data_4ED8
# 
_entry.id   4ED8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ED8         
NDB   NA1716       
RCSB  RCSB071470   
WWPDB D_1000071470 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ECQ . unspecified 
PDB 4ECR . unspecified 
PDB 4ECS . unspecified 
PDB 4ECT . unspecified 
PDB 4ECU . unspecified 
PDB 4ECV . unspecified 
PDB 4ECW . unspecified 
PDB 4ECX . unspecified 
PDB 4ECY . unspecified 
PDB 4ECZ . unspecified 
PDB 4ED0 . unspecified 
PDB 4ED1 . unspecified 
PDB 4ED2 . unspecified 
PDB 4ED3 . unspecified 
PDB 4ED6 . unspecified 
PDB 4ED7 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ED8 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakamura, T.' 1 
'Zhao, Y.'     2 
'Yang, W.'     3 
# 
_citation.id                        primary 
_citation.title                     'Watching DNA polymerase eta make a phosphodiester bond' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            487 
_citation.page_first                196 
_citation.page_last                 201 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22785315 
_citation.pdbx_database_id_DOI      10.1038/nature11181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nakamura, T.' 1 
primary 'Zhao, Y.'     2 
primary 'Yamagata, Y.' 3 
primary 'Hua, Y.J.'    4 
primary 'Yang, W.'     5 
# 
_cell.entry_id           4ED8 
_cell.length_a           98.786 
_cell.length_b           98.786 
_cell.length_c           82.431 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ED8 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? 
'Catalytic core (UNP RESIDUES 1-432)' ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*G)-3')
;
3662.404  1   ?       ? ?                                     ? 
3 polymer     syn 
;DNA (5'-D(*TP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2730.810  1   ?       ? ?                                     ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    2   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    2   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ?                                     ? 
8 water       nat water                                                18.015    479 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A, Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DG)' CATTATGACGCG T ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' TGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DG  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP POLH_HUMAN Q9Y253 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 ? 
2 PDB 4ED8       4ED8   2 ? ? ? 
3 PDB 4ED8       4ED8   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ED8 A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4ED8 T 1 ? 12  ? 4ED8   1 ? 12  ? 1 12  
3 3 4ED8 P 1 ? 9   ? 4ED8   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ED8 GLY A 1 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -2 1 
1 4ED8 PRO A 2 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' -1 2 
1 4ED8 HIS A 3 ? UNP Q9Y253 ? ? 'EXPRESSION TAG' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4ED8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.72 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 6-17%(W/V) PEG 2K-MME, VAPOR DIFFUSION, temperature 293K, pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-08-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     4ED8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.52 
_reflns.number_obs                   67307 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.061 
_reflns.pdbx_netI_over_sigmaI        16.7 
_reflns.B_iso_Wilson_estimate        15.600 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.52 
_reflns_shell.d_res_low                   1.55 
_reflns_shell.percent_possible_all        71.8 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.631 
_reflns_shell.meanI_over_sigI_obs         1.6 
_reflns_shell.pdbx_redundancy             2.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4ED8 
_refine.ls_number_reflns_obs                     67241 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.517 
_refine.ls_d_res_high                            1.521 
_refine.ls_percent_reflns_obs                    95.97 
_refine.ls_R_factor_obs                          0.1727 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1712 
_refine.ls_R_factor_R_free                       0.2002 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  3397 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               27.4114 
_refine.aniso_B[1][1]                            -1.5906 
_refine.aniso_B[2][2]                            -1.5906 
_refine.aniso_B[3][3]                            3.1811 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.344 
_refine.solvent_model_param_bsol                 41.997 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.17 
_refine.overall_FOM_work_R_set                   0.8748 
_refine.B_iso_max                                146.380 
_refine.B_iso_min                                6.540 
_refine.pdbx_overall_phase_error                 20.1800 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             479 
_refine_hist.number_atoms_total               4298 
_refine_hist.d_res_high                       1.521 
_refine_hist.d_res_low                        28.517 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           3996 0.023  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          5476 1.133  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     613  0.066  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      629  0.005  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1559 17.904 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.5210 1.5427  24 63.0000  1739 . 0.2544 0.2674 . 84  . 1823 . 'X-RAY DIFFRACTION' . 
1.5427 1.5657  24 80.0000  2227 . 0.2390 0.2831 . 118 . 2345 . 'X-RAY DIFFRACTION' . 
1.5657 1.5902  24 93.0000  2572 . 0.2291 0.2552 . 118 . 2690 . 'X-RAY DIFFRACTION' . 
1.5902 1.6162  24 96.0000  2685 . 0.2254 0.2497 . 117 . 2802 . 'X-RAY DIFFRACTION' . 
1.6162 1.6441  24 98.0000  2697 . 0.2057 0.2350 . 154 . 2851 . 'X-RAY DIFFRACTION' . 
1.6441 1.6740  24 98.0000  2694 . 0.2014 0.2194 . 156 . 2850 . 'X-RAY DIFFRACTION' . 
1.6740 1.7062  24 98.0000  2640 . 0.1944 0.2375 . 160 . 2800 . 'X-RAY DIFFRACTION' . 
1.7062 1.7410  24 98.0000  2706 . 0.1883 0.2060 . 141 . 2847 . 'X-RAY DIFFRACTION' . 
1.7410 1.7789  24 98.0000  2716 . 0.1890 0.2398 . 137 . 2853 . 'X-RAY DIFFRACTION' . 
1.7789 1.8202  24 98.0000  2680 . 0.1813 0.2293 . 157 . 2837 . 'X-RAY DIFFRACTION' . 
1.8202 1.8658  24 98.0000  2770 . 0.1806 0.2017 . 139 . 2909 . 'X-RAY DIFFRACTION' . 
1.8658 1.9162  24 98.0000  2709 . 0.1723 0.2096 . 132 . 2841 . 'X-RAY DIFFRACTION' . 
1.9162 1.9726  24 99.0000  2731 . 0.1656 0.2143 . 140 . 2871 . 'X-RAY DIFFRACTION' . 
1.9726 2.0362  24 99.0000  2722 . 0.1617 0.2123 . 152 . 2874 . 'X-RAY DIFFRACTION' . 
2.0362 2.1090  24 98.0000  2754 . 0.1621 0.1947 . 150 . 2904 . 'X-RAY DIFFRACTION' . 
2.1090 2.1934  24 99.0000  2717 . 0.1590 0.1952 . 147 . 2864 . 'X-RAY DIFFRACTION' . 
2.1934 2.2932  24 99.0000  2738 . 0.1552 0.2026 . 167 . 2905 . 'X-RAY DIFFRACTION' . 
2.2932 2.4140  24 99.0000  2738 . 0.1602 0.1847 . 140 . 2878 . 'X-RAY DIFFRACTION' . 
2.4140 2.5652  24 99.0000  2765 . 0.1724 0.1920 . 137 . 2902 . 'X-RAY DIFFRACTION' . 
2.5652 2.7631  24 99.0000  2748 . 0.1707 0.1947 . 145 . 2893 . 'X-RAY DIFFRACTION' . 
2.7631 3.0408  24 100.0000 2790 . 0.1777 0.2150 . 140 . 2930 . 'X-RAY DIFFRACTION' . 
3.0408 3.4802  24 100.0000 2776 . 0.1585 0.1865 . 144 . 2920 . 'X-RAY DIFFRACTION' . 
3.4802 4.3821  24 100.0000 2753 . 0.1415 0.1732 . 181 . 2934 . 'X-RAY DIFFRACTION' . 
4.3821 28.5221 24 97.0000  2777 . 0.1643 0.1795 . 141 . 2918 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  4ED8 
_struct.title                     
'Human DNA polymerase eta - DNA ternary complex: Reaction in the TG crystal at pH 7.0, Normal translocation' 
_struct.pdbx_descriptor           'DNA polymerase eta (E.C.2.7.7.7)/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ED8 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  2  PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  3  SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  4  TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  5  LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  6  LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  7  SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  8  GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  9  SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 10 ASN A 222 ? ASN A 233 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P11 11 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 12 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 13 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 14 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 15 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 16 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 17 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 18 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 19 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 20 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 21 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MG  . MG ? ? A GLU 116 A MG  502 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc2  metalc ? ? A ASP 16  OD1   B ? ? 1_555 F MG  . MG B ? A ASP 13  A MG  504 1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc3  metalc ? ? A ASP 16  OD2   A ? ? 1_555 D MG  . MG ? ? A ASP 13  A MG  502 1_555 ? ? ? ? ? ? ?            2.206 ? 
metalc4  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA A ? A ASP 115 A CA  503 1_555 ? ? ? ? ? ? ?            2.244 ? 
metalc5  metalc ? ? I DTP .   O3G   ? ? ? 1_555 F MG  . MG B ? P DTP 501 A MG  504 1_555 ? ? ? ? ? ? ?            2.257 ? 
metalc6  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F MG  . MG B ? A ASP 115 A MG  504 1_555 ? ? ? ? ? ? ?            2.263 ? 
metalc7  metalc ? ? I DTP .   O3G   ? ? ? 1_555 E CA  . CA A ? P DTP 501 A CA  503 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc8  metalc ? ? I DTP .   O1B   ? ? ? 1_555 E CA  . CA A ? P DTP 501 A CA  503 1_555 ? ? ? ? ? ? ?            2.283 ? 
metalc9  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA A ? A MET 14  A CA  503 1_555 ? ? ? ? ? ? ?            2.292 ? 
metalc10 metalc ? ? I DTP .   O2A   ? ? ? 1_555 D MG  . MG ? ? P DTP 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc11 metalc ? ? A MET 17  O     ? ? ? 1_555 F MG  . MG B ? A MET 14  A MG  504 1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc12 metalc ? ? I DTP .   O1B   ? ? ? 1_555 F MG  . MG B ? P DTP 501 A MG  504 1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc13 metalc ? ? C DA  9   "O3'" ? ? ? 1_555 D MG  . MG ? ? P DA  9   A MG  502 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc14 metalc ? ? I DTP .   O2A   ? ? ? 1_555 F MG  . MG B ? P DTP 501 A MG  504 1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc15 metalc ? ? I DTP .   O2A   ? ? ? 1_555 E CA  . CA A ? P DTP 501 A CA  503 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc16 metalc ? ? A ASP 16  OD1   A ? ? 1_555 E CA  . CA A ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.387 ? 
metalc17 metalc ? ? A ASP 118 OD2   ? ? ? 1_555 D MG  . MG ? ? A ASP 115 A MG  502 1_555 ? ? ? ? ? ? ?            2.433 ? 
metalc18 metalc ? ? A ASP 16  OD2   A ? ? 1_555 E CA  . CA A ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            3.016 ? 
metalc19 metalc ? ? D MG  .   MG    ? ? ? 1_555 J HOH . O  ? ? A MG  502 A HOH 601 1_555 ? ? ? ? ? ? ?            2.167 ? 
hydrog1  hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  9 N1 ? ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  9 N6 ? ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3 ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4 ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 1.15  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -1.65 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -6.79 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
A 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
A 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
A 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
A 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
A 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
B 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
B 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
B 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
C 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
C 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
D 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
D 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
D 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
E 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
E 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
E 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
E 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
A 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
A 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
A 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
A 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
B 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
B 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
C 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
D 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
D 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
E 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
E 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
E 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE DTP P 501' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG A 502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 503'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 504'  
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 505' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 26 ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 26 MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 26 ASP A 18  ? ASP A 15  . ? 1_555 ? 
