101 GLU A OE2   1 
ATOM   842  N  N     . ILE A 1 105 ? 60.719 6.998   -10.602 1.00 12.67 ? 102 ILE A N     1 
ATOM   843  C  CA    . ILE A 1 105 ? 62.137 6.774   -10.290 1.00 12.61 ? 102 ILE A CA    1 
ATOM   844  C  C     . ILE A 1 105 ? 62.446 5.274   -10.234 1.00 15.36 ? 102 ILE A C     1 
ATOM   845  O  O     . ILE A 1 105 ? 63.421 4.796   -10.830 1.00 13.34 ? 102 ILE A O     1 
ATOM   846  C  CB    . ILE A 1 105 ? 62.535 7.453   -8.965  1.00 12.34 ? 102 ILE A CB    1 
ATOM   847  C  CG1   . ILE A 1 105 ? 62.398 8.977   -9.077  1.00 12.98 ? 102 ILE A CG1   1 
ATOM   848  C  CG2   . ILE A 1 105 ? 63.962 7.083   -8.553  1.00 12.97 ? 102 ILE A CG2   1 
ATOM   849  C  CD1   . ILE A 1 105 ? 62.384 9.677   -7.740  1.00 16.90 ? 102 ILE A CD1   1 
ATOM   850  N  N     . MET A 1 106 ? 61.611 4.511   -9.539  1.00 12.01 ? 103 MET A N     1 
ATOM   851  C  CA    . MET A 1 106 ? 61.867 3.077   -9.455  1.00 11.00 ? 103 MET A CA    1 
ATOM   852  C  C     . MET A 1 106 ? 61.872 2.418   -10.823 1.00 16.34 ? 103 MET A C     1 
ATOM   853  O  O     . MET A 1 106 ? 62.651 1.504   -11.076 1.00 15.33 ? 103 MET A O     1 
ATOM   854  C  CB    . MET A 1 106 ? 60.846 2.385   -8.543  1.00 12.06 ? 103 MET A CB    1 
ATOM   855  C  CG    . MET A 1 106 ? 61.057 2.721   -7.076  1.00 12.86 ? 103 MET A CG    1 
ATOM   856  S  SD    . MET A 1 106 ? 59.888 1.856   -6.013  1.00 18.08 ? 103 MET A SD    1 
ATOM   857  C  CE    . MET A 1 106 ? 58.352 2.545   -6.594  1.00 25.59 ? 103 MET A CE    1 
ATOM   858  N  N     . SER A 1 107 ? 61.005 2.893   -11.708 1.00 14.52 ? 104 SER A N     1 
ATOM   859  C  CA    A SER A 1 107 ? 60.872 2.300   -13.032 0.26 18.30 ? 104 SER A CA    1 
ATOM   860  C  CA    B SER A 1 107 ? 60.876 2.300   -13.030 0.74 18.34 ? 104 SER A CA    1 
ATOM   861  C  C     . SER A 1 107 ? 62.132 2.470   -13.880 1.00 14.78 ? 104 SER A C     1 
ATOM   862  O  O     . SER A 1 107 ? 62.286 1.800   -14.895 1.00 16.92 ? 104 SER A O     1 
ATOM   863  C  CB    A SER A 1 107 ? 59.659 2.879   -13.763 0.26 16.86 ? 104 SER A CB    1 
ATOM   864  C  CB    B SER A 1 107 ? 59.660 2.878   -13.759 0.74 16.76 ? 104 SER A CB    1 
ATOM   865  O  OG    A SER A 1 107 ? 59.825 4.264   -14.006 0.26 18.78 ? 104 SER A OG    1 
ATOM   866  O  OG    B SER A 1 107 ? 58.466 2.553   -13.076 0.74 21.95 ? 104 SER A OG    1 
ATOM   867  N  N     . ARG A 1 108 ? 63.023 3.375   -13.474 1.00 12.52 ? 105 ARG A N     1 
ATOM   868  C  CA    . ARG A 1 108 ? 64.289 3.552   -14.193 1.00 18.95 ? 105 ARG A CA    1 
ATOM   869  C  C     . ARG A 1 108 ? 65.188 2.340   -14.006 1.00 23.19 ? 105 ARG A C     1 
ATOM   870  O  O     . ARG A 1 108 ? 65.989 2.000   -14.882 1.00 17.53 ? 105 ARG A O     1 
ATOM   871  C  CB    . ARG A 1 108 ? 65.048 4.792   -13.716 1.00 17.84 ? 105 ARG A CB    1 
ATOM   872  C  CG    . ARG A 1 108 ? 64.371 6.104   -14.028 1.00 17.46 ? 105 ARG A CG    1 
ATOM   873  C  CD    . ARG A 1 108 ? 65.393 7.220   -14.217 1.00 25.97 ? 105 ARG A CD    1 
ATOM   874  N  NE    . ARG A 1 108 ? 66.385 7.292   -13.145 1.00 25.42 ? 105 ARG A NE    1 
ATOM   875  C  CZ    . ARG A 1 108 ? 66.342 8.160   -12.137 1.00 17.95 ? 105 ARG A CZ    1 
ATOM   876  N  NH1   . ARG A 1 108 ? 67.292 8.150   -11.215 1.00 30.10 ? 105 ARG A NH1   1 
ATOM   877  N  NH2   . ARG A 1 108 ? 65.345 9.029   -12.045 1.00 18.81 ? 105 ARG A NH2   1 
ATOM   878  N  N     . PHE A 1 109 ? 65.059 1.704   -12.848 1.00 19.39 ? 106 PHE A N     1 
ATOM   879  C  CA    . PHE A 1 109 ? 65.922 0.580   -12.475 1.00 21.63 ? 106 PHE A CA    1 
ATOM   880  C  C     . PHE A 1 109 ? 65.403 -0.766  -12.966 1.00 26.11 ? 106 PHE A C     1 
ATOM   881  O  O     . PHE A 1 109 ? 66.176 -1.630  -13.385 1.00 24.59 ? 106 PHE A O     1 
ATOM   882  C  CB    . PHE A 1 109 ? 66.107 0.542   -10.958 1.00 17.27 ? 106 PHE A CB    1 
ATOM   883  C  CG    . PHE A 1 109 ? 66.850 1.724   -10.417 1.00 22.21 ? 106 PHE A CG    1 
ATOM   884  C  CD1   . PHE A 1 109 ? 66.209 2.933   -10.231 1.00 15.02 ? 106 PHE A CD1   1 
ATOM   885  C  CD2   . PHE A 1 109 ? 68.195 1.628   -10.100 1.00 16.48 ? 106 PHE A CD2   1 
ATOM   886  C  CE1   . PHE A 1 109 ? 66.904 4.034   -9.730  1.00 14.47 ? 106 PHE A CE1   1 
ATOM   887  C  CE2   . PHE A 1 109 ? 68.886 2.715   -9.605  1.00 19.41 ? 106 PHE A CE2   1 
ATOM   888  C  CZ    . PHE A 1 109 ? 68.242 3.922   -9.424  1.00 17.36 ? 106 PHE A CZ    1 
ATOM   889  N  N     . ALA A 1 110 ? 64.092 -0.946  -12.905 1.00 23.39 ? 107 ALA A N     1 
ATOM   890  C  CA    . ALA A 1 110 ? 63.487 -2.208  -13.295 1.00 21.41 ? 107 ALA A CA    1 
ATOM   891  C  C     . ALA A 1 110 ? 61.987 -2.070  -13.471 1.00 21.90 ? 107 ALA A C     1 
ATOM   892  O  O     . ALA A 1 110 ? 61.397 -1.048  -13.115 1.00 22.54 ? 107 ALA A O     1 
ATOM   893  C  CB    . ALA A 1 110 ? 63.793 -3.284  -12.268 1.00 25.99 ? 107 ALA A CB    1 
ATOM   894  N  N     . VAL A 1 111 ? 61.384 -3.107  -14.041 1.00 26.79 ? 108 VAL A N     1 
ATOM   895  C  CA    . VAL A 1 111 ? 59.942 -3.194  -14.174 1.00 28.28 ? 108 VAL A CA    1 
ATOM   896  C  C     . VAL A 1 111 ? 59.344 -3.308  -12.779 1.00 20.80 ? 108 VAL A C     1 
ATOM   897  O  O     . VAL A 1 111 ? 59.815 -4.100  -11.960 1.00 26.15 ? 108 VAL A O     1 
ATOM   898  C  CB    . VAL A 1 111 ? 59.543 -4.439  -14.981 1.00 40.75 ? 108 VAL A CB    1 
ATOM   899  C  CG1   . VAL A 1 111 ? 58.043 -4.448  -15.239 1.00 37.70 ? 108 VAL A CG1   1 
ATOM   900  C  CG2   . VAL A 1 111 ? 60.318 -4.493  -16.287 1.00 42.77 ? 108 VAL A CG2   1 
ATOM   901  N  N     . ILE A 1 112 ? 58.326 -2.506  -12.494 1.00 23.72 ? 109 ILE A N     1 
ATOM   902  C  CA    . ILE A 1 112 ? 57.726 -2.535  -11.165 1.00 16.29 ? 109 ILE A CA    1 
ATOM   903  C  C     . ILE A 1 112 ? 56.271 -2.974  -11.191 1.00 12.14 ? 109 ILE A C     1 
ATOM   904  O  O     . ILE A 1 112 ? 55.574 -2.822  -12.199 1.00 16.18 ? 109 ILE A O     1 
ATOM   905  C  CB    . ILE A 1 112 ? 57.821 -1.160  -10.465 1.00 18.81 ? 109 ILE A CB    1 
ATOM   906  C  CG1   . ILE A 1 112 ? 56.811 -0.186  -11.069 1.00 21.93 ? 109 ILE A CG1   1 
ATOM   907  C  CG2   . ILE A 1 112 ? 59.244 -0.616  -10.551 1.00 25.85 ? 109 ILE A CG2   1 
ATOM   908  C  CD1   . ILE A 1 112 ? 56.568 1.056   -10.217 1.00 26.47 ? 109 ILE A CD1   1 
ATOM   909  N  N     . GLU A 1 113 ? 55.822 -3.544  -10.079 1.00 11.28 ? 110 GLU A N     1 
ATOM   910  C  CA    . GLU A 1 113 ? 54.405 -3.782  -9.861  1.00 10.56 ? 110 GLU A CA    1 
ATOM   911  C  C     . GLU A 1 113 ? 53.956 -2.846  -8.753  1.00 13.96 ? 110 GLU A C     1 
ATOM   912  O  O     . GLU A 1 113 ? 54.427 -2.959  -7.628  1.00 12.94 ? 110 GLU A O     1 
ATOM   913  C  CB    . GLU A 1 113 ? 54.132 -5.235  -9.442  1.00 13.94 ? 110 GLU A CB    1 
ATOM   914  C  CG    . GLU A 1 113 ? 52.638 -5.521  -9.238  1.00 16.57 ? 110 GLU A CG    1 
ATOM   915  C  CD    . GLU A 1 113 ? 52.353 -6.911  -8.703  1.00 17.06 ? 110 GLU A CD    1 
ATOM   916  O  OE1   . GLU A 1 113 ? 51.283 -7.098  -8.086  1.00 20.78 ? 110 GLU A OE1   1 
ATOM   917  O  OE2   . GLU A 1 113 ? 53.190 -7.816  -8.896  1.00 15.96 ? 110 GLU A OE2   1 
ATOM   918  N  N     . ARG A 1 114 ? 53.071 -1.905  -9.077  1.00 13.86 ? 111 ARG A N     1 
ATOM   919  C  CA    . ARG A 1 114 ? 52.495 -1.014  -8.066  1.00 13.81 ? 111 ARG A CA    1 
ATOM   920  C  C     . ARG A 1 114 ? 51.599 -1.808  -7.130  1.00 18.10 ? 111 ARG A C     1 
ATOM   921  O  O     . ARG A 1 114 ? 50.537 -2.288  -7.536  1.00 22.22 ? 111 ARG A O     1 
ATOM   922  C  CB    . ARG A 1 114 ? 51.669 0.097   -8.731  1.00 13.15 ? 111 ARG A CB    1 
ATOM   923  C  CG    . ARG A 1 114 ? 51.108 1.147   -7.755  1.00 15.05 ? 111 ARG A CG    1 
ATOM   924  C  CD    . ARG A 1 114 ? 50.051 2.001   -8.444  1.00 18.62 ? 111 ARG A CD    1 
ATOM   925  N  NE    . ARG A 1 114 ? 49.725 3.231   -7.727  1.00 21.55 ? 111 ARG A NE    1 
ATOM   926  C  CZ    . ARG A 1 114 ? 48.789 3.328   -6.789  1.00 25.01 ? 111 ARG A CZ    1 
ATOM   927  N  NH1   . ARG A 1 114 ? 48.089 2.258   -6.429  1.00 23.21 ? 111 ARG A NH1   1 
ATOM   928  N  NH2   . ARG A 1 114 ? 48.555 4.499   -6.206  1.00 23.08 ? 111 ARG A NH2   1 
ATOM   929  N  N     . ALA A 1 115 ? 52.014 -1.947  -5.876  1.00 10.61 ? 112 ALA A N     1 
ATOM   930  C  CA    . ALA A 1 115 ? 51.256 -2.748  -4.929  1.00 12.62 ? 112 ALA A CA    1 
ATOM   931  C  C     . ALA A 1 115 ? 50.259 -1.919  -4.124  1.00 18.19 ? 112 ALA A C     1 
ATOM   932  O  O     . ALA A 1 115 ? 49.232 -2.429  -3.671  1.00 17.54 ? 112 ALA A O     1 
ATOM   933  C  CB    . ALA A 1 115 ? 52.202 -3.489  -3.998  1.00 16.04 ? 112 ALA A CB    1 
ATOM   934  N  N     . SER A 1 116 ? 50.580 -0.645  -3.934  1.00 14.15 ? 113 SER A N     1 
ATOM   935  C  CA    . SER A 1 116 ? 49.707 0.270   -3.210  1.00 14.32 ? 113 SER A CA    1 
ATOM   936  C  C     . SER A 1 116 ? 50.200 1.679   -3.480  1.00 13.11 ? 113 SER A C     1 
ATOM   937  O  O     . SER A 1 116 ? 51.101 1.871   -4.284  1.00 13.32 ? 113 SER A O     1 
ATOM   938  C  CB    . SER A 1 116 ? 49.799 0.012   -1.716  1.00 19.83 ? 113 SER A CB    1 
ATOM   939  O  OG    . SER A 1 116 ? 51.048 0.484   -1.231  1.00 17.78 ? 113 SER A OG    1 
ATOM   940  N  N     . ILE A 1 117 ? 49.627 2.668   -2.800  1.00 12.19 ? 114 ILE A N     1 
ATOM   941  C  CA    . ILE A 1 117 ? 50.041 4.046   -3.033  1.00 10.23 ? 114 ILE A CA    1 
ATOM   942  C  C     . ILE A 1 117 ? 51.523 4.278   -2.718  1.00 12.80 ? 114 ILE A C     1 
ATOM   943  O  O     . ILE A 1 117 ? 52.136 5.188   -3.264  1.00 12.52 ? 114 ILE A O     1 
ATOM   944  C  CB    . ILE A 1 117 ? 49.177 5.051   -2.234  1.00 12.73 ? 114 ILE A CB    1 
ATOM   945  C  CG1   . ILE A 1 117 ? 49.416 6.483   -2.727  1.00 13.68 ? 114 ILE A CG1   1 
ATOM   946  C  CG2   . ILE A 1 117 ? 49.465 4.933   -0.750  1.00 13.70 ? 114 ILE A CG2   1 
ATOM   947  C  CD1   . ILE A 1 117 ? 48.322 7.458   -2.315  1.00 18.51 ? 114 ILE A CD1   1 
ATOM   948  N  N     . ASP A 1 118 ? 52.122 3.450   -1.861  1.00 10.53 ? 115 ASP A N     1 
ATOM   949  C  CA    . ASP A 1 118 ? 53.513 3.716   -1.500  1.00 9.97  ? 115 ASP A CA    1 
ATOM   950  C  C     . ASP A 1 118 ? 54.395 2.466   -1.468  1.00 12.08 ? 115 ASP A C     1 
ATOM   951  O  O     . ASP A 1 118 ? 55.447 2.460   -0.829  1.00 13.15 ? 115 ASP A O     1 
ATOM   952  C  CB    . ASP A 1 118 ? 53.575 4.449   -0.166  1.00 8.36  ? 115 ASP A CB    1 
ATOM   953  C  CG    . ASP A 1 118 ? 53.454 3.521   0.998   1.00 13.33 ? 115 ASP A CG    1 
ATOM   954  O  OD1   . ASP A 1 118 ? 54.069 3.831   2.032   1.00 12.79 ? 115 ASP A OD1   1 
ATOM   955  O  OD2   . ASP A 1 118 ? 52.767 2.479   0.867   1.00 13.69 ? 115 ASP A OD2   1 
ATOM   956  N  N     . GLU A 1 119 ? 53.958 1.411   -2.147  1.00 10.03 ? 116 GLU A N     1 
ATOM   957  C  CA    . GLU A 1 119 ? 54.738 0.173   -2.225  1.00 12.29 ? 116 GLU A CA    1 
ATOM   958  C  C     . GLU A 1 119 ? 54.825 -0.309  -3.657  1.00 11.42 ? 116 GLU A C     1 
ATOM   959  O  O     . GLU A 1 119 ? 53.845 -0.236  -4.399  1.00 10.10 ? 116 GLU A O     1 
ATOM   960  C  CB    . GLU A 1 119 ? 54.091 -0.937  -1.395  1.00 13.52 ? 116 GLU A CB    1 
ATOM   961  C  CG    A GLU A 1 119 ? 53.895 -0.594  0.076   0.52 14.38 ? 116 GLU A CG    1 
ATOM   962  C  CG    B GLU A 1 119 ? 54.255 -0.761  0.104   0.48 14.87 ? 116 GLU A CG    1 
ATOM   963  C  CD    A GLU A 1 119 ? 53.313 -1.749  0.867   0.52 18.95 ? 116 GLU A CD    1 
ATOM   964  C  CD    B GLU A 1 119 ? 53.544 -1.839  0.891   0.48 18.68 ? 116 GLU A CD    1 
ATOM   965  O  OE1   A GLU A 1 119 ? 52.427 -2.454  0.335   0.52 17.71 ? 116 GLU A OE1   1 
ATOM   966  O  OE1   B GLU A 1 119 ? 54.055 -2.977  0.967   0.48 15.73 ? 116 GLU A OE1   1 
ATOM   967  O  OE2   A GLU A 1 119 ? 53.747 -1.956  2.020   0.52 22.67 ? 116 GLU A OE2   1 
ATOM   968  O  OE2   B GLU A 1 119 ? 52.464 -1.543  1.433   0.48 28.55 ? 116 GLU A OE2   1 
ATOM   969  N  N     . ALA A 1 120 ? 55.994 -0.819  -4.034  1.00 9.93  ? 117 ALA A N     1 
ATOM   970  C  CA    . ALA A 1 120 ? 56.150 -1.446  -5.338  1.00 10.82 ? 117 ALA A CA    1 
ATOM   971  C  C     . ALA A 1 120 ? 57.062 -2.666  -5.243  1.00 11.79 ? 117 ALA A C     1 
ATOM   972  O  O     . ALA A 1 120 ? 58.047 -2.655  -4.512  1.00 12.18 ? 117 ALA A O     1 
ATOM   973  C  CB    . ALA A 1 120 ? 56.716 -0.455  -6.336  1.00 13.47 ? 117 ALA A CB    1 
ATOM   974  N  N     . TYR A 1 121 ? 56.726 -3.712  -5.987  1.00 11.54 ? 118 TYR A N     1 
ATOM   975  C  CA    . TYR A 1 121 ? 57.631 -4.842  -6.137  1.00 11.78 ? 118 TYR A CA    1 
ATOM   976  C  C     . TYR A 1 121 ? 58.481 -4.614  -7.364  1.00 12.76 ? 118 TYR A C     1 
ATOM   977  O  O     . TYR A 1 121 ? 58.030 -3.999  -8.334  1.00 12.36 ? 118 TYR A O     1 
ATOM   978  C  CB    . TYR A 1 121 ? 56.858 -6.151  -6.278  1.00 10.70 ? 118 TYR A CB    1 
ATOM   979  C  CG    . TYR A 1 121 ? 56.135 -6.556  -5.018  1.00 10.21 ? 118 TYR A CG    1 
ATOM   980  C  CD1   . TYR A 1 121 ? 54.799 -6.230  -4.824  1.00 12.12 ? 118 TYR A CD1   1 
ATOM   981  C  CD2   . TYR A 1 121 ? 56.798 -7.248  -4.010  1.00 12.79 ? 118 TYR A CD2   1 
ATOM   982  C  CE1   . TYR A 1 121 ? 54.128 -6.604  -3.655  1.00 13.69 ? 118 TYR A CE1   1 
ATOM   983  C  CE2   . TYR A 1 121 ? 56.139 -7.618  -2.838  1.00 12.60 ? 118 TYR A CE2   1 
ATOM   984  C  CZ    . TYR A 1 121 ? 54.808 -7.296  -2.675  1.00 18.72 ? 118 TYR A CZ    1 
ATOM   985  O  OH    . TYR A 1 121 ? 54.160 -7.669  -1.525  1.00 19.31 ? 118 TYR A OH    1 
ATOM   986  N  N     . VAL A 1 122 ? 59.711 -5.125  -7.311  1.00 12.11 ? 119 VAL A N     1 
ATOM   987  C  CA    . VAL A 1 122 ? 60.692 -4.957  -8.360  1.00 15.66 ? 119 VAL A CA    1 
ATOM   988  C  C     . VAL A 1 122 ? 61.257 -6.329  -8.669  1.00 18.24 ? 119 VAL A C     1 
ATOM   989  O  O     . VAL A 1 122 ? 61.702 -7.021  -7.754  1.00 12.59 ? 119 VAL A O     1 
ATOM   990  C  CB    . VAL A 1 122 ? 61.866 -4.099  -7.838  1.00 14.64 ? 119 VAL A CB    1 
ATOM   991  C  CG1   . VAL A 1 122 ? 62.719 -3.625  -8.983  1.00 27.28 ? 119 VAL A CG1   1 
ATOM   992  C  CG2   . VAL A 1 122 ? 61.335 -2.915  -7.032  1.00 27.03 ? 119 VAL A CG2   1 
ATOM   993  N  N     . ASP A 1 123 ? 61.253 -6.735  -9.939  1.00 14.29 ? 120 ASP A N     1 
ATOM   994  C  CA    . ASP A 1 123 ? 61.945 -7.966  -10.318 1.00 16.58 ? 120 ASP A CA    1 
ATOM   995  C  C     . ASP A 1 123 ? 63.346 -7.614  -10.793 1.00 19.31 ? 120 ASP A C     1 
ATOM   996  O  O     . ASP A 1 123 ? 63.519 -7.029  -11.861 1.00 21.17 ? 120 ASP A O     1 
ATOM   997  C  CB    . ASP A 1 123 ? 61.178 -8.734  -11.402 1.00 24.07 ? 120 ASP A CB    1 
ATOM   998  C  CG    . ASP A 1 123 ? 61.776 -10.102 -11.689 1.00 28.86 ? 120 ASP A CG    1 
ATOM   999  O  OD1   . ASP A 1 123 ? 63.015 -10.213 -11.784 1.00 21.13 ? 120 ASP A OD1   1 
ATOM   1000 O  OD2   . ASP A 1 123 ? 61.008 -11.083 -11.812 1.00 38.03 ? 120 ASP A OD2   1 
ATOM   1001 N  N     . LEU A 1 124 ? 64.345 -7.959  -9.990  1.00 16.31 ? 121 LEU A N     1 
ATOM   1002 C  CA    . LEU A 1 124 ? 65.714 -7.527  -10.248 1.00 12.30 ? 121 LEU A CA    1 
ATOM   1003 C  C     . LEU A 1 124 ? 66.563 -8.612  -10.898 1.00 11.58 ? 121 LEU A C     1 
ATOM   1004 O  O     . LEU A 1 124 ? 67.781 -8.447  -11.051 1.00 13.01 ? 121 LEU A O     1 
ATOM   1005 C  CB    . LEU A 1 124 ? 66.377 -7.092  -8.940  1.00 11.00 ? 121 LEU A CB    1 
ATOM   1006 C  CG    . LEU A 1 124 ? 65.759 -5.867  -8.271  1.00 13.63 ? 121 LEU A CG    1 
ATOM   1007 C  CD1   . LEU A 1 124 ? 66.218 -5.776  -6.828  1.00 21.23 ? 121 LEU A CD1   1 
ATOM   1008 C  CD2   . LEU A 1 124 ? 66.132 -4.617  -9.048  1.00 19.65 ? 121 LEU A CD2   1 
ATOM   1009 N  N     . THR A 1 125 ? 65.929 -9.716  -11.275 1.00 12.62 ? 122 THR A N     1 
ATOM   1010 C  CA    . THR A 1 125 ? 66.685 -10.863 -11.773 1.00 12.45 ? 122 THR A CA    1 
ATOM   1011 C  C     . THR A 1 125 ? 67.625 -10.471 -12.916 1.00 18.66 ? 122 THR A C     1 
ATOM   1012 O  O     . THR A 1 125 ? 68.817 -10.777 -12.876 1.00 17.09 ? 122 THR A O     1 
ATOM   1013 C  CB    . THR A 1 125 ? 65.763 -12.018 -12.180 1.00 17.13 ? 122 THR A CB    1 
ATOM   1014 O  OG1   . THR A 1 125 ? 64.875 -12.314 -11.094 1.00 16.03 ? 122 THR A OG1   1 
ATOM   1015 C  CG2   . THR A 1 125 ? 66.581 -13.267 -12.512 1.00 19.96 ? 122 THR A CG2   1 
ATOM   1016 N  N     . SER A 1 126 ? 67.093 -9.772  -13.914 1.00 20.87 ? 123 SER A N     1 
ATOM   1017 C  CA    A SER A 1 126 ? 67.882 -9.384  -15.081 0.49 19.42 ? 123 SER A CA    1 
ATOM   1018 C  CA    B SER A 1 126 ? 67.884 -9.389  -15.081 0.51 19.42 ? 123 SER A CA    1 
ATOM   1019 C  C     . SER A 1 126 ? 68.961 -8.357  -14.746 1.00 21.31 ? 123 SER A C     1 
ATOM   1020 O  O     . SER A 1 126 ? 70.095 -8.464  -15.212 1.00 18.99 ? 123 SER A O     1 
ATOM   1021 C  CB    A SER A 1 126 ? 66.976 -8.856  -16.197 0.49 26.56 ? 123 SER A CB    1 
ATOM   1022 C  CB    B SER A 1 126 ? 66.980 -8.859  -16.193 0.51 26.56 ? 123 SER A CB    1 
ATOM   1023 O  OG    A SER A 1 126 ? 66.299 -9.919  -16.847 0.49 22.85 ? 123 SER A OG    1 
ATOM   1024 O  OG    B SER A 1 126 ? 66.381 -7.636  -15.815 0.51 26.23 ? 123 SER A OG    1 
ATOM   1025 N  N     . ALA A 1 127 ? 68.600 -7.362  -13.940 1.00 13.31 ? 124 ALA A N     1 
ATOM   1026 C  CA    . ALA A 1 127 ? 69.533 -6.310  -13.534 1.00 16.88 ? 124 ALA A CA    1 
ATOM   1027 C  C     . ALA A 1 127 ? 70.711 -6.901  -12.780 1.00 16.35 ? 124 ALA A C     1 
ATOM   1028 O  O     . ALA A 1 127 ? 71.859 -6.483  -12.958 1.00 18.21 ? 124 ALA A O     1 
ATOM   1029 C  CB    . ALA A 1 127 ? 68.825 -5.264  -12.672 1.00 16.63 ? 124 ALA A CB    1 
ATOM   1030 N  N     . VAL A 1 128 ? 70.420 -7.878  -11.928 1.00 18.58 ? 125 VAL A N     1 
ATOM   1031 C  CA    . VAL A 1 128 ? 71.464 -8.554  -11.171 1.00 17.34 ? 125 VAL A CA    1 
ATOM   1032 C  C     . VAL A 1 128 ? 72.445 -9.276  -12.090 1.00 16.47 ? 125 VAL A C     1 
ATOM   1033 O  O     . VAL A 1 128 ? 73.660 -9.183  -11.901 1.00 17.81 ? 125 VAL A O     1 
ATOM   1034 C  CB    . VAL A 1 128 ? 70.868 -9.542  -10.153 1.00 16.36 ? 125 VAL A CB    1 
ATOM   1035 C  CG1   . VAL A 1 128 ? 71.928 -10.528 -9.681  1.00 14.47 ? 125 VAL A CG1   1 
ATOM   1036 C  CG2   . VAL A 1 128 ? 70.295 -8.770  -8.986  1.00 13.79 ? 125 VAL A CG2   1 
ATOM   1037 N  N     . GLN A 1 129 ? 71.921 -9.980  -13.088 1.00 16.31 ? 126 GLN A N     1 
ATOM   1038 C  CA    . GLN A 1 129 ? 72.781 -10.677 -14.036 1.00 30.37 ? 126 GLN A CA    1 
ATOM   1039 C  C     . GLN A 1 129 ? 73.731 -9.697  -14.718 1.00 28.55 ? 126 GLN A C     1 
ATOM   1040 O  O     . GLN A 1 129 ? 74.931 -9.955  -14.827 1.00 23.59 ? 126 GLN A O     1 
ATOM   1041 C  CB    . GLN A 1 129 ? 71.954 -11.427 -15.080 1.00 31.25 ? 126 GLN A CB    1 
ATOM   1042 C  CG    . GLN A 1 129 ? 71.024 -12.487 -14.503 1.00 32.95 ? 126 GLN A CG    1 
ATOM   1043 C  CD    . GLN A 1 129 ? 71.767 -13.675 -13.907 1.00 54.09 ? 126 GLN A CD    1 
ATOM   1044 O  OE1   . GLN A 1 129 ? 72.983 -13.632 -13.708 1.00 57.79 ? 126 GLN A OE1   1 
ATOM   1045 N  NE2   . GLN A 1 129 ? 71.033 -14.747 -13.621 1.00 51.29 ? 126 GLN A NE2   1 
ATOM   1046 N  N     . GLU A 1 130 ? 73.191 -8.568  -15.167 1.00 25.68 ? 127 GLU A N     1 
ATOM   1047 C  CA    . GLU A 1 130 ? 74.006 -7.561  -15.837 1.00 27.27 ? 127 GLU A CA    1 
ATOM   1048 C  C     . GLU A 1 130 ? 75.097 -7.007  -14.925 1.00 29.55 ? 127 GLU A C     1 
ATOM   1049 O  O     . GLU A 1 130 ? 76.259 -6.914  -15.330 1.00 28.91 ? 127 GLU A O     1 
ATOM   1050 C  CB    . GLU A 1 130 ? 73.137 -6.426  -16.384 1.00 27.97 ? 127 GLU A CB    1 
ATOM   1051 C  CG    . GLU A 1 130 ? 72.133 -6.883  -17.427 1.00 35.50 ? 127 GLU A CG    1 
ATOM   1052 C  CD    . GLU A 1 130 ? 71.339 -5.730  -18.013 1.00 70.35 ? 127 GLU A CD    1 
ATOM   1053 O  OE1   . GLU A 1 130 ? 71.883 -4.604  -18.083 1.00 62.46 ? 127 GLU A OE1   1 
ATOM   1054 O  OE2   . GLU A 1 130 ? 70.169 -5.950  -18.397 1.00 65.88 ? 127 GLU A OE2   1 
ATOM   1055 N  N     . ARG A 1 131 ? 74.728 -6.645  -13.697 1.00 20.44 ? 128 ARG A N     1 
ATOM   1056 C  CA    . ARG A 1 131 ? 75.695 -6.090  -12.753 1.00 27.47 ? 128 ARG A CA    1 
ATOM   1057 C  C     . ARG A 1 131 ? 76.782 -7.105  -12.404 1.00 28.45 ? 128 ARG A C     1 
ATOM   1058 O  O     . ARG A 1 131 ? 77.947 -6.738  -12.236 1.00 30.05 ? 128 ARG A O     1 
ATOM   1059 C  CB    . ARG A 1 131 ? 75.001 -5.581  -11.483 1.00 18.52 ? 128 ARG A CB    1 
ATOM   1060 C  CG    . ARG A 1 131 ? 75.953 -5.022  -10.430 1.00 28.78 ? 128 ARG A CG    1 
ATOM   1061 C  CD    . ARG A 1 131 ? 76.556 -3.690  -10.873 1.00 24.92 ? 128 ARG A CD    1 
ATOM   1062 N  NE    . ARG A 1 131 ? 75.504 -2.729  -11.184 1.00 39.64 ? 128 ARG A NE    1 
ATOM   1063 C  CZ    . ARG A 1 131 ? 74.985 -1.882  -10.300 1.00 23.46 ? 128 ARG A CZ    1 
ATOM   1064 N  NH1   . ARG A 1 131 ? 75.444 -1.860  -9.054  1.00 23.44 ? 128 ARG A NH1   1 
ATOM   1065 N  NH2   . ARG A 1 131 ? 74.023 -1.048  -10.668 1.00 45.80 ? 128 ARG A NH2   1 
ATOM   1066 N  N     . LEU A 1 132 ? 76.399 -8.376  -12.289 1.00 21.07 ? 129 LEU A N     1 
ATOM   1067 C  CA    . LEU A 1 132 ? 77.367 -9.445  -12.040 1.00 20.12 ? 129 LEU A CA    1 
ATOM   1068 C  C     . LEU A 1 132 ? 78.395 -9.531  -13.161 1.00 34.37 ? 129 LEU A C     1 
ATOM   1069 O  O     . LEU A 1 132 ? 79.579 -9.751  -12.910 1.00 29.42 ? 129 LEU A O     1 
ATOM   1070 C  CB    . LEU A 1 132 ? 76.669 -10.798 -11.856 1.00 30.07 ? 129 LEU A CB    1 
ATOM   1071 C  CG    . LEU A 1 132 ? 76.274 -11.145 -10.416 1.00 17.95 ? 129 LEU A CG    1 
ATOM   1072 C  CD1   . LEU A 1 132 ? 75.339 -12.349 -10.360 1.00 22.56 ? 129 LEU A CD1   1 
ATOM   1073 C  CD2   . LEU A 1 132 ? 77.513 -11.381 -9.543  1.00 18.87 ? 129 LEU A CD2   1 
ATOM   1074 N  N     . GLN A 1 133 ? 77.939 -9.357  -14.398 1.00 33.33 ? 130 GLN A N     1 
ATOM   1075 C  CA    . GLN A 1 133 ? 78.847 -9.365  -15.542 1.00 33.22 ? 130 GLN A CA    1 
ATOM   1076 C  C     . GLN A 1 133 ? 79.852 -8.222  -15.461 1.00 34.96 ? 130 GLN A C     1 
ATOM   1077 O  O     . GLN A 1 133 ? 81.046 -8.425  -15.667 1.00 46.97 ? 130 GLN A O     1 
ATOM   1078 C  CB    . GLN A 1 133 ? 78.074 -9.313  -16.859 1.00 35.58 ? 130 GLN A CB    1 
ATOM   1079 C  CG    . GLN A 1 133 ? 77.370 -10.617 -17.203 1.00 42.42 ? 130 GLN A CG    1 
ATOM   1080 C  CD    . GLN A 1 133 ? 76.604 -10.542 -18.512 1.00 71.13 ? 130 GLN A CD    1 
ATOM   1081 O  OE1   . GLN A 1 133 ? 76.542 -9.489  -19.150 1.00 74.53 ? 130 GLN A OE1   1 
ATOM   1082 N  NE2   . GLN A 1 133 ? 76.015 -11.663 -18.918 1.00 73.65 ? 130 GLN A NE2   1 
ATOM   1083 N  N     . LYS A 1 134 ? 79.370 -7.021  -15.153 1.00 39.23 ? 131 LYS A N     1 
ATOM   1084 C  CA    . LYS A 1 134 ? 80.256 -5.871  -14.997 1.00 48.42 ? 131 LYS A CA    1 
ATOM   1085 C  C     . LYS A 1 134 ? 81.269 -6.087  -13.875 1.00 49.36 ? 131 LYS A C     1 
ATOM   1086 O  O     . LYS A 1 134 ? 82.434 -5.712  -14.003 1.00 51.50 ? 131 LYS A O     1 
ATOM   1087 C  CB    . LYS A 1 134 ? 79.460 -4.585  -14.749 1.00 47.13 ? 131 LYS A CB    1 
ATOM   1088 C  CG    . LYS A 1 134 ? 78.682 -4.093  -15.960 1.00 56.85 ? 131 LYS A CG    1 
ATOM   1089 C  CD    . LYS A 1 134 ? 78.140 -2.684  -15.746 1.00 63.89 ? 131 LYS A CD    1 
ATOM   1090 C  CE    . LYS A 1 134 ? 77.160 -2.628  -14.584 1.00 58.16 ? 131 LYS A CE    1 
ATOM   1091 N  NZ    . LYS A 1 134 ? 76.518 -1.287  -14.453 1.00 53.68 ? 131 LYS A NZ    1 
ATOM   1092 N  N     . LEU A 1 135 ? 80.821 -6.692  -12.778 1.00 43.83 ? 132 LEU A N     1 
ATOM   1093 C  CA    . LEU A 1 135 ? 81.690 -6.936  -11.630 1.00 53.94 ? 132 LEU A CA    1 
ATOM   1094 C  C     . LEU A 1 135 ? 82.870 -7.838  -11.980 1.00 56.20 ? 132 LEU A C     1 
ATOM   1095 O  O     . LEU A 1 135 ? 83.995 -7.600  -11.541 1.00 60.31 ? 132 LEU A O     1 
ATOM   1096 C  CB    . LEU A 1 135 ? 80.900 -7.544  -10.468 1.00 49.50 ? 132 LEU A CB    1 
ATOM   1097 C  CG    . LEU A 1 135 ? 80.492 -6.585  -9.349  1.00 48.85 ? 132 LEU A CG    1 
ATOM   1098 C  CD1   . LEU A 1 135 ? 79.536 -5.524  -9.870  1.00 45.51 ? 132 LEU A CD1   1 
ATOM   1099 C  CD2   . LEU A 1 135 ? 79.870 -7.353  -8.188  1.00 57.25 ? 132 LEU A CD2   1 
ATOM   1100 N  N     . GLN A 1 136 ? 82.600 -8.877  -12.765 1.00 51.12 ? 133 GLN A N     1 
ATOM   1101 C  CA    . GLN A 1 136 ? 83.630 -9.826  -13.175 1.00 55.68 ? 133 GLN A CA    1 
ATOM   1102 C  C     . GLN A 1 136 ? 84.413 -10.397 -11.996 1.00 59.39 ? 133 GLN A C     1 
ATOM   1103 O  O     . GLN A 1 136 ? 85.607 -10.136 -11.848 1.00 56.40 ? 133 GLN A O     1 
ATOM   1104 C  CB    . GLN A 1 136 ? 84.585 -9.188  -14.187 1.00 53.40 ? 133 GLN A CB    1 
ATOM   1105 C  CG    . GLN A 1 136 ? 83.965 -8.969  -15.555 1.00 62.09 ? 133 GLN A CG    1 
ATOM   1106 C  CD    . GLN A 1 136 ? 84.970 -8.513  -16.592 1.00 66.39 ? 133 GLN A CD    1 
ATOM   1107 O  OE1   . GLN A 1 136 ? 84.640 -8.369  -17.770 1.00 67.19 ? 133 GLN A OE1   1 
ATOM   1108 N  NE2   . GLN A 1 136 ? 86.206 -8.284  -16.161 1.00 80.03 ? 133 GLN A NE2   1 
ATOM   1109 N  N     . GLY A 1 137 ? 83.730 -11.176 -11.163 1.00 55.01 ? 134 GLY A N     1 
ATOM   1110 C  CA    . GLY A 1 137 ? 84.369 -11.873 -10.061 1.00 51.42 ? 134 GLY A CA    1 
ATOM   1111 C  C     . GLY A 1 137 ? 84.794 -10.979 -8.913  1.00 53.22 ? 134 GLY A C     1 
ATOM   1112 O  O     . GLY A 1 137 ? 85.161 -11.467 -7.844  1.00 54.62 ? 134 GLY A O     1 
ATOM   1113 N  N     . GLN A 1 138 ? 84.747 -9.669  -9.127  1.00 45.79 ? 135 GLN A N     1 
ATOM   1114 C  CA    . GLN A 1 138 ? 85.154 -8.721  -8.098  1.00 48.52 ? 135 GLN A CA    1 
ATOM   1115 C  C     . GLN A 1 138 ? 84.253 -8.813  -6.869  1.00 52.22 ? 135 GLN A C     1 
ATOM   1116 O  O     . GLN A 1 138 ? 83.025 -8.825  -6.988  1.00 41.44 ? 135 GLN A O     1 
ATOM   1117 C  CB    . GLN A 1 138 ? 85.155 -7.296  -8.651  1.00 52.08 ? 135 GLN A CB    1 
ATOM   1118 C  CG    . GLN A 1 138 ? 85.727 -6.262  -7.696  1.00 61.26 ? 135 GLN A CG    1 
ATOM   1119 C  CD    . GLN A 1 138 ? 85.793 -4.878  -8.309  1.00 73.13 ? 135 GLN A CD    1 
ATOM   1120 O  OE1   . GLN A 1 138 ? 86.142 -3.904  -7.640  1.00 68.53 ? 135 GLN A OE1   1 
ATOM   1121 N  NE2   . GLN A 1 138 ? 85.457 -4.782  -9.592  1.00 72.78 ? 135 GLN A NE2   1 
ATOM   1122 N  N     . PRO A 1 139 ? 84.868 -8.888  -5.680  1.00 48.00 ? 136 PRO A N     1 
ATOM   1123 C  CA    . PRO A 1 139 ? 84.161 -8.978  -4.398  1.00 46.12 ? 136 PRO A CA    1 
ATOM   1124 C  C     . PRO A 1 139 ? 83.243 -7.788  -4.144  1.00 44.69 ? 136 PRO A C     1 
ATOM   1125 O  O     . PRO A 1 139 ? 83.442 -6.716  -4.712  1.00 36.03 ? 136 PRO A O     1 
ATOM   1126 C  CB    . PRO A 1 139 ? 85.299 -8.993  -3.368  1.00 47.71 ? 136 PRO A CB    1 
ATOM   1127 C  CG    . PRO A 1 139 ? 86.495 -8.457  -4.093  1.00 49.18 ? 136 PRO A CG    1 
ATOM   1128 C  CD    . PRO A 1 139 ? 86.329 -8.910  -5.503  1.00 45.02 ? 136 PRO A CD    1 
ATOM   1129 N  N     . ILE A 1 140 ? 82.246 -7.986  -3.290  1.00 41.99 ? 137 ILE A N     1 
ATOM   1130 C  CA    . ILE A 1 140 ? 81.317 -6.921  -2.949  1.00 28.14 ? 137 ILE A CA    1 
ATOM   1131 C  C     . ILE A 1 140 ? 81.695 -6.307  -1.610  1.00 23.53 ? 137 ILE A C     1 
ATOM   1132 O  O     . ILE A 1 140 ? 81.684 -6.981  -0.584  1.00 28.00 ? 137 ILE A O     1 
ATOM   1133 C  CB    . ILE A 1 140 ? 79.870 -7.436  -2.905  1.00 23.92 ? 137 ILE A CB    1 
ATOM   1134 C  CG1   . ILE A 1 140 ? 79.517 -8.093  -4.242  1.00 25.19 ? 137 ILE A CG1   1 
ATOM   1135 C  CG2   . ILE A 1 140 ? 78.898 -6.297  -2.592  1.00 24.29 ? 137 ILE A CG2   1 
ATOM   1136 C  CD1   . ILE A 1 140 ? 78.097 -8.581  -4.332  1.00 33.82 ? 137 ILE A CD1   1 
ATOM   1137 N  N     . SER A 1 141 ? 82.041 -5.024  -1.638  1.00 30.05 ? 138 SER A N     1 
ATOM   1138 C  CA    . SER A 1 141 ? 82.431 -4.290  -0.437  1.00 26.56 ? 138 SER A CA    1 
ATOM   1139 C  C     . SER A 1 141 ? 81.234 -3.979  0.456   1.00 28.17 ? 138 SER A C     1 
ATOM   1140 O  O     . SER A 1 141 ? 80.151 -3.671  -0.040  1.00 26.05 ? 138 SER A O     1 
ATOM   1141 C  CB    . SER A 1 141 ? 83.116 -2.977  -0.832  1.00 25.51 ? 138 SER A CB    1 
ATOM   1142 O  OG    . SER A 1 141 ? 83.288 -2.137  0.298   1.00 34.42 ? 138 SER A OG    1 
ATOM   1143 N  N     . ALA A 1 142 ? 81.434 -4.044  1.772   1.00 17.67 ? 139 ALA A N     1 
ATOM   1144 C  CA    . ALA A 1 142 ? 80.386 -3.667  2.715   1.00 21.52 ? 139 ALA A CA    1 
ATOM   1145 C  C     . ALA A 1 142 ? 79.991 -2.207  2.537   1.00 26.40 ? 139 ALA A C     1 
ATOM   1146 O  O     . ALA A 1 142 ? 78.915 -1.789  2.960   1.00 20.11 ? 139 ALA A O     1 
ATOM   1147 C  CB    . ALA A 1 142 ? 80.833 -3.916  4.141   1.00 24.66 ? 139 ALA A CB    1 
ATOM   1148 N  N     . ASP A 1 143 ? 80.879 -1.430  1.926   1.00 23.50 ? 140 ASP A N     1 
ATOM   1149 C  CA    . ASP A 1 143 ? 80.616 -0.021  1.690   1.00 23.96 ? 140 ASP A CA    1 
ATOM   1150 C  C     . ASP A 1 143 ? 79.481 0.160   0.694   1.00 24.13 ? 140 ASP A C     1 
ATOM   1151 O  O     . ASP A 1 143 ? 78.833 1.205   0.679   1.00 22.13 ? 140 ASP A O     1 
ATOM   1152 C  CB    . ASP A 1 143 ? 81.876 0.686   1.190   1.00 24.56 ? 140 ASP A CB    1 
ATOM   1153 C  CG    . ASP A 1 143 ? 82.983 0.690   2.219   1.00 44.72 ? 140 ASP A CG    1 
ATOM   1154 O  OD1   . ASP A 1 143 ? 82.670 0.719   3.431   1.00 42.58 ? 140 ASP A OD1   1 
ATOM   1155 O  OD2   . ASP A 1 143 ? 84.166 0.661   1.819   1.00 56.66 ? 140 ASP A OD2   1 
ATOM   1156 N  N     . LEU A 1 144 ? 79.243 -0.857  -0.133  1.00 18.74 ? 141 LEU A N     1 
ATOM   1157 C  CA    . LEU A 1 144 ? 78.155 -0.811  -1.103  1.00 18.25 ? 141 LEU A CA    1 
ATOM   1158 C  C     . LEU A 1 144 ? 76.792 -1.117  -0.483  1.00 15.83 ? 141 LEU A C     1 
ATOM   1159 O  O     . LEU A 1 144 ? 75.767 -1.010  -1.150  1.00 18.03 ? 141 LEU A O     1 
ATOM   1160 C  CB    . LEU A 1 144 ? 78.427 -1.765  -2.260  1.00 19.78 ? 141 LEU A CB    1 
ATOM   1161 C  CG    . LEU A 1 144 ? 79.661 -1.390  -3.083  1.00 26.01 ? 141 LEU A CG    1 
ATOM   1162 C  CD1   . LEU A 1 144 ? 79.854 -2.335  -4.258  1.00 31.06 ? 141 LEU A CD1   1 
ATOM   1163 C  CD2   . LEU A 1 144 ? 79.537 0.051   -3.557  1.00 30.94 ? 141 LEU A CD2   1 
ATOM   1164 N  N     . LEU A 1 145 ? 76.796 -1.481  0.795   1.00 15.87 ? 142 LEU A N     1 
ATOM   1165 C  CA    . LEU A 1 145 ? 75.587 -1.917  1.491   1.00 12.30 ? 142 LEU A CA    1 
ATOM   1166 C  C     . LEU A 1 145 ? 75.421 -1.189  2.826   1.00 15.31 ? 142 LEU A C     1 
ATOM   1167 O  O     . LEU A 1 145 ? 75.254 -1.807  3.873   1.00 13.48 ? 142 LEU A O     1 
ATOM   1168 C  CB    . LEU A 1 145 ? 75.653 -3.439  1.701   1.00 14.56 ? 142 LEU A CB    1 
ATOM   1169 C  CG    . LEU A 1 145 ? 75.570 -4.266  0.414   1.00 11.22 ? 142 LEU A CG    1 
ATOM   1170 C  CD1   . LEU A 1 145 ? 76.014 -5.732  0.614   1.00 15.02 ? 142 LEU A CD1   1 
ATOM   1171 C  CD2   . LEU A 1 145 ? 74.148 -4.215  -0.131  1.00 14.44 ? 142 LEU A CD2   1 
ATOM   1172 N  N     . PRO A 1 146 ? 75.441 0.148   2.787   1.00 16.41 ? 143 PRO A N     1 
ATOM   1173 C  CA    . PRO A 1 146 ? 75.499 0.965   4.003   1.00 17.67 ? 143 PRO A CA    1 
ATOM   1174 C  C     . PRO A 1 146 ? 74.254 0.901   4.887   1.00 20.42 ? 143 PRO A C     1 
ATOM   1175 O  O     . PRO A 1 146 ? 74.341 1.284   6.048   1.00 16.25 ? 143 PRO A O     1 
ATOM   1176 C  CB    . PRO A 1 146 ? 75.684 2.385   3.454   1.00 19.94 ? 143 PRO A CB    1 
ATOM   1177 C  CG    . PRO A 1 146 ? 75.083 2.339   2.087   1.00 19.38 ? 143 PRO A CG    1 
ATOM   1178 C  CD    . PRO A 1 146 ? 75.407 0.971   1.564   1.00 15.65 ? 143 PRO A CD    1 
ATOM   1179 N  N     . SER A 1 147 ? 73.127 0.423   4.367   1.00 13.09 ? 144 SER A N     1 
ATOM   1180 C  CA    . SER A 1 147 ? 71.911 0.412   5.165   1.00 13.92 ? 144 SER A CA    1 
ATOM   1181 C  C     . SER A 1 147 ? 71.223 -0.961  5.136   1.00 11.53 ? 144 SER A C     1 
ATOM   1182 O  O     . SER A 1 147 ? 70.040 -1.074  5.453   1.00 14.43 ? 144 SER A O     1 
ATOM   1183 C  CB    . SER A 1 147 ? 70.954 1.511   4.694   1.00 16.82 ? 144 SER A CB    1 
ATOM   1184 O  OG    . SER A 1 147 ? 70.457 1.227   3.399   1.00 18.87 ? 144 SER A OG    1 
ATOM   1185 N  N     . THR A 1 148 ? 72.000 -1.994  4.817   1.00 11.97 ? 145 THR A N     1 
ATOM   1186 C  CA    . THR A 1 148 ? 71.494 -3.370  4.658   1.00 10.77 ? 145 THR A CA    1 
ATOM   1187 C  C     . THR A 1 148 ? 71.699 -4.226  5.902   1.00 13.58 ? 145 THR A C     1 
ATOM   1188 O  O     . THR A 1 148 ? 72.782 -4.225  6.497   1.00 14.07 ? 145 THR A O     1 
ATOM   1189 C  CB    . THR A 1 148 ? 72.202 -4.068  3.469   1.00 13.02 ? 145 THR A CB    1 
ATOM   1190 O  OG1   . THR A 1 148 ? 71.881 -3.383  2.254   1.00 13.52 ? 145 THR A OG1   1 
ATOM   1191 C  CG2   . THR A 1 148 ? 71.784 -5.553  3.338   1.00 9.94  ? 145 THR A CG2   1 
ATOM   1192 N  N     . TYR A 1 149 ? 70.642 -4.943  6.282   1.00 11.35 ? 146 TYR A N     1 
ATOM   1193 C  CA    . TYR A 1 149 ? 70.684 -5.983  7.302   1.00 12.81 ? 146 TYR A CA    1 
ATOM   1194 C  C     . TYR A 1 149 ? 70.601 -7.338  6.629   1.00 14.10 ? 146 TYR A C     1 
ATOM   1195 O  O     . TYR A 1 149 ? 69.864 -7.508  5.655   1.00 12.64 ? 146 TYR A O     1 
ATOM   1196 C  CB    . TYR A 1 149 ? 69.489 -5.869  8.236   1.00 11.78 ? 146 TYR A CB    1 
ATOM   1197 C  CG    . TYR A 1 149 ? 69.640 -4.808  9.291   1.00 11.33 ? 146 TYR A CG    1 
ATOM   1198 C  CD1   . TYR A 1 149 ? 70.082 -5.138  10.568  1.00 12.69 ? 146 TYR A CD1   1 
ATOM   1199 C  CD2   . TYR A 1 149 ? 69.320 -3.481  9.021   1.00 13.87 ? 146 TYR A CD2   1 
ATOM   1200 C  CE1   . TYR A 1 149 ? 70.223 -4.176  11.537  1.00 17.74 ? 146 TYR A CE1   1 
ATOM   1201 C  CE2   . TYR A 1 149 ? 69.464 -2.507  9.989   1.00 17.64 ? 146 TYR A CE2   1 
ATOM   1202 C  CZ    . TYR A 1 149 ? 69.912 -2.864  11.245  1.00 20.87 ? 146 TYR A CZ    1 
ATOM   1203 O  OH    . TYR A 1 149 ? 70.049 -1.912  12.225  1.00 22.26 ? 146 TYR A OH    1 
ATOM   1204 N  N     . ILE A 1 150 ? 71.351 -8.303  7.153   1.00 10.44 ? 147 ILE A N     1 
ATOM   1205 C  CA    . ILE A 1 150 ? 71.244 -9.681  6.688   1.00 10.56 ? 147 ILE A CA    1 
ATOM   1206 C  C     . ILE A 1 150 ? 70.509 -10.471 7.760   1.00 12.93 ? 147 ILE A C     1 
ATOM   1207 O  O     . ILE A 1 150 ? 71.061 -10.726 8.823   1.00 14.21 ? 147 ILE A O     1 
ATOM   1208 C  CB    . ILE A 1 150 ? 72.628 -10.314 6.468   1.00 11.64 ? 147 ILE A CB    1 
ATOM   1209 C  CG1   . ILE A 1 150 ? 73.490 -9.443  5.542   1.00 12.87 ? 147 ILE A CG1   1 
ATOM   1210 C  CG2   . ILE A 1 150 ? 72.480 -11.729 5.901   1.00 19.33 ? 147 ILE A CG2   1 
ATOM   1211 C  CD1   . ILE A 1 150 ? 72.899 -9.238  4.130   1.00 17.33 ? 147 ILE A CD1   1 
ATOM   1212 N  N     . GLU A 1 151 ? 69.259 -10.845 7.490   1.00 11.38 ? 148 GLU A N     1 
ATOM   1213 C  CA    . GLU A 1 151 ? 68.439 -11.492 8.498   1.00 12.88 ? 148 GLU A CA    1 
ATOM   1214 C  C     . GLU A 1 151 ? 69.087 -12.793 8.951   1.00 15.62 ? 148 GLU A C     1 
ATOM   1215 O  O     . GLU A 1 151 ? 69.498 -13.611 8.125   1.00 12.82 ? 148 GLU A O     1 
ATOM   1216 C  CB    . GLU A 1 151 ? 67.029 -11.761 7.959   1.00 10.24 ? 148 GLU A CB    1 
ATOM   1217 C  CG    . GLU A 1 151 ? 66.127 -12.542 8.917   1.00 15.45 ? 148 GLU A CG    1 
ATOM   1218 C  CD    . GLU A 1 151 ? 65.905 -11.847 10.242  1.00 16.93 ? 148 GLU A CD    1 
ATOM   1219 O  OE1   . GLU A 1 151 ? 65.643 -12.553 11.241  1.00 17.77 ? 148 GLU A OE1   1 
ATOM   1220 O  OE2   . GLU A 1 151 ? 65.961 -10.596 10.286  1.00 20.36 ? 148 GLU A OE2   1 
ATOM   1221 N  N     . GLY A 1 152 ? 69.175 -12.977 10.266  1.00 11.67 ? 149 GLY A N     1 
ATOM   1222 C  CA    . GLY A 1 152 ? 69.736 -14.200 10.825  1.00 15.24 ? 149 GLY A CA    1 
ATOM   1223 C  C     . GLY A 1 152 ? 71.166 -14.033 11.306  1.00 17.24 ? 149 GLY A C     1 
ATOM   1224 O  O     . GLY A 1 152 ? 71.690 -14.868 12.044  1.00 18.80 ? 149 GLY A O     1 
ATOM   1225 N  N     . LEU A 1 153 ? 71.805 -12.951 10.883  1.00 14.89 ? 150 LEU A N     1 
ATOM   1226 C  CA    . LEU A 1 153 ? 73.180 -12.682 11.283  1.00 13.96 ? 150 LEU A CA    1 
ATOM   1227 C  C     . LEU A 1 153 ? 73.250 -11.373 12.062  1.00 20.28 ? 150 LEU A C     1 
ATOM   1228 O  O     . LEU A 1 153 ? 72.410 -10.493 11.881  1.00 16.31 ? 150 LEU A O     1 
ATOM   1229 C  CB    . LEU A 1 153 ? 74.089 -12.607 10.060  1.00 12.76 ? 150 LEU A CB    1 
ATOM   1230 C  CG    . LEU A 1 153 ? 74.208 -13.856 9.194   1.00 18.78 ? 150 LEU A CG    1 
ATOM   1231 C  CD1   . LEU A 1 153 ? 75.109 -13.583 8.004   1.00 14.95 ? 150 LEU A CD1   1 
ATOM   1232 C  CD2   . LEU A 1 153 ? 74.722 -15.038 10.018  1.00 21.42 ? 150 LEU A CD2   1 
ATOM   1233 N  N     . PRO A 1 154 ? 74.266 -11.234 12.927  1.00 22.19 ? 151 PRO A N     1 
ATOM   1234 C  CA    . PRO A 1 154 ? 75.349 -12.203 13.152  1.00 15.10 ? 151 PRO A CA    1 
ATOM   1235 C  C     . PRO A 1 154 ? 74.898 -13.392 13.995  1.00 18.34 ? 151 PRO A C     1 
ATOM   1236 O  O     . PRO A 1 154 ? 73.890 -13.318 14.696  1.00 21.75 ? 151 PRO A O     1 
ATOM   1237 C  CB    . PRO A 1 154 ? 76.384 -11.381 13.931  1.00 19.01 ? 151 PRO A CB    1 
ATOM   1238 C  CG    . PRO A 1 154 ? 75.566 -10.397 14.684  1.00 24.02 ? 151 PRO A CG    1 
ATOM   1239 C  CD    . PRO A 1 154 ? 74.418 -10.034 13.764  1.00 16.71 ? 151 PRO A CD    1 
ATOM   1240 N  N     . GLN A 1 155 ? 75.642 -14.487 13.919  1.00 21.20 ? 152 GLN A N     1 
ATOM   1241 C  CA    . GLN A 1 155 ? 75.333 -15.668 14.714  1.00 27.16 ? 152 GLN A CA    1 
ATOM   1242 C  C     . GLN A 1 155 ? 76.617 -16.412 15.037  1.00 36.63 ? 152 GLN A C     1 
ATOM   1243 O  O     . GLN A 1 155 ? 77.634 -16.220 14.366  1.00 33.97 ? 152 GLN A O     1 
ATOM   1244 C  CB    . GLN A 1 155 ? 74.374 -16.594 13.963  1.00 27.83 ? 152 GLN A CB    1 
ATOM   1245 C  CG    . GLN A 1 155 ? 74.981 -17.221 12.725  1.00 35.65 ? 152 GLN A CG    1 
ATOM   1246 C  CD    . GLN A 1 155 ? 74.899 -18.736 12.738  1.00 45.05 ? 152 GLN A CD    1 
ATOM   1247 O  OE1   . GLN A 1 155 ? 73.825 -19.311 12.926  1.00 41.14 ? 152 GLN A OE1   1 
ATOM   1248 N  NE2   . GLN A 1 155 ? 76.038 -19.390 12.539  1.00 22.66 ? 152 GLN A NE2   1 
ATOM   1249 N  N     . GLY A 1 156 ? 76.569 -17.248 16.071  1.00 30.17 ? 153 GLY A N     1 
ATOM   1250 C  CA    . GLY A 1 156 ? 77.683 -18.126 16.395  1.00 48.45 ? 153 GLY A CA    1 
ATOM   1251 C  C     . GLY A 1 156 ? 78.765 -17.504 17.261  1.00 50.30 ? 153 GLY A C     1 
ATOM   1252 O  O     . GLY A 1 156 ? 78.594 -16.403 17.786  1.00 43.80 ? 153 GLY A O     1 
ATOM   1253 N  N     . PRO A 1 157 ? 79.892 -18.220 17.419  1.00 61.91 ? 154 PRO A N     1 
ATOM   1254 C  CA    . PRO A 1 157 ? 81.035 -17.776 18.227  1.00 60.67 ? 154 PRO A CA    1 
ATOM   1255 C  C     . PRO A 1 157 ? 81.849 -16.674 17.549  1.00 53.25 ? 154 PRO A C     1 
ATOM   1256 O  O     . PRO A 1 157 ? 81.835 -16.570 16.322  1.00 61.23 ? 154 PRO A O     1 
ATOM   1257 C  CB    . PRO A 1 157 ? 81.876 -19.049 18.364  1.00 45.88 ? 154 PRO A CB    1 
ATOM   1258 C  CG    . PRO A 1 157 ? 81.553 -19.841 17.148  1.00 28.86 ? 154 PRO A CG    1 
ATOM   1259 C  CD    . PRO A 1 157 ? 80.102 -19.566 16.856  1.00 48.14 ? 154 PRO A CD    1 
ATOM   1260 N  N     . THR A 1 163 ? 79.679 -5.852  20.134  1.00 70.07 ? 160 THR A N     1 
ATOM   1261 C  CA    . THR A 1 163 ? 79.013 -4.555  20.187  1.00 64.56 ? 160 THR A CA    1 
ATOM   1262 C  C     . THR A 1 163 ? 77.573 -4.679  20.680  1.00 58.43 ? 160 THR A C     1 
ATOM   1263 O  O     . THR A 1 163 ? 76.864 -5.629  20.345  1.00 56.81 ? 160 THR A O     1 
ATOM   1264 C  CB    . THR A 1 163 ? 79.013 -3.864  18.816  1.00 53.25 ? 160 THR A CB    1 
ATOM   1265 O  OG1   . THR A 1 163 ? 78.261 -2.645  18.893  1.00 56.30 ? 160 THR A OG1   1 
ATOM   1266 C  CG2   . THR A 1 163 ? 78.393 -4.775  17.770  1.00 53.26 ? 160 THR A CG2   1 
ATOM   1267 N  N     . VAL A 1 164 ? 77.147 -3.703  21.473  1.00 50.84 ? 161 VAL A N     1 
ATOM   1268 C  CA    . VAL A 1 164 ? 75.820 -3.730  22.073  1.00 49.15 ? 161 VAL A CA    1 
ATOM   1269 C  C     . VAL A 1 164 ? 74.896 -2.692  21.438  1.00 45.13 ? 161 VAL A C     1 
ATOM   1270 O  O     . VAL A 1 164 ? 73.800 -2.438  21.940  1.00 45.38 ? 161 VAL A O     1 
ATOM   1271 C  CB    . VAL A 1 164 ? 75.895 -3.490  23.595  1.00 50.61 ? 161 VAL A CB    1 
ATOM   1272 C  CG1   . VAL A 1 164 ? 76.725 -4.578  24.263  1.00 35.38 ? 161 VAL A CG1   1 
ATOM   1273 C  CG2   . VAL A 1 164 ? 76.480 -2.117  23.888  1.00 36.67 ? 161 VAL A CG2   1 
ATOM   1274 N  N     . GLN A 1 165 ? 75.343 -2.101  20.332  1.00 28.42 ? 162 GLN A N     1 
ATOM   1275 C  CA    . GLN A 1 165 ? 74.566 -1.080  19.633  1.00 28.56 ? 162 GLN A CA    1 
ATOM   1276 C  C     . GLN A 1 165 ? 74.045 -1.572  18.284  1.00 33.09 ? 162 GLN A C     1 
ATOM   1277 O  O     . GLN A 1 165 ? 74.678 -2.397  17.626  1.00 38.81 ? 162 GLN A O     1 
ATOM   1278 C  CB    . GLN A 1 165 ? 75.396 0.187   19.444  1.00 42.15 ? 162 GLN A CB    1 
ATOM   1279 C  CG    . GLN A 1 165 ? 75.795 0.855   20.748  1.00 53.69 ? 162 GLN A CG    1 
ATOM   1280 C  CD    . GLN A 1 165 ? 76.724 2.032   20.534  1.00 61.11 ? 162 GLN A CD    1 
ATOM   1281 O  OE1   . GLN A 1 165 ? 77.861 2.032   21.005  1.00 52.68 ? 162 GLN A OE1   1 
ATOM   1282 N  NE2   . GLN A 1 165 ? 76.242 3.045   19.821  1.00 64.50 ? 162 GLN A NE2   1 
ATOM   1283 N  N     . LYS A 1 166 ? 72.897 -1.046  17.869  1.00 31.66 ? 163 LYS A N     1 
ATOM   1284 C  CA    . LYS A 1 166 ? 72.225 -1.543  16.671  1.00 39.59 ? 163 LYS A CA    1 
ATOM   1285 C  C     . LYS A 1 166 ? 73.120 -1.544  15.429  1.00 23.74 ? 163 LYS A C     1 
ATOM   1286 O  O     . LYS A 1 166 ? 73.198 -2.546  14.719  1.00 27.47 ? 163 LYS A O     1 
ATOM   1287 C  CB    . LYS A 1 166 ? 70.935 -0.763  16.395  1.00 34.59 ? 163 LYS A CB    1 
ATOM   1288 C  CG    . LYS A 1 166 ? 69.905 -1.568  15.616  1.00 38.78 ? 163 LYS A CG    1 
ATOM   1289 C  CD    . LYS A 1 166 ? 68.703 -0.724  15.217  1.00 53.03 ? 163 LYS A CD    1 
ATOM   1290 C  CE    . LYS A 1 166 ? 69.109 0.399   14.267  1.00 65.43 ? 163 LYS A CE    1 
ATOM   1291 N  NZ    . LYS A 1 166 ? 67.940 1.069   13.623  1.00 58.10 ? 163 LYS A NZ    1 
ATOM   1292 N  N     . GLU A 1 167 ? 73.789 -0.427  15.158  1.00 26.58 ? 164 GLU A N     1 
ATOM   1293 C  CA    . GLU A 1 167 ? 74.597 -0.331  13.945  1.00 26.08 ? 164 GLU A CA    1 
ATOM   1294 C  C     . GLU A 1 167 ? 75.773 -1.298  13.983  1.00 29.46 ? 164 GLU A C     1 
ATOM   1295 O  O     . GLU A 1 167 ? 76.182 -1.836  12.952  1.00 24.40 ? 164 GLU A O     1 
ATOM   1296 C  CB    . GLU A 1 167 ? 75.080 1.102   13.711  1.00 36.52 ? 164 GLU A CB    1 
ATOM   1297 C  CG    . GLU A 1 167 ? 76.108 1.254   12.592  1.00 27.09 ? 164 GLU A CG    1 
ATOM   1298 C  CD    . GLU A 1 167 ? 75.551 0.980   11.196  1.00 34.48 ? 164 GLU A CD    1 
ATOM   1299 O  OE1   . GLU A 1 167 ? 76.357 0.953   10.244  1.00 31.14 ? 164 GLU A OE1   1 
ATOM   1300 O  OE2   . GLU A 1 167 ? 74.323 0.797   11.039  1.00 27.70 ? 164 GLU A OE2   1 
ATOM   1301 N  N     . GLY A 1 168 ? 76.309 -1.518  15.178  1.00 29.09 ? 165 GLY A N     1 
ATOM   1302 C  CA    . GLY A 1 168 ? 77.403 -2.450  15.358  1.00 29.82 ? 165 GLY A CA    1 
ATOM   1303 C  C     . GLY A 1 168 ? 76.982 -3.857  14.995  1.00 23.23 ? 165 GLY A C     1 
ATOM   1304 O  O     . GLY A 1 168 ? 77.736 -4.601  14.359  1.00 23.76 ? 165 GLY A O     1 
ATOM   1305 N  N     . MET A 1 169 ? 75.771 -4.228  15.404  1.00 25.72 ? 166 MET A N     1 
ATOM   1306 C  CA    . MET A 1 169 ? 75.218 -5.531  15.059  1.00 20.67 ? 166 MET A CA    1 
ATOM   1307 C  C     . MET A 1 169 ? 75.014 -5.656  13.552  1.00 20.30 ? 166 MET A C     1 
ATOM   1308 O  O     . MET A 1 169 ? 75.349 -6.679  12.957  1.00 24.91 ? 166 MET A O     1 
ATOM   1309 C  CB    . MET A 1 169 ? 73.899 -5.784  15.798  1.00 29.80 ? 166 MET A CB    1 
ATOM   1310 C  CG    . MET A 1 169 ? 73.371 -7.207  15.644  1.00 41.30 ? 166 MET A CG    1 
ATOM   1311 S  SD    . MET A 1 169 ? 73.406 -8.159  17.182  1.00 52.48 ? 166 MET A SD    1 
ATOM   1312 C  CE    . MET A 1 169 ? 74.990 -7.661  17.861  1.00 35.32 ? 166 MET A CE    1 
ATOM   1313 N  N     . ARG A 1 170 ? 74.472 -4.611  12.933  1.00 22.18 ? 167 ARG A N     1 
ATOM   1314 C  CA    . ARG A 1 170 ? 74.214 -4.639  11.497  1.00 19.78 ? 167 ARG A CA    1 
ATOM   1315 C  C     . ARG A 1 170 ? 75.488 -4.949  10.738  1.00 20.88 ? 167 ARG A C     1 
ATOM   1316 O  O     . ARG A 1 170 ? 75.495 -5.803  9.865   1.00 17.19 ? 167 ARG A O     1 
ATOM   1317 C  CB    . ARG A 1 170 ? 73.648 -3.305  11.009  1.00 16.74 ? 167 ARG A CB    1 
ATOM   1318 C  CG    . ARG A 1 170 ? 73.238 -3.323  9.537   1.00 16.36 ? 167 ARG A CG    1 
ATOM   1319 C  CD    . ARG A 1 170 ? 73.014 -1.921  8.994   1.00 17.56 ? 167 ARG A CD    1 
ATOM   1320 N  NE    . ARG A 1 170 ? 74.279 -1.216  8.787   1.00 22.28 ? 167 ARG A NE    1 
ATOM   1321 C  CZ    . ARG A 1 170 ? 75.103 -1.436  7.768   1.00 16.55 ? 167 ARG A CZ    1 
ATOM   1322 N  NH1   . ARG A 1 170 ? 74.813 -2.355  6.853   1.00 16.27 ? 167 ARG A NH1   1 
ATOM   1323 N  NH2   . ARG A 1 170 ? 76.226 -0.737  7.661   1.00 19.15 ? 167 ARG A NH2   1 
ATOM   1324 N  N     . LYS A 1 171 ? 76.565 -4.244  11.076  1.00 18.06 ? 168 LYS A N     1 
ATOM   1325 C  CA    . LYS A 1 171 ? 77.839 -4.426  10.386  1.00 18.52 ? 168 LYS A CA    1 
ATOM   1326 C  C     . LYS A 1 171 ? 78.450 -5.804  10.650  1.00 18.91 ? 168 LYS A C     1 
ATOM   1327 O  O     . LYS A 1 171 ? 79.024 -6.426  9.751   1.00 17.41 ? 168 LYS A O     1 
ATOM   1328 C  CB    . LYS A 1 171 ? 78.829 -3.332  10.790  1.00 26.68 ? 168 LYS A CB    1 
ATOM   1329 C  CG    . LYS A 1 171 ? 78.512 -1.959  10.219  1.00 26.65 ? 168 LYS A CG    1 
ATOM   1330 C  CD    . LYS A 1 171 ? 79.591 -0.951  10.620  1.00 34.08 ? 168 LYS A CD    1 
ATOM   1331 C  CE    . LYS A 1 171 ? 79.358 0.402   9.962   1.00 54.53 ? 168 LYS A CE    1 
ATOM   1332 N  NZ    . LYS A 1 171 ? 80.398 1.399   10.342  1.00 64.21 ? 168 LYS A NZ    1 
ATOM   1333 N  N     . GLN A 1 172 ? 78.329 -6.281  11.882  1.00 20.72 ? 169 GLN A N     1 
ATOM   1334 C  CA    . GLN A 1 172 ? 78.841 -7.607  12.214  1.00 21.68 ? 169 GLN A CA    1 
ATOM   1335 C  C     . GLN A 1 172 ? 78.147 -8.681  11.379  1.00 21.25 ? 169 GLN A C     1 
ATOM   1336 O  O     . GLN A 1 172 ? 78.790 -9.608  10.882  1.00 17.97 ? 169 GLN A O     1 
ATOM   1337 C  CB    . GLN A 1 172 ? 78.696 -7.902  13.708  1.00 25.61 ? 169 GLN A CB    1 
ATOM   1338 C  CG    . GLN A 1 172 ? 79.721 -7.192  14.581  1.00 39.89 ? 169 GLN A CG    1 
ATOM   1339 C  CD    . GLN A 1 172 ? 81.141 -7.689  14.346  1.00 58.86 ? 169 GLN A CD    1 
ATOM   1340 O  OE1   . GLN A 1 172 ? 81.373 -8.887  14.179  1.00 61.09 ? 169 GLN A OE1   1 
ATOM   1341 N  NE2   . GLN A 1 172 ? 82.097 -6.764  14.329  1.00 50.47 ? 169 GLN A NE2   1 
ATOM   1342 N  N     . GLY A 1 173 ? 76.831 -8.553  11.228  1.00 22.99 ? 170 GLY A N     1 
ATOM   1343 C  CA    . GLY A 1 173 ? 76.069 -9.501  10.436  1.00 16.02 ? 170 GLY A CA    1 
ATOM   1344 C  C     . GLY A 1 173 ? 76.444 -9.410  8.970   1.00 15.42 ? 170 GLY A C     1 
ATOM   1345 O  O     . GLY A 1 173 ? 76.634 -10.426 8.288   1.00 15.70 ? 170 GLY A O     1 
ATOM   1346 N  N     . LEU A 1 174 ? 76.546 -8.181  8.473   1.00 16.10 ? 171 LEU A N     1 
ATOM   1347 C  CA    . LEU A 1 174 ? 76.951 -7.953  7.091   1.00 13.33 ? 171 LEU A CA    1 
ATOM   1348 C  C     . LEU A 1 174 ? 78.335 -8.530  6.803   1.00 17.72 ? 171 LEU A C     1 
ATOM   1349 O  O     . LEU A 1 174 ? 78.564 -9.138  5.760   1.00 16.50 ? 171 LEU A O     1 
ATOM   1350 C  CB    . LEU A 1 174 ? 76.926 -6.452  6.757   1.00 13.61 ? 171 LEU A CB    1 
ATOM   1351 C  CG    . LEU A 1 174 ? 77.307 -6.104  5.318   1.00 15.98 ? 171 LEU A CG    1 
ATOM   1352 C  CD1   . LEU A 1 174 ? 76.381 -6.808  4.335   1.00 17.73 ? 171 LEU A CD1   1 
ATOM   1353 C  CD2   . LEU A 1 174 ? 77.281 -4.587  5.098   1.00 19.32 ? 171 LEU A CD2   1 
ATOM   1354 N  N     . PHE A 1 175 ? 79.260 -8.339  7.737   1.00 17.52 ? 172 PHE A N     1 
ATOM   1355 C  CA    . PHE A 1 175 ? 80.616 -8.849  7.565   1.00 17.07 ? 172 PHE A CA    1 
ATOM   1356 C  C     . PHE A 1 175 ? 80.630 -10.373 7.466   1.00 15.82 ? 172 PHE A C     1 
ATOM   1357 O  O     . PHE A 1 175 ? 81.319 -10.940 6.617   1.00 22.90 ? 172 PHE A O     1 
ATOM   1358 C  CB    . PHE A 1 175 ? 81.512 -8.383  8.714   1.00 16.52 ? 172 PHE A CB    1 
ATOM   1359 C  CG    . PHE A 1 175 ? 81.973 -6.958  8.584   1.00 41.18 ? 172 PHE A CG    1 
ATOM   1360 C  CD1   . PHE A 1 175 ? 82.130 -6.378  7.334   1.00 41.32 ? 172 PHE A CD1   1 
ATOM   1361 C  CD2   . PHE A 1 175 ? 82.251 -6.200  9.710   1.00 37.39 ? 172 PHE A CD2   1 
ATOM   1362 C  CE1   . PHE A 1 175 ? 82.557 -5.069  7.209   1.00 42.13 ? 172 PHE A CE1   1 
ATOM   1363 C  CE2   . PHE A 1 175 ? 82.682 -4.887  9.591   1.00 50.10 ? 172 PHE A CE2   1 
ATOM   1364 C  CZ    . PHE A 1 175 ? 82.832 -4.321  8.338   1.00 45.48 ? 172 PHE A CZ    1 
ATOM   1365 N  N     . GLN A 1 176 ? 79.870 -11.036 8.334   1.00 18.72 ? 173 GLN A N     1 
ATOM   1366 C  CA    . GLN A 1 176 ? 79.808 -12.494 8.305   1.00 19.47 ? 173 GLN A CA    1 
ATOM   1367 C  C     . GLN A 1 176 ? 79.256 -12.963 6.965   1.00 22.83 ? 173 GLN A C     1 
ATOM   1368 O  O     . GLN A 1 176 ? 79.767 -13.904 6.364   1.00 19.16 ? 173 GLN A O     1 
ATOM   1369 C  CB    . GLN A 1 176 ? 78.968 -13.043 9.462   1.00 20.45 ? 173 GLN A CB    1 
ATOM   1370 C  CG    . GLN A 1 176 ? 79.581 -12.818 10.842  1.00 24.22 ? 173 GLN A CG    1 
ATOM   1371 C  CD    . GLN A 1 176 ? 78.789 -13.490 11.946  1.00 26.40 ? 173 GLN A CD    1 
ATOM   1372 O  OE1   . GLN A 1 176 ? 77.711 -14.028 11.710  1.00 22.18 ? 173 GLN A OE1   1 
ATOM   1373 N  NE2   . GLN A 1 176 ? 79.322 -13.459 13.162  1.00 31.94 ? 173 GLN A NE2   1 
ATOM   1374 N  N     . TRP A 1 177 ? 78.217 -12.285 6.489   1.00 15.88 ? 174 TRP A N     1 
ATOM   1375 C  CA    . TRP A 1 177 ? 77.575 -12.660 5.235   1.00 14.79 ? 174 TRP A CA    1 
ATOM   1376 C  C     . TRP A 1 177 ? 78.550 -12.538 4.065   1.00 13.41 ? 174 TRP A C     1 
ATOM   1377 O  O     . TRP A 1 177 ? 78.687 -13.456 3.256   1.00 19.19 ? 174 TRP A O     1 
ATOM   1378 C  CB    . TRP A 1 177 ? 76.339 -11.784 5.005   1.00 13.98 ? 174 TRP A CB    1 
ATOM   1379 C  CG    . TRP A 1 177 ? 75.699 -11.946 3.656   1.00 21.14 ? 174 TRP A CG    1 
ATOM   1380 C  CD1   . TRP A 1 177 ? 75.834 -11.108 2.587   1.00 17.40 ? 174 TRP A CD1   1 
ATOM   1381 C  CD2   . TRP A 1 177 ? 74.801 -12.988 3.237   1.00 15.69 ? 174 TRP A CD2   1 
ATOM   1382 N  NE1   . TRP A 1 177 ? 75.096 -11.566 1.532   1.00 15.82 ? 174 TRP A NE1   1 
ATOM   1383 C  CE2   . TRP A 1 177 ? 74.453 -12.719 1.898   1.00 16.93 ? 174 TRP A CE2   1 
ATOM   1384 C  CE3   . TRP A 1 177 ? 74.275 -14.128 3.855   1.00 19.08 ? 174 TRP A CE3   1 
ATOM   1385 C  CZ2   . TRP A 1 177 ? 73.592 -13.537 1.169   1.00 12.30 ? 174 TRP A CZ2   1 
ATOM   1386 C  CZ3   . TRP A 1 177 ? 73.419 -14.943 3.129   1.00 16.18 ? 174 TRP A CZ3   1 
ATOM   1387 C  CH2   . TRP A 1 177 ? 73.084 -14.643 1.801   1.00 17.32 ? 174 TRP A CH2   1 
ATOM   1388 N  N     . LEU A 1 178 ? 79.230 -11.400 3.989   1.00 14.57 ? 175 LEU A N     1 
ATOM   1389 C  CA    . LEU A 1 178 ? 80.138 -11.130 2.885   1.00 14.08 ? 175 LEU A CA    1 
ATOM   1390 C  C     . LEU A 1 178 ? 81.368 -12.029 2.944   1.00 23.11 ? 175 LEU A C     1 
ATOM   1391 O  O     . LEU A 1 178 ? 81.875 -12.469 1.912   1.00 25.11 ? 175 LEU A O     1 
ATOM   1392 C  CB    . LEU A 1 178 ? 80.570 -9.671  2.894   1.00 14.69 ? 175 LEU A CB    1 
ATOM   1393 C  CG    . LEU A 1 178 ? 79.445 -8.662  2.679   1.00 16.46 ? 175 LEU A CG    1 
ATOM   1394 C  CD1   . LEU A 1 178 ? 80.014 -7.255  2.700   1.00 20.82 ? 175 LEU A CD1   1 
ATOM   1395 C  CD2   . LEU A 1 178 ? 78.728 -8.939  1.366   1.00 19.34 ? 175 LEU A CD2   1 
ATOM   1396 N  N     . ASP A 1 179 ? 81.841 -12.292 4.155   1.00 26.22 ? 176 ASP A N     1 
ATOM   1397 C  CA    . ASP A 1 179 ? 82.999 -13.162 4.337   1.00 32.39 ? 176 ASP A CA    1 
ATOM   1398 C  C     . ASP A 1 179 ? 82.722 -14.550 3.775   1.00 31.17 ? 176 ASP A C     1 
ATOM   1399 O  O     . ASP A 1 179 ? 83.621 -15.199 3.237   1.00 33.92 ? 176 ASP A O     1 
ATOM   1400 C  CB    . ASP A 1 179 ? 83.394 -13.250 5.816   1.00 25.46 ? 176 ASP A CB    1 
ATOM   1401 C  CG    . ASP A 1 179 ? 84.176 -12.038 6.283   1.00 49.80 ? 176 ASP A CG    1 
ATOM   1402 O  OD1   . ASP A 1 179 ? 84.850 -11.401 5.443   1.00 57.23 ? 176 ASP A OD1   1 
ATOM   1403 O  OD2   . ASP A 1 179 ? 84.122 -11.722 7.492   1.00 53.82 ? 176 ASP A OD2   1 
ATOM   1404 N  N     . SER A 1 180 ? 81.472 -14.993 3.890   1.00 24.47 ? 177 SER A N     1 
ATOM   1405 C  CA    . SER A 1 180 ? 81.092 -16.338 3.470   1.00 28.36 ? 177 SER A CA    1 
ATOM   1406 C  C     . SER A 1 180 ? 80.689 -16.420 2.001   1.00 30.51 ? 177 SER A C     1 
ATOM   1407 O  O     . SER A 1 180 ? 80.529 -17.511 1.457   1.00 41.09 ? 177 SER A O     1 
ATOM   1408 C  CB    . SER A 1 180 ? 79.939 -16.849 4.335   1.00 30.62 ? 177 SER A CB    1 
ATOM   1409 O  OG    . SER A 1 180 ? 80.234 -16.696 5.711   1.00 39.52 ? 177 SER A OG    1 
ATOM   1410 N  N     . LEU A 1 181 ? 80.519 -15.267 1.365   1.00 21.30 ? 178 LEU A N     1 
ATOM   1411 C  CA    A LEU A 1 181 ? 80.053 -15.207 -0.019  0.42 22.57 ? 178 LEU A CA    1 
ATOM   1412 C  CA    B LEU A 1 181 ? 80.041 -15.222 -0.011  0.58 22.49 ? 178 LEU A CA    1 
ATOM   1413 C  C     . LEU A 1 181 ? 81.048 -15.784 -1.016  1.00 34.77 ? 178 LEU A C     1 
ATOM   1414 O  O     . LEU A 1 181 ? 82.235 -15.472 -0.962  1.00 31.66 ? 178 LEU A O     1 
ATOM   1415 C  CB    A LEU A 1 181 ? 79.743 -13.763 -0.420  0.42 27.63 ? 178 LEU A CB    1 
ATOM   1416 C  CB    B LEU A 1 181 ? 79.673 -13.783 -0.382  0.58 27.62 ? 178 LEU A CB    1 
ATOM   1417 C  CG    A LEU A 1 181 ? 78.342 -13.225 -0.155  0.42 19.80 ? 178 LEU A CG    1 
ATOM   1418 C  CG    B LEU A 1 181 ? 78.663 -13.598 -1.511  0.58 22.95 ? 178 LEU A CG    1 
ATOM   1419 C  CD1   A LEU A 1 181 ? 78.179 -11.860 -0.816  0.42 12.95 ? 178 LEU A CD1   1 
ATOM   1420 C  CD1   B LEU A 1 181 ? 77.378 -14.333 -1.178  0.58 22.45 ? 178 LEU A CD1   1 
ATOM   1421 C  CD2   A LEU A 1 181 ? 77.300 -14.198 -0.675  0.42 20.71 ? 178 LEU A CD2   1 
ATOM   1422 C  CD2   B LEU A 1 181 ? 78.393 -12.112 -1.740  0.58 13.79 ? 178 LEU A CD2   1 
ATOM   1423 N  N     . GLN A 1 182 ? 80.557 -16.610 -1.938  1.00 33.11 ? 179 GLN A N     1 
ATOM   1424 C  CA    . GLN A 1 182 ? 81.402 -17.132 -3.008  1.00 42.41 ? 179 GLN A CA    1 
ATOM   1425 C  C     . GLN A 1 182 ? 81.146 -16.366 -4.305  1.00 55.97 ? 179 GLN A C     1 
ATOM   1426 O  O     . GLN A 1 182 ? 80.281 -16.739 -5.101  1.00 50.21 ? 179 GLN A O     1 
ATOM   1427 C  CB    . GLN A 1 182 ? 81.177 -18.632 -3.219  1.00 49.96 ? 179 GLN A CB    1 
ATOM   1428 C  CG    . GLN A 1 182 ? 82.080 -19.255 -4.286  1.00 54.43 ? 179 GLN A CG    1 
ATOM   1429 C  CD    . GLN A 1 182 ? 83.560 -18.969 -4.056  1.00 66.19 ? 179 GLN A CD    1 
ATOM   1430 O  OE1   . GLN A 1 182 ? 84.074 -17.923 -4.458  1.00 61.18 ? 179 GLN A OE1   1 
ATOM   1431 N  NE2   . GLN A 1 182 ? 84.250 -19.903 -3.410  1.00 59.62 ? 179 GLN A NE2   1 
ATOM   1432 N  N     . ILE A 1 183 ? 81.911 -15.297 -4.507  1.00 43.83 ? 180 ILE A N     1 
ATOM   1433 C  CA    . ILE A 1 183 ? 81.720 -14.395 -5.641  1.00 50.87 ? 180 ILE A CA    1 
ATOM   1434 C  C     . ILE A 1 183 ? 82.165 -15.033 -6.953  1.00 50.15 ? 180 ILE A C     1 
ATOM   1435 O  O     . ILE A 1 183 ? 82.058 -14.430 -8.022  1.00 47.86 ? 180 ILE A O     1 
ATOM   1436 C  CB    . ILE A 1 183 ? 82.506 -13.091 -5.436  1.00 48.39 ? 180 ILE A CB    1 
ATOM   1437 C  CG1   . ILE A 1 183 ? 83.998 -13.400 -5.309  1.00 46.89 ? 180 ILE A CG1   1 
ATOM   1438 C  CG2   . ILE A 1 183 ? 82.005 -12.357 -4.201  1.00 47.18 ? 180 ILE A CG2   1 
ATOM   1439 C  CD1   . ILE A 1 183 ? 84.832 -12.227 -4.861  1.00 53.74 ? 180 ILE A CD1   1 
ATOM   1440 N  N     . ASP A 1 184 ? 82.663 -16.259 -6.857  1.00 60.05 ? 181 ASP A N     1 
ATOM   1441 C  CA    . ASP A 1 184 ? 83.191 -16.982 -8.004  1.00 58.37 ? 181 ASP A CA    1 
ATOM   1442 C  C     . ASP A 1 184 ? 82.071 -17.437 -8.936  1.00 52.33 ? 181 ASP A C     1 
ATOM   1443 O  O     . ASP A 1 184 ? 82.223 -17.425 -10.157 1.00 53.71 ? 181 ASP A O     1 
ATOM   1444 C  CB    . ASP A 1 184 ? 83.985 -18.195 -7.516  1.00 57.35 ? 181 ASP A CB    1 
ATOM   1445 C  CG    . ASP A 1 184 ? 85.049 -18.631 -8.498  1.00 78.77 ? 181 ASP A CG    1 
ATOM   1446 O  OD1   . ASP A 1 184 ? 84.856 -18.426 -9.716  1.00 85.08 ? 181 ASP A OD1   1 
ATOM   1447 O  OD2   . ASP A 1 184 ? 86.080 -19.177 -8.050  1.00 73.39 ? 181 ASP A OD2   1 
ATOM   1448 N  N     . ASN A 1 185 ? 80.944 -17.828 -8.350  1.00 47.85 ? 182 ASN A N     1 
ATOM   1449 C  CA    . ASN A 1 185 ? 79.841 -18.421 -9.100  1.00 47.25 ? 182 ASN A CA    1 
ATOM   1450 C  C     . ASN A 1 185 ? 78.714 -17.434 -9.403  1.00 45.86 ? 182 ASN A C     1 
ATOM   1451 O  O     . ASN A 1 185 ? 78.002 -16.994 -8.501  1.00 33.91 ? 182 ASN A O     1 
ATOM   1452 C  CB    . ASN A 1 185 ? 79.293 -19.628 -8.337  1.00 34.75 ? 182 ASN A CB    1 
ATOM   1453 C  CG    . ASN A 1 185 ? 78.196 -20.350 -9.089  1.00 46.96 ? 182 ASN A CG    1 
ATOM   1454 O  OD1   . ASN A 1 185 ? 78.047 -20.194 -10.302 1.00 50.41 ? 182 ASN A OD1   1 
ATOM   1455 N  ND2   . ASN A 1 185 ? 77.421 -21.156 -8.370  1.00 56.02 ? 182 ASN A ND2   1 
ATOM   1456 N  N     . LEU A 1 186 ? 78.549 -17.103 -10.681 1.00 49.34 ? 183 LEU A N     1 
ATOM   1457 C  CA    . LEU A 1 186 ? 77.538 -16.135 -11.102 1.00 42.24 ? 183 LEU A CA    1 
ATOM   1458 C  C     . LEU A 1 186 ? 76.109 -16.654 -10.939 1.00 31.38 ? 183 LEU A C     1 
ATOM   1459 O  O     . LEU A 1 186 ? 75.149 -15.918 -11.164 1.00 38.51 ? 183 LEU A O     1 
ATOM   1460 C  CB    . LEU A 1 186 ? 77.769 -15.701 -12.552 1.00 33.86 ? 183 LEU A CB    1 
ATOM   1461 C  CG    . LEU A 1 186 ? 78.813 -14.613 -12.813 1.00 51.20 ? 183 LEU A CG    1 
ATOM   1462 C  CD1   . LEU A 1 186 ? 80.197 -15.049 -12.348 1.00 61.85 ? 183 LEU A CD1   1 
ATOM   1463 C  CD2   . LEU A 1 186 ? 78.830 -14.236 -14.289 1.00 53.06 ? 183 LEU A CD2   1 
ATOM   1464 N  N     . THR A 1 187 ? 75.972 -17.919 -10.552 1.00 41.13 ? 184 THR A N     1 
ATOM   1465 C  CA    . THR A 1 187 ? 74.651 -18.515 -10.371 1.00 37.85 ? 184 THR A CA    1 
ATOM   1466 C  C     . THR A 1 187 ? 74.344 -18.833 -8.906  1.00 30.73 ? 184 THR A C     1 
ATOM   1467 O  O     . THR A 1 187 ? 73.334 -19.469 -8.609  1.00 36.37 ? 184 THR A O     1 
ATOM   1468 C  CB    . THR A 1 187 ? 74.478 -19.801 -11.209 1.00 47.04 ? 184 THR A CB    1 
ATOM   1469 O  OG1   . THR A 1 187 ? 75.365 -20.818 -10.723 1.00 50.03 ? 184 THR A OG1   1 
ATOM   1470 C  CG2   . THR A 1 187 ? 74.769 -19.529 -12.678 1.00 45.63 ? 184 THR A CG2   1 
ATOM   1471 N  N     . SER A 1 188 ? 75.217 -18.406 -7.998  1.00 31.65 ? 185 SER A N     1 
ATOM   1472 C  CA    . SER A 1 188 ? 74.949 -18.556 -6.568  1.00 23.75 ? 185 SER A CA    1 
ATOM   1473 C  C     . SER A 1 188 ? 73.783 -17.658 -6.176  1.00 20.39 ? 185 SER A C     1 
ATOM   1474 O  O     . SER A 1 188 ? 73.865 -16.442 -6.325  1.00 17.94 ? 185 SER A O     1 
ATOM   1475 C  CB    . SER A 1 188 ? 76.168 -18.175 -5.737  1.00 25.40 ? 185 SER A CB    1 
ATOM   1476 O  OG    . SER A 1 188 ? 75.830 -18.128 -4.355  1.00 32.25 ? 185 SER A OG    1 
ATOM   1477 N  N     . PRO A 1 189 ? 72.688 -18.256 -5.689  1.00 18.17 ? 186 PRO A N     1 
ATOM   1478 C  CA    . PRO A 1 189 ? 71.524 -17.464 -5.270  1.00 14.89 ? 186 PRO A CA    1 
ATOM   1479 C  C     . PRO A 1 189 ? 71.872 -16.416 -4.217  1.00 15.62 ? 186 PRO A C     1 
ATOM   1480 O  O     . PRO A 1 189 ? 71.333 -15.311 -4.275  1.00 13.77 ? 186 PRO A O     1 
ATOM   1481 C  CB    . PRO A 1 189 ? 70.586 -18.518 -4.677  1.00 15.34 ? 186 PRO A CB    1 
ATOM   1482 C  CG    . PRO A 1 189 ? 70.927 -19.775 -5.452  1.00 18.01 ? 186 PRO A CG    1 
ATOM   1483 C  CD    . PRO A 1 189 ? 72.426 -19.705 -5.619  1.00 20.40 ? 186 PRO A CD    1 
ATOM   1484 N  N     . ASP A 1 190 ? 72.745 -16.747 -3.266  1.00 13.33 ? 187 ASP A N     1 
ATOM   1485 C  CA    . ASP A 1 190 ? 73.066 -15.797 -2.209  1.00 13.48 ? 187 ASP A CA    1 
ATOM   1486 C  C     . ASP A 1 190 ? 73.812 -14.604 -2.797  1.00 13.27 ? 187 ASP A C     1 
ATOM   1487 O  O     . ASP A 1 190 ? 73.615 -13.468 -2.364  1.00 13.79 ? 187 ASP A O     1 
ATOM   1488 C  CB    . ASP A 1 190 ? 73.928 -16.433 -1.107  1.00 14.19 ? 187 ASP A CB    1 
ATOM   1489 C  CG    . ASP A 1 190 ? 73.165 -17.441 -0.251  1.00 23.09 ? 187 ASP A CG    1 
ATOM   1490 O  OD1   . ASP A 1 190 ? 71.920 -17.400 -0.216  1.00 14.09 ? 187 ASP A OD1   1 
ATOM   1491 O  OD2   . ASP A 1 190 ? 73.824 -18.273 0.407   1.00 19.49 ? 187 ASP A OD2   1 
ATOM   1492 N  N     . LEU A 1 191 ? 74.697 -14.866 -3.757  1.00 13.16 ? 188 LEU A N     1 
ATOM   1493 C  CA    . LEU A 1 191 ? 75.414 -13.776 -4.415  1.00 15.07 ? 188 LEU A CA    1 
ATOM   1494 C  C     . LEU A 1 191 ? 74.431 -12.904 -5.174  1.00 14.40 ? 188 LEU A C     1 
ATOM   1495 O  O     . LEU A 1 191 ? 74.523 -11.680 -5.136  1.00 12.89 ? 188 LEU A O     1 
ATOM   1496 C  CB    . LEU A 1 191 ? 76.469 -14.308 -5.388  1.00 15.84 ? 188 LEU A CB    1 
ATOM   1497 C  CG    . LEU A 1 191 ? 77.225 -13.257 -6.216  1.00 19.90 ? 188 LEU A CG    1 
ATOM   1498 C  CD1   . LEU A 1 191 ? 77.992 -12.302 -5.329  1.00 18.26 ? 188 LEU A CD1   1 
ATOM   1499 C  CD2   . LEU A 1 191 ? 78.170 -13.939 -7.202  1.00 25.58 ? 188 LEU A CD2   1 
ATOM   1500 N  N     . GLN A 1 192 ? 73.495 -13.539 -5.869  1.00 13.45 ? 189 GLN A N     1 
ATOM   1501 C  CA    . GLN A 1 192 ? 72.500 -12.803 -6.639  1.00 14.78 ? 189 GLN A CA    1 
ATOM   1502 C  C     . GLN A 1 192 ? 71.674 -11.888 -5.743  1.00 12.69 ? 189 GLN A C     1 
ATOM   1503 O  O     . GLN A 1 192 ? 71.407 -10.744 -6.106  1.00 14.74 ? 189 GLN A O     1 
ATOM   1504 C  CB    . GLN A 1 192 ? 71.609 -13.756 -7.432  1.00 16.00 ? 189 GLN A CB    1 
ATOM   1505 C  CG    . GLN A 1 192 ? 72.346 -14.443 -8.582  1.00 17.42 ? 189 GLN A CG    1 
ATOM   1506 C  CD    . GLN A 1 192 ? 71.602 -15.642 -9.131  1.00 31.80 ? 189 GLN A CD    1 
ATOM   1507 O  OE1   . GLN A 1 192 ? 70.760 -16.233 -8.454  1.00 30.29 ? 189 GLN A OE1   1 
ATOM   1508 N  NE2   . GLN A 1 192 ? 71.916 -16.015 -10.367 1.00 41.12 ? 189 GLN A NE2   1 
ATOM   1509 N  N     . LEU A 1 193 ? 71.275 -12.387 -4.573  1.00 10.22 ? 190 LEU A N     1 
ATOM   1510 C  CA    . LEU A 1 193 ? 70.541 -11.560 -3.614  1.00 11.38 ? 190 LEU A CA    1 
ATOM   1511 C  C     . LEU A 1 193 ? 71.385 -10.373 -3.155  1.00 13.42 ? 190 LEU A C     1 
ATOM   1512 O  O     . LEU A 1 193 ? 70.875 -9.273  -2.948  1.00 11.75 ? 190 LEU A O     1 
ATOM   1513 C  CB    . LEU A 1 193 ? 70.111 -12.377 -2.394  1.00 10.28 ? 190 LEU A CB    1 
ATOM   1514 C  CG    . LEU A 1 193 ? 69.041 -13.454 -2.567  1.00 8.38  ? 190 LEU A CG    1 
ATOM   1515 C  CD1   . LEU A 1 193 ? 68.733 -14.054 -1.185  1.00 11.52 ? 190 LEU A CD1   1 
ATOM   1516 C  CD2   . LEU A 1 193 ? 67.783 -12.891 -3.205  1.00 9.67  ? 190 LEU A CD2   1 
ATOM   1517 N  N     . THR A 1 194 ? 72.678 -10.612 -2.965  1.00 10.62 ? 191 THR A N     1 
ATOM   1518 C  CA    . THR A 1 194 ? 73.571 -9.584  -2.471  1.00 9.00  ? 191 THR A CA    1 
ATOM   1519 C  C     . THR A 1 194 ? 73.702 -8.476  -3.509  1.00 11.67 ? 191 THR A C     1 
ATOM   1520 O  O     . THR A 1 194 ? 73.663 -7.295  -3.175  1.00 12.37 ? 191 THR A O     1 
ATOM   1521 C  CB    . THR A 1 194 ? 74.957 -10.168 -2.157  1.00 12.15 ? 191 THR A CB    1 
ATOM   1522 O  OG1   . THR A 1 194 ? 74.816 -11.209 -1.184  1.00 14.51 ? 191 THR A OG1   1 
ATOM   1523 C  CG2   . THR A 1 194 ? 75.888 -9.088  -1.623  1.00 13.88 ? 191 THR A CG2   1 
ATOM   1524 N  N     . VAL A 1 195 ? 73.844 -8.860  -4.771  1.00 15.47 ? 192 VAL A N     1 
ATOM   1525 C  CA    . VAL A 1 195 ? 73.929 -7.861  -5.830  1.00 14.76 ? 192 VAL A CA    1 
ATOM   1526 C  C     . VAL A 1 195 ? 72.599 -7.122  -5.935  1.00 14.89 ? 192 VAL A C     1 
ATOM   1527 O  O     . VAL A 1 195 ? 72.562 -5.909  -6.178  1.00 14.10 ? 192 VAL A O     1 
ATOM   1528 C  CB    . VAL A 1 195 ? 74.287 -8.497  -7.173  1.00 11.89 ? 192 VAL A CB    1 
ATOM   1529 C  CG1   . VAL A 1 195 ? 74.127 -7.481  -8.295  1.00 14.55 ? 192 VAL A CG1   1 
ATOM   1530 C  CG2   . VAL A 1 195 ? 75.714 -9.038  -7.123  1.00 12.76 ? 192 VAL A CG2   1 
ATOM   1531 N  N     . GLY A 1 196 ? 71.505 -7.856  -5.748  1.00 9.36  ? 193 GLY A N     1 
ATOM   1532 C  CA    . GLY A 1 196 ? 70.189 -7.229  -5.681  1.00 8.99  ? 193 GLY A CA    1 
ATOM   1533 C  C     . GLY A 1 196 ? 70.138 -6.151  -4.615  1.00 13.54 ? 193 GLY A C     1 
ATOM   1534 O  O     . GLY A 1 196 ? 69.609 -5.050  -4.838  1.00 14.17 ? 193 GLY A O     1 
ATOM   1535 N  N     . ALA A 1 197 ? 70.680 -6.455  -3.440  1.00 11.02 ? 194 ALA A N     1 
ATOM   1536 C  CA    . ALA A 1 197 ? 70.695 -5.486  -2.354  1.00 11.60 ? 194 ALA A CA    1 
ATOM   1537 C  C     . ALA A 1 197 ? 71.512 -4.256  -2.739  1.00 17.06 ? 194 ALA A C     1 
ATOM   1538 O  O     . ALA A 1 197 ? 71.156 -3.142  -2.377  1.00 12.28 ? 194 ALA A O     1 
ATOM   1539 C  CB    . ALA A 1 197 ? 71.241 -6.115  -1.060  1.00 11.48 ? 194 ALA A CB    1 
ATOM   1540 N  N     . VAL A 1 198 ? 72.607 -4.453  -3.469  1.00 11.78 ? 195 VAL A N     1 
ATOM   1541 C  CA    . VAL A 1 198 ? 73.427 -3.314  -3.880  1.00 12.35 ? 195 VAL A CA    1 
ATOM   1542 C  C     . VAL A 1 198 ? 72.632 -2.391  -4.795  1.00 15.21 ? 195 VAL A C     1 
ATOM   1543 O  O     . VAL A 1 198 ? 72.701 -1.164  -4.671  1.00 16.57 ? 195 VAL A O     1 
ATOM   1544 C  CB    . VAL A 1 198 ? 74.721 -3.757  -4.581  1.00 19.09 ? 195 VAL A CB    1 
ATOM   1545 C  CG1   . VAL A 1 198 ? 75.427 -2.548  -5.206  1.00 18.33 ? 195 VAL A CG1   1 
ATOM   1546 C  CG2   . VAL A 1 198 ? 75.636 -4.442  -3.579  1.00 14.95 ? 195 VAL A CG2   1 
ATOM   1547 N  N     . ILE A 1 199 ? 71.864 -2.990  -5.699  1.00 10.03 ? 196 ILE A N     1 
ATOM   1548 C  CA    . ILE A 1 199 ? 71.035 -2.223  -6.617  1.00 13.58 ? 196 ILE A CA    1 
ATOM   1549 C  C     . ILE A 1 199 ? 69.911 -1.491  -5.879  1.00 13.12 ? 196 ILE A C     1 
ATOM   1550 O  O     . ILE A 1 199 ? 69.594 -0.346  -6.197  1.00 11.23 ? 196 ILE A O     1 
ATOM   1551 C  CB    . ILE A 1 199 ? 70.462 -3.105  -7.740  1.00 13.32 ? 196 ILE A CB    1 
ATOM   1552 C  CG1   . ILE A 1 199 ? 71.593 -3.543  -8.680  1.00 12.58 ? 196 ILE A CG1   1 
ATOM   1553 C  CG2   . ILE A 1 199 ? 69.380 -2.341  -8.509  1.00 14.83 ? 196 ILE A CG2   1 
ATOM   1554 C  CD1   . ILE A 1 199 ? 71.194 -4.602  -9.698  1.00 17.14 ? 196 ILE A CD1   1 
ATOM   1555 N  N     . VAL A 1 200 ? 69.332 -2.147  -4.877  1.00 13.51 ? 197 VAL A N     1 
ATOM   1556 C  CA    . VAL A 1 200 ? 68.283 -1.522  -4.077  1.00 10.33 ? 197 VAL A CA    1 
ATOM   1557 C  C     . VAL A 1 200 ? 68.836 -0.370  -3.228  1.00 14.55 ? 197 VAL A C     1 
ATOM   1558 O  O     . VAL A 1 200 ? 68.147 0.628   -3.024  1.00 13.49 ? 197 VAL A O     1 
ATOM   1559 C  CB    . VAL A 1 200 ? 67.514 -2.563  -3.220  1.00 8.03  ? 197 VAL A CB    1 
ATOM   1560 C  CG1   . VAL A 1 200 ? 66.514 -1.876  -2.285  1.00 11.08 ? 197 VAL A CG1   1 
ATOM   1561 C  CG2   . VAL A 1 200 ? 66.807 -3.568  -4.127  1.00 14.29 ? 197 VAL A CG2   1 
ATOM   1562 N  N     . GLU A 1 201 ? 70.078 -0.484  -2.755  1.00 9.68  ? 198 GLU A N     1 
ATOM   1563 C  CA    . GLU A 1 201 ? 70.715 0.648   -2.088  1.00 11.86 ? 198 GLU A CA    1 
ATOM   1564 C  C     . GLU A 1 201 ? 70.746 1.833   -3.056  1.00 11.70 ? 198 GLU A C     1 
ATOM   1565 O  O     . GLU A 1 201 ? 70.410 2.965   -2.692  1.00 15.08 ? 198 GLU A O     1 
ATOM   1566 C  CB    . GLU A 1 201 ? 72.148 0.322   -1.640  1.00 16.65 ? 198 GLU A CB    1 
ATOM   1567 C  CG    . GLU A 1 201 ? 72.268 -0.680  -0.477  1.00 15.26 ? 198 GLU A CG    1 
ATOM   1568 C  CD    . GLU A 1 201 ? 72.137 -0.063  0.905   1.00 16.50 ? 198 GLU A CD    1 
ATOM   1569 O  OE1   . GLU A 1 201 ? 71.785 1.133   1.035   1.00 15.30 ? 198 GLU A OE1   1 
ATOM   1570 O  OE2   . GLU A 1 201 ? 72.385 -0.790  1.888   1.00 14.44 ? 198 GLU A OE2   1 
ATOM   1571 N  N     . GLU A 1 202 ? 71.133 1.556   -4.293  1.00 11.04 ? 199 GLU A N     1 
ATOM   1572 C  CA    . GLU A 1 202 ? 71.220 2.598   -5.321  1.00 11.48 ? 199 GLU A CA    1 
ATOM   1573 C  C     . GLU A 1 202 ? 69.842 3.190   -5.639  1.00 14.43 ? 199 GLU A C     1 
ATOM   1574 O  O     . GLU A 1 202 ? 69.689 4.413   -5.761  1.00 12.44 ? 199 GLU A O     1 
ATOM   1575 C  CB    . GLU A 1 202 ? 71.888 2.043   -6.586  1.00 17.84 ? 199 GLU A CB    1 
ATOM   1576 C  CG    . GLU A 1 202 ? 73.383 1.759   -6.395  1.00 20.46 ? 199 GLU A CG    1 
ATOM   1577 C  CD    . GLU A 1 202 ? 73.967 0.822   -7.444  1.00 22.15 ? 199 GLU A CD    1 
ATOM   1578 O  OE1   . GLU A 1 202 ? 75.197 0.601   -7.422  1.00 26.83 ? 199 GLU A OE1   1 
ATOM   1579 O  OE2   . GLU A 1 202 ? 73.211 0.301   -8.285  1.00 25.20 ? 199 GLU A OE2   1 
ATOM   1580 N  N     . MET A 1 203 ? 68.841 2.324   -5.764  1.00 10.05 ? 200 MET A N     1 
ATOM   1581 C  CA    . MET A 1 203 ? 67.471 2.774   -6.013  1.00 11.70 ? 200 MET A CA    1 
ATOM   1582 C  C     . MET A 1 203 ? 66.970 3.664   -4.886  1.00 12.51 ? 200 MET A C     1 
ATOM   1583 O  O     . MET A 1 203 ? 66.374 4.718   -5.129  1.00 11.86 ? 200 MET A O     1 
ATOM   1584 C  CB    . MET A 1 203 ? 66.512 1.588   -6.164  1.00 12.15 ? 200 MET A CB    1 
ATOM   1585 C  CG    A MET A 1 203 ? 66.779 0.683   -7.337  0.45 13.95 ? 200 MET A CG    1 
ATOM   1586 C  CG    B MET A 1 203 ? 65.185 1.954   -6.784  0.55 15.26 ? 200 MET A CG    1 
ATOM   1587 S  SD    A MET A 1 203 ? 65.640 -0.721  -7.382  0.45 19.46 ? 200 MET A SD    1 
ATOM   1588 S  SD    B MET A 1 203 ? 64.103 0.527   -6.974  0.55 19.27 ? 200 MET A SD    1 
ATOM   1589 C  CE    A MET A 1 203 ? 64.094 0.100   -7.771  0.45 7.92  ? 200 MET A CE    1 
ATOM   1590 C  CE    B MET A 1 203 ? 65.278 -0.742  -7.439  0.55 18.24 ? 200 MET A CE    1 
ATOM   1591 N  N     . ARG A 1 204 ? 67.185 3.234   -3.646  1.00 9.67  ? 201 ARG A N     1 
ATOM   1592 C  CA    . ARG A 1 204 ? 66.705 3.988   -2.497  1.00 9.90  ? 201 ARG A CA    1 
ATOM   1593 C  C     . ARG A 1 204 ? 67.450 5.323   -2.386  1.00 17.57 ? 201 ARG A C     1 
ATOM   1594 O  O     . ARG A 1 204 ? 66.875 6.322   -1.972  1.00 11.67 ? 201 ARG A O     1 
ATOM   1595 C  CB    . ARG A 1 204 ? 66.825 3.170   -1.202  1.00 11.59 ? 201 ARG A CB    1 
ATOM   1596 C  CG    . ARG A 1 204 ? 65.888 1.958   -1.189  1.00 13.85 ? 201 ARG A CG    1 
ATOM   1597 C  CD    . ARG A 1 204 ? 65.978 1.151   0.102   1.00 14.46 ? 201 ARG A CD    1 
ATOM   1598 N  NE    . ARG A 1 204 ? 65.984 2.013   1.272   1.00 13.45 ? 201 ARG A NE    1 
ATOM   1599 C  CZ    . ARG A 1 204 ? 67.002 2.113   2.114   1.00 15.35 ? 201 ARG A CZ    1 
ATOM   1600 N  NH1   . ARG A 1 204 ? 66.930 2.946   3.143   1.00 13.88 ? 201 ARG A NH1   1 
ATOM   1601 N  NH2   . ARG A 1 204 ? 68.093 1.372   1.930   1.00 14.14 ? 201 ARG A NH2   1 
ATOM   1602 N  N     . ALA A 1 205 ? 68.724 5.344   -2.768  1.00 13.96 ? 202 ALA A N     1 
ATOM   1603 C  CA    . ALA A 1 205 ? 69.475 6.602   -2.733  1.00 15.86 ? 202 ALA A CA    1 
ATOM   1604 C  C     . ALA A 1 205 ? 68.897 7.588   -3.750  1.00 11.65 ? 202 ALA A C     1 
ATOM   1605 O  O     . ALA A 1 205 ? 68.770 8.785   -3.470  1.00 12.23 ? 202 ALA A O     1 
ATOM   1606 C  CB    . ALA A 1 205 ? 70.945 6.363   -3.014  1.00 14.03 ? 202 ALA A CB    1 
ATOM   1607 N  N     . ALA A 1 206 ? 68.573 7.087   -4.938  1.00 12.46 ? 203 ALA A N     1 
ATOM   1608 C  CA    . ALA A 1 206 ? 67.979 7.924   -5.977  1.00 12.74 ? 203 ALA A CA    1 
ATOM   1609 C  C     . ALA A 1 206 ? 66.624 8.469   -5.534  1.00 11.47 ? 203 ALA A C     1 
ATOM   1610 O  O     . ALA A 1 206 ? 66.318 9.650   -5.748  1.00 11.88 ? 203 ALA A O     1 
ATOM   1611 C  CB    . ALA A 1 206 ? 67.841 7.152   -7.279  1.00 16.13 ? 203 ALA A CB    1 
ATOM   1612 N  N     . ILE A 1 207 ? 65.800 7.619   -4.925  1.00 10.16 ? 204 ILE A N     1 
ATOM   1613 C  CA    . ILE A 1 207 ? 64.506 8.097   -4.436  1.00 10.97 ? 204 ILE A CA    1 
ATOM   1614 C  C     . ILE A 1 207 ? 64.710 9.237   -3.461  1.00 15.10 ? 204 ILE A C     1 
ATOM   1615 O  O     . ILE A 1 207 ? 64.041 10.270  -3.552  1.00 10.47 ? 204 ILE A O     1 
ATOM   1616 C  CB    . ILE A 1 207 ? 63.675 6.978   -3.772  1.00 7.94  ? 204 ILE A CB    1 
ATOM   1617 C  CG1   . ILE A 1 207 ? 63.274 5.939   -4.821  1.00 9.86  ? 204 ILE A CG1   1 
ATOM   1618 C  CG2   . ILE A 1 207 ? 62.434 7.554   -3.081  1.00 9.51  ? 204 ILE A CG2   1 
ATOM   1619 C  CD1   . ILE A 1 207 ? 62.659 4.650   -4.232  1.00 12.12 ? 204 ILE A CD1   1 
ATOM   1620 N  N     . GLU A 1 208 ? 65.631 9.065   -2.518  1.00 12.59 ? 205 GLU A N     1 
ATOM   1621 C  CA    . GLU A 1 208 ? 65.822 10.104  -1.516  1.00 11.55 ? 205 GLU A CA    1 
ATOM   1622 C  C     . GLU A 1 208 ? 66.408 11.379  -2.113  1.00 12.41 ? 205 GLU A C     1 
ATOM   1623 O  O     . GLU A 1 208 ? 65.953 12.480  -1.791  1.00 12.71 ? 205 GLU A O     1 
ATOM   1624 C  CB    . GLU A 1 208 ? 66.685 9.632   -0.345  1.00 12.30 ? 205 GLU A CB    1 
ATOM   1625 C  CG    . GLU A 1 208 ? 66.591 10.588  0.846   1.00 13.41 ? 205 GLU A CG    1 
ATOM   1626 C  CD    . GLU A 1 208 ? 67.410 10.157  2.045   1.00 19.33 ? 205 GLU A CD    1 
ATOM   1627 O  OE1   . GLU A 1 208 ? 67.407 10.895  3.053   1.00 19.90 ? 205 GLU A OE1   1 
ATOM   1628 O  OE2   . GLU A 1 208 ? 68.047 9.086   1.984   1.00 20.82 ? 205 GLU A OE2   1 
ATOM   1629 N  N     . ARG A 1 209 ? 67.406 11.231  -2.985  1.00 10.94 ? 206 ARG A N     1 
ATOM   1630 C  CA    . ARG A 1 209 ? 68.016 12.395  -3.630  1.00 13.90 ? 206 ARG A CA    1 
ATOM   1631 C  C     . ARG A 1 209 ? 66.987 13.188  -4.427  1.00 17.17 ? 206 ARG A C     1 
ATOM   1632 O  O     . ARG A 1 209 ? 66.956 14.414  -4.360  1.00 14.27 ? 206 ARG A O     1 
ATOM   1633 C  CB    . ARG A 1 209 ? 69.165 12.000  -4.567  1.00 17.85 ? 206 ARG A CB    1 
ATOM   1634 C  CG    . ARG A 1 209 ? 69.878 13.233  -5.177  1.00 18.18 ? 206 ARG A CG    1 
ATOM   1635 C  CD    . ARG A 1 209 ? 70.942 12.894  -6.228  1.00 25.25 ? 206 ARG A CD    1 
ATOM   1636 N  NE    . ARG A 1 209 ? 70.388 12.593  -7.551  1.00 29.41 ? 206 ARG A NE    1 
ATOM   1637 C  CZ    . ARG A 1 209 ? 70.002 13.506  -8.442  1.00 30.10 ? 206 ARG A CZ    1 
ATOM   1638 N  NH1   . ARG A 1 209 ? 69.521 13.121  -9.620  1.00 26.38 ? 206 ARG A NH1   1 
ATOM   1639 N  NH2   . ARG A 1 209 ? 70.086 14.801  -8.162  1.00 21.37 ? 206 ARG A NH2   1 
ATOM   1640 N  N     . GLU A 1 210 ? 66.146 12.481  -5.178  1.00 10.63 ? 207 GLU A N     1 
ATOM   1641 C  CA    . GLU A 1 210 ? 65.270 13.129  -6.144  1.00 12.34 ? 207 GLU A CA    1 
ATOM   1642 C  C     . GLU A 1 210 ? 63.899 13.542  -5.602  1.00 11.68 ? 207 GLU A C     1 
ATOM   1643 O  O     . GLU A 1 210 ? 63.209 14.339  -6.232  1.00 10.60 ? 207 GLU A O     1 
ATOM   1644 C  CB    . GLU A 1 210 ? 65.122 12.257  -7.390  1.00 13.64 ? 207 GLU A CB    1 
ATOM   1645 C  CG    . GLU A 1 210 ? 66.471 11.944  -8.023  1.00 12.12 ? 207 GLU A CG    1 
ATOM   1646 C  CD    . GLU A 1 210 ? 66.376 11.094  -9.267  1.00 22.63 ? 207 GLU A CD    1 
ATOM   1647 O  OE1   . GLU A 1 210 ? 65.303 11.072  -9.906  1.00 20.57 ? 207 GLU A OE1   1 
ATOM   1648 O  OE2   . GLU A 1 210 ? 67.391 10.448  -9.609  1.00 25.52 ? 207 GLU A OE2   1 
ATOM   1649 N  N     . THR A 1 211 ? 63.500 13.020  -4.441  1.00 11.28 ? 208 THR A N     1 
ATOM   1650 C  CA    . THR A 1 211 ? 62.198 13.398  -3.889  1.00 10.19 ? 208 THR A CA    1 
ATOM   1651 C  C     . THR A 1 211 ? 62.277 13.903  -2.456  1.00 10.18 ? 208 THR A C     1 
ATOM   1652 O  O     . THR A 1 211 ? 61.351 14.549  -1.972  1.00 13.92 ? 208 THR A O     1 
ATOM   1653 C  CB    . THR A 1 211 ? 61.194 12.221  -3.901  1.00 12.90 ? 208 THR A CB    1 
ATOM   1654 O  OG1   . THR A 1 211 ? 61.637 11.218  -2.977  1.00 11.85 ? 208 THR A OG1   1 
ATOM   1655 C  CG2   . THR A 1 211 ? 61.067 11.631  -5.291  1.00 10.14 ? 208 THR A CG2   1 
ATOM   1656 N  N     . GLY A 1 212 ? 63.371 13.590  -1.772  1.00 11.25 ? 209 GLY A N     1 
ATOM   1657 C  CA    . GLY A 1 212 ? 63.462 13.857  -0.349  1.00 11.38 ? 209 GLY A CA    1 
ATOM   1658 C  C     . GLY A 1 212 ? 62.885 12.750  0.528   1.00 15.31 ? 209 GLY A C     1 
ATOM   1659 O  O     . GLY A 1 212 ? 63.033 12.797  1.750   1.00 17.02 ? 209 GLY A O     1 
ATOM   1660 N  N     . PHE A 1 213 ? 62.242 11.754  -0.081  1.00 14.51 ? 210 PHE A N     1 
ATOM   1661 C  CA    . PHE A 1 213 ? 61.566 10.697  0.684   1.00 9.07  ? 210 PHE A CA    1 
ATOM   1662 C  C     . PHE A 1 213 ? 62.479 9.507   0.991   1.00 9.07  ? 210 PHE A C     1 
ATOM   1663 O  O     . PHE A 1 213 ? 63.241 9.054   0.135   1.00 12.45 ? 210 PHE A O     1 
ATOM   1664 C  CB    . PHE A 1 213 ? 60.313 10.189  -0.038  1.00 10.17 ? 210 PHE A CB    1 
ATOM   1665 C  CG    . PHE A 1 213 ? 59.315 11.264  -0.383  1.00 10.96 ? 210 PHE A CG    1 
ATOM   1666 C  CD1   . PHE A 1 213 ? 58.612 11.203  -1.576  1.00 13.37 ? 210 PHE A CD1   1 
ATOM   1667 C  CD2   . PHE A 1 213 ? 59.072 12.316  0.483   1.00 12.66 ? 210 PHE A CD2   1 
ATOM   1668 C  CE1   . PHE A 1 213 ? 57.688 12.179  -1.908  1.00 10.56 ? 210 PHE A CE1   1 
ATOM   1669 C  CE2   . PHE A 1 213 ? 58.151 13.299  0.157   1.00 8.72  ? 210 PHE A CE2   1 
ATOM   1670 C  CZ    . PHE A 1 213 ? 57.457 13.228  -1.040  1.00 9.33  ? 210 PHE A CZ    1 
ATOM   1671 N  N     . GLN A 1 214 ? 62.379 9.007   2.224   1.00 8.04  ? 211 GLN A N     1 
ATOM   1672 C  CA    . GLN A 1 214 ? 63.085 7.805   2.664   1.00 8.87  ? 211 GLN A CA    1 
ATOM   1673 C  C     . GLN A 1 214 ? 62.161 6.599   2.623   1.00 12.37 ? 211 GLN A C     1 
ATOM   1674 O  O     . GLN A 1 214 ? 60.945 6.731   2.735   1.00 11.94 ? 211 GLN A O     1 
ATOM   1675 C  CB    . GLN A 1 214 ? 63.603 7.987   4.097   1.00 13.29 ? 211 GLN A CB    1 
ATOM   1676 C  CG    . GLN A 1 214 ? 64.757 8.981   4.208   1.00 12.65 ? 211 GLN A CG    1 
ATOM   1677 C  CD    . GLN A 1 214 ? 65.305 9.107   5.620   1.00 18.08 ? 211 GLN A CD    1 
ATOM   1678 O  OE1   . GLN A 1 214 ? 64.715 8.618   6.579   1.00 12.91 ? 211 GLN A OE1   1 
ATOM   1679 N  NE2   . GLN A 1 214 ? 66.447 9.772   5.747   1.00 24.08 ? 211 GLN A NE2   1 
ATOM   1680 N  N     . CYS A 1 215 ? 62.742 5.414   2.474   1.00 10.61 ? 212 CYS A N     1 
ATOM   1681 C  CA    . CYS A 1 215 ? 61.936 4.202   2.426   1.00 8.32  ? 212 CYS A CA    1 
ATOM   1682 C  C     . CYS A 1 215 ? 62.715 3.029   3.006   1.00 9.03  ? 212 CYS A C     1 
ATOM   1683 O  O     . CYS A 1 215 ? 63.915 3.126   3.265   1.00 13.54 ? 212 CYS A O     1 
ATOM   1684 C  CB    . CYS A 1 215 ? 61.551 3.887   0.974   1.00 9.40  ? 212 CYS A CB    1 
ATOM   1685 S  SG    . CYS A 1 215 ? 62.986 3.512   -0.069  1.00 15.08 ? 212 CYS A SG    1 
ATOM   1686 N  N     . SER A 1 216 ? 62.008 1.929   3.221   1.00 10.80 ? 213 SER A N     1 
ATOM   1687 C  CA    . SER A 1 216 ? 62.648 0.671   3.573   1.00 11.42 ? 213 SER A CA    1 
ATOM   1688 C  C     . SER A 1 216 ? 62.454 -0.292  2.412   1.00 11.58 ? 213 SER A C     1 
ATOM   1689 O  O     . SER A 1 216 ? 61.612 -0.060  1.544   1.00 12.36 ? 213 SER A O     1 
ATOM   1690 C  CB    . SER A 1 216 ? 62.034 0.115   4.856   1.00 12.73 ? 213 SER A CB    1 
ATOM   1691 O  OG    . SER A 1 216 ? 62.182 1.060   5.912   1.00 16.30 ? 213 SER A OG    1 
ATOM   1692 N  N     . ALA A 1 217 ? 63.231 -1.372  2.380   1.00 12.01 ? 214 ALA A N     1 
ATOM   1693 C  CA    . ALA A 1 217 ? 63.051 -2.374  1.335   1.00 8.51  ? 214 ALA A CA    1 
ATOM   1694 C  C     . ALA A 1 217 ? 63.382 -3.774  1.845   1.00 9.85  ? 214 ALA A C     1 
ATOM   1695 O  O     . ALA A 1 217 ? 64.164 -3.927  2.785   1.00 10.30 ? 214 ALA A O     1 
ATOM   1696 C  CB    . ALA A 1 217 ? 63.924 -2.050  0.131   1.00 12.32 ? 214 ALA A CB    1 
ATOM   1697 N  N     . GLY A 1 218 ? 62.780 -4.780  1.219   1.00 9.68  ? 215 GLY A N     1 
ATOM   1698 C  CA    . GLY A 1 218 ? 63.165 -6.160  1.453   1.00 7.58  ? 215 GLY A CA    1 
ATOM   1699 C  C     . GLY A 1 218 ? 63.699 -6.722  0.157   1.00 11.09 ? 215 GLY A C     1 
ATOM   1700 O  O     . GLY A 1 218 ? 63.174 -6.401  -0.911  1.00 10.30 ? 215 GLY A O     1 
ATOM   1701 N  N     . ILE A 1 219 ? 64.747 -7.541  0.248   1.00 9.88  ? 216 ILE A N     1 
ATOM   1702 C  CA    . ILE A 1 219 ? 65.281 -8.252  -0.914  1.00 10.51 ? 216 ILE A CA    1 
ATOM   1703 C  C     . ILE A 1 219 ? 65.288 -9.749  -0.628  1.00 13.31 ? 216 ILE A C     1 
ATOM   1704 O  O     . ILE A 1 219 ? 65.844 -10.198 0.381   1.00 11.82 ? 216 ILE A O     1 
ATOM   1705 C  CB    . ILE A 1 219 ? 66.728 -7.816  -1.252  1.00 11.57 ? 216 ILE A CB    1 
ATOM   1706 C  CG1   . ILE A 1 219 ? 66.825 -6.288  -1.410  1.00 14.24 ? 216 ILE A CG1   1 
ATOM   1707 C  CG2   . ILE A 1 219 ? 67.217 -8.526  -2.515  1.00 11.33 ? 216 ILE A CG2   1 
ATOM   1708 C  CD1   . ILE A 1 219 ? 67.139 -5.562  -0.115  1.00 14.33 ? 216 ILE A CD1   1 
ATOM   1709 N  N     . SER A 1 220 ? 64.652 -10.518 -1.502  1.00 8.12  ? 217 SER A N     1 
ATOM   1710 C  CA    . SER A 1 220 ? 64.640 -11.968 -1.343  1.00 8.05  ? 217 SER A CA    1 
ATOM   1711 C  C     . SER A 1 220 ? 64.358 -12.626 -2.684  1.00 11.68 ? 217 SER A C     1 
ATOM   1712 O  O     . SER A 1 220 ? 64.592 -12.019 -3.718  1.00 10.74 ? 217 SER A O     1 
ATOM   1713 C  CB    . SER A 1 220 ? 63.615 -12.392 -0.290  1.00 10.53 ? 217 SER A CB    1 
ATOM   1714 O  OG    . SER A 1 220 ? 63.816 -13.745 0.090   1.00 12.58 ? 217 SER A OG    1 
ATOM   1715 N  N     . HIS A 1 221 ? 63.867 -13.866 -2.673  1.00 12.82 ? 218 HIS A N     1 
ATOM   1716 C  CA    . HIS A 1 221 ? 63.672 -14.614 -3.912  1.00 10.76 ? 218 HIS A CA    1 
ATOM   1717 C  C     . HIS A 1 221 ? 62.236 -14.574 -4.446  1.00 10.67 ? 218 HIS A C     1 
ATOM   1718 O  O     . HIS A 1 221 ? 61.963 -15.090 -5.526  1.00 11.93 ? 218 HIS A O     1 
ATOM   1719 C  CB    . HIS A 1 221 ? 64.117 -16.077 -3.743  1.00 10.80 ? 218 HIS A CB    1 
ATOM   1720 C  CG    . HIS A 1 221 ? 65.602 -16.251 -3.671  1.00 12.01 ? 218 HIS A CG    1 
ATOM   1721 N  ND1   . HIS A 1 221 ? 66.440 -15.895 -4.703  1.00 11.26 ? 218 HIS A ND1   1 
ATOM   1722 C  CD2   . HIS A 1 221 ? 66.396 -16.755 -2.694  1.00 11.05 ? 218 HIS A CD2   1 
ATOM   1723 C  CE1   . HIS A 1 221 ? 67.690 -16.172 -4.367  1.00 13.26 ? 218 HIS A CE1   1 
ATOM   1724 N  NE2   . HIS A 1 221 ? 67.690 -16.688 -3.152  1.00 11.58 ? 218 HIS A NE2   1 
ATOM   1725 N  N     . ASN A 1 222 ? 61.331 -13.955 -3.701  1.00 7.86  ? 219 ASN A N     1 
ATOM   1726 C  CA    . ASN A 1 222 ? 59.929 -13.868 -4.109  1.00 5.04  ? 219 ASN A CA    1 
ATOM   1727 C  C     . ASN A 1 222 ? 59.226 -12.709 -3.396  1.00 9.02  ? 219 ASN A C     1 
ATOM   1728 O  O     . ASN A 1 222 ? 59.797 -12.078 -2.497  1.00 11.92 ? 219 ASN A O     1 
ATOM   1729 C  CB    . ASN A 1 222 ? 59.182 -15.196 -3.865  1.00 8.77  ? 219 ASN A CB    1 
ATOM   1730 C  CG    . ASN A 1 222 ? 59.285 -15.674 -2.423  1.00 12.94 ? 219 ASN A CG    1 
ATOM   1731 O  OD1   . ASN A 1 222 ? 58.800 -15.007 -1.508  1.00 11.57 ? 219 ASN A OD1   1 
ATOM   1732 N  ND2   . ASN A 1 222 ? 59.903 -16.851 -2.216  1.00 10.92 ? 219 ASN A ND2   1 
ATOM   1733 N  N     . LYS A 1 223 ? 57.993 -12.426 -3.802  1.00 10.63 ? 220 LYS A N     1 
ATOM   1734 C  CA    . LYS A 1 223 ? 57.283 -11.265 -3.268  1.00 10.60 ? 220 LYS A CA    1 
ATOM   1735 C  C     . LYS A 1 223 ? 56.958 -11.386 -1.787  1.00 12.57 ? 220 LYS A C     1 
ATOM   1736 O  O     . LYS A 1 223 ? 57.099 -10.426 -1.037  1.00 11.99 ? 220 LYS A O     1 
ATOM   1737 C  CB    . LYS A 1 223 ? 56.013 -10.972 -4.082  1.00 10.65 ? 220 LYS A CB    1 
ATOM   1738 C  CG    . LYS A 1 223 ? 56.303 -10.573 -5.519  1.00 11.64 ? 220 LYS A CG    1 
ATOM   1739 C  CD    . LYS A 1 223 ? 55.151 -9.778  -6.150  1.00 27.78 ? 220 LYS A CD    1 
ATOM   1740 C  CE    . LYS A 1 223 ? 53.892 -10.592 -6.278  1.00 28.79 ? 220 LYS A CE    1 
ATOM   1741 N  NZ    . LYS A 1 223 ? 52.831 -9.874  -7.070  1.00 18.60 ? 220 LYS A NZ    1 
ATOM   1742 N  N     . VAL A 1 224 ? 56.524 -12.565 -1.361  1.00 9.32  ? 221 VAL A N     1 
ATOM   1743 C  CA    . VAL A 1 224 ? 56.118 -12.735 0.034   1.00 11.82 ? 221 VAL A CA    1 
ATOM   1744 C  C     . VAL A 1 224 ? 57.295 -12.545 0.991   1.00 12.26 ? 221 VAL A C     1 
ATOM   1745 O  O     . VAL A 1 224 ? 57.180 -11.854 2.007   1.00 11.92 ? 221 VAL A O     1 
ATOM   1746 C  CB    . VAL A 1 224 ? 55.431 -14.092 0.268   1.00 12.75 ? 221 VAL A CB    1 
ATOM   1747 C  CG1   . VAL A 1 224 ? 55.300 -14.376 1.755   1.00 16.02 ? 221 VAL A CG1   1 
ATOM   1748 C  CG2   . VAL A 1 224 ? 54.066 -14.076 -0.383  1.00 16.21 ? 221 VAL A CG2   1 
ATOM   1749 N  N     . LEU A 1 225 ? 58.431 -13.145 0.659   1.00 9.86  ? 222 LEU A N     1 
ATOM   1750 C  CA    . LEU A 1 225 ? 59.628 -12.983 1.479   1.00 10.04 ? 222 LEU A CA    1 
ATOM   1751 C  C     . LEU A 1 225 ? 60.179 -11.559 1.412   1.00 9.83  ? 222 LEU A C     1 
ATOM   1752 O  O     . LEU A 1 225 ? 60.718 -11.050 2.384   1.00 9.50  ? 222 LEU A O     1 
ATOM   1753 C  CB    . LEU A 1 225 ? 60.716 -13.974 1.066   1.00 8.44  ? 222 LEU A CB    1 
ATOM   1754 C  CG    . LEU A 1 225 ? 60.419 -15.437 1.426   1.00 10.10 ? 222 LEU A CG    1 
ATOM   1755 C  CD1   . LEU A 1 225 ? 61.610 -16.342 1.029   1.00 8.45  ? 222 LEU A CD1   1 
ATOM   1756 C  CD2   . LEU A 1 225 ? 60.123 -15.555 2.910   1.00 14.49 ? 222 LEU A CD2   1 
ATOM   1757 N  N     . ALA A 1 226 ? 60.053 -10.913 0.259   1.00 10.57 ? 223 ALA A N     1 
ATOM   1758 C  CA    . ALA A 1 226 ? 60.560 -9.552  0.138   1.00 11.32 ? 223 ALA A CA    1 
ATOM   1759 C  C     . ALA A 1 226 ? 59.738 -8.598  1.006   1.00 9.41  ? 223 ALA A C     1 
ATOM   1760 O  O     . ALA A 1 226 ? 60.284 -7.707  1.669   1.00 9.63  ? 223 ALA A O     1 
ATOM   1761 C  CB    . ALA A 1 226 ? 60.549 -9.112  -1.316  1.00 11.49 ? 223 ALA A CB    1 
ATOM   1762 N  N     . LYS A 1 227 ? 58.423 -8.806  1.011   1.00 8.59  ? 224 LYS A N     1 
ATOM   1763 C  CA    . LYS A 1 227 ? 57.520 -8.016  1.840   1.00 10.52 ? 224 LYS A CA    1 
ATOM   1764 C  C     . LYS A 1 227 ? 57.812 -8.261  3.317   1.00 13.50 ? 224 LYS A C     1 
ATOM   1765 O  O     . LYS A 1 227 ? 57.912 -7.316  4.099   1.00 11.92 ? 224 LYS A O     1 