4  AC1 26 CYS A 19  ? CYS A 16  . ? 1_555 ? 
5  AC1 26 PHE A 20  ? PHE A 17  . ? 1_555 ? 
6  AC1 26 PHE A 21  ? PHE A 18  . ? 1_555 ? 
7  AC1 26 ILE A 51  ? ILE A 48  . ? 1_555 ? 
8  AC1 26 ALA A 52  ? ALA A 49  . ? 1_555 ? 
9  AC1 26 TYR A 55  ? TYR A 52  . ? 1_555 ? 
10 AC1 26 ARG A 58  ? ARG A 55  . ? 1_555 ? 
11 AC1 26 ARG A 64  ? ARG A 61  . ? 1_555 ? 
12 AC1 26 ASP A 118 ? ASP A 115 . ? 1_555 ? 
13 AC1 26 LYS A 234 ? LYS A 231 . ? 1_555 ? 
14 AC1 26 MG  D .   ? MG  A 502 . ? 1_555 ? 
15 AC1 26 CA  E .   ? CA  A 503 . ? 1_555 ? 
16 AC1 26 MG  F .   ? MG  A 504 . ? 1_555 ? 
17 AC1 26 HOH J .   ? HOH A 601 . ? 1_555 ? 
18 AC1 26 HOH J .   ? HOH A 612 . ? 1_555 ? 
19 AC1 26 HOH J .   ? HOH A 641 . ? 1_555 ? 
20 AC1 26 HOH J .   ? HOH A 646 . ? 1_555 ? 
21 AC1 26 HOH J .   ? HOH A 726 . ? 1_555 ? 
22 AC1 26 HOH J .   ? HOH A 905 . ? 1_555 ? 
23 AC1 26 DA  C 9   ? DA  P 9   . ? 1_555 ? 
24 AC1 26 DA  B 2   ? DA  T 2   . ? 1_555 ? 
25 AC1 26 DT  B 3   ? DT  T 3   . ? 1_555 ? 
26 AC1 26 DT  B 4   ? DT  T 4   . ? 1_555 ? 
27 AC2 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
28 AC2 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
29 AC2 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
30 AC2 8  CA  E .   ? CA  A 503 . ? 1_555 ? 
31 AC2 8  MG  F .   ? MG  A 504 . ? 1_555 ? 
32 AC2 8  HOH J .   ? HOH A 601 . ? 1_555 ? 
33 AC2 8  DA  C 9   ? DA  P 9   . ? 1_555 ? 
34 AC2 8  DTP I .   ? DTP P 501 . ? 1_555 ? 
35 AC3 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
36 AC3 5  MET A 17  ? MET A 14  . ? 1_555 ? 
37 AC3 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
38 AC3 5  MG  D .   ? MG  A 502 . ? 1_555 ? 
39 AC3 5  DTP I .   ? DTP P 501 . ? 1_555 ? 
40 AC4 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
41 AC4 5  MET A 17  ? MET A 14  . ? 1_555 ? 
42 AC4 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
43 AC4 5  MG  D .   ? MG  A 502 . ? 1_555 ? 
44 AC4 5  DTP I .   ? DTP P 501 . ? 1_555 ? 
45 AC5 9  ARG A 27  ? ARG A 24  . ? 6_545 ? 
46 AC5 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
47 AC5 9  SER A 251 ? SER A 248 . ? 1_555 ? 
48 AC5 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
49 AC5 9  GLU A 280 ? GLU A 277 . ? 1_555 ? 
50 AC5 9  HOH J .   ? HOH A 606 . ? 1_555 ? 
51 AC5 9  HOH J .   ? HOH A 636 . ? 1_555 ? 
52 AC5 9  HOH J .   ? HOH A 705 . ? 1_555 ? 
53 AC5 9  HOH J .   ? HOH A 899 . ? 1_555 ? 
54 AC6 9  ASN A 29  ? ASN A 26  . ? 1_555 ? 
55 AC6 9  PRO A 30  ? PRO A 27  . ? 1_555 ? 
56 AC6 9  HIS A 31  ? HIS A 28  . ? 1_555 ? 
57 AC6 9  GLY A 274 ? GLY A 271 . ? 5_664 ? 
58 AC6 9  GLU A 276 ? GLU A 273 . ? 5_664 ? 
59 AC6 9  TYR A 277 ? TYR A 274 . ? 5_664 ? 
60 AC6 9  GLU A 280 ? GLU A 277 . ? 5_664 ? 
61 AC6 9  HOH J .   ? HOH A 742 . ? 5_664 ? 
62 AC6 9  HOH J .   ? HOH A 868 . ? 5_664 ? 
# 
_database_PDB_matrix.entry_id          4ED8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ED8 
_atom_sites.fract_transf_matrix[1][1]   0.010123 
_atom_sites.fract_transf_matrix[1][2]   0.005844 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011689 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012131 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 66.114 -33.925 -3.308  1.00 60.58  ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.487 -33.948 -3.777  1.00 57.57  ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.741 -32.990 -4.928  1.00 51.41  ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.432 -31.799 -4.831  1.00 44.56  ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 68.309 -33.508 -6.028  1.00 50.22  ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.658 -32.722 -7.220  1.00 50.16  ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.442 -32.236 -8.011  1.00 50.47  ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.591 -31.409 -8.913  1.00 55.06  ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.473 -33.711 -8.062  1.00 52.70  ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 69.000 -35.057 -7.628  1.00 53.14  ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.707 -34.921 -6.162  1.00 50.42  ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 66.259 -32.738 -7.672  1.00 42.04  ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 65.047 -32.393 -8.410  1.00 42.59  ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 64.083 -31.549 -7.584  1.00 45.51  ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 63.020 -31.155 -8.065  1.00 43.84  ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.349 -33.662 -8.899  1.00 38.83  ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.264 -34.605 -9.610  1.00 36.94  ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.897 -34.276 -10.789 1.00 38.99  ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.664 -35.862 -9.304  1.00 32.60  ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.646 -35.290 -11.181 1.00 37.68  ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.522 -36.265 -10.299 1.00 38.54  ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.461 -31.278 -6.339  1.00 48.97  ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.631 -30.479 -5.447  1.00 48.73  ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.856 -28.995 -5.704  1.00 44.01  ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.940 -28.472 -5.446  1.00 39.17  ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.949 -30.804 -3.986  1.00 54.08  ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 62.939 -30.247 -2.995  1.00 56.59  ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 61.327 -31.038 -3.167  1.00 131.49 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 61.774 -32.753 -2.906  1.00 47.40  ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.830 -28.326 -6.223  1.00 45.91  ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.897 -26.892 -6.474  1.00 43.66  ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 63.028 -26.146 -5.152  1.00 39.98  ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.425 -26.531 -4.147  1.00 41.27  ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.670 -26.427 -7.238  1.00 42.50  ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.831 -25.086 -5.152  1.00 28.43  ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 64.105 -24.331 -3.937  1.00 25.39  ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.614 -22.891 -4.052  1.00 23.44  ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.818 -22.086 -3.144  1.00 26.76  ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.610 -24.318 -3.617  1.00 29.70  ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.327 -23.747 -4.718  1.00 26.74  ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 66.116 -25.740 -3.371  1.00 31.28  ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.977 -22.569 -5.174  1.00 26.12  ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.420 -21.243 -5.376  1.00 25.38  ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.464 -20.152 -5.235  1.00 23.54  ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 63.234 -19.142 -4.556  1.00 22.14  ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.616 -20.355 -5.873  1.00 20.30  ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.703 -19.377 -5.803  1.00 16.45  ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 66.021 -18.800 -7.181  1.00 20.15  ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 67.117 -18.295 -7.411  1.00 22.74  ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.954 -20.022 -5.205  1.00 21.49  ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.848 -20.362 -3.718  1.00 18.24  ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 68.071 -21.127 -3.228  1.00 17.74  ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 68.283 -22.273 -3.607  1.00 23.57  ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.893 -20.481 -2.411  1.00 20.25  ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 65.040 -18.863 -8.077  1.00 21.11  ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 65.215 -18.516 -9.482  1.00 22.65  ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 65.168 -17.016 -9.782  1.00 20.09  ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 65.667 -16.577 -10.813 1.00 24.76  ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 64.155 -19.240 -10.329 1.00 27.04  ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 62.732 -19.071 -9.776  1.00 37.92  ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 62.483 -19.427 -8.601  1.00 35.77  ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 61.854 -18.579 -10.521 1.00 42.94  ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 64.552 -16.244 -8.896  1.00 15.73  ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 64.352 -14.815 -9.125  1.00 15.10  ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 64.984 -13.985 -8.026  1.00 16.54  ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 65.219 -14.481 -6.929  1.00 14.21  ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 62.857 -14.478 -9.144  1.00 14.75  ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 62.056 -15.140 -10.256 1.00 16.68  ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 60.593 -14.714 -10.151 1.00 17.67  ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 59.933 -15.344 -9.008  1.00 15.90  ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 58.859 -14.860 -8.387  1.00 14.10  ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 58.333 -15.535 -7.375  1.00 14.71  ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 58.282 -13.728 -8.776  1.00 14.41  ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 65.237 -12.711 -8.319  1.00 12.70  ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 65.515 -11.742 -7.256  1.00 10.64  ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 64.378 -10.726 -7.275  1.00 13.45  ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 64.144 -10.082 -8.295  1.00 15.10  ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 66.865 -11.021 -7.444  1.00 11.79  ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 67.108 -10.053 -6.290  1.00 13.06  ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 68.004 -12.028 -7.547  1.00 13.66  ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 63.668 -10.590 -6.155  1.00 10.92  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 62.494 -9.721  -6.057  1.00 10.97  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 62.684 -8.781  -4.890  1.00 9.76   ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 63.126 -9.201  -3.816  1.00 11.31  ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 61.187 -10.536 -5.851  1.00 9.81   ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 59.986 -9.612  -5.609  1.00 12.94  ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 60.936 -11.447 -7.048  1.00 10.58  ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 62.379 -7.507  -5.089  1.00 9.70   ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 62.419 -6.545  -3.994  1.00 10.19  ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 61.060 -5.940  -3.781  1.00 12.06  ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 60.247 -5.852  -4.711  1.00 12.66  ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 63.449 -5.437  -4.268  1.00 12.00  ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 60.807 -5.520  -2.549  1.00 10.15  ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 59.628 -4.728  -2.237  1.00 9.64   ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 60.120 -3.437  -1.596  1.00 12.47  ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 60.815 -3.471  -0.577  1.00 12.38  ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 58.697 -5.500  -1.304  1.00 12.54  ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 57.364 -4.895  -0.860  1.00 15.36  ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 57.552 -3.946  0.320   1.00 14.85  ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 56.641 -4.196  -2.032  1.00 12.76  ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 59.787 -2.300  -2.207  1.00 9.97   ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 60.164 -1.003  -1.660  1.00 11.66  ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 58.905 -0.363  -1.071  1.00 12.86  ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 57.859 -0.318  -1.723  1.00 12.05  ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 60.712 -0.096  -2.756  1.00 9.94   ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 61.049 1.281   -2.190  1.00 15.27  ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 61.942 -0.738  -3.386  1.00 16.49  ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 58.991 0.101   0.173   1.00 11.81  ? 13   ASP A N     1 
ATOM   109  C  CA    A ASP A 1 16  ? 57.850 0.681   0.861   0.50 12.87  ? 13   ASP A CA    1 
ATOM   110  C  CA    B ASP A 1 16  ? 57.837 0.635   0.907   0.50 13.02  ? 13   ASP A CA    1 
ATOM   111  C  C     . ASP A 1 16  ? 58.227 1.992   1.519   1.00 11.33  ? 13   ASP A C     1 
ATOM   112  O  O     . ASP A 1 16  ? 59.118 2.047   2.364   1.00 14.03  ? 13   ASP A O     1 
ATOM   113  C  CB    A ASP A 1 16  ? 57.342 -0.291  1.914   0.50 12.51  ? 13   ASP A CB    1 
ATOM   114  C  CB    B ASP A 1 16  ? 57.518 -0.382  2.014   0.50 14.54  ? 13   ASP A CB    1 
ATOM   115  C  CG    A ASP A 1 16  ? 56.241 0.291   2.738   0.50 15.23  ? 13   ASP A CG    1 
ATOM   116  C  CG    B ASP A 1 16  ? 56.275 -0.051  2.799   0.50 15.97  ? 13   ASP A CG    1 
ATOM   117  O  OD1   A ASP A 1 16  ? 56.536 0.995   3.718   0.50 19.06  ? 13   ASP A OD1   1 
ATOM   118  O  OD1   B ASP A 1 16  ? 55.915 1.129   2.869   0.50 12.18  ? 13   ASP A OD1   1 
ATOM   119  O  OD2   A ASP A 1 16  ? 55.078 0.070   2.383   0.50 20.93  ? 13   ASP A OD2   1 
ATOM   120  O  OD2   B ASP A 1 16  ? 55.674 -0.984  3.375   0.50 19.66  ? 13   ASP A OD2   1 
ATOM   121  N  N     . MET A 1 17  ? 57.565 3.080   1.134   1.00 9.81   ? 14   MET A N     1 
ATOM   122  C  CA    . MET A 1 17  ? 57.949 4.375   1.694   1.00 10.37  ? 14   MET A CA    1 
ATOM   123  C  C     . MET A 1 17  ? 57.684 4.447   3.194   1.00 11.34  ? 14   MET A C     1 
ATOM   124  O  O     . MET A 1 17  ? 56.739 3.866   3.677   1.00 13.00  ? 14   MET A O     1 
ATOM   125  C  CB    . MET A 1 17  ? 57.183 5.512   1.015   1.00 15.84  ? 14   MET A CB    1 
ATOM   126  C  CG    . MET A 1 17  ? 57.208 5.489   -0.510  1.00 13.30  ? 14   MET A CG    1 
ATOM   127  S  SD    . MET A 1 17  ? 58.881 5.524   -1.180  1.00 16.05  ? 14   MET A SD    1 
ATOM   128  C  CE    . MET A 1 17  ? 59.449 7.098   -0.603  1.00 23.84  ? 14   MET A CE    1 
ATOM   129  N  N     . ASP A 1 18  ? 58.547 5.128   3.930   1.00 9.46   ? 15   ASP A N     1 
ATOM   130  C  CA    . ASP A 1 18  ? 58.353 5.270   5.378   1.00 11.34  ? 15   ASP A CA    1 
ATOM   131  C  C     . ASP A 1 18  ? 57.288 6.312   5.653   1.00 9.40   ? 15   ASP A C     1 
ATOM   132  O  O     . ASP A 1 18  ? 57.263 7.378   5.008   1.00 10.62  ? 15   ASP A O     1 
ATOM   133  C  CB    . ASP A 1 18  ? 59.657 5.644   6.066   1.00 9.19   ? 15   ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 18  ? 60.754 4.590   5.883   1.00 12.52  ? 15   ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 18  ? 60.451 3.382   5.760   1.00 15.87  ? 15   ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 18  ? 61.923 4.996   5.902   1.00 17.23  ? 15   ASP A OD2   1 
ATOM   137  N  N     . CYS A 1 19  ? 56.392 5.981   6.581   1.00 9.94   ? 16   CYS A N     1 
ATOM   138  C  CA    . CYS A 1 19  ? 55.286 6.865   6.965   1.00 9.79   ? 16   CYS A CA    1 