ATOM   1766 C  CB    . LYS A 1 227 ? 56.057 -8.369  1.516   1.00 9.18  ? 224 LYS A CB    1 
ATOM   1767 C  CG    A LYS A 1 227 ? 55.030 -7.708  2.434   0.55 17.66 ? 224 LYS A CG    1 
ATOM   1768 C  CG    B LYS A 1 227 ? 55.045 -7.775  2.487   0.45 17.66 ? 224 LYS A CG    1 
ATOM   1769 C  CD    A LYS A 1 227 ? 55.157 -6.191  2.426   0.55 21.69 ? 224 LYS A CD    1 
ATOM   1770 C  CD    B LYS A 1 227 ? 55.136 -6.259  2.533   0.45 21.81 ? 224 LYS A CD    1 
ATOM   1771 C  CE    A LYS A 1 227 ? 54.124 -5.549  3.354   0.55 24.02 ? 224 LYS A CE    1 
ATOM   1772 C  CE    B LYS A 1 227 ? 54.129 -5.686  3.524   0.45 23.60 ? 224 LYS A CE    1 
ATOM   1773 N  NZ    A LYS A 1 227 ? 54.344 -4.084  3.512   0.55 24.65 ? 224 LYS A NZ    1 
ATOM   1774 N  NZ    B LYS A 1 227 ? 52.748 -6.136  3.206   0.45 21.86 ? 224 LYS A NZ    1 
ATOM   1775 N  N     . LEU A 1 228 ? 57.951 -9.533  3.693   1.00 9.81  ? 225 LEU A N     1 
ATOM   1776 C  CA    . LEU A 1 228 ? 58.262 -9.869  5.074   1.00 9.42  ? 225 LEU A CA    1 
ATOM   1777 C  C     . LEU A 1 228 ? 59.587 -9.228  5.469   1.00 13.52 ? 225 LEU A C     1 
ATOM   1778 O  O     . LEU A 1 228 ? 59.701 -8.576  6.520   1.00 13.48 ? 225 LEU A O     1 
ATOM   1779 C  CB    . LEU A 1 228 ? 58.327 -11.386 5.261   1.00 12.66 ? 225 LEU A CB    1 
ATOM   1780 C  CG    . LEU A 1 228 ? 58.465 -11.841 6.716   1.00 18.98 ? 225 LEU A CG    1 
ATOM   1781 C  CD1   . LEU A 1 228 ? 57.256 -11.386 7.506   1.00 19.00 ? 225 LEU A CD1   1 
ATOM   1782 C  CD2   . LEU A 1 228 ? 58.631 -13.353 6.814   1.00 16.15 ? 225 LEU A CD2   1 
ATOM   1783 N  N     . ALA A 1 229 ? 60.588 -9.400  4.615   1.00 10.15 ? 226 ALA A N     1 
ATOM   1784 C  CA    . ALA A 1 229 ? 61.908 -8.826  4.866   1.00 10.65 ? 226 ALA A CA    1 
ATOM   1785 C  C     . ALA A 1 229 ? 61.836 -7.318  5.090   1.00 14.35 ? 226 ALA A C     1 
ATOM   1786 O  O     . ALA A 1 229 ? 62.458 -6.776  6.012   1.00 12.12 ? 226 ALA A O     1 
ATOM   1787 C  CB    . ALA A 1 229 ? 62.864 -9.149  3.705   1.00 10.39 ? 226 ALA A CB    1 
ATOM   1788 N  N     . CYS A 1 230 ? 61.067 -6.635  4.252   1.00 8.60  ? 227 CYS A N     1 
ATOM   1789 C  CA    . CYS A 1 230 ? 61.029 -5.172  4.305   1.00 8.80  ? 227 CYS A CA    1 
ATOM   1790 C  C     . CYS A 1 230 ? 60.641 -4.659  5.695   1.00 12.20 ? 227 CYS A C     1 
ATOM   1791 O  O     . CYS A 1 230 ? 61.186 -3.667  6.172   1.00 18.49 ? 227 CYS A O     1 
ATOM   1792 C  CB    . CYS A 1 230 ? 60.059 -4.643  3.244   1.00 10.16 ? 227 CYS A CB    1 
ATOM   1793 S  SG    . CYS A 1 230 ? 59.947 -2.843  3.147   1.00 13.18 ? 227 CYS A SG    1 
ATOM   1794 N  N     . GLY A 1 231 ? 59.709 -5.344  6.348   1.00 12.56 ? 228 GLY A N     1 
ATOM   1795 C  CA    . GLY A 1 231 ? 59.218 -4.896  7.642   1.00 10.66 ? 228 GLY A CA    1 
ATOM   1796 C  C     . GLY A 1 231 ? 60.156 -5.204  8.805   1.00 17.19 ? 228 GLY A C     1 
ATOM   1797 O  O     . GLY A 1 231 ? 59.923 -4.777  9.938   1.00 17.88 ? 228 GLY A O     1 
ATOM   1798 N  N     . LEU A 1 232 ? 61.223 -5.946  8.545   1.00 14.93 ? 229 LEU A N     1 
ATOM   1799 C  CA    . LEU A 1 232 ? 62.064 -6.404  9.649   1.00 12.56 ? 229 LEU A CA    1 
ATOM   1800 C  C     . LEU A 1 232 ? 62.927 -5.279  10.227  1.00 16.77 ? 229 LEU A C     1 
ATOM   1801 O  O     . LEU A 1 232 ? 63.218 -5.259  11.428  1.00 14.45 ? 229 LEU A O     1 
ATOM   1802 C  CB    . LEU A 1 232 ? 62.907 -7.610  9.238   1.00 12.15 ? 229 LEU A CB    1 
ATOM   1803 C  CG    . LEU A 1 232 ? 62.133 -8.883  8.882   1.00 15.70 ? 229 LEU A CG    1 
ATOM   1804 C  CD1   . LEU A 1 232 ? 63.105 -9.998  8.526   1.00 15.51 ? 229 LEU A CD1   1 
ATOM   1805 C  CD2   . LEU A 1 232 ? 61.226 -9.302  10.027  1.00 20.62 ? 229 LEU A CD2   1 
ATOM   1806 N  N     . ASN A 1 233 ? 63.313 -4.325  9.384   1.00 11.36 ? 230 ASN A N     1 
ATOM   1807 C  CA    . ASN A 1 233 ? 64.123 -3.204  9.842   1.00 14.74 ? 230 ASN A CA    1 
ATOM   1808 C  C     . ASN A 1 233 ? 63.663 -1.878  9.236   1.00 18.94 ? 230 ASN A C     1 
ATOM   1809 O  O     . ASN A 1 233 ? 64.246 -1.394  8.273   1.00 34.01 ? 230 ASN A O     1 
ATOM   1810 C  CB    . ASN A 1 233 ? 65.604 -3.430  9.524   1.00 13.54 ? 230 ASN A CB    1 
ATOM   1811 C  CG    . ASN A 1 233 ? 66.178 -4.651  10.238  1.00 16.56 ? 230 ASN A CG    1 
ATOM   1812 O  OD1   . ASN A 1 233 ? 66.489 -4.593  11.428  1.00 15.82 ? 230 ASN A OD1   1 
ATOM   1813 N  ND2   . ASN A 1 233 ? 66.345 -5.752  9.504   1.00 12.82 ? 230 ASN A ND2   1 
ATOM   1814 N  N     . LYS A 1 234 ? 62.592 -1.329  9.791   1.00 30.48 ? 231 LYS A N     1 
ATOM   1815 C  CA    . LYS A 1 234 ? 62.097 -0.011  9.413   1.00 17.75 ? 231 LYS A CA    1 
ATOM   1816 C  C     . LYS A 1 234 ? 62.414 0.942   10.556  1.00 27.01 ? 231 LYS A C     1 
ATOM   1817 O  O     . LYS A 1 234 ? 62.500 0.517   11.709  1.00 33.93 ? 231 LYS A O     1 
ATOM   1818 C  CB    . LYS A 1 234 ? 60.577 -0.054  9.189   1.00 25.21 ? 231 LYS A CB    1 
ATOM   1819 C  CG    . LYS A 1 234 ? 60.123 -0.429  7.783   1.00 22.39 ? 231 LYS A CG    1 
ATOM   1820 C  CD    . LYS A 1 234 ? 58.682 0.093   7.526   1.00 28.11 ? 231 LYS A CD    1 
ATOM   1821 C  CE    . LYS A 1 234 ? 58.317 0.165   6.032   1.00 34.83 ? 231 LYS A CE    1 
ATOM   1822 N  NZ    . LYS A 1 234 ? 58.346 1.563   5.439   1.00 13.36 ? 231 LYS A NZ    1 
ATOM   1823 N  N     . PRO A 1 235 ? 62.585 2.237   10.252  1.00 17.31 ? 232 PRO A N     1 
ATOM   1824 C  CA    . PRO A 1 235 ? 62.529 2.836   8.916   1.00 16.49 ? 232 PRO A CA    1 
ATOM   1825 C  C     . PRO A 1 235 ? 63.910 3.034   8.299   1.00 14.06 ? 232 PRO A C     1 
ATOM   1826 O  O     . PRO A 1 235 ? 64.922 2.830   8.967   1.00 15.68 ? 232 PRO A O     1 
ATOM   1827 C  CB    . PRO A 1 235 ? 61.925 4.211   9.202   1.00 16.53 ? 232 PRO A CB    1 
ATOM   1828 C  CG    . PRO A 1 235 ? 62.500 4.566   10.538  1.00 27.10 ? 232 PRO A CG    1 
ATOM   1829 C  CD    . PRO A 1 235 ? 62.611 3.269   11.306  1.00 19.86 ? 232 PRO A CD    1 
ATOM   1830 N  N     . ASN A 1 236 ? 63.935 3.435   7.031   1.00 14.21 ? 233 ASN A N     1 
ATOM   1831 C  CA    . ASN A 1 236 ? 65.171 3.860   6.376   1.00 13.58 ? 233 ASN A CA    1 
ATOM   1832 C  C     . ASN A 1 236 ? 66.266 2.796   6.366   1.00 9.92  ? 233 ASN A C     1 
ATOM   1833 O  O     . ASN A 1 236 ? 67.446 3.121   6.428   1.00 13.00 ? 233 ASN A O     1 
ATOM   1834 C  CB    . ASN A 1 236 ? 65.694 5.159   7.011   1.00 13.53 ? 233 ASN A CB    1 
ATOM   1835 C  CG    . ASN A 1 236 ? 66.726 5.860   6.141   1.00 16.67 ? 233 ASN A CG    1 
ATOM   1836 O  OD1   . ASN A 1 236 ? 66.657 5.802   4.918   1.00 18.80 ? 233 ASN A OD1   1 
ATOM   1837 N  ND2   . ASN A 1 236 ? 67.694 6.517   6.774   1.00 21.45 ? 233 ASN A ND2   1 
ATOM   1838 N  N     . ARG A 1 237 ? 65.870 1.527   6.275   1.00 9.05  ? 234 ARG A N     1 
ATOM   1839 C  CA    . ARG A 1 237 ? 66.831 0.420   6.176   1.00 12.26 ? 234 ARG A CA    1 
ATOM   1840 C  C     . ARG A 1 237 ? 66.309 -0.632  5.207   1.00 10.28 ? 234 ARG A C     1 
ATOM   1841 O  O     . ARG A 1 237 ? 65.133 -0.634  4.854   1.00 12.78 ? 234 ARG A O     1 
ATOM   1842 C  CB    . ARG A 1 237 ? 67.062 -0.245  7.540   1.00 15.25 ? 234 ARG A CB    1 
ATOM   1843 C  CG    . ARG A 1 237 ? 67.693 0.644   8.592   1.00 13.95 ? 234 ARG A CG    1 
ATOM   1844 C  CD    . ARG A 1 237 ? 69.141 0.936   8.261   1.00 19.84 ? 234 ARG A CD    1 
ATOM   1845 N  NE    . ARG A 1 237 ? 69.804 1.690   9.324   1.00 22.61 ? 234 ARG A NE    1 
ATOM   1846 C  CZ    . ARG A 1 237 ? 69.955 3.013   9.319   1.00 33.42 ? 234 ARG A CZ    1 
ATOM   1847 N  NH1   . ARG A 1 237 ? 69.495 3.733   8.308   1.00 25.35 ? 234 ARG A NH1   1 
ATOM   1848 N  NH2   . ARG A 1 237 ? 70.574 3.618   10.323  1.00 28.53 ? 234 ARG A NH2   1 
ATOM   1849 N  N     . GLN A 1 238 ? 67.183 -1.532  4.771   1.00 9.76  ? 235 GLN A N     1 
ATOM   1850 C  CA    . GLN A 1 238 ? 66.740 -2.615  3.911   1.00 11.42 ? 235 GLN A CA    1 
ATOM   1851 C  C     . GLN A 1 238 ? 67.273 -3.941  4.424   1.00 8.78  ? 235 GLN A C     1 
ATOM   1852 O  O     . GLN A 1 238 ? 68.314 -3.993  5.073   1.00 13.70 ? 235 GLN A O     1 
ATOM   1853 C  CB    . GLN A 1 238 ? 67.164 -2.383  2.465   1.00 7.38  ? 235 GLN A CB    1 
ATOM   1854 C  CG    . GLN A 1 238 ? 68.658 -2.203  2.266   1.00 14.00 ? 235 GLN A CG    1 
ATOM   1855 C  CD    . GLN A 1 238 ? 69.015 -1.949  0.816   1.00 14.22 ? 235 GLN A CD    1 
ATOM   1856 O  OE1   . GLN A 1 238 ? 68.610 -0.939  0.226   1.00 14.67 ? 235 GLN A OE1   1 
ATOM   1857 N  NE2   . GLN A 1 238 ? 69.776 -2.863  0.230   1.00 9.77  ? 235 GLN A NE2   1 
ATOM   1858 N  N     . THR A 1 239 ? 66.541 -5.012  4.133   1.00 10.91 ? 236 THR A N     1 
ATOM   1859 C  CA    . THR A 1 239 ? 66.822 -6.309  4.732   1.00 12.16 ? 236 THR A CA    1 
ATOM   1860 C  C     . THR A 1 239 ? 66.853 -7.386  3.662   1.00 10.84 ? 236 THR A C     1 
ATOM   1861 O  O     . THR A 1 239 ? 65.943 -7.483  2.847   1.00 12.04 ? 236 THR A O     1 
ATOM   1862 C  CB    . THR A 1 239 ? 65.753 -6.673  5.779   1.00 11.34 ? 236 THR A CB    1 
ATOM   1863 O  OG1   . THR A 1 239 ? 65.720 -5.673  6.798   1.00 11.76 ? 236 THR A OG1   1 
ATOM   1864 C  CG2   . THR A 1 239 ? 66.063 -8.023  6.434   1.00 14.86 ? 236 THR A CG2   1 
ATOM   1865 N  N     . LEU A 1 240 ? 67.903 -8.199  3.687   1.00 11.18 ? 237 LEU A N     1 
ATOM   1866 C  CA    . LEU A 1 240 ? 68.058 -9.306  2.756   1.00 9.84  ? 237 LEU A CA    1 
ATOM   1867 C  C     . LEU A 1 240 ? 67.677 -10.577 3.503   1.00 13.15 ? 237 LEU A C     1 
ATOM   1868 O  O     . LEU A 1 240 ? 68.226 -10.865 4.565   1.00 10.03 ? 237 LEU A O     1 
ATOM   1869 C  CB    . LEU A 1 240 ? 69.514 -9.369  2.261   1.00 10.48 ? 237 LEU A CB    1 
ATOM   1870 C  CG    . LEU A 1 240 ? 69.927 -10.430 1.233   1.00 11.84 ? 237 LEU A CG    1 
ATOM   1871 C  CD1   . LEU A 1 240 ? 71.276 -10.097 0.588   1.00 13.93 ? 237 LEU A CD1   1 
ATOM   1872 C  CD2   . LEU A 1 240 ? 70.001 -11.813 1.857   1.00 12.31 ? 237 LEU A CD2   1 
ATOM   1873 N  N     . VAL A 1 241 ? 66.707 -11.308 2.971   1.00 8.58  ? 238 VAL A N     1 
ATOM   1874 C  CA    . VAL A 1 241 ? 66.304 -12.584 3.550   1.00 10.79 ? 238 VAL A CA    1 
ATOM   1875 C  C     . VAL A 1 241 ? 66.686 -13.679 2.579   1.00 11.90 ? 238 VAL A C     1 
ATOM   1876 O  O     . VAL A 1 241 ? 66.073 -13.821 1.524   1.00 11.88 ? 238 VAL A O     1 
ATOM   1877 C  CB    . VAL A 1 241 ? 64.789 -12.622 3.821   1.00 11.80 ? 238 VAL A CB    1 
ATOM   1878 C  CG1   . VAL A 1 241 ? 64.286 -14.075 3.975   1.00 13.79 ? 238 VAL A CG1   1 
ATOM   1879 C  CG2   . VAL A 1 241 ? 64.448 -11.797 5.060   1.00 9.29  ? 238 VAL A CG2   1 
ATOM   1880 N  N     . SER A 1 242 ? 67.716 -14.444 2.924   1.00 10.88 ? 239 SER A N     1 
ATOM   1881 C  CA    . SER A 1 242 ? 68.183 -15.500 2.041   1.00 11.40 ? 239 SER A CA    1 
ATOM   1882 C  C     . SER A 1 242 ? 67.318 -16.752 2.200   1.00 7.27  ? 239 SER A C     1 
ATOM   1883 O  O     . SER A 1 242 ? 66.570 -16.890 3.166   1.00 12.85 ? 239 SER A O     1 
ATOM   1884 C  CB    . SER A 1 242 ? 69.639 -15.842 2.360   1.00 16.98 ? 239 SER A CB    1 
ATOM   1885 O  OG    . SER A 1 242 ? 69.734 -16.351 3.678   1.00 13.68 ? 239 SER A OG    1 
ATOM   1886 N  N     . HIS A 1 243 ? 67.432 -17.670 1.251   1.00 9.57  ? 240 HIS A N     1 
ATOM   1887 C  CA    . HIS A 1 243 ? 66.684 -18.916 1.347   1.00 11.86 ? 240 HIS A CA    1 
ATOM   1888 C  C     . HIS A 1 243 ? 67.079 -19.659 2.623   1.00 11.79 ? 240 HIS A C     1 
ATOM   1889 O  O     . HIS A 1 243 ? 66.233 -20.236 3.309   1.00 11.70 ? 240 HIS A O     1 
ATOM   1890 C  CB    . HIS A 1 243 ? 66.958 -19.806 0.137   1.00 14.31 ? 240 HIS A CB    1 
ATOM   1891 C  CG    . HIS A 1 243 ? 66.214 -21.107 0.173   1.00 16.47 ? 240 HIS A CG    1 
ATOM   1892 N  ND1   . HIS A 1 243 ? 64.857 -21.191 -0.054  1.00 17.67 ? 240 HIS A ND1   1 
ATOM   1893 C  CD2   . HIS A 1 243 ? 66.632 -22.371 0.422   1.00 19.95 ? 240 HIS A CD2   1 
ATOM   1894 C  CE1   . HIS A 1 243 ? 64.472 -22.451 0.047   1.00 21.37 ? 240 HIS A CE1   1 
ATOM   1895 N  NE2   . HIS A 1 243 ? 65.530 -23.188 0.334   1.00 18.93 ? 240 HIS A NE2   1 
ATOM   1896 N  N     . GLY A 1 244 ? 68.373 -19.629 2.932   1.00 11.65 ? 241 GLY A N     1 
ATOM   1897 C  CA    . GLY A 1 244 ? 68.901 -20.335 4.086   1.00 14.87 ? 241 GLY A CA    1 
ATOM   1898 C  C     . GLY A 1 244 ? 68.390 -19.793 5.405   1.00 12.13 ? 241 GLY A C     1 
ATOM   1899 O  O     . GLY A 1 244 ? 68.334 -20.515 6.398   1.00 13.77 ? 241 GLY A O     1 
ATOM   1900 N  N     . SER A 1 245 ? 68.004 -18.520 5.415   1.00 8.22  ? 242 SER A N     1 
ATOM   1901 C  CA    . SER A 1 245 ? 67.528 -17.877 6.637   1.00 10.67 ? 242 SER A CA    1 
ATOM   1902 C  C     . SER A 1 245 ? 66.101 -18.289 6.982   1.00 11.00 ? 242 SER A C     1 
ATOM   1903 O  O     . SER A 1 245 ? 65.625 -18.027 8.090   1.00 10.93 ? 242 SER A O     1 
ATOM   1904 C  CB    . SER A 1 245 ? 67.580 -16.351 6.501   1.00 12.10 ? 242 SER A CB    1 
ATOM   1905 O  OG    . SER A 1 245 ? 66.481 -15.902 5.733   1.00 11.31 ? 242 SER A OG    1 
ATOM   1906 N  N     . VAL A 1 246 ? 65.416 -18.934 6.044   1.00 10.34 ? 243 VAL A N     1 
ATOM   1907 C  CA    . VAL A 1 246 ? 63.988 -19.214 6.228   1.00 8.70  ? 243 VAL A CA    1 
ATOM   1908 C  C     . VAL A 1 246 ? 63.612 -20.142 7.411   1.00 12.16 ? 243 VAL A C     1 
ATOM   1909 O  O     . VAL A 1 246 ? 62.739 -19.804 8.211   1.00 9.93  ? 243 VAL A O     1 
ATOM   1910 C  CB    . VAL A 1 246 ? 63.326 -19.673 4.912   1.00 9.10  ? 243 VAL A CB    1 
ATOM   1911 C  CG1   . VAL A 1 246 ? 61.876 -20.097 5.159   1.00 9.53  ? 243 VAL A CG1   1 
ATOM   1912 C  CG2   . VAL A 1 246 ? 63.383 -18.535 3.896   1.00 12.00 ? 243 VAL A CG2   1 
ATOM   1913 N  N     . PRO A 1 247 ? 64.279 -21.299 7.551   1.00 10.21 ? 244 PRO A N     1 
ATOM   1914 C  CA    . PRO A 1 247 ? 63.867 -22.158 8.670   1.00 7.81  ? 244 PRO A CA    1 
ATOM   1915 C  C     . PRO A 1 247 ? 63.917 -21.463 10.034  1.00 9.03  ? 244 PRO A C     1 
ATOM   1916 O  O     . PRO A 1 247 ? 62.966 -21.579 10.805  1.00 12.91 ? 244 PRO A O     1 
ATOM   1917 C  CB    . PRO A 1 247 ? 64.868 -23.329 8.601   1.00 10.47 ? 244 PRO A CB    1 
ATOM   1918 C  CG    . PRO A 1 247 ? 65.192 -23.418 7.126   1.00 11.32 ? 244 PRO A CG    1 
ATOM   1919 C  CD    . PRO A 1 247 ? 65.285 -21.958 6.695   1.00 11.05 ? 244 PRO A CD    1 
ATOM   1920 N  N     . GLN A 1 248 ? 64.982 -20.735 10.335  1.00 12.72 ? 245 GLN A N     1 
ATOM   1921 C  CA    . GLN A 1 248 ? 65.043 -20.067 11.636  1.00 10.55 ? 245 GLN A CA    1 
ATOM   1922 C  C     . GLN A 1 248 ? 64.025 -18.925 11.720  1.00 11.87 ? 245 GLN A C     1 
ATOM   1923 O  O     . GLN A 1 248 ? 63.310 -18.785 12.718  1.00 12.89 ? 245 GLN A O     1 
ATOM   1924 C  CB    . GLN A 1 248 ? 66.458 -19.566 11.936  1.00 11.46 ? 245 GLN A CB    1 
ATOM   1925 C  CG    . GLN A 1 248 ? 67.454 -20.699 12.192  1.00 18.40 ? 245 GLN A CG    1 
ATOM   1926 C  CD    . GLN A 1 248 ? 68.487 -20.356 13.250  1.00 31.26 ? 245 GLN A CD    1 
ATOM   1927 O  OE1   . GLN A 1 248 ? 68.164 -20.259 14.436  1.00 34.81 ? 245 GLN A OE1   1 
ATOM   1928 N  NE2   . GLN A 1 248 ? 69.740 -20.179 12.827  1.00 28.09 ? 245 GLN A NE2   1 
ATOM   1929 N  N     . LEU A 1 249 ? 63.952 -18.124 10.663  1.00 10.23 ? 246 LEU A N     1 
ATOM   1930 C  CA    . LEU A 1 249 ? 63.017 -16.994 10.621  1.00 11.29 ? 246 LEU A CA    1 
ATOM   1931 C  C     . LEU A 1 249 ? 61.572 -17.454 10.829  1.00 9.80  ? 246 LEU A C     1 
ATOM   1932 O  O     . LEU A 1 249 ? 60.798 -16.822 11.557  1.00 10.86 ? 246 LEU A O     1 
ATOM   1933 C  CB    . LEU A 1 249 ? 63.143 -16.255 9.281   1.00 13.99 ? 246 LEU A CB    1 
ATOM   1934 C  CG    . LEU A 1 249 ? 62.256 -15.018 9.093   1.00 12.02 ? 246 LEU A CG    1 
ATOM   1935 C  CD1   . LEU A 1 249 ? 62.560 -13.985 10.172  1.00 12.88 ? 246 LEU A CD1   1 
ATOM   1936 C  CD2   . LEU A 1 249 ? 62.432 -14.414 7.691   1.00 11.24 ? 246 LEU A CD2   1 
ATOM   1937 N  N     . PHE A 1 250 ? 61.205 -18.558 10.190  1.00 10.63 ? 247 PHE A N     1 
ATOM   1938 C  CA    . PHE A 1 250 ? 59.826 -19.014 10.251  1.00 9.92  ? 247 PHE A CA    1 
ATOM   1939 C  C     . PHE A 1 250 ? 59.519 -19.757 11.545  1.00 11.25 ? 247 PHE A C     1 
ATOM   1940 O  O     . PHE A 1 250 ? 58.356 -19.947 11.882  1.00 11.69 ? 247 PHE A O     1 
ATOM   1941 C  CB    . PHE A 1 250 ? 59.482 -19.896 9.041   1.00 10.73 ? 247 PHE A CB    1 
ATOM   1942 C  CG    . PHE A 1 250 ? 59.112 -19.125 7.792   1.00 9.69  ? 247 PHE A CG    1 
ATOM   1943 C  CD1   . PHE A 1 250 ? 58.599 -19.792 6.683   1.00 10.26 ? 247 PHE A CD1   1 
ATOM   1944 C  CD2   . PHE A 1 250 ? 59.267 -17.744 7.725   1.00 13.02 ? 247 PHE A CD2   1 
ATOM   1945 C  CE1   . PHE A 1 250 ? 58.240 -19.103 5.528   1.00 8.58  ? 247 PHE A CE1   1 
ATOM   1946 C  CE2   . PHE A 1 250 ? 58.919 -17.046 6.572   1.00 13.90 ? 247 PHE A CE2   1 
ATOM   1947 C  CZ    . PHE A 1 250 ? 58.397 -17.725 5.475   1.00 12.39 ? 247 PHE A CZ    1 
ATOM   1948 N  N     . SER A 1 251 ? 60.558 -20.172 12.270  1.00 11.77 ? 248 SER A N     1 
ATOM   1949 C  CA    . SER A 1 251 ? 60.361 -21.055 13.420  1.00 11.95 ? 248 SER A CA    1 
ATOM   1950 C  C     . SER A 1 251 ? 59.596 -20.361 14.544  1.00 11.15 ? 248 SER A C     1 
ATOM   1951 O  O     . SER A 1 251 ? 58.929 -21.014 15.343  1.00 11.21 ? 248 SER A O     1 
ATOM   1952 C  CB    . SER A 1 251 ? 61.700 -21.595 13.942  1.00 8.65  ? 248 SER A CB    1 
ATOM   1953 O  OG    . SER A 1 251 ? 62.469 -20.578 14.556  1.00 11.74 ? 248 SER A OG    1 
ATOM   1954 N  N     . GLN A 1 252 ? 59.687 -19.035 14.599  1.00 12.45 ? 249 GLN A N     1 
ATOM   1955 C  CA    . GLN A 1 252 ? 58.944 -18.281 15.596  1.00 10.79 ? 249 GLN A CA    1 
ATOM   1956 C  C     . GLN A 1 252 ? 58.115 -17.159 14.964  1.00 16.27 ? 249 GLN A C     1 
ATOM   1957 O  O     . GLN A 1 252 ? 57.807 -16.175 15.628  1.00 15.74 ? 249 GLN A O     1 
ATOM   1958 C  CB    . GLN A 1 252 ? 59.893 -17.662 16.622  1.00 15.84 ? 249 GLN A CB    1 
ATOM   1959 C  CG    . GLN A 1 252 ? 60.781 -18.636 17.364  1.00 18.57 ? 249 GLN A CG    1 
ATOM   1960 C  CD    . GLN A 1 252 ? 61.606 -17.922 18.421  1.00 26.16 ? 249 GLN A CD    1 
ATOM   1961 O  OE1   . GLN A 1 252 ? 61.206 -17.833 19.582  1.00 28.41 ? 249 GLN A OE1   1 
ATOM   1962 N  NE2   . GLN A 1 252 ? 62.747 -17.375 18.012  1.00 21.70 ? 249 GLN A NE2   1 
ATOM   1963 N  N     . MET A 1 253 ? 57.764 -17.303 13.689  1.00 11.07 ? 250 MET A N     1 
ATOM   1964 C  CA    . MET A 1 253 ? 57.037 -16.257 12.967  1.00 13.71 ? 250 MET A CA    1 
ATOM   1965 C  C     . MET A 1 253 ? 55.541 -16.526 13.026  1.00 11.42 ? 250 MET A C     1 
ATOM   1966 O  O     . MET A 1 253 ? 55.073 -17.521 12.480  1.00 11.07 ? 250 MET A O     1 
ATOM   1967 C  CB    . MET A 1 253 ? 57.497 -16.205 11.498  1.00 9.92  ? 250 MET A CB    1 
ATOM   1968 C  CG    . MET A 1 253 ? 56.849 -15.084 10.660  1.00 13.01 ? 250 MET A CG    1 
ATOM   1969 S  SD    . MET A 1 253 ? 57.237 -13.425 11.242  1.00 19.97 ? 250 MET A SD    1 
ATOM   1970 C  CE    . MET A 1 253 ? 59.012 -13.321 10.959  1.00 12.51 ? 250 MET A CE    1 
ATOM   1971 N  N     . PRO A 1 254 ? 54.778 -15.646 13.692  1.00 11.44 ? 251 PRO A N     1 
ATOM   1972 C  CA    . PRO A 1 254 ? 53.338 -15.907 13.701  1.00 12.76 ? 251 PRO A CA    1 
ATOM   1973 C  C     . PRO A 1 254 ? 52.780 -15.974 12.283  1.00 13.31 ? 251 PRO A C     1 
ATOM   1974 O  O     . PRO A 1 254 ? 53.153 -15.185 11.419  1.00 13.69 ? 251 PRO A O     1 
ATOM   1975 C  CB    . PRO A 1 254 ? 52.763 -14.707 14.462  1.00 12.98 ? 251 PRO A CB    1 
ATOM   1976 C  CG    . PRO A 1 254 ? 53.901 -14.260 15.351  1.00 14.73 ? 251 PRO A CG    1 
ATOM   1977 C  CD    . PRO A 1 254 ? 55.135 -14.457 14.487  1.00 14.48 ? 251 PRO A CD    1 
ATOM   1978 N  N     . ILE A 1 255 ? 51.897 -16.937 12.055  1.00 11.45 ? 252 ILE A N     1 
ATOM   1979 C  CA    . ILE A 1 255 ? 51.300 -17.129 10.742  1.00 10.15 ? 252 ILE A CA    1 
ATOM   1980 C  C     . ILE A 1 255 ? 50.716 -15.826 10.151  1.00 10.20 ? 252 ILE A C     1 
ATOM   1981 O  O     . ILE A 1 255 ? 50.872 -15.561 8.957   1.00 10.80 ? 252 ILE A O     1 
ATOM   1982 C  CB    . ILE A 1 255 ? 50.271 -18.278 10.797  1.00 13.06 ? 252 ILE A CB    1 
ATOM   1983 C  CG1   . ILE A 1 255 ? 51.022 -19.612 10.878  1.00 14.76 ? 252 ILE A CG1   1 
ATOM   1984 C  CG2   . ILE A 1 255 ? 49.327 -18.246 9.590   1.00 14.68 ? 252 ILE A CG2   1 
ATOM   1985 C  CD1   . ILE A 1 255 ? 50.185 -20.757 11.385  1.00 16.87 ? 252 ILE A CD1   1 
ATOM   1986 N  N     . ARG A 1 256 ? 50.088 -15.004 10.993  1.00 12.04 ? 253 ARG A N     1 
ATOM   1987 C  CA    . ARG A 1 256 ? 49.411 -13.799 10.517  1.00 10.73 ? 253 ARG A CA    1 
ATOM   1988 C  C     . ARG A 1 256 ? 50.373 -12.770 9.932   1.00 11.82 ? 253 ARG A C     1 
ATOM   1989 O  O     . ARG A 1 256 ? 49.947 -11.792 9.308   1.00 12.28 ? 253 ARG A O     1 
ATOM   1990 C  CB    . ARG A 1 256 ? 48.590 -13.152 11.636  1.00 12.38 ? 253 ARG A CB    1 
ATOM   1991 C  CG    . ARG A 1 256 ? 49.436 -12.569 12.744  1.00 13.96 ? 253 ARG A CG    1 
ATOM   1992 C  CD    . ARG A 1 256 ? 48.587 -11.965 13.859  1.00 14.55 ? 253 ARG A CD    1 
ATOM   1993 N  NE    . ARG A 1 256 ? 49.437 -11.460 14.940  1.00 19.22 ? 253 ARG A NE    1 
ATOM   1994 C  CZ    . ARG A 1 256 ? 49.878 -12.200 15.952  1.00 24.12 ? 253 ARG A CZ    1 
ATOM   1995 N  NH1   . ARG A 1 256 ? 49.538 -13.482 16.038  1.00 17.71 ? 253 ARG A NH1   1 
ATOM   1996 N  NH2   . ARG A 1 256 ? 50.650 -11.657 16.886  1.00 21.09 ? 253 ARG A NH2   1 
ATOM   1997 N  N     . LYS A 1 257 ? 51.671 -12.972 10.127  1.00 11.25 ? 254 LYS A N     1 
ATOM   1998 C  CA    . LYS A 1 257 ? 52.626 -11.983 9.621   1.00 11.46 ? 254 LYS A CA    1 
ATOM   1999 C  C     . LYS A 1 257 ? 52.870 -12.117 8.128   1.00 14.74 ? 254 LYS A C     1 
ATOM   2000 O  O     . LYS A 1 257 ? 53.375 -11.190 7.493   1.00 15.27 ? 254 LYS A O     1 
ATOM   2001 C  CB    . LYS A 1 257 ? 53.959 -12.068 10.363  1.00 10.20 ? 254 LYS A CB    1 
ATOM   2002 C  CG    . LYS A 1 257 ? 53.834 -11.895 11.871  1.00 19.83 ? 254 LYS A CG    1 
ATOM   2003 C  CD    . LYS A 1 257 ? 53.287 -10.530 12.253  1.00 17.45 ? 254 LYS A CD    1 
ATOM   2004 C  CE    . LYS A 1 257 ? 53.139 -10.417 13.776  1.00 23.81 ? 254 LYS A CE    1 
ATOM   2005 N  NZ    . LYS A 1 257 ? 52.659 -9.066  14.220  1.00 26.44 ? 254 LYS A NZ    1 
ATOM   2006 N  N     . ILE A 1 258 ? 52.530 -13.275 7.570   1.00 10.95 ? 255 ILE A N     1 
ATOM   2007 C  CA    . ILE A 1 258 ? 52.802 -13.535 6.156   1.00 11.45 ? 255 ILE A CA    1 
ATOM   2008 C  C     . ILE A 1 258 ? 51.674 -12.970 5.300   1.00 13.21 ? 255 ILE A C     1 
ATOM   2009 O  O     . ILE A 1 258 ? 50.508 -13.126 5.630   1.00 12.83 ? 255 ILE A O     1 
ATOM   2010 C  CB    . ILE A 1 258 ? 52.967 -15.043 5.881   1.00 14.15 ? 255 ILE A CB    1 
ATOM   2011 C  CG1   . ILE A 1 258 ? 54.379 -15.510 6.262   1.00 22.01 ? 255 ILE A CG1   1 
ATOM   2012 C  CG2   . ILE A 1 258 ? 52.727 -15.352 4.410   1.00 15.85 ? 255 ILE A CG2   1 
ATOM   2013 C  CD1   . ILE A 1 258 ? 54.771 -15.233 7.697   1.00 22.79 ? 255 ILE A CD1   1 
ATOM   2014 N  N     . ARG A 1 259 ? 52.020 -12.309 4.203   1.00 10.38 ? 256 ARG A N     1 
ATOM   2015 C  CA    . ARG A 1 259 ? 51.000 -11.664 3.370   1.00 12.88 ? 256 ARG A CA    1 
ATOM   2016 C  C     . ARG A 1 259 ? 49.940 -12.640 2.849   1.00 15.38 ? 256 ARG A C     1 
ATOM   2017 O  O     . ARG A 1 259 ? 50.269 -13.651 2.223   1.00 15.24 ? 256 ARG A O     1 
ATOM   2018 C  CB    . ARG A 1 259 ? 51.639 -10.928 2.189   1.00 16.93 ? 256 ARG A CB    1 
ATOM   2019 C  CG    . ARG A 1 259 ? 50.599 -10.243 1.309   1.00 21.45 ? 256 ARG A CG    1 
ATOM   2020 C  CD    . ARG A 1 259 ? 51.207 -9.425  0.195   1.00 25.23 ? 256 ARG A CD    1 
ATOM   2021 N  NE    . ARG A 1 259 ? 51.677 -10.235 -0.924  1.00 46.16 ? 256 ARG A NE    1 
ATOM   2022 C  CZ    . ARG A 1 259 ? 51.858 -9.756  -2.151  1.00 53.51 ? 256 ARG A CZ    1 
ATOM   2023 N  NH1   . ARG A 1 259 ? 52.294 -10.542 -3.124  1.00 39.05 ? 256 ARG A NH1   1 
ATOM   2024 N  NH2   . ARG A 1 259 ? 51.593 -8.481  -2.409  1.00 64.27 ? 256 ARG A NH2   1 
ATOM   2025 N  N     . SER A 1 260 ? 48.675 -12.300 3.108   1.00 13.41 ? 257 SER A N     1 
ATOM   2026 C  CA    . SER A 1 260 ? 47.485 -13.067 2.722   1.00 12.54 ? 257 SER A CA    1 
ATOM   2027 C  C     . SER A 1 260 ? 46.967 -13.934 3.867   1.00 18.51 ? 257 SER A C     1 
ATOM   2028 O  O     . SER A 1 260 ? 45.862 -14.468 3.794   1.00 15.06 ? 257 SER A O     1 
ATOM   2029 C  CB    . SER A 1 260 ? 47.695 -13.903 1.449   1.00 18.66 ? 257 SER A CB    1 
ATOM   2030 O  OG    . SER A 1 260 ? 48.336 -15.144 1.714   1.00 16.78 ? 257 SER A OG    1 
ATOM   2031 N  N     . LEU A 1 261 ? 47.760 -14.052 4.931   1.00 12.01 ? 258 LEU A N     1 
ATOM   2032 C  CA    . LEU A 1 261 ? 47.363 -14.861 6.083   1.00 9.76  ? 258 LEU A CA    1 
ATOM   2033 C  C     . LEU A 1 261 ? 47.026 -14.011 7.310   1.00 15.94 ? 258 LEU A C     1 
ATOM   2034 O  O     . LEU A 1 261 ? 46.888 -14.541 8.412   1.00 12.83 ? 258 LEU A O     1 
ATOM   2035 C  CB    . LEU A 1 261 ? 48.463 -15.870 6.431   1.00 10.40 ? 258 LEU A CB    1 
ATOM   2036 C  CG    . LEU A 1 261 ? 48.868 -16.819 5.288   1.00 10.84 ? 258 LEU A CG    1 
ATOM   2037 C  CD1   . LEU A 1 261 ? 49.935 -17.750 5.779   1.00 10.19 ? 258 LEU A CD1   1 
ATOM   2038 C  CD2   . LEU A 1 261 ? 47.687 -17.633 4.776   1.00 12.85 ? 258 LEU A CD2   1 
ATOM   2039 N  N     . GLY A 1 262 ? 46.878 -12.701 7.114   1.00 15.02 ? 259 GLY A N     1 
ATOM   2040 C  CA    . GLY A 1 262 ? 46.588 -11.789 8.212   1.00 12.64 ? 259 GLY A CA    1 
ATOM   2041 C  C     . GLY A 1 262 ? 45.129 -11.728 8.635   1.00 16.70 ? 259 GLY A C     1 
ATOM   2042 O  O     . GLY A 1 262 ? 44.775 -11.001 9.566   1.00 15.66 ? 259 GLY A O     1 
ATOM   2043 N  N     . GLY A 1 263 ? 44.287 -12.500 7.959   1.00 12.72 ? 260 GLY A N     1 
ATOM   2044 C  CA    . GLY A 1 263 ? 42.853 -12.479 8.194   1.00 15.13 ? 260 GLY A CA    1 
ATOM   2045 C  C     . GLY A 1 263 ? 42.232 -13.825 8.536   1.00 20.64 ? 260 GLY A C     1 
ATOM   2046 O  O     . GLY A 1 263 ? 42.811 -14.627 9.270   1.00 18.22 ? 260 GLY A O     1 
ATOM   2047 N  N     . LYS A 1 264 ? 41.035 -14.070 8.008   1.00 14.99 ? 261 LYS A N     1 
ATOM   2048 C  CA    . LYS A 1 264 ? 40.279 -15.279 8.324   1.00 17.69 ? 261 LYS A CA    1 
ATOM   2049 C  C     . LYS A 1 264 ? 40.984 -16.582 7.939   1.00 14.48 ? 261 LYS A C     1 
ATOM   2050 O  O     . LYS A 1 264 ? 40.925 -17.552 8.687   1.00 18.12 ? 261 LYS A O     1 
ATOM   2051 C  CB    . LYS A 1 264 ? 38.874 -15.221 7.702   1.00 20.47 ? 261 LYS A CB    1 
ATOM   2052 C  CG    . LYS A 1 264 ? 37.967 -14.184 8.357   1.00 22.09 ? 261 LYS A CG    1 
ATOM   2053 C  CD    . LYS A 1 264 ? 36.583 -14.146 7.711   1.00 22.63 ? 261 LYS A CD    1 
ATOM   2054 C  CE    . LYS A 1 264 ? 35.724 -13.053 8.339   1.00 41.36 ? 261 LYS A CE    1 
ATOM   2055 N  NZ    . LYS A 1 264 ? 34.417 -12.895 7.646   1.00 44.34 ? 261 LYS A NZ    1 
ATOM   2056 N  N     . LEU A 1 265 ? 41.634 -16.612 6.775   1.00 15.58 ? 262 LEU A N     1 
ATOM   2057 C  CA    . LEU A 1 265 ? 42.347 -17.812 6.348   1.00 16.99 ? 262 LEU A CA    1 
ATOM   2058 C  C     . LEU A 1 265 ? 43.465 -18.162 7.327   1.00 13.04 ? 262 LEU A C     1 
ATOM   2059 O  O     . LEU A 1 265 ? 43.601 -19.312 7.732   1.00 15.36 ? 262 LEU A O     1 
ATOM   2060 C  CB    . LEU A 1 265 ? 42.920 -17.653 4.942   1.00 13.00 ? 262 LEU A CB    1 
ATOM   2061 C  CG    . LEU A 1 265 ? 43.767 -18.839 4.451   1.00 13.65 ? 262 LEU A CG    1 
ATOM   2062 C  CD1   . LEU A 1 265 ? 42.887 -20.080 4.354   1.00 19.50 ? 262 LEU A CD1   1 
ATOM   2063 C  CD2   . LEU A 1 265 ? 44.404 -18.521 3.111   1.00 17.61 ? 262 LEU A CD2   1 
ATOM   2064 N  N     . GLY A 1 266 ? 44.269 -17.172 7.706   1.00 16.28 ? 263 GLY A N     1 
ATOM   2065 C  CA    . GLY A 1 266 ? 45.344 -17.418 8.652   1.00 14.44 ? 263 GLY A CA    1 
ATOM   2066 C  C     . GLY A 1 266 ? 44.808 -17.918 9.980   1.00 12.01 ? 263 GLY A C     1 
ATOM   2067 O  O     . GLY A 1 266 ? 45.397 -18.803 10.623  1.00 13.73 ? 263 GLY A O     1 
ATOM   2068 N  N     . ALA A 1 267 ? 43.680 -17.353 10.403  1.00 13.47 ? 264 ALA A N     1 
ATOM   2069 C  CA    . ALA A 1 267 ? 43.059 -17.781 11.644  1.00 15.80 ? 264 ALA A CA    1 
ATOM   2070 C  C     . ALA A 1 267 ? 42.586 -19.226 11.535  1.00 15.74 ? 264 ALA A C     1 
ATOM   2071 O  O     . ALA A 1 267 ? 42.681 -19.991 12.497  1.00 17.60 ? 264 ALA A O     1 
ATOM   2072 C  CB    . ALA A 1 267 ? 41.909 -16.853 12.024  1.00 19.91 ? 264 ALA A CB    1 
ATOM   2073 N  N     . SER A 1 268 ? 42.092 -19.609 10.358  1.00 14.07 ? 265 SER A N     1 
ATOM   2074 C  CA    . SER A 1 268 ? 41.651 -20.983 10.151  1.00 13.16 ? 265 SER A CA    1 
ATOM   2075 C  C     . SER A 1 268 ? 42.838 -21.944 10.160  1.00 16.07 ? 265 SER A C     1 
ATOM   2076 O  O     . SER A 1 268 ? 42.741 -23.038 10.707  1.00 14.53 ? 265 SER A O     1 
ATOM   2077 C  CB    . SER A 1 268 ? 40.846 -21.132 8.855   1.00 18.51 ? 265 SER A CB    1 
ATOM   2078 O  OG    A SER A 1 268 ? 39.794 -20.188 8.791   0.26 17.18 ? 265 SER A OG    1 
ATOM   2079 O  OG    B SER A 1 268 ? 41.688 -21.225 7.724   0.41 11.14 ? 265 SER A OG    1 
ATOM   2080 O  OG    C SER A 1 268 ? 40.455 -22.480 8.656   0.33 14.14 ? 265 SER A OG    1 
ATOM   2081 N  N     . VAL A 1 269 ? 43.954 -21.534 9.558   1.00 13.50 ? 266 VAL A N     1 
ATOM   2082 C  CA    . VAL A 1 269 ? 45.150 -22.375 9.547   1.00 11.38 ? 266 VAL A CA    1 
ATOM   2083 C  C     . VAL A 1 269 ? 45.546 -22.684 10.995  1.00 18.03 ? 266 VAL A C     1 
ATOM   2084 O  O     . VAL A 1 269 ? 45.819 -23.828 11.357  1.00 16.84 ? 266 VAL A O     1 
ATOM   2085 C  CB    . VAL A 1 269 ? 46.332 -21.696 8.828   1.00 14.12 ? 266 VAL A CB    1 
ATOM   2086 C  CG1   . VAL A 1 269 ? 47.620 -22.478 9.050   1.00 14.50 ? 266 VAL A CG1   1 
ATOM   2087 C  CG2   . VAL A 1 269 ? 46.042 -21.534 7.343   1.00 10.38 ? 266 VAL A CG2   1 
ATOM   2088 N  N     . ILE A 1 270 ? 45.559 -21.645 11.820  1.00 12.28 ? 267 ILE A N     1 
ATOM   2089 C  CA    . ILE A 1 270 ? 45.933 -21.771 13.223  1.00 11.67 ? 267 ILE A CA    1 
ATOM   2090 C  C     . ILE A 1 270 ? 44.977 -22.686 13.976  1.00 13.60 ? 267 ILE A C     1 
ATOM   2091 O  O     . ILE A 1 270 ? 45.406 -23.563 14.720  1.00 17.58 ? 267 ILE A O     1 
ATOM   2092 C  CB    . ILE A 1 270 ? 45.965 -20.387 13.891  1.00 16.76 ? 267 ILE A CB    1 
ATOM   2093 C  CG1   . ILE A 1 270 ? 47.188 -19.610 13.406  1.00 15.80 ? 267 ILE A CG1   1 
ATOM   2094 C  CG2   . ILE A 1 270 ? 45.953 -20.516 15.411  1.00 28.09 ? 267 ILE A CG2   1 
ATOM   2095 C  CD1   . ILE A 1 270 ? 47.205 -18.169 13.856  1.00 23.56 ? 267 ILE A CD1   1 
ATOM   2096 N  N     . GLU A 1 271 ? 43.679 -22.485 13.766  1.00 13.99 ? 268 GLU A N     1 
ATOM   2097 C  CA    . GLU A 1 271 ? 42.666 -23.209 14.525  1.00 15.61 ? 268 GLU A CA    1 
ATOM   2098 C  C     . GLU A 1 271 ? 42.577 -24.672 14.110  1.00 19.81 ? 268 GLU A C     1 
ATOM   2099 O  O     . GLU A 1 271 ? 42.519 -25.574 14.957  1.00 19.27 ? 268 GLU A O     1 
ATOM   2100 C  CB    . GLU A 1 271 ? 41.301 -22.539 14.355  1.00 21.57 ? 268 GLU A CB    1 
ATOM   2101 C  CG    . GLU A 1 271 ? 40.142 -23.294 14.994  1.00 34.81 ? 268 GLU A CG    1 
ATOM   2102 C  CD    . GLU A 1 271 ? 38.875 -22.458 15.066  1.00 46.91 ? 268 GLU A CD    1 
ATOM   2103 O  OE1   . GLU A 1 271 ? 38.938 -21.252 14.746  1.00 60.41 ? 268 GLU A OE1   1 
ATOM   2104 O  OE2   . GLU A 1 271 ? 37.816 -23.003 15.440  1.00 48.59 ? 268 GLU A OE2   1 
ATOM   2105 N  N     . ILE A 1 272 ? 42.562 -24.899 12.802  1.00 14.28 ? 269 ILE A N     1 
ATOM   2106 C  CA    . ILE A 1 272 ? 42.384 -26.239 12.262  1.00 14.99 ? 269 ILE A CA    1 
ATOM   2107 C  C     . ILE A 1 272 ? 43.602 -27.116 12.501  1.00 17.92 ? 269 ILE A C     1 
ATOM   2108 O  O     . ILE A 1 272 ? 43.476 -28.293 12.852  1.00 18.04 ? 269 ILE A O     1 
ATOM   2109 C  CB    . ILE A 1 272 ? 42.070 -26.190 10.750  1.00 17.09 ? 269 ILE A CB    1 
ATOM   2110 C  CG1   . ILE A 1 272 ? 40.663 -25.639 10.517  1.00 23.00 ? 269 ILE A CG1   1 
ATOM   2111 C  CG2   . ILE A 1 272 ? 42.195 -27.571 10.129  1.00 21.01 ? 269 ILE A CG2   1 
ATOM   2112 C  CD1   . ILE A 1 272 ? 40.287 -25.533 9.052   1.00 25.18 ? 269 ILE A CD1   1 
ATOM   2113 N  N     . LEU A 1 273 ? 44.790 -26.547 12.322  1.00 15.05 ? 270 LEU A N     1 
ATOM   2114 C  CA    . LEU A 1 273 ? 46.015 -27.328 12.449  1.00 15.08 ? 270 LEU A CA    1 
ATOM   2115 C  C     . LEU A 1 273 ? 46.587 -27.337 13.864  1.00 14.43 ? 270 LEU A C     1 
ATOM   2116 O  O     . LEU A 1 273 ? 47.411 -28.187 14.193  1.00 17.12 ? 270 LEU A O     1 
ATOM   2117 C  CB    . LEU A 1 273 ? 47.064 -26.846 11.450  1.00 13.07 ? 270 LEU A CB    1 
ATOM   2118 C  CG    . LEU A 1 273 ? 46.666 -27.003 9.980   1.00 18.48 ? 270 LEU A CG    1 
ATOM   2119 C  CD1   . LEU A 1 273 ? 47.798 -26.506 9.079   1.00 16.07 ? 270 LEU A CD1   1 
ATOM   2120 C  CD2   . LEU A 1 273 ? 46.336 -28.452 9.666   1.00 21.98 ? 270 LEU A CD2   1 
ATOM   2121 N  N     . GLY A 1 274 ? 46.122 -26.414 14.699  1.00 14.35 ? 271 GLY A N     1 
ATOM   2122 C  CA    . GLY A 1 274 ? 46.613 -26.295 16.061  1.00 14.86 ? 271 GLY A CA    1 
ATOM   2123 C  C     . GLY A 1 274 ? 48.076 -25.904 16.123  1.00 23.73 ? 271 GLY A C     1 
ATOM   2124 O  O     . GLY A 1 274 ? 48.847 -26.459 16.912  1.00 17.01 ? 271 GLY A O     1 
ATOM   2125 N  N     . ILE A 1 275 ? 48.461 -24.950 15.280  1.00 14.55 ? 272 ILE A N     1 
ATOM   2126 C  CA    . ILE A 1 275 ? 49.825 -24.440 15.268  1.00 11.83 ? 272 ILE A CA    1 
ATOM   2127 C  C     . ILE A 1 275 ? 49.806 -22.924 15.407  1.00 12.39 ? 272 ILE A C     1 
ATOM   2128 O  O     . ILE A 1 275 ? 48.747 -22.300 15.330  1.00 15.80 ? 272 ILE A O     1 
ATOM   2129 C  CB    . ILE A 1 275 ? 50.540 -24.791 13.963  1.00 12.40 ? 272 ILE A CB    1 
ATOM   2130 C  CG1   . ILE A 1 275 ? 49.760 -24.249 12.762  1.00 16.10 ? 272 ILE A CG1   1 
ATOM   2131 C  CG2   . ILE A 1 275 ? 50.703 -26.291 13.832  1.00 12.63 ? 272 ILE A CG2   1 
ATOM   2132 C  CD1   . ILE A 1 275 ? 50.488 -24.463 11.421  1.00 11.14 ? 272 ILE A CD1   1 
ATOM   2133 N  N     . GLU A 1 276 ? 50.981 -22.331 15.587  1.00 12.06 ? 273 GLU A N     1 
ATOM   2134 C  CA    . GLU A 1 276 ? 51.093 -20.878 15.748  1.00 14.81 ? 273 GLU A CA    1 
ATOM   2135 C  C     . GLU A 1 276 ? 52.067 -20.230 14.763  1.00 12.30 ? 273 GLU A C     1 
ATOM   2136 O  O     . GLU A 1 276 ? 51.897 -19.070 14.387  1.00 13.85 ? 273 GLU A O     1 
ATOM   2137 C  CB    . GLU A 1 276 ? 51.550 -20.539 17.166  1.00 16.81 ? 273 GLU A CB    1 
ATOM   2138 C  CG    . GLU A 1 276 ? 50.566 -20.958 18.250  1.00 26.48 ? 273 GLU A CG    1 
ATOM   2139 C  CD    . GLU A 1 276 ? 51.198 -20.988 19.622  1.00 38.35 ? 273 GLU A CD    1 
ATOM   2140 O  OE1   . GLU A 1 276 ? 50.800 -21.844 20.440  1.00 50.05 ? 273 GLU A OE1   1 
ATOM   2141 O  OE2   . GLU A 1 276 ? 52.093 -20.159 19.882  1.00 38.29 ? 273 GLU A OE2   1 
ATOM   2142 N  N     . TYR A 1 277 ? 53.103 -20.963 14.375  1.00 11.46 ? 274 TYR A N     1 
ATOM   2143 C  CA    . TYR A 1 277 ? 54.196 -20.367 13.603  1.00 11.42 ? 274 TYR A CA    1 
ATOM   2144 C  C     . TYR A 1 277 ? 54.273 -20.926 12.198  1.00 11.41 ? 274 TYR A C     1 
ATOM   2145 O  O     . TYR A 1 277 ? 53.918 -22.073 11.946  1.00 11.74 ? 274 TYR A O     1 
ATOM   2146 C  CB    . TYR A 1 277 ? 55.547 -20.553 14.309  1.00 13.79 ? 274 TYR A CB    1 
ATOM   2147 C  CG    . TYR A 1 277 ? 55.543 -20.041 15.725  1.00 13.78 ? 274 TYR A CG    1 
ATOM   2148 C  CD1   . TYR A 1 277 ? 55.745 -20.902 16.797  1.00 17.27 ? 274 TYR A CD1   1 
ATOM   2149 C  CD2   . TYR A 1 277 ? 55.273 -18.710 15.995  1.00 13.38 ? 274 TYR A CD2   1 
ATOM   2150 C  CE1   . TYR A 1 277 ? 55.719 -20.440 18.100  1.00 18.71 ? 274 TYR A CE1   1 
ATOM   2151 C  CE2   . TYR A 1 277 ? 55.235 -18.241 17.293  1.00 17.75 ? 274 TYR A CE2   1 
ATOM   2152 C  CZ    . TYR A 1 277 ? 55.457 -19.114 18.343  1.00 17.70 ? 274 TYR A CZ    1 
ATOM   2153 O  OH    . TYR A 1 277 ? 55.421 -18.647 19.638  1.00 19.26 ? 274 TYR A OH    1 
ATOM   2154 N  N     . MET A 1 278 ? 54.759 -20.102 11.282  1.00 9.84  ? 275 MET A N     1 
ATOM   2155 C  CA    . MET A 1 278 ? 54.843 -20.484 9.882   1.00 12.12 ? 275 MET A CA    1 
ATOM   2156 C  C     . MET A 1 278 ? 55.631 -21.777 9.669   1.00 11.94 ? 275 MET A C     1 
ATOM   2157 O  O     . MET A 1 278 ? 55.250 -22.611 8.850   1.00 11.68 ? 275 MET A O     1 
ATOM   2158 C  CB    . MET A 1 278 ? 55.463 -19.342 9.074   1.00 14.91 ? 275 MET A CB    1 
ATOM   2159 C  CG    A MET A 1 278 ? 55.214 -19.440 7.581   0.70 11.55 ? 275 MET A CG    1 
ATOM   2160 C  CG    B MET A 1 278 ? 54.523 -18.194 8.835   0.30 13.98 ? 275 MET A CG    1 
ATOM   2161 S  SD    A MET A 1 278 ? 53.472 -19.303 7.123   0.70 14.33 ? 275 MET A SD    1 
ATOM   2162 S  SD    B MET A 1 278 ? 53.106 -18.697 7.846   0.30 17.87 ? 275 MET A SD    1 
ATOM   2163 C  CE    A MET A 1 278 ? 53.557 -19.767 5.391   0.70 16.52 ? 275 MET A CE    1 
ATOM   2164 C  CE    B MET A 1 278 ? 53.917 -19.493 6.463   0.30 15.69 ? 275 MET A CE    1 
ATOM   2165 N  N     . GLY A 1 279 ? 56.739 -21.942 10.391  1.00 10.66 ? 276 GLY A N     1 
ATOM   2166 C  CA    . GLY A 1 279 ? 57.571 -23.123 10.221  1.00 11.33 ? 276 GLY A CA    1 
ATOM   2167 C  C     . GLY A 1 279 ? 56.848 -24.429 10.523  1.00 12.91 ? 276 GLY A C     1 
ATOM   2168 O  O     . GLY A 1 279 ? 57.170 -25.479 9.959   1.00 14.66 ? 276 GLY A O     1 
ATOM   2169 N  N     . GLU A 1 280 ? 55.869 -24.376 11.422  1.00 10.02 ? 277 GLU A N     1 
ATOM   2170 C  CA    . GLU A 1 280 ? 55.161 -25.584 11.820  1.00 8.91  ? 277 GLU A CA    1 
ATOM   2171 C  C     . GLU A 1 280 ? 54.384 -26.187 10.657  1.00 12.69 ? 277 GLU A C     1 
ATOM   2172 O  O     . GLU A 1 280 ? 54.011 -27.358 10.694  1.00 12.55 ? 277 GLU A O     1 
ATOM   2173 C  CB    . GLU A 1 280 ? 54.214 -25.300 12.985  1.00 11.22 ? 277 GLU A CB    1 
ATOM   2174 C  CG    . GLU A 1 280 ? 54.923 -24.988 14.288  1.00 11.03 ? 277 GLU A CG    1 
ATOM   2175 C  CD    . GLU A 1 280 ? 53.952 -24.704 15.402  1.00 15.58 ? 277 GLU A CD    1 
ATOM   2176 O  OE1   . GLU A 1 280 ? 53.615 -23.521 15.595  1.00 15.22 ? 277 GLU A OE1   1 
ATOM   2177 O  OE2   . GLU A 1 280 ? 53.513 -25.664 16.071  1.00 18.56 ? 277 GLU A OE2   1 
ATOM   2178 N  N     . LEU A 1 281 ? 54.145 -25.388 9.622   1.00 10.90 ? 278 LEU A N     1 
ATOM   2179 C  CA    . LEU A 1 281 ? 53.410 -25.875 8.459   1.00 9.25  ? 278 LEU A CA    1 
ATOM   2180 C  C     . LEU A 1 281 ? 54.138 -26.977 7.694   1.00 10.36 ? 278 LEU A C     1 
ATOM   2181 O  O     . LEU A 1 281 ? 53.507 -27.749 6.975   1.00 12.15 ? 278 LEU A O     1 
ATOM   2182 C  CB    . LEU A 1 281 ? 53.079 -24.719 7.510   1.00 9.55  ? 278 LEU A CB    1 
ATOM   2183 C  CG    . LEU A 1 281 ? 51.852 -23.903 7.908   1.00 14.44 ? 278 LEU A CG    1 
ATOM   2184 C  CD1   . LEU A 1 281 ? 51.825 -22.595 7.119   1.00 14.17 ? 278 LEU A CD1   1 
ATOM   2185 C  CD2   . LEU A 1 281 ? 50.572 -24.714 7.681   1.00 10.59 ? 278 LEU A CD2   1 
ATOM   2186 N  N     . THR A 1 282 ? 55.460 -27.044 7.835   1.00 13.47 ? 279 THR A N     1 
ATOM   2187 C  CA    . THR A 1 282 ? 56.248 -28.009 7.062   1.00 11.44 ? 279 THR A CA    1 
ATOM   2188 C  C     . THR A 1 282 ? 55.896 -29.466 7.360   1.00 10.46 ? 279 THR A C     1 
ATOM   2189 O  O     . THR A 1 282 ? 56.223 -30.352 6.574   1.00 14.59 ? 279 THR A O     1 
ATOM   2190 C  CB    . THR A 1 282 ? 57.766 -27.829 7.256   1.00 13.34 ? 279 THR A CB    1 
ATOM   2191 O  OG1   . THR A 1 282 ? 58.111 -28.128 8.616   1.00 15.35 ? 279 THR A OG1   1 
ATOM   2192 C  CG2   . THR A 1 282 ? 58.186 -26.404 6.920   1.00 11.50 ? 279 THR A CG2   1 
ATOM   2193 N  N     . GLN A 1 283 ? 55.238 -29.715 8.489   1.00 13.68 ? 280 GLN A N     1 
ATOM   2194 C  CA    . GLN A 1 283 ? 54.978 -31.086 8.921   1.00 19.09 ? 280 GLN A CA    1 
ATOM   2195 C  C     . GLN A 1 283 ? 53.737 -31.719 8.299   1.00 19.08 ? 280 GLN A C     1 
ATOM   2196 O  O     . GLN A 1 283 ? 53.412 -32.865 8.587   1.00 24.31 ? 280 GLN A O     1 
ATOM   2197 C  CB    . GLN A 1 283 ? 54.898 -31.148 10.443  1.00 17.54 ? 280 GLN A CB    1 
ATOM   2198 C  CG    A GLN A 1 283 ? 53.681 -30.503 11.024  0.51 17.80 ? 280 GLN A CG    1 
ATOM   2199 C  CG    B GLN A 1 283 ? 56.235 -30.893 11.073  0.49 13.29 ? 280 GLN A CG    1 
ATOM   2200 C  CD    A GLN A 1 283 ? 53.790 -30.347 12.522  0.51 29.19 ? 280 GLN A CD    1 
ATOM   2201 C  CD    B GLN A 1 283 ? 57.302 -31.739 10.417  0.49 14.82 ? 280 GLN A CD    1 
ATOM   2202 O  OE1   A GLN A 1 283 ? 54.045 -31.313 13.246  0.51 26.00 ? 280 GLN A OE1   1 
ATOM   2203 O  OE1   B GLN A 1 283 ? 57.278 -32.966 10.517  0.49 14.84 ? 280 GLN A OE1   1 
ATOM   2204 N  NE2   A GLN A 1 283 ? 53.610 -29.125 12.998  0.51 10.39 ? 280 GLN A NE2   1 
ATOM   2205 N  NE2   B GLN A 1 283 ? 58.231 -31.094 9.719   0.49 14.64 ? 280 GLN A NE2   1 
ATOM   2206 N  N     . PHE A 1 284 ? 53.051 -30.972 7.448   1.00 13.40 ? 281 PHE A N     1 
ATOM   2207 C  CA    . PHE A 1 284 ? 51.850 -31.468 6.789   1.00 10.66 ? 281 PHE A CA    1 
ATOM   2208 C  C     . PHE A 1 284 ? 52.144 -31.752 5.322   1.00 17.74 ? 281 PHE A C     1 
ATOM   2209 O  O     . PHE A 1 284 ? 52.965 -31.076 4.714   1.00 16.09 ? 281 PHE A O     1 
ATOM   2210 C  CB    . PHE A 1 284 ? 50.731 -30.441 6.937   1.00 11.11 ? 281 PHE A CB    1 
ATOM   2211 C  CG    . PHE A 1 284 ? 50.410 -30.128 8.375   1.00 13.60 ? 281 PHE A CG    1 
ATOM   2212 C  CD1   . PHE A 1 284 ? 49.537 -30.936 9.090   1.00 21.19 ? 281 PHE A CD1   1 
ATOM   2213 C  CD2   . PHE A 1 284 ? 51.027 -29.071 9.026   1.00 14.00 ? 281 PHE A CD2   1 
ATOM   2214 C  CE1   . PHE A 1 284 ? 49.255 -30.669 10.417  1.00 21.89 ? 281 PHE A CE1   1 
ATOM   2215 C  CE2   . PHE A 1 284 ? 50.753 -28.802 10.348  1.00 18.04 ? 281 PHE A CE2   1 
ATOM   2216 C  CZ    . PHE A 1 284 ? 49.869 -29.602 11.049  1.00 18.83 ? 281 PHE A CZ    1 
ATOM   2217 N  N     . THR A 1 285 ? 51.496 -32.761 4.753   1.00 13.83 ? 282 THR A N     1 
ATOM   2218 C  CA    . THR A 1 285 ? 51.699 -33.042 3.335   1.00 13.84 ? 282 THR A CA    1 
ATOM   2219 C  C     . THR A 1 285 ? 50.957 -31.994 2.510   1.00 10.88 ? 282 THR A C     1 
ATOM   2220 O  O     . THR A 1 285 ? 50.065 -31.320 3.005   1.00 11.22 ? 282 THR A O     1 
ATOM   2221 C  CB    . THR A 1 285 ? 51.155 -34.418 2.953   1.00 12.99 ? 282 THR A CB    1 
ATOM   2222 O  OG1   . THR A 1 285 ? 49.735 -34.411 3.118   1.00 14.53 ? 282 THR A OG1   1 
ATOM   2223 C  CG2   . THR A 1 285 ? 51.773 -35.493 3.836   1.00 23.30 ? 282 THR A CG2   1 
ATOM   2224 N  N     . GLU A 1 286 ? 51.315 -31.863 1.241   1.00 11.15 ? 283 GLU A N     1 
ATOM   2225 C  CA    . GLU A 1 286 ? 50.587 -30.949 0.374   1.00 12.60 ? 283 GLU A CA    1 
ATOM   2226 C  C     . GLU A 1 286 ? 49.086 -31.301 0.341   1.00 11.28 ? 283 GLU A C     1 
ATOM   2227 O  O     . GLU A 1 286 ? 48.228 -30.417 0.414   1.00 14.71 ? 283 GLU A O     1 
ATOM   2228 C  CB    . GLU A 1 286 ? 51.198 -30.959 -1.029  1.00 12.24 ? 283 GLU A CB    1 