ATOM   139  C  C     . CYS A 1 19  ? 54.896 7.863   5.871   1.00 9.67   ? 16   CYS A C     1 
ATOM   140  O  O     . CYS A 1 19  ? 55.055 9.092   6.022   1.00 10.86  ? 16   CYS A O     1 
ATOM   141  C  CB    . CYS A 1 19  ? 55.609 7.635   8.265   1.00 12.28  ? 16   CYS A CB    1 
ATOM   142  S  SG    . CYS A 1 19  ? 57.206 8.545   8.371   1.00 15.39  ? 16   CYS A SG    1 
ATOM   143  N  N     . PHE A 1 20  ? 54.370 7.339   4.771   1.00 9.51   ? 17   PHE A N     1 
ATOM   144  C  CA    . PHE A 1 20  ? 54.408 8.079   3.515   1.00 8.69   ? 17   PHE A CA    1 
ATOM   145  C  C     . PHE A 1 20  ? 53.691 9.428   3.548   1.00 9.66   ? 17   PHE A C     1 
ATOM   146  O  O     . PHE A 1 20  ? 54.274 10.438  3.150   1.00 10.47  ? 17   PHE A O     1 
ATOM   147  C  CB    . PHE A 1 20  ? 53.866 7.199   2.383   1.00 11.28  ? 17   PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 20  ? 53.924 7.843   1.028   1.00 9.98   ? 17   PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 20  ? 55.108 8.395   0.543   1.00 11.51  ? 17   PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 20  ? 52.788 7.885   0.226   1.00 13.36  ? 17   PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 20  ? 55.145 8.981   -0.724  1.00 13.91  ? 17   PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 20  ? 52.835 8.457   -1.039  1.00 13.41  ? 17   PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 20  ? 54.010 8.995   -1.513  1.00 13.48  ? 17   PHE A CZ    1 
ATOM   154  N  N     . PHE A 1 21  ? 52.445 9.464   4.011   1.00 8.96   ? 18   PHE A N     1 
ATOM   155  C  CA    . PHE A 1 21  ? 51.705 10.727  3.919   1.00 9.07   ? 18   PHE A CA    1 
ATOM   156  C  C     . PHE A 1 21  ? 52.383 11.772  4.816   1.00 9.01   ? 18   PHE A C     1 
ATOM   157  O  O     . PHE A 1 21  ? 52.362 12.960  4.513   1.00 9.66   ? 18   PHE A O     1 
ATOM   158  C  CB    . PHE A 1 21  ? 50.228 10.578  4.318   1.00 10.91  ? 18   PHE A CB    1 
ATOM   159  C  CG    . PHE A 1 21  ? 49.364 9.849   3.315   1.00 11.36  ? 18   PHE A CG    1 
ATOM   160  C  CD1   . PHE A 1 21  ? 49.905 9.099   2.283   1.00 11.79  ? 18   PHE A CD1   1 
ATOM   161  C  CD2   . PHE A 1 21  ? 47.990 9.936   3.417   1.00 11.11  ? 18   PHE A CD2   1 
ATOM   162  C  CE1   . PHE A 1 21  ? 49.072 8.427   1.376   1.00 13.19  ? 18   PHE A CE1   1 
ATOM   163  C  CE2   . PHE A 1 21  ? 47.145 9.266   2.509   1.00 11.24  ? 18   PHE A CE2   1 
ATOM   164  C  CZ    . PHE A 1 21  ? 47.687 8.515   1.497   1.00 11.01  ? 18   PHE A CZ    1 
ATOM   165  N  N     . VAL A 1 22  ? 52.964 11.325  5.932   1.00 9.27   ? 19   VAL A N     1 
ATOM   166  C  CA    . VAL A 1 22  ? 53.712 12.236  6.809   1.00 8.36   ? 19   VAL A CA    1 
ATOM   167  C  C     . VAL A 1 22  ? 54.918 12.838  6.084   1.00 9.83   ? 19   VAL A C     1 
ATOM   168  O  O     . VAL A 1 22  ? 55.144 14.052  6.136   1.00 9.87   ? 19   VAL A O     1 
ATOM   169  C  CB    . VAL A 1 22  ? 54.156 11.524  8.087   1.00 8.08   ? 19   VAL A CB    1 
ATOM   170  C  CG1   . VAL A 1 22  ? 55.252 12.323  8.817   1.00 12.13  ? 19   VAL A CG1   1 
ATOM   171  C  CG2   . VAL A 1 22  ? 52.952 11.280  8.982   1.00 11.90  ? 19   VAL A CG2   1 
ATOM   172  N  N     . GLN A 1 23  ? 55.684 12.011  5.380   1.00 8.50   ? 20   GLN A N     1 
ATOM   173  C  CA    . GLN A 1 23  ? 56.826 12.568  4.659   1.00 6.54   ? 20   GLN A CA    1 
ATOM   174  C  C     . GLN A 1 23  ? 56.398 13.557  3.589   1.00 8.88   ? 20   GLN A C     1 
ATOM   175  O  O     . GLN A 1 23  ? 57.093 14.542  3.345   1.00 11.12  ? 20   GLN A O     1 
ATOM   176  C  CB    . GLN A 1 23  ? 57.653 11.478  3.993   1.00 9.03   ? 20   GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 23  ? 58.459 10.607  4.929   1.00 13.05  ? 20   GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 23  ? 59.573 9.912   4.156   1.00 13.35  ? 20   GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 23  ? 60.640 10.487  3.939   1.00 16.27  ? 20   GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 23  ? 59.316 8.683   3.704   1.00 16.03  ? 20   GLN A NE2   1 
ATOM   181  N  N     . VAL A 1 24  ? 55.275 13.291  2.920   1.00 7.96   ? 21   VAL A N     1 
ATOM   182  C  CA    . VAL A 1 24  ? 54.795 14.238  1.913   1.00 7.42   ? 21   VAL A CA    1 
ATOM   183  C  C     . VAL A 1 24  ? 54.523 15.599  2.568   1.00 9.39   ? 21   VAL A C     1 
ATOM   184  O  O     . VAL A 1 24  ? 54.891 16.652  2.021   1.00 9.76   ? 21   VAL A O     1 
ATOM   185  C  CB    . VAL A 1 24  ? 53.525 13.711  1.182   1.00 7.68   ? 21   VAL A CB    1 
ATOM   186  C  CG1   . VAL A 1 24  ? 52.962 14.765  0.233   1.00 10.17  ? 21   VAL A CG1   1 
ATOM   187  C  CG2   . VAL A 1 24  ? 53.835 12.410  0.410   1.00 8.88   ? 21   VAL A CG2   1 
ATOM   188  N  N     . GLU A 1 25  ? 53.886 15.574  3.739   1.00 9.06   ? 22   GLU A N     1 
ATOM   189  C  CA    . GLU A 1 25  ? 53.567 16.819  4.436   1.00 10.31  ? 22   GLU A CA    1 
ATOM   190  C  C     . GLU A 1 25  ? 54.821 17.476  5.022   1.00 9.92   ? 22   GLU A C     1 
ATOM   191  O  O     . GLU A 1 25  ? 54.916 18.709  5.063   1.00 10.37  ? 22   GLU A O     1 
ATOM   192  C  CB    . GLU A 1 25  ? 52.504 16.579  5.525   1.00 9.23   ? 22   GLU A CB    1 
ATOM   193  C  CG    . GLU A 1 25  ? 51.160 16.082  4.993   1.00 9.99   ? 22   GLU A CG    1 
ATOM   194  C  CD    . GLU A 1 25  ? 50.442 17.107  4.133   1.00 13.21  ? 22   GLU A CD    1 
ATOM   195  O  OE1   . GLU A 1 25  ? 50.709 18.317  4.301   1.00 16.46  ? 22   GLU A OE1   1 
ATOM   196  O  OE2   . GLU A 1 25  ? 49.615 16.717  3.265   1.00 15.88  ? 22   GLU A OE2   1 
ATOM   197  N  N     . GLN A 1 26  ? 55.797 16.671  5.446   1.00 10.35  ? 23   GLN A N     1 
ATOM   198  C  CA    . GLN A 1 26  ? 57.044 17.222  5.995   1.00 9.29   ? 23   GLN A CA    1 
ATOM   199  C  C     . GLN A 1 26  ? 57.921 17.854  4.923   1.00 11.35  ? 23   GLN A C     1 
ATOM   200  O  O     . GLN A 1 26  ? 58.619 18.839  5.189   1.00 11.18  ? 23   GLN A O     1 
ATOM   201  C  CB    . GLN A 1 26  ? 57.841 16.149  6.735   1.00 8.69   ? 23   GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 26  ? 57.212 15.684  8.036   1.00 9.50   ? 23   GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 26  ? 57.952 14.516  8.634   1.00 12.47  ? 23   GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 26  ? 58.401 13.626  7.908   1.00 12.69  ? 23   GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 26  ? 58.099 14.510  9.960   1.00 13.87  ? 23   GLN A NE2   1 
ATOM   206  N  N     . ARG A 1 27  ? 57.889 17.307  3.709   1.00 9.32   ? 24   ARG A N     1 
ATOM   207  C  CA    . ARG A 1 27  ? 58.626 17.937  2.609   1.00 8.69   ? 24   ARG A CA    1 
ATOM   208  C  C     . ARG A 1 27  ? 58.066 19.339  2.368   1.00 14.88  ? 24   ARG A C     1 
ATOM   209  O  O     . ARG A 1 27  ? 58.814 20.314  2.237   1.00 11.91  ? 24   ARG A O     1 
ATOM   210  C  CB    . ARG A 1 27  ? 58.532 17.109  1.318   1.00 9.99   ? 24   ARG A CB    1 
ATOM   211  C  CG    . ARG A 1 27  ? 59.326 17.729  0.155   1.00 10.83  ? 24   ARG A CG    1 
ATOM   212  C  CD    . ARG A 1 27  ? 59.355 16.796  -1.042  1.00 12.75  ? 24   ARG A CD    1 
ATOM   213  N  NE    . ARG A 1 27  ? 58.053 16.700  -1.694  1.00 11.31  ? 24   ARG A NE    1 
ATOM   214  C  CZ    . ARG A 1 27  ? 57.863 16.104  -2.863  1.00 11.92  ? 24   ARG A CZ    1 
ATOM   215  N  NH1   . ARG A 1 27  ? 58.887 15.519  -3.488  1.00 10.99  ? 24   ARG A NH1   1 
ATOM   216  N  NH2   . ARG A 1 27  ? 56.651 16.082  -3.409  1.00 13.46  ? 24   ARG A NH2   1 
ATOM   217  N  N     . GLN A 1 28  ? 56.739 19.430  2.340   1.00 9.57   ? 25   GLN A N     1 
ATOM   218  C  CA    . GLN A 1 28  ? 56.050 20.680  2.032   1.00 10.03  ? 25   GLN A CA    1 
ATOM   219  C  C     . GLN A 1 28  ? 56.191 21.715  3.151   1.00 11.09  ? 25   GLN A C     1 
ATOM   220  O  O     . GLN A 1 28  ? 56.308 22.910  2.884   1.00 11.64  ? 25   GLN A O     1 
ATOM   221  C  CB    . GLN A 1 28  ? 54.563 20.416  1.744   1.00 10.99  ? 25   GLN A CB    1 
ATOM   222  C  CG    . GLN A 1 28  ? 53.806 21.654  1.276   1.00 12.64  ? 25   GLN A CG    1 
ATOM   223  C  CD    . GLN A 1 28  ? 52.316 21.383  1.100   1.00 17.58  ? 25   GLN A CD    1 
ATOM   224  O  OE1   . GLN A 1 28  ? 51.920 20.272  0.786   1.00 17.11  ? 25   GLN A OE1   1 
ATOM   225  N  NE2   . GLN A 1 28  ? 51.492 22.406  1.296   1.00 23.98  ? 25   GLN A NE2   1 
ATOM   226  N  N     . ASN A 1 29  ? 56.156 21.243  4.390   1.00 9.86   ? 26   ASN A N     1 
ATOM   227  C  CA    . ASN A 1 29  ? 56.222 22.116  5.559   1.00 12.25  ? 26   ASN A CA    1 
ATOM   228  C  C     . ASN A 1 29  ? 57.378 21.748  6.469   1.00 10.92  ? 26   ASN A C     1 
ATOM   229  O  O     . ASN A 1 29  ? 57.263 20.877  7.314   1.00 10.70  ? 26   ASN A O     1 
ATOM   230  C  CB    . ASN A 1 29  ? 54.899 22.078  6.338   1.00 12.16  ? 26   ASN A CB    1 
ATOM   231  C  CG    . ASN A 1 29  ? 54.891 23.027  7.538   1.00 15.13  ? 26   ASN A CG    1 
ATOM   232  O  OD1   . ASN A 1 29  ? 55.881 23.702  7.830   1.00 16.20  ? 26   ASN A OD1   1 
ATOM   233  N  ND2   . ASN A 1 29  ? 53.755 23.085  8.237   1.00 20.08  ? 26   ASN A ND2   1 
ATOM   234  N  N     . PRO A 1 30  ? 58.518 22.412  6.290   1.00 10.22  ? 27   PRO A N     1 
ATOM   235  C  CA    . PRO A 1 30  ? 59.718 22.080  7.061   1.00 14.46  ? 27   PRO A CA    1 
ATOM   236  C  C     . PRO A 1 30  ? 59.533 22.144  8.581   1.00 14.33  ? 27   PRO A C     1 
ATOM   237  O  O     . PRO A 1 30  ? 60.274 21.476  9.305   1.00 16.05  ? 27   PRO A O     1 
ATOM   238  C  CB    . PRO A 1 30  ? 60.723 23.144  6.599   1.00 13.70  ? 27   PRO A CB    1 
ATOM   239  C  CG    . PRO A 1 30  ? 60.283 23.478  5.212   1.00 16.07  ? 27   PRO A CG    1 
ATOM   240  C  CD    . PRO A 1 30  ? 58.776 23.418  5.246   1.00 12.83  ? 27   PRO A CD    1 
ATOM   241  N  N     . HIS A 1 31  ? 58.553 22.906  9.059   1.00 13.99  ? 28   HIS A N     1 
ATOM   242  C  CA    . HIS A 1 31  ? 58.287 22.965  10.496  1.00 18.38  ? 28   HIS A CA    1 
ATOM   243  C  C     . HIS A 1 31  ? 57.907 21.607  11.077  1.00 18.04  ? 28   HIS A C     1 
ATOM   244  O  O     . HIS A 1 31  ? 58.011 21.408  12.297  1.00 17.13  ? 28   HIS A O     1 
ATOM   245  C  CB    . HIS A 1 31  ? 57.174 23.966  10.801  1.00 20.67  ? 28   HIS A CB    1 
ATOM   246  C  CG    . HIS A 1 31  ? 57.627 25.390  10.801  1.00 26.30  ? 28   HIS A CG    1 
ATOM   247  N  ND1   . HIS A 1 31  ? 56.914 26.398  10.187  1.00 35.53  ? 28   HIS A ND1   1 
ATOM   248  C  CD2   . HIS A 1 31  ? 58.714 25.979  11.354  1.00 26.85  ? 28   HIS A CD2   1 
ATOM   249  C  CE1   . HIS A 1 31  ? 57.548 27.545  10.354  1.00 35.32  ? 28   HIS A CE1   1 
ATOM   250  N  NE2   . HIS A 1 31  ? 58.644 27.318  11.057  1.00 34.42  ? 28   HIS A NE2   1 
ATOM   251  N  N     . LEU A 1 32  ? 57.466 20.680  10.219  1.00 15.15  ? 29   LEU A N     1 
ATOM   252  C  CA    . LEU A 1 32  ? 57.023 19.351  10.678  1.00 11.66  ? 29   LEU A CA    1 
ATOM   253  C  C     . LEU A 1 32  ? 58.167 18.341  10.682  1.00 13.40  ? 29   LEU A C     1 
ATOM   254  O  O     . LEU A 1 32  ? 58.025 17.234  11.198  1.00 12.54  ? 29   LEU A O     1 
ATOM   255  C  CB    . LEU A 1 32  ? 55.907 18.799  9.781   1.00 11.01  ? 29   LEU A CB    1 
ATOM   256  C  CG    . LEU A 1 32  ? 54.634 19.640  9.749   1.00 14.71  ? 29   LEU A CG    1 
ATOM   257  C  CD1   . LEU A 1 32  ? 53.610 18.997  8.828   1.00 14.67  ? 29   LEU A CD1   1 
ATOM   258  C  CD2   . LEU A 1 32  ? 54.074 19.786  11.161  1.00 19.23  ? 29   LEU A CD2   1 
ATOM   259  N  N     . ARG A 1 33  ? 59.300 18.696  10.085  1.00 13.10  ? 30   ARG A N     1 
ATOM   260  C  CA    . ARG A 1 33  ? 60.385 17.728  9.956   1.00 13.73  ? 30   ARG A CA    1 
ATOM   261  C  C     . ARG A 1 33  ? 60.987 17.364  11.305  1.00 15.83  ? 30   ARG A C     1 
ATOM   262  O  O     . ARG A 1 33  ? 61.180 18.229  12.163  1.00 15.57  ? 30   ARG A O     1 
ATOM   263  C  CB    . ARG A 1 33  ? 61.471 18.272  9.017   1.00 12.78  ? 30   ARG A CB    1 
ATOM   264  C  CG    . ARG A 1 33  ? 60.938 18.514  7.604   1.00 13.53  ? 30   ARG A CG    1 
ATOM   265  C  CD    . ARG A 1 33  ? 61.965 19.161  6.694   1.00 13.00  ? 30   ARG A CD    1 
ATOM   266  N  NE    . ARG A 1 33  ? 61.407 19.453  5.372   1.00 13.73  ? 30   ARG A NE    1 
ATOM   267  C  CZ    . ARG A 1 33  ? 62.129 19.932  4.365   1.00 18.08  ? 30   ARG A CZ    1 
ATOM   268  N  NH1   . ARG A 1 33  ? 63.420 20.176  4.544   1.00 20.90  ? 30   ARG A NH1   1 
ATOM   269  N  NH2   . ARG A 1 33  ? 61.562 20.189  3.191   1.00 14.18  ? 30   ARG A NH2   1 
ATOM   270  N  N     . ASN A 1 34  ? 61.267 16.078  11.487  1.00 14.66  ? 31   ASN A N     1 
ATOM   271  C  CA    . ASN A 1 34  ? 61.955 15.615  12.690  1.00 16.04  ? 31   ASN A CA    1 
ATOM   272  C  C     . ASN A 1 34  ? 61.157 15.928  13.943  1.00 20.55  ? 31   ASN A C     1 
ATOM   273  O  O     . ASN A 1 34  ? 61.711 16.279  14.990  1.00 24.59  ? 31   ASN A O     1 
ATOM   274  C  CB    . ASN A 1 34  ? 63.349 16.241  12.780  1.00 21.20  ? 31   ASN A CB    1 
ATOM   275  C  CG    . ASN A 1 34  ? 64.201 15.928  11.565  1.00 28.25  ? 31   ASN A CG    1 
ATOM   276  O  OD1   . ASN A 1 34  ? 64.346 14.767  11.176  1.00 34.36  ? 31   ASN A OD1   1 
ATOM   277  N  ND2   . ASN A 1 34  ? 64.740 16.964  10.941  1.00 32.68  ? 31   ASN A ND2   1 
ATOM   278  N  N     . LYS A 1 35  ? 59.843 15.809  13.818  1.00 14.34  ? 32   LYS A N     1 
ATOM   279  C  CA    . LYS A 1 35  ? 58.922 16.070  14.914  1.00 15.25  ? 32   LYS A CA    1 
ATOM   280  C  C     . LYS A 1 35  ? 57.953 14.906  15.037  1.00 15.34  ? 32   LYS A C     1 
ATOM   281  O  O     . LYS A 1 35  ? 57.700 14.196  14.063  1.00 14.43  ? 32   LYS A O     1 
ATOM   282  C  CB    . LYS A 1 35  ? 58.094 17.323  14.609  1.00 16.35  ? 32   LYS A CB    1 
ATOM   283  C  CG    . LYS A 1 35  ? 58.889 18.621  14.554  1.00 20.37  ? 32   LYS A CG    1 
ATOM   284  C  CD    . LYS A 1 35  ? 59.046 19.210  15.932  1.00 30.57  ? 32   LYS A CD    1 
ATOM   285  C  CE    . LYS A 1 35  ? 59.837 20.510  15.883  1.00 37.04  ? 32   LYS A CE    1 
ATOM   286  N  NZ    . LYS A 1 35  ? 59.882 21.154  17.228  1.00 38.05  ? 32   LYS A NZ    1 
ATOM   287  N  N     . PRO A 1 36  ? 57.386 14.712  16.234  1.00 13.90  ? 33   PRO A N     1 
ATOM   288  C  CA    . PRO A 1 36  ? 56.241 13.802  16.327  1.00 13.63  ? 33   PRO A CA    1 
ATOM   289  C  C     . PRO A 1 36  ? 55.067 14.452  15.602  1.00 13.47  ? 33   PRO A C     1 
ATOM   290  O  O     . PRO A 1 36  ? 54.611 15.540  15.979  1.00 14.44  ? 33   PRO A O     1 
ATOM   291  C  CB    . PRO A 1 36  ? 55.976 13.721  17.831  1.00 16.08  ? 33   PRO A CB    1 
ATOM   292  C  CG    . PRO A 1 36  ? 56.506 15.023  18.383  1.00 21.96  ? 33   PRO A CG    1 
ATOM   293  C  CD    . PRO A 1 36  ? 57.687 15.390  17.512  1.00 18.05  ? 33   PRO A CD    1 
ATOM   294  N  N     . CYS A 1 37  ? 54.605 13.800  14.549  1.00 12.76  ? 34   CYS A N     1 
ATOM   295  C  CA    A CYS A 1 37  ? 53.653 14.381  13.612  0.40 13.92  ? 34   CYS A CA    1 
ATOM   296  C  CA    B CYS A 1 37  ? 53.513 14.368  13.789  0.60 12.75  ? 34   CYS A CA    1 
ATOM   297  C  C     . CYS A 1 37  ? 52.725 13.282  13.101  1.00 13.10  ? 34   CYS A C     1 
ATOM   298  O  O     . CYS A 1 37  ? 53.145 12.123  13.020  1.00 14.27  ? 34   CYS A O     1 
ATOM   299  C  CB    A CYS A 1 37  ? 54.448 15.002  12.453  0.40 20.47  ? 34   CYS A CB    1 
ATOM   300  C  CB    B CYS A 1 37  ? 54.015 15.411  12.789  0.60 15.64  ? 34   CYS A CB    1 
ATOM   301  S  SG    A CYS A 1 37  ? 53.535 15.709  11.061  0.40 15.99  ? 34   CYS A SG    1 