ATOM   2229 C  CG    . GLU A 1 286 ? 50.589 -29.915 -1.944  1.00 11.85 ? 283 GLU A CG    1 
ATOM   2230 C  CD    . GLU A 1 286 ? 51.350 -29.768 -3.242  1.00 22.69 ? 283 GLU A CD    1 
ATOM   2231 O  OE1   . GLU A 1 286 ? 52.306 -30.535 -3.467  1.00 24.40 ? 283 GLU A OE1   1 
ATOM   2232 O  OE2   . GLU A 1 286 ? 50.994 -28.873 -4.033  1.00 22.84 ? 283 GLU A OE2   1 
ATOM   2233 N  N     . SER A 1 287 ? 48.774 -32.597 0.263   1.00 12.78 ? 284 SER A N     1 
ATOM   2234 C  CA    . SER A 1 287 ? 47.380 -33.040 0.187   1.00 17.80 ? 284 SER A CA    1 
ATOM   2235 C  C     . SER A 1 287 ? 46.632 -32.706 1.464   1.00 14.91 ? 284 SER A C     1 
ATOM   2236 O  O     . SER A 1 287 ? 45.467 -32.318 1.420   1.00 15.24 ? 284 SER A O     1 
ATOM   2237 C  CB    . SER A 1 287 ? 47.280 -34.545 -0.095  1.00 17.20 ? 284 SER A CB    1 
ATOM   2238 O  OG    A SER A 1 287 ? 47.901 -34.878 -1.319  0.79 19.16 ? 284 SER A OG    1 
ATOM   2239 O  OG    B SER A 1 287 ? 48.009 -35.295 0.859   0.21 13.83 ? 284 SER A OG    1 
ATOM   2240 N  N     . GLN A 1 288 ? 47.299 -32.850 2.607   1.00 15.07 ? 285 GLN A N     1 
ATOM   2241 C  CA    . GLN A 1 288 ? 46.671 -32.486 3.873   1.00 11.81 ? 285 GLN A CA    1 
ATOM   2242 C  C     . GLN A 1 288 ? 46.271 -31.013 3.865   1.00 10.95 ? 285 GLN A C     1 
ATOM   2243 O  O     . GLN A 1 288 ? 45.165 -30.646 4.277   1.00 12.38 ? 285 GLN A O     1 
ATOM   2244 C  CB    . GLN A 1 288 ? 47.604 -32.767 5.053   1.00 13.41 ? 285 GLN A CB    1 
ATOM   2245 C  CG    . GLN A 1 288 ? 47.660 -34.222 5.469   1.00 21.86 ? 285 GLN A CG    1 
ATOM   2246 C  CD    . GLN A 1 288 ? 48.571 -34.446 6.667   1.00 23.61 ? 285 GLN A CD    1 
ATOM   2247 O  OE1   . GLN A 1 288 ? 49.720 -34.007 6.681   1.00 17.95 ? 285 GLN A OE1   1 
ATOM   2248 N  NE2   . GLN A 1 288 ? 48.052 -35.125 7.685   1.00 30.49 ? 285 GLN A NE2   1 
ATOM   2249 N  N     . LEU A 1 289 ? 47.175 -30.161 3.396   1.00 14.91 ? 286 LEU A N     1 
ATOM   2250 C  CA    . LEU A 1 289 ? 46.900 -28.729 3.392   1.00 14.48 ? 286 LEU A CA    1 
ATOM   2251 C  C     . LEU A 1 289 ? 45.801 -28.400 2.386   1.00 14.97 ? 286 LEU A C     1 
ATOM   2252 O  O     . LEU A 1 289 ? 44.968 -27.532 2.623   1.00 12.44 ? 286 LEU A O     1 
ATOM   2253 C  CB    . LEU A 1 289 ? 48.171 -27.926 3.099   1.00 13.39 ? 286 LEU A CB    1 
ATOM   2254 C  CG    . LEU A 1 289 ? 49.275 -28.023 4.164   1.00 10.72 ? 286 LEU A CG    1 
ATOM   2255 C  CD1   . LEU A 1 289 ? 50.546 -27.286 3.728   1.00 10.95 ? 286 LEU A CD1   1 
ATOM   2256 C  CD2   . LEU A 1 289 ? 48.771 -27.485 5.497   1.00 13.08 ? 286 LEU A CD2   1 
ATOM   2257 N  N     . GLN A 1 290 ? 45.805 -29.092 1.255   1.00 14.25 ? 287 GLN A N     1 
ATOM   2258 C  CA    . GLN A 1 290 ? 44.763 -28.872 0.255   1.00 14.31 ? 287 GLN A CA    1 
ATOM   2259 C  C     . GLN A 1 290 ? 43.407 -29.318 0.788   1.00 17.34 ? 287 GLN A C     1 
ATOM   2260 O  O     . GLN A 1 290 ? 42.369 -28.733 0.455   1.00 16.06 ? 287 GLN A O     1 
ATOM   2261 C  CB    . GLN A 1 290 ? 45.087 -29.621 -1.037  1.00 15.75 ? 287 GLN A CB    1 
ATOM   2262 C  CG    . GLN A 1 290 ? 46.297 -29.069 -1.775  1.00 15.38 ? 287 GLN A CG    1 
ATOM   2263 C  CD    . GLN A 1 290 ? 46.680 -29.921 -2.964  1.00 17.58 ? 287 GLN A CD    1 
ATOM   2264 O  OE1   . GLN A 1 290 ? 46.704 -31.150 -2.878  1.00 18.84 ? 287 GLN A OE1   1 
ATOM   2265 N  NE2   . GLN A 1 290 ? 46.977 -29.273 -4.086  1.00 18.28 ? 287 GLN A NE2   1 
ATOM   2266 N  N     . SER A 1 291 ? 43.421 -30.351 1.622   1.00 13.36 ? 288 SER A N     1 
ATOM   2267 C  CA    . SER A 1 291 ? 42.181 -30.888 2.181   1.00 11.03 ? 288 SER A CA    1 
ATOM   2268 C  C     . SER A 1 291 ? 41.446 -29.885 3.062   1.00 23.58 ? 288 SER A C     1 
ATOM   2269 O  O     . SER A 1 291 ? 40.217 -29.893 3.133   1.00 22.97 ? 288 SER A O     1 
ATOM   2270 C  CB    . SER A 1 291 ? 42.440 -32.187 2.963   1.00 17.59 ? 288 SER A CB    1 
ATOM   2271 O  OG    . SER A 1 291 ? 42.967 -31.921 4.260   1.00 20.67 ? 288 SER A OG    1 
ATOM   2272 N  N     . HIS A 1 292 ? 42.194 -29.023 3.736   1.00 16.30 ? 289 HIS A N     1 
ATOM   2273 C  CA    . HIS A 1 292 ? 41.583 -28.054 4.637   1.00 16.81 ? 289 HIS A CA    1 
ATOM   2274 C  C     . HIS A 1 292 ? 41.342 -26.712 3.964   1.00 25.94 ? 289 HIS A C     1 
ATOM   2275 O  O     . HIS A 1 292 ? 40.326 -26.060 4.200   1.00 23.21 ? 289 HIS A O     1 
ATOM   2276 C  CB    . HIS A 1 292 ? 42.476 -27.836 5.857   1.00 17.19 ? 289 HIS A CB    1 
ATOM   2277 C  CG    . HIS A 1 292 ? 42.586 -29.029 6.754   1.00 18.76 ? 289 HIS A CG    1 
ATOM   2278 N  ND1   . HIS A 1 292 ? 41.507 -29.551 7.434   1.00 25.19 ? 289 HIS A ND1   1 
ATOM   2279 C  CD2   . HIS A 1 292 ? 43.655 -29.780 7.109   1.00 23.88 ? 289 HIS A CD2   1 
ATOM   2280 C  CE1   . HIS A 1 292 ? 41.903 -30.584 8.156   1.00 23.23 ? 289 HIS A CE1   1 
ATOM   2281 N  NE2   . HIS A 1 292 ? 43.202 -30.743 7.979   1.00 24.20 ? 289 HIS A NE2   1 
ATOM   2282 N  N     . PHE A 1 293 ? 42.285 -26.295 3.125   1.00 17.45 ? 290 PHE A N     1 
ATOM   2283 C  CA    . PHE A 1 293 ? 42.294 -24.916 2.649   1.00 16.91 ? 290 PHE A CA    1 
ATOM   2284 C  C     . PHE A 1 293 ? 42.083 -24.778 1.145   1.00 19.25 ? 290 PHE A C     1 
ATOM   2285 O  O     . PHE A 1 293 ? 42.134 -23.672 0.600   1.00 22.07 ? 290 PHE A O     1 
ATOM   2286 C  CB    . PHE A 1 293 ? 43.583 -24.238 3.111   1.00 15.91 ? 290 PHE A CB    1 
ATOM   2287 C  CG    . PHE A 1 293 ? 43.891 -24.503 4.556   1.00 18.05 ? 290 PHE A CG    1 
ATOM   2288 C  CD1   . PHE A 1 293 ? 43.105 -23.948 5.555   1.00 13.67 ? 290 PHE A CD1   1 
ATOM   2289 C  CD2   . PHE A 1 293 ? 44.939 -25.333 4.914   1.00 16.05 ? 290 PHE A CD2   1 
ATOM   2290 C  CE1   . PHE A 1 293 ? 43.362 -24.215 6.888   1.00 15.70 ? 290 PHE A CE1   1 
ATOM   2291 C  CE2   . PHE A 1 293 ? 45.209 -25.604 6.241   1.00 14.77 ? 290 PHE A CE2   1 
ATOM   2292 C  CZ    . PHE A 1 293 ? 44.423 -25.043 7.230   1.00 18.74 ? 290 PHE A CZ    1 
ATOM   2293 N  N     . GLY A 1 294 ? 41.810 -25.901 0.484   1.00 15.37 ? 291 GLY A N     1 
ATOM   2294 C  CA    . GLY A 1 294 ? 41.588 -25.890 -0.951  1.00 19.42 ? 291 GLY A CA    1 
ATOM   2295 C  C     . GLY A 1 294 ? 42.852 -26.166 -1.734  1.00 19.46 ? 291 GLY A C     1 
ATOM   2296 O  O     . GLY A 1 294 ? 43.954 -26.038 -1.208  1.00 17.39 ? 291 GLY A O     1 
ATOM   2297 N  N     . GLU A 1 295 ? 42.686 -26.551 -2.996  1.00 13.28 ? 292 GLU A N     1 
ATOM   2298 C  CA    . GLU A 1 295 ? 43.800 -26.920 -3.861  1.00 13.84 ? 292 GLU A CA    1 
ATOM   2299 C  C     . GLU A 1 295 ? 44.822 -25.795 -4.003  1.00 13.88 ? 292 GLU A C     1 
ATOM   2300 O  O     . GLU A 1 295 ? 46.029 -26.009 -3.856  1.00 14.96 ? 292 GLU A O     1 
ATOM   2301 C  CB    . GLU A 1 295 ? 43.258 -27.294 -5.241  1.00 19.22 ? 292 GLU A CB    1 
ATOM   2302 C  CG    . GLU A 1 295 ? 44.287 -27.819 -6.217  1.00 21.31 ? 292 GLU A CG    1 
ATOM   2303 C  CD    . GLU A 1 295 ? 43.683 -28.080 -7.587  1.00 42.82 ? 292 GLU A CD    1 
ATOM   2304 O  OE1   . GLU A 1 295 ? 44.293 -27.674 -8.599  1.00 36.94 ? 292 GLU A OE1   1 
ATOM   2305 O  OE2   . GLU A 1 295 ? 42.589 -28.683 -7.651  1.00 29.16 ? 292 GLU A OE2   1 
ATOM   2306 N  N     . LYS A 1 296 ? 44.332 -24.597 -4.308  1.00 12.73 ? 293 LYS A N     1 
ATOM   2307 C  CA    . LYS A 1 296 ? 45.208 -23.466 -4.560  1.00 12.20 ? 293 LYS A CA    1 
ATOM   2308 C  C     . LYS A 1 296 ? 45.942 -23.042 -3.284  1.00 16.94 ? 293 LYS A C     1 
ATOM   2309 O  O     . LYS A 1 296 ? 47.167 -22.981 -3.266  1.00 15.24 ? 293 LYS A O     1 
ATOM   2310 C  CB    . LYS A 1 296 ? 44.417 -22.299 -5.161  1.00 18.02 ? 293 LYS A CB    1 
ATOM   2311 C  CG    . LYS A 1 296 ? 45.279 -21.124 -5.595  1.00 32.80 ? 293 LYS A CG    1 
ATOM   2312 C  CD    . LYS A 1 296 ? 44.473 -20.100 -6.390  1.00 23.71 ? 293 LYS A CD    1 
ATOM   2313 C  CE    . LYS A 1 296 ? 45.272 -18.813 -6.595  1.00 34.14 ? 293 LYS A CE    1 
ATOM   2314 N  NZ    . LYS A 1 296 ? 44.704 -17.960 -7.678  1.00 41.91 ? 293 LYS A NZ    1 
ATOM   2315 N  N     . ASN A 1 297 ? 45.193 -22.762 -2.224  1.00 14.82 ? 294 ASN A N     1 
ATOM   2316 C  CA    . ASN A 1 297 ? 45.796 -22.328 -0.957  1.00 19.08 ? 294 ASN A CA    1 
ATOM   2317 C  C     . ASN A 1 297 ? 46.711 -23.391 -0.368  1.00 17.20 ? 294 ASN A C     1 
ATOM   2318 O  O     . ASN A 1 297 ? 47.747 -23.084 0.224   1.00 14.80 ? 294 ASN A O     1 
ATOM   2319 C  CB    . ASN A 1 297 ? 44.721 -22.014 0.079   1.00 17.16 ? 294 ASN A CB    1 
ATOM   2320 C  CG    . ASN A 1 297 ? 44.016 -20.703 -0.176  1.00 21.22 ? 294 ASN A CG    1 
ATOM   2321 O  OD1   . ASN A 1 297 ? 44.599 -19.758 -0.710  1.00 27.89 ? 294 ASN A OD1   1 
ATOM   2322 N  ND2   . ASN A 1 297 ? 42.750 -20.630 0.235   1.00 20.60 ? 294 ASN A ND2   1 
ATOM   2323 N  N     . GLY A 1 298 ? 46.306 -24.647 -0.509  1.00 15.98 ? 295 GLY A N     1 
ATOM   2324 C  CA    . GLY A 1 298 ? 47.057 -25.749 0.060   1.00 15.65 ? 295 GLY A CA    1 
ATOM   2325 C  C     . GLY A 1 298 ? 48.421 -25.870 -0.585  1.00 15.29 ? 295 GLY A C     1 
ATOM   2326 O  O     . GLY A 1 298 ? 49.433 -26.043 0.103   1.00 12.23 ? 295 GLY A O     1 
ATOM   2327 N  N     . SER A 1 299 ? 48.453 -25.796 -1.913  1.00 10.50 ? 296 SER A N     1 
ATOM   2328 C  CA    . SER A 1 299 ? 49.726 -25.838 -2.632  1.00 10.17 ? 296 SER A CA    1 
ATOM   2329 C  C     . SER A 1 299 ? 50.556 -24.612 -2.299  1.00 12.88 ? 296 SER A C     1 
ATOM   2330 O  O     . SER A 1 299 ? 51.780 -24.698 -2.135  1.00 14.10 ? 296 SER A O     1 
ATOM   2331 C  CB    . SER A 1 299 ? 49.494 -25.919 -4.141  1.00 15.73 ? 296 SER A CB    1 
ATOM   2332 O  OG    . SER A 1 299 ? 48.947 -27.176 -4.487  1.00 17.11 ? 296 SER A OG    1 
ATOM   2333 N  N     . TRP A 1 300 ? 49.895 -23.463 -2.203  1.00 15.09 ? 297 TRP A N     1 
ATOM   2334 C  CA    . TRP A 1 300 ? 50.610 -22.232 -1.867  1.00 14.49 ? 297 TRP A CA    1 
ATOM   2335 C  C     . TRP A 1 300 ? 51.270 -22.322 -0.488  1.00 14.78 ? 297 TRP A C     1 
ATOM   2336 O  O     . TRP A 1 300 ? 52.440 -21.965 -0.323  1.00 14.99 ? 297 TRP A O     1 
ATOM   2337 C  CB    . TRP A 1 300 ? 49.674 -21.023 -1.951  1.00 17.17 ? 297 TRP A CB    1 
ATOM   2338 C  CG    . TRP A 1 300 ? 50.353 -19.716 -1.690  1.00 16.17 ? 297 TRP A CG    1 
ATOM   2339 C  CD1   . TRP A 1 300 ? 51.026 -18.943 -2.593  1.00 19.30 ? 297 TRP A CD1   1 
ATOM   2340 C  CD2   . TRP A 1 300 ? 50.406 -19.013 -0.440  1.00 11.40 ? 297 TRP A CD2   1 
ATOM   2341 N  NE1   . TRP A 1 300 ? 51.502 -17.804 -1.978  1.00 21.29 ? 297 TRP A NE1   1 
ATOM   2342 C  CE2   . TRP A 1 300 ? 51.138 -17.827 -0.657  1.00 15.01 ? 297 TRP A CE2   1 
ATOM   2343 C  CE3   . TRP A 1 300 ? 49.919 -19.279 0.843   1.00 16.61 ? 297 TRP A CE3   1 
ATOM   2344 C  CZ2   . TRP A 1 300 ? 51.378 -16.903 0.360   1.00 12.90 ? 297 TRP A CZ2   1 
ATOM   2345 C  CZ3   . TRP A 1 300 ? 50.165 -18.362 1.850   1.00 21.85 ? 297 TRP A CZ3   1 
ATOM   2346 C  CH2   . TRP A 1 300 ? 50.890 -17.191 1.602   1.00 15.18 ? 297 TRP A CH2   1 
ATOM   2347 N  N     . LEU A 1 301 ? 50.512 -22.801 0.496   1.00 12.98 ? 298 LEU A N     1 
ATOM   2348 C  CA    . LEU A 1 301 ? 51.023 -22.958 1.856   1.00 11.35 ? 298 LEU A CA    1 
ATOM   2349 C  C     . LEU A 1 301 ? 52.164 -23.958 1.930   1.00 12.25 ? 298 LEU A C     1 
ATOM   2350 O  O     . LEU A 1 301 ? 53.140 -23.743 2.645   1.00 12.39 ? 298 LEU A O     1 
ATOM   2351 C  CB    . LEU A 1 301 ? 49.911 -23.400 2.809   1.00 10.08 ? 298 LEU A CB    1 
ATOM   2352 C  CG    . LEU A 1 301 ? 48.825 -22.353 3.100   1.00 16.38 ? 298 LEU A CG    1 
ATOM   2353 C  CD1   . LEU A 1 301 ? 47.592 -23.013 3.722   1.00 16.91 ? 298 LEU A CD1   1 
ATOM   2354 C  CD2   . LEU A 1 301 ? 49.353 -21.252 4.009   1.00 14.90 ? 298 LEU A CD2   1 
ATOM   2355 N  N     . TYR A 1 302 ? 52.028 -25.062 1.205   1.00 12.54 ? 299 TYR A N     1 
ATOM   2356 C  CA    . TYR A 1 302 ? 53.065 -26.088 1.196   1.00 9.70  ? 299 TYR A CA    1 
ATOM   2357 C  C     . TYR A 1 302 ? 54.406 -25.517 0.748   1.00 13.20 ? 299 TYR A C     1 
ATOM   2358 O  O     . TYR A 1 302 ? 55.444 -25.738 1.389   1.00 13.28 ? 299 TYR A O     1 
ATOM   2359 C  CB    . TYR A 1 302 ? 52.658 -27.261 0.289   1.00 9.46  ? 299 TYR A CB    1 
ATOM   2360 C  CG    . TYR A 1 302 ? 53.652 -28.405 0.349   1.00 13.21 ? 299 TYR A CG    1 
ATOM   2361 C  CD1   . TYR A 1 302 ? 53.593 -29.345 1.369   1.00 12.69 ? 299 TYR A CD1   1 
ATOM   2362 C  CD2   . TYR A 1 302 ? 54.673 -28.514 -0.587  1.00 19.25 ? 299 TYR A CD2   1 
ATOM   2363 C  CE1   . TYR A 1 302 ? 54.519 -30.383 1.440   1.00 15.80 ? 299 TYR A CE1   1 
ATOM   2364 C  CE2   . TYR A 1 302 ? 55.603 -29.542 -0.521  1.00 18.59 ? 299 TYR A CE2   1 
ATOM   2365 C  CZ    . TYR A 1 302 ? 55.513 -30.474 0.493   1.00 25.45 ? 299 TYR A CZ    1 
ATOM   2366 O  OH    . TYR A 1 302 ? 56.433 -31.494 0.561   1.00 24.66 ? 299 TYR A OH    1 
ATOM   2367 N  N     . ALA A 1 303 ? 54.388 -24.779 -0.355  1.00 10.93 ? 300 ALA A N     1 
ATOM   2368 C  CA    . ALA A 1 303 ? 55.605 -24.140 -0.835  1.00 10.82 ? 300 ALA A CA    1 
ATOM   2369 C  C     . ALA A 1 303 ? 56.041 -22.959 0.044   1.00 11.82 ? 300 ALA A C     1 
ATOM   2370 O  O     . ALA A 1 303 ? 57.223 -22.805 0.348   1.00 10.15 ? 300 ALA A O     1 
ATOM   2371 C  CB    . ALA A 1 303 ? 55.434 -23.699 -2.297  1.00 16.69 ? 300 ALA A CB    1 
ATOM   2372 N  N     . MET A 1 304 ? 55.094 -22.130 0.465   1.00 12.82 ? 301 MET A N     1 
ATOM   2373 C  CA    . MET A 1 304 ? 55.459 -20.900 1.167   1.00 10.59 ? 301 MET A CA    1 
ATOM   2374 C  C     . MET A 1 304 ? 56.174 -21.156 2.490   1.00 10.58 ? 301 MET A C     1 
ATOM   2375 O  O     . MET A 1 304 ? 57.091 -20.422 2.849   1.00 11.69 ? 301 MET A O     1 
ATOM   2376 C  CB    . MET A 1 304 ? 54.225 -20.037 1.433   1.00 10.53 ? 301 MET A CB    1 
ATOM   2377 C  CG    . MET A 1 304 ? 54.559 -18.608 1.852   1.00 15.42 ? 301 MET A CG    1 
ATOM   2378 S  SD    . MET A 1 304 ? 55.289 -17.706 0.476   1.00 16.05 ? 301 MET A SD    1 
ATOM   2379 C  CE    . MET A 1 304 ? 57.020 -17.634 0.945   1.00 14.22 ? 301 MET A CE    1 
ATOM   2380 N  N     . CYS A 1 305 ? 55.752 -22.182 3.221   1.00 10.26 ? 302 CYS A N     1 
ATOM   2381 C  CA    . CYS A 1 305 ? 56.357 -22.438 4.528   1.00 10.82 ? 302 CYS A CA    1 
ATOM   2382 C  C     . CYS A 1 305 ? 57.801 -22.930 4.362   1.00 10.23 ? 302 CYS A C     1 
ATOM   2383 O  O     . CYS A 1 305 ? 58.560 -22.978 5.325   1.00 13.51 ? 302 CYS A O     1 
ATOM   2384 C  CB    . CYS A 1 305 ? 55.526 -23.421 5.367   1.00 9.84  ? 302 CYS A CB    1 
ATOM   2385 S  SG    . CYS A 1 305 ? 55.532 -25.144 4.768   1.00 11.15 ? 302 CYS A SG    1 
ATOM   2386 N  N     . ARG A 1 306 ? 58.167 -23.270 3.130   1.00 10.60 ? 303 ARG A N     1 
ATOM   2387 C  CA    . ARG A 1 306 ? 59.538 -23.644 2.789   1.00 11.55 ? 303 ARG A CA    1 
ATOM   2388 C  C     . ARG A 1 306 ? 60.292 -22.478 2.134   1.00 14.49 ? 303 ARG A C     1 
ATOM   2389 O  O     . ARG A 1 306 ? 61.435 -22.629 1.689   1.00 13.90 ? 303 ARG A O     1 
ATOM   2390 C  CB    . ARG A 1 306 ? 59.530 -24.885 1.885   1.00 12.28 ? 303 ARG A CB    1 
ATOM   2391 C  CG    . ARG A 1 306 ? 59.017 -26.129 2.609   1.00 12.05 ? 303 ARG A CG    1 
ATOM   2392 C  CD    . ARG A 1 306 ? 58.738 -27.320 1.679   1.00 15.88 ? 303 ARG A CD    1 
ATOM   2393 N  NE    . ARG A 1 306 ? 58.516 -28.525 2.474   1.00 14.56 ? 303 ARG A NE    1 
ATOM   2394 C  CZ    . ARG A 1 306 ? 57.387 -28.806 3.118   1.00 12.16 ? 303 ARG A CZ    1 
ATOM   2395 N  NH1   . ARG A 1 306 ? 57.296 -29.921 3.835   1.00 15.89 ? 303 ARG A NH1   1 
ATOM   2396 N  NH2   . ARG A 1 306 ? 56.347 -27.981 3.048   1.00 10.10 ? 303 ARG A NH2   1 
ATOM   2397 N  N     . GLY A 1 307 ? 59.648 -21.313 2.086   1.00 11.19 ? 304 GLY A N     1 
ATOM   2398 C  CA    . GLY A 1 307 ? 60.257 -20.111 1.542   1.00 14.38 ? 304 GLY A CA    1 
ATOM   2399 C  C     . GLY A 1 307 ? 60.082 -19.983 0.039   1.00 13.23 ? 304 GLY A C     1 
ATOM   2400 O  O     . GLY A 1 307 ? 60.754 -19.173 -0.614  1.00 14.64 ? 304 GLY A O     1 
ATOM   2401 N  N     . ILE A 1 308 ? 59.180 -20.785 -0.512  1.00 9.81  ? 305 ILE A N     1 
ATOM   2402 C  CA    . ILE A 1 308 ? 59.000 -20.847 -1.964  1.00 12.64 ? 305 ILE A CA    1 
ATOM   2403 C  C     . ILE A 1 308 ? 57.644 -20.311 -2.408  1.00 11.43 ? 305 ILE A C     1 
ATOM   2404 O  O     . ILE A 1 308 ? 56.617 -20.657 -1.835  1.00 11.46 ? 305 ILE A O     1 
ATOM   2405 C  CB    . ILE A 1 308 ? 59.160 -22.295 -2.460  1.00 12.61 ? 305 ILE A CB    1 
ATOM   2406 C  CG1   . ILE A 1 308 ? 60.527 -22.839 -2.034  1.00 14.59 ? 305 ILE A CG1   1 
ATOM   2407 C  CG2   . ILE A 1 308 ? 58.964 -22.372 -3.963  1.00 17.97 ? 305 ILE A CG2   1 
ATOM   2408 C  CD1   . ILE A 1 308 ? 60.683 -24.334 -2.271  1.00 28.15 ? 305 ILE A CD1   1 
ATOM   2409 N  N     . GLU A 1 309 ? 57.652 -19.460 -3.432  1.00 9.31  ? 306 GLU A N     1 
ATOM   2410 C  CA    . GLU A 1 309 ? 56.426 -18.836 -3.925  1.00 13.83 ? 306 GLU A CA    1 
ATOM   2411 C  C     . GLU A 1 309 ? 56.688 -18.328 -5.332  1.00 20.17 ? 306 GLU A C     1 
ATOM   2412 O  O     . GLU A 1 309 ? 57.779 -17.847 -5.620  1.00 16.94 ? 306 GLU A O     1 
ATOM   2413 C  CB    . GLU A 1 309 ? 56.026 -17.664 -3.034  1.00 18.81 ? 306 GLU A CB    1 
ATOM   2414 C  CG    . GLU A 1 309 ? 54.563 -17.320 -3.132  1.00 25.76 ? 306 GLU A CG    1 
ATOM   2415 C  CD    . GLU A 1 309 ? 54.297 -15.845 -3.327  1.00 26.16 ? 306 GLU A CD    1 
ATOM   2416 O  OE1   . GLU A 1 309 ? 55.261 -15.050 -3.463  1.00 23.96 ? 306 GLU A OE1   1 
ATOM   2417 O  OE2   . GLU A 1 309 ? 53.102 -15.481 -3.344  1.00 28.63 ? 306 GLU A OE2   1 
ATOM   2418 N  N     . HIS A 1 310 ? 55.697 -18.417 -6.211  1.00 19.29 ? 307 HIS A N     1 
ATOM   2419 C  CA    . HIS A 1 310 ? 55.964 -18.148 -7.622  1.00 21.90 ? 307 HIS A CA    1 
ATOM   2420 C  C     . HIS A 1 310 ? 55.201 -16.978 -8.232  1.00 16.95 ? 307 HIS A C     1 
ATOM   2421 O  O     . HIS A 1 310 ? 55.368 -16.696 -9.419  1.00 21.94 ? 307 HIS A O     1 
ATOM   2422 C  CB    . HIS A 1 310 ? 55.747 -19.414 -8.451  1.00 28.72 ? 307 HIS A CB    1 
ATOM   2423 C  CG    . HIS A 1 310 ? 56.735 -20.499 -8.152  1.00 30.41 ? 307 HIS A CG    1 
ATOM   2424 N  ND1   . HIS A 1 310 ? 58.098 -20.300 -8.212  1.00 30.88 ? 307 HIS A ND1   1 
ATOM   2425 C  CD2   . HIS A 1 310 ? 56.557 -21.793 -7.796  1.00 34.84 ? 307 HIS A CD2   1 
ATOM   2426 C  CE1   . HIS A 1 310 ? 58.718 -21.426 -7.907  1.00 41.73 ? 307 HIS A CE1   1 
ATOM   2427 N  NE2   . HIS A 1 310 ? 57.807 -22.347 -7.651  1.00 32.15 ? 307 HIS A NE2   1 
ATOM   2428 N  N     . ASP A 1 311 ? 54.370 -16.301 -7.440  1.00 15.07 ? 308 ASP A N     1 
ATOM   2429 C  CA    . ASP A 1 311 ? 53.617 -15.156 -7.962  1.00 14.78 ? 308 ASP A CA    1 
ATOM   2430 C  C     . ASP A 1 311 ? 54.562 -14.182 -8.676  1.00 16.71 ? 308 ASP A C     1 
ATOM   2431 O  O     . ASP A 1 311 ? 55.528 -13.712 -8.087  1.00 14.79 ? 308 ASP A O     1 
ATOM   2432 C  CB    . ASP A 1 311 ? 52.883 -14.439 -6.836  1.00 16.21 ? 308 ASP A CB    1 
ATOM   2433 C  CG    . ASP A 1 311 ? 51.926 -13.376 -7.352  1.00 22.97 ? 308 ASP A CG    1 
ATOM   2434 O  OD1   . ASP A 1 311 ? 51.698 -12.380 -6.641  1.00 35.97 ? 308 ASP A OD1   1 
ATOM   2435 O  OD2   . ASP A 1 311 ? 51.391 -13.547 -8.466  1.00 34.96 ? 308 ASP A OD2   1 
ATOM   2436 N  N     . PRO A 1 312 ? 54.291 -13.875 -9.956  1.00 15.22 ? 309 PRO A N     1 
ATOM   2437 C  CA    . PRO A 1 312 ? 55.247 -13.004 -10.648 1.00 12.24 ? 309 PRO A CA    1 
ATOM   2438 C  C     . PRO A 1 312 ? 55.080 -11.531 -10.298 1.00 10.05 ? 309 PRO A C     1 
ATOM   2439 O  O     . PRO A 1 312 ? 54.014 -11.105 -9.865  1.00 13.51 ? 309 PRO A O     1 
ATOM   2440 C  CB    . PRO A 1 312 ? 54.915 -13.222 -12.133 1.00 15.81 ? 309 PRO A CB    1 
ATOM   2441 C  CG    . PRO A 1 312 ? 53.501 -13.656 -12.144 1.00 17.35 ? 309 PRO A CG    1 
ATOM   2442 C  CD    . PRO A 1 312 ? 53.265 -14.420 -10.865 1.00 19.09 ? 309 PRO A CD    1 
ATOM   2443 N  N     . VAL A 1 313 ? 56.150 -10.762 -10.474 1.00 13.60 ? 310 VAL A N     1 
ATOM   2444 C  CA    . VAL A 1 313 ? 56.047 -9.315  -10.386 1.00 11.77 ? 310 VAL A CA    1 
ATOM   2445 C  C     . VAL A 1 313 ? 55.372 -8.886  -11.671 1.00 12.46 ? 310 VAL A C     1 
ATOM   2446 O  O     . VAL A 1 313 ? 55.947 -9.045  -12.744 1.00 17.57 ? 310 VAL A O     1 
ATOM   2447 C  CB    . VAL A 1 313 ? 57.429 -8.663  -10.303 1.00 14.59 ? 310 VAL A CB    1 
ATOM   2448 C  CG1   . VAL A 1 313 ? 57.311 -7.143  -10.354 1.00 14.52 ? 310 VAL A CG1   1 
ATOM   2449 C  CG2   . VAL A 1 313 ? 58.109 -9.090  -9.031  1.00 12.35 ? 310 VAL A CG2   1 
ATOM   2450 N  N     . LYS A 1 314 ? 54.148 -8.372  -11.562 1.00 16.88 ? 311 LYS A N     1 
ATOM   2451 C  CA    . LYS A 1 314 ? 53.379 -8.001  -12.742 1.00 17.19 ? 311 LYS A CA    1 
ATOM   2452 C  C     . LYS A 1 314 ? 53.862 -6.671  -13.272 1.00 12.75 ? 311 LYS A C     1 
ATOM   2453 O  O     . LYS A 1 314 ? 54.103 -5.746  -12.501 1.00 14.89 ? 311 LYS A O     1 
ATOM   2454 C  CB    . LYS A 1 314 ? 51.893 -7.882  -12.405 1.00 16.58 ? 311 LYS A CB    1 
ATOM   2455 C  CG    . LYS A 1 314 ? 51.373 -8.939  -11.457 1.00 29.03 ? 311 LYS A CG    1 
ATOM   2456 C  CD    . LYS A 1 314 ? 51.170 -10.259 -12.164 1.00 24.75 ? 311 LYS A CD    1 
ATOM   2457 C  CE    . LYS A 1 314 ? 50.470 -11.257 -11.255 1.00 31.30 ? 311 LYS A CE    1 
ATOM   2458 N  NZ    . LYS A 1 314 ? 51.263 -11.533 -10.016 1.00 30.84 ? 311 LYS A NZ    1 
ATOM   2459 N  N     . PRO A 1 315 ? 54.002 -6.567  -14.598 1.00 14.50 ? 312 PRO A N     1 
ATOM   2460 C  CA    . PRO A 1 315 ? 54.384 -5.310  -15.241 1.00 18.90 ? 312 PRO A CA    1 
ATOM   2461 C  C     . PRO A 1 315 ? 53.213 -4.340  -15.206 1.00 19.01 ? 312 PRO A C     1 
ATOM   2462 O  O     . PRO A 1 315 ? 52.442 -4.263  -16.161 1.00 17.27 ? 312 PRO A O     1 
ATOM   2463 C  CB    . PRO A 1 315 ? 54.689 -5.735  -16.686 1.00 19.46 ? 312 PRO A CB    1 
ATOM   2464 C  CG    . PRO A 1 315 ? 53.874 -6.980  -16.895 1.00 16.18 ? 312 PRO A CG    1 
ATOM   2465 C  CD    . PRO A 1 315 ? 53.861 -7.675  -15.560 1.00 14.98 ? 312 PRO A CD    1 
ATOM   2466 N  N     . ARG A 1 316 ? 53.064 -3.617  -14.101 1.00 14.59 ? 313 ARG A N     1 
ATOM   2467 C  CA    . ARG A 1 316 ? 51.957 -2.674  -13.976 1.00 14.68 ? 313 ARG A CA    1 
ATOM   2468 C  C     . ARG A 1 316 ? 52.297 -1.546  -13.012 1.00 23.15 ? 313 ARG A C     1 
ATOM   2469 O  O     . ARG A 1 316 ? 52.412 -1.759  -11.803 1.00 17.30 ? 313 ARG A O     1 
ATOM   2470 C  CB    . ARG A 1 316 ? 50.673 -3.373  -13.526 1.00 17.75 ? 313 ARG A CB    1 
ATOM   2471 C  CG    . ARG A 1 316 ? 49.483 -2.416  -13.447 1.00 18.58 ? 313 ARG A CG    1 
ATOM   2472 C  CD    . ARG A 1 316 ? 48.236 -3.084  -12.914 1.00 21.21 ? 313 ARG A CD    1 
ATOM   2473 N  NE    . ARG A 1 316 ? 48.474 -3.689  -11.612 1.00 21.40 ? 313 ARG A NE    1 
ATOM   2474 C  CZ    . ARG A 1 316 ? 48.487 -3.032  -10.457 1.00 27.07 ? 313 ARG A CZ    1 
ATOM   2475 N  NH1   . ARG A 1 316 ? 48.274 -1.714  -10.422 1.00 24.54 ? 313 ARG A NH1   1 
ATOM   2476 N  NH2   . ARG A 1 316 ? 48.721 -3.701  -9.331  1.00 25.87 ? 313 ARG A NH2   1 
ATOM   2477 N  N     . GLN A 1 317 ? 52.438 -0.345  -13.560 1.00 15.26 ? 314 GLN A N     1 
ATOM   2478 C  CA    . GLN A 1 317 ? 52.828 0.818   -12.776 1.00 23.42 ? 314 GLN A CA    1 
ATOM   2479 C  C     . GLN A 1 317 ? 51.629 1.698   -12.423 1.00 21.95 ? 314 GLN A C     1 
ATOM   2480 O  O     . GLN A 1 317 ? 51.672 2.462   -11.458 1.00 20.77 ? 314 GLN A O     1 
ATOM   2481 C  CB    . GLN A 1 317 ? 53.870 1.633   -13.548 1.00 27.29 ? 314 GLN A CB    1 
ATOM   2482 C  CG    . GLN A 1 317 ? 54.501 2.750   -12.750 1.00 35.56 ? 314 GLN A CG    1 
ATOM   2483 C  CD    . GLN A 1 317 ? 55.521 3.520   -13.549 1.00 29.10 ? 314 GLN A CD    1 
ATOM   2484 O  OE1   . GLN A 1 317 ? 55.919 3.101   -14.637 1.00 45.10 ? 314 GLN A OE1   1 
ATOM   2485 N  NE2   . GLN A 1 317 ? 55.953 4.656   -13.017 1.00 30.79 ? 314 GLN A NE2   1 
ATOM   2486 N  N     . LEU A 1 318 ? 50.561 1.583   -13.207 1.00 19.58 ? 315 LEU A N     1 
ATOM   2487 C  CA    . LEU A 1 318 ? 49.362 2.399   -13.011 1.00 19.72 ? 315 LEU A CA    1 
ATOM   2488 C  C     . LEU A 1 318 ? 48.267 1.627   -12.295 1.00 15.89 ? 315 LEU A C     1 
ATOM   2489 O  O     . LEU A 1 318 ? 48.096 0.432   -12.525 1.00 14.61 ? 315 LEU A O     1 
ATOM   2490 C  CB    . LEU A 1 318 ? 48.796 2.842   -14.361 1.00 16.34 ? 315 LEU A CB    1 
ATOM   2491 C  CG    . LEU A 1 318 ? 49.673 3.686   -15.281 1.00 21.90 ? 315 LEU A CG    1 
ATOM   2492 C  CD1   . LEU A 1 318 ? 48.899 4.005   -16.560 1.00 16.37 ? 315 LEU A CD1   1 
ATOM   2493 C  CD2   . LEU A 1 318 ? 50.143 4.966   -14.588 1.00 22.78 ? 315 LEU A CD2   1 
ATOM   2494 N  N     . PRO A 1 319 ? 47.486 2.317   -11.457 1.00 15.53 ? 316 PRO A N     1 
ATOM   2495 C  CA    . PRO A 1 319 ? 46.310 1.658   -10.870 1.00 13.50 ? 316 PRO A CA    1 
ATOM   2496 C  C     . PRO A 1 319 ? 45.286 1.234   -11.932 1.00 14.92 ? 316 PRO A C     1 
ATOM   2497 O  O     . PRO A 1 319 ? 45.166 1.906   -12.954 1.00 20.47 ? 316 PRO A O     1 
ATOM   2498 C  CB    . PRO A 1 319 ? 45.730 2.729   -9.937  1.00 18.46 ? 316 PRO A CB    1 
ATOM   2499 C  CG    . PRO A 1 319 ? 46.333 4.015   -10.382 1.00 20.74 ? 316 PRO A CG    1 
ATOM   2500 C  CD    . PRO A 1 319 ? 47.670 3.693   -10.960 1.00 14.05 ? 316 PRO A CD    1 
ATOM   2501 N  N     . LYS A 1 320 ? 44.582 0.129   -11.681 1.00 14.66 ? 317 LYS A N     1 
ATOM   2502 C  CA    . LYS A 1 320 ? 43.603 -0.456  -12.607 1.00 15.36 ? 317 LYS A CA    1 
ATOM   2503 C  C     . LYS A 1 320 ? 42.225 0.176   -12.475 1.00 17.13 ? 317 LYS A C     1 
ATOM   2504 O  O     . LYS A 1 320 ? 41.352 -0.043  -13.312 1.00 19.11 ? 317 LYS A O     1 
ATOM   2505 C  CB    . LYS A 1 320 ? 43.423 -1.953  -12.316 1.00 19.37 ? 317 LYS A CB    1 
ATOM   2506 C  CG    . LYS A 1 320 ? 44.576 -2.851  -12.689 1.00 27.80 ? 317 LYS A CG    1 
ATOM   2507 C  CD    . LYS A 1 320 ? 44.137 -4.312  -12.581 1.00 28.52 ? 317 LYS A CD    1 
ATOM   2508 C  CE    . LYS A 1 320 ? 45.185 -5.250  -13.137 1.00 41.96 ? 317 LYS A CE    1 
ATOM   2509 N  NZ    . LYS A 1 320 ? 44.708 -6.654  -13.120 1.00 39.50 ? 317 LYS A NZ    1 
ATOM   2510 N  N     . THR A 1 321 ? 42.020 0.914   -11.389 1.00 14.18 ? 318 THR A N     1 
ATOM   2511 C  CA    . THR A 1 321 ? 40.739 1.544   -11.119 1.00 15.47 ? 318 THR A CA    1 
ATOM   2512 C  C     . THR A 1 321 ? 40.979 2.927   -10.539 1.00 14.75 ? 318 THR A C     1 
ATOM   2513 O  O     . THR A 1 321 ? 42.032 3.199   -9.952  1.00 18.66 ? 318 THR A O     1 
ATOM   2514 C  CB    . THR A 1 321 ? 39.873 0.725   -10.123 1.00 23.56 ? 318 THR A CB    1 
ATOM   2515 O  OG1   . THR A 1 321 ? 40.605 0.491   -8.913  1.00 18.89 ? 318 THR A OG1   1 
ATOM   2516 C  CG2   . THR A 1 321 ? 39.461 -0.609  -10.716 1.00 24.69 ? 318 THR A CG2   1 
ATOM   2517 N  N     . ILE A 1 322 ? 40.006 3.805   -10.729 1.00 12.96 ? 319 ILE A N     1 
ATOM   2518 C  CA    . ILE A 1 322 ? 40.052 5.140   -10.158 1.00 17.09 ? 319 ILE A CA    1 
ATOM   2519 C  C     . ILE A 1 322 ? 38.710 5.361   -9.496  1.00 14.47 ? 319 ILE A C     1 
ATOM   2520 O  O     . ILE A 1 322 ? 37.677 5.391   -10.163 1.00 16.56 ? 319 ILE A O     1 
ATOM   2521 C  CB    . ILE A 1 322 ? 40.314 6.205   -11.233 1.00 12.47 ? 319 ILE A CB    1 
ATOM   2522 C  CG1   . ILE A 1 322 ? 41.671 5.935   -11.903 1.00 23.28 ? 319 ILE A CG1   1 
ATOM   2523 C  CG2   . ILE A 1 322 ? 40.247 7.622   -10.632 1.00 15.44 ? 319 ILE A CG2   1 
ATOM   2524 C  CD1   . ILE A 1 322 ? 42.038 6.914   -13.016 1.00 18.77 ? 319 ILE A CD1   1 
ATOM   2525 N  N     . GLY A 1 323 ? 38.714 5.463   -8.175  1.00 13.47 ? 320 GLY A N     1 
ATOM   2526 C  CA    . GLY A 1 323 ? 37.467 5.570   -7.450  1.00 15.75 ? 320 GLY A CA    1 
ATOM   2527 C  C     . GLY A 1 323 ? 37.458 6.663   -6.405  1.00 14.06 ? 320 GLY A C     1 
ATOM   2528 O  O     . GLY A 1 323 ? 38.494 7.190   -6.014  1.00 15.74 ? 320 GLY A O     1 
ATOM   2529 N  N     . CYS A 1 324 ? 36.261 7.002   -5.952  0.99 15.58 ? 321 CYS A N     1 
ATOM   2530 C  CA    B CYS A 1 324 ? 36.052 8.018   -4.918  0.39 19.28 ? 321 CYS A CA    1 
ATOM   2531 C  CA    C CYS A 1 324 ? 36.149 7.893   -4.818  0.61 19.17 ? 321 CYS A CA    1 
ATOM   2532 C  C     . CYS A 1 324 ? 34.910 7.546   -4.022  0.93 13.89 ? 321 CYS A C     1 
ATOM   2533 O  O     . CYS A 1 324 ? 33.912 7.042   -4.540  1.00 16.81 ? 321 CYS A O     1 
ATOM   2534 C  CB    B CYS A 1 324 ? 35.632 9.363   -5.539  0.39 24.11 ? 321 CYS A CB    1 
ATOM   2535 C  CB    C CYS A 1 324 ? 36.127 9.348   -5.260  0.61 25.94 ? 321 CYS A CB    1 
ATOM   2536 S  SG    B CYS A 1 324 ? 36.516 9.954   -7.017  0.39 18.67 ? 321 CYS A SG    1 
ATOM   2537 S  SG    C CYS A 1 324 ? 34.816 9.685   -6.406  0.61 24.00 ? 321 CYS A SG    1 
ATOM   2538 N  N     . SER A 1 325 ? 35.007 7.761   -2.720  1.00 16.93 ? 322 SER A N     1 
ATOM   2539 C  CA    . SER A 1 325 ? 33.917 7.365   -1.846  1.00 14.91 ? 322 SER A CA    1 
ATOM   2540 C  C     . SER A 1 325 ? 33.801 8.296   -0.661  1.00 19.50 ? 322 SER A C     1 
ATOM   2541 O  O     . SER A 1 325 ? 34.742 9.012   -0.313  1.00 15.80 ? 322 SER A O     1 
ATOM   2542 C  CB    . SER A 1 325 ? 34.119 5.935   -1.347  1.00 20.59 ? 322 SER A CB    1 
ATOM   2543 O  OG    . SER A 1 325 ? 35.329 5.831   -0.626  1.00 20.05 ? 322 SER A OG    1 
ATOM   2544 N  N     . LYS A 1 326 ? 32.636 8.268   -0.033  1.00 18.20 ? 323 LYS A N     1 
ATOM   2545 C  CA    . LYS A 1 326 ? 32.436 9.031   1.180   1.00 16.96 ? 323 LYS A CA    1 
ATOM   2546 C  C     . LYS A 1 326 ? 31.418 8.336   2.065   1.00 20.44 ? 323 LYS A C     1 
ATOM   2547 O  O     . LYS A 1 326 ? 30.393 7.848   1.584   1.00 17.90 ? 323 LYS A O     1 
ATOM   2548 C  CB    . LYS A 1 326 ? 31.977 10.449  0.845   1.00 15.84 ? 323 LYS A CB    1 
ATOM   2549 C  CG    . LYS A 1 326 ? 31.741 11.313  2.079   1.00 14.57 ? 323 LYS A CG    1 
ATOM   2550 C  CD    . LYS A 1 326 ? 31.347 12.724  1.687   1.00 20.33 ? 323 LYS A CD    1 
ATOM   2551 C  CE    . LYS A 1 326 ? 30.980 13.558  2.904   1.00 27.72 ? 323 LYS A CE    1 
ATOM   2552 N  NZ    . LYS A 1 326 ? 32.079 13.568  3.893   1.00 26.16 ? 323 LYS A NZ    1 
ATOM   2553 N  N     . ASN A 1 327 ? 31.738 8.258   3.350   1.00 15.62 ? 324 ASN A N     1 
ATOM   2554 C  CA    . ASN A 1 327 ? 30.812 7.771   4.356   1.00 19.65 ? 324 ASN A CA    1 
ATOM   2555 C  C     . ASN A 1 327 ? 29.948 8.897   4.889   1.00 23.28 ? 324 ASN A C     1 
ATOM   2556 O  O     . ASN A 1 327 ? 30.378 10.050  4.948   1.00 19.34 ? 324 ASN A O     1 
ATOM   2557 C  CB    . ASN A 1 327 ? 31.562 7.132   5.522   1.00 16.55 ? 324 ASN A CB    1 
ATOM   2558 C  CG    . ASN A 1 327 ? 32.254 5.850   5.133   1.00 22.87 ? 324 ASN A CG    1 
ATOM   2559 O  OD1   . ASN A 1 327 ? 31.975 5.278   4.081   1.00 29.86 ? 324 ASN A OD1   1 
ATOM   2560 N  ND2   . ASN A 1 327 ? 33.158 5.385   5.986   1.00 24.27 ? 324 ASN A ND2   1 
ATOM   2561 N  N     . PHE A 1 328 ? 28.729 8.546   5.281   1.00 24.56 ? 325 PHE A N     1 
ATOM   2562 C  CA    . PHE A 1 328 ? 27.804 9.484   5.902   1.00 27.39 ? 325 PHE A CA    1 
ATOM   2563 C  C     . PHE A 1 328 ? 27.287 8.808   7.166   1.00 30.20 ? 325 PHE A C     1 
ATOM   2564 O  O     . PHE A 1 328 ? 26.198 8.233   7.174   1.00 32.80 ? 325 PHE A O     1 
ATOM   2565 C  CB    . PHE A 1 328 ? 26.668 9.820   4.936   1.00 26.53 ? 325 PHE A CB    1 
ATOM   2566 C  CG    . PHE A 1 328 ? 27.147 10.349  3.613   1.00 24.94 ? 325 PHE A CG    1 
ATOM   2567 C  CD1   . PHE A 1 328 ? 27.461 9.479   2.580   1.00 29.10 ? 325 PHE A CD1   1 
ATOM   2568 C  CD2   . PHE A 1 328 ? 27.318 11.707  3.412   1.00 24.45 ? 325 PHE A CD2   1 
ATOM   2569 C  CE1   . PHE A 1 328 ? 27.915 9.957   1.369   1.00 19.85 ? 325 PHE A CE1   1 
ATOM   2570 C  CE2   . PHE A 1 328 ? 27.772 12.194  2.199   1.00 28.84 ? 325 PHE A CE2   1 
ATOM   2571 C  CZ    . PHE A 1 328 ? 28.075 11.313  1.175   1.00 24.24 ? 325 PHE A CZ    1 
ATOM   2572 N  N     . PRO A 1 329 ? 28.091 8.859   8.237   1.00 26.31 ? 326 PRO A N     1 
ATOM   2573 C  CA    . PRO A 1 329 ? 27.887 8.087   9.465   1.00 40.15 ? 326 PRO A CA    1 
ATOM   2574 C  C     . PRO A 1 329 ? 26.764 8.612   10.346  1.00 49.03 ? 326 PRO A C     1 
ATOM   2575 O  O     . PRO A 1 329 ? 26.367 9.769   10.223  1.00 34.45 ? 326 PRO A O     1 
ATOM   2576 C  CB    . PRO A 1 329 ? 29.222 8.245   10.192  1.00 36.61 ? 326 PRO A CB    1 
ATOM   2577 C  CG    . PRO A 1 329 ? 29.725 9.568   9.742   1.00 41.05 ? 326 PRO A CG    1 
ATOM   2578 C  CD    . PRO A 1 329 ? 29.310 9.685   8.304   1.00 39.09 ? 326 PRO A CD    1 
ATOM   2579 N  N     . GLY A 1 330 ? 26.271 7.744   11.226  1.00 56.78 ? 327 GLY A N     1 
ATOM   2580 C  CA    . GLY A 1 330 ? 25.279 8.096   12.225  1.00 51.87 ? 327 GLY A CA    1 
ATOM   2581 C  C     . GLY A 1 330 ? 24.192 9.039   11.757  1.00 41.19 ? 327 GLY A C     1 
ATOM   2582 O  O     . GLY A 1 330 ? 23.290 8.651   11.015  1.00 51.66 ? 327 GLY A O     1 
ATOM   2583 N  N     . LYS A 1 331 ? 24.290 10.289  12.192  1.00 44.28 ? 328 LYS A N     1 
ATOM   2584 C  CA    . LYS A 1 331 ? 23.246 11.278  11.957  1.00 44.72 ? 328 LYS A CA    1 
ATOM   2585 C  C     . LYS A 1 331 ? 23.281 11.861  10.548  1.00 48.78 ? 328 LYS A C     1 
ATOM   2586 O  O     . LYS A 1 331 ? 22.272 12.359  10.050  1.00 48.96 ? 328 LYS A O     1 
ATOM   2587 C  CB    . LYS A 1 331 ? 23.348 12.394  13.003  1.00 58.54 ? 328 LYS A CB    1 
ATOM   2588 C  CG    . LYS A 1 331 ? 22.449 13.595  12.758  1.00 69.71 ? 328 LYS A CG    1 
ATOM   2589 C  CD    . LYS A 1 331 ? 22.125 14.304  14.067  1.00 78.83 ? 328 LYS A CD    1 
ATOM   2590 C  CE    . LYS A 1 331 ? 21.547 15.690  13.834  1.00 65.36 ? 328 LYS A CE    1 
ATOM   2591 N  NZ    . LYS A 1 331 ? 22.607 16.669  13.464  1.00 60.99 ? 328 LYS A NZ    1 
ATOM   2592 N  N     . THR A 1 332 ? 24.439 11.791  9.903   1.00 50.88 ? 329 THR A N     1 
ATOM   2593 C  CA    . THR A 1 332 ? 24.618 12.425  8.600   1.00 40.70 ? 329 THR A CA    1 
ATOM   2594 C  C     . THR A 1 332 ? 24.108 11.564  7.439   1.00 38.62 ? 329 THR A C     1 
ATOM   2595 O  O     . THR A 1 332 ? 24.149 11.985  6.283   1.00 39.41 ? 329 THR A O     1 
ATOM   2596 C  CB    . THR A 1 332 ? 26.098 12.795  8.358   1.00 44.47 ? 329 THR A CB    1 
ATOM   2597 O  OG1   . THR A 1 332 ? 26.879 11.601  8.242   1.00 36.33 ? 329 THR A OG1   1 
ATOM   2598 C  CG2   . THR A 1 332 ? 26.636 13.633  9.515   1.00 36.20 ? 329 THR A CG2   1 
ATOM   2599 N  N     . ALA A 1 333 ? 23.625 10.364  7.751   1.00 33.32 ? 330 ALA A N     1 
ATOM   2600 C  CA    . ALA A 1 333 ? 23.133 9.445   6.725   1.00 26.57 ? 330 ALA A CA    1 
ATOM   2601 C  C     . ALA A 1 333 ? 22.154 10.127  5.771   1.00 40.50 ? 330 ALA A C     1 
ATOM   2602 O  O     . ALA A 1 333 ? 21.181 10.743  6.202   1.00 46.68 ? 330 ALA A O     1 
ATOM   2603 C  CB    . ALA A 1 333 ? 22.488 8.228   7.369   1.00 37.58 ? 330 ALA A CB    1 
ATOM   2604 N  N     . LEU A 1 334 ? 22.421 10.016  4.473   1.00 46.18 ? 331 LEU A N     1 
ATOM   2605 C  CA    . LEU A 1 334 ? 21.588 10.647  3.454   1.00 38.68 ? 331 LEU A CA    1 
ATOM   2606 C  C     . LEU A 1 334 ? 20.178 10.058  3.456   1.00 44.35 ? 331 LEU A C     1 
ATOM   2607 O  O     . LEU A 1 334 ? 20.000 8.849   3.301   1.00 46.16 ? 331 LEU A O     1 
ATOM   2608 C  CB    . LEU A 1 334 ? 22.216 10.476  2.070   1.00 43.00 ? 331 LEU A CB    1 
ATOM   2609 C  CG    . LEU A 1 334 ? 23.668 10.929  1.919   1.00 38.16 ? 331 LEU A CG    1 
ATOM   2610 C  CD1   . LEU A 1 334 ? 24.090 10.838  0.461   1.00 39.64 ? 331 LEU A CD1   1 
ATOM   2611 C  CD2   . LEU A 1 334 ? 23.837 12.345  2.442   1.00 37.43 ? 331 LEU A CD2   1 
ATOM   2612 N  N     . ALA A 1 335 ? 19.179 10.921  3.617   1.00 50.71 ? 332 ALA A N     1 
ATOM   2613 C  CA    . ALA A 1 335 ? 17.801 10.466  3.792   1.00 58.89 ? 332 ALA A CA    1 
ATOM   2614 C  C     . ALA A 1 335 ? 16.821 11.077  2.791   1.00 51.44 ? 332 ALA A C     1 
ATOM   2615 O  O     . ALA A 1 335 ? 15.613 10.858  2.890   1.00 56.10 ? 332 ALA A O     1 
ATOM   2616 C  CB    . ALA A 1 335 ? 17.336 10.737  5.217   1.00 47.08 ? 332 ALA A CB    1 
ATOM   2617 N  N     . THR A 1 336 ? 17.338 11.841  1.834   1.00 53.73 ? 333 THR A N     1 
ATOM   2618 C  CA    . THR A 1 336 ? 16.498 12.438  0.800   1.00 51.97 ? 333 THR A CA    1 
ATOM   2619 C  C     . THR A 1 336 ? 17.109 12.286  -0.589  1.00 61.98 ? 333 THR A C     1 
ATOM   2620 O  O     . THR A 1 336 ? 18.306 12.494  -0.778  1.00 49.58 ? 333 THR A O     1 
ATOM   2621 C  CB    . THR A 1 336 ? 16.257 13.929  1.057   1.00 45.84 ? 333 THR A CB    1 
ATOM   2622 O  OG1   . THR A 1 336 ? 17.491 14.643  0.925   1.00 56.81 ? 333 THR A OG1   1 
ATOM   2623 C  CG2   . THR A 1 336 ? 15.689 14.148  2.452   1.00 58.34 ? 333 THR A CG2   1 
ATOM   2624 N  N     . ARG A 1 337 ? 16.274 11.929  -1.558  1.00 55.76 ? 334 ARG A N     1 
ATOM   2625 C  CA    . ARG A 1 337 ? 16.713 11.791  -2.940  1.00 48.56 ? 334 ARG A CA    1 
ATOM   2626 C  C     . ARG A 1 337 ? 17.613 12.954  -3.360  1.00 55.53 ? 334 ARG A C     1 
ATOM   2627 O  O     . ARG A 1 337 ? 18.618 12.756  -4.043  1.00 43.94 ? 334 ARG A O     1 
ATOM   2628 C  CB    . ARG A 1 337 ? 15.502 11.685  -3.869  1.00 58.08 ? 334 ARG A CB    1 
ATOM   2629 C  CG    . ARG A 1 337 ? 15.846 11.584  -5.343  1.00 63.18 ? 334 ARG A CG    1 
ATOM   2630 C  CD    . ARG A 1 337 ? 14.590 11.445  -6.192  1.00 60.86 ? 334 ARG A CD    1 
ATOM   2631 N  NE    . ARG A 1 337 ? 13.580 12.430  -5.820  1.00 66.79 ? 334 ARG A NE    1 
ATOM   2632 C  CZ    . ARG A 1 337 ? 13.643 13.720  -6.134  1.00 68.72 ? 334 ARG A CZ    1 
ATOM   2633 N  NH1   . ARG A 1 337 ? 14.674 14.189  -6.826  1.00 60.61 ? 334 ARG A NH1   1 
ATOM   2634 N  NH2   . ARG A 1 337 ? 12.676 14.543  -5.750  1.00 67.86 ? 334 ARG A NH2   1 
ATOM   2635 N  N     . GLU A 1 338 ? 17.251 14.162  -2.938  1.00 44.45 ? 335 GLU A N     1 
ATOM   2636 C  CA    . GLU A 1 338 ? 18.029 15.362  -3.240  1.00 35.89 ? 335 GLU A CA    1 
ATOM   2637 C  C     . GLU A 1 338 ? 19.461 15.271  -2.709  1.00 46.30 ? 335 GLU A C     1 
ATOM   2638 O  O     . GLU A 1 338 ? 20.418 15.603  -3.408  1.00 40.56 ? 335 GLU A O     1 
ATOM   2639 C  CB    . GLU A 1 338 ? 17.349 16.595  -2.642  1.00 54.78 ? 335 GLU A CB    1 
ATOM   2640 C  CG    . GLU A 1 338 ? 15.984 16.907  -3.228  1.00 67.33 ? 335 GLU A CG    1 
ATOM   2641 C  CD    . GLU A 1 338 ? 16.072 17.486  -4.624  1.00 68.04 ? 335 GLU A CD    1 
ATOM   2642 O  OE1   . GLU A 1 338 ? 17.167 17.952  -5.007  1.00 56.66 ? 335 GLU A OE1   1 
ATOM   2643 O  OE2   . GLU A 1 338 ? 15.047 17.473  -5.337  1.00 66.98 ? 335 GLU A OE2   1 
ATOM   2644 N  N     . GLN A 1 339 ? 19.600 14.841  -1.459  1.00 58.62 ? 336 GLN A N     1 
ATOM   2645 C  CA    . GLN A 1 339 ? 20.917 14.668  -0.856  1.00 46.19 ? 336 GLN A CA    1 
ATOM   2646 C  C     . GLN A 1 339 ? 21.726 13.655  -1.654  1.00 45.29 ? 336 GLN A C     1 
ATOM   2647 O  O     . GLN A 1 339 ? 22.851 13.930  -2.072  1.00 38.56 ? 336 GLN A O     1 
ATOM   2648 C  CB    . GLN A 1 339 ? 20.785 14.193  0.590   1.00 38.57 ? 336 GLN A CB    1 
ATOM   2649 C  CG    . GLN A 1 339 ? 20.434 15.284  1.587   1.00 44.83 ? 336 GLN A CG    1 
ATOM   2650 C  CD    . GLN A 1 339 ? 20.497 14.792  3.019   1.00 54.86 ? 336 GLN A CD    1 
ATOM   2651 O  OE1   . GLN A 1 339 ? 19.717 13.929  3.425   1.00 62.38 ? 336 GLN A OE1   1 
ATOM   2652 N  NE2   . GLN A 1 339 ? 21.439 15.328  3.790   1.00 53.02 ? 336 GLN A NE2   1 
ATOM   2653 N  N     . VAL A 1 340 ? 21.139 12.480  -1.854  1.00 39.14 ? 337 VAL A N     1 
ATOM   2654 C  CA    . VAL A 1 340 ? 21.774 11.417  -2.616  1.00 44.87 ? 337 VAL A CA    1 
ATOM   2655 C  C     . VAL A 1 340 ? 22.285 11.939  -3.957  1.00 39.28 ? 337 VAL A C     1 
ATOM   2656 O  O     . VAL A 1 340 ? 23.372 11.573  -4.401  1.00 32.84 ? 337 VAL A O     1 
ATOM   2657 C  CB    . VAL A 1 340 ? 20.806 10.239  -2.842  1.00 40.81 ? 337 VAL A CB    1 
ATOM   2658 C  CG1   . VAL A 1 340 ? 21.452 9.174   -3.704  1.00 32.48 ? 337 VAL A CG1   1 
ATOM   2659 C  CG2   . VAL A 1 340 ? 20.371 9.652   -1.508  1.00 38.14 ? 337 VAL A CG2   1 
ATOM   2660 N  N     . GLN A 1 341 ? 21.507 12.815  -4.585  1.00 43.17 ? 338 GLN A N     1 
ATOM   2661 C  CA    . GLN A 1 341 ? 21.861 13.357  -5.893  1.00 37.74 ? 338 GLN A CA    1 
ATOM   2662 C  C     . GLN A 1 341 ? 22.997 14.369  -5.827  1.00 44.26 ? 338 GLN A C     1 
ATOM   2663 O  O     . GLN A 1 341 ? 23.858 14.400  -6.707  1.00 40.13 ? 338 GLN A O     1 
ATOM   2664 C  CB    . GLN A 1 341 ? 20.644 13.996  -6.567  1.00 41.32 ? 338 GLN A CB    1 
ATOM   2665 C  CG    . GLN A 1 341 ? 19.596 13.000  -7.036  1.00 50.45 ? 338 GLN A CG    1 
ATOM   2666 C  CD    . GLN A 1 341 ? 18.420 13.670  -7.725  1.00 62.21 ? 338 GLN A CD    1 
ATOM   2667 O  OE1   . GLN A 1 341 ? 18.091 14.824  -7.441  1.00 56.32 ? 338 GLN A OE1   1 
ATOM   2668 N  NE2   . GLN A 1 341 ? 17.786 12.950  -8.643  1.00 57.21 ? 338 GLN A NE2   1 
ATOM   2669 N  N     . TRP A 1 342 ? 22.997 15.210  -4.799  1.00 27.79 ? 339 TRP A N     1 
ATOM   2670 C  CA    . TRP A 1 342 ? 24.036 16.220  -4.686  1.00 37.82 ? 339 TRP A CA    1 
ATOM   2671 C  C     . TRP A 1 342 ? 25.392 15.590  -4.386  1.00 21.16 ? 339 TRP A C     1 
ATOM   2672 O  O     . TRP A 1 342 ? 26.404 15.984  -4.961  1.00 25.54 ? 339 TRP A O     1 
ATOM   2673 C  CB    . TRP A 1 342 ? 23.702 17.270  -3.624  1.00 33.92 ? 339 TRP A CB    1 
ATOM   2674 C  CG    . TRP A 1 342 ? 24.671 18.410  -3.654  1.00 35.46 ? 339 TRP A CG    1 
ATOM   2675 C  CD1   . TRP A 1 342 ? 24.700 19.432  -4.556  1.00 34.50 ? 339 TRP A CD1   1 
ATOM   2676 C  CD2   . TRP A 1 342 ? 25.770 18.632  -2.762  1.00 33.73 ? 339 TRP A CD2   1 
ATOM   2677 N  NE1   . TRP A 1 342 ? 25.739 20.283  -4.276  1.00 43.21 ? 339 TRP A NE1   1 
ATOM   2678 C  CE2   . TRP A 1 342 ? 26.412 19.814  -3.179  1.00 36.88 ? 339 TRP A CE2   1 
ATOM   2679 C  CE3   . TRP A 1 342 ? 26.269 17.950  -1.649  1.00 33.08 ? 339 TRP A CE3   1 
ATOM   2680 C  CZ2   . TRP A 1 342 ? 27.528 20.330  -2.523  1.00 42.24 ? 339 TRP A CZ2   1 
ATOM   2681 C  CZ3   . TRP A 1 342 ? 27.377 18.464  -0.999  1.00 32.90 ? 339 TRP A CZ3   1 
ATOM   2682 C  CH2   . TRP A 1 342 ? 27.994 19.642  -1.438  1.00 39.08 ? 339 TRP A CH2   1 
ATOM   2683 N  N     . TRP A 1 343 ? 25.401 14.614  -3.486  1.00 23.81 ? 340 TRP A N     1 
ATOM   2684 C  CA    . TRP A 1 343 ? 26.643 13.955  -3.110  1.00 24.71 ? 340 TRP A CA    1 
ATOM   2685 C  C     . TRP A 1 343 ? 27.191 13.082  -4.230  1.00 24.19 ? 340 TRP A C     1 
ATOM   2686 O  O     . TRP A 1 343 ? 28.399 13.021  -4.435  1.00 20.94 ? 340 TRP A O     1 
ATOM   2687 C  CB    . TRP A 1 343 ? 26.479 13.153  -1.820  1.00 24.93 ? 340 TRP A CB    1 
ATOM   2688 C  CG    . TRP A 1 343 ? 26.544 14.023  -0.612  1.00 38.17 ? 340 TRP A CG    1 
ATOM   2689 C  CD1   . TRP A 1 343 ? 25.530 14.302  0.256   1.00 32.62 ? 340 TRP A CD1   1 
ATOM   2690 C  CD2   . TRP A 1 343 ? 27.684 14.760  -0.152  1.00 20.61 ? 340 TRP A CD2   1 
ATOM   2691 N  NE1   . TRP A 1 343 ? 25.973 15.158  1.239   1.00 41.67 ? 340 TRP A NE1   1 
ATOM   2692 C  CE2   . TRP A 1 343 ? 27.291 15.455  1.010   1.00 35.32 ? 340 TRP A CE2   1 
ATOM   2693 C  CE3   . TRP A 1 343 ? 29.000 14.897  -0.610  1.00 20.97 ? 340 TRP A CE3   1 
ATOM   2694 C  CZ2   . TRP A 1 343 ? 28.167 16.270  1.726   1.00 29.35 ? 340 TRP A CZ2   1 
ATOM   2695 C  CZ3   . TRP A 1 343 ? 29.869 15.706  0.100   1.00 21.59 ? 340 TRP A CZ3   1 
ATOM   2696 C  CH2   . TRP A 1 343 ? 29.448 16.384  1.259   1.00 32.65 ? 340 TRP A CH2   1 
ATOM   2697 N  N     . LEU A 1 344 ? 26.311 12.409  -4.961  1.00 18.21 ? 341 LEU A N     1 
ATOM   2698 C  CA    . LEU A 1 344 ? 26.774 11.640  -6.112  1.00 23.79 ? 341 LEU A CA    1 
ATOM   2699 C  C     . LEU A 1 344 ? 27.452 12.579  -7.097  1.00 23.23 ? 341 LEU A C     1 
ATOM   2700 O  O     . LEU A 1 344 ? 28.474 12.238  -7.693  1.00 18.82 ? 341 LEU A O     1 
ATOM   2701 C  CB    . LEU A 1 344 ? 25.634 10.866  -6.783  1.00 24.09 ? 341 LEU A CB    1 
ATOM   2702 C  CG    . LEU A 1 344 ? 25.163 9.581   -6.093  1.00 27.33 ? 341 LEU A CG    1 
ATOM   2703 C  CD1   . LEU A 1 344 ? 23.906 9.039   -6.766  1.00 38.50 ? 341 LEU A CD1   1 
ATOM   2704 C  CD2   . LEU A 1 344 ? 26.252 8.517   -6.063  1.00 33.64 ? 341 LEU A CD2   1 
ATOM   2705 N  N     . LEU A 1 345 ? 26.902 13.780  -7.248  1.00 22.37 ? 342 LEU A N     1 
ATOM   2706 C  CA    . LEU A 1 345 ? 27.518 14.765  -8.122  1.00 18.50 ? 342 LEU A CA    1 
ATOM   2707 C  C     . LEU A 1 345 ? 28.902 15.205  -7.633  1.00 20.75 ? 342 LEU A C     1 
ATOM   2708 O  O     . LEU A 1 345 ? 29.820 15.377  -8.432  1.00 17.91 ? 342 LEU A O     1 
ATOM   2709 C  CB    . LEU A 1 345 ? 26.614 15.990  -8.304  1.00 24.79 ? 342 LEU A CB    1 
ATOM   2710 C  CG    . LEU A 1 345 ? 27.202 17.112  -9.159  1.00 22.29 ? 342 LEU A CG    1 
ATOM   2711 C  CD1   . LEU A 1 345 ? 27.479 16.636  -10.585 1.00 23.82 ? 342 LEU A CD1   1 
ATOM   2712 C  CD2   . LEU A 1 345 ? 26.260 18.311  -9.184  1.00 32.78 ? 342 LEU A CD2   1 
ATOM   2713 N  N     . GLN A 1 346 ? 29.055 15.396  -6.328  1.00 16.58 ? 343 GLN A N     1 
ATOM   2714 C  CA    . GLN A 1 346 ? 30.351 15.820  -5.814  1.00 18.62 ? 343 GLN A CA    1 
ATOM   2715 C  C     . GLN A 1 346 ? 31.391 14.750  -6.145  1.00 15.97 ? 343 GLN A C     1 
ATOM   2716 O  O     . GLN A 1 346 ? 32.480 15.056  -6.637  1.00 17.19 ? 343 GLN A O     1 
ATOM   2717 C  CB    . GLN A 1 346 ? 30.304 16.065  -4.302  1.00 26.37 ? 343 GLN A CB    1 
ATOM   2718 C  CG    . GLN A 1 346 ? 29.285 17.117  -3.866  1.00 21.89 ? 343 GLN A CG    1 
ATOM   2719 C  CD    . GLN A 1 346 ? 29.298 18.350  -4.749  1.00 19.93 ? 343 GLN A CD    1 
ATOM   2720 O  OE1   . GLN A 1 346 ? 30.273 19.104  -4.784  1.00 22.65 ? 343 GLN A OE1   1 
ATOM   2721 N  NE2   . GLN A 1 346 ? 28.203 18.565  -5.469  1.00 30.37 ? 343 GLN A NE2   1 
ATOM   2722 N  N     . LEU A 1 347 ? 31.036 13.500  -5.866  1.00 20.64 ? 344 LEU A N     1 
ATOM   2723 C  CA    . LEU A 1 347 ? 31.917 12.368  -6.133  1.00 18.68 ? 344 LEU A CA    1 
ATOM   2724 C  C     . LEU A 1 347 ? 32.242 12.309  -7.615  1.00 18.35 ? 344 LEU A C     1 
ATOM   2725 O  O     . LEU A 1 347 ? 33.388 12.082  -8.002  1.00 16.28 ? 344 LEU A O     1 
ATOM   2726 C  CB    . LEU A 1 347 ? 31.268 11.054  -5.681  1.00 14.54 ? 344 LEU A CB    1 
ATOM   2727 C  CG    . LEU A 1 347 ? 31.352 10.725  -4.190  1.00 22.83 ? 344 LEU A CG    1 
ATOM   2728 C  CD1   . LEU A 1 347 ? 30.774 9.345   -3.914  1.00 27.38 ? 344 LEU A CD1   1 
ATOM   2729 C  CD2   . LEU A 1 347 ? 32.785 10.784  -3.732  1.00 27.48 ? 344 LEU A CD2   1 
ATOM   2730 N  N     . ALA A 1 348 ? 31.228 12.534  -8.443  1.00 16.88 ? 345 ALA A N     1 
ATOM   2731 C  CA    . ALA A 1 348 ? 31.392 12.418  -9.886  1.00 18.49 ? 345 ALA A CA    1 
ATOM   2732 C  C     . ALA A 1 348 ? 32.280 13.515  -10.438 1.00 17.71 ? 345 ALA A C     1 
ATOM   2733 O  O     . ALA A 1 348 ? 32.960 13.316  -11.438 1.00 17.64 ? 345 ALA A O     1 
ATOM   2734 C  CB    . ALA A 1 348 ? 30.035 12.439  -10.583 1.00 16.17 ? 345 ALA A CB    1 
ATOM   2735 N  N     . GLN A 1 349 ? 32.256 14.684  -9.801  1.00 14.37 ? 346 GLN A N     1 
ATOM   2736 C  CA    . GLN A 1 349 ? 33.095 15.791  -10.236 1.00 15.29 ? 346 GLN A CA    1 
ATOM   2737 C  C     . GLN A 1 349 ? 34.561 15.530  -9.895  1.00 15.83 ? 346 GLN A C     1 
ATOM   2738 O  O     . GLN A 1 349 ? 35.450 15.874  -10.668 1.00 17.47 ? 346 GLN A O     1 
ATOM   2739 C  CB    . GLN A 1 349 ? 32.622 17.120  -9.635  1.00 19.11 ? 346 GLN A CB    1 
ATOM   2740 C  CG    . GLN A 1 349 ? 31.514 17.778  -10.459 1.00 22.17 ? 346 GLN A CG    1 
ATOM   2741 C  CD    . GLN A 1 349 ? 30.809 18.925  -9.738  1.00 34.36 ? 346 GLN A CD    1 
ATOM   2742 O  OE1   . GLN A 1 349 ? 30.971 19.122  -8.534  1.00 26.61 ? 346 GLN A OE1   1 
ATOM   2743 N  NE2   . GLN A 1 349 ? 30.009 19.679  -10.482 1.00 38.02 ? 346 GLN A NE2   1 
ATOM   2744 N  N     . GLU A 1 350 ? 34.816 14.920  -8.743  1.00 14.02 ? 347 GLU A N     1 
ATOM   2745 C  CA    . GLU A 1 350 ? 36.192 14.551  -8.432  1.00 16.45 ? 347 GLU A CA    1 
ATOM   2746 C  C     . GLU A 1 350 ? 36.657 13.465  -9.403  1.00 10.90 ? 347 GLU A C     1 
ATOM   2747 O  O     . GLU A 1 350 ? 37.745 13.549  -9.963  1.00 15.45 ? 347 GLU A O     1 
ATOM   2748 C  CB    . GLU A 1 350 ? 36.363 14.081  -6.984  1.00 18.11 ? 347 GLU A CB    1 
ATOM   2749 C  CG    . GLU A 1 350 ? 37.812 13.653  -6.695  1.00 19.97 ? 347 GLU A CG    1 
ATOM   2750 C  CD    . GLU A 1 350 ? 38.018 13.062  -5.312  1.00 23.56 ? 347 GLU A CD    1 
ATOM   2751 O  OE1   . GLU A 1 350 ? 37.295 13.446  -4.370  1.00 23.67 ? 347 GLU A OE1   1 
ATOM   2752 O  OE2   . GLU A 1 350 ? 38.914 12.207  -5.168  1.00 21.83 ? 347 GLU A OE2   1 
ATOM   2753 N  N     . LEU A 1 351 ? 35.815 12.460  -9.599  1.00 14.46 ? 348 LEU A N     1 
ATOM   2754 C  CA    . LEU A 1 351 ? 36.118 11.366  -10.525 1.00 13.83 ? 348 LEU A CA    1 
ATOM   2755 C  C     . LEU A 1 351 ? 36.390 11.897  -11.937 1.00 18.41 ? 348 LEU A C     1 
ATOM   2756 O  O     . LEU A 1 351 ? 37.360 11.497  -12.574 1.00 14.63 ? 348 LEU A O     1 
ATOM   2757 C  CB    . LEU A 1 351 ? 34.972 10.351  -10.545 1.00 13.90 ? 348 LEU A CB    1 
ATOM   2758 C  CG    . LEU A 1 351 ? 35.268 8.995   -11.198 1.00 18.58 ? 348 LEU A CG    1 
ATOM   2759 C  CD1   . LEU A 1 351 ? 36.530 8.373   -10.589 1.00 16.88 ? 348 LEU A CD1   1 
ATOM   2760 C  CD2   . LEU A 1 351 ? 34.091 8.030   -11.083 1.00 16.77 ? 348 LEU A CD2   1 
ATOM   2761 N  N     . GLU A 1 352 ? 35.538 12.795  -12.429 1.00 17.11 ? 349 GLU A N     1 
ATOM   2762 C  CA    . GLU A 1 352 ? 35.770 13.382  -13.749 1.00 15.71 ? 349 GLU A CA    1 
ATOM   2763 C  C     . GLU A 1 352 ? 37.131 14.055  -13.839 1.00 15.60 ? 349 GLU A C     1 
ATOM   2764 O  O     . GLU A 1 352 ? 37.829 13.933  -14.843 1.00 17.10 ? 349 GLU A O     1 
ATOM   2765 C  CB    . GLU A 1 352 ? 34.680 14.400  -14.136 1.00 15.16 ? 349 GLU A CB    1 
ATOM   2766 C  CG    . GLU A 1 352 ? 34.981 15.100  -15.454 1.00 28.74 ? 349 GLU A CG    1 
ATOM   2767 C  CD    . GLU A 1 352 ? 34.070 16.283  -15.731 1.00 39.24 ? 349 GLU A CD    1 
ATOM   2768 O  OE1   . GLU A 1 352 ? 34.471 17.166  -16.521 1.00 54.70 ? 349 GLU A OE1   1 
ATOM   2769 O  OE2   . GLU A 1 352 ? 32.953 16.331  -15.172 1.00 39.13 ? 349 GLU A OE2   1 
ATOM   2770 N  N     . GLU A 1 353 ? 37.511 14.780  -12.792 1.00 14.18 ? 350 GLU A N     1 
ATOM   2771 C  CA    . GLU A 1 353 ? 38.773 15.496  -12.812 1.00 12.33 ? 350 GLU A CA    1 
ATOM   2772 C  C     . GLU A 1 353 ? 39.956 14.526  -12.879 1.00 13.71 ? 350 GLU A C     1 
ATOM   2773 O  O     . GLU A 1 353 ? 40.931 14.742  -13.607 1.00 14.90 ? 350 GLU A O     1 
ATOM   2774 C  CB    . GLU A 1 353 ? 38.894 16.403  -11.581 1.00 23.45 ? 350 GLU A CB    1 
ATOM   2775 C  CG    . GLU A 1 353 ? 40.196 17.174  -11.523 1.00 32.35 ? 350 GLU A CG    1 
ATOM   2776 C  CD    . GLU A 1 353 ? 40.160 18.318  -10.521 1.00 54.18 ? 350 GLU A CD    1 
ATOM   2777 O  OE1   . GLU A 1 353 ? 39.068 18.616  -9.990  1.00 45.52 ? 350 GLU A OE1   1 
ATOM   2778 O  OE2   . GLU A 1 353 ? 41.226 18.921  -10.271 1.00 59.10 ? 350 GLU A OE2   1 
ATOM   2779 N  N     . ARG A 1 354 ? 39.861 13.454  -12.111 1.00 13.11 ? 351 ARG A N     1 
ATOM   2780 C  CA    . ARG A 1 354 ? 40.945 12.489  -12.042 1.00 15.45 ? 351 ARG A CA    1 
ATOM   2781 C  C     . ARG A 1 354 ? 40.998 11.655  -13.313 1.00 14.87 ? 351 ARG A C     1 
ATOM   2782 O  O     . ARG A 1 354 ? 42.074 11.316  -13.785 1.00 17.10 ? 351 ARG A O     1 
ATOM   2783 C  CB    . ARG A 1 354 ? 40.803 11.613  -10.799 1.00 14.50 ? 351 ARG A CB    1 
ATOM   2784 C  CG    . ARG A 1 354 ? 41.121 12.383  -9.520  1.00 13.35 ? 351 ARG A CG    1 
ATOM   2785 C  CD    . ARG A 1 354 ? 40.661 11.648  -8.288  1.00 19.58 ? 351 ARG A CD    1 
ATOM   2786 N  NE    . ARG A 1 354 ? 41.184 10.292  -8.220  1.00 13.68 ? 351 ARG A NE    1 
ATOM   2787 C  CZ    . ARG A 1 354 ? 40.729 9.377   -7.370  1.00 16.26 ? 351 ARG A CZ    1 
ATOM   2788 N  NH1   . ARG A 1 354 ? 39.748 9.691   -6.520  1.00 17.74 ? 351 ARG A NH1   1 
ATOM   2789 N  NH2   . ARG A 1 354 ? 41.248 8.159   -7.364  1.00 14.01 ? 351 ARG A NH2   1 
ATOM   2790 N  N     . LEU A 1 355 ? 39.834 11.353  -13.875 1.00 15.99 ? 352 LEU A N     1 
ATOM   2791 C  CA    . LEU A 1 355 ? 39.779 10.592  -15.118 1.00 16.09 ? 352 LEU A CA    1 
ATOM   2792 C  C     . LEU A 1 355 ? 40.347 11.367  -16.296 1.00 14.56 ? 352 LEU A C     1 
ATOM   2793 O  O     . LEU A 1 355 ? 41.092 10.819  -17.113 1.00 19.21 ? 352 LEU A O     1 
ATOM   2794 C  CB    . LEU A 1 355 ? 38.344 10.176  -15.422 1.00 15.22 ? 352 LEU A CB    1 
ATOM   2795 C  CG    . LEU A 1 355 ? 37.821 8.994   -14.612 1.00 14.04 ? 352 LEU A CG    1 
ATOM   2796 C  CD1   . LEU A 1 355 ? 36.347 8.825   -14.911 1.00 14.54 ? 352 LEU A CD1   1 
ATOM   2797 C  CD2   . LEU A 1 355 ? 38.585 7.724   -14.952 1.00 17.22 ? 352 LEU A CD2   1 
ATOM   2798 N  N     . THR A 1 356 ? 39.987 12.644  -16.394 1.00 18.72 ? 353 THR A N     1 
ATOM   2799 C  CA    . THR A 1 356 ? 40.483 13.466  -17.486 1.00 15.39 ? 353 THR A CA    1 
ATOM   2800 C  C     . THR A 1 356 ? 42.010 13.578  -17.427 1.00 14.92 ? 353 THR A C     1 
ATOM   2801 O  O     . THR A 1 356 ? 42.691 13.482  -18.448 1.00 19.38 ? 353 THR A O     1 
ATOM   2802 C  CB    . THR A 1 356 ? 39.820 14.866  -17.508 1.00 20.27 ? 353 THR A CB    1 
ATOM   2803 O  OG1   . THR A 1 356 ? 38.395 14.716  -17.585 1.00 23.29 ? 353 THR A OG1   1 
ATOM   2804 C  CG2   . THR A 1 356 ? 40.298 15.656  -18.707 1.00 27.46 ? 353 THR A CG2   1 
ATOM   2805 N  N     . LYS A 1 357 ? 42.553 13.769  -16.230 1.00 21.02 ? 354 LYS A N     1 
ATOM   2806 C  CA    . LYS A 1 357 ? 44.001 13.805  -16.088 1.00 17.68 ? 354 LYS A CA    1 
ATOM   2807 C  C     . LYS A 1 357 ? 44.604 12.451  -16.446 1.00 19.82 ? 354 LYS A C     1 
ATOM   2808 O  O     . LYS A 1 357 ? 45.652 12.379  -17.089 1.00 19.62 ? 354 LYS A O     1 
ATOM   2809 C  CB    . LYS A 1 357 ? 44.427 14.226  -14.680 1.00 22.82 ? 354 LYS A CB    1 
ATOM   2810 C  CG    . LYS A 1 357 ? 45.947 14.330  -14.535 1.00 22.26 ? 354 LYS A CG    1 
ATOM   2811 C  CD    . LYS A 1 357 ? 46.354 15.397  -13.533 1.00 43.32 ? 354 LYS A CD    1 
ATOM   2812 C  CE    . LYS A 1 357 ? 47.650 16.073  -13.962 1.00 49.84 ? 354 LYS A CE    1 
ATOM   2813 N  NZ    . LYS A 1 357 ? 48.739 15.091  -14.224 1.00 30.99 ? 354 LYS A NZ    1 
ATOM   2814 N  N     . ASP A 1 358 ? 43.933 11.379  -16.037 1.00 16.07 ? 355 ASP A N     1 
ATOM   2815 C  CA    . ASP A 1 358 ? 44.441 10.036  -16.320 1.00 19.40 ? 355 ASP A CA    1 
ATOM   2816 C  C     . ASP A 1 358 ? 44.484 9.772   -17.827 1.00 18.76 ? 355 ASP A C     1 
ATOM   2817 O  O     . ASP A 1 358 ? 45.429 9.159   -18.328 1.00 22.39 ? 355 ASP A O     1 
ATOM   2818 C  CB    . ASP A 1 358 ? 43.613 8.961   -15.604 1.00 16.19 ? 355 ASP A CB    1 
ATOM   2819 C  CG    . ASP A 1 358 ? 44.131 7.555   -15.868 1.00 23.96 ? 355 ASP A CG    1 
ATOM   2820 O  OD1   . ASP A 1 358 ? 45.121 7.139   -15.224 1.00 20.78 ? 355 ASP A OD1   1 
ATOM   2821 O  OD2   . ASP A 1 358 ? 43.554 6.871   -16.730 1.00 18.56 ? 355 ASP A OD2   1 
ATOM   2822 N  N     . ARG A 1 359 ? 43.466 10.239  -18.543 1.00 15.75 ? 356 ARG A N     1 
ATOM   2823 C  CA    . ARG A 1 359 ? 43.376 10.017  -19.985 1.00 17.28 ? 356 ARG A CA    1 
ATOM   2824 C  C     . ARG A 1 359 ? 44.483 10.767  -20.721 1.00 18.91 ? 356 ARG A C     1 
ATOM   2825 O  O     . ARG A 1 359 ? 45.081 10.248  -21.666 1.00 19.17 ? 356 ARG A O     1 
ATOM   2826 C  CB    . ARG A 1 359 ? 41.999 10.455  -20.498 1.00 22.22 ? 356 ARG A CB    1 
ATOM   2827 C  CG    . ARG A 1 359 ? 41.729 10.141  -21.971 1.00 24.49 ? 356 ARG A CG    1 
ATOM   2828 C  CD    . ARG A 1 359 ? 40.311 10.574  -22.367 1.00 25.57 ? 356 ARG A CD    1 
ATOM   2829 N  NE    . ARG A 1 359 ? 40.131 12.019  -22.244 1.00 33.63 ? 356 ARG A NE    1 
ATOM   2830 C  CZ    . ARG A 1 359 ? 38.954 12.634  -22.149 1.00 37.17 ? 356 ARG A CZ    1 
ATOM   2831 N  NH1   . ARG A 1 359 ? 37.825 11.935  -22.146 1.00 33.47 ? 356 ARG A NH1   1 
ATOM   2832 N  NH2   . ARG A 1 359 ? 38.907 13.956  -22.049 1.00 39.45 ? 356 ARG A NH2   1 
ATOM   2833 N  N     . ASN A 1 360 ? 44.766 11.987  -20.277 1.00 17.88 ? 357 ASN A N     1 
ATOM   2834 C  CA    . ASN A 1 360 ? 45.825 12.792  -20.882 1.00 16.77 ? 357 ASN A CA    1 
ATOM   2835 C  C     . ASN A 1 360 ? 47.227 12.251  -20.610 1.00 22.41 ? 357 ASN A C     1 
ATOM   2836 O  O     . ASN A 1 360 ? 48.112 12.302  -21.475 1.00 18.85 ? 357 ASN A O     1 
ATOM   2837 C  CB    . ASN A 1 360 ? 45.747 14.233  -20.381 1.00 19.24 ? 357 ASN A CB    1 
ATOM   2838 C  CG    . ASN A 1 360 ? 44.620 15.012  -21.024 1.00 29.39 ? 357 ASN A CG    1 
ATOM   2839 O  OD1   . ASN A 1 360 ? 44.214 14.727  -22.152 1.00 31.01 ? 357 ASN A OD1   1 
ATOM   2840 N  ND2   . ASN A 1 360 ? 44.110 16.008  -20.308 1.00 23.84 ? 357 ASN A ND2   1 
ATOM   2841 N  N     . ASP A 1 361 ? 47.440 11.759  -19.396 1.00 20.28 ? 358 ASP A N     1 
ATOM   2842 C  CA    . ASP A 1 361 ? 48.758 11.276  -19.006 1.00 20.05 ? 358 ASP A CA    1 
ATOM   2843 C  C     . ASP A 1 361 ? 49.049 9.883   -19.538 1.00 17.34 ? 358 ASP A C     1 
ATOM   2844 O  O     . ASP A 1 361 ? 50.176 9.584   -19.924 1.00 20.99 ? 358 ASP A O     1 
ATOM   2845 C  CB    . ASP A 1 361 ? 48.898 11.235  -17.480 1.00 23.79 ? 358 ASP A CB    1 
ATOM   2846 C  CG    . ASP A 1 361 ? 48.986 12.614  -16.858 1.00 36.71 ? 358 ASP A CG    1 
ATOM   2847 O  OD1   . ASP A 1 361 ? 49.111 13.609  -17.605 1.00 26.03 ? 358 ASP A OD1   1 
ATOM   2848 O  OD2   . ASP A 1 361 ? 48.942 12.692  -15.612 1.00 28.32 ? 358 ASP A OD2   1 
ATOM   2849 N  N     . ASN A 1 362 ? 48.033 9.031   -19.542 1.00 17.61 ? 359 ASN A N     1 
ATOM   2850 C  CA    . ASN A 1 362 ? 48.256 7.596   -19.673 1.00 23.24 ? 359 ASN A CA    1 
ATOM   2851 C  C     . ASN A 1 362 ? 47.630 6.939   -20.895 1.00 19.12 ? 359 ASN A C     1 
ATOM   2852 O  O     . ASN A 1 362 ? 47.673 5.719   -21.031 1.00 18.06 ? 359 ASN A O     1 
ATOM   2853 C  CB    . ASN A 1 362 ? 47.807 6.897   -18.381 1.00 15.11 ? 359 ASN A CB    1 
ATOM   2854 C  CG    . ASN A 1 362 ? 48.606 7.365   -17.175 1.00 20.41 ? 359 ASN A CG    1 
ATOM   2855 O  OD1   . ASN A 1 362 ? 49.822 7.519   -17.259 1.00 20.09 ? 359 ASN A OD1   1 
ATOM   2856 N  ND2   . ASN A 1 362 ? 47.928 7.608   -16.057 1.00 16.42 ? 359 ASN A ND2   1 
ATOM   2857 N  N     . ASP A 1 363 ? 47.055 7.744   -21.782 1.00 16.22 ? 360 ASP A N     1 
ATOM   2858 C  CA    . ASP A 1 363 ? 46.530 7.229   -23.046 1.00 17.27 ? 360 ASP A CA    1 
ATOM   2859 C  C     . ASP A 1 363 ? 45.593 6.051   -22.871 1.00 19.47 ? 360 ASP A C     1 
ATOM   2860 O  O     . ASP A 1 363 ? 45.762 5.005   -23.510 1.00 23.28 ? 360 ASP A O     1 
ATOM   2861 C  CB    . ASP A 1 363 ? 47.677 6.829   -23.965 1.00 22.88 ? 360 ASP A CB    1 
ATOM   2862 C  CG    . ASP A 1 363 ? 48.504 8.012   -24.394 1.00 28.81 ? 360 ASP A CG    1 
ATOM   2863 O  OD1   . ASP A 1 363 ? 47.904 9.020   -24.822 1.00 23.38 ? 360 ASP A OD1   1 
ATOM   2864 O  OD2   . ASP A 1 363 ? 49.746 7.938   -24.289 1.00 31.35 ? 360 ASP A OD2   1 
ATOM   2865 N  N     . ARG A 1 364 ? 44.593 6.222   -22.016 1.00 18.29 ? 361 ARG A N     1 
ATOM   2866 C  CA    . ARG A 1 364 ? 43.621 5.174   -21.770 1.00 19.07 ? 361 ARG A CA    1 
ATOM   2867 C  C     . ARG A 1 364 ? 42.313 5.801   -21.324 1.00 22.55 ? 361 ARG A C     1 
ATOM   2868 O  O     . ARG A 1 364 ? 42.284 6.943   -20.869 1.00 22.01 ? 361 ARG A O     1 
ATOM   2869 C  CB    . ARG A 1 364 ? 44.136 4.206   -20.695 1.00 20.97 ? 361 ARG A CB    1 
ATOM   2870 C  CG    . ARG A 1 364 ? 44.336 4.848   -19.325 1.00 22.51 ? 361 ARG A CG    1 
ATOM   2871 C  CD    . ARG A 1 364 ? 44.915 3.852   -18.311 1.00 20.33 ? 361 ARG A CD    1 
ATOM   2872 N  NE    . ARG A 1 364 ? 44.935 4.401   -16.957 1.00 18.72 ? 361 ARG A NE    1 
ATOM   2873 C  CZ    . ARG A 1 364 ? 45.133 3.676   -15.856 1.00 21.83 ? 361 ARG A CZ    1 
ATOM   2874 N  NH1   . ARG A 1 364 ? 45.130 4.258   -14.660 1.00 18.12 ? 361 ARG A NH1   1 
ATOM   2875 N  NH2   . ARG A 1 364 ? 45.328 2.370   -15.947 1.00 17.02 ? 361 ARG A NH2   1 
ATOM   2876 N  N     . VAL A 1 365 ? 41.232 5.047   -21.464 1.00 18.09 ? 362 VAL A N     1 
ATOM   2877 C  CA    . VAL A 1 365 ? 39.916 5.497   -21.047 1.00 20.15 ? 362 VAL A CA    1 
ATOM   2878 C  C     . VAL A 1 365 ? 39.179 4.397   -20.296 1.00 22.29 ? 362 VAL A C     1 
ATOM   2879 O  O     . VAL A 1 365 ? 39.182 3.239   -20.711 1.00 22.50 ? 362 VAL A O     1 
ATOM   2880 C  CB    . VAL A 1 365 ? 39.070 5.931   -22.257 1.00 24.90 ? 362 VAL A CB    1 
ATOM   2881 C  CG1   . VAL A 1 365 ? 39.535 7.281   -22.759 1.00 41.40 ? 362 VAL A CG1   1 
ATOM   2882 C  CG2   . VAL A 1 365 ? 39.153 4.890   -23.371 1.00 26.45 ? 362 VAL A CG2   1 
ATOM   2883 N  N     . ALA A 1 366 ? 38.542 4.765   -19.190 1.00 19.62 ? 363 ALA A N     1 
ATOM   2884 C  CA    . ALA A 1 366 ? 37.698 3.836   -18.449 1.00 15.77 ? 363 ALA A CA    1 
ATOM   2885 C  C     . ALA A 1 366 ? 36.400 3.594   -19.214 1.00 21.84 ? 363 ALA A C     1 
ATOM   2886 O  O     . ALA A 1 366 ? 35.857 4.515   -19.835 1.00 24.78 ? 363 ALA A O     1 
ATOM   2887 C  CB    . ALA A 1 366 ? 37.394 4.394   -17.078 1.00 18.56 ? 363 ALA A CB    1 
ATOM   2888 N  N     . THR A 1 367 ? 35.888 2.368   -19.162 1.00 21.22 ? 364 THR A N     1 
ATOM   2889 C  CA    . THR A 1 367 ? 34.682 2.059   -19.918 1.00 19.05 ? 364 THR A CA    1 
ATOM   2890 C  C     . THR A 1 367 ? 33.511 1.631   -19.047 1.00 23.02 ? 364 THR A C     1 
ATOM   2891 O  O     . THR A 1 367 ? 32.398 1.452   -19.538 1.00 21.85 ? 364 THR A O     1 
ATOM   2892 C  CB    . THR A 1 367 ? 34.945 0.965   -20.981 1.00 18.78 ? 364 THR A CB    1 
ATOM   2893 O  OG1   . THR A 1 367 ? 35.287 -0.264  -20.330 1.00 17.77 ? 364 THR A OG1   1 
ATOM   2894 C  CG2   . THR A 1 367 ? 36.086 1.384   -21.894 1.00 21.39 ? 364 THR A CG2   1 
ATOM   2895 N  N     . GLN A 1 368 ? 33.758 1.458   -17.756 1.00 18.75 ? 365 GLN A N     1 
ATOM   2896 C  CA    . GLN A 1 368 ? 32.713 0.989   -16.863 1.00 22.40 ? 365 GLN A CA    1 
ATOM   2897 C  C     . GLN A 1 368 ? 32.685 1.822   -15.595 1.00 18.31 ? 365 GLN A C     1 
ATOM   2898 O  O     . GLN A 1 368 ? 33.728 2.121   -15.020 1.00 21.67 ? 365 GLN A O     1 
ATOM   2899 C  CB    . GLN A 1 368 ? 32.940 -0.474  -16.504 1.00 23.11 ? 365 GLN A CB    1 
ATOM   2900 C  CG    . GLN A 1 368 ? 31.926 -1.030  -15.532 1.00 31.57 ? 365 GLN A CG    1 
ATOM   2901 C  CD    . GLN A 1 368 ? 32.097 -2.516  -15.311 1.00 33.39 ? 365 GLN A CD    1 
ATOM   2902 O  OE1   . GLN A 1 368 ? 33.048 -2.955  -14.661 1.00 46.49 ? 365 GLN A OE1   1 
ATOM   2903 N  NE2   . GLN A 1 368 ? 31.173 -3.302  -15.851 1.00 28.15 ? 365 GLN A NE2   1 
ATOM   2904 N  N     . LEU A 1 369 ? 31.486 2.204   -15.181 1.00 18.00 ? 366 LEU A N     1 
ATOM   2905 C  CA    . LEU A 1 369 ? 31.307 2.930   -13.931 1.00 21.17 ? 366 LEU A CA    1 
ATOM   2906 C  C     . LEU A 1 369 ? 30.641 2.016   -12.912 1.00 23.82 ? 366 LEU A C     1 
ATOM   2907 O  O     . LEU A 1 369 ? 29.547 1.500   -13.146 1.00 26.10 ? 366 LEU A O     1 
ATOM   2908 C  CB    . LEU A 1 369 ? 30.454 4.182   -14.152 1.00 17.50 ? 366 LEU A CB    1 
ATOM   2909 C  CG    . LEU A 1 369 ? 30.111 4.987   -12.898 1.00 25.57 ? 366 LEU A CG    1 
ATOM   2910 C  CD1   . LEU A 1 369 ? 31.380 5.607   -12.316 1.00 21.97 ? 366 LEU A CD1   1 
ATOM   2911 C  CD2   . LEU A 1 369 ? 29.067 6.063   -13.201 1.00 31.22 ? 366 LEU A CD2   1 
ATOM   2912 N  N     . VAL A 1 370 ? 31.311 1.804   -11.786 1.00 20.46 ? 367 VAL A N     1 
ATOM   2913 C  CA    . VAL A 1 370 ? 30.772 0.969   -10.725 1.00 18.97 ? 367 VAL A CA    1 
ATOM   2914 C  C     . VAL A 1 370 ? 30.213 1.849   -9.617  1.00 23.90 ? 367 VAL A C     1 
ATOM   2915 O  O     . VAL A 1 370 ? 30.887 2.760   -9.149  1.00 21.19 ? 367 VAL A O     1 
ATOM   2916 C  CB    . VAL A 1 370 ? 31.855 0.034   -10.159 1.00 19.65 ? 367 VAL A CB    1 
ATOM   2917 C  CG1   . VAL A 1 370 ? 31.339 -0.717  -8.940  1.00 21.53 ? 367 VAL A CG1   1 
ATOM   2918 C  CG2   . VAL A 1 370 ? 32.313 -0.933  -11.238 1.00 24.20 ? 367 VAL A CG2   1 
ATOM   2919 N  N     . VAL A 1 371 ? 28.972 1.585   -9.220  1.00 21.42 ? 368 VAL A N     1 
ATOM   2920 C  CA    . VAL A 1 371 ? 28.301 2.382   -8.198  1.00 26.32 ? 368 VAL A CA    1 
ATOM   2921 C  C     . VAL A 1 371 ? 27.991 1.498   -7.006  1.00 28.07 ? 368 VAL A C     1 
ATOM   2922 O  O     . VAL A 1 371 ? 27.399 0.430   -7.149  1.00 27.67 ? 368 VAL A O     1 
ATOM   2923 C  CB    . VAL A 1 371 ? 26.993 3.014   -8.726  1.00 27.77 ? 368 VAL A CB    1 
ATOM   2924 C  CG1   . VAL A 1 371 ? 26.407 3.980   -7.698  1.00 24.89 ? 368 VAL A CG1   1 
ATOM   2925 C  CG2   . VAL A 1 371 ? 27.242 3.729   -10.041 1.00 30.22 ? 368 VAL A CG2   1 
ATOM   2926 N  N     . SER A 1 372 ? 28.402 1.938   -5.824  1.00 23.77 ? 369 SER A N     1 
ATOM   2927 C  CA    . SER A 1 372 ? 28.219 1.136   -4.626  1.00 28.50 ? 369 SER A CA    1 
ATOM   2928 C  C     . SER A 1 372 ? 27.705 2.002   -3.490  1.00 30.57 ? 369 SER A C     1 
ATOM   2929 O  O     . SER A 1 372 ? 28.081 3.169   -3.361  1.00 20.44 ? 369 SER A O     1 
ATOM   2930 C  CB    . SER A 1 372 ? 29.534 0.462   -4.232  1.00 33.91 ? 369 SER A CB    1 
ATOM   2931 O  OG    . SER A 1 372 ? 29.369 -0.366  -3.094  1.00 39.58 ? 369 SER A OG    1 
ATOM   2932 N  N     . ILE A 1 373 ? 26.827 1.434   -2.676  1.00 29.64 ? 370 ILE A N     1 
ATOM   2933 C  CA    . ILE A 1 373 ? 26.280 2.165   -1.545  1.00 28.54 ? 370 ILE A CA    1 
ATOM   2934 C  C     . ILE A 1 373 ? 26.186 1.269   -0.323  1.00 34.77 ? 370 ILE A C     1 
ATOM   2935 O  O     . ILE A 1 373 ? 26.271 0.045   -0.424  1.00 30.41 ? 370 ILE A O     1 
ATOM   2936 C  CB    . ILE A 1 373 ? 24.882 2.754   -1.842  1.00 34.46 ? 370 ILE A CB    1 
ATOM   2937 C  CG1   . ILE A 1 373 ? 23.856 1.635   -2.026  1.00 41.73 ? 370 ILE A CG1   1 
ATOM   2938 C  CG2   . ILE A 1 373 ? 24.914 3.682   -3.055  1.00 27.32 ? 370 ILE A CG2   1 
ATOM   2939 C  CD1   . ILE A 1 373 ? 22.483 2.141   -2.393  1.00 30.47 ? 370 ILE A CD1   1 
ATOM   2940 N  N     . ARG A 1 374 ? 26.022 1.893   0.836   1.00 31.39 ? 371 ARG A N     1 
ATOM   2941 C  CA    . ARG A 1 374 ? 25.785 1.153   2.062   1.00 35.04 ? 371 ARG A CA    1 
ATOM   2942 C  C     . ARG A 1 374 ? 24.475 1.648   2.648   1.00 44.43 ? 371 ARG A C     1 
ATOM   2943 O  O     . ARG A 1 374 ? 24.144 2.828   2.531   1.00 33.38 ? 371 ARG A O     1 
ATOM   2944 C  CB    . ARG A 1 374 ? 26.932 1.356   3.049   1.00 32.75 ? 371 ARG A CB    1 
ATOM   2945 C  CG    . ARG A 1 374 ? 26.955 0.368   4.207   1.00 37.57 ? 371 ARG A CG    1 
ATOM   2946 C  CD    . ARG A 1 374 ? 28.113 0.668   5.143   1.00 52.22 ? 371 ARG A CD    1 
ATOM   2947 N  NE    . ARG A 1 374 ? 28.140 -0.214  6.306   1.00 61.62 ? 371 ARG A NE    1 
ATOM   2948 C  CZ    . ARG A 1 374 ? 28.974 -0.067  7.330   1.00 68.45 ? 371 ARG A CZ    1 
ATOM   2949 N  NH1   . ARG A 1 374 ? 29.847 0.933   7.336   1.00 55.75 ? 371 ARG A NH1   1 
ATOM   2950 N  NH2   . ARG A 1 374 ? 28.937 -0.913  8.351   1.00 65.17 ? 371 ARG A NH2   1 
ATOM   2951 N  N     . VAL A 1 375 ? 23.719 0.732   3.245   1.00 49.32 ? 372 VAL A N     1 
ATOM   2952 C  CA    . VAL A 1 375 ? 22.465 1.073   3.906   1.00 42.77 ? 372 VAL A CA    1 
ATOM   2953 C  C     . VAL A 1 375 ? 22.653 0.989   5.415   1.00 31.07 ? 372 VAL A C     1 
ATOM   2954 O  O     . VAL A 1 375 ? 23.356 0.109   5.914   1.00 37.98 ? 372 VAL A O     1 
ATOM   2955 C  CB    . VAL A 1 375 ? 21.328 0.126   3.484   1.00 52.34 ? 372 VAL A CB    1 
ATOM   2956 C  CG1   . VAL A 1 375 ? 20.929 0.387   2.038   1.00 59.19 ? 372 VAL A CG1   1 
ATOM   2957 C  CG2   . VAL A 1 375 ? 21.745 -1.325  3.681   1.00 51.37 ? 372 VAL A CG2   1 
ATOM   2958 N  N     . GLN A 1 376 ? 22.036 1.911   6.140   1.00 33.01 ? 373 GLN A N     1 
ATOM   2959 C  CA    . GLN A 1 376 ? 22.193 1.952   7.589   1.00 48.76 ? 373 GLN A CA    1 
ATOM   2960 C  C     . GLN A 1 376 ? 21.884 0.604   8.239   1.00 48.61 ? 373 GLN A C     1 
ATOM   2961 O  O     . GLN A 1 376 ? 20.866 -0.018  7.941   1.00 56.85 ? 373 GLN A O     1 
ATOM   2962 C  CB    . GLN A 1 376 ? 21.309 3.045   8.187   1.00 46.43 ? 373 GLN A CB    1 
ATOM   2963 C  CG    . GLN A 1 376 ? 21.758 3.510   9.560   1.00 57.51 ? 373 GLN A CG    1 
ATOM   2964 C  CD    . GLN A 1 376 ? 21.179 4.863   9.930   1.00 69.09 ? 373 GLN A CD    1 
ATOM   2965 O  OE1   . GLN A 1 376 ? 20.050 5.192   9.561   1.00 63.48 ? 373 GLN A OE1   1 
ATOM   2966 N  NE2   . GLN A 1 376 ? 21.959 5.661   10.655  1.00 63.89 ? 373 GLN A NE2   1 
ATOM   2967 N  N     . GLY A 1 377 ? 22.773 0.149   9.117   1.00 55.17 ? 374 GLY A N     1 
ATOM   2968 C  CA    . GLY A 1 377 ? 22.546 -1.084  9.850   1.00 66.43 ? 374 GLY A CA    1 
ATOM   2969 C  C     . GLY A 1 377 ? 23.367 -2.270  9.373   1.00 63.90 ? 374 GLY A C     1 
ATOM   2970 O  O     . GLY A 1 377 ? 23.664 -3.183  10.146  1.00 52.05 ? 374 GLY A O     1 
ATOM   2971 N  N     . ASP A 1 378 ? 23.732 -2.263  8.095   1.00 48.77 ? 375 ASP A N     1 
ATOM   2972 C  CA    . ASP A 1 378 ? 24.528 -3.342  7.527   1.00 49.41 ? 375 ASP A CA    1 
ATOM   2973 C  C     . ASP A 1 378 ? 25.949 -3.284  8.081   1.00 61.59 ? 375 ASP A C     1 
ATOM   2974 O  O     . ASP A 1 378 ? 26.577 -2.225  8.073   1.00 68.01 ? 375 ASP A O     1 
ATOM   2975 C  CB    . ASP A 1 378 ? 24.543 -3.236  6.001   1.00 51.42 ? 375 ASP A CB    1 
ATOM   2976 C  CG    . ASP A 1 378 ? 25.113 -4.472  5.335   1.00 50.45 ? 375 ASP A CG    1 
ATOM   2977 O  OD1   . ASP A 1 378 ? 25.881 -5.204  5.991   1.00 37.15 ? 375 ASP A OD1   1 
ATOM   2978 O  OD2   . ASP A 1 378 ? 24.793 -4.707  4.151   1.00 47.49 ? 375 ASP A OD2   1 
ATOM   2979 N  N     . LYS A 1 379 ? 26.454 -4.415  8.569   1.00 65.57 ? 376 LYS A N     1 
ATOM   2980 C  CA    . LYS A 1 379 ? 27.809 -4.458  9.117   1.00 74.86 ? 376 LYS A CA    1 
ATOM   2981 C  C     . LYS A 1 379 ? 28.846 -4.562  8.004   1.00 74.12 ? 376 LYS A C     1 
ATOM   2982 O  O     . LYS A 1 379 ? 30.042 -4.376  8.234   1.00 70.97 ? 376 LYS A O     1 
ATOM   2983 C  CB    . LYS A 1 379 ? 27.981 -5.625  10.095  1.00 76.96 ? 376 LYS A CB    1 
ATOM   2984 C  CG    . LYS A 1 379 ? 29.196 -5.475  11.006  1.00 82.34 ? 376 LYS A CG    1 
ATOM   2985 C  CD    . LYS A 1 379 ? 29.567 -6.778  11.696  1.00 80.73 ? 376 LYS A CD    1 
ATOM   2986 C  CE    . LYS A 1 379 ? 30.362 -7.686  10.773  1.00 79.18 ? 376 LYS A CE    1 
ATOM   2987 N  NZ    . LYS A 1 379 ? 30.839 -8.907  11.480  1.00 74.41 ? 376 LYS A NZ    1 
ATOM   2988 N  N     . ARG A 1 380 ? 28.377 -4.865  6.798   1.00 68.74 ? 377 ARG A N     1 
ATOM   2989 C  CA    . ARG A 1 380 ? 29.252 -4.973  5.637   1.00 73.62 ? 377 ARG A CA    1 
ATOM   2990 C  C     . ARG A 1 380 ? 29.646 -3.596  5.110   1.00 71.72 ? 377 ARG A C     1 
ATOM   2991 O  O     . ARG A 1 380 ? 28.810 -2.695  5.018   1.00 64.72 ? 377 ARG A O     1 
ATOM   2992 C  CB    . ARG A 1 380 ? 28.569 -5.770  4.524   1.00 66.77 ? 377 ARG A CB    1 
ATOM   2993 C  CG    . ARG A 1 380 ? 28.241 -7.208  4.884   1.00 64.95 ? 377 ARG A CG    1 
ATOM   2994 C  CD    . ARG A 1 380 ? 27.468 -7.876  3.759   1.00 59.53 ? 377 ARG A CD    1 
ATOM   2995 N  NE    . ARG A 1 380 ? 26.172 -7.238  3.538   1.00 56.71 ? 377 ARG A NE    1 
ATOM   2996 C  CZ    . ARG A 1 380 ? 25.382 -7.489  2.499   1.00 49.50 ? 377 ARG A CZ    1 
ATOM   2997 N  NH1   . ARG A 1 380 ? 25.757 -8.360  1.572   1.00 53.14 ? 377 ARG A NH1   1 
ATOM   2998 N  NH2   . ARG A 1 380 ? 24.219 -6.864  2.382   1.00 45.37 ? 377 ARG A NH2   1 
ATOM   2999 N  N     . LEU A 1 381 ? 30.921 -3.442  4.766   1.00 70.03 ? 378 LEU A N     1 
ATOM   3000 C  CA    . LEU A 1 381 ? 31.407 -2.202  4.178   1.00 67.76 ? 378 LEU A CA    1 
ATOM   3001 C  C     . LEU A 1 381 ? 30.506 -1.764  3.029   1.00 60.26 ? 378 LEU A C     1 
ATOM   3002 O  O     . LEU A 1 381 ? 30.082 -0.609  2.965   1.00 69.78 ? 378 LEU A O     1 
ATOM   3003 C  CB    . LEU A 1 381 ? 32.847 -2.363  3.686   1.00 73.90 ? 378 LEU A CB    1 
ATOM   3004 C  CG    . LEU A 1 381 ? 33.968 -2.212  4.718   1.00 77.19 ? 378 LEU A CG    1 
ATOM   3005 C  CD1   . LEU A 1 381 ? 33.833 -3.233  5.842   1.00 76.62 ? 378 LEU A CD1   1 
ATOM   3006 C  CD2   . LEU A 1 381 ? 35.328 -2.323  4.041   1.00 72.23 ? 378 LEU A CD2   1 
ATOM   3007 N  N     . SER A 1 382 ? 30.219 -2.693  2.122   1.00 56.16 ? 379 SER A N     1 
ATOM   3008 C  CA    . SER A 1 382 ? 29.311 -2.427  1.012   1.00 52.94 ? 379 SER A CA    1 
ATOM   3009 C  C     . SER A 1 382 ? 28.051 -3.261  1.142   1.00 44.09 ? 379 SER A C     1 
ATOM   3010 O  O     . SER A 1 382 ? 28.104 -4.423  1.547   1.00 51.95 ? 379 SER A O     1 
ATOM   3011 C  CB    . SER A 1 382 ? 29.978 -2.728  -0.330  1.00 45.22 ? 379 SER A CB    1 
ATOM   3012 O  OG    . SER A 1 382 ? 29.003 -2.870  -1.353  1.00 38.72 ? 379 SER A OG    1 
ATOM   3013 N  N     . SER A 1 383 ? 26.920 -2.665  0.784   1.00 46.72 ? 380 SER A N     1 
ATOM   3014 C  CA    . SER A 1 383 ? 25.639 -3.355  0.836   1.00 45.73 ? 380 SER A CA    1 
ATOM   3015 C  C     . SER A 1 383 ? 25.139 -3.674  -0.564  1.00 52.74 ? 380 SER A C     1 
ATOM   3016 O  O     . SER A 1 383 ? 24.142 -4.378  -0.733  1.00 51.20 ? 380 SER A O     1 
ATOM   3017 C  CB    . SER A 1 383 ? 24.596 -2.494  1.559   1.00 49.37 ? 380 SER A CB    1 
ATOM   3018 O  OG    . SER A 1 383 ? 24.967 -2.248  2.903   1.00 48.55 ? 380 SER A OG    1 
ATOM   3019 N  N     . LEU A 1 384 ? 25.833 -3.155  -1.569  1.00 43.78 ? 381 LEU A N     1 
ATOM   3020 C  CA    . LEU A 1 384 ? 25.335 -3.230  -2.935  1.00 45.83 ? 381 LEU A CA    1 
ATOM   3021 C  C     . LEU A 1 384 ? 26.362 -2.694  -3.926  1.00 54.79 ? 381 LEU A C     1 
ATOM   3022 O  O     . LEU A 1 384 ? 27.173 -1.832  -3.586  1.00 47.15 ? 381 LEU A O     1 
ATOM   3023 C  CB    . LEU A 1 384 ? 24.036 -2.428  -3.052  1.00 38.69 ? 381 LEU A CB    1 
ATOM   3024 C  CG    . LEU A 1 384 ? 23.377 -2.360  -4.428  1.00 40.23 ? 381 LEU A CG    1 
ATOM   3025 C  CD1   . LEU A 1 384 ? 22.530 -3.592  -4.674  1.00 54.75 ? 381 LEU A CD1   1 
ATOM   3026 C  CD2   . LEU A 1 384 ? 22.532 -1.113  -4.529  1.00 39.29 ? 381 LEU A CD2   1 
ATOM   3027 N  N     . ARG A 1 385 ? 26.322 -3.214  -5.150  1.00 45.81 ? 382 ARG A N     1 
ATOM   3028 C  CA    . ARG A 1 385 ? 27.235 -2.794  -6.206  1.00 34.75 ? 382 ARG A CA    1 
ATOM   3029 C  C     . ARG A 1 385 ? 26.604 -3.034  -7.569  1.00 46.03 ? 382 ARG A C     1 
ATOM   3030 O  O     . ARG A 1 385 ? 26.244 -4.163  -7.906  1.00 47.25 ? 382 ARG A O     1 
ATOM   3031 C  CB    . ARG A 1 385 ? 28.553 -3.563  -6.123  1.00 39.71 ? 382 ARG A CB    1 
ATOM   3032 C  CG    . ARG A 1 385 ? 29.600 -3.094  -7.122  1.00 41.63 ? 382 ARG A CG    1 
ATOM   3033 C  CD    . ARG A 1 385 ? 30.633 -4.176  -7.401  1.00 44.81 ? 382 ARG A CD    1 
ATOM   3034 N  NE    . ARG A 1 385 ? 30.300 -4.959  -8.590  1.00 56.59 ? 382 ARG A NE    1 
ATOM   3035 C  CZ    . ARG A 1 385 ? 31.040 -4.993  -9.695  1.00 49.88 ? 382 ARG A CZ    1 
ATOM   3036 N  NH1   . ARG A 1 385 ? 30.657 -5.731  -10.728 1.00 55.12 ? 382 ARG A NH1   1 
ATOM   3037 N  NH2   . ARG A 1 385 ? 32.167 -4.296  -9.766  1.00 33.61 ? 382 ARG A NH2   1 
ATOM   3038 N  N     . ARG A 1 386 ? 26.474 -1.972  -8.352  1.00 40.21 ? 383 ARG A N     1 
ATOM   3039 C  CA    . ARG A 1 386 ? 25.901 -2.081  -9.685  1.00 39.76 ? 383 ARG A CA    1 
ATOM   3040 C  C     . ARG A 1 386 ? 26.741 -1.307  -10.694 1.00 35.98 ? 383 ARG A C     1 
ATOM   3041 O  O     . ARG A 1 386 ? 27.324 -0.279  -10.364 1.00 33.61 ? 383 ARG A O     1 
ATOM   3042 C  CB    . ARG A 1 386 ? 24.467 -1.571  -9.676  1.00 37.26 ? 383 ARG A CB    1 
ATOM   3043 C  CG    . ARG A 1 386 ? 23.543 -2.352  -8.757  1.00 44.31 ? 383 ARG A CG    1 
ATOM   3044 C  CD    . ARG A 1 386 ? 23.345 -3.773  -9.259  1.00 50.58 ? 383 ARG A CD    1 
ATOM   3045 N  NE    . ARG A 1 386 ? 22.282 -4.464  -8.536  1.00 35.72 ? 383 ARG A NE    1 
ATOM   3046 C  CZ    . ARG A 1 386 ? 20.988 -4.284  -8.779  1.00 56.42 ? 383 ARG A CZ    1 
ATOM   3047 N  NH1   . ARG A 1 386 ? 20.077 -4.949  -8.079  1.00 63.10 ? 383 ARG A NH1   1 
ATOM   3048 N  NH2   . ARG A 1 386 ? 20.604 -3.433  -9.722  1.00 44.70 ? 383 ARG A NH2   1 
ATOM   3049 N  N     . CYS A 1 387 ? 26.798 -1.797  -11.926 1.00 39.20 ? 384 CYS A N     1 
ATOM   3050 C  CA    A CYS A 1 387 ? 27.620 -1.151  -12.941 0.50 34.39 ? 384 CYS A CA    1 
ATOM   3051 C  CA    B CYS A 1 387 ? 27.625 -1.179  -12.959 0.50 34.40 ? 384 CYS A CA    1 
ATOM   3052 C  C     . CYS A 1 387 ? 26.808 -0.653  -14.130 1.00 37.75 ? 384 CYS A C     1 
ATOM   3053 O  O     . CYS A 1 387 ? 25.741 -1.181  -14.441 1.00 41.38 ? 384 CYS A O     1 
ATOM   3054 C  CB    A CYS A 1 387 ? 28.741 -2.088  -13.407 0.50 32.34 ? 384 CYS A CB    1 
ATOM   3055 C  CB    B CYS A 1 387 ? 28.648 -2.184  -13.486 0.50 32.36 ? 384 CYS A CB    1 
ATOM   3056 S  SG    A CYS A 1 387 ? 28.185 -3.678  -14.061 0.50 41.11 ? 384 CYS A SG    1 
ATOM   3057 S  SG    B CYS A 1 387 ? 29.637 -2.958  -12.211 0.50 29.88 ? 384 CYS A SG    1 
ATOM   3058 N  N     . CYS A 1 388 ? 27.325 0.381   -14.781 1.00 32.65 ? 385 CYS A N     1 
ATOM   3059 C  CA    . CYS A 1 388 ? 26.726 0.900   -15.998 1.00 39.69 ? 385 CYS A CA    1 
ATOM   3060 C  C     . CYS A 1 388 ? 27.845 1.390   -16.902 1.00 39.15 ? 385 CYS A C     1 
ATOM   3061 O  O     . CYS A 1 388 ? 28.996 1.498   -16.471 1.00 36.88 ? 385 CYS A O     1 
ATOM   3062 C  CB    . CYS A 1 388 ? 25.742 2.026   -15.691 1.00 33.61 ? 385 CYS A CB    1 
ATOM   3063 S  SG    . CYS A 1 388 ? 26.472 3.491   -14.948 1.00 38.29 ? 385 CYS A SG    1 
ATOM   3064 N  N     . ALA A 1 389 ? 27.515 1.680   -18.154 1.00 37.14 ? 386 ALA A N     1 
ATOM   3065 C  CA    . ALA A 1 389 ? 28.530 2.088   -19.114 1.00 27.29 ? 386 ALA A CA    1 
ATOM   3066 C  C     . ALA A 1 389 ? 29.100 3.462   -18.784 1.00 28.48 ? 386 ALA A C     1 
ATOM   3067 O  O     . ALA A 1 389 ? 28.362 4.391   -18.461 1.00 27.20 ? 386 ALA A O     1 
ATOM   3068 C  CB    . ALA A 1 389 ? 27.966 2.074   -20.523 1.00 37.15 ? 386 ALA A CB    1 
ATOM   3069 N  N     . LEU A 1 390 ? 30.420 3.583   -18.858 1.00 23.34 ? 387 LEU A N     1 
ATOM   3070 C  CA    . LEU A 1 390 ? 31.072 4.878   -18.724 1.00 23.21 ? 387 LEU A CA    1 
ATOM   3071 C  C     . LEU A 1 390 ? 31.454 5.318   -20.130 1.00 26.67 ? 387 LEU A C     1 
ATOM   3072 O  O     . LEU A 1 390 ? 32.498 4.924   -20.650 1.00 24.07 ? 387 LEU A O     1 
ATOM   3073 C  CB    . LEU A 1 390 ? 32.315 4.753   -17.842 1.00 22.69 ? 387 LEU A CB    1 
ATOM   3074 C  CG    . LEU A 1 390 ? 32.732 5.977   -17.027 1.00 23.81 ? 387 LEU A CG    1 
ATOM   3075 C  CD1   . LEU A 1 390 ? 33.906 5.614   -16.121 1.00 23.20 ? 387 LEU A CD1   1 
ATOM   3076 C  CD2   . LEU A 1 390 ? 33.080 7.152   -17.932 1.00 25.70 ? 387 LEU A CD2   1 
ATOM   3077 N  N     . THR A 1 391 ? 30.593 6.107   -20.763 1.00 23.22 ? 388 THR A N     1 
ATOM   3078 C  CA    . THR A 1 391 ? 30.784 6.436   -22.172 1.00 28.98 ? 388 THR A CA    1 
ATOM   3079 C  C     . THR A 1 391 ? 31.292 7.858   -22.400 1.00 33.82 ? 388 THR A C     1 
ATOM   3080 O  O     . THR A 1 391 ? 31.843 8.161   -23.456 1.00 30.24 ? 388 THR A O     1 
ATOM   3081 C  CB    . THR A 1 391 ? 29.490 6.228   -22.974 1.00 41.02 ? 388 THR A CB    1 
ATOM   3082 O  OG1   . THR A 1 391 ? 28.455 7.057   -22.432 1.00 37.83 ? 388 THR A OG1   1 
ATOM   3083 C  CG2   . THR A 1 391 ? 29.056 4.773   -22.903 1.00 28.30 ? 388 THR A CG2   1 
ATOM   3084 N  N     . ARG A 1 392 ? 31.095 8.723   -21.409 1.00 28.97 ? 389 ARG A N     1 
ATOM   3085 C  CA    . ARG A 1 392 ? 31.587 10.096  -21.467 1.00 26.24 ? 389 ARG A CA    1 
ATOM   3086 C  C     . ARG A 1 392 ? 32.179 10.531  -20.125 1.00 23.04 ? 389 ARG A C     1 
ATOM   3087 O  O     . ARG A 1 392 ? 31.627 10.240  -19.067 1.00 28.53 ? 389 ARG A O     1 
ATOM   3088 C  CB    . ARG A 1 392 ? 30.469 11.063  -21.872 1.00 33.87 ? 389 ARG A CB    1 
ATOM   3089 C  CG    . ARG A 1 392 ? 30.087 10.995  -23.343 1.00 42.55 ? 389 ARG A CG    1 
ATOM   3090 C  CD    . ARG A 1 392 ? 29.030 12.035  -23.692 1.00 54.88 ? 389 ARG A CD    1 
ATOM   3091 N  NE    . ARG A 1 392 ? 29.455 13.384  -23.325 1.00 50.01 ? 389 ARG A NE    1 
ATOM   3092 C  CZ    . ARG A 1 392 ? 28.766 14.197  -22.529 1.00 59.23 ? 389 ARG A CZ    1 
ATOM   3093 N  NH1   . ARG A 1 392 ? 27.605 13.805  -22.019 1.00 54.62 ? 389 ARG A NH1   1 
ATOM   3094 N  NH2   . ARG A 1 392 ? 29.235 15.407  -22.250 1.00 47.09 ? 389 ARG A NH2   1 
ATOM   3095 N  N     . TYR A 1 393 ? 33.303 11.230  -20.180 1.00 23.18 ? 390 TYR A N     1 
ATOM   3096 C  CA    . TYR A 1 393 ? 33.892 11.788  -18.975 1.00 22.96 ? 390 TYR A CA    1 
ATOM   3097 C  C     . TYR A 1 393 ? 33.145 13.076  -18.647 1.00 30.84 ? 390 TYR A C     1 
ATOM   3098 O  O     . TYR A 1 393 ? 33.633 14.176  -18.908 1.00 32.34 ? 390 TYR A O     1 
ATOM   3099 C  CB    . TYR A 1 393 ? 35.384 12.047  -19.171 1.00 25.25 ? 390 TYR A CB    1 
ATOM   3100 C  CG    . TYR A 1 393 ? 36.264 10.814  -19.055 1.00 15.27 ? 390 TYR A CG    1 
ATOM   3101 C  CD1   . TYR A 1 393 ? 37.646 10.930  -19.007 1.00 16.52 ? 390 TYR A CD1   1 
ATOM   3102 C  CD2   . TYR A 1 393 ? 35.714 9.538   -19.001 1.00 22.66 ? 390 TYR A CD2   1 
ATOM   3103 C  CE1   . TYR A 1 393 ? 38.458 9.808   -18.901 1.00 18.07 ? 390 TYR A CE1   1 
ATOM   3104 C  CE2   . TYR A 1 393 ? 36.519 8.410   -18.892 1.00 23.40 ? 390 TYR A CE2   1 
ATOM   3105 C  CZ    . TYR A 1 393 ? 37.890 8.553   -18.845 1.00 23.15 ? 390 TYR A CZ    1 
ATOM   3106 O  OH    . TYR A 1 393 ? 38.700 7.438   -18.728 1.00 21.29 ? 390 TYR A OH    1 
ATOM   3107 N  N     . ASP A 1 394 ? 31.946 12.923  -18.096 1.00 29.33 ? 391 ASP A N     1 
ATOM   3108 C  CA    . ASP A 1 394 ? 31.092 14.059  -17.767 1.00 32.65 ? 391 ASP A CA    1 
ATOM   3109 C  C     . ASP A 1 394 ? 30.473 13.848  -16.395 1.00 22.85 ? 391 ASP A C     1 
ATOM   3110 O  O     . ASP A 1 394 ? 29.702 12.916  -16.197 1.00 23.64 ? 391 ASP A O     1 
ATOM   3111 C  CB    . ASP A 1 394 ? 29.992 14.215  -18.818 1.00 28.61 ? 391 ASP A CB    1 
ATOM   3112 C  CG    . ASP A 1 394 ? 29.190 15.487  -18.635 1.00 40.33 ? 391 ASP A CG    1 
ATOM   3113 O  OD1   . ASP A 1 394 ? 28.306 15.511  -17.753 1.00 36.57 ? 391 ASP A OD1   1 
ATOM   3114 O  OD2   . ASP A 1 394 ? 29.444 16.461  -19.375 1.00 53.15 ? 391 ASP A OD2   1 
ATOM   3115 N  N     . ALA A 1 395 ? 30.813 14.714  -15.445 1.00 25.92 ? 392 ALA A N     1 
ATOM   3116 C  CA    . ALA A 1 395 ? 30.387 14.523  -14.065 1.00 25.08 ? 392 ALA A CA    1 
ATOM   3117 C  C     . ALA A 1 395 ? 28.868 14.446  -13.929 1.00 26.96 ? 392 ALA A C     1 
ATOM   3118 O  O     . ALA A 1 395 ? 28.340 13.596  -13.212 1.00 22.82 ? 392 ALA A O     1 
ATOM   3119 C  CB    . ALA A 1 395 ? 30.956 15.627  -13.174 1.00 24.99 ? 392 ALA A CB    1 
ATOM   3120 N  N     . HIS A 1 396 ? 28.163 15.345  -14.609 1.00 29.34 ? 393 HIS A N     1 
ATOM   3121 C  CA    . HIS A 1 396 ? 26.707 15.361  -14.538 1.00 28.86 ? 393 HIS A CA    1 
ATOM   3122 C  C     . HIS A 1 396 ? 26.094 14.075  -15.081 1.00 24.55 ? 393 HIS A C     1 
ATOM   3123 O  O     . HIS A 1 396 ? 25.163 13.533  -14.489 1.00 29.13 ? 393 HIS A O     1 
ATOM   3124 C  CB    . HIS A 1 396 ? 26.141 16.583  -15.263 1.00 28.50 ? 393 HIS A CB    1 
ATOM   3125 C  CG    . HIS A 1 396 ? 26.326 17.865  -14.509 1.00 31.88 ? 393 HIS A CG    1 
ATOM   3126 N  ND1   . HIS A 1 396 ? 27.306 18.781  -14.826 1.00 42.40 ? 393 HIS A ND1   1 
ATOM   3127 C  CD2   . HIS A 1 396 ? 25.664 18.375  -13.444 1.00 35.35 ? 393 HIS A CD2   1 
ATOM   3128 C  CE1   . HIS A 1 396 ? 27.235 19.805  -13.993 1.00 42.69 ? 393 HIS A CE1   1 
ATOM   3129 N  NE2   . HIS A 1 396 ? 26.247 19.583  -13.145 1.00 46.58 ? 393 HIS A NE2   1 
ATOM   3130 N  N     . LYS A 1 397 ? 26.627 13.585  -16.198 1.00 28.61 ? 394 LYS A N     1 
ATOM   3131 C  CA    . LYS A 1 397 ? 26.162 12.326  -16.776 1.00 25.62 ? 394 LYS A CA    1 
ATOM   3132 C  C     . LYS A 1 397 ? 26.472 11.120  -15.898 1.00 26.64 ? 394 LYS A C     1 
ATOM   3133 O  O     . LYS A 1 397 ? 25.616 10.262  -15.685 1.00 26.78 ? 394 LYS A O     1 
ATOM   3134 C  CB    . LYS A 1 397 ? 26.762 12.103  -18.163 1.00 28.05 ? 394 LYS A CB    1 
ATOM   3135 C  CG    . LYS A 1 397 ? 26.471 10.712  -18.721 1.00 32.52 ? 394 LYS A CG    1 
ATOM   3136 C  CD    . LYS A 1 397 ? 26.786 10.620  -20.207 1.00 46.90 ? 394 LYS A CD    1 
ATOM   3137 C  CE    . LYS A 1 397 ? 26.571 9.206   -20.730 1.00 46.96 ? 394 LYS A CE    1 
ATOM   3138 N  NZ    . LYS A 1 397 ? 25.228 8.658   -20.376 1.00 47.28 ? 394 LYS A NZ    1 
ATOM   3139 N  N     . MET A 1 398 ? 27.702 11.047  -15.399 1.00 27.07 ? 395 MET A N     1 
ATOM   3140 C  CA    . MET A 1 398 ? 28.084 9.952   -14.518 1.00 23.25 ? 395 MET A CA    1 
ATOM   3141 C  C     . MET A 1 398 ? 27.202 9.912   -13.269 1.00 25.46 ? 395 MET A C     1 
ATOM   3142 O  O     . MET A 1 398 ? 26.724 8.852   -12.879 1.00 25.23 ? 395 MET A O     1 
ATOM   3143 C  CB    . MET A 1 398 ? 29.574 10.037  -14.151 1.00 18.67 ? 395 MET A CB    1 
ATOM   3144 C  CG    . MET A 1 398 ? 30.503 9.471   -15.228 1.00 24.38 ? 395 MET A CG    1 
ATOM   3145 S  SD    . MET A 1 398 ? 32.251 9.421   -14.748 1.00 27.63 ? 395 MET A SD    1 
ATOM   3146 C  CE    . MET A 1 398 ? 32.615 11.171  -14.688 1.00 19.76 ? 395 MET A CE    1 
ATOM   3147 N  N     . SER A 1 399 ? 26.978 11.069  -12.654 1.00 26.69 ? 396 SER A N     1 
ATOM   3148 C  CA    . SER A 1 399 ? 26.189 11.123  -11.425 1.00 22.04 ? 396 SER A CA    1 
ATOM   3149 C  C     . SER A 1 399 ? 24.715 10.816  -11.692 1.00 29.78 ? 396 SER A C     1 
ATOM   3150 O  O     . SER A 1 399 ? 24.032 10.247  -10.847 1.00 26.68 ? 396 SER A O     1 
ATOM   3151 C  CB    . SER A 1 399 ? 26.333 12.483  -10.735 1.00 31.57 ? 396 SER A CB    1 
ATOM   3152 O  OG    . SER A 1 399 ? 25.743 13.514  -11.504 1.00 33.19 ? 396 SER A OG    1 
ATOM   3153 N  N     . HIS A 1 400 ? 24.228 11.190  -12.870 1.00 29.22 ? 397 HIS A N     1 