ATOM   302  S  SG    B CYS A 1 37  ? 55.119 14.734  11.548  0.60 14.16  ? 34   CYS A SG    1 
ATOM   303  N  N     . ALA A 1 38  ? 51.522 13.648  12.698  1.00 10.38  ? 35   ALA A N     1 
ATOM   304  C  CA    . ALA A 1 38  ? 50.604 12.687  12.108  1.00 10.33  ? 35   ALA A CA    1 
ATOM   305  C  C     . ALA A 1 38  ? 49.771 13.401  11.073  1.00 9.99   ? 35   ALA A C     1 
ATOM   306  O  O     . ALA A 1 38  ? 49.636 14.616  11.121  1.00 12.37  ? 35   ALA A O     1 
ATOM   307  C  CB    . ALA A 1 38  ? 49.706 12.108  13.174  1.00 10.32  ? 35   ALA A CB    1 
ATOM   308  N  N     . VAL A 1 39  ? 49.217 12.631  10.145  1.00 9.28   ? 36   VAL A N     1 
ATOM   309  C  CA    . VAL A 1 39  ? 48.298 13.166  9.147   1.00 9.51   ? 36   VAL A CA    1 
ATOM   310  C  C     . VAL A 1 39  ? 46.896 12.739  9.539   1.00 12.28  ? 36   VAL A C     1 
ATOM   311  O  O     . VAL A 1 39  ? 46.668 11.559  9.843   1.00 11.90  ? 36   VAL A O     1 
ATOM   312  C  CB    . VAL A 1 39  ? 48.671 12.674  7.745   1.00 9.52   ? 36   VAL A CB    1 
ATOM   313  C  CG1   . VAL A 1 39  ? 47.593 13.073  6.741   1.00 10.78  ? 36   VAL A CG1   1 
ATOM   314  C  CG2   . VAL A 1 39  ? 50.039 13.267  7.340   1.00 11.77  ? 36   VAL A CG2   1 
ATOM   315  N  N     . VAL A 1 40  ? 45.975 13.709  9.563   1.00 14.59  ? 37   VAL A N     1 
ATOM   316  C  CA    . VAL A 1 40  ? 44.616 13.491  10.045  1.00 13.29  ? 37   VAL A CA    1 
ATOM   317  C  C     . VAL A 1 40  ? 43.605 13.806  8.947   1.00 15.21  ? 37   VAL A C     1 
ATOM   318  O  O     . VAL A 1 40  ? 43.830 14.666  8.098   1.00 16.15  ? 37   VAL A O     1 
ATOM   319  C  CB    . VAL A 1 40  ? 44.302 14.360  11.301  1.00 15.84  ? 37   VAL A CB    1 
ATOM   320  C  CG1   A VAL A 1 40  ? 45.002 13.805  12.527  0.41 17.43  ? 37   VAL A CG1   1 
ATOM   321  C  CG1   B VAL A 1 40  ? 44.144 15.820  10.923  0.59 15.32  ? 37   VAL A CG1   1 
ATOM   322  C  CG2   A VAL A 1 40  ? 44.674 15.815  11.059  0.41 12.76  ? 37   VAL A CG2   1 
ATOM   323  C  CG2   B VAL A 1 40  ? 43.070 13.866  12.025  0.59 15.92  ? 37   VAL A CG2   1 
ATOM   324  N  N     . GLN A 1 41  ? 42.486 13.100  8.984   1.00 14.53  ? 38   GLN A N     1 
ATOM   325  C  CA    . GLN A 1 41  ? 41.413 13.259  8.016   1.00 17.65  ? 38   GLN A CA    1 
ATOM   326  C  C     . GLN A 1 41  ? 40.200 13.780  8.773   1.00 12.78  ? 38   GLN A C     1 
ATOM   327  O  O     . GLN A 1 41  ? 39.719 13.117  9.693   1.00 15.17  ? 38   GLN A O     1 
ATOM   328  C  CB    . GLN A 1 41  ? 41.104 11.881  7.445   1.00 22.64  ? 38   GLN A CB    1 
ATOM   329  C  CG    . GLN A 1 41  ? 40.471 11.846  6.090   1.00 24.77  ? 38   GLN A CG    1 
ATOM   330  C  CD    . GLN A 1 41  ? 40.726 10.510  5.396   1.00 20.32  ? 38   GLN A CD    1 
ATOM   331  O  OE1   . GLN A 1 41  ? 41.172 10.473  4.252   1.00 18.30  ? 38   GLN A OE1   1 
ATOM   332  N  NE2   . GLN A 1 41  ? 40.441 9.405   6.093   1.00 20.38  ? 38   GLN A NE2   1 
ATOM   333  N  N     . TYR A 1 42  ? 39.719 14.962  8.389   1.00 13.36  ? 39   TYR A N     1 
ATOM   334  C  CA    . TYR A 1 42  ? 38.605 15.634  9.064   1.00 16.62  ? 39   TYR A CA    1 
ATOM   335  C  C     . TYR A 1 42  ? 39.052 16.094  10.450  1.00 18.16  ? 39   TYR A C     1 
ATOM   336  O  O     . TYR A 1 42  ? 40.229 15.948  10.799  1.00 19.24  ? 39   TYR A O     1 
ATOM   337  C  CB    . TYR A 1 42  ? 37.338 14.765  9.094   1.00 18.37  ? 39   TYR A CB    1 
ATOM   338  C  CG    . TYR A 1 42  ? 36.930 14.271  7.712   1.00 12.73  ? 39   TYR A CG    1 
ATOM   339  C  CD1   . TYR A 1 42  ? 36.638 15.167  6.695   1.00 14.52  ? 39   TYR A CD1   1 
ATOM   340  C  CD2   . TYR A 1 42  ? 36.874 12.908  7.423   1.00 14.27  ? 39   TYR A CD2   1 
ATOM   341  C  CE1   . TYR A 1 42  ? 36.286 14.725  5.438   1.00 17.18  ? 39   TYR A CE1   1 
ATOM   342  C  CE2   . TYR A 1 42  ? 36.515 12.455  6.167   1.00 13.85  ? 39   TYR A CE2   1 
ATOM   343  C  CZ    . TYR A 1 42  ? 36.225 13.378  5.180   1.00 15.16  ? 39   TYR A CZ    1 
ATOM   344  O  OH    . TYR A 1 42  ? 35.859 12.951  3.925   1.00 15.39  ? 39   TYR A OH    1 
ATOM   345  N  N     . LYS A 1 43  ? 38.137 16.662  11.228  1.00 21.95  ? 40   LYS A N     1 
ATOM   346  C  CA    . LYS A 1 43  ? 38.529 17.311  12.485  1.00 22.97  ? 40   LYS A CA    1 
ATOM   347  C  C     . LYS A 1 43  ? 37.380 17.346  13.480  1.00 27.25  ? 40   LYS A C     1 
ATOM   348  O  O     . LYS A 1 43  ? 37.583 17.375  14.697  1.00 24.98  ? 40   LYS A O     1 
ATOM   349  C  CB    . LYS A 1 43  ? 38.998 18.741  12.202  1.00 30.04  ? 40   LYS A CB    1 
ATOM   350  C  CG    . LYS A 1 43  ? 40.154 19.224  13.073  1.00 46.51  ? 40   LYS A CG    1 
ATOM   351  C  CD    . LYS A 1 43  ? 41.489 18.706  12.550  1.00 46.96  ? 40   LYS A CD    1 
ATOM   352  C  CE    . LYS A 1 43  ? 42.654 19.205  13.394  1.00 44.63  ? 40   LYS A CE    1 
ATOM   353  N  NZ    . LYS A 1 43  ? 42.577 18.704  14.796  1.00 43.86  ? 40   LYS A NZ    1 
ATOM   354  N  N     . SER A 1 44  ? 36.164 17.346  12.955  1.00 29.09  ? 41   SER A N     1 
ATOM   355  C  CA    . SER A 1 44  ? 34.987 17.542  13.790  1.00 25.94  ? 41   SER A CA    1 
ATOM   356  C  C     . SER A 1 44  ? 34.787 16.426  14.807  1.00 33.41  ? 41   SER A C     1 
ATOM   357  O  O     . SER A 1 44  ? 34.604 16.696  15.995  1.00 43.70  ? 41   SER A O     1 
ATOM   358  C  CB    . SER A 1 44  ? 33.751 17.714  12.910  1.00 31.58  ? 41   SER A CB    1 
ATOM   359  O  OG    . SER A 1 44  ? 33.940 18.815  12.041  1.00 37.36  ? 41   SER A OG    1 
ATOM   360  N  N     . TRP A 1 45  ? 34.834 15.178  14.349  1.00 27.04  ? 42   TRP A N     1 
ATOM   361  C  CA    . TRP A 1 45  ? 34.648 14.043  15.244  1.00 26.53  ? 42   TRP A CA    1 
ATOM   362  C  C     . TRP A 1 45  ? 35.954 13.647  15.915  1.00 26.58  ? 42   TRP A C     1 
ATOM   363  O  O     . TRP A 1 45  ? 36.865 13.149  15.258  1.00 23.90  ? 42   TRP A O     1 
ATOM   364  C  CB    . TRP A 1 45  ? 34.048 12.841  14.507  1.00 30.64  ? 42   TRP A CB    1 
ATOM   365  C  CG    . TRP A 1 45  ? 33.703 11.698  15.421  1.00 37.40  ? 42   TRP A CG    1 
ATOM   366  C  CD1   . TRP A 1 45  ? 34.403 10.539  15.586  1.00 42.50  ? 42   TRP A CD1   1 
ATOM   367  C  CD2   . TRP A 1 45  ? 32.580 11.616  16.307  1.00 45.31  ? 42   TRP A CD2   1 
ATOM   368  N  NE1   . TRP A 1 45  ? 33.783 9.738   16.515  1.00 45.55  ? 42   TRP A NE1   1 
ATOM   369  C  CE2   . TRP A 1 45  ? 32.661 10.377  16.972  1.00 47.05  ? 42   TRP A CE2   1 
ATOM   370  C  CE3   . TRP A 1 45  ? 31.512 12.469  16.599  1.00 51.31  ? 42   TRP A CE3   1 
ATOM   371  C  CZ2   . TRP A 1 45  ? 31.715 9.969   17.910  1.00 53.80  ? 42   TRP A CZ2   1 
ATOM   372  C  CZ3   . TRP A 1 45  ? 30.575 12.064  17.530  1.00 57.10  ? 42   TRP A CZ3   1 
ATOM   373  C  CH2   . TRP A 1 45  ? 30.681 10.826  18.175  1.00 59.45  ? 42   TRP A CH2   1 
ATOM   374  N  N     . LYS A 1 46  ? 36.025 13.888  17.222  1.00 27.62  ? 43   LYS A N     1 
ATOM   375  C  CA    . LYS A 1 46  ? 37.155 13.483  18.056  1.00 25.65  ? 43   LYS A CA    1 
ATOM   376  C  C     . LYS A 1 46  ? 38.501 13.981  17.552  1.00 24.37  ? 43   LYS A C     1 
ATOM   377  O  O     . LYS A 1 46  ? 39.524 13.313  17.726  1.00 19.75  ? 43   LYS A O     1 
ATOM   378  C  CB    . LYS A 1 46  ? 37.175 11.961  18.235  1.00 28.69  ? 43   LYS A CB    1 
ATOM   379  C  CG    . LYS A 1 46  ? 35.983 11.430  19.024  1.00 32.60  ? 43   LYS A CG    1 
ATOM   380  C  CD    . LYS A 1 46  ? 36.000 9.913   19.129  1.00 36.40  ? 43   LYS A CD    1 
ATOM   381  C  CE    . LYS A 1 46  ? 34.742 9.399   19.819  1.00 47.35  ? 43   LYS A CE    1 
ATOM   382  N  NZ    . LYS A 1 46  ? 34.674 7.909   19.836  1.00 51.05  ? 43   LYS A NZ    1 
ATOM   383  N  N     . GLY A 1 47  ? 38.490 15.149  16.918  1.00 21.74  ? 44   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 47  ? 39.704 15.794  16.466  1.00 17.48  ? 44   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 47  ? 40.227 15.352  15.108  1.00 19.66  ? 44   GLY A C     1 