ATOM   3154 C  CA    . HIS A 1 400 ? 22.849 10.870  -13.224 1.00 36.35 ? 397 HIS A CA    1 
ATOM   3155 C  C     . HIS A 1 400 ? 22.685 9.369   -13.461 1.00 30.39 ? 397 HIS A C     1 
ATOM   3156 O  O     . HIS A 1 400 ? 21.707 8.763   -13.023 1.00 37.49 ? 397 HIS A O     1 
ATOM   3157 C  CB    . HIS A 1 400 ? 22.386 11.655  -14.451 1.00 37.55 ? 397 HIS A CB    1 
ATOM   3158 C  CG    . HIS A 1 400 ? 20.950 11.417  -14.801 1.00 55.14 ? 397 HIS A CG    1 
ATOM   3159 N  ND1   . HIS A 1 400 ? 20.555 10.475  -15.728 1.00 60.07 ? 397 HIS A ND1   1 
ATOM   3160 C  CD2   . HIS A 1 400 ? 19.812 11.980  -14.329 1.00 57.22 ? 397 HIS A CD2   1 
ATOM   3161 C  CE1   . HIS A 1 400 ? 19.237 10.479  -15.822 1.00 61.20 ? 397 HIS A CE1   1 
ATOM   3162 N  NE2   . HIS A 1 400 ? 18.762 11.383  -14.984 1.00 58.47 ? 397 HIS A NE2   1 
ATOM   3163 N  N     . ASP A 1 401 ? 23.660 8.770   -14.141 1.00 33.65 ? 398 ASP A N     1 
ATOM   3164 C  CA    . ASP A 1 401 ? 23.631 7.339   -14.419 1.00 30.06 ? 398 ASP A CA    1 
ATOM   3165 C  C     . ASP A 1 401 ? 23.751 6.522   -13.144 1.00 34.10 ? 398 ASP A C     1 
ATOM   3166 O  O     . ASP A 1 401 ? 23.094 5.490   -12.996 1.00 32.02 ? 398 ASP A O     1 
ATOM   3167 C  CB    . ASP A 1 401 ? 24.749 6.956   -15.394 1.00 30.65 ? 398 ASP A CB    1 
ATOM   3168 C  CG    . ASP A 1 401 ? 24.555 7.569   -16.766 1.00 42.86 ? 398 ASP A CG    1 
ATOM   3169 O  OD1   . ASP A 1 401 ? 23.415 7.985   -17.071 1.00 35.10 ? 398 ASP A OD1   1 
ATOM   3170 O  OD2   . ASP A 1 401 ? 25.537 7.635   -17.536 1.00 36.24 ? 398 ASP A OD2   1 
ATOM   3171 N  N     . ALA A 1 402 ? 24.595 6.984   -12.226 1.00 30.20 ? 399 ALA A N     1 
ATOM   3172 C  CA    . ALA A 1 402 ? 24.776 6.310   -10.948 1.00 27.36 ? 399 ALA A CA    1 
ATOM   3173 C  C     . ALA A 1 402 ? 23.468 6.300   -10.170 1.00 28.87 ? 399 ALA A C     1 
ATOM   3174 O  O     . ALA A 1 402 ? 23.092 5.287   -9.582  1.00 30.43 ? 399 ALA A O     1 
ATOM   3175 C  CB    . ALA A 1 402 ? 25.874 6.991   -10.134 1.00 31.50 ? 399 ALA A CB    1 
ATOM   3176 N  N     . PHE A 1 403 ? 22.784 7.438   -10.163 1.00 36.02 ? 400 PHE A N     1 
ATOM   3177 C  CA    . PHE A 1 403 ? 21.494 7.534   -9.495  1.00 40.44 ? 400 PHE A CA    1 
ATOM   3178 C  C     . PHE A 1 403 ? 20.515 6.545   -10.117 1.00 38.98 ? 400 PHE A C     1 
ATOM   3179 O  O     . PHE A 1 403 ? 19.996 5.661   -9.439  1.00 36.28 ? 400 PHE A O     1 
ATOM   3180 C  CB    . PHE A 1 403 ? 20.940 8.954   -9.591  1.00 41.26 ? 400 PHE A CB    1 
ATOM   3181 C  CG    . PHE A 1 403 ? 19.640 9.143   -8.867  1.00 49.39 ? 400 PHE A CG    1 
ATOM   3182 C  CD1   . PHE A 1 403 ? 18.436 9.085   -9.549  1.00 54.81 ? 400 PHE A CD1   1 
ATOM   3183 C  CD2   . PHE A 1 403 ? 19.621 9.367   -7.500  1.00 46.12 ? 400 PHE A CD2   1 
ATOM   3184 C  CE1   . PHE A 1 403 ? 17.237 9.255   -8.883  1.00 61.09 ? 400 PHE A CE1   1 
ATOM   3185 C  CE2   . PHE A 1 403 ? 18.425 9.538   -6.828  1.00 59.43 ? 400 PHE A CE2   1 
ATOM   3186 C  CZ    . PHE A 1 403 ? 17.232 9.481   -7.521  1.00 59.47 ? 400 PHE A CZ    1 
ATOM   3187 N  N     . THR A 1 404 ? 20.282 6.697   -11.416 1.00 41.63 ? 401 THR A N     1 
ATOM   3188 C  CA    . THR A 1 404 ? 19.401 5.800   -12.157 1.00 42.73 ? 401 THR A CA    1 
ATOM   3189 C  C     . THR A 1 404 ? 19.622 4.344   -11.754 1.00 41.99 ? 401 THR A C     1 
ATOM   3190 O  O     . THR A 1 404 ? 18.675 3.569   -11.633 1.00 49.87 ? 401 THR A O     1 
ATOM   3191 C  CB    . THR A 1 404 ? 19.627 5.927   -13.675 1.00 32.08 ? 401 THR A CB    1 
ATOM   3192 O  OG1   . THR A 1 404 ? 19.466 7.293   -14.079 1.00 37.31 ? 401 THR A OG1   1 
ATOM   3193 C  CG2   . THR A 1 404 ? 18.648 5.048   -14.441 1.00 41.81 ? 401 THR A CG2   1 
ATOM   3194 N  N     . VAL A 1 405 ? 20.880 3.984   -11.536 1.00 43.17 ? 402 VAL A N     1 
ATOM   3195 C  CA    . VAL A 1 405 ? 21.251 2.609   -11.224 1.00 27.21 ? 402 VAL A CA    1 
ATOM   3196 C  C     . VAL A 1 405 ? 20.933 2.196   -9.780  1.00 41.24 ? 402 VAL A C     1 
ATOM   3197 O  O     . VAL A 1 405 ? 20.717 1.017   -9.506  1.00 33.28 ? 402 VAL A O     1 
ATOM   3198 C  CB    . VAL A 1 405 ? 22.745 2.361   -11.543 1.00 49.76 ? 402 VAL A CB    1 
ATOM   3199 C  CG1   . VAL A 1 405 ? 23.280 1.178   -10.765 1.00 41.70 ? 402 VAL A CG1   1 
ATOM   3200 C  CG2   . VAL A 1 405 ? 22.940 2.163   -13.042 1.00 40.10 ? 402 VAL A CG2   1 
ATOM   3201 N  N     . ILE A 1 406 ? 20.886 3.160   -8.863  1.00 43.18 ? 403 ILE A N     1 
ATOM   3202 C  CA    . ILE A 1 406 ? 20.639 2.847   -7.454  1.00 48.00 ? 403 ILE A CA    1 
ATOM   3203 C  C     . ILE A 1 406 ? 19.260 3.275   -6.945  1.00 47.05 ? 403 ILE A C     1 
ATOM   3204 O  O     . ILE A 1 406 ? 18.832 2.851   -5.870  1.00 50.00 ? 403 ILE A O     1 
ATOM   3205 C  CB    . ILE A 1 406 ? 21.702 3.479   -6.529  1.00 34.43 ? 403 ILE A CB    1 
ATOM   3206 C  CG1   . ILE A 1 406 ? 21.597 5.006   -6.559  1.00 41.10 ? 403 ILE A CG1   1 
ATOM   3207 C  CG2   . ILE A 1 406 ? 23.092 3.002   -6.911  1.00 38.47 ? 403 ILE A CG2   1 
ATOM   3208 C  CD1   . ILE A 1 406 ? 22.476 5.700   -5.543  1.00 52.40 ? 403 ILE A CD1   1 
ATOM   3209 N  N     . LYS A 1 407 ? 18.573 4.113   -7.713  1.00 41.73 ? 404 LYS A N     1 
ATOM   3210 C  CA    . LYS A 1 407 ? 17.305 4.693   -7.276  1.00 52.16 ? 404 LYS A CA    1 
ATOM   3211 C  C     . LYS A 1 407 ? 16.277 3.640   -6.854  1.00 57.34 ? 404 LYS A C     1 
ATOM   3212 O  O     . LYS A 1 407 ? 15.373 3.928   -6.070  1.00 56.43 ? 404 LYS A O     1 
ATOM   3213 C  CB    . LYS A 1 407 ? 16.724 5.595   -8.368  1.00 54.01 ? 404 LYS A CB    1 
ATOM   3214 C  CG    . LYS A 1 407 ? 16.222 4.844   -9.589  1.00 51.60 ? 404 LYS A CG    1 
ATOM   3215 C  CD    . LYS A 1 407 ? 15.829 5.800   -10.701 1.00 54.29 ? 404 LYS A CD    1 
ATOM   3216 C  CE    . LYS A 1 407 ? 15.148 5.060   -11.840 1.00 59.24 ? 404 LYS A CE    1 
ATOM   3217 N  NZ    . LYS A 1 407 ? 15.939 3.879   -12.285 1.00 70.84 ? 404 LYS A NZ    1 
ATOM   3218 N  N     . ASN A 1 408 ? 16.421 2.423   -7.370  1.00 53.78 ? 405 ASN A N     1 
ATOM   3219 C  CA    . ASN A 1 408 ? 15.493 1.341   -7.043  1.00 61.15 ? 405 ASN A CA    1 
ATOM   3220 C  C     . ASN A 1 408 ? 15.715 0.755   -5.653  1.00 65.03 ? 405 ASN A C     1 
ATOM   3221 O  O     . ASN A 1 408 ? 15.083 -0.235  -5.282  1.00 51.26 ? 405 ASN A O     1 
ATOM   3222 C  CB    . ASN A 1 408 ? 15.569 0.221   -8.087  1.00 62.30 ? 405 ASN A CB    1 
ATOM   3223 C  CG    . ASN A 1 408 ? 15.149 0.680   -9.470  1.00 70.96 ? 405 ASN A CG    1 
ATOM   3224 O  OD1   . ASN A 1 408 ? 15.713 0.250   -10.478 1.00 75.94 ? 405 ASN A OD1   1 
ATOM   3225 N  ND2   . ASN A 1 408 ? 14.157 1.563   -9.526  1.00 70.11 ? 405 ASN A ND2   1 
ATOM   3226 N  N     . CYS A 1 409 ? 16.616 1.363   -4.888  1.00 50.33 ? 406 CYS A N     1 
ATOM   3227 C  CA    . CYS A 1 409 ? 16.936 0.865   -3.556  1.00 54.12 ? 406 CYS A CA    1 
ATOM   3228 C  C     . CYS A 1 409 ? 16.105 1.582   -2.510  1.00 50.57 ? 406 CYS A C     1 
ATOM   3229 O  O     . CYS A 1 409 ? 15.982 1.125   -1.375  1.00 62.63 ? 406 CYS A O     1 
ATOM   3230 C  CB    . CYS A 1 409 ? 18.423 1.050   -3.256  1.00 58.29 ? 406 CYS A CB    1 
ATOM   3231 S  SG    . CYS A 1 409 ? 19.506 0.134   -4.360  1.00 72.74 ? 406 CYS A SG    1 
ATOM   3232 N  N     . ASN A 1 410 ? 15.539 2.715   -2.906  1.00 48.58 ? 407 ASN A N     1 
ATOM   3233 C  CA    . ASN A 1 410 ? 14.708 3.507   -2.016  1.00 60.23 ? 407 ASN A CA    1 
ATOM   3234 C  C     . ASN A 1 410 ? 13.388 2.806   -1.684  1.00 69.02 ? 407 ASN A C     1 
ATOM   3235 O  O     . ASN A 1 410 ? 12.469 2.764   -2.504  1.00 66.29 ? 407 ASN A O     1 
ATOM   3236 C  CB    . ASN A 1 410 ? 14.451 4.881   -2.632  1.00 35.88 ? 407 ASN A CB    1 
ATOM   3237 C  CG    . ASN A 1 410 ? 13.776 5.822   -1.674  1.00 51.44 ? 407 ASN A CG    1 
ATOM   3238 O  OD1   . ASN A 1 410 ? 13.589 5.497   -0.503  1.00 50.44 ? 407 ASN A OD1   1 
ATOM   3239 N  ND2   . ASN A 1 410 ? 13.412 7.003   -2.161  1.00 42.24 ? 407 ASN A ND2   1 
ATOM   3240 N  N     . THR A 1 411 ? 13.306 2.254   -0.477  1.00 57.88 ? 408 THR A N     1 
ATOM   3241 C  CA    . THR A 1 411 ? 12.117 1.538   -0.028  1.00 58.87 ? 408 THR A CA    1 
ATOM   3242 C  C     . THR A 1 411 ? 10.994 2.506   0.329   1.00 65.82 ? 408 THR A C     1 
ATOM   3243 O  O     . THR A 1 411 ? 9.864  2.093   0.592   1.00 71.56 ? 408 THR A O     1 
ATOM   3244 C  CB    . THR A 1 411 ? 12.426 0.647   1.195   1.00 58.89 ? 408 THR A CB    1 
ATOM   3245 O  OG1   . THR A 1 411 ? 13.541 -0.202  0.900   1.00 69.58 ? 408 THR A OG1   1 
ATOM   3246 C  CG2   . THR A 1 411 ? 11.226 -0.216  1.555   1.00 78.37 ? 408 THR A CG2   1 
ATOM   3247 N  N     . SER A 1 412 ? 11.311 3.796   0.331   1.00 65.50 ? 409 SER A N     1 
ATOM   3248 C  CA    . SER A 1 412 ? 10.337 4.827   0.672   1.00 55.49 ? 409 SER A CA    1 
ATOM   3249 C  C     . SER A 1 412 ? 9.049  4.684   -0.125  1.00 65.65 ? 409 SER A C     1 
ATOM   3250 O  O     . SER A 1 412 ? 9.033  4.084   -1.199  1.00 68.30 ? 409 SER A O     1 
ATOM   3251 C  CB    . SER A 1 412 ? 10.928 6.217   0.436   1.00 53.43 ? 409 SER A CB    1 
ATOM   3252 O  OG    . SER A 1 412 ? 9.927  7.218   0.508   1.00 65.00 ? 409 SER A OG    1 
ATOM   3253 N  N     . GLY A 1 413 ? 7.968  5.232   0.418   1.00 71.36 ? 410 GLY A N     1 
ATOM   3254 C  CA    . GLY A 1 413 ? 6.712  5.314   -0.301  1.00 66.49 ? 410 GLY A CA    1 
ATOM   3255 C  C     . GLY A 1 413 ? 6.558  6.723   -0.833  1.00 65.10 ? 410 GLY A C     1 
ATOM   3256 O  O     . GLY A 1 413 ? 6.084  6.936   -1.950  1.00 63.99 ? 410 GLY A O     1 
ATOM   3257 N  N     . ILE A 1 414 ? 6.975  7.688   -0.019  1.00 65.28 ? 411 ILE A N     1 
ATOM   3258 C  CA    . ILE A 1 414 ? 6.975  9.090   -0.408  1.00 62.95 ? 411 ILE A CA    1 
ATOM   3259 C  C     . ILE A 1 414 ? 8.118  9.344   -1.381  1.00 71.17 ? 411 ILE A C     1 
ATOM   3260 O  O     . ILE A 1 414 ? 9.291  9.235   -1.018  1.00 70.87 ? 411 ILE A O     1 
ATOM   3261 C  CB    . ILE A 1 414 ? 7.145  10.003  0.819   1.00 64.13 ? 411 ILE A CB    1 
ATOM   3262 C  CG1   . ILE A 1 414 ? 6.195  9.567   1.937   1.00 57.63 ? 411 ILE A CG1   1 
ATOM   3263 C  CG2   . ILE A 1 414 ? 6.930  11.464  0.434   1.00 58.28 ? 411 ILE A CG2   1 
ATOM   3264 C  CD1   . ILE A 1 414 ? 6.484  10.210  3.273   1.00 65.39 ? 411 ILE A CD1   1 
ATOM   3265 N  N     . GLN A 1 415 ? 7.767  9.678   -2.619  1.00 72.92 ? 412 GLN A N     1 
ATOM   3266 C  CA    . GLN A 1 415 ? 8.745  9.887   -3.684  1.00 72.41 ? 412 GLN A CA    1 
ATOM   3267 C  C     . GLN A 1 415 ? 10.014 10.580  -3.191  1.00 67.22 ? 412 GLN A C     1 
ATOM   3268 O  O     . GLN A 1 415 ? 11.124 10.080  -3.387  1.00 70.68 ? 412 GLN A O     1 
ATOM   3269 C  CB    . GLN A 1 415 ? 8.116  10.701  -4.820  1.00 69.05 ? 412 GLN A CB    1 
ATOM   3270 C  CG    . GLN A 1 415 ? 8.815  10.555  -6.160  1.00 72.08 ? 412 GLN A CG    1 
ATOM   3271 C  CD    . GLN A 1 415 ? 7.856  10.156  -7.268  1.00 73.91 ? 412 GLN A CD    1 
ATOM   3272 O  OE1   . GLN A 1 415 ? 6.804  10.773  -7.450  1.00 83.87 ? 412 GLN A OE1   1 
ATOM   3273 N  NE2   . GLN A 1 415 ? 8.212  9.110   -8.010  1.00 72.84 ? 412 GLN A NE2   1 
ATOM   3274 N  N     . THR A 1 416 ? 9.835  11.722  -2.534  1.00 59.96 ? 413 THR A N     1 
ATOM   3275 C  CA    . THR A 1 416 ? 10.941 12.606  -2.167  1.00 64.41 ? 413 THR A CA    1 
ATOM   3276 C  C     . THR A 1 416 ? 12.014 11.998  -1.257  1.00 59.39 ? 413 THR A C     1 
ATOM   3277 O  O     . THR A 1 416 ? 13.207 12.233  -1.454  1.00 50.64 ? 413 THR A O     1 
ATOM   3278 C  CB    . THR A 1 416 ? 10.408 13.895  -1.506  1.00 55.92 ? 413 THR A CB    1 
ATOM   3279 O  OG1   . THR A 1 416 ? 9.744  14.692  -2.493  1.00 65.36 ? 413 THR A OG1   1 
ATOM   3280 C  CG2   . THR A 1 416 ? 11.547 14.701  -0.899  1.00 55.16 ? 413 THR A CG2   1 
ATOM   3281 N  N     . GLU A 1 417 ? 11.590 11.226  -0.262  1.00 61.75 ? 414 GLU A N     1 
ATOM   3282 C  CA    . GLU A 1 417 ? 12.497 10.749  0.782   1.00 57.41 ? 414 GLU A CA    1 
ATOM   3283 C  C     . GLU A 1 417 ? 13.277 9.498   0.375   1.00 61.08 ? 414 GLU A C     1 
ATOM   3284 O  O     . GLU A 1 417 ? 12.972 8.872   -0.637  1.00 59.87 ? 414 GLU A O     1 
ATOM   3285 C  CB    . GLU A 1 417 ? 11.714 10.473  2.067   1.00 59.63 ? 414 GLU A CB    1 
ATOM   3286 C  CG    . GLU A 1 417 ? 10.684 11.540  2.413   1.00 63.36 ? 414 GLU A CG    1 
ATOM   3287 C  CD    . GLU A 1 417 ? 11.312 12.867  2.786   1.00 62.77 ? 414 GLU A CD    1 
ATOM   3288 O  OE1   . GLU A 1 417 ? 11.971 12.939  3.845   1.00 57.97 ? 414 GLU A OE1   1 
ATOM   3289 O  OE2   . GLU A 1 417 ? 11.142 13.840  2.022   1.00 69.64 ? 414 GLU A OE2   1 
ATOM   3290 N  N     . TRP A 1 418 ? 14.283 9.140   1.171   1.00 53.49 ? 415 TRP A N     1 
ATOM   3291 C  CA    . TRP A 1 418 ? 15.064 7.930   0.924   1.00 45.95 ? 415 TRP A CA    1 
ATOM   3292 C  C     . TRP A 1 418 ? 15.126 7.033   2.159   1.00 50.16 ? 415 TRP A C     1 
ATOM   3293 O  O     . TRP A 1 418 ? 15.477 7.489   3.247   1.00 56.96 ? 415 TRP A O     1 
ATOM   3294 C  CB    . TRP A 1 418 ? 16.488 8.276   0.469   1.00 47.39 ? 415 TRP A CB    1 
ATOM   3295 C  CG    . TRP A 1 418 ? 17.193 7.101   -0.137  1.00 45.74 ? 415 TRP A CG    1 
ATOM   3296 C  CD1   . TRP A 1 418 ? 17.637 5.985   0.513   1.00 48.55 ? 415 TRP A CD1   1 
ATOM   3297 C  CD2   . TRP A 1 418 ? 17.518 6.915   -1.519  1.00 37.29 ? 415 TRP A CD2   1 
ATOM   3298 N  NE1   . TRP A 1 418 ? 18.218 5.115   -0.381  1.00 49.33 ? 415 TRP A NE1   1 
ATOM   3299 C  CE2   . TRP A 1 418 ? 18.158 5.665   -1.635  1.00 44.69 ? 415 TRP A CE2   1 
ATOM   3300 C  CE3   . TRP A 1 418 ? 17.330 7.686   -2.670  1.00 38.21 ? 415 TRP A CE3   1 
ATOM   3301 C  CZ2   . TRP A 1 418 ? 18.613 5.171   -2.855  1.00 55.64 ? 415 TRP A CZ2   1 
ATOM   3302 C  CZ3   . TRP A 1 418 ? 17.784 7.195   -3.878  1.00 38.01 ? 415 TRP A CZ3   1 
ATOM   3303 C  CH2   . TRP A 1 418 ? 18.416 5.950   -3.963  1.00 45.82 ? 415 TRP A CH2   1 
ATOM   3304 N  N     . SER A 1 419 ? 14.800 5.754   1.986   1.00 45.69 ? 416 SER A N     1 
ATOM   3305 C  CA    . SER A 1 419 ? 14.836 4.809   3.099   1.00 54.80 ? 416 SER A CA    1 
ATOM   3306 C  C     . SER A 1 419 ? 15.264 3.408   2.662   1.00 51.01 ? 416 SER A C     1 
ATOM   3307 O  O     . SER A 1 419 ? 14.854 2.932   1.605   1.00 59.90 ? 416 SER A O     1 
ATOM   3308 C  CB    . SER A 1 419 ? 13.472 4.746   3.791   1.00 64.94 ? 416 SER A CB    1 
ATOM   3309 O  OG    . SER A 1 419 ? 12.468 4.294   2.899   1.00 63.27 ? 416 SER A OG    1 
ATOM   3310 N  N     . PRO A 1 420 ? 16.109 2.753   3.474   1.00 46.08 ? 417 PRO A N     1 
ATOM   3311 C  CA    . PRO A 1 420 ? 16.707 3.387   4.653   1.00 61.17 ? 417 PRO A CA    1 
ATOM   3312 C  C     . PRO A 1 420 ? 17.844 4.313   4.236   1.00 50.59 ? 417 PRO A C     1 
ATOM   3313 O  O     . PRO A 1 420 ? 18.367 4.168   3.131   1.00 55.65 ? 417 PRO A O     1 
ATOM   3314 C  CB    . PRO A 1 420 ? 17.254 2.196   5.444   1.00 54.05 ? 417 PRO A CB    1 
ATOM   3315 C  CG    . PRO A 1 420 ? 17.551 1.173   4.412   1.00 61.49 ? 417 PRO A CG    1 
ATOM   3316 C  CD    . PRO A 1 420 ? 16.486 1.333   3.360   1.00 52.59 ? 417 PRO A CD    1 
ATOM   3317 N  N     . PRO A 1 421 ? 18.215 5.264   5.106   1.00 56.98 ? 418 PRO A N     1 
ATOM   3318 C  CA    . PRO A 1 421 ? 19.287 6.217   4.801   1.00 48.39 ? 418 PRO A CA    1 
ATOM   3319 C  C     . PRO A 1 421 ? 20.547 5.523   4.289   1.00 32.81 ? 418 PRO A C     1 
ATOM   3320 O  O     . PRO A 1 421 ? 20.809 4.372   4.653   1.00 33.53 ? 418 PRO A O     1 
ATOM   3321 C  CB    . PRO A 1 421 ? 19.560 6.869   6.157   1.00 44.99 ? 418 PRO A CB    1 
ATOM   3322 C  CG    . PRO A 1 421 ? 18.254 6.794   6.868   1.00 58.96 ? 418 PRO A CG    1 
ATOM   3323 C  CD    . PRO A 1 421 ? 17.632 5.494   6.440   1.00 53.08 ? 418 PRO A CD    1 
ATOM   3324 N  N     . LEU A 1 422 ? 21.305 6.222   3.448   1.00 45.98 ? 419 LEU A N     1 
ATOM   3325 C  CA    . LEU A 1 422 ? 22.559 5.703   2.910   1.00 37.94 ? 419 LEU A CA    1 
ATOM   3326 C  C     . LEU A 1 422 ? 23.742 6.211   3.725   1.00 25.35 ? 419 LEU A C     1 
ATOM   3327 O  O     . LEU A 1 422 ? 23.871 7.409   3.958   1.00 37.36 ? 419 LEU A O     1 
ATOM   3328 C  CB    . LEU A 1 422 ? 22.731 6.123   1.449   1.00 34.90 ? 419 LEU A CB    1 
ATOM   3329 C  CG    . LEU A 1 422 ? 21.667 5.681   0.443   1.00 42.53 ? 419 LEU A CG    1 
ATOM   3330 C  CD1   . LEU A 1 422 ? 22.076 6.081   -0.975  1.00 28.52 ? 419 LEU A CD1   1 
ATOM   3331 C  CD2   . LEU A 1 422 ? 21.425 4.182   0.537   1.00 34.44 ? 419 LEU A CD2   1 
ATOM   3332 N  N     . THR A 1 423 ? 24.604 5.296   4.154   1.00 35.93 ? 420 THR A N     1 
ATOM   3333 C  CA    . THR A 1 423 ? 25.734 5.662   4.999   1.00 31.10 ? 420 THR A CA    1 
ATOM   3334 C  C     . THR A 1 423 ? 27.072 5.618   4.253   1.00 30.23 ? 420 THR A C     1 
ATOM   3335 O  O     . THR A 1 423 ? 28.119 5.883   4.840   1.00 23.33 ? 420 THR A O     1 
ATOM   3336 C  CB    . THR A 1 423 ? 25.811 4.775   6.253   1.00 32.24 ? 420 THR A CB    1 
ATOM   3337 O  OG1   . THR A 1 423 ? 25.846 3.395   5.865   1.00 39.73 ? 420 THR A OG1   1 
ATOM   3338 C  CG2   . THR A 1 423 ? 24.602 5.019   7.149   1.00 38.84 ? 420 THR A CG2   1 
ATOM   3339 N  N     . MET A 1 424 ? 27.032 5.268   2.970   1.00 25.11 ? 421 MET A N     1 
ATOM   3340 C  CA    . MET A 1 424 ? 28.225 5.335   2.120   1.00 21.64 ? 421 MET A CA    1 
ATOM   3341 C  C     . MET A 1 424 ? 27.851 5.439   0.644   1.00 31.06 ? 421 MET A C     1 
ATOM   3342 O  O     . MET A 1 424 ? 26.903 4.797   0.189   1.00 26.72 ? 421 MET A O     1 
ATOM   3343 C  CB    . MET A 1 424 ? 29.139 4.131   2.368   1.00 24.49 ? 421 MET A CB    1 
ATOM   3344 C  CG    . MET A 1 424 ? 30.417 4.105   1.527   1.00 22.78 ? 421 MET A CG    1 
ATOM   3345 S  SD    . MET A 1 424 ? 30.140 3.463   -0.136  1.00 28.44 ? 421 MET A SD    1 
ATOM   3346 C  CE    . MET A 1 424 ? 29.613 1.790   0.234   1.00 27.86 ? 421 MET A CE    1 
ATOM   3347 N  N     . LEU A 1 425 ? 28.583 6.280   -0.085  1.00 19.55 ? 422 LEU A N     1 
ATOM   3348 C  CA    . LEU A 1 425 ? 28.499 6.349   -1.541  1.00 20.59 ? 422 LEU A CA    1 
ATOM   3349 C  C     . LEU A 1 425 ? 29.879 6.080   -2.134  1.00 19.07 ? 422 LEU A C     1 
ATOM   3350 O  O     . LEU A 1 425 ? 30.887 6.544   -1.595  1.00 20.40 ? 422 LEU A O     1 
ATOM   3351 C  CB    . LEU A 1 425 ? 28.020 7.727   -1.998  1.00 16.01 ? 422 LEU A CB    1 
ATOM   3352 C  CG    . LEU A 1 425 ? 26.601 8.148   -1.613  1.00 28.38 ? 422 LEU A CG    1 
ATOM   3353 C  CD1   . LEU A 1 425 ? 26.289 9.508   -2.227  1.00 26.63 ? 422 LEU A CD1   1 
ATOM   3354 C  CD2   . LEU A 1 425 ? 25.584 7.105   -2.051  1.00 24.07 ? 422 LEU A CD2   1 
ATOM   3355 N  N     . PHE A 1 426 ? 29.921 5.350   -3.248  1.00 18.76 ? 423 PHE A N     1 
ATOM   3356 C  CA    . PHE A 1 426 ? 31.185 4.965   -3.882  1.00 14.36 ? 423 PHE A CA    1 
ATOM   3357 C  C     . PHE A 1 426 ? 31.016 4.928   -5.402  1.00 22.94 ? 423 PHE A C     1 
ATOM   3358 O  O     . PHE A 1 426 ? 30.119 4.248   -5.913  1.00 18.89 ? 423 PHE A O     1 
ATOM   3359 C  CB    . PHE A 1 426 ? 31.613 3.584   -3.367  1.00 19.36 ? 423 PHE A CB    1 
ATOM   3360 C  CG    . PHE A 1 426 ? 32.954 3.120   -3.866  1.00 20.56 ? 423 PHE A CG    1 
ATOM   3361 C  CD1   . PHE A 1 426 ? 33.259 1.770   -3.898  1.00 48.51 ? 423 PHE A CD1   1 
ATOM   3362 C  CD2   . PHE A 1 426 ? 33.918 4.026   -4.281  1.00 25.47 ? 423 PHE A CD2   1 
ATOM   3363 C  CE1   . PHE A 1 426 ? 34.487 1.331   -4.349  1.00 37.70 ? 423 PHE A CE1   1 
ATOM   3364 C  CE2   . PHE A 1 426 ? 35.152 3.592   -4.730  1.00 26.48 ? 423 PHE A CE2   1 
ATOM   3365 C  CZ    . PHE A 1 426 ? 35.435 2.242   -4.764  1.00 30.01 ? 423 PHE A CZ    1 
ATOM   3366 N  N     . LEU A 1 427 ? 31.864 5.671   -6.113  1.00 15.92 ? 424 LEU A N     1 
ATOM   3367 C  CA    . LEU A 1 427 ? 31.915 5.636   -7.576  1.00 13.42 ? 424 LEU A CA    1 
ATOM   3368 C  C     . LEU A 1 427 ? 33.293 5.196   -8.006  1.00 19.23 ? 424 LEU A C     1 
ATOM   3369 O  O     . LEU A 1 427 ? 34.285 5.729   -7.524  1.00 18.07 ? 424 LEU A O     1 
ATOM   3370 C  CB    . LEU A 1 427 ? 31.649 7.017   -8.174  1.00 21.02 ? 424 LEU A CB    1 
ATOM   3371 C  CG    . LEU A 1 427 ? 30.281 7.666   -7.998  1.00 26.66 ? 424 LEU A CG    1 
ATOM   3372 C  CD1   . LEU A 1 427 ? 30.284 9.021   -8.686  1.00 23.02 ? 424 LEU A CD1   1 
ATOM   3373 C  CD2   . LEU A 1 427 ? 29.177 6.777   -8.559  1.00 21.40 ? 424 LEU A CD2   1 
ATOM   3374 N  N     . CYS A 1 428 ? 33.362 4.246   -8.934  1.00 15.35 ? 425 CYS A N     1 
ATOM   3375 C  CA    . CYS A 1 428 ? 34.651 3.726   -9.367  1.00 15.17 ? 425 CYS A CA    1 
ATOM   3376 C  C     . CYS A 1 428 ? 34.676 3.515   -10.877 1.00 22.37 ? 425 CYS A C     1 
ATOM   3377 O  O     . CYS A 1 428 ? 33.776 2.893   -11.447 1.00 22.41 ? 425 CYS A O     1 
ATOM   3378 C  CB    . CYS A 1 428 ? 34.969 2.418   -8.638  1.00 19.62 ? 425 CYS A CB    1 
ATOM   3379 S  SG    . CYS A 1 428 ? 36.664 1.812   -8.909  1.00 24.15 ? 425 CYS A SG    1 
ATOM   3380 N  N     . ALA A 1 429 ? 35.698 4.064   -11.519 1.00 15.07 ? 426 ALA A N     1 
ATOM   3381 C  CA    . ALA A 1 429 ? 35.886 3.891   -12.947 1.00 16.83 ? 426 ALA A CA    1 
ATOM   3382 C  C     . ALA A 1 429 ? 36.818 2.703   -13.179 1.00 16.24 ? 426 ALA A C     1 
ATOM   3383 O  O     . ALA A 1 429 ? 37.879 2.605   -12.558 1.00 15.72 ? 426 ALA A O     1 
ATOM   3384 C  CB    . ALA A 1 429 ? 36.464 5.154   -13.561 1.00 15.46 ? 426 ALA A CB    1 
ATOM   3385 N  N     . THR A 1 430 ? 36.419 1.806   -14.079 1.00 16.95 ? 427 THR A N     1 
ATOM   3386 C  CA    . THR A 1 430 ? 37.143 0.554   -14.278 1.00 17.59 ? 427 THR A CA    1 
ATOM   3387 C  C     . THR A 1 430 ? 37.185 0.149   -15.746 1.00 21.52 ? 427 THR A C     1 
ATOM   3388 O  O     . THR A 1 430 ? 36.624 0.829   -16.602 1.00 19.88 ? 427 THR A O     1 
ATOM   3389 C  CB    . THR A 1 430 ? 36.472 -0.607  -13.504 1.00 19.15 ? 427 THR A CB    1 
ATOM   3390 O  OG1   . THR A 1 430 ? 35.196 -0.898  -14.083 1.00 26.17 ? 427 THR A OG1   1 
ATOM   3391 C  CG2   . THR A 1 430 ? 36.286 -0.250  -12.035 1.00 26.81 ? 427 THR A CG2   1 
ATOM   3392 N  N     . LYS A 1 431 ? 37.845 -0.972  -16.023 1.00 21.69 ? 428 LYS A N     1 
ATOM   3393 C  CA    . LYS A 1 431 ? 37.873 -1.540  -17.372 1.00 24.40 ? 428 LYS A CA    1 
ATOM   3394 C  C     . LYS A 1 431 ? 38.440 -0.555  -18.385 1.00 16.77 ? 428 LYS A C     1 
ATOM   3395 O  O     . LYS A 1 431 ? 37.741 -0.095  -19.288 1.00 21.89 ? 428 LYS A O     1 
ATOM   3396 C  CB    . LYS A 1 431 ? 36.478 -2.002  -17.791 1.00 24.54 ? 428 LYS A CB    1 
ATOM   3397 C  CG    . LYS A 1 431 ? 35.922 -3.111  -16.904 1.00 36.42 ? 428 LYS A CG    1 
ATOM   3398 C  CD    . LYS A 1 431 ? 34.762 -3.843  -17.565 1.00 43.81 ? 428 LYS A CD    1 
ATOM   3399 C  CE    . LYS A 1 431 ? 34.208 -4.931  -16.653 1.00 45.22 ? 428 LYS A CE    1 
ATOM   3400 N  NZ    . LYS A 1 431 ? 35.294 -5.763  -16.061 1.00 51.11 ? 428 LYS A NZ    1 
ATOM   3401 N  N     . PHE A 1 432 ? 39.717 -0.236  -18.225 1.00 20.70 ? 429 PHE A N     1 
ATOM   3402 C  CA    . PHE A 1 432 ? 40.386 0.698   -19.116 1.00 17.89 ? 429 PHE A CA    1 
ATOM   3403 C  C     . PHE A 1 432 ? 40.699 0.065   -20.466 1.00 27.52 ? 429 PHE A C     1 
ATOM   3404 O  O     . PHE A 1 432 ? 40.986 -1.131  -20.558 1.00 23.14 ? 429 PHE A O     1 
ATOM   3405 C  CB    . PHE A 1 432 ? 41.677 1.228   -18.475 1.00 18.08 ? 429 PHE A CB    1 
ATOM   3406 C  CG    . PHE A 1 432 ? 41.443 2.208   -17.356 1.00 17.18 ? 429 PHE A CG    1 
ATOM   3407 C  CD1   . PHE A 1 432 ? 41.313 3.564   -17.616 1.00 16.71 ? 429 PHE A CD1   1 
ATOM   3408 C  CD2   . PHE A 1 432 ? 41.344 1.772   -16.044 1.00 27.04 ? 429 PHE A CD2   1 
ATOM   3409 C  CE1   . PHE A 1 432 ? 41.092 4.466   -16.589 1.00 16.45 ? 429 PHE A CE1   1 
ATOM   3410 C  CE2   . PHE A 1 432 ? 41.124 2.669   -15.014 1.00 32.65 ? 429 PHE A CE2   1 
ATOM   3411 C  CZ    . PHE A 1 432 ? 40.995 4.018   -15.290 1.00 28.11 ? 429 PHE A CZ    1 
ATOM   3412 N  N     . SER A 1 433 ? 40.628 0.885   -21.510 1.00 21.35 ? 430 SER A N     1 
ATOM   3413 C  CA    . SER A 1 433 ? 41.051 0.501   -22.848 1.00 20.29 ? 430 SER A CA    1 
ATOM   3414 C  C     . SER A 1 433 ? 42.008 1.569   -23.344 1.00 28.32 ? 430 SER A C     1 
ATOM   3415 O  O     . SER A 1 433 ? 41.943 2.709   -22.895 1.00 19.08 ? 430 SER A O     1 
ATOM   3416 C  CB    . SER A 1 433 ? 39.848 0.408   -23.787 1.00 29.95 ? 430 SER A CB    1 
ATOM   3417 O  OG    . SER A 1 433 ? 38.959 -0.615  -23.377 1.00 45.66 ? 430 SER A OG    1 
ATOM   3418 N  N     . ALA A 1 434 ? 42.902 1.205   -24.258 1.00 22.72 ? 431 ALA A N     1 
ATOM   3419 C  CA    . ALA A 1 434 ? 43.844 2.173   -24.807 1.00 20.58 ? 431 ALA A CA    1 
ATOM   3420 C  C     . ALA A 1 434 ? 43.099 3.242   -25.601 1.00 29.61 ? 431 ALA A C     1 
ATOM   3421 O  O     . ALA A 1 434 ? 42.081 2.960   -26.233 1.00 30.42 ? 431 ALA A O     1 
ATOM   3422 C  CB    . ALA A 1 434 ? 44.886 1.481   -25.676 1.00 33.35 ? 431 ALA A CB    1 
ATOM   3423 N  N     . SER A 1 435 ? 43.603 4.472   -25.554 1.00 20.45 ? 432 SER A N     1 
ATOM   3424 C  CA    . SER A 1 435 ? 43.002 5.567   -26.308 1.00 25.66 ? 432 SER A CA    1 
ATOM   3425 C  C     . SER A 1 435 ? 44.076 6.496   -26.861 1.00 36.91 ? 432 SER A C     1 
ATOM   3426 O  O     . SER A 1 435 ? 43.773 7.579   -27.352 1.00 33.68 ? 432 SER A O     1 
ATOM   3427 C  CB    . SER A 1 435 ? 42.031 6.353   -25.430 1.00 32.35 ? 432 SER A CB    1 
ATOM   3428 O  OG    . SER A 1 435 ? 42.723 6.987   -24.368 1.00 40.62 ? 432 SER A OG    1 
ATOM   3429 O  OXT   . SER A 1 435 ? 45.270 6.195   -26.828 1.00 41.56 ? 432 SER A OXT   1 
ATOM   3430 O  "O3'" . DC  B 2 1   ? 26.958 5.090   11.859  1.00 52.71 ? 1   DC  T "O3'" 1 
ATOM   3431 P  P     . DA  B 2 2   ? 28.070 4.897   13.003  1.00 94.09 ? 2   DA  T P     1 
ATOM   3432 O  OP1   . DA  B 2 2   ? 28.091 3.464   13.382  1.00 87.52 ? 2   DA  T OP1   1 
ATOM   3433 O  OP2   . DA  B 2 2   ? 27.842 5.931   14.039  1.00 70.81 ? 2   DA  T OP2   1 
ATOM   3434 O  "O5'" . DA  B 2 2   ? 29.442 5.255   12.258  1.00 76.87 ? 2   DA  T "O5'" 1 
ATOM   3435 C  "C5'" . DA  B 2 2   ? 30.677 4.743   12.754  1.00 64.56 ? 2   DA  T "C5'" 1 
ATOM   3436 C  "C4'" . DA  B 2 2   ? 31.649 5.851   13.124  1.00 57.95 ? 2   DA  T "C4'" 1 
ATOM   3437 O  "O4'" . DA  B 2 2   ? 31.136 7.133   12.686  1.00 55.17 ? 2   DA  T "O4'" 1 
ATOM   3438 C  "C3'" . DA  B 2 2   ? 31.918 5.985   14.621  1.00 57.99 ? 2   DA  T "C3'" 1 
ATOM   3439 O  "O3'" . DA  B 2 2   ? 33.305 5.815   14.863  1.00 53.84 ? 2   DA  T "O3'" 1 
ATOM   3440 C  "C2'" . DA  B 2 2   ? 31.455 7.391   14.996  1.00 51.32 ? 2   DA  T "C2'" 1 
ATOM   3441 C  "C1'" . DA  B 2 2   ? 31.445 8.112   13.655  1.00 54.98 ? 2   DA  T "C1'" 1 
ATOM   3442 N  N9    . DA  B 2 2   ? 30.430 9.153   13.571  1.00 46.31 ? 2   DA  T N9    1 
ATOM   3443 C  C8    . DA  B 2 2   ? 29.129 9.077   13.988  1.00 53.20 ? 2   DA  T C8    1 
ATOM   3444 N  N7    . DA  B 2 2   ? 28.440 10.176  13.778  1.00 51.23 ? 2   DA  T N7    1 
ATOM   3445 C  C5    . DA  B 2 2   ? 29.355 11.029  13.180  1.00 49.41 ? 2   DA  T C5    1 
ATOM   3446 C  C6    . DA  B 2 2   ? 29.250 12.352  12.709  1.00 53.56 ? 2   DA  T C6    1 
ATOM   3447 N  N6    . DA  B 2 2   ? 28.125 13.072  12.772  1.00 56.63 ? 2   DA  T N6    1 
ATOM   3448 N  N1    . DA  B 2 2   ? 30.355 12.907  12.166  1.00 60.48 ? 2   DA  T N1    1 
ATOM   3449 C  C2    . DA  B 2 2   ? 31.481 12.184  12.102  1.00 47.93 ? 2   DA  T C2    1 
ATOM   3450 N  N3    . DA  B 2 2   ? 31.701 10.935  12.510  1.00 42.47 ? 2   DA  T N3    1 
ATOM   3451 C  C4    . DA  B 2 2   ? 30.586 10.413  13.045  1.00 51.89 ? 2   DA  T C4    1 
ATOM   3452 P  P     . DT  B 2 3   ? 33.871 4.383   15.318  1.00 65.45 ? 3   DT  T P     1 
ATOM   3453 O  OP1   . DT  B 2 3   ? 32.738 3.593   15.851  1.00 65.37 ? 3   DT  T OP1   1 
ATOM   3454 O  OP2   . DT  B 2 3   ? 35.070 4.613   16.154  1.00 53.36 ? 3   DT  T OP2   1 
ATOM   3455 O  "O5'" . DT  B 2 3   ? 34.335 3.706   13.943  1.00 61.45 ? 3   DT  T "O5'" 1 
ATOM   3456 C  "C5'" . DT  B 2 3   ? 35.690 3.811   13.515  1.00 52.29 ? 3   DT  T "C5'" 1 
ATOM   3457 C  "C4'" . DT  B 2 3   ? 35.912 5.085   12.721  1.00 50.31 ? 3   DT  T "C4'" 1 
ATOM   3458 O  "O4'" . DT  B 2 3   ? 37.336 5.280   12.526  1.00 54.09 ? 3   DT  T "O4'" 1 
ATOM   3459 C  "C3'" . DT  B 2 3   ? 35.276 5.104   11.333  1.00 45.45 ? 3   DT  T "C3'" 1 
ATOM   3460 O  "O3'" . DT  B 2 3   ? 34.623 6.350   11.140  1.00 39.27 ? 3   DT  T "O3'" 1 
ATOM   3461 C  "C2'" . DT  B 2 3   ? 36.453 4.917   10.380  1.00 46.84 ? 3   DT  T "C2'" 1 
ATOM   3462 C  "C1'" . DT  B 2 3   ? 37.605 5.541   11.163  1.00 47.40 ? 3   DT  T "C1'" 1 
ATOM   3463 N  N1    . DT  B 2 3   ? 38.948 4.961   10.862  1.00 47.13 ? 3   DT  T N1    1 
ATOM   3464 C  C2    . DT  B 2 3   ? 39.978 5.791   10.458  1.00 50.98 ? 3   DT  T C2    1 
ATOM   3465 O  O2    . DT  B 2 3   ? 39.862 6.999   10.322  1.00 56.80 ? 3   DT  T O2    1 
ATOM   3466 N  N3    . DT  B 2 3   ? 41.167 5.145   10.218  1.00 41.03 ? 3   DT  T N3    1 
ATOM   3467 C  C4    . DT  B 2 3   ? 41.419 3.787   10.339  1.00 46.57 ? 3   DT  T C4    1 
ATOM   3468 O  O4    . DT  B 2 3   ? 42.521 3.305   10.101  1.00 41.25 ? 3   DT  T O4    1 
ATOM   3469 C  C5    . DT  B 2 3   ? 40.301 2.980   10.768  1.00 36.79 ? 3   DT  T C5    1 
ATOM   3470 C  C7    . DT  B 2 3   ? 40.452 1.496   10.937  1.00 57.63 ? 3   DT  T C7    1 
ATOM   3471 C  C6    . DT  B 2 3   ? 39.137 3.600   11.010  1.00 46.96 ? 3   DT  T C6    1 
ATOM   3472 P  P     . DT  B 2 4   ? 33.934 6.689   9.731   1.00 55.41 ? 4   DT  T P     1 
ATOM   3473 O  OP1   . DT  B 2 4   ? 33.159 7.942   9.893   1.00 53.77 ? 4   DT  T OP1   1 
ATOM   3474 O  OP2   . DT  B 2 4   ? 33.242 5.469   9.256   1.00 54.58 ? 4   DT  T OP2   1 
ATOM   3475 O  "O5'" . DT  B 2 4   ? 35.186 6.953   8.760   1.00 26.80 ? 4   DT  T "O5'" 1 
ATOM   3476 C  "C5'" . DT  B 2 4   ? 35.893 8.178   8.854   1.00 23.00 ? 4   DT  T "C5'" 1 
ATOM   3477 C  "C4'" . DT  B 2 4   ? 36.606 8.418   7.540   1.00 18.71 ? 4   DT  T "C4'" 1 
ATOM   3478 O  "O4'" . DT  B 2 4   ? 37.786 7.587   7.497   1.00 21.76 ? 4   DT  T "O4'" 1 
ATOM   3479 C  "C3'" . DT  B 2 4   ? 35.801 8.083   6.288   1.00 13.75 ? 4   DT  T "C3'" 1 
ATOM   3480 O  "O3'" . DT  B 2 4   ? 36.070 9.145   5.394   1.00 16.47 ? 4   DT  T "O3'" 1 
ATOM   3481 C  "C2'" . DT  B 2 4   ? 36.374 6.735   5.846   1.00 16.99 ? 4   DT  T "C2'" 1 
ATOM   3482 C  "C1'" . DT  B 2 4   ? 37.825 6.875   6.282   1.00 17.40 ? 4   DT  T "C1'" 1 
ATOM   3483 N  N1    . DT  B 2 4   ? 38.562 5.626   6.606   1.00 18.86 ? 4   DT  T N1    1 
ATOM   3484 C  C2    . DT  B 2 4   ? 39.889 5.585   6.261   1.00 14.03 ? 4   DT  T C2    1 
ATOM   3485 O  O2    . DT  B 2 4   ? 40.445 6.505   5.690   1.00 14.30 ? 4   DT  T O2    1 
ATOM   3486 N  N3    . DT  B 2 4   ? 40.529 4.425   6.598   1.00 17.98 ? 4   DT  T N3    1 
ATOM   3487 C  C4    . DT  B 2 4   ? 39.996 3.331   7.243   1.00 20.67 ? 4   DT  T C4    1 
ATOM   3488 O  O4    . DT  B 2 4   ? 40.672 2.341   7.504   1.00 18.30 ? 4   DT  T O4    1 
ATOM   3489 C  C5    . DT  B 2 4   ? 38.600 3.442   7.591   1.00 24.00 ? 4   DT  T C5    1 
ATOM   3490 C  C7    . DT  B 2 4   ? 37.914 2.305   8.300   1.00 21.50 ? 4   DT  T C7    1 
ATOM   3491 C  C6    . DT  B 2 4   ? 37.957 4.573   7.268   1.00 22.02 ? 4   DT  T C6    1 
ATOM   3492 P  P     . DA  B 2 5   ? 35.497 9.128   3.894   1.00 18.27 ? 5   DA  T P     1 
ATOM   3493 O  OP1   . DA  B 2 5   ? 35.157 10.510  3.531   1.00 18.88 ? 5   DA  T OP1   1 
ATOM   3494 O  OP2   . DA  B 2 5   ? 34.496 8.047   3.790   1.00 17.83 ? 5   DA  T OP2   1 
ATOM   3495 O  "O5'" . DA  B 2 5   ? 36.759 8.651   3.025   1.00 16.45 ? 5   DA  T "O5'" 1 
ATOM   3496 C  "C5'" . DA  B 2 5   ? 37.918 9.471   2.919   1.00 12.86 ? 5   DA  T "C5'" 1 
ATOM   3497 C  "C4'" . DA  B 2 5   ? 38.898 8.833   1.959   1.00 14.59 ? 5   DA  T "C4'" 1 
ATOM   3498 O  "O4'" . DA  B 2 5   ? 39.489 7.654   2.581   1.00 17.62 ? 5   DA  T "O4'" 1 
ATOM   3499 C  "C3'" . DA  B 2 5   ? 38.289 8.362   0.640   1.00 13.14 ? 5   DA  T "C3'" 1 
ATOM   3500 O  "O3'" . DA  B 2 5   ? 39.214 8.690   -0.381  1.00 18.13 ? 5   DA  T "O3'" 1 
ATOM   3501 C  "C2'" . DA  B 2 5   ? 38.187 6.847   0.830   1.00 13.01 ? 5   DA  T "C2'" 1 
ATOM   3502 C  "C1'" . DA  B 2 5   ? 39.437 6.580   1.665   1.00 22.09 ? 5   DA  T "C1'" 1 
ATOM   3503 N  N9    . DA  B 2 5   ? 39.434 5.318   2.413   1.00 15.56 ? 5   DA  T N9    1 
ATOM   3504 C  C8    . DA  B 2 5   ? 38.378 4.745   3.064   1.00 16.04 ? 5   DA  T C8    1 
ATOM   3505 N  N7    . DA  B 2 5   ? 38.678 3.610   3.657   1.00 19.05 ? 5   DA  T N7    1 
ATOM   3506 C  C5    . DA  B 2 5   ? 40.028 3.429   3.389   1.00 16.45 ? 5   DA  T C5    1 
ATOM   3507 C  C6    . DA  B 2 5   ? 40.939 2.406   3.743   1.00 16.79 ? 5   DA  T C6    1 
ATOM   3508 N  N6    . DA  B 2 5   ? 40.593 1.345   4.480   1.00 18.15 ? 5   DA  T N6    1 
ATOM   3509 N  N1    . DA  B 2 5   ? 42.209 2.533   3.316   1.00 17.05 ? 5   DA  T N1    1 
ATOM   3510 C  C2    . DA  B 2 5   ? 42.546 3.603   2.580   1.00 18.62 ? 5   DA  T C2    1 
ATOM   3511 N  N3    . DA  B 2 5   ? 41.775 4.621   2.184   1.00 17.28 ? 5   DA  T N3    1 
ATOM   3512 C  C4    . DA  B 2 5   ? 40.512 4.471   2.627   1.00 16.31 ? 5   DA  T C4    1 
ATOM   3513 P  P     . DT  B 2 6   ? 38.791 8.591   -1.928  1.00 16.87 ? 6   DT  T P     1 
ATOM   3514 O  OP1   . DT  B 2 6   ? 39.938 9.047   -2.733  1.00 19.72 ? 6   DT  T OP1   1 
ATOM   3515 O  OP2   . DT  B 2 6   ? 37.489 9.276   -2.092  1.00 18.73 ? 6   DT  T OP2   1 
ATOM   3516 O  "O5'" . DT  B 2 6   ? 38.523 7.027   -2.144  1.00 25.28 ? 6   DT  T "O5'" 1 
ATOM   3517 C  "C5'" . DT  B 2 6   ? 39.270 6.252   -3.075  1.00 18.58 ? 6   DT  T "C5'" 1 
ATOM   3518 C  "C4'" . DT  B 2 6   ? 40.542 5.665   -2.498  1.00 16.64 ? 6   DT  T "C4'" 1 
ATOM   3519 O  "O4'" . DT  B 2 6   ? 40.266 4.968   -1.265  1.00 21.39 ? 6   DT  T "O4'" 1 
ATOM   3520 C  "C3'" . DT  B 2 6   ? 41.126 4.601   -3.408  1.00 19.04 ? 6   DT  T "C3'" 1 
ATOM   3521 O  "O3'" . DT  B 2 6   ? 42.078 5.225   -4.215  1.00 16.67 ? 6   DT  T "O3'" 1 
ATOM   3522 C  "C2'" . DT  B 2 6   ? 41.777 3.583   -2.471  1.00 26.05 ? 6   DT  T "C2'" 1 
ATOM   3523 C  "C1'" . DT  B 2 6   ? 41.230 3.956   -1.097  1.00 23.70 ? 6   DT  T "C1'" 1 
ATOM   3524 N  N1    . DT  B 2 6   ? 40.569 2.841   -0.393  1.00 16.15 ? 6   DT  T N1    1 
ATOM   3525 C  C2    . DT  B 2 6   ? 41.322 1.741   -0.036  1.00 12.76 ? 6   DT  T C2    1 
ATOM   3526 O  O2    . DT  B 2 6   ? 42.502 1.621   -0.285  1.00 17.26 ? 6   DT  T O2    1 
ATOM   3527 N  N3    . DT  B 2 6   ? 40.617 0.775   0.625   1.00 19.25 ? 6   DT  T N3    1 
ATOM   3528 C  C4    . DT  B 2 6   ? 39.288 0.794   0.973   1.00 20.60 ? 6   DT  T C4    1 
ATOM   3529 O  O4    . DT  B 2 6   ? 38.760 -0.135  1.575   1.00 23.64 ? 6   DT  T O4    1 
ATOM   3530 C  C5    . DT  B 2 6   ? 38.559 1.969   0.578   1.00 18.05 ? 6   DT  T C5    1 
ATOM   3531 C  C7    . DT  B 2 6   ? 37.097 2.076   0.906   1.00 22.25 ? 6   DT  T C7    1 
ATOM   3532 C  C6    . DT  B 2 6   ? 39.226 2.926   -0.078  1.00 16.23 ? 6   DT  T C6    1 
ATOM   3533 P  P     . DG  B 2 7   ? 42.266 4.770   -5.738  1.00 16.73 ? 7   DG  T P     1 
ATOM   3534 O  OP1   . DG  B 2 7   ? 43.406 5.530   -6.297  1.00 18.30 ? 7   DG  T OP1   1 
ATOM   3535 O  OP2   . DG  B 2 7   ? 40.960 4.818   -6.393  1.00 14.01 ? 7   DG  T OP2   1 
ATOM   3536 O  "O5'" . DG  B 2 7   ? 42.598 3.192   -5.624  1.00 19.63 ? 7   DG  T "O5'" 1 
ATOM   3537 C  "C5'" . DG  B 2 7   ? 43.912 2.675   -5.661  1.00 37.77 ? 7   DG  T "C5'" 1 
ATOM   3538 C  "C4'" . DG  B 2 7   ? 43.921 1.172   -5.395  1.00 15.98 ? 7   DG  T "C4'" 1 
ATOM   3539 O  "O4'" . DG  B 2 7   ? 43.149 0.861   -4.219  1.00 19.86 ? 7   DG  T "O4'" 1 
ATOM   3540 C  "C3'" . DG  B 2 7   ? 43.327 0.278   -6.478  1.00 20.52 ? 7   DG  T "C3'" 1 
ATOM   3541 O  "O3'" . DG  B 2 7   ? 44.382 -0.287  -7.226  1.00 24.69 ? 7   DG  T "O3'" 1 
ATOM   3542 C  "C2'" . DG  B 2 7   ? 42.577 -0.805  -5.712  1.00 28.26 ? 7   DG  T "C2'" 1 
ATOM   3543 C  "C1'" . DG  B 2 7   ? 42.942 -0.522  -4.260  1.00 18.37 ? 7   DG  T "C1'" 1 
ATOM   3544 N  N9    . DG  B 2 7   ? 41.872 -0.891  -3.346  1.00 18.26 ? 7   DG  T N9    1 
ATOM   3545 C  C8    . DG  B 2 7   ? 40.690 -0.229  -3.116  1.00 18.87 ? 7   DG  T C8    1 
ATOM   3546 N  N7    . DG  B 2 7   ? 39.923 -0.832  -2.245  1.00 21.28 ? 7   DG  T N7    1 
ATOM   3547 C  C5    . DG  B 2 7   ? 40.649 -1.966  -1.885  1.00 19.31 ? 7   DG  T C5    1 
ATOM   3548 C  C6    . DG  B 2 7   ? 40.333 -3.003  -0.977  1.00 16.56 ? 7   DG  T C6    1 
ATOM   3549 O  O6    . DG  B 2 7   ? 39.311 -3.124  -0.282  1.00 20.71 ? 7   DG  T O6    1 
ATOM   3550 N  N1    . DG  B 2 7   ? 41.351 -3.965  -0.917  1.00 17.16 ? 7   DG  T N1    1 
ATOM   3551 C  C2    . DG  B 2 7   ? 42.521 -3.924  -1.642  1.00 18.08 ? 7   DG  T C2    1 
ATOM   3552 N  N2    . DG  B 2 7   ? 43.392 -4.932  -1.460  1.00 17.86 ? 7   DG  T N2    1 
ATOM   3553 N  N3    . DG  B 2 7   ? 42.825 -2.946  -2.492  1.00 20.35 ? 7   DG  T N3    1 
ATOM   3554 C  C4    . DG  B 2 7   ? 41.845 -2.014  -2.556  1.00 15.42 ? 7   DG  T C4    1 
ATOM   3555 P  P     . DA  B 2 8   ? 44.065 -1.257  -8.469  1.00 24.57 ? 8   DA  T P     1 
ATOM   3556 O  OP1   . DA  B 2 8   ? 45.128 -1.068  -9.468  1.00 23.87 ? 8   DA  T OP1   1 
ATOM   3557 O  OP2   . DA  B 2 8   ? 42.638 -1.103  -8.827  1.00 28.06 ? 8   DA  T OP2   1 
ATOM   3558 O  "O5'" . DA  B 2 8   ? 44.259 -2.723  -7.854  1.00 22.95 ? 8   DA  T "O5'" 1 
ATOM   3559 C  "C5'" . DA  B 2 8   ? 45.531 -3.053  -7.306  1.00 14.08 ? 8   DA  T "C5'" 1 
ATOM   3560 C  "C4'" . DA  B 2 8   ? 45.551 -4.527  -6.945  1.00 22.56 ? 8   DA  T "C4'" 1 
ATOM   3561 O  "O4'" . DA  B 2 8   ? 44.659 -4.737  -5.824  1.00 27.29 ? 8   DA  T "O4'" 1 
ATOM   3562 C  "C3'" . DA  B 2 8   ? 45.079 -5.460  -8.059  1.00 24.02 ? 8   DA  T "C3'" 1 
ATOM   3563 O  "O3'" . DA  B 2 8   ? 45.912 -6.616  -8.090  1.00 26.08 ? 8   DA  T "O3'" 1 
ATOM   3564 C  "C2'" . DA  B 2 8   ? 43.649 -5.807  -7.656  1.00 21.20 ? 8   DA  T "C2'" 1 
ATOM   3565 C  "C1'" . DA  B 2 8   ? 43.706 -5.729  -6.133  1.00 22.48 ? 8   DA  T "C1'" 1 
ATOM   3566 N  N9    . DA  B 2 8   ? 42.423 -5.352  -5.553  1.00 25.52 ? 8   DA  T N9    1 
ATOM   3567 C  C8    . DA  B 2 8   ? 41.642 -4.290  -5.916  1.00 22.37 ? 8   DA  T C8    1 
ATOM   3568 N  N7    . DA  B 2 8   ? 40.534 -4.193  -5.231  1.00 17.63 ? 8   DA  T N7    1 
ATOM   3569 C  C5    . DA  B 2 8   ? 40.587 -5.267  -4.357  1.00 17.83 ? 8   DA  T C5    1 
ATOM   3570 C  C6    . DA  B 2 8   ? 39.698 -5.725  -3.367  1.00 21.71 ? 8   DA  T C6    1 
ATOM   3571 N  N6    . DA  B 2 8   ? 38.536 -5.121  -3.077  1.00 15.59 ? 8   DA  T N6    1 
ATOM   3572 N  N1    . DA  B 2 8   ? 40.055 -6.835  -2.680  1.00 23.11 ? 8   DA  T N1    1 
ATOM   3573 C  C2    . DA  B 2 8   ? 41.214 -7.435  -2.971  1.00 17.12 ? 8   DA  T C2    1 
ATOM   3574 N  N3    . DA  B 2 8   ? 42.133 -7.102  -3.883  1.00 18.83 ? 8   DA  T N3    1 
ATOM   3575 C  C4    . DA  B 2 8   ? 41.745 -5.997  -4.547  1.00 25.06 ? 8   DA  T C4    1 
ATOM   3576 P  P     . DC  B 2 9   ? 45.768 -7.697  -9.274  1.00 26.23 ? 9   DC  T P     1 
ATOM   3577 O  OP1   . DC  B 2 9   ? 47.122 -8.179  -9.608  1.00 29.20 ? 9   DC  T OP1   1 
ATOM   3578 O  OP2   . DC  B 2 9   ? 44.909 -7.125  -10.331 1.00 25.71 ? 9   DC  T OP2   1 
ATOM   3579 O  "O5'" . DC  B 2 9   ? 44.928 -8.879  -8.602  1.00 20.89 ? 9   DC  T "O5'" 1 
ATOM   3580 C  "C5'" . DC  B 2 9   ? 45.483 -9.503  -7.471  1.00 23.09 ? 9   DC  T "C5'" 1 
ATOM   3581 C  "C4'" . DC  B 2 9   ? 44.448 -10.420 -6.873  1.00 22.75 ? 9   DC  T "C4'" 1 
ATOM   3582 O  "O4'" . DC  B 2 9   ? 43.348 -9.654  -6.333  1.00 28.44 ? 9   DC  T "O4'" 1 
ATOM   3583 C  "C3'" . DC  B 2 9   ? 43.833 -11.357 -7.901  1.00 24.98 ? 9   DC  T "C3'" 1 
ATOM   3584 O  "O3'" . DC  B 2 9   ? 43.885 -12.633 -7.338  1.00 38.74 ? 9   DC  T "O3'" 1 
ATOM   3585 C  "C2'" . DC  B 2 9   ? 42.391 -10.879 -8.039  1.00 30.42 ? 9   DC  T "C2'" 1 
ATOM   3586 C  "C1'" . DC  B 2 9   ? 42.160 -10.352 -6.632  1.00 27.05 ? 9   DC  T "C1'" 1 
ATOM   3587 N  N1    . DC  B 2 9   ? 41.017 -9.421  -6.520  1.00 23.96 ? 9   DC  T N1    1 
ATOM   3588 C  C2    . DC  B 2 9   ? 40.065 -9.652  -5.532  1.00 27.72 ? 9   DC  T C2    1 
ATOM   3589 O  O2    . DC  B 2 9   ? 40.202 -10.626 -4.778  1.00 24.83 ? 9   DC  T O2    1 
ATOM   3590 N  N3    . DC  B 2 9   ? 39.017 -8.804  -5.433  1.00 21.45 ? 9   DC  T N3    1 
ATOM   3591 C  C4    . DC  B 2 9   ? 38.907 -7.766  -6.260  1.00 24.53 ? 9   DC  T C4    1 
ATOM   3592 N  N4    . DC  B 2 9   ? 37.847 -6.966  -6.107  1.00 21.56 ? 9   DC  T N4    1 
ATOM   3593 C  C5    . DC  B 2 9   ? 39.868 -7.515  -7.278  1.00 29.50 ? 9   DC  T C5    1 
ATOM   3594 C  C6    . DC  B 2 9   ? 40.900 -8.361  -7.372  1.00 26.68 ? 9   DC  T C6    1 
ATOM   3595 P  P     . DG  B 2 10  ? 43.916 -13.928 -8.279  1.00 33.80 ? 10  DG  T P     1 
ATOM   3596 O  OP1   . DG  B 2 10  ? 45.276 -14.495 -8.223  1.00 35.50 ? 10  DG  T OP1   1 
ATOM   3597 O  OP2   . DG  B 2 10  ? 43.305 -13.568 -9.576  1.00 35.70 ? 10  DG  T OP2   1 
ATOM   3598 O  "O5'" . DG  B 2 10  ? 42.907 -14.921 -7.554  1.00 24.62 ? 10  DG  T "O5'" 1 
ATOM   3599 C  "C5'" . DG  B 2 10  ? 43.058 -15.126 -6.169  1.00 26.12 ? 10  DG  T "C5'" 1 
ATOM   3600 C  "C4'" . DG  B 2 10  ? 41.823 -15.820 -5.639  1.00 28.33 ? 10  DG  T "C4'" 1 
ATOM   3601 O  "O4'" . DG  B 2 10  ? 40.762 -14.852 -5.465  1.00 26.95 ? 10  DG  T "O4'" 1 
ATOM   3602 C  "C3'" . DG  B 2 10  ? 41.274 -16.913 -6.552  1.00 32.98 ? 10  DG  T "C3'" 1 
ATOM   3603 O  "O3'" . DG  B 2 10  ? 40.840 -17.973 -5.717  1.00 36.07 ? 10  DG  T "O3'" 1 
ATOM   3604 C  "C2'" . DG  B 2 10  ? 40.135 -16.212 -7.286  1.00 24.47 ? 10  DG  T "C2'" 1 
ATOM   3605 C  "C1'" . DG  B 2 10  ? 39.637 -15.216 -6.240  1.00 30.44 ? 10  DG  T "C1'" 1 
ATOM   3606 N  N9    . DG  B 2 10  ? 39.086 -13.974 -6.776  1.00 27.04 ? 10  DG  T N9    1 
ATOM   3607 C  C8    . DG  B 2 10  ? 39.612 -13.195 -7.779  1.00 28.37 ? 10  DG  T C8    1 
ATOM   3608 N  N7    . DG  B 2 10  ? 38.904 -12.131 -8.035  1.00 30.37 ? 10  DG  T N7    1 
ATOM   3609 C  C5    . DG  B 2 10  ? 37.840 -12.207 -7.143  1.00 24.22 ? 10  DG  T C5    1 
ATOM   3610 C  C6    . DG  B 2 10  ? 36.747 -11.332 -6.956  1.00 25.82 ? 10  DG  T C6    1 
ATOM   3611 O  O6    . DG  B 2 10  ? 36.510 -10.284 -7.570  1.00 31.15 ? 10  DG  T O6    1 
ATOM   3612 N  N1    . DG  B 2 10  ? 35.889 -11.776 -5.947  1.00 24.50 ? 10  DG  T N1    1 
ATOM   3613 C  C2    . DG  B 2 10  ? 36.075 -12.930 -5.213  1.00 25.92 ? 10  DG  T C2    1 
ATOM   3614 N  N2    . DG  B 2 10  ? 35.155 -13.208 -4.279  1.00 29.80 ? 10  DG  T N2    1 
ATOM   3615 N  N3    . DG  B 2 10  ? 37.100 -13.760 -5.380  1.00 25.97 ? 10  DG  T N3    1 
ATOM   3616 C  C4    . DG  B 2 10  ? 37.939 -13.332 -6.355  1.00 20.30 ? 10  DG  T C4    1 
ATOM   3617 P  P     . DC  B 2 11  ? 40.157 -19.285 -6.347  1.00 31.56 ? 11  DC  T P     1 
ATOM   3618 O  OP1   . DC  B 2 11  ? 40.672 -20.460 -5.614  1.00 27.86 ? 11  DC  T OP1   1 
ATOM   3619 O  OP2   . DC  B 2 11  ? 40.286 -19.218 -7.817  1.00 28.33 ? 11  DC  T OP2   1 
ATOM   3620 O  "O5'" . DC  B 2 11  ? 38.613 -19.095 -6.005  1.00 24.03 ? 11  DC  T "O5'" 1 
ATOM   3621 C  "C5'" . DC  B 2 11  ? 38.213 -18.872 -4.666  1.00 22.64 ? 11  DC  T "C5'" 1 
ATOM   3622 C  "C4'" . DC  B 2 11  ? 36.702 -18.745 -4.607  1.00 28.36 ? 11  DC  T "C4'" 1 
ATOM   3623 O  "O4'" . DC  B 2 11  ? 36.304 -17.486 -5.196  1.00 22.96 ? 11  DC  T "O4'" 1 
ATOM   3624 C  "C3'" . DC  B 2 11  ? 35.923 -19.817 -5.361  1.00 19.27 ? 11  DC  T "C3'" 1 
ATOM   3625 O  "O3'" . DC  B 2 11  ? 34.822 -20.189 -4.554  1.00 21.67 ? 11  DC  T "O3'" 1 
ATOM   3626 C  "C2'" . DC  B 2 11  ? 35.487 -19.110 -6.647  1.00 29.69 ? 11  DC  T "C2'" 1 
ATOM   3627 C  "C1'" . DC  B 2 11  ? 35.287 -17.684 -6.150  1.00 26.38 ? 11  DC  T "C1'" 1 
ATOM   3628 N  N1    . DC  B 2 11  ? 35.480 -16.600 -7.154  1.00 21.66 ? 11  DC  T N1    1 
ATOM   3629 C  C2    . DC  B 2 11  ? 34.577 -15.539 -7.212  1.00 24.47 ? 11  DC  T C2    1 
ATOM   3630 O  O2    . DC  B 2 11  ? 33.607 -15.511 -6.444  1.00 25.84 ? 11  DC  T O2    1 
ATOM   3631 N  N3    . DC  B 2 11  ? 34.781 -14.559 -8.124  1.00 29.79 ? 11  DC  T N3    1 
ATOM   3632 C  C4    . DC  B 2 11  ? 35.830 -14.619 -8.940  1.00 23.97 ? 11  DC  T C4    1 
ATOM   3633 N  N4    . DC  B 2 11  ? 35.979 -13.622 -9.820  1.00 43.16 ? 11  DC  T N4    1 
ATOM   3634 C  C5    . DC  B 2 11  ? 36.769 -15.686 -8.894  1.00 28.37 ? 11  DC  T C5    1 
ATOM   3635 C  C6    . DC  B 2 11  ? 36.559 -16.647 -7.987  1.00 28.30 ? 11  DC  T C6    1 
ATOM   3636 P  P     . DG  B 2 12  ? 33.971 -21.501 -4.911  1.00 20.31 ? 12  DG  T P     1 
ATOM   3637 O  OP1   . DG  B 2 12  ? 33.363 -22.004 -3.658  1.00 21.14 ? 12  DG  T OP1   1 
ATOM   3638 O  OP2   . DG  B 2 12  ? 34.831 -22.391 -5.708  1.00 20.46 ? 12  DG  T OP2   1 
ATOM   3639 O  "O5'" . DG  B 2 12  ? 32.818 -20.943 -5.856  1.00 25.65 ? 12  DG  T "O5'" 1 
ATOM   3640 C  "C5'" . DG  B 2 12  ? 31.808 -20.149 -5.241  1.00 27.40 ? 12  DG  T "C5'" 1 
ATOM   3641 C  "C4'" . DG  B 2 12  ? 30.956 -19.490 -6.298  1.00 27.94 ? 12  DG  T "C4'" 1 
ATOM   3642 O  "O4'" . DG  B 2 12  ? 31.787 -18.569 -7.042  1.00 28.30 ? 12  DG  T "O4'" 1 
ATOM   3643 C  "C3'" . DG  B 2 12  ? 30.366 -20.458 -7.326  1.00 33.71 ? 12  DG  T "C3'" 1 
ATOM   3644 O  "O3'" . DG  B 2 12  ? 28.993 -20.139 -7.539  1.00 32.57 ? 12  DG  T "O3'" 1 
ATOM   3645 C  "C2'" . DG  B 2 12  ? 31.203 -20.183 -8.570  1.00 35.09 ? 12  DG  T "C2'" 1 
ATOM   3646 C  "C1'" . DG  B 2 12  ? 31.368 -18.683 -8.377  1.00 35.37 ? 12  DG  T "C1'" 1 
ATOM   3647 N  N9    A DG  B 2 12  ? 32.216 -17.885 -9.262  0.20 30.36 ? 12  DG  T N9    1 
ATOM   3648 N  N9    B DG  B 2 12  ? 32.450 -18.254 -9.254  0.80 30.45 ? 12  DG  T N9    1 
ATOM   3649 C  C8    A DG  B 2 12  ? 33.434 -18.177 -9.824  0.20 26.02 ? 12  DG  T C8    1 
ATOM   3650 C  C8    B DG  B 2 12  ? 33.538 -19.014 -9.611  0.80 22.66 ? 12  DG  T C8    1 
ATOM   3651 N  N7    A DG  B 2 12  ? 33.898 -17.206 -10.565 0.20 24.90 ? 12  DG  T N7    1 
ATOM   3652 N  N7    B DG  B 2 12  ? 34.356 -18.408 -10.423 0.80 29.13 ? 12  DG  T N7    1 
ATOM   3653 C  C5    A DG  B 2 12  ? 32.931 -16.210 -10.485 0.20 28.13 ? 12  DG  T C5    1 
ATOM   3654 C  C5    B DG  B 2 12  ? 33.768 -17.164 -10.626 0.80 24.24 ? 12  DG  T C5    1 
ATOM   3655 C  C6    A DG  B 2 12  ? 32.874 -14.923 -11.076 0.20 30.69 ? 12  DG  T C6    1 
ATOM   3656 C  C6    B DG  B 2 12  ? 34.202 -16.075 -11.419 0.80 31.47 ? 12  DG  T C6    1 
ATOM   3657 O  O6    A DG  B 2 12  ? 33.702 -14.380 -11.821 0.20 34.07 ? 12  DG  T O6    1 
ATOM   3658 O  O6    B DG  B 2 12  ? 35.223 -15.994 -12.120 0.80 38.26 ? 12  DG  T O6    1 
ATOM   3659 N  N1    A DG  B 2 12  ? 31.707 -14.243 -10.726 0.20 32.76 ? 12  DG  T N1    1 
ATOM   3660 N  N1    B DG  B 2 12  ? 33.315 -15.003 -11.350 0.80 31.50 ? 12  DG  T N1    1 
ATOM   3661 C  C2    A DG  B 2 12  ? 30.718 -14.743 -9.909  0.20 28.98 ? 12  DG  T C2    1 
ATOM   3662 C  C2    B DG  B 2 12  ? 32.158 -14.991 -10.608 0.80 31.58 ? 12  DG  T C2    1 
ATOM   3663 N  N2    A DG  B 2 12  ? 29.663 -13.945 -9.683  0.20 30.04 ? 12  DG  T N2    1 
ATOM   3664 N  N2    B DG  B 2 12  ? 31.433 -13.865 -10.664 0.80 32.54 ? 12  DG  T N2    1 
ATOM   3665 N  N3    A DG  B 2 12  ? 30.762 -15.945 -9.352  0.20 31.49 ? 12  DG  T N3    1 
ATOM   3666 N  N3    B DG  B 2 12  ? 31.740 -16.006 -9.860  0.80 31.84 ? 12  DG  T N3    1 
ATOM   3667 C  C4    A DG  B 2 12  ? 31.892 -16.616 -9.684  0.20 29.58 ? 12  DG  T C4    1 
ATOM   3668 C  C4    B DG  B 2 12  ? 32.594 -17.054 -9.915  0.80 27.07 ? 12  DG  T C4    1 
ATOM   3669 O  "O5'" . DT  C 3 1   ? 27.944 -8.274  -16.882 1.00 51.80 ? 1   DT  P "O5'" 1 
ATOM   3670 C  "C5'" . DT  C 3 1   ? 28.365 -7.972  -15.561 1.00 41.77 ? 1   DT  P "C5'" 1 
ATOM   3671 C  "C4'" . DT  C 3 1   ? 27.590 -8.795  -14.543 1.00 52.26 ? 1   DT  P "C4'" 1 
ATOM   3672 O  "O4'" . DT  C 3 1   ? 27.921 -10.200 -14.691 1.00 42.91 ? 1   DT  P "O4'" 1 
ATOM   3673 C  "C3'" . DT  C 3 1   ? 27.861 -8.423  -13.090 1.00 38.94 ? 1   DT  P "C3'" 1 
ATOM   3674 O  "O3'" . DT  C 3 1   ? 26.698 -7.810  -12.575 1.00 57.67 ? 1   DT  P "O3'" 1 
ATOM   3675 C  "C2'" . DT  C 3 1   ? 28.124 -9.748  -12.376 1.00 46.49 ? 1   DT  P "C2'" 1 
ATOM   3676 C  "C1'" . DT  C 3 1   ? 28.506 -10.699 -13.505 1.00 43.24 ? 1   DT  P "C1'" 1 
ATOM   3677 N  N1    . DT  C 3 1   ? 29.974 -10.813 -13.716 1.00 41.82 ? 1   DT  P N1    1 
ATOM   3678 C  C2    . DT  C 3 1   ? 30.733 -11.499 -12.792 1.00 38.19 ? 1   DT  P C2    1 
ATOM   3679 O  O2    . DT  C 3 1   ? 30.261 -12.021 -11.795 1.00 38.97 ? 1   DT  P O2    1 
ATOM   3680 N  N3    . DT  C 3 1   ? 32.072 -11.547 -13.082 1.00 46.30 ? 1   DT  P N3    1 
ATOM   3681 C  C4    . DT  C 3 1   ? 32.708 -10.991 -14.179 1.00 43.16 ? 1   DT  P C4    1 
ATOM   3682 O  O4    . DT  C 3 1   ? 33.919 -11.089 -14.350 1.00 59.85 ? 1   DT  P O4    1 
ATOM   3683 C  C5    . DT  C 3 1   ? 31.855 -10.289 -15.104 1.00 38.97 ? 1   DT  P C5    1 
ATOM   3684 C  C7    . DT  C 3 1   ? 32.435 -9.645  -16.331 1.00 44.41 ? 1   DT  P C7    1 
ATOM   3685 C  C6    . DT  C 3 1   ? 30.547 -10.239 -14.832 1.00 41.98 ? 1   DT  P C6    1 
ATOM   3686 P  P     . DG  C 3 2   ? 26.812 -6.693  -11.427 1.00 45.03 ? 2   DG  P P     1 
ATOM   3687 O  OP1   . DG  C 3 2   ? 25.481 -6.084  -11.258 1.00 48.08 ? 2   DG  P OP1   1 
ATOM   3688 O  OP2   . DG  C 3 2   ? 27.999 -5.857  -11.721 1.00 54.98 ? 2   DG  P OP2   1 
ATOM   3689 O  "O5'" . DG  C 3 2   ? 27.118 -7.544  -10.109 1.00 48.31 ? 2   DG  P "O5'" 1 
ATOM   3690 C  "C5'" . DG  C 3 2   ? 26.067 -8.330  -9.579  1.00 29.53 ? 2   DG  P "C5'" 1 
ATOM   3691 C  "C4'" . DG  C 3 2   ? 26.410 -8.870  -8.206  1.00 42.75 ? 2   DG  P "C4'" 1 
ATOM   3692 O  "O4'" . DG  C 3 2   ? 27.579 -9.724  -8.283  1.00 35.33 ? 2   DG  P "O4'" 1 
ATOM   3693 C  "C3'" . DG  C 3 2   ? 26.718 -7.806  -7.163  1.00 48.04 ? 2   DG  P "C3'" 1 
ATOM   3694 O  "O3'" . DG  C 3 2   ? 26.023 -8.179  -5.986  1.00 36.30 ? 2   DG  P "O3'" 1 
ATOM   3695 C  "C2'" . DG  C 3 2   ? 28.243 -7.840  -7.028  1.00 32.67 ? 2   DG  P "C2'" 1 
ATOM   3696 C  "C1'" . DG  C 3 2   ? 28.585 -9.279  -7.401  1.00 41.73 ? 2   DG  P "C1'" 1 
ATOM   3697 N  N9    . DG  C 3 2   ? 29.839 -9.461  -8.122  1.00 30.78 ? 2   DG  P N9    1 
ATOM   3698 C  C8    . DG  C 3 2   ? 30.380 -8.650  -9.091  1.00 38.35 ? 2   DG  P C8    1 
ATOM   3699 N  N7    . DG  C 3 2   ? 31.515 -9.091  -9.560  1.00 30.02 ? 2   DG  P N7    1 
ATOM   3700 C  C5    . DG  C 3 2   ? 31.735 -10.274 -8.861  1.00 28.64 ? 2   DG  P C5    1 
ATOM   3701 C  C6    . DG  C 3 2   ? 32.804 -11.195 -8.938  1.00 24.46 ? 2   DG  P C6    1 
ATOM   3702 O  O6    . DG  C 3 2   ? 33.802 -11.147 -9.672  1.00 26.22 ? 2   DG  P O6    1 
ATOM   3703 N  N1    . DG  C 3 2   ? 32.640 -12.263 -8.056  1.00 26.55 ? 2   DG  P N1    1 
ATOM   3704 C  C2    . DG  C 3 2   ? 31.573 -12.415 -7.205  1.00 34.61 ? 2   DG  P C2    1 
ATOM   3705 N  N2    . DG  C 3 2   ? 31.578 -13.507 -6.425  1.00 37.78 ? 2   DG  P N2    1 
ATOM   3706 N  N3    . DG  C 3 2   ? 30.563 -11.559 -7.123  1.00 35.28 ? 2   DG  P N3    1 
ATOM   3707 C  C4    . DG  C 3 2   ? 30.711 -10.517 -7.978  1.00 41.35 ? 2   DG  P C4    1 
ATOM   3708 P  P     . DC  C 3 3   ? 26.411 -7.526  -4.572  1.00 51.89 ? 3   DC  P P     1 
ATOM   3709 O  OP1   . DC  C 3 3   ? 25.241 -7.652  -3.679  1.00 48.29 ? 3   DC  P OP1   1 
ATOM   3710 O  OP2   . DC  C 3 3   ? 26.999 -6.192  -4.828  1.00 46.84 ? 3   DC  P OP2   1 
ATOM   3711 O  "O5'" . DC  C 3 3   ? 27.562 -8.491  -4.023  1.00 52.14 ? 3   DC  P "O5'" 1 
ATOM   3712 C  "C5'" . DC  C 3 3   ? 27.277 -9.880  -3.916  1.00 37.56 ? 3   DC  P "C5'" 1 
ATOM   3713 C  "C4'" . DC  C 3 3   ? 28.315 -10.583 -3.063  1.00 35.41 ? 3   DC  P "C4'" 1 
ATOM   3714 O  "O4'" . DC  C 3 3   ? 29.516 -10.798 -3.840  1.00 36.94 ? 3   DC  P "O4'" 1 
ATOM   3715 C  "C3'" . DC  C 3 3   ? 28.723 -9.819  -1.808  1.00 44.42 ? 3   DC  P "C3'" 1 
ATOM   3716 O  "O3'" . DC  C 3 3   ? 28.577 -10.684 -0.687  1.00 50.59 ? 3   DC  P "O3'" 1 
ATOM   3717 C  "C2'" . DC  C 3 3   ? 30.170 -9.392  -2.063  1.00 36.19 ? 3   DC  P "C2'" 1 
ATOM   3718 C  "C1'" . DC  C 3 3   ? 30.653 -10.398 -3.107  1.00 40.05 ? 3   DC  P "C1'" 1 
ATOM   3719 N  N1    . DC  C 3 3   ? 31.629 -9.845  -4.087  1.00 39.19 ? 3   DC  P N1    1 
ATOM   3720 C  C2    . DC  C 3 3   ? 32.743 -10.607 -4.459  1.00 25.40 ? 3   DC  P C2    1 
ATOM   3721 O  O2    . DC  C 3 3   ? 32.896 -11.726 -3.962  1.00 42.33 ? 3   DC  P O2    1 
ATOM   3722 N  N3    . DC  C 3 3   ? 33.625 -10.096 -5.357  1.00 27.30 ? 3   DC  P N3    1 
ATOM   3723 C  C4    . DC  C 3 3   ? 33.419 -8.881  -5.866  1.00 29.43 ? 3   DC  P C4    1 
ATOM   3724 N  N4    . DC  C 3 3   ? 34.310 -8.413  -6.747  1.00 31.58 ? 3   DC  P N4    1 
ATOM   3725 C  C5    . DC  C 3 3   ? 32.289 -8.091  -5.500  1.00 32.98 ? 3   DC  P C5    1 
ATOM   3726 C  C6    . DC  C 3 3   ? 31.428 -8.605  -4.617  1.00 31.58 ? 3   DC  P C6    1 
ATOM   3727 P  P     . DG  C 3 4   ? 29.043 -10.206 0.775   1.00 43.07 ? 4   DG  P P     1 
ATOM   3728 O  OP1   . DG  C 3 4   ? 28.135 -10.822 1.767   1.00 48.56 ? 4   DG  P OP1   1 
ATOM   3729 O  OP2   . DG  C 3 4   ? 29.239 -8.736  0.738   1.00 38.33 ? 4   DG  P OP2   1 
ATOM   3730 O  "O5'" . DG  C 3 4   ? 30.487 -10.859 0.930   1.00 29.57 ? 4   DG  P "O5'" 1 
ATOM   3731 C  "C5'" . DG  C 3 4   ? 30.642 -12.242 0.704   1.00 26.05 ? 4   DG  P "C5'" 1 
ATOM   3732 C  "C4'" . DG  C 3 4   ? 32.113 -12.597 0.833   1.00 46.33 ? 4   DG  P "C4'" 1 
ATOM   3733 O  "O4'" . DG  C 3 4   ? 32.846 -12.032 -0.283  1.00 44.16 ? 4   DG  P "O4'" 1 
ATOM   3734 C  "C3'" . DG  C 3 4   ? 32.783 -12.086 2.107   1.00 30.94 ? 4   DG  P "C3'" 1 
ATOM   3735 O  "O3'" . DG  C 3 4   ? 33.493 -13.170 2.676   1.00 40.86 ? 4   DG  P "O3'" 1 
ATOM   3736 C  "C2'" . DG  C 3 4   ? 33.705 -10.967 1.626   1.00 30.60 ? 4   DG  P "C2'" 1 
ATOM   3737 C  "C1'" . DG  C 3 4   ? 34.006 -11.376 0.186   1.00 34.77 ? 4   DG  P "C1'" 1 
ATOM   3738 N  N9    . DG  C 3 4   ? 34.272 -10.255 -0.712  1.00 28.50 ? 4   DG  P N9    1 
ATOM   3739 C  C8    . DG  C 3 4   ? 33.543 -9.101  -0.846  1.00 26.89 ? 4   DG  P C8    1 
ATOM   3740 N  N7    . DG  C 3 4   ? 34.019 -8.282  -1.739  1.00 33.27 ? 4   DG  P N7    1 
ATOM   3741 C  C5    . DG  C 3 4   ? 35.138 -8.932  -2.235  1.00 24.45 ? 4   DG  P C5    1 
ATOM   3742 C  C6    . DG  C 3 4   ? 36.062 -8.529  -3.227  1.00 28.23 ? 4   DG  P C6    1 
ATOM   3743 O  O6    . DG  C 3 4   ? 36.071 -7.478  -3.881  1.00 32.24 ? 4   DG  P O6    1 
ATOM   3744 N  N1    . DG  C 3 4   ? 37.055 -9.489  -3.426  1.00 25.79 ? 4   DG  P N1    1 
ATOM   3745 C  C2    . DG  C 3 4   ? 37.136 -10.685 -2.751  1.00 23.17 ? 4   DG  P C2    1 
ATOM   3746 N  N2    . DG  C 3 4   ? 38.157 -11.498 -3.069  1.00 23.70 ? 4   DG  P N2    1 
ATOM   3747 N  N3    . DG  C 3 4   ? 36.275 -11.070 -1.821  1.00 25.82 ? 4   DG  P N3    1 
ATOM   3748 C  C4    . DG  C 3 4   ? 35.307 -10.147 -1.616  1.00 22.46 ? 4   DG  P C4    1 
ATOM   3749 P  P     . DT  C 3 5   ? 34.260 -12.997 4.079   1.00 38.53 ? 5   DT  P P     1 
ATOM   3750 O  OP1   . DT  C 3 5   ? 34.183 -14.284 4.795   1.00 35.84 ? 5   DT  P OP1   1 
ATOM   3751 O  OP2   . DT  C 3 5   ? 33.778 -11.751 4.715   1.00 35.23 ? 5   DT  P OP2   1 
ATOM   3752 O  "O5'" . DT  C 3 5   ? 35.776 -12.744 3.641   1.00 28.82 ? 5   DT  P "O5'" 1 
ATOM   3753 C  "C5'" . DT  C 3 5   ? 36.348 -13.562 2.647   1.00 21.95 ? 5   DT  P "C5'" 1 
ATOM   3754 C  "C4'" . DT  C 3 5   ? 37.716 -13.041 2.255   1.00 18.65 ? 5   DT  P "C4'" 1 
ATOM   3755 O  "O4'" . DT  C 3 5   ? 37.597 -11.973 1.290   1.00 18.35 ? 5   DT  P "O4'" 1 
ATOM   3756 C  "C3'" . DT  C 3 5   ? 38.551 -12.497 3.410   1.00 16.79 ? 5   DT  P "C3'" 1 
ATOM   3757 O  "O3'" . DT  C 3 5   ? 39.732 -13.269 3.424   1.00 19.16 ? 5   DT  P "O3'" 1 
ATOM   3758 C  "C2'" . DT  C 3 5   ? 38.817 -11.038 3.040   1.00 19.04 ? 5   DT  P "C2'" 1 
ATOM   3759 C  "C1'" . DT  C 3 5   ? 38.649 -11.058 1.527   1.00 18.95 ? 5   DT  P "C1'" 1 
ATOM   3760 N  N1    . DT  C 3 5   ? 38.230 -9.765  0.918   1.00 19.44 ? 5   DT  P N1    1 
ATOM   3761 C  C2    . DT  C 3 5   ? 39.003 -9.207  -0.074  1.00 15.82 ? 5   DT  P C2    1 
ATOM   3762 O  O2    . DT  C 3 5   ? 40.031 -9.711  -0.483  1.00 21.07 ? 5   DT  P O2    1 
ATOM   3763 N  N3    . DT  C 3 5   ? 38.526 -8.031  -0.586  1.00 17.79 ? 5   DT  P N3    1 
ATOM   3764 C  C4    . DT  C 3 5   ? 37.375 -7.376  -0.197  1.00 22.03 ? 5   DT  P C4    1 
ATOM   3765 O  O4    . DT  C 3 5   ? 37.024 -6.317  -0.707  1.00 19.76 ? 5   DT  P O4    1 
ATOM   3766 C  C5    . DT  C 3 5   ? 36.616 -8.013  0.847   1.00 22.89 ? 5   DT  P C5    1 
ATOM   3767 C  C7    . DT  C 3 5   ? 35.349 -7.379  1.346   1.00 23.41 ? 5   DT  P C7    1 
ATOM   3768 C  C6    . DT  C 3 5   ? 37.070 -9.165  1.354   1.00 19.08 ? 5   DT  P C6    1 
ATOM   3769 P  P     . DC  C 3 6   ? 40.768 -13.165 4.648   1.00 17.42 ? 6   DC  P P     1 
ATOM   3770 O  OP1   . DC  C 3 6   ? 41.453 -14.480 4.774   1.00 19.87 ? 6   DC  P OP1   1 
ATOM   3771 O  OP2   . DC  C 3 6   ? 40.077 -12.562 5.793   1.00 12.77 ? 6   DC  P OP2   1 
ATOM   3772 O  "O5'" . DC  C 3 6   ? 41.829 -12.089 4.140   1.00 14.58 ? 6   DC  P "O5'" 1 
ATOM   3773 C  "C5'" . DC  C 3 6   ? 42.680 -12.372 3.049   1.00 13.52 ? 6   DC  P "C5'" 1 
ATOM   3774 C  "C4'" . DC  C 3 6   ? 43.436 -11.097 2.715   1.00 20.54 ? 6   DC  P "C4'" 1 
ATOM   3775 O  "O4'" . DC  C 3 6   ? 42.525 -10.175 2.058   1.00 18.27 ? 6   DC  P "O4'" 1 
ATOM   3776 C  "C3'" . DC  C 3 6   ? 44.022 -10.351 3.920   1.00 16.13 ? 6   DC  P "C3'" 1 
ATOM   3777 O  "O3'" . DC  C 3 6   ? 45.440 -10.506 3.859   1.00 13.39 ? 6   DC  P "O3'" 1 
ATOM   3778 C  "C2'" . DC  C 3 6   ? 43.583 -8.895  3.708   1.00 16.44 ? 6   DC  P "C2'" 1 
ATOM   3779 C  "C1'" . DC  C 3 6   ? 43.005 -8.880  2.295   1.00 17.38 ? 6   DC  P "C1'" 1 
ATOM   3780 N  N1    . DC  C 3 6   ? 41.889 -7.902  2.133   1.00 17.06 ? 6   DC  P N1    1 
ATOM   3781 C  C2    . DC  C 3 6   ? 41.947 -6.979  1.084   1.00 15.81 ? 6   DC  P C2    1 
ATOM   3782 O  O2    . DC  C 3 6   ? 42.911 -7.007  0.301   1.00 16.06 ? 6   DC  P O2    1 
ATOM   3783 N  N3    . DC  C 3 6   ? 40.937 -6.081  0.959   1.00 17.80 ? 6   DC  P N3    1 
ATOM   3784 C  C4    . DC  C 3 6   ? 39.915 -6.093  1.818   1.00 19.10 ? 6   DC  P C4    1 
ATOM   3785 N  N4    . DC  C 3 6   ? 38.947 -5.188  1.644   1.00 14.85 ? 6   DC  P N4    1 
ATOM   3786 C  C5    . DC  C 3 6   ? 39.835 -7.027  2.896   1.00 14.94 ? 6   DC  P C5    1 
ATOM   3787 C  C6    . DC  C 3 6   ? 40.837 -7.909  3.012   1.00 17.94 ? 6   DC  P C6    1 
ATOM   3788 P  P     . DA  C 3 7   ? 46.408 -9.783  4.928   1.00 14.62 ? 7   DA  P P     1 
ATOM   3789 O  OP1   . DA  C 3 7   ? 47.614 -10.638 5.095   1.00 15.68 ? 7   DA  P OP1   1 
ATOM   3790 O  OP2   . DA  C 3 7   ? 45.613 -9.420  6.116   1.00 15.28 ? 7   DA  P OP2   1 
ATOM   3791 O  "O5'" . DA  C 3 7   ? 46.741 -8.369  4.256   1.00 17.39 ? 7   DA  P "O5'" 1 
ATOM   3792 C  "C5'" . DA  C 3 7   ? 47.511 -8.163  3.100   1.00 26.94 ? 7   DA  P "C5'" 1 
ATOM   3793 C  "C4'" . DA  C 3 7   ? 47.271 -6.738  2.600   1.00 26.22 ? 7   DA  P "C4'" 1 
ATOM   3794 O  "O4'" . DA  C 3 7   ? 45.879 -6.564  2.229   1.00 19.67 ? 7   DA  P "O4'" 1 
ATOM   3795 C  "C3'" . DA  C 3 7   ? 47.448 -5.540  3.541   1.00 23.73 ? 7   DA  P "C3'" 1 
ATOM   3796 O  "O3'" A DA  C 3 7   ? 48.838 -5.282  3.700   0.66 29.16 ? 7   DA  P "O3'" 1 
ATOM   3797 O  "O3'" B DA  C 3 7   ? 48.789 -5.388  4.041   0.34 29.84 ? 7   DA  P "O3'" 1 
ATOM   3798 C  "C2'" . DA  C 3 7   ? 46.876 -4.441  2.663   1.00 22.30 ? 7   DA  P "C2'" 1 
ATOM   3799 C  "C1'" . DA  C 3 7   ? 45.724 -5.170  1.988   1.00 19.18 ? 7   DA  P "C1'" 1 
ATOM   3800 N  N9    . DA  C 3 7   ? 44.431 -4.704  2.468   1.00 16.32 ? 7   DA  P N9    1 
ATOM   3801 C  C8    . DA  C 3 7   ? 43.624 -5.244  3.432   1.00 19.41 ? 7   DA  P C8    1 
ATOM   3802 N  N7    . DA  C 3 7   ? 42.519 -4.567  3.619   1.00 17.81 ? 7   DA  P N7    1 
ATOM   3803 C  C5    . DA  C 3 7   ? 42.616 -3.507  2.723   1.00 16.23 ? 7   DA  P C5    1 
ATOM   3804 C  C6    . DA  C 3 7   ? 41.769 -2.425  2.425   1.00 17.57 ? 7   DA  P C6    1 
ATOM   3805 N  N6    . DA  C 3 7   ? 40.597 -2.232  3.035   1.00 19.48 ? 7   DA  P N6    1 
ATOM   3806 N  N1    . DA  C 3 7   ? 42.172 -1.549  1.481   1.00 15.75 ? 7   DA  P N1    1 
ATOM   3807 C  C2    . DA  C 3 7   ? 43.345 -1.752  0.874   1.00 16.32 ? 7   DA  P C2    1 
ATOM   3808 N  N3    . DA  C 3 7   ? 44.227 -2.735  1.070   1.00 17.18 ? 7   DA  P N3    1 
ATOM   3809 C  C4    . DA  C 3 7   ? 43.793 -3.576  2.017   1.00 16.36 ? 7   DA  P C4    1 
ATOM   3810 P  P     A DT  C 3 8   ? 49.361 -3.955  4.461   0.58 20.54 ? 8   DT  P P     1 
ATOM   3811 P  P     B DT  C 3 8   ? 49.921 -4.655  3.167   0.42 26.61 ? 8   DT  P P     1 
ATOM   3812 O  OP1   A DT  C 3 8   ? 50.819 -4.088  4.622   0.58 20.42 ? 8   DT  P OP1   1 
ATOM   3813 O  OP1   B DT  C 3 8   ? 50.081 -5.402  1.903   0.42 27.23 ? 8   DT  P OP1   1 
ATOM   3814 O  OP2   A DT  C 3 8   ? 48.526 -3.744  5.674   0.58 12.65 ? 8   DT  P OP2   1 
ATOM   3815 O  OP2   B DT  C 3 8   ? 51.080 -4.409  4.050   0.42 23.57 ? 8   DT  P OP2   1 
ATOM   3816 O  "O5'" A DT  C 3 8   ? 49.054 -2.750  3.425   0.58 24.48 ? 8   DT  P "O5'" 1 
ATOM   3817 O  "O5'" B DT  C 3 8   ? 49.289 -3.226  2.843   0.42 27.56 ? 8   DT  P "O5'" 1 
ATOM   3818 C  "C5'" A DT  C 3 8   ? 49.861 -2.431  2.260   0.58 22.06 ? 8   DT  P "C5'" 1 
ATOM   3819 C  "C5'" B DT  C 3 8   ? 50.067 -2.435  2.003   0.42 23.13 ? 8   DT  P "C5'" 1 
ATOM   3820 C  "C4'" . DT  C 3 8   ? 49.464 -1.103  1.600   1.00 15.59 ? 8   DT  P "C4'" 1 
ATOM   3821 O  "O4'" . DT  C 3 8   ? 48.023 -1.036  1.664   1.00 12.70 ? 8   DT  P "O4'" 1 
ATOM   3822 C  "C3'" . DT  C 3 8   ? 49.992 0.147   2.315   1.00 19.41 ? 8   DT  P "C3'" 1 
ATOM   3823 O  "O3'" . DT  C 3 8   ? 50.485 1.038   1.333   1.00 19.01 ? 8   DT  P "O3'" 1 
ATOM   3824 C  "C2'" . DT  C 3 8   ? 48.770 0.766   2.995   1.00 20.21 ? 8   DT  P "C2'" 1 
ATOM   3825 C  "C1'" . DT  C 3 8   ? 47.627 0.235   2.140   1.00 17.78 ? 8   DT  P "C1'" 1 
ATOM   3826 N  N1    . DT  C 3 8   ? 46.375 0.033   2.909   1.00 16.32 ? 8   DT  P N1    1 
ATOM   3827 C  C2    . DT  C 3 8   ? 45.366 0.963   2.776   1.00 18.30 ? 8   DT  P C2    1 
ATOM   3828 O  O2    . DT  C 3 8   ? 45.455 1.948   2.057   1.00 18.27 ? 8   DT  P O2    1 
ATOM   3829 N  N3    . DT  C 3 8   ? 44.240 0.693   3.514   1.00 15.83 ? 8   DT  P N3    1 
ATOM   3830 C  C4    . DT  C 3 8   ? 44.054 -0.387  4.356   1.00 19.67 ? 8   DT  P C4    1 
ATOM   3831 O  O4    . DT  C 3 8   ? 43.023 -0.556  4.983   1.00 18.12 ? 8   DT  P O4    1 
ATOM   3832 C  C5    . DT  C 3 8   ? 45.150 -1.312  4.459   1.00 14.62 ? 8   DT  P C5    1 
ATOM   3833 C  C7    . DT  C 3 8   ? 45.002 -2.510  5.358   1.00 17.58 ? 8   DT  P C7    1 
ATOM   3834 C  C6    . DT  C 3 8   ? 46.249 -1.065  3.739   1.00 16.00 ? 8   DT  P C6    1 
HETATM 3835 CA CA    . CA  D 4 .   ? 54.717 2.624   3.971   1.00 11.40 ? 502 CA  A CA    1 
HETATM 3836 C  C1    . GOL E 5 .   ? 60.599 -24.802 12.593  1.00 16.65 ? 503 GOL A C1    1 
HETATM 3837 O  O1    . GOL E 5 .   ? 59.218 -25.010 12.479  1.00 15.95 ? 503 GOL A O1    1 
HETATM 3838 C  C2    . GOL E 5 .   ? 61.200 -24.404 11.243  1.00 17.67 ? 503 GOL A C2    1 
HETATM 3839 O  O2    . GOL E 5 .   ? 60.695 -23.154 10.863  1.00 15.74 ? 503 GOL A O2    1 
HETATM 3840 C  C3    . GOL E 5 .   ? 60.875 -25.402 10.131  1.00 24.22 ? 503 GOL A C3    1 
HETATM 3841 O  O3    . GOL E 5 .   ? 61.596 -25.050 8.957   1.00 16.29 ? 503 GOL A O3    1 
HETATM 3842 C  C1    . GOL F 5 .   ? 54.727 28.186  4.771   1.00 32.67 ? 504 GOL A C1    1 
HETATM 3843 O  O1    . GOL F 5 .   ? 53.369 28.009  4.423   1.00 29.52 ? 504 GOL A O1    1 
HETATM 3844 C  C2    . GOL F 5 .   ? 55.120 27.222  5.887   1.00 35.80 ? 504 GOL A C2    1 
HETATM 3845 O  O2    . GOL F 5 .   ? 54.314 26.063  5.835   1.00 38.40 ? 504 GOL A O2    1 
HETATM 3846 C  C3    . GOL F 5 .   ? 56.584 26.824  5.734   1.00 36.79 ? 504 GOL A C3    1 
HETATM 3847 O  O3    . GOL F 5 .   ? 56.999 26.017  6.823   1.00 23.51 ? 504 GOL A O3    1 
HETATM 3848 P  PG    . DTP G 6 .   ? 55.223 2.669   7.494   1.00 11.35 ? 501 DTP P PG    1 
HETATM 3849 O  O1G   . DTP G 6 .   ? 54.889 1.735   8.631   1.00 11.97 ? 501 DTP P O1G   1 
HETATM 3850 O  O2G   . DTP G 6 .   ? 56.467 3.483   7.702   1.00 11.12 ? 501 DTP P O2G   1 
HETATM 3851 O  O3G   . DTP G 6 .   ? 55.134 2.013   6.153   1.00 11.20 ? 501 DTP P O3G   1 
HETATM 3852 P  PB    . DTP G 6 .   ? 53.024 4.249   6.459   1.00 10.83 ? 501 DTP P PB    1 
HETATM 3853 O  O1B   . DTP G 6 .   ? 53.763 4.410   5.160   1.00 10.18 ? 501 DTP P O1B   1 
HETATM 3854 O  O2B   . DTP G 6 .   ? 52.310 5.454   7.017   1.00 11.39 ? 501 DTP P O2B   1 
HETATM 3855 O  O3B   . DTP G 6 .   ? 54.022 3.759   7.617   1.00 9.01  ? 501 DTP P O3B   1 
HETATM 3856 P  PA    . DTP G 6 .   ? 51.426 2.193   5.167   1.00 11.20 ? 501 DTP P PA    1 
HETATM 3857 O  O1A   . DTP G 6 .   ? 50.517 1.144   5.762   1.00 13.12 ? 501 DTP P O1A   1 
HETATM 3858 O  O2A   . DTP G 6 .   ? 52.560 1.693   4.325   1.00 11.60 ? 501 DTP P O2A   1 
HETATM 3859 O  O3A   . DTP G 6 .   ? 51.980 3.026   6.427   1.00 10.28 ? 501 DTP P O3A   1 
HETATM 3860 O  "O5'" . DTP G 6 .   ? 50.491 3.176   4.310   1.00 12.87 ? 501 DTP P "O5'" 1 
HETATM 3861 C  "C5'" . DTP G 6 .   ? 51.005 4.115   3.375   1.00 10.01 ? 501 DTP P "C5'" 1 
HETATM 3862 C  "C4'" . DTP G 6 .   ? 50.069 5.313   3.342   1.00 9.37  ? 501 DTP P "C4'" 1 
HETATM 3863 O  "O4'" . DTP G 6 .   ? 48.741 4.905   2.996   1.00 11.71 ? 501 DTP P "O4'" 1 
HETATM 3864 C  "C3'" . DTP G 6 .   ? 49.956 5.921   4.730   1.00 8.72  ? 501 DTP P "C3'" 1 
HETATM 3865 O  "O3'" . DTP G 6 .   ? 50.992 6.881   4.996   1.00 9.46  ? 501 DTP P "O3'" 1 
HETATM 3866 C  "C2'" . DTP G 6 .   ? 48.571 6.535   4.719   1.00 10.42 ? 501 DTP P "C2'" 1 
HETATM 3867 C  "C1'" . DTP G 6 .   ? 47.780 5.599   3.807   1.00 11.14 ? 501 DTP P "C1'" 1 
HETATM 3868 N  N9    . DTP G 6 .   ? 47.028 4.584   4.582   1.00 14.49 ? 501 DTP P N9    1 
HETATM 3869 C  C8    . DTP G 6 .   ? 47.478 3.400   5.038   1.00 11.39 ? 501 DTP P C8    1 
HETATM 3870 N  N7    . DTP G 6 .   ? 46.465 2.766   5.686   1.00 11.89 ? 501 DTP P N7    1 
HETATM 3871 C  C5    . DTP G 6 .   ? 45.377 3.571   5.608   1.00 12.95 ? 501 DTP P C5    1 
HETATM 3872 C  C6    . DTP G 6 .   ? 44.072 3.479   6.067   1.00 17.79 ? 501 DTP P C6    1 
HETATM 3873 N  N6    . DTP G 6 .   ? 43.668 2.379   6.754   1.00 14.00 ? 501 DTP P N6    1 
HETATM 3874 N  N1    . DTP G 6 .   ? 43.207 4.496   5.821   1.00 13.03 ? 501 DTP P N1    1 
HETATM 3875 C  C2    . DTP G 6 .   ? 43.600 5.580   5.139   1.00 11.84 ? 501 DTP P C2    1 
HETATM 3876 N  N3    . DTP G 6 .   ? 44.851 5.702   4.681   1.00 10.64 ? 501 DTP P N3    1 
HETATM 3877 C  C4    . DTP G 6 .   ? 45.746 4.705   4.904   1.00 9.85  ? 501 DTP P C4    1 
HETATM 3878 O  O     . HOH H 7 .   ? 67.563 -20.671 8.991   1.00 10.96 ? 601 HOH A O     1 
HETATM 3879 O  O     . HOH H 7 .   ? 58.038 -23.551 14.478  1.00 10.89 ? 602 HOH A O     1 
HETATM 3880 O  O     . HOH H 7 .   ? 64.056 -3.464  6.300   1.00 13.02 ? 603 HOH A O     1 
HETATM 3881 O  O     . HOH H 7 .   ? 53.970 -28.542 4.429   1.00 14.75 ? 604 HOH A O     1 
HETATM 3882 O  O     . HOH H 7 .   ? 60.551 -18.532 -4.472  1.00 11.38 ? 605 HOH A O     1 
HETATM 3883 O  O     . HOH H 7 .   ? 56.587 -14.009 -5.723  1.00 12.82 ? 606 HOH A O     1 
HETATM 3884 O  O     . HOH H 7 .   ? 54.835 -11.483 3.614   1.00 13.32 ? 607 HOH A O     1 
HETATM 3885 O  O     . HOH H 7 .   ? 68.961 16.304  -3.815  1.00 16.59 ? 608 HOH A O     1 
HETATM 3886 O  O     . HOH H 7 .   ? 69.286 -13.510 5.316   1.00 11.69 ? 609 HOH A O     1 
HETATM 3887 O  O     . HOH H 7 .   ? 44.087 -14.490 5.849   1.00 14.35 ? 610 HOH A O     1 
HETATM 3888 O  O     . HOH H 7 .   ? 43.746 12.215  -7.051  1.00 16.40 ? 611 HOH A O     1 
HETATM 3889 O  O     . HOH H 7 .   ? 62.648 14.837  -8.933  1.00 15.36 ? 612 HOH A O     1 
HETATM 3890 O  O     . HOH H 7 .   ? 58.645 -12.155 -11.174 1.00 13.94 ? 613 HOH A O     1 
HETATM 3891 O  O     . HOH H 7 .   ? 40.707 11.598  -3.306  1.00 16.45 ? 614 HOH A O     1 
HETATM 3892 O  O     . HOH H 7 .   ? 69.310 -17.589 -1.063  1.00 13.94 ? 615 HOH A O     1 
HETATM 3893 O  O     . HOH H 7 .   ? 52.535 1.389   9.940   1.00 14.40 ? 616 HOH A O     1 
HETATM 3894 O  O     . HOH H 7 .   ? 51.876 5.900   9.511   1.00 11.74 ? 617 HOH A O     1 
HETATM 3895 O  O     . HOH H 7 .   ? 55.611 17.423  -0.341  1.00 13.33 ? 618 HOH A O     1 
HETATM 3896 O  O     . HOH H 7 .   ? 54.485 -9.627  5.710   1.00 15.48 ? 619 HOH A O     1 
HETATM 3897 O  O     . HOH H 7 .   ? 59.424 9.621   11.007  1.00 12.31 ? 620 HOH A O     1 
HETATM 3898 O  O     . HOH H 7 .   ? 60.085 11.547  -9.996  1.00 16.08 ? 621 HOH A O     1 
HETATM 3899 O  O     . HOH H 7 .   ? 67.303 -16.670 9.915   1.00 14.25 ? 622 HOH A O     1 
HETATM 3900 O  O     . HOH H 7 .   ? 49.041 6.745   -11.526 1.00 17.35 ? 623 HOH A O     1 
HETATM 3901 O  O     . HOH H 7 .   ? 65.562 5.585   2.503   1.00 18.98 ? 624 HOH A O     1 
HETATM 3902 O  O     . HOH H 7 .   ? 71.109 3.516   0.007   1.00 16.63 ? 625 HOH A O     1 
HETATM 3903 O  O     . HOH H 7 .   ? 45.248 -14.314 10.727  1.00 14.70 ? 626 HOH A O     1 
HETATM 3904 O  O     . HOH H 7 .   ? 62.446 7.284   7.332   1.00 14.86 ? 627 HOH A O     1 
HETATM 3905 O  O     . HOH H 7 .   ? 49.233 -15.645 13.752  1.00 15.49 ? 628 HOH A O     1 
HETATM 3906 O  O     . HOH H 7 .   ? 41.443 7.622   -18.415 1.00 15.75 ? 629 HOH A O     1 
HETATM 3907 O  O     . HOH H 7 .   ? 53.761 13.490  -9.657  1.00 16.10 ? 630 HOH A O     1 
HETATM 3908 O  O     . HOH H 7 .   ? 45.711 15.956  -1.363  1.00 15.79 ? 631 HOH A O     1 
HETATM 3909 O  O     . HOH H 7 .   ? 53.855 -20.539 -2.397  1.00 16.70 ? 632 HOH A O     1 
HETATM 3910 O  O     . HOH H 7 .   ? 43.517 -33.065 -0.197  1.00 21.02 ? 633 HOH A O     1 
HETATM 3911 O  O     . HOH H 7 .   ? 44.183 -15.194 1.619   1.00 18.01 ? 634 HOH A O     1 
HETATM 3912 O  O     . HOH H 7 .   ? 51.390 5.517   -8.157  1.00 20.45 ? 635 HOH A O     1 
HETATM 3913 O  O     . HOH H 7 .   ? 73.266 -7.449  9.266   1.00 14.24 ? 636 HOH A O     1 
HETATM 3914 O  O     . HOH H 7 .   ? 65.729 -6.628  -13.416 1.00 17.85 ? 637 HOH A O     1 
HETATM 3915 O  O     . HOH H 7 .   ? 52.401 15.769  -4.433  1.00 15.31 ? 638 HOH A O     1 
HETATM 3916 O  O     . HOH H 7 .   ? 48.785 -22.408 -5.426  1.00 20.83 ? 639 HOH A O     1 
HETATM 3917 O  O     . HOH H 7 .   ? 46.277 16.812  1.335   1.00 14.21 ? 640 HOH A O     1 
HETATM 3918 O  O     . HOH H 7 .   ? 54.048 17.423  -2.910  1.00 18.56 ? 641 HOH A O     1 
HETATM 3919 O  O     . HOH H 7 .   ? 66.005 -15.237 11.889  1.00 20.46 ? 642 HOH A O     1 
HETATM 3920 O  O     . HOH H 7 .   ? 65.732 -22.968 3.544   1.00 16.10 ? 643 HOH A O     1 
HETATM 3921 O  O     . HOH H 7 .   ? 42.321 -22.687 -2.372  1.00 16.46 ? 644 HOH A O     1 
HETATM 3922 O  O     . HOH H 7 .   ? 40.787 16.869  6.295   1.00 21.55 ? 645 HOH A O     1 
HETATM 3923 O  O     . HOH H 7 .   ? 44.524 7.464   2.471   1.00 14.83 ? 646 HOH A O     1 
HETATM 3924 O  O     . HOH H 7 .   ? 63.319 -26.593 7.265   1.00 15.50 ? 647 HOH A O     1 
HETATM 3925 O  O     . HOH H 7 .   ? 60.085 14.033  -8.492  1.00 20.90 ? 648 HOH A O     1 
HETATM 3926 O  O     . HOH H 7 .   ? 60.893 -23.462 6.582   1.00 19.54 ? 649 HOH A O     1 
HETATM 3927 O  O     . HOH H 7 .   ? 49.825 2.897   13.039  1.00 19.29 ? 650 HOH A O     1 
HETATM 3928 O  O     . HOH H 7 .   ? 45.106 7.450   -10.228 1.00 18.51 ? 651 HOH A O     1 
HETATM 3929 O  O     . HOH H 7 .   ? 54.089 15.367  -6.450  1.00 18.11 ? 652 HOH A O     1 
HETATM 3930 O  O     . HOH H 7 .   ? 51.778 -8.837  5.123   1.00 22.80 ? 653 HOH A O     1 
HETATM 3931 O  O     . HOH H 7 .   ? 59.386 11.111  8.769   1.00 18.26 ? 654 HOH A O     1 
HETATM 3932 O  O     . HOH H 7 .   ? 41.084 7.027   19.270  1.00 18.65 ? 655 HOH A O     1 
HETATM 3933 O  O     . HOH H 7 .   ? 50.304 -17.307 15.716  1.00 18.42 ? 656 HOH A O     1 
HETATM 3934 O  O     . HOH H 7 .   ? 44.272 11.136  -12.080 1.00 20.06 ? 657 HOH A O     1 
HETATM 3935 O  O     . HOH H 7 .   ? 46.783 -0.362  -14.913 1.00 19.05 ? 658 HOH A O     1 
HETATM 3936 O  O     . HOH H 7 .   ? 45.046 16.963  -17.955 1.00 26.64 ? 659 HOH A O     1 
HETATM 3937 O  O     . HOH H 7 .   ? 41.855 -30.550 -6.229  1.00 18.73 ? 660 HOH A O     1 
HETATM 3938 O  O     . HOH H 7 .   ? 64.101 -9.344  -14.104 1.00 20.55 ? 661 HOH A O     1 
HETATM 3939 O  O     . HOH H 7 .   ? 58.734 15.318  -10.399 1.00 24.10 ? 662 HOH A O     1 
HETATM 3940 O  O     . HOH H 7 .   ? 68.389 -15.897 -7.400  1.00 27.14 ? 663 HOH A O     1 
HETATM 3941 O  O     . HOH H 7 .   ? 48.117 10.730  -9.322  1.00 20.67 ? 664 HOH A O     1 
HETATM 3942 O  O     . HOH H 7 .   ? 70.693 -16.113 7.929   1.00 20.67 ? 665 HOH A O     1 
HETATM 3943 O  O     . HOH H 7 .   ? 51.184 3.527   10.843  1.00 23.22 ? 666 HOH A O     1 
HETATM 3944 O  O     . HOH H 7 .   ? 51.381 5.224   -10.828 1.00 20.98 ? 667 HOH A O     1 
HETATM 3945 O  O     . HOH H 7 .   ? 49.183 -9.500  10.714  1.00 24.90 ? 668 HOH A O     1 
HETATM 3946 O  O     . HOH H 7 .   ? 53.350 -28.218 15.525  1.00 22.10 ? 669 HOH A O     1 
HETATM 3947 O  O     . HOH H 7 .   ? 43.740 9.755   -9.780  1.00 18.89 ? 670 HOH A O     1 
HETATM 3948 O  O     . HOH H 7 .   ? 64.608 6.528   -0.254  1.00 17.91 ? 671 HOH A O     1 
HETATM 3949 O  O     . HOH H 7 .   ? 41.535 17.008  -14.703 1.00 23.93 ? 672 HOH A O     1 
HETATM 3950 O  O     . HOH H 7 .   ? 54.096 16.181  -9.108  1.00 25.03 ? 673 HOH A O     1 
HETATM 3951 O  O     . HOH H 7 .   ? 58.118 -14.435 -12.816 1.00 25.69 ? 674 HOH A O     1 
HETATM 3952 O  O     . HOH H 7 .   ? 37.101 16.122  -4.171  1.00 26.12 ? 675 HOH A O     1 
HETATM 3953 O  O     . HOH H 7 .   ? 52.426 20.214  5.282   1.00 18.02 ? 676 HOH A O     1 
HETATM 3954 O  O     . HOH H 7 .   ? 49.205 12.222  -11.373 1.00 26.16 ? 677 HOH A O     1 
HETATM 3955 O  O     . HOH H 7 .   ? 42.095 8.378   3.543   1.00 18.48 ? 678 HOH A O     1 
HETATM 3956 O  O     . HOH H 7 .   ? 49.301 7.310   -7.442  1.00 21.63 ? 679 HOH A O     1 
HETATM 3957 O  O     . HOH H 7 .   ? 48.758 3.073   21.481  1.00 19.85 ? 680 HOH A O     1 
HETATM 3958 O  O     . HOH H 7 .   ? 71.584 6.033   -7.032  1.00 20.89 ? 681 HOH A O     1 
HETATM 3959 O  O     . HOH H 7 .   ? 49.675 8.462   -13.502 1.00 26.53 ? 682 HOH A O     1 
HETATM 3960 O  O     . HOH H 7 .   ? 47.137 2.521   -1.217  1.00 21.93 ? 683 HOH A O     1 
HETATM 3961 O  O     . HOH H 7 .   ? 50.297 -27.629 18.855  1.00 24.56 ? 684 HOH A O     1 
HETATM 3962 O  O     . HOH H 7 .   ? 49.973 -3.268  -17.055 1.00 26.51 ? 685 HOH A O     1 
HETATM 3963 O  O     . HOH H 7 .   ? 41.296 -1.544  -16.156 1.00 26.61 ? 686 HOH A O     1 
HETATM 3964 O  O     . HOH H 7 .   ? 32.976 11.190  5.406   1.00 22.43 ? 687 HOH A O     1 
HETATM 3965 O  O     . HOH H 7 .   ? 44.245 -12.923 -0.011  1.00 25.46 ? 688 HOH A O     1 
HETATM 3966 O  O     . HOH H 7 .   ? 47.540 -0.480  -7.978  1.00 26.19 ? 689 HOH A O     1 
HETATM 3967 O  O     . HOH H 7 .   ? 39.415 18.922  18.548  1.00 25.86 ? 690 HOH A O     1 
HETATM 3968 O  O     . HOH H 7 .   ? 46.543 -9.562  11.070  1.00 29.50 ? 691 HOH A O     1 
HETATM 3969 O  O     . HOH H 7 .   ? 55.895 -7.322  6.454   1.00 21.60 ? 692 HOH A O     1 
HETATM 3970 O  O     . HOH H 7 .   ? 59.821 13.119  11.521  1.00 21.75 ? 693 HOH A O     1 
HETATM 3971 O  O     . HOH H 7 .   ? 41.646 23.826  8.886   1.00 20.22 ? 694 HOH A O     1 
HETATM 3972 O  O     . HOH H 7 .   ? 78.112 -0.953  5.670   1.00 23.20 ? 695 HOH A O     1 
HETATM 3973 O  O     . HOH H 7 .   ? 63.475 -18.968 -1.238  1.00 20.49 ? 696 HOH A O     1 
HETATM 3974 O  O     . HOH H 7 .   ? 51.754 6.330   -18.776 1.00 30.87 ? 697 HOH A O     1 
HETATM 3975 O  O     . HOH H 7 .   ? 48.266 -33.425 -3.483  1.00 22.04 ? 698 HOH A O     1 
HETATM 3976 O  O     . HOH H 7 .   ? 60.506 -17.852 -7.263  1.00 28.41 ? 699 HOH A O     1 
HETATM 3977 O  O     . HOH H 7 .   ? 40.923 -29.410 -1.933  1.00 26.36 ? 700 HOH A O     1 
HETATM 3978 O  O     . HOH H 7 .   ? 47.752 7.873   -9.487  1.00 23.56 ? 701 HOH A O     1 
HETATM 3979 O  O     . HOH H 7 .   ? 48.596 -36.888 2.877   1.00 22.69 ? 702 HOH A O     1 
HETATM 3980 O  O     . HOH H 7 .   ? 51.541 8.774   -15.268 1.00 25.28 ? 703 HOH A O     1 
HETATM 3981 O  O     . HOH H 7 .   ? 48.497 -17.949 17.529  1.00 27.23 ? 704 HOH A O     1 
HETATM 3982 O  O     . HOH H 7 .   ? 50.675 -34.650 -0.597  1.00 21.74 ? 705 HOH A O     1 
HETATM 3983 O  O     . HOH H 7 .   ? 83.903 -5.149  2.808   1.00 27.79 ? 706 HOH A O     1 
HETATM 3984 O  O     . HOH H 7 .   ? 72.311 -7.782  11.975  1.00 22.20 ? 707 HOH A O     1 
HETATM 3985 O  O     . HOH H 7 .   ? 59.237 5.026   17.080  1.00 20.71 ? 708 HOH A O     1 
HETATM 3986 O  O     . HOH H 7 .   ? 62.913 9.366   -13.261 1.00 29.43 ? 709 HOH A O     1 
HETATM 3987 O  O     . HOH H 7 .   ? 53.378 -33.512 0.011   1.00 22.17 ? 710 HOH A O     1 
HETATM 3988 O  O     . HOH H 7 .   ? 42.669 15.814  24.016  1.00 24.20 ? 711 HOH A O     1 
HETATM 3989 O  O     . HOH H 7 .   ? 51.134 0.349   -15.897 1.00 27.08 ? 712 HOH A O     1 
HETATM 3990 O  O     . HOH H 7 .   ? 58.476 -9.196  -13.926 1.00 26.43 ? 713 HOH A O     1 
HETATM 3991 O  O     . HOH H 7 .   ? 47.499 -16.624 -0.484  1.00 26.84 ? 714 HOH A O     1 
HETATM 3992 O  O     . HOH H 7 .   ? 45.354 0.516   -18.211 1.00 26.64 ? 715 HOH A O     1 
HETATM 3993 O  O     . HOH H 7 .   ? 66.546 3.722   11.092  1.00 26.46 ? 716 HOH A O     1 
HETATM 3994 O  O     . HOH H 7 .   ? 49.897 -9.423  -8.359  1.00 22.01 ? 717 HOH A O     1 
HETATM 3995 O  O     . HOH H 7 .   ? 54.365 15.543  23.452  1.00 32.23 ? 718 HOH A O     1 
HETATM 3996 O  O     . HOH H 7 .   ? 64.291 -24.683 -7.864  1.00 44.12 ? 719 HOH A O     1 
HETATM 3997 O  O     . HOH H 7 .   ? 55.667 -1.296  -14.593 1.00 27.94 ? 720 HOH A O     1 
HETATM 3998 O  O     . HOH H 7 .   ? 41.558 15.785  -22.754 1.00 29.71 ? 721 HOH A O     1 
HETATM 3999 O  O     . HOH H 7 .   ? 59.798 10.565  20.040  1.00 20.44 ? 722 HOH A O     1 
HETATM 4000 O  O     . HOH H 7 .   ? 72.258 -3.803  -13.635 1.00 23.29 ? 723 HOH A O     1 
HETATM 4001 O  O     . HOH H 7 .   ? 53.052 -26.567 -3.598  1.00 21.50 ? 724 HOH A O     1 
HETATM 4002 O  O     . HOH H 7 .   ? 48.006 -27.252 -7.002  1.00 31.04 ? 725 HOH A O     1 
HETATM 4003 O  O     . HOH H 7 .   ? 57.884 -7.795  8.350   1.00 20.73 ? 726 HOH A O     1 
HETATM 4004 O  O     . HOH H 7 .   ? 62.490 11.834  5.938   1.00 34.25 ? 727 HOH A O     1 
HETATM 4005 O  O     . HOH H 7 .   ? 70.571 -17.264 12.681  1.00 30.22 ? 728 HOH A O     1 
HETATM 4006 O  O     . HOH H 7 .   ? 47.098 16.375  -23.379 1.00 27.52 ? 729 HOH A O     1 
HETATM 4007 O  O     . HOH H 7 .   ? 70.807 -19.163 1.547   1.00 20.18 ? 730 HOH A O     1 
HETATM 4008 O  O     . HOH H 7 .   ? 49.948 -8.991  13.123  1.00 25.30 ? 731 HOH A O     1 
HETATM 4009 O  O     . HOH H 7 .   ? 41.842 20.418  5.067   1.00 23.58 ? 732 HOH A O     1 
HETATM 4010 O  O     . HOH H 7 .   ? 34.635 6.049   -21.598 1.00 31.90 ? 733 HOH A O     1 
HETATM 4011 O  O     . HOH H 7 .   ? 44.355 15.823  26.473  1.00 30.72 ? 734 HOH A O     1 
HETATM 4012 O  O     . HOH H 7 .   ? 51.200 -8.891  -5.175  1.00 22.81 ? 735 HOH A O     1 
HETATM 4013 O  O     . HOH H 7 .   ? 63.456 12.938  -10.591 1.00 27.03 ? 736 HOH A O     1 
HETATM 4014 O  O     . HOH H 7 .   ? 58.529 -18.229 20.042  1.00 27.22 ? 737 HOH A O     1 
HETATM 4015 O  O     . HOH H 7 .   ? 43.330 -1.478  -24.914 1.00 27.84 ? 738 HOH A O     1 
HETATM 4016 O  O     . HOH H 7 .   ? 79.024 3.412   2.187   1.00 31.48 ? 739 HOH A O     1 
HETATM 4017 O  O     . HOH H 7 .   ? 51.332 21.638  7.427   1.00 30.99 ? 740 HOH A O     1 
HETATM 4018 O  O     . HOH H 7 .   ? 56.691 -3.428  4.775   1.00 30.79 ? 741 HOH A O     1 
HETATM 4019 O  O     . HOH H 7 .   ? 58.773 4.666   23.255  1.00 26.68 ? 742 HOH A O     1 
HETATM 4020 O  O     . HOH H 7 .   ? 46.087 7.274   -12.750 1.00 27.29 ? 743 HOH A O     1 
HETATM 4021 O  O     . HOH H 7 .   ? 69.289 4.567   4.189   1.00 27.47 ? 744 HOH A O     1 
HETATM 4022 O  O     . HOH H 7 .   ? 36.016 11.184  0.899   1.00 23.74 ? 745 HOH A O     1 
HETATM 4023 O  O     . HOH H 7 .   ? 76.613 2.576   7.095   1.00 25.72 ? 746 HOH A O     1 
HETATM 4024 O  O     . HOH H 7 .   ? 53.834 6.017   -12.129 1.00 27.29 ? 747 HOH A O     1 
HETATM 4025 O  O     . HOH H 7 .   ? 65.902 -22.360 -7.732  1.00 27.63 ? 748 HOH A O     1 
HETATM 4026 O  O     . HOH H 7 .   ? 61.715 -31.569 -10.478 1.00 31.44 ? 749 HOH A O     1 
HETATM 4027 O  O     . HOH H 7 .   ? 53.399 -8.629  8.838   1.00 32.18 ? 750 HOH A O     1 
HETATM 4028 O  O     . HOH H 7 .   ? 38.805 -17.940 10.551  1.00 25.46 ? 751 HOH A O     1 
HETATM 4029 O  O     . HOH H 7 .   ? 58.232 -27.529 11.607  1.00 20.77 ? 752 HOH A O     1 
HETATM 4030 O  O     . HOH H 7 .   ? 60.627 -28.118 8.940   1.00 27.13 ? 753 HOH A O     1 
HETATM 4031 O  O     . HOH H 7 .   ? 61.646 8.055   10.147  1.00 27.34 ? 754 HOH A O     1 
HETATM 4032 O  O     . HOH H 7 .   ? 56.122 13.551  -11.168 1.00 24.95 ? 755 HOH A O     1 
HETATM 4033 O  O     . HOH H 7 .   ? 50.914 17.546  -5.589  1.00 28.93 ? 756 HOH A O     1 
HETATM 4034 O  O     . HOH H 7 .   ? 84.113 -7.899  1.050   1.00 41.62 ? 757 HOH A O     1 
HETATM 4035 O  O     . HOH H 7 .   ? 56.786 21.696  18.360  1.00 25.24 ? 758 HOH A O     1 
HETATM 4036 O  O     . HOH H 7 .   ? 37.045 13.188  12.199  1.00 27.42 ? 759 HOH A O     1 
HETATM 4037 O  O     . HOH H 7 .   ? 70.604 0.406   11.624  1.00 32.55 ? 760 HOH A O     1 
HETATM 4038 O  O     . HOH H 7 .   ? 70.579 -6.896  14.022  1.00 30.29 ? 761 HOH A O     1 
HETATM 4039 O  O     . HOH H 7 .   ? 71.744 -19.045 14.536  1.00 36.62 ? 762 HOH A O     1 
HETATM 4040 O  O     . HOH H 7 .   ? 40.524 -18.358 -1.527  1.00 34.28 ? 763 HOH A O     1 
HETATM 4041 O  O     . HOH H 7 .   ? 61.522 14.656  8.880   1.00 26.39 ? 764 HOH A O     1 
HETATM 4042 O  O     . HOH H 7 .   ? 75.266 0.314   -3.427  1.00 26.66 ? 765 HOH A O     1 
HETATM 4043 O  O     . HOH H 7 .   ? 59.715 -31.552 4.273   1.00 27.12 ? 766 HOH A O     1 
HETATM 4044 O  O     . HOH H 7 .   ? 65.871 -4.263  -14.903 1.00 27.56 ? 767 HOH A O     1 
HETATM 4045 O  O     . HOH H 7 .   ? 63.159 -23.667 3.508   1.00 26.39 ? 768 HOH A O     1 
HETATM 4046 O  O     . HOH H 7 .   ? 68.273 -14.620 -9.846  1.00 27.44 ? 769 HOH A O     1 
HETATM 4047 O  O     . HOH H 7 .   ? 45.775 18.056  -3.398  1.00 32.45 ? 770 HOH A O     1 
HETATM 4048 O  O     . HOH H 7 .   ? 45.174 20.654  4.028   1.00 30.16 ? 771 HOH A O     1 
HETATM 4049 O  O     . HOH H 7 .   ? 62.901 -17.146 -6.991  1.00 28.69 ? 772 HOH A O     1 
HETATM 4050 O  O     . HOH H 7 .   ? 46.951 16.615  25.731  1.00 29.61 ? 773 HOH A O     1 
HETATM 4051 O  O     . HOH H 7 .   ? 61.381 20.927  11.979  1.00 25.33 ? 774 HOH A O     1 
HETATM 4052 O  O     . HOH H 7 .   ? 57.562 -19.062 22.366  1.00 33.38 ? 775 HOH A O     1 
HETATM 4053 O  O     . HOH H 7 .   ? 49.323 14.824  -22.444 1.00 30.34 ? 776 HOH A O     1 
HETATM 4054 O  O     . HOH H 7 .   ? 42.434 -19.062 15.155  1.00 24.56 ? 777 HOH A O     1 
HETATM 4055 O  O     . HOH H 7 .   ? 69.788 5.262   1.297   1.00 39.46 ? 778 HOH A O     1 
HETATM 4056 O  O     . HOH H 7 .   ? 42.767 -30.076 -3.849  1.00 34.88 ? 779 HOH A O     1 
HETATM 4057 O  O     . HOH H 7 .   ? 52.895 -19.770 22.422  1.00 29.09 ? 780 HOH A O     1 
HETATM 4058 O  O     . HOH H 7 .   ? 52.458 3.864   18.306  1.00 24.33 ? 781 HOH A O     1 
HETATM 4059 O  O     . HOH H 7 .   ? 57.323 -16.441 -11.092 1.00 26.67 ? 782 HOH A O     1 
HETATM 4060 O  O     . HOH H 7 .   ? 53.406 -20.169 -4.929  1.00 29.93 ? 783 HOH A O     1 
HETATM 4061 O  O     . HOH H 7 .   ? 57.963 17.931  20.294  1.00 31.38 ? 784 HOH A O     1 
HETATM 4062 O  O     . HOH H 7 .   ? 69.820 -12.938 -11.299 1.00 28.51 ? 785 HOH A O     1 
HETATM 4063 O  O     . HOH H 7 .   ? 32.855 2.854   -23.667 1.00 29.78 ? 786 HOH A O     1 
HETATM 4064 O  O     . HOH H 7 .   ? 63.403 7.901   12.003  1.00 47.01 ? 787 HOH A O     1 
HETATM 4065 O  O     . HOH H 7 .   ? 44.545 9.822   -24.294 1.00 32.43 ? 788 HOH A O     1 
HETATM 4066 O  O     . HOH H 7 .   ? 45.761 2.179   18.789  1.00 30.15 ? 789 HOH A O     1 
HETATM 4067 O  O     . HOH H 7 .   ? 52.820 -12.832 -3.643  1.00 28.90 ? 790 HOH A O     1 
HETATM 4068 O  O     . HOH H 7 .   ? 41.350 21.766  2.143   1.00 24.26 ? 791 HOH A O     1 
HETATM 4069 O  O     . HOH H 7 .   ? 53.695 7.324   -14.462 1.00 32.42 ? 792 HOH A O     1 
HETATM 4070 O  O     . HOH H 7 .   ? 46.825 19.511  1.678   1.00 22.06 ? 793 HOH A O     1 
HETATM 4071 O  O     . HOH H 7 .   ? 39.025 -19.767 12.623  1.00 37.44 ? 794 HOH A O     1 
HETATM 4072 O  O     . HOH H 7 .   ? 14.776 5.915   -15.288 1.00 41.23 ? 795 HOH A O     1 
HETATM 4073 O  O     . HOH H 7 .   ? 44.783 -17.130 -0.262  1.00 26.95 ? 796 HOH A O     1 
HETATM 4074 O  O     . HOH H 7 .   ? 50.159 1.037   20.607  1.00 38.48 ? 797 HOH A O     1 
HETATM 4075 O  O     . HOH H 7 .   ? 46.447 2.586   -3.956  1.00 28.93 ? 798 HOH A O     1 
HETATM 4076 O  O     . HOH H 7 .   ? 69.728 10.133  -8.195  1.00 25.63 ? 799 HOH A O     1 
HETATM 4077 O  O     . HOH H 7 .   ? 46.299 0.459   7.129   1.00 28.50 ? 800 HOH A O     1 