ATOM   386  O  O     . GLY A 1 47  ? 41.223 15.878  14.628  1.00 19.10  ? 44   GLY A O     1 
ATOM   387  N  N     . GLY A 1 48  ? 39.560 14.385  14.488  1.00 19.46  ? 45   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 48  ? 40.018 13.877  13.206  1.00 16.91  ? 45   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 48  ? 40.588 12.483  13.339  1.00 16.39  ? 45   GLY A C     1 
ATOM   390  O  O     . GLY A 1 48  ? 41.050 12.096  14.403  1.00 17.13  ? 45   GLY A O     1 
ATOM   391  N  N     . GLY A 1 49  ? 40.553 11.727  12.253  1.00 14.38  ? 46   GLY A N     1 
ATOM   392  C  CA    . GLY A 1 49  ? 41.058 10.368  12.271  1.00 12.58  ? 46   GLY A CA    1 
ATOM   393  C  C     . GLY A 1 49  ? 42.482 10.305  11.748  1.00 15.07  ? 46   GLY A C     1 
ATOM   394  O  O     . GLY A 1 49  ? 42.762 10.796  10.660  1.00 14.03  ? 46   GLY A O     1 
ATOM   395  N  N     . ILE A 1 50  ? 43.382 9.691   12.509  1.00 13.66  ? 47   ILE A N     1 
ATOM   396  C  CA    . ILE A 1 50  ? 44.785 9.635   12.098  1.00 14.71  ? 47   ILE A CA    1 
ATOM   397  C  C     . ILE A 1 50  ? 45.018 8.536   11.072  1.00 16.03  ? 47   ILE A C     1 
ATOM   398  O  O     . ILE A 1 50  ? 44.644 7.387   11.292  1.00 18.25  ? 47   ILE A O     1 
ATOM   399  C  CB    . ILE A 1 50  ? 45.703 9.424   13.310  1.00 13.43  ? 47   ILE A CB    1 
ATOM   400  C  CG1   . ILE A 1 50  ? 45.702 10.677  14.177  1.00 20.86  ? 47   ILE A CG1   1 
ATOM   401  C  CG2   . ILE A 1 50  ? 47.132 9.080   12.876  1.00 16.29  ? 47   ILE A CG2   1 
ATOM   402  C  CD1   . ILE A 1 50  ? 46.559 10.543  15.411  1.00 27.69  ? 47   ILE A CD1   1 
ATOM   403  N  N     . ILE A 1 51  ? 45.640 8.886   9.949   1.00 12.57  ? 48   ILE A N     1 
ATOM   404  C  CA    . ILE A 1 51  ? 45.910 7.885   8.933   1.00 14.13  ? 48   ILE A CA    1 
ATOM   405  C  C     . ILE A 1 51  ? 47.399 7.615   8.680   1.00 12.45  ? 48   ILE A C     1 
ATOM   406  O  O     . ILE A 1 51  ? 47.738 6.668   7.988   1.00 12.93  ? 48   ILE A O     1 
ATOM   407  C  CB    . ILE A 1 51  ? 45.157 8.156   7.620   1.00 16.07  ? 48   ILE A CB    1 
ATOM   408  C  CG1   . ILE A 1 51  ? 45.565 9.483   6.993   1.00 13.40  ? 48   ILE A CG1   1 
ATOM   409  C  CG2   . ILE A 1 51  ? 43.652 8.120   7.863   1.00 18.31  ? 48   ILE A CG2   1 
ATOM   410  C  CD1   . ILE A 1 51  ? 45.034 9.630   5.582   1.00 17.08  ? 48   ILE A CD1   1 
ATOM   411  N  N     . ALA A 1 52  ? 48.280 8.424   9.258   1.00 11.77  ? 49   ALA A N     1 
ATOM   412  C  CA    . ALA A 1 52  ? 49.724 8.195   9.128   1.00 10.02  ? 49   ALA A CA    1 
ATOM   413  C  C     . ALA A 1 52  ? 50.447 8.869   10.280  1.00 8.90   ? 49   ALA A C     1 
ATOM   414  O  O     . ALA A 1 52  ? 50.010 9.919   10.746  1.00 9.41   ? 49   ALA A O     1 
ATOM   415  C  CB    . ALA A 1 52  ? 50.245 8.713   7.777   1.00 10.49  ? 49   ALA A CB    1 
ATOM   416  N  N     . VAL A 1 53  ? 51.555 8.274   10.730  1.00 9.51   ? 50   VAL A N     1 
ATOM   417  C  CA    . VAL A 1 53  ? 52.221 8.677   11.969  1.00 8.11   ? 50   VAL A CA    1 
ATOM   418  C  C     . VAL A 1 53  ? 53.737 8.631   11.821  1.00 10.69  ? 50   VAL A C     1 
ATOM   419  O  O     . VAL A 1 53  ? 54.285 7.621   11.378  1.00 11.06  ? 50   VAL A O     1 
ATOM   420  C  CB    . VAL A 1 53  ? 51.811 7.724   13.123  1.00 10.07  ? 50   VAL A CB    1 
ATOM   421  C  CG1   . VAL A 1 53  ? 52.413 8.202   14.438  1.00 11.16  ? 50   VAL A CG1   1 
ATOM   422  C  CG2   . VAL A 1 53  ? 50.298 7.616   13.217  1.00 13.81  ? 50   VAL A CG2   1 
ATOM   423  N  N     . SER A 1 54  ? 54.413 9.727   12.165  1.00 9.35   ? 51   SER A N     1 
ATOM   424  C  CA    . SER A 1 54  ? 55.871 9.749   12.113  1.00 12.13  ? 51   SER A CA    1 
ATOM   425  C  C     . SER A 1 54  ? 56.469 8.823   13.161  1.00 10.13  ? 51   SER A C     1 
ATOM   426  O  O     . SER A 1 54  ? 55.838 8.516   14.174  1.00 11.30  ? 51   SER A O     1 
ATOM   427  C  CB    . SER A 1 54  ? 56.421 11.169  12.298  1.00 11.98  ? 51   SER A CB    1 
ATOM   428  O  OG    . SER A 1 54  ? 56.427 11.533  13.669  1.00 12.26  ? 51   SER A OG    1 
ATOM   429  N  N     . TYR A 1 55  ? 57.692 8.375   12.903  1.00 11.71  ? 52   TYR A N     1 
ATOM   430  C  CA    . TYR A 1 55  ? 58.343 7.464   13.838  1.00 12.20  ? 52   TYR A CA    1 
ATOM   431  C  C     . TYR A 1 55  ? 58.561 8.086   15.221  1.00 13.94  ? 52   TYR A C     1 
ATOM   432  O  O     . TYR A 1 55  ? 58.448 7.398   16.236  1.00 15.13  ? 52   TYR A O     1 
ATOM   433  C  CB    . TYR A 1 55  ? 59.618 6.862   13.219  1.00 12.96  ? 52   TYR A CB    1 
ATOM   434  C  CG    . TYR A 1 55  ? 59.262 5.759   12.242  1.00 12.23  ? 52   TYR A CG    1 
ATOM   435  C  CD1   . TYR A 1 55  ? 58.830 6.060   10.954  1.00 12.91  ? 52   TYR A CD1   1 
ATOM   436  C  CD2   . TYR A 1 55  ? 59.266 4.429   12.636  1.00 17.48  ? 52   TYR A CD2   1 
ATOM   437  C  CE1   . TYR A 1 55  ? 58.452 5.059   10.068  1.00 15.11  ? 52   TYR A CE1   1 
ATOM   438  C  CE2   . TYR A 1 55  ? 58.901 3.425   11.760  1.00 14.76  ? 52   TYR A CE2   1 
ATOM   439  C  CZ    . TYR A 1 55  ? 58.483 3.742   10.483  1.00 15.20  ? 52   TYR A CZ    1 
ATOM   440  O  OH    . TYR A 1 55  ? 58.121 2.719   9.627   1.00 16.72  ? 52   TYR A OH    1 
ATOM   441  N  N     . GLU A 1 56  ? 58.818 9.390   15.262  1.00 14.26  ? 53   GLU A N     1 
ATOM   442  C  CA    . GLU A 1 56  ? 58.897 10.110  16.531  1.00 13.80  ? 53   GLU A CA    1 
ATOM   443  C  C     . GLU A 1 56  ? 57.591 10.019  17.332  1.00 14.50  ? 53   GLU A C     1 
ATOM   444  O  O     . GLU A 1 56  ? 57.612 9.847   18.549  1.00 16.82  ? 53   GLU A O     1 
ATOM   445  C  CB    . GLU A 1 56  ? 59.283 11.572  16.283  1.00 16.19  ? 53   GLU A CB    1 
ATOM   446  C  CG    . GLU A 1 56  ? 60.681 11.748  15.673  1.00 20.50  ? 53   GLU A CG    1 
ATOM   447  C  CD    . GLU A 1 56  ? 60.704 11.685  14.146  1.00 29.34  ? 53   GLU A CD    1 
ATOM   448  O  OE1   . GLU A 1 56  ? 59.696 11.280  13.520  1.00 21.61  ? 53   GLU A OE1   1 
ATOM   449  O  OE2   . GLU A 1 56  ? 61.747 12.054  13.564  1.00 32.89  ? 53   GLU A OE2   1 
ATOM   450  N  N     . ALA A 1 57  ? 56.452 10.135  16.653  1.00 11.97  ? 54   ALA A N     1 
ATOM   451  C  CA    . ALA A 1 57  ? 55.148 10.042  17.311  1.00 11.15  ? 54   ALA A CA    1 
ATOM   452  C  C     . ALA A 1 57  ? 54.822 8.609   17.712  1.00 11.53  ? 54   ALA A C     1 
ATOM   453  O  O     . ALA A 1 57  ? 54.170 8.383   18.721  1.00 12.95  ? 54   ALA A O     1 
ATOM   454  C  CB    . ALA A 1 57  ? 54.041 10.597  16.390  1.00 12.17  ? 54   ALA A CB    1 
ATOM   455  N  N     . ARG A 1 58  ? 55.281 7.637   16.930  1.00 13.32  ? 55   ARG A N     1 
ATOM   456  C  CA    . ARG A 1 58  ? 55.020 6.236   17.265  1.00 14.60  ? 55   ARG A CA    1 
ATOM   457  C  C     . ARG A 1 58  ? 55.639 5.861   18.603  1.00 14.21  ? 55   ARG A C     1 
ATOM   458  O  O     . ARG A 1 58  ? 55.102 5.009   19.326  1.00 15.74  ? 55   ARG A O     1 
ATOM   459  C  CB    . ARG A 1 58  ? 55.527 5.300   16.167  1.00 12.42  ? 55   ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 58  ? 54.788 5.452   14.859  1.00 13.86  ? 55   ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 58  ? 55.366 4.523   13.799  1.00 13.30  ? 55   ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 58  ? 54.940 4.948   12.472  1.00 14.36  ? 55   ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 58  ? 54.975 4.195   11.381  1.00 16.77  ? 55   ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 58  ? 55.414 2.941   11.445  1.00 17.43  ? 55   ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 58  ? 54.560 4.709   10.222  1.00 16.13  ? 55   ARG A NH2   1 