HETATM 4078 O  O     . HOH H 7 .   ? 66.077 -26.082 0.947   1.00 28.94 ? 801 HOH A O     1 
HETATM 4079 O  O     . HOH H 7 .   ? 67.436 -8.373  10.170  1.00 24.41 ? 802 HOH A O     1 
HETATM 4080 O  O     . HOH H 7 .   ? 61.832 11.494  -11.965 1.00 27.96 ? 803 HOH A O     1 
HETATM 4081 O  O     . HOH H 7 .   ? 62.388 -13.120 -13.260 1.00 33.46 ? 804 HOH A O     1 
HETATM 4082 O  O     . HOH H 7 .   ? 53.337 24.278  4.305   1.00 32.75 ? 805 HOH A O     1 
HETATM 4083 O  O     . HOH H 7 .   ? 56.168 1.229   13.424  1.00 30.81 ? 806 HOH A O     1 
HETATM 4084 O  O     . HOH H 7 .   ? 73.224 2.116   8.327   1.00 31.79 ? 807 HOH A O     1 
HETATM 4085 O  O     . HOH H 7 .   ? 56.181 18.797  18.475  1.00 25.94 ? 808 HOH A O     1 
HETATM 4086 O  O     . HOH H 7 .   ? 61.383 -28.179 4.655   1.00 30.08 ? 809 HOH A O     1 
HETATM 4087 O  O     . HOH H 7 .   ? 42.604 13.033  -23.761 1.00 31.92 ? 810 HOH A O     1 
HETATM 4088 O  O     . HOH H 7 .   ? 54.187 -32.577 -2.372  1.00 31.51 ? 811 HOH A O     1 
HETATM 4089 O  O     . HOH H 7 .   ? 41.363 -3.161  -22.846 1.00 27.02 ? 812 HOH A O     1 
HETATM 4090 O  O     . HOH H 7 .   ? 37.572 15.149  -20.147 1.00 39.54 ? 813 HOH A O     1 
HETATM 4091 O  O     . HOH H 7 .   ? 39.787 7.371   13.565  1.00 35.96 ? 814 HOH A O     1 
HETATM 4092 O  O     . HOH H 7 .   ? 61.612 -16.441 14.142  1.00 27.91 ? 815 HOH A O     1 
HETATM 4093 O  O     . HOH H 7 .   ? 67.480 -6.644  12.955  1.00 23.03 ? 816 HOH A O     1 
HETATM 4094 O  O     . HOH H 7 .   ? 47.678 16.011  -17.565 1.00 35.06 ? 817 HOH A O     1 
HETATM 4095 O  O     . HOH H 7 .   ? 67.581 6.516   1.331   1.00 31.18 ? 818 HOH A O     1 
HETATM 4096 O  O     . HOH H 7 .   ? 55.192 2.733   21.318  1.00 34.35 ? 819 HOH A O     1 
HETATM 4097 O  O     . HOH H 7 .   ? 52.162 -6.085  -0.694  1.00 28.87 ? 820 HOH A O     1 
HETATM 4098 O  O     . HOH H 7 .   ? 76.746 0.974   -5.645  1.00 27.67 ? 821 HOH A O     1 
HETATM 4099 O  O     . HOH H 7 .   ? 60.108 14.353  3.588   1.00 25.80 ? 822 HOH A O     1 
HETATM 4100 O  O     . HOH H 7 .   ? 65.990 -21.506 14.810  1.00 39.47 ? 823 HOH A O     1 
HETATM 4101 O  O     . HOH H 7 .   ? 63.126 -7.226  13.191  1.00 31.86 ? 824 HOH A O     1 
HETATM 4102 O  O     . HOH H 7 .   ? 47.324 -22.715 17.710  1.00 25.69 ? 825 HOH A O     1 
HETATM 4103 O  O     . HOH H 7 .   ? 51.542 -29.195 17.013  1.00 32.53 ? 826 HOH A O     1 
HETATM 4104 O  O     . HOH H 7 .   ? 36.061 11.091  10.698  1.00 28.65 ? 827 HOH A O     1 
HETATM 4105 O  O     . HOH H 7 .   ? 23.316 14.069  -9.374  1.00 37.83 ? 828 HOH A O     1 
HETATM 4106 O  O     . HOH H 7 .   ? 57.677 23.406  14.305  1.00 29.31 ? 829 HOH A O     1 
HETATM 4107 O  O     . HOH H 7 .   ? 50.555 -13.319 -0.654  1.00 22.61 ? 830 HOH A O     1 
HETATM 4108 O  O     . HOH H 7 .   ? 39.551 21.475  5.985   1.00 35.28 ? 831 HOH A O     1 
HETATM 4109 O  O     . HOH H 7 .   ? 51.428 -29.075 -6.601  1.00 37.12 ? 832 HOH A O     1 
HETATM 4110 O  O     . HOH H 7 .   ? 38.321 -15.796 12.362  1.00 35.21 ? 833 HOH A O     1 
HETATM 4111 O  O     . HOH H 7 .   ? 56.184 -3.009  7.743   1.00 27.80 ? 834 HOH A O     1 
HETATM 4112 O  O     . HOH H 7 .   ? 38.988 2.664   -26.700 1.00 44.71 ? 835 HOH A O     1 
HETATM 4113 O  O     . HOH H 7 .   ? 46.101 0.817   14.277  1.00 35.22 ? 836 HOH A O     1 
HETATM 4114 O  O     . HOH H 7 .   ? 57.819 0.188   -14.579 1.00 32.98 ? 837 HOH A O     1 
HETATM 4115 O  O     . HOH H 7 .   ? 40.928 -18.311 0.988   1.00 33.83 ? 838 HOH A O     1 
HETATM 4116 O  O     . HOH H 7 .   ? 46.931 -14.770 15.017  1.00 30.15 ? 839 HOH A O     1 
HETATM 4117 O  O     . HOH H 7 .   ? 41.038 14.244  -6.154  1.00 33.51 ? 840 HOH A O     1 
HETATM 4118 O  O     . HOH H 7 .   ? 52.981 -18.156 -11.159 1.00 29.00 ? 841 HOH A O     1 
HETATM 4119 O  O     . HOH H 7 .   ? 35.217 20.991  0.724   1.00 28.93 ? 842 HOH A O     1 
HETATM 4120 O  O     . HOH H 7 .   ? 43.136 17.372  18.869  1.00 32.96 ? 843 HOH A O     1 
HETATM 4121 O  O     . HOH H 7 .   ? 48.396 19.788  4.989   1.00 29.92 ? 844 HOH A O     1 
HETATM 4122 O  O     . HOH H 7 .   ? 62.132 -25.211 5.284   1.00 30.72 ? 845 HOH A O     1 
HETATM 4123 O  O     . HOH H 7 .   ? 52.491 8.393   25.778  1.00 33.78 ? 846 HOH A O     1 
HETATM 4124 O  O     . HOH H 7 .   ? 62.013 16.006  2.671   1.00 31.76 ? 847 HOH A O     1 
HETATM 4125 O  O     . HOH H 7 .   ? 28.136 6.727   -17.072 1.00 29.42 ? 848 HOH A O     1 
HETATM 4126 O  O     . HOH H 7 .   ? 35.411 10.574  23.188  1.00 43.89 ? 849 HOH A O     1 
HETATM 4127 O  O     . HOH H 7 .   ? 62.412 12.169  9.594   1.00 39.61 ? 850 HOH A O     1 
HETATM 4128 O  O     . HOH H 7 .   ? 69.717 -9.029  10.995  1.00 27.24 ? 851 HOH A O     1 
HETATM 4129 O  O     . HOH H 7 .   ? 52.199 3.033   14.090  1.00 43.66 ? 852 HOH A O     1 
HETATM 4130 O  O     . HOH H 7 .   ? 43.005 -8.690  9.795   1.00 36.05 ? 853 HOH A O     1 
HETATM 4131 O  O     . HOH H 7 .   ? 38.832 -28.359 7.412   1.00 29.33 ? 854 HOH A O     1 
HETATM 4132 O  O     . HOH H 7 .   ? 35.013 20.474  -9.716  1.00 41.60 ? 855 HOH A O     1 
HETATM 4133 O  O     . HOH H 7 .   ? 63.310 -4.813  -15.402 1.00 34.11 ? 856 HOH A O     1 
HETATM 4134 O  O     . HOH H 7 .   ? 53.352 19.366  -1.232  1.00 26.21 ? 857 HOH A O     1 
HETATM 4135 O  O     . HOH H 7 .   ? 77.674 3.048   -1.235  1.00 34.67 ? 858 HOH A O     1 
HETATM 4136 O  O     . HOH H 7 .   ? 38.579 10.601  9.499   1.00 29.56 ? 859 HOH A O     1 
HETATM 4137 O  O     . HOH H 7 .   ? 65.301 12.962  3.545   1.00 33.76 ? 860 HOH A O     1 
HETATM 4138 O  O     . HOH H 7 .   ? 70.292 -21.915 0.892   1.00 30.74 ? 861 HOH A O     1 
HETATM 4139 O  O     . HOH H 7 .   ? 51.461 -22.915 -5.452  1.00 32.73 ? 862 HOH A O     1 
HETATM 4140 O  O     . HOH H 7 .   ? 62.438 -7.235  -15.052 1.00 39.59 ? 863 HOH A O     1 
HETATM 4141 O  O     . HOH H 7 .   ? 80.327 -18.299 -12.640 1.00 37.64 ? 864 HOH A O     1 
HETATM 4142 O  O     . HOH H 7 .   ? 67.731 -5.450  -17.312 1.00 42.42 ? 865 HOH A O     1 
HETATM 4143 O  O     . HOH H 7 .   ? 61.221 9.838   7.317   1.00 28.04 ? 866 HOH A O     1 
HETATM 4144 O  O     . HOH H 7 .   ? 31.235 1.706   -21.881 1.00 36.91 ? 867 HOH A O     1 
HETATM 4145 O  O     . HOH H 7 .   ? 37.340 13.639  21.868  1.00 34.97 ? 868 HOH A O     1 
HETATM 4146 O  O     . HOH H 7 .   ? 34.132 3.492   2.830   1.00 30.59 ? 869 HOH A O     1 
HETATM 4147 O  O     . HOH H 7 .   ? 47.389 14.137  -10.683 1.00 39.30 ? 870 HOH A O     1 
HETATM 4148 O  O     . HOH H 7 .   ? 81.822 -18.983 5.895   1.00 33.67 ? 871 HOH A O     1 
HETATM 4149 O  O     . HOH H 7 .   ? 29.464 8.293   -18.747 1.00 31.28 ? 872 HOH A O     1 
HETATM 4150 O  O     . HOH H 7 .   ? 34.639 11.641  -22.607 1.00 34.49 ? 873 HOH A O     1 
HETATM 4151 O  O     . HOH H 7 .   ? 55.337 -17.605 -12.969 1.00 41.21 ? 874 HOH A O     1 
HETATM 4152 O  O     . HOH H 7 .   ? 68.952 -21.461 -8.499  1.00 39.34 ? 875 HOH A O     1 
HETATM 4153 O  O     . HOH H 7 .   ? 44.996 -33.095 8.401   1.00 39.13 ? 876 HOH A O     1 
HETATM 4154 O  O     . HOH H 7 .   ? 41.128 -29.793 13.230  1.00 32.54 ? 877 HOH A O     1 
HETATM 4155 O  O     . HOH H 7 .   ? 65.275 -13.055 -16.372 1.00 42.53 ? 878 HOH A O     1 
HETATM 4156 O  O     . HOH H 7 .   ? 44.712 -32.933 -2.841  1.00 30.32 ? 879 HOH A O     1 
HETATM 4157 O  O     . HOH H 7 .   ? 34.631 15.432  11.388  1.00 29.51 ? 880 HOH A O     1 
HETATM 4158 O  O     . HOH H 7 .   ? 34.587 14.209  22.260  1.00 36.97 ? 881 HOH A O     1 
HETATM 4159 O  O     . HOH H 7 .   ? 34.722 7.963   23.115  1.00 45.49 ? 882 HOH A O     1 
HETATM 4160 O  O     . HOH H 7 .   ? 48.688 10.970  -13.641 1.00 32.58 ? 883 HOH A O     1 
HETATM 4161 O  O     . HOH H 7 .   ? 62.487 -2.317  12.740  1.00 39.35 ? 884 HOH A O     1 
HETATM 4162 O  O     . HOH H 7 .   ? 77.436 1.092   17.040  1.00 44.00 ? 885 HOH A O     1 
HETATM 4163 O  O     . HOH H 7 .   ? 35.012 17.609  -12.707 1.00 28.59 ? 886 HOH A O     1 
HETATM 4164 O  O     . HOH H 7 .   ? 52.993 0.319   12.391  1.00 30.48 ? 887 HOH A O     1 
HETATM 4165 O  O     . HOH H 7 .   ? 65.267 -34.587 -5.732  1.00 36.08 ? 888 HOH A O     1 
HETATM 4166 O  O     . HOH H 7 .   ? 59.720 -28.376 -1.761  1.00 40.51 ? 889 HOH A O     1 
HETATM 4167 O  O     . HOH H 7 .   ? 55.597 -20.626 21.401  1.00 31.41 ? 890 HOH A O     1 
HETATM 4168 O  O     . HOH H 7 .   ? 57.535 -34.750 8.727   1.00 34.81 ? 891 HOH A O     1 
HETATM 4169 O  O     . HOH H 7 .   ? 53.376 -30.622 -7.935  1.00 38.43 ? 892 HOH A O     1 
HETATM 4170 O  O     . HOH H 7 .   ? 81.332 -11.129 -7.881  1.00 40.07 ? 893 HOH A O     1 
HETATM 4171 O  O     . HOH H 7 .   ? 51.636 13.299  -11.253 1.00 27.75 ? 894 HOH A O     1 
HETATM 4172 O  O     . HOH H 7 .   ? 59.797 3.563   21.200  1.00 33.54 ? 895 HOH A O     1 
HETATM 4173 O  O     . HOH H 7 .   ? 73.458 4.653   -0.599  1.00 33.33 ? 896 HOH A O     1 
HETATM 4174 O  O     . HOH H 7 .   ? 50.983 -6.355  -5.350  1.00 30.83 ? 897 HOH A O     1 
HETATM 4175 O  O     . HOH H 7 .   ? 43.349 20.127  -11.750 1.00 39.96 ? 898 HOH A O     1 
HETATM 4176 O  O     . HOH H 7 .   ? 57.890 11.958  -11.725 1.00 34.23 ? 899 HOH A O     1 
HETATM 4177 O  O     . HOH H 7 .   ? 37.215 18.927  17.082  1.00 35.85 ? 900 HOH A O     1 
HETATM 4178 O  O     . HOH H 7 .   ? 60.493 13.628  6.327   1.00 36.00 ? 901 HOH A O     1 
HETATM 4179 O  O     . HOH H 7 .   ? 36.650 17.510  19.719  1.00 41.74 ? 902 HOH A O     1 
HETATM 4180 O  O     . HOH H 7 .   ? 42.522 5.914   21.265  1.00 31.92 ? 903 HOH A O     1 
HETATM 4181 O  O     . HOH H 7 .   ? 65.063 -19.328 15.756  1.00 26.38 ? 904 HOH A O     1 
HETATM 4182 O  O     . HOH H 7 .   ? 61.766 9.110   19.281  1.00 35.58 ? 905 HOH A O     1 
HETATM 4183 O  O     . HOH H 7 .   ? 44.671 -23.218 18.005  1.00 37.51 ? 906 HOH A O     1 
HETATM 4184 O  O     . HOH H 7 .   ? 67.404 6.279   10.210  1.00 29.23 ? 907 HOH A O     1 
HETATM 4185 O  O     . HOH H 7 .   ? 48.901 -0.507  -16.560 1.00 32.79 ? 908 HOH A O     1 
HETATM 4186 O  O     . HOH H 7 .   ? 72.245 2.071   12.667  1.00 40.12 ? 909 HOH A O     1 
HETATM 4187 O  O     . HOH H 7 .   ? 53.314 -33.116 -4.742  1.00 40.02 ? 910 HOH A O     1 
HETATM 4188 O  O     . HOH H 7 .   ? 79.151 0.485   15.233  1.00 45.61 ? 911 HOH A O     1 
HETATM 4189 O  O     . HOH H 7 .   ? 47.524 -4.746  -15.999 1.00 30.44 ? 912 HOH A O     1 
HETATM 4190 O  O     . HOH H 7 .   ? 39.958 -18.450 14.822  1.00 40.17 ? 913 HOH A O     1 
HETATM 4191 O  O     . HOH H 7 .   ? 60.599 6.325   -15.393 1.00 30.60 ? 914 HOH A O     1 
HETATM 4192 O  O     . HOH H 7 .   ? 47.286 -20.171 18.784  1.00 34.15 ? 915 HOH A O     1 
HETATM 4193 O  O     . HOH H 7 .   ? 56.872 -3.901  10.380  1.00 45.06 ? 916 HOH A O     1 
HETATM 4194 O  O     . HOH H 7 .   ? 69.590 8.465   4.324   1.00 39.41 ? 917 HOH A O     1 
HETATM 4195 O  O     . HOH H 7 .   ? 61.607 15.909  5.250   1.00 37.32 ? 918 HOH A O     1 
HETATM 4196 O  O     . HOH H 7 .   ? 64.114 19.841  11.382  1.00 32.25 ? 919 HOH A O     1 
HETATM 4197 O  O     . HOH H 7 .   ? 49.832 -15.897 -8.885  1.00 40.33 ? 920 HOH A O     1 
HETATM 4198 O  O     . HOH H 7 .   ? 43.526 -16.145 -2.507  1.00 36.39 ? 921 HOH A O     1 
HETATM 4199 O  O     . HOH H 7 .   ? 71.685 9.014   -6.481  1.00 32.17 ? 922 HOH A O     1 
HETATM 4200 O  O     . HOH H 7 .   ? 57.561 5.439   -15.497 1.00 30.85 ? 923 HOH A O     1 
HETATM 4201 O  O     . HOH H 7 .   ? 52.723 -2.467  8.757   1.00 34.30 ? 924 HOH A O     1 
HETATM 4202 O  O     . HOH H 7 .   ? 66.966 -21.164 -10.173 1.00 38.50 ? 925 HOH A O     1 
HETATM 4203 O  O     . HOH H 7 .   ? 55.913 -27.881 -4.002  1.00 41.61 ? 926 HOH A O     1 
HETATM 4204 O  O     . HOH H 7 .   ? 48.483 3.261   -20.125 1.00 37.76 ? 927 HOH A O     1 
HETATM 4205 O  O     . HOH H 7 .   ? 47.214 2.396   -22.335 1.00 38.23 ? 928 HOH A O     1 
HETATM 4206 O  O     . HOH H 7 .   ? 51.144 -0.503  8.142   1.00 36.81 ? 929 HOH A O     1 
HETATM 4207 O  O     . HOH H 7 .   ? 42.732 10.961  -25.500 1.00 37.07 ? 930 HOH A O     1 
HETATM 4208 O  O     . HOH H 7 .   ? 38.548 -22.773 11.657  1.00 44.08 ? 931 HOH A O     1 
HETATM 4209 O  O     . HOH H 7 .   ? 81.051 -15.710 7.984   1.00 34.51 ? 932 HOH A O     1 
HETATM 4210 O  O     . HOH H 7 .   ? 44.834 13.268  -10.460 1.00 36.39 ? 933 HOH A O     1 
HETATM 4211 O  O     . HOH H 7 .   ? 56.333 -33.259 2.572   1.00 33.38 ? 934 HOH A O     1 
HETATM 4212 O  O     . HOH H 7 .   ? 49.975 -14.954 -3.445  1.00 46.26 ? 935 HOH A O     1 
HETATM 4213 O  O     . HOH H 7 .   ? 55.433 5.590   25.416  1.00 35.75 ? 936 HOH A O     1 
HETATM 4214 O  O     . HOH H 7 .   ? 39.505 0.324   -6.325  1.00 31.28 ? 937 HOH A O     1 
HETATM 4215 O  O     . HOH H 7 .   ? 46.889 19.995  -2.045  1.00 38.80 ? 938 HOH A O     1 
HETATM 4216 O  O     . HOH H 7 .   ? 37.406 9.681   -23.427 1.00 45.07 ? 939 HOH A O     1 
HETATM 4217 O  O     . HOH H 7 .   ? 48.953 -6.074  -10.639 1.00 36.53 ? 940 HOH A O     1 
HETATM 4218 O  O     . HOH H 7 .   ? 47.937 0.945   -18.804 1.00 40.06 ? 941 HOH A O     1 
HETATM 4219 O  O     . HOH H 7 .   ? 61.777 8.058   16.198  1.00 36.44 ? 942 HOH A O     1 
HETATM 4220 O  O     . HOH H 7 .   ? 48.526 -0.886  6.183   1.00 32.49 ? 943 HOH A O     1 
HETATM 4221 O  O     . HOH H 7 .   ? 52.917 1.957   16.764  1.00 41.24 ? 944 HOH A O     1 
HETATM 4222 O  O     . HOH H 7 .   ? 62.345 -29.780 -12.232 1.00 37.39 ? 945 HOH A O     1 
HETATM 4223 O  O     . HOH H 7 .   ? 46.569 19.014  24.707  1.00 36.71 ? 946 HOH A O     1 
HETATM 4224 O  O     . HOH H 7 .   ? 63.621 -1.114  -16.647 1.00 36.75 ? 947 HOH A O     1 
HETATM 4225 O  O     . HOH H 7 .   ? 65.058 -9.218  12.510  1.00 37.15 ? 948 HOH A O     1 
HETATM 4226 O  O     . HOH H 7 .   ? 81.002 -2.211  24.151  1.00 46.33 ? 949 HOH A O     1 
HETATM 4227 O  O     . HOH H 7 .   ? 37.994 7.739   22.508  1.00 43.41 ? 950 HOH A O     1 
HETATM 4228 O  O     . HOH H 7 .   ? 83.158 -23.915 0.155   1.00 27.90 ? 951 HOH A O     1 
HETATM 4229 O  O     . HOH H 7 .   ? 44.258 -1.024  -16.241 1.00 33.14 ? 952 HOH A O     1 
HETATM 4230 O  O     . HOH H 7 .   ? 74.947 -22.491 -6.323  1.00 42.22 ? 953 HOH A O     1 
HETATM 4231 O  O     . HOH H 7 .   ? 65.451 -32.580 -12.967 1.00 48.89 ? 954 HOH A O     1 
HETATM 4232 O  O     . HOH H 7 .   ? 47.824 -30.663 -6.589  1.00 38.69 ? 955 HOH A O     1 
HETATM 4233 O  O     . HOH H 7 .   ? 39.340 -1.784  -13.757 1.00 38.05 ? 956 HOH A O     1 
HETATM 4234 O  O     . HOH H 7 .   ? 47.873 3.139   -26.104 1.00 43.93 ? 957 HOH A O     1 
HETATM 4235 O  O     . HOH H 7 .   ? 83.325 -0.979  -4.421  1.00 39.97 ? 958 HOH A O     1 
HETATM 4236 O  O     . HOH H 7 .   ? 57.216 -25.784 -5.293  1.00 43.39 ? 959 HOH A O     1 
HETATM 4237 O  O     . HOH H 7 .   ? 71.619 0.403   -10.437 1.00 42.28 ? 960 HOH A O     1 
HETATM 4238 O  O     . HOH H 7 .   ? 64.595 -15.592 13.946  1.00 32.76 ? 961 HOH A O     1 
HETATM 4239 O  O     . HOH H 7 .   ? 59.561 -19.734 23.993  1.00 33.05 ? 962 HOH A O     1 
HETATM 4240 O  O     . HOH H 7 .   ? 53.628 5.352   -16.572 1.00 39.59 ? 963 HOH A O     1 
HETATM 4241 O  O     . HOH H 7 .   ? 51.327 -1.847  12.597  1.00 38.05 ? 964 HOH A O     1 
HETATM 4242 O  O     . HOH H 7 .   ? 48.835 21.936  3.065   1.00 39.24 ? 965 HOH A O     1 
HETATM 4243 O  O     . HOH H 7 .   ? 48.665 -11.097 -1.230  1.00 41.80 ? 966 HOH A O     1 
HETATM 4244 O  O     . HOH H 7 .   ? 43.255 -25.881 17.606  1.00 41.31 ? 967 HOH A O     1 
HETATM 4245 O  O     . HOH H 7 .   ? 68.582 -26.198 -0.348  1.00 30.01 ? 968 HOH A O     1 
HETATM 4246 O  O     . HOH H 7 .   ? 57.308 0.268   10.919  1.00 36.89 ? 969 HOH A O     1 
HETATM 4247 O  O     . HOH H 7 .   ? 48.916 13.969  28.747  1.00 41.30 ? 970 HOH A O     1 
HETATM 4248 O  O     . HOH H 7 .   ? 65.761 8.513   9.221   1.00 30.47 ? 971 HOH A O     1 
HETATM 4249 O  O     . HOH H 7 .   ? 70.401 -18.959 -9.279  1.00 35.80 ? 972 HOH A O     1 
HETATM 4250 O  O     . HOH H 7 .   ? 57.735 -26.757 -2.647  1.00 41.32 ? 973 HOH A O     1 
HETATM 4251 O  O     . HOH H 7 .   ? 28.664 21.189  -7.653  1.00 37.05 ? 974 HOH A O     1 
HETATM 4252 O  O     . HOH H 7 .   ? 31.214 21.936  -3.565  1.00 35.51 ? 975 HOH A O     1 
HETATM 4253 O  O     . HOH H 7 .   ? 7.341  2.486   -2.565  1.00 52.30 ? 976 HOH A O     1 
HETATM 4254 O  O     . HOH H 7 .   ? 71.778 1.189   19.204  1.00 38.80 ? 977 HOH A O     1 
HETATM 4255 O  O     . HOH H 7 .   ? 40.178 15.544  25.133  1.00 42.48 ? 978 HOH A O     1 
HETATM 4256 O  O     . HOH H 7 .   ? 44.202 18.247  23.575  1.00 43.11 ? 979 HOH A O     1 
HETATM 4257 O  O     . HOH H 7 .   ? 68.710 5.527   -14.156 1.00 36.66 ? 980 HOH A O     1 
HETATM 4258 O  O     . HOH H 7 .   ? 54.670 -35.185 1.577   1.00 41.59 ? 981 HOH A O     1 
HETATM 4259 O  O     . HOH H 7 .   ? 49.219 -29.666 15.738  1.00 34.25 ? 982 HOH A O     1 
HETATM 4260 O  O     . HOH H 7 .   ? 43.899 -28.979 15.799  1.00 38.43 ? 983 HOH A O     1 
HETATM 4261 O  O     . HOH H 7 .   ? 56.010 -33.028 5.196   1.00 34.57 ? 984 HOH A O     1 
HETATM 4262 O  O     . HOH H 7 .   ? 60.823 -33.216 1.614   1.00 36.29 ? 985 HOH A O     1 
HETATM 4263 O  O     . HOH H 7 .   ? 31.365 -6.805  -13.116 1.00 39.09 ? 986 HOH A O     1 
HETATM 4264 O  O     . HOH H 7 .   ? 36.394 -3.299  -10.090 1.00 46.03 ? 987 HOH A O     1 
HETATM 4265 O  O     . HOH H 7 .   ? 60.018 -6.484  -12.605 1.00 30.29 ? 988 HOH A O     1 
HETATM 4266 O  O     . HOH H 7 .   ? 69.326 -10.965 12.518  1.00 30.71 ? 989 HOH A O     1 
HETATM 4267 O  O     . HOH H 7 .   ? 56.370 -35.918 -0.604  1.00 38.49 ? 990 HOH A O     1 
HETATM 4268 O  O     . HOH H 7 .   ? 40.102 -22.402 3.392   1.00 31.52 ? 991 HOH A O     1 
HETATM 4269 O  O     . HOH H 7 .   ? 35.614 22.650  -3.311  1.00 34.85 ? 992 HOH A O     1 
HETATM 4270 O  O     . HOH H 7 .   ? 66.272 -2.514  13.171  1.00 26.59 ? 993 HOH A O     1 
HETATM 4271 O  O     . HOH H 7 .   ? 44.584 -3.330  -17.409 1.00 43.60 ? 994 HOH A O     1 
HETATM 4272 O  O     . HOH H 7 .   ? 33.175 8.164   17.337  1.00 42.94 ? 995 HOH A O     1 
HETATM 4273 O  O     . HOH H 7 .   ? 73.493 -19.532 -2.486  1.00 24.76 ? 996 HOH A O     1 
HETATM 4274 O  O     . HOH H 7 .   ? 54.487 -0.833  7.550   1.00 26.67 ? 997 HOH A O     1 
HETATM 4275 O  O     . HOH H 7 .   ? 53.628 -0.792  4.933   1.00 25.56 ? 998 HOH A O     1 
HETATM 4276 O  O     . HOH H 7 .   ? 43.175 -8.821  7.305   1.00 22.71 ? 999 HOH A O     1 
HETATM 4277 O  O     . HOH I 7 .   ? 35.134 5.885   2.263   1.00 20.83 ? 101 HOH T O     1 
HETATM 4278 O  O     . HOH I 7 .   ? 37.448 -23.327 -5.336  1.00 22.82 ? 102 HOH T O     1 
HETATM 4279 O  O     . HOH I 7 .   ? 41.098 -3.532  -9.051  1.00 30.74 ? 103 HOH T O     1 
HETATM 4280 O  O     . HOH I 7 .   ? 43.568 5.526   -8.832  1.00 24.99 ? 104 HOH T O     1 
HETATM 4281 O  O     . HOH I 7 .   ? 37.125 -2.747  -3.969  1.00 28.85 ? 105 HOH T O     1 
HETATM 4282 O  O     . HOH I 7 .   ? 38.967 2.898   -5.830  1.00 27.27 ? 106 HOH T O     1 
HETATM 4283 O  O     . HOH I 7 .   ? 41.894 -20.210 -3.326  1.00 32.00 ? 107 HOH T O     1 
HETATM 4284 O  O     . HOH I 7 .   ? 40.215 -0.310  8.112   1.00 28.91 ? 108 HOH T O     1 
HETATM 4285 O  O     . HOH I 7 .   ? 36.438 2.485   4.790   1.00 26.96 ? 109 HOH T O     1 
HETATM 4286 O  O     . HOH I 7 .   ? 45.873 5.625   -5.011  1.00 23.95 ? 110 HOH T O     1 
HETATM 4287 O  O     . HOH I 7 .   ? 38.236 2.674   -3.142  1.00 28.28 ? 111 HOH T O     1 
HETATM 4288 O  O     . HOH I 7 .   ? 41.030 -22.581 -7.004  1.00 29.20 ? 112 HOH T O     1 
HETATM 4289 O  O     . HOH I 7 .   ? 44.429 -8.606  -3.534  1.00 29.02 ? 113 HOH T O     1 
HETATM 4290 O  O     . HOH I 7 .   ? 44.817 6.453   -2.828  1.00 28.29 ? 114 HOH T O     1 
HETATM 4291 O  O     . HOH I 7 .   ? 44.714 -0.316  8.919   1.00 40.04 ? 115 HOH T O     1 
HETATM 4292 O  O     . HOH I 7 .   ? 45.807 -5.229  -3.070  1.00 32.79 ? 116 HOH T O     1 
HETATM 4293 O  O     . HOH I 7 .   ? 37.480 0.222   -2.656  1.00 29.77 ? 117 HOH T O     1 
HETATM 4294 O  O     . HOH I 7 .   ? 29.462 3.336   16.326  1.00 46.72 ? 118 HOH T O     1 
HETATM 4295 O  O     . HOH I 7 .   ? 47.083 -8.627  -4.313  1.00 40.46 ? 119 HOH T O     1 
HETATM 4296 O  O     . HOH I 7 .   ? 45.601 -2.368  -2.915  1.00 37.20 ? 120 HOH T O     1 
HETATM 4297 O  O     . HOH I 7 .   ? 36.775 -1.992  -0.429  1.00 33.79 ? 121 HOH T O     1 
HETATM 4298 O  O     . HOH I 7 .   ? 33.203 10.104  7.869   1.00 41.26 ? 122 HOH T O     1 
HETATM 4299 O  O     . HOH I 7 .   ? 43.504 0.862   10.754  1.00 42.94 ? 123 HOH T O     1 
HETATM 4300 O  O     . HOH I 7 .   ? 37.922 0.234   4.910   1.00 37.08 ? 124 HOH T O     1 
HETATM 4301 O  O     . HOH I 7 .   ? 34.940 5.969   18.501  1.00 44.92 ? 125 HOH T O     1 
HETATM 4302 O  O     . HOH I 7 .   ? 38.128 -1.805  6.505   1.00 42.53 ? 126 HOH T O     1 
HETATM 4303 O  O     . HOH I 7 .   ? 38.890 -2.141  -5.988  1.00 41.40 ? 127 HOH T O     1 
HETATM 4304 O  O     . HOH I 7 .   ? 34.508 -0.082  -1.430  1.00 43.75 ? 128 HOH T O     1 
HETATM 4305 O  O     . HOH I 7 .   ? 47.467 -12.684 -8.878  1.00 38.35 ? 129 HOH T O     1 
HETATM 4306 O  O     . HOH I 7 .   ? 42.199 -7.311  -10.226 1.00 38.59 ? 130 HOH T O     1 
HETATM 4307 O  O     . HOH J 7 .   ? 49.719 -10.214 6.835   1.00 17.76 ? 101 HOH P O     1 
HETATM 4308 O  O     . HOH J 7 .   ? 41.962 -11.521 -0.858  1.00 22.49 ? 102 HOH P O     1 
HETATM 4309 O  O     . HOH J 7 .   ? 41.599 -15.658 2.008   1.00 19.13 ? 103 HOH P O     1 
HETATM 4310 O  O     . HOH J 7 .   ? 45.152 -8.231  -0.763  1.00 29.42 ? 104 HOH P O     1 
HETATM 4311 O  O     . HOH J 7 .   ? 46.496 -2.417  -0.411  1.00 23.70 ? 105 HOH P O     1 
HETATM 4312 O  O     . HOH J 7 .   ? 40.371 -13.891 0.081   1.00 27.99 ? 106 HOH P O     1 
HETATM 4313 O  O     . HOH J 7 .   ? 40.669 -9.210  6.083   1.00 31.40 ? 107 HOH P O     1 
HETATM 4314 O  O     . HOH J 7 .   ? 46.819 3.856   1.159   1.00 25.64 ? 108 HOH P O     1 
HETATM 4315 O  O     . HOH J 7 .   ? 42.280 -1.581  7.189   1.00 29.11 ? 109 HOH P O     1 
HETATM 4316 O  O     . HOH J 7 .   ? 52.612 -2.962  5.811   1.00 30.90 ? 110 HOH P O     1 
HETATM 4317 O  O     . HOH J 7 .   ? 42.183 -4.145  7.828   1.00 33.17 ? 111 HOH P O     1 
HETATM 4318 O  O     . HOH J 7 .   ? 37.155 -4.598  3.741   1.00 30.66 ? 112 HOH P O     1 
HETATM 4319 O  O     . HOH J 7 .   ? 46.069 -10.683 0.213   1.00 29.76 ? 113 HOH P O     1 
HETATM 4320 O  O     . HOH J 7 .   ? 46.929 -7.807  8.043   1.00 34.39 ? 114 HOH P O     1 
HETATM 4321 O  O     . HOH J 7 .   ? 49.786 -7.827  8.287   1.00 29.12 ? 115 HOH P O     1 
HETATM 4322 O  O     . HOH J 7 .   ? 38.520 -10.586 6.741   1.00 38.34 ? 116 HOH P O     1 
HETATM 4323 O  O     . HOH J 7 .   ? 45.508 5.962   -0.027  1.00 30.89 ? 117 HOH P O     1 
HETATM 4324 O  O     . HOH J 7 .   ? 51.218 -6.507  6.124   1.00 31.78 ? 118 HOH P O     1 
HETATM 4325 O  O     . HOH J 7 .   ? 52.549 -4.994  7.665   1.00 36.85 ? 119 HOH P O     1 
HETATM 4326 O  O     . HOH J 7 .   ? 31.704 -13.724 -2.651  1.00 35.30 ? 120 HOH P O     1 
HETATM 4327 O  O     . HOH J 7 .   ? 24.845 -5.575  -13.866 1.00 49.45 ? 121 HOH P O     1 
HETATM 4328 O  O     . HOH J 7 .   ? 40.700 -5.211  5.826   1.00 33.27 ? 122 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DG  12  12  12  DG  DG  T . n 
C 3 1   DT  1   1   1   DT  DT  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1   502 502 CA  CA  A . 
E 5 GOL 1   503 436 GOL GOL A . 
F 5 GOL 1   504 438 GOL GOL A . 
G 6 DTP 1   501 9   DTP DTP P . 
H 7 HOH 1   601 3   HOH HOH A . 
H 7 HOH 2   602 4   HOH HOH A . 
H 7 HOH 3   603 5   HOH HOH A . 
H 7 HOH 4   604 6   HOH HOH A . 
H 7 HOH 5   605 7   HOH HOH A . 
H 7 HOH 6   606 8   HOH HOH A . 
H 7 HOH 7   607 9   HOH HOH A . 
H 7 HOH 8   608 10  HOH HOH A . 
H 7 HOH 9   609 11  HOH HOH A . 
H 7 HOH 10  610 12  HOH HOH A . 
H 7 HOH 11  611 13  HOH HOH A . 
H 7 HOH 12  612 14  HOH HOH A . 
H 7 HOH 13  613 15  HOH HOH A . 
H 7 HOH 14  614 16  HOH HOH A . 
H 7 HOH 15  615 17  HOH HOH A . 
H 7 HOH 16  616 18  HOH HOH A . 
H 7 HOH 17  617 19  HOH HOH A . 
H 7 HOH 18  618 20  HOH HOH A . 
H 7 HOH 19  619 21  HOH HOH A . 
H 7 HOH 20  620 22  HOH HOH A . 
H 7 HOH 21  621 23  HOH HOH A . 
H 7 HOH 22  622 24  HOH HOH A . 
H 7 HOH 23  623 25  HOH HOH A . 
H 7 HOH 24  624 26  HOH HOH A . 
H 7 HOH 25  625 27  HOH HOH A . 
H 7 HOH 26  626 28  HOH HOH A . 
H 7 HOH 27  627 29  HOH HOH A . 
H 7 HOH 28  628 30  HOH HOH A . 
H 7 HOH 29  629 31  HOH HOH A . 
H 7 HOH 30  630 32  HOH HOH A . 
H 7 HOH 31  631 33  HOH HOH A . 
H 7 HOH 32  632 34  HOH HOH A . 
H 7 HOH 33  633 35  HOH HOH A . 
H 7 HOH 34  634 36  HOH HOH A . 
H 7 HOH 35  635 37  HOH HOH A . 
H 7 HOH 36  636 38  HOH HOH A . 
H 7 HOH 37  637 39  HOH HOH A . 
H 7 HOH 38  638 40  HOH HOH A . 
H 7 HOH 39  639 41  HOH HOH A . 
H 7 HOH 40  640 43  HOH HOH A . 
H 7 HOH 41  641 44  HOH HOH A . 
H 7 HOH 42  642 45  HOH HOH A . 
H 7 HOH 43  643 46  HOH HOH A . 
H 7 HOH 44  644 47  HOH HOH A . 
H 7 HOH 45  645 48  HOH HOH A . 
H 7 HOH 46  646 49  HOH HOH A . 
H 7 HOH 47  647 50  HOH HOH A . 
H 7 HOH 48  648 51  HOH HOH A . 
H 7 HOH 49  649 52  HOH HOH A . 
H 7 HOH 50  650 53  HOH HOH A . 
H 7 HOH 51  651 54  HOH HOH A . 
H 7 HOH 52  652 55  HOH HOH A . 
H 7 HOH 53  653 56  HOH HOH A . 
H 7 HOH 54  654 57  HOH HOH A . 
H 7 HOH 55  655 58  HOH HOH A . 
H 7 HOH 56  656 59  HOH HOH A . 
H 7 HOH 57  657 60  HOH HOH A . 
H 7 HOH 58  658 61  HOH HOH A . 
H 7 HOH 59  659 62  HOH HOH A . 
H 7 HOH 60  660 63  HOH HOH A . 
H 7 HOH 61  661 64  HOH HOH A . 
H 7 HOH 62  662 65  HOH HOH A . 
H 7 HOH 63  663 67  HOH HOH A . 
H 7 HOH 64  664 68  HOH HOH A . 
H 7 HOH 65  665 69  HOH HOH A . 
H 7 HOH 66  666 70  HOH HOH A . 
H 7 HOH 67  667 71  HOH HOH A . 
H 7 HOH 68  668 72  HOH HOH A . 
H 7 HOH 69  669 73  HOH HOH A . 
H 7 HOH 70  670 74  HOH HOH A . 
H 7 HOH 71  671 75  HOH HOH A . 
H 7 HOH 72  672 76  HOH HOH A . 
H 7 HOH 73  673 77  HOH HOH A . 
H 7 HOH 74  674 79  HOH HOH A . 
H 7 HOH 75  675 80  HOH HOH A . 
H 7 HOH 76  676 81  HOH HOH A . 
H 7 HOH 77  677 82  HOH HOH A . 
H 7 HOH 78  678 83  HOH HOH A . 
H 7 HOH 79  679 84  HOH HOH A . 
H 7 HOH 80  680 85  HOH HOH A . 
H 7 HOH 81  681 86  HOH HOH A . 
H 7 HOH 82  682 87  HOH HOH A . 
H 7 HOH 83  683 88  HOH HOH A . 
H 7 HOH 84  684 89  HOH HOH A . 
H 7 HOH 85  685 90  HOH HOH A . 
H 7 HOH 86  686 91  HOH HOH A . 
H 7 HOH 87  687 92  HOH HOH A . 
H 7 HOH 88  688 93  HOH HOH A . 
H 7 HOH 89  689 95  HOH HOH A . 
H 7 HOH 90  690 96  HOH HOH A . 
H 7 HOH 91  691 97  HOH HOH A . 
H 7 HOH 92  692 98  HOH HOH A . 
H 7 HOH 93  693 99  HOH HOH A . 
H 7 HOH 94  694 100 HOH HOH A . 
H 7 HOH 95  695 101 HOH HOH A . 
H 7 HOH 96  696 103 HOH HOH A . 
H 7 HOH 97  697 104 HOH HOH A . 
H 7 HOH 98  698 106 HOH HOH A . 
H 7 HOH 99  699 109 HOH HOH A . 
H 7 HOH 100 700 110 HOH HOH A . 
H 7 HOH 101 701 112 HOH HOH A . 
H 7 HOH 102 702 113 HOH HOH A . 
H 7 HOH 103 703 114 HOH HOH A . 
H 7 HOH 104 704 115 HOH HOH A . 
H 7 HOH 105 705 116 HOH HOH A . 
H 7 HOH 106 706 117 HOH HOH A . 
H 7 HOH 107 707 118 HOH HOH A . 
H 7 HOH 108 708 120 HOH HOH A . 
H 7 HOH 109 709 121 HOH HOH A . 
H 7 HOH 110 710 122 HOH HOH A . 
H 7 HOH 111 711 123 HOH HOH A . 
H 7 HOH 112 712 125 HOH HOH A . 
H 7 HOH 113 713 126 HOH HOH A . 
H 7 HOH 114 714 127 HOH HOH A . 
H 7 HOH 115 715 128 HOH HOH A . 
H 7 HOH 116 716 129 HOH HOH A . 
H 7 HOH 117 717 131 HOH HOH A . 
H 7 HOH 118 718 132 HOH HOH A . 
H 7 HOH 119 719 133 HOH HOH A . 
H 7 HOH 120 720 134 HOH HOH A . 
H 7 HOH 121 721 135 HOH HOH A . 
H 7 HOH 122 722 137 HOH HOH A . 
H 7 HOH 123 723 138 HOH HOH A . 
H 7 HOH 124 724 139 HOH HOH A . 
H 7 HOH 125 725 140 HOH HOH A . 
H 7 HOH 126 726 142 HOH HOH A . 
H 7 HOH 127 727 143 HOH HOH A . 
H 7 HOH 128 728 145 HOH HOH A . 
H 7 HOH 129 729 146 HOH HOH A . 
H 7 HOH 130 730 147 HOH HOH A . 
H 7 HOH 131 731 148 HOH HOH A . 
H 7 HOH 132 732 149 HOH HOH A . 
H 7 HOH 133 733 150 HOH HOH A . 
H 7 HOH 134 734 151 HOH HOH A . 
H 7 HOH 135 735 153 HOH HOH A . 
H 7 HOH 136 736 154 HOH HOH A . 
H 7 HOH 137 737 155 HOH HOH A . 
H 7 HOH 138 738 156 HOH HOH A . 
H 7 HOH 139 739 158 HOH HOH A . 
H 7 HOH 140 740 159 HOH HOH A . 
H 7 HOH 141 741 160 HOH HOH A . 
H 7 HOH 142 742 161 HOH HOH A . 
H 7 HOH 143 743 163 HOH HOH A . 
H 7 HOH 144 744 164 HOH HOH A . 
H 7 HOH 145 745 165 HOH HOH A . 
H 7 HOH 146 746 166 HOH HOH A . 
H 7 HOH 147 747 167 HOH HOH A . 
H 7 HOH 148 748 168 HOH HOH A . 
H 7 HOH 149 749 169 HOH HOH A . 
H 7 HOH 150 750 170 HOH HOH A . 
H 7 HOH 151 751 171 HOH HOH A . 
H 7 HOH 152 752 172 HOH HOH A . 
H 7 HOH 153 753 173 HOH HOH A . 
H 7 HOH 154 754 174 HOH HOH A . 
H 7 HOH 155 755 175 HOH HOH A . 
H 7 HOH 156 756 176 HOH HOH A . 
H 7 HOH 157 757 178 HOH HOH A . 
H 7 HOH 158 758 179 HOH HOH A . 
H 7 HOH 159 759 180 HOH HOH A . 
H 7 HOH 160 760 181 HOH HOH A . 
H 7 HOH 161 761 182 HOH HOH A . 
H 7 HOH 162 762 183 HOH HOH A . 
H 7 HOH 163 763 184 HOH HOH A . 
H 7 HOH 164 764 185 HOH HOH A . 
H 7 HOH 165 765 186 HOH HOH A . 
H 7 HOH 166 766 187 HOH HOH A . 
H 7 HOH 167 767 189 HOH HOH A . 
H 7 HOH 168 768 190 HOH HOH A . 
H 7 HOH 169 769 191 HOH HOH A . 
H 7 HOH 170 770 193 HOH HOH A . 
H 7 HOH 171 771 194 HOH HOH A . 
H 7 HOH 172 772 195 HOH HOH A . 
H 7 HOH 173 773 197 HOH HOH A . 
H 7 HOH 174 774 198 HOH HOH A . 
H 7 HOH 175 775 199 HOH HOH A . 
H 7 HOH 176 776 200 HOH HOH A . 
H 7 HOH 177 777 201 HOH HOH A . 
H 7 HOH 178 778 202 HOH HOH A . 
H 7 HOH 179 779 203 HOH HOH A . 
H 7 HOH 180 780 204 HOH HOH A . 
H 7 HOH 181 781 205 HOH HOH A . 
H 7 HOH 182 782 206 HOH HOH A . 
H 7 HOH 183 783 207 HOH HOH A . 
H 7 HOH 184 784 208 HOH HOH A . 
H 7 HOH 185 785 209 HOH HOH A . 
H 7 HOH 186 786 210 HOH HOH A . 
H 7 HOH 187 787 211 HOH HOH A . 
H 7 HOH 188 788 212 HOH HOH A . 
H 7 HOH 189 789 215 HOH HOH A . 
H 7 HOH 190 790 216 HOH HOH A . 
H 7 HOH 191 791 217 HOH HOH A . 
H 7 HOH 192 792 219 HOH HOH A . 
H 7 HOH 193 793 220 HOH HOH A . 
H 7 HOH 194 794 221 HOH HOH A . 
H 7 HOH 195 795 222 HOH HOH A . 
H 7 HOH 196 796 223 HOH HOH A . 
H 7 HOH 197 797 224 HOH HOH A . 
H 7 HOH 198 798 225 HOH HOH A . 
H 7 HOH 199 799 226 HOH HOH A . 
H 7 HOH 200 800 227 HOH HOH A . 
H 7 HOH 201 801 228 HOH HOH A . 
H 7 HOH 202 802 229 HOH HOH A . 
H 7 HOH 203 803 231 HOH HOH A . 
H 7 HOH 204 804 232 HOH HOH A . 
H 7 HOH 205 805 234 HOH HOH A . 
H 7 HOH 206 806 235 HOH HOH A . 
H 7 HOH 207 807 236 HOH HOH A . 
H 7 HOH 208 808 237 HOH HOH A . 
H 7 HOH 209 809 240 HOH HOH A . 
H 7 HOH 210 810 241 HOH HOH A . 
H 7 HOH 211 811 242 HOH HOH A . 
H 7 HOH 212 812 243 HOH HOH A . 
H 7 HOH 213 813 244 HOH HOH A . 
H 7 HOH 214 814 246 HOH HOH A . 
H 7 HOH 215 815 247 HOH HOH A . 
H 7 HOH 216 816 248 HOH HOH A . 
H 7 HOH 217 817 249 HOH HOH A . 
H 7 HOH 218 818 250 HOH HOH A . 
H 7 HOH 219 819 251 HOH HOH A . 
H 7 HOH 220 820 252 HOH HOH A . 
H 7 HOH 221 821 253 HOH HOH A . 
H 7 HOH 222 822 254 HOH HOH A . 
H 7 HOH 223 823 255 HOH HOH A . 
H 7 HOH 224 824 257 HOH HOH A . 
H 7 HOH 225 825 258 HOH HOH A . 
H 7 HOH 226 826 259 HOH HOH A . 
H 7 HOH 227 827 260 HOH HOH A . 
H 7 HOH 228 828 262 HOH HOH A . 
H 7 HOH 229 829 263 HOH HOH A . 
H 7 HOH 230 830 265 HOH HOH A . 
H 7 HOH 231 831 266 HOH HOH A . 
H 7 HOH 232 832 269 HOH HOH A . 
H 7 HOH 233 833 270 HOH HOH A . 
H 7 HOH 234 834 272 HOH HOH A . 
H 7 HOH 235 835 273 HOH HOH A . 
H 7 HOH 236 836 274 HOH HOH A . 
H 7 HOH 237 837 275 HOH HOH A . 
H 7 HOH 238 838 276 HOH HOH A . 
H 7 HOH 239 839 277 HOH HOH A . 
H 7 HOH 240 840 278 HOH HOH A . 
H 7 HOH 241 841 279 HOH HOH A . 
H 7 HOH 242 842 280 HOH HOH A . 
H 7 HOH 243 843 281 HOH HOH A . 
H 7 HOH 244 844 282 HOH HOH A . 
H 7 HOH 245 845 283 HOH HOH A . 
H 7 HOH 246 846 285 HOH HOH A . 
H 7 HOH 247 847 286 HOH HOH A . 
H 7 HOH 248 848 287 HOH HOH A . 
H 7 HOH 249 849 288 HOH HOH A . 
H 7 HOH 250 850 289 HOH HOH A . 
H 7 HOH 251 851 290 HOH HOH A . 
H 7 HOH 252 852 291 HOH HOH A . 
H 7 HOH 253 853 293 HOH HOH A . 
H 7 HOH 254 854 294 HOH HOH A . 
H 7 HOH 255 855 295 HOH HOH A . 
H 7 HOH 256 856 297 HOH HOH A . 
H 7 HOH 257 857 298 HOH HOH A . 
H 7 HOH 258 858 299 HOH HOH A . 
H 7 HOH 259 859 300 HOH HOH A . 
H 7 HOH 260 860 301 HOH HOH A . 
H 7 HOH 261 861 302 HOH HOH A . 
H 7 HOH 262 862 304 HOH HOH A . 
H 7 HOH 263 863 305 HOH HOH A . 
H 7 HOH 264 864 306 HOH HOH A . 
H 7 HOH 265 865 307 HOH HOH A . 
H 7 HOH 266 866 308 HOH HOH A . 
H 7 HOH 267 867 310 HOH HOH A . 
H 7 HOH 268 868 311 HOH HOH A . 
H 7 HOH 269 869 313 HOH HOH A . 
H 7 HOH 270 870 314 HOH HOH A . 
H 7 HOH 271 871 316 HOH HOH A . 
H 7 HOH 272 872 317 HOH HOH A . 
H 7 HOH 273 873 319 HOH HOH A . 
H 7 HOH 274 874 320 HOH HOH A . 
H 7 HOH 275 875 321 HOH HOH A . 
H 7 HOH 276 876 323 HOH HOH A . 
H 7 HOH 277 877 324 HOH HOH A . 
H 7 HOH 278 878 325 HOH HOH A . 
H 7 HOH 279 879 326 HOH HOH A . 
H 7 HOH 280 880 327 HOH HOH A . 
H 7 HOH 281 881 328 HOH HOH A . 
H 7 HOH 282 882 329 HOH HOH A . 
H 7 HOH 283 883 330 HOH HOH A . 
H 7 HOH 284 884 331 HOH HOH A . 
H 7 HOH 285 885 332 HOH HOH A . 
H 7 HOH 286 886 333 HOH HOH A . 
H 7 HOH 287 887 334 HOH HOH A . 
H 7 HOH 288 888 335 HOH HOH A . 
H 7 HOH 289 889 336 HOH HOH A . 
H 7 HOH 290 890 337 HOH HOH A . 
H 7 HOH 291 891 338 HOH HOH A . 
H 7 HOH 292 892 339 HOH HOH A . 
H 7 HOH 293 893 340 HOH HOH A . 
H 7 HOH 294 894 341 HOH HOH A . 
H 7 HOH 295 895 342 HOH HOH A . 
H 7 HOH 296 896 343 HOH HOH A . 
H 7 HOH 297 897 344 HOH HOH A . 
H 7 HOH 298 898 345 HOH HOH A . 
H 7 HOH 299 899 346 HOH HOH A . 
H 7 HOH 300 900 348 HOH HOH A . 
H 7 HOH 301 901 349 HOH HOH A . 
H 7 HOH 302 902 350 HOH HOH A . 
H 7 HOH 303 903 351 HOH HOH A . 
H 7 HOH 304 904 352 HOH HOH A . 
H 7 HOH 305 905 354 HOH HOH A . 
H 7 HOH 306 906 355 HOH HOH A . 
H 7 HOH 307 907 356 HOH HOH A . 
H 7 HOH 308 908 357 HOH HOH A . 
H 7 HOH 309 909 358 HOH HOH A . 
H 7 HOH 310 910 361 HOH HOH A . 
H 7 HOH 311 911 363 HOH HOH A . 
H 7 HOH 312 912 364 HOH HOH A . 
H 7 HOH 313 913 365 HOH HOH A . 
H 7 HOH 314 914 366 HOH HOH A . 
H 7 HOH 315 915 367 HOH HOH A . 
H 7 HOH 316 916 368 HOH HOH A . 
H 7 HOH 317 917 369 HOH HOH A . 
H 7 HOH 318 918 370 HOH HOH A . 
H 7 HOH 319 919 371 HOH HOH A . 
H 7 HOH 320 920 372 HOH HOH A . 
H 7 HOH 321 921 373 HOH HOH A . 
H 7 HOH 322 922 374 HOH HOH A . 
H 7 HOH 323 923 375 HOH HOH A . 
H 7 HOH 324 924 376 HOH HOH A . 
H 7 HOH 325 925 378 HOH HOH A . 
H 7 HOH 326 926 382 HOH HOH A . 
H 7 HOH 327 927 383 HOH HOH A . 
H 7 HOH 328 928 384 HOH HOH A . 
H 7 HOH 329 929 385 HOH HOH A . 
H 7 HOH 330 930 386 HOH HOH A . 
H 7 HOH 331 931 388 HOH HOH A . 
H 7 HOH 332 932 389 HOH HOH A . 
H 7 HOH 333 933 390 HOH HOH A . 
H 7 HOH 334 934 391 HOH HOH A . 
H 7 HOH 335 935 393 HOH HOH A . 
H 7 HOH 336 936 394 HOH HOH A . 
H 7 HOH 337 937 395 HOH HOH A . 
H 7 HOH 338 938 396 HOH HOH A . 
H 7 HOH 339 939 398 HOH HOH A . 
H 7 HOH 340 940 400 HOH HOH A . 
H 7 HOH 341 941 401 HOH HOH A . 
H 7 HOH 342 942 402 HOH HOH A . 
H 7 HOH 343 943 403 HOH HOH A . 
H 7 HOH 344 944 404 HOH HOH A . 
H 7 HOH 345 945 406 HOH HOH A . 
H 7 HOH 346 946 407 HOH HOH A . 
H 7 HOH 347 947 408 HOH HOH A . 
H 7 HOH 348 948 409 HOH HOH A . 
H 7 HOH 349 949 410 HOH HOH A . 
H 7 HOH 350 950 411 HOH HOH A . 
H 7 HOH 351 951 412 HOH HOH A . 
H 7 HOH 352 952 414 HOH HOH A . 
H 7 HOH 353 953 415 HOH HOH A . 
H 7 HOH 354 954 416 HOH HOH A . 
H 7 HOH 355 955 417 HOH HOH A . 
H 7 HOH 356 956 418 HOH HOH A . 
H 7 HOH 357 957 421 HOH HOH A . 
H 7 HOH 358 958 422 HOH HOH A . 
H 7 HOH 359 959 423 HOH HOH A . 
H 7 HOH 360 960 425 HOH HOH A . 
H 7 HOH 361 961 426 HOH HOH A . 
H 7 HOH 362 962 427 HOH HOH A . 
H 7 HOH 363 963 428 HOH HOH A . 
H 7 HOH 364 964 430 HOH HOH A . 
H 7 HOH 365 965 434 HOH HOH A . 
H 7 HOH 366 966 435 HOH HOH A . 
H 7 HOH 367 967 436 HOH HOH A . 
H 7 HOH 368 968 437 HOH HOH A . 
H 7 HOH 369 969 439 HOH HOH A . 
H 7 HOH 370 970 440 HOH HOH A . 
H 7 HOH 371 971 441 HOH HOH A . 
H 7 HOH 372 972 442 HOH HOH A . 
H 7 HOH 373 973 443 HOH HOH A . 
H 7 HOH 374 974 444 HOH HOH A . 
H 7 HOH 375 975 445 HOH HOH A . 
H 7 HOH 376 976 446 HOH HOH A . 
H 7 HOH 377 977 447 HOH HOH A . 
H 7 HOH 378 978 448 HOH HOH A . 
H 7 HOH 379 979 452 HOH HOH A . 
H 7 HOH 380 980 453 HOH HOH A . 
H 7 HOH 381 981 454 HOH HOH A . 
H 7 HOH 382 982 456 HOH HOH A . 
H 7 HOH 383 983 457 HOH HOH A . 
H 7 HOH 384 984 458 HOH HOH A . 
H 7 HOH 385 985 459 HOH HOH A . 
H 7 HOH 386 986 460 HOH HOH A . 
H 7 HOH 387 987 462 HOH HOH A . 
H 7 HOH 388 988 463 HOH HOH A . 
H 7 HOH 389 989 464 HOH HOH A . 
H 7 HOH 390 990 465 HOH HOH A . 
H 7 HOH 391 991 466 HOH HOH A . 
H 7 HOH 392 992 467 HOH HOH A . 
H 7 HOH 393 993 469 HOH HOH A . 
H 7 HOH 394 994 470 HOH HOH A . 
H 7 HOH 395 995 471 HOH HOH A . 
H 7 HOH 396 996 472 HOH HOH A . 
H 7 HOH 397 997 473 HOH HOH A . 
H 7 HOH 398 998 474 HOH HOH A . 
H 7 HOH 399 999 152 HOH HOH A . 
I 7 HOH 1   101 66  HOH HOH T . 
I 7 HOH 2   102 94  HOH HOH T . 
I 7 HOH 3   103 107 HOH HOH T . 
I 7 HOH 4   104 119 HOH HOH T . 
I 7 HOH 5   105 130 HOH HOH T . 
I 7 HOH 6   106 136 HOH HOH T . 
I 7 HOH 7   107 141 HOH HOH T . 
I 7 HOH 8   108 144 HOH HOH T . 
I 7 HOH 9   109 177 HOH HOH T . 
I 7 HOH 10  110 188 HOH HOH T . 
I 7 HOH 11  111 196 HOH HOH T . 
I 7 HOH 12  112 214 HOH HOH T . 
I 7 HOH 13  113 230 HOH HOH T . 
I 7 HOH 14  114 233 HOH HOH T . 
I 7 HOH 15  115 239 HOH HOH T . 
I 7 HOH 16  116 245 HOH HOH T . 
I 7 HOH 17  117 261 HOH HOH T . 
I 7 HOH 18  118 264 HOH HOH T . 
I 7 HOH 19  119 322 HOH HOH T . 
I 7 HOH 20  120 362 HOH HOH T . 
I 7 HOH 21  121 381 HOH HOH T . 
I 7 HOH 22  122 387 HOH HOH T . 
I 7 HOH 23  123 392 HOH HOH T . 
I 7 HOH 24  124 399 HOH HOH T . 
I 7 HOH 25  125 420 HOH HOH T . 
I 7 HOH 26  126 424 HOH HOH T . 
I 7 HOH 27  127 432 HOH HOH T . 
I 7 HOH 28  128 449 HOH HOH T . 
I 7 HOH 29  129 455 HOH HOH T . 
I 7 HOH 30  130 461 HOH HOH T . 
J 7 HOH 1   101 42  HOH HOH P . 
J 7 HOH 2   102 78  HOH HOH P . 
J 7 HOH 3   103 102 HOH HOH P . 
J 7 HOH 4   104 105 HOH HOH P . 
J 7 HOH 5   105 108 HOH HOH P . 
J 7 HOH 6   106 111 HOH HOH P . 
J 7 HOH 7   107 157 HOH HOH P . 
J 7 HOH 8   108 162 HOH HOH P . 
J 7 HOH 9   109 192 HOH HOH P . 
J 7 HOH 10  110 213 HOH HOH P . 
J 7 HOH 11  111 267 HOH HOH P . 
J 7 HOH 12  112 268 HOH HOH P . 
J 7 HOH 13  113 292 HOH HOH P . 
J 7 HOH 14  114 296 HOH HOH P . 
J 7 HOH 15  115 303 HOH HOH P . 
J 7 HOH 16  116 318 HOH HOH P . 
J 7 HOH 17  117 347 HOH HOH P . 
J 7 HOH 18  118 360 HOH HOH P . 
J 7 HOH 19  119 379 HOH HOH P . 
J 7 HOH 20  120 405 HOH HOH P . 
J 7 HOH 21  121 451 HOH HOH P . 
J 7 HOH 22  122 468 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5410  ? 
1 MORE         -44   ? 
1 'SSA (A^2)'  22070 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O3G ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O1B ? G DTP .   ? P DTP 501 ? 1_555 78.2  ? 
2  O3G ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASP 16  ? A ASP 13  ? 1_555 100.8 ? 
3  O1B ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASP 16  ? A ASP 13  ? 1_555 178.7 ? 
4  O3G ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O   ? A MET 17  ? A MET 14  ? 1_555 93.7  ? 
5  O1B ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O   ? A MET 17  ? A MET 14  ? 1_555 88.7  ? 
6  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O   ? A MET 17  ? A MET 14  ? 1_555 90.5  ? 
7  O3G ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 163.3 ? 
8  O1B ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 85.2  ? 
9  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 95.8  ? 
10 O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 83.9  ? 
11 O3G ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2A ? G DTP .   ? P DTP 501 ? 1_555 85.4  ? 
12 O1B ? G DTP .   ? P DTP 501 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2A ? G DTP .   ? P DTP 501 ? 1_555 81.6  ? 
13 OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2A ? G DTP .   ? P DTP 501 ? 1_555 99.2  ? 
14 O   ? A MET 17  ? A MET 14  ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2A ? G DTP .   ? P DTP 501 ? 1_555 170.3 ? 
15 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O2A ? G DTP .   ? P DTP 501 ? 1_555 94.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 12 ? ? "C1'" T DG 12 ? ? N9    T DG 12 ? A 110.98 108.30 2.68  0.30 N 
2 1 "O4'" P DA 7  ? ? "C4'" P DA 7  ? ? "C3'" P DA 7  ? ? 100.02 104.50 -4.48 0.40 N 
3 1 "O4'" P DA 7  ? ? "C1'" P DA 7  ? ? N9    P DA 7  ? ? 110.76 108.30 2.46  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 19.52   65.53   
2 1 TYR A 39  ? A 70.86   83.26   
3 1 TYR A 39  ? B 63.64   162.37  
4 1 SER A 62  ? ? 83.93   -14.43  
5 1 SER A 217 ? ? -157.69 -157.74 
6 1 SER A 257 ? ? 97.90   -10.97  
7 1 PRO A 418 ? ? -49.48  150.43  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ED7 'double helix'         
4ED7 'b-form double helix'  
4ED7 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.095  -0.143 -0.004 5.338   -7.749  5.087  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.079 -0.038 0.254  -2.896  -17.305 0.030  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.199 -0.167 -0.286 -10.897 -4.104  -0.543 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.092  -0.083 0.083  0.707   -4.700  1.184  4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.264  -0.160 -0.006 1.081   -8.683  -0.079 5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.270 -0.130 0.052  -1.329  -7.497  1.676  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.322  0.140  0.116  1.650   -3.467  3.689  7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DG 12 1_555 C DT 1 1_555 -1.900 0.169  0.828  36.798  -1.180  13.910 8 T_DG12:DT1_P T 12 ? P 1 ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.755  -1.391 3.545 -2.222  1.345  28.468 -3.143 -2.066 3.409 2.728  4.507 
28.583 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.270 -1.360 3.459 5.747   9.320  29.139 -4.305 1.594  2.800 17.753 
-10.946 31.086 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.516 -0.456 3.160 -1.694  2.257  34.686 -1.094 0.613  3.146 3.778  2.836 
34.797 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 -0.128 -0.762 3.376 1.799   3.206  30.052 -2.120 0.616  3.266 6.153  
-3.453  30.271 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.530 0.201  3.506 -1.539  3.204  35.026 -0.182 0.629  3.529 5.307  2.549 
35.200 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.114 -0.171 3.440 -2.058  -2.375 36.373 0.073  -0.118 3.445 -3.796 3.290 
36.503 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DG 12 1_555 C DT 1 1_555 1.358  -0.781 2.628 -12.616 6.225  16.422 -3.655 -6.807 0.992 18.065 
36.610  21.592 7 TT_DC11DG12:DT1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'                       CA  
5 GLYCEROL                            GOL 
6 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
7 water                               HOH 
#