ATOM   466  N  N     . ALA A 1 59  ? 56.742 6.522   18.944  1.00 15.94  ? 56   ALA A N     1 
ATOM   467  C  CA    . ALA A 1 59  ? 57.429 6.275   20.210  1.00 15.65  ? 56   ALA A CA    1 
ATOM   468  C  C     . ALA A 1 59  ? 56.549 6.609   21.413  1.00 19.59  ? 56   ALA A C     1 
ATOM   469  O  O     . ALA A 1 59  ? 56.748 6.068   22.498  1.00 21.69  ? 56   ALA A O     1 
ATOM   470  C  CB    . ALA A 1 59  ? 58.729 7.048   20.263  1.00 17.25  ? 56   ALA A CB    1 
ATOM   471  N  N     . PHE A 1 60  ? 55.579 7.500   21.219  1.00 15.80  ? 57   PHE A N     1 
ATOM   472  C  CA    . PHE A 1 60  ? 54.638 7.867   22.275  1.00 16.85  ? 57   PHE A CA    1 
ATOM   473  C  C     . PHE A 1 60  ? 53.425 6.951   22.286  1.00 19.39  ? 57   PHE A C     1 
ATOM   474  O  O     . PHE A 1 60  ? 52.564 7.071   23.159  1.00 21.83  ? 57   PHE A O     1 
ATOM   475  C  CB    . PHE A 1 60  ? 54.143 9.308   22.083  1.00 13.07  ? 57   PHE A CB    1 
ATOM   476  C  CG    . PHE A 1 60  ? 55.179 10.363  22.376  1.00 15.90  ? 57   PHE A CG    1 
ATOM   477  C  CD1   . PHE A 1 60  ? 55.256 10.955  23.634  1.00 20.03  ? 57   PHE A CD1   1 
ATOM   478  C  CD2   . PHE A 1 60  ? 56.049 10.790  21.392  1.00 19.14  ? 57   PHE A CD2   1 
ATOM   479  C  CE1   . PHE A 1 60  ? 56.194 11.941  23.901  1.00 26.56  ? 57   PHE A CE1   1 
ATOM   480  C  CE2   . PHE A 1 60  ? 56.991 11.775  21.647  1.00 20.70  ? 57   PHE A CE2   1 
ATOM   481  C  CZ    . PHE A 1 60  ? 57.065 12.354  22.906  1.00 25.97  ? 57   PHE A CZ    1 
ATOM   482  N  N     . GLY A 1 61  ? 53.332 6.064   21.299  1.00 17.88  ? 58   GLY A N     1 
ATOM   483  C  CA    . GLY A 1 61  ? 52.212 5.140   21.205  1.00 18.09  ? 58   GLY A CA    1 
ATOM   484  C  C     . GLY A 1 61  ? 51.110 5.583   20.258  1.00 15.31  ? 58   GLY A C     1 
ATOM   485  O  O     . GLY A 1 61  ? 50.048 4.958   20.198  1.00 16.54  ? 58   GLY A O     1 
ATOM   486  N  N     . VAL A 1 62  ? 51.354 6.656   19.500  1.00 14.22  ? 59   VAL A N     1 
ATOM   487  C  CA    . VAL A 1 62  ? 50.374 7.110   18.527  1.00 13.29  ? 59   VAL A CA    1 
ATOM   488  C  C     . VAL A 1 62  ? 50.331 6.104   17.380  1.00 15.43  ? 59   VAL A C     1 
ATOM   489  O  O     . VAL A 1 62  ? 51.378 5.652   16.898  1.00 14.08  ? 59   VAL A O     1 
ATOM   490  C  CB    . VAL A 1 62  ? 50.714 8.525   17.973  1.00 13.28  ? 59   VAL A CB    1 
ATOM   491  C  CG1   . VAL A 1 62  ? 49.665 8.958   16.960  1.00 14.42  ? 59   VAL A CG1   1 
ATOM   492  C  CG2   . VAL A 1 62  ? 50.798 9.536   19.108  1.00 16.37  ? 59   VAL A CG2   1 
ATOM   493  N  N     . THR A 1 63  ? 49.124 5.749   16.951  1.00 16.37  ? 60   THR A N     1 
ATOM   494  C  CA    . THR A 1 63  ? 48.954 4.805   15.860  1.00 15.90  ? 60   THR A CA    1 
ATOM   495  C  C     . THR A 1 63  ? 47.910 5.267   14.871  1.00 16.05  ? 60   THR A C     1 
ATOM   496  O  O     . THR A 1 63  ? 47.048 6.077   15.182  1.00 18.16  ? 60   THR A O     1 
ATOM   497  C  CB    . THR A 1 63  ? 48.494 3.411   16.365  1.00 21.08  ? 60   THR A CB    1 
ATOM   498  O  OG1   . THR A 1 63  ? 47.158 3.496   16.891  1.00 23.05  ? 60   THR A OG1   1 
ATOM   499  C  CG2   . THR A 1 63  ? 49.432 2.880   17.430  1.00 21.54  ? 60   THR A CG2   1 
ATOM   500  N  N     . ARG A 1 64  ? 47.991 4.716   13.666  1.00 16.68  ? 61   ARG A N     1 
ATOM   501  C  CA    . ARG A 1 64  ? 46.930 4.825   12.690  1.00 19.70  ? 61   ARG A CA    1 
ATOM   502  C  C     . ARG A 1 64  ? 45.610 4.335   13.298  1.00 22.65  ? 61   ARG A C     1 
ATOM   503  O  O     . ARG A 1 64  ? 45.604 3.433   14.146  1.00 21.37  ? 61   ARG A O     1 
ATOM   504  C  CB    . ARG A 1 64  ? 47.311 4.002   11.456  1.00 28.18  ? 61   ARG A CB    1 
ATOM   505  C  CG    . ARG A 1 64  ? 46.174 3.627   10.539  1.00 35.33  ? 61   ARG A CG    1 
ATOM   506  C  CD    . ARG A 1 64  ? 46.725 2.949   9.288   1.00 37.52  ? 61   ARG A CD    1 
ATOM   507  N  NE    . ARG A 1 64  ? 47.681 3.833   8.635   1.00 37.16  ? 61   ARG A NE    1 
ATOM   508  C  CZ    . ARG A 1 64  ? 48.871 3.464   8.169   1.00 32.36  ? 61   ARG A CZ    1 
ATOM   509  N  NH1   . ARG A 1 64  ? 49.277 2.196   8.246   1.00 28.43  ? 61   ARG A NH1   1 
ATOM   510  N  NH2   . ARG A 1 64  ? 49.654 4.378   7.609   1.00 20.51  ? 61   ARG A NH2   1 
ATOM   511  N  N     . SER A 1 65  ? 44.508 4.942   12.861  1.00 21.97  ? 62   SER A N     1 
ATOM   512  C  CA    . SER A 1 65  ? 43.144 4.623   13.309  1.00 22.53  ? 62   SER A CA    1 
ATOM   513  C  C     . SER A 1 65  ? 42.747 5.326   14.610  1.00 21.52  ? 62   SER A C     1 
ATOM   514  O  O     . SER A 1 65  ? 41.581 5.362   14.978  1.00 28.10  ? 62   SER A O     1 
ATOM   515  C  CB    . SER A 1 65  ? 42.919 3.113   13.443  1.00 24.47  ? 62   SER A CB    1 
ATOM   516  O  OG    . SER A 1 65  ? 43.337 2.641   14.715  1.00 30.40  ? 62   SER A OG    1 
ATOM   517  N  N     . MET A 1 66  ? 43.727 5.873   15.308  1.00 21.67  ? 63   MET A N     1 
ATOM   518  C  CA    . MET A 1 66  ? 43.469 6.634   16.519  1.00 18.75  ? 63   MET A CA    1 
ATOM   519  C  C     . MET A 1 66  ? 42.794 7.955   16.176  1.00 18.63  ? 63   MET A C     1 
ATOM   520  O  O     . MET A 1 66  ? 43.098 8.566   15.147  1.00 16.92  ? 63   MET A O     1 
ATOM   521  C  CB    . MET A 1 66  ? 44.806 6.906   17.189  1.00 21.30  ? 63   MET A CB    1 
ATOM   522  C  CG    . MET A 1 66  ? 44.788 7.263   18.629  1.00 27.58  ? 63   MET A CG    1 
ATOM   523  S  SD    . MET A 1 66  ? 46.481 7.067   19.219  1.00 25.34  ? 63   MET A SD    1 
ATOM   524  C  CE    . MET A 1 66  ? 46.596 5.315   19.482  1.00 24.97  ? 63   MET A CE    1 
ATOM   525  N  N     . TRP A 1 67  ? 41.875 8.404   17.027  1.00 18.09  ? 64   TRP A N     1 
ATOM   526  C  CA    . TRP A 1 67  ? 41.353 9.762   16.909  1.00 15.04  ? 64   TRP A CA    1 
ATOM   527  C  C     . TRP A 1 67  ? 42.421 10.734  17.410  1.00 16.13  ? 64   TRP A C     1 
ATOM   528  O  O     . TRP A 1 67  ? 43.137 10.426  18.366  1.00 15.45  ? 64   TRP A O     1 
ATOM   529  C  CB    . TRP A 1 67  ? 40.056 9.938   17.702  1.00 19.00  ? 64   TRP A CB    1 
ATOM   530  C  CG    . TRP A 1 67  ? 38.966 9.044   17.225  1.00 17.29  ? 64   TRP A CG    1 
ATOM   531  C  CD1   . TRP A 1 67  ? 38.418 7.993   17.899  1.00 24.89  ? 64   TRP A CD1   1 
ATOM   532  C  CD2   . TRP A 1 67  ? 38.303 9.096   15.951  1.00 22.12  ? 64   TRP A CD2   1 
ATOM   533  N  NE1   . TRP A 1 67  ? 37.444 7.395   17.131  1.00 28.65  ? 64   TRP A NE1   1 
ATOM   534  C  CE2   . TRP A 1 67  ? 37.357 8.052   15.932  1.00 28.15  ? 64   TRP A CE2   1 
ATOM   535  C  CE3   . TRP A 1 67  ? 38.413 9.935   14.831  1.00 20.91  ? 64   TRP A CE3   1 
ATOM   536  C  CZ2   . TRP A 1 67  ? 36.526 7.816   14.835  1.00 29.78  ? 64   TRP A CZ2   1 
ATOM   537  C  CZ3   . TRP A 1 67  ? 37.587 9.699   13.742  1.00 22.95  ? 64   TRP A CZ3   1 
ATOM   538  C  CH2   . TRP A 1 67  ? 36.655 8.647   13.754  1.00 29.03  ? 64   TRP A CH2   1 
ATOM   539  N  N     . ALA A 1 68  ? 42.542 11.892  16.759  1.00 15.23  ? 65   ALA A N     1 
ATOM   540  C  CA    . ALA A 1 68  ? 43.555 12.870  17.145  1.00 15.35  ? 65   ALA A CA    1 
ATOM   541  C  C     . ALA A 1 68  ? 43.412 13.314  18.600  1.00 15.12  ? 65   ALA A C     1 
ATOM   542  O  O     . ALA A 1 68  ? 44.414 13.546  19.269  1.00 16.53  ? 65   ALA A O     1 
ATOM   543  C  CB    . ALA A 1 68  ? 43.549 14.087  16.203  1.00 15.92  ? 65   ALA A CB    1 
ATOM   544  N  N     . ASP A 1 69  ? 42.179 13.429  19.093  1.00 16.10  ? 66   ASP A N     1 
ATOM   545  C  CA    . ASP A 1 69  ? 41.991 13.847  20.481  1.00 18.76  ? 66   ASP A CA    1 
ATOM   546  C  C     . ASP A 1 69  ? 42.644 12.851  21.432  1.00 17.76  ? 66   ASP A C     1 
ATOM   547  O  O     . ASP A 1 69  ? 43.181 13.228  22.475  1.00 19.33  ? 66   ASP A O     1 
ATOM   548  C  CB    . ASP A 1 69  ? 40.513 13.963  20.831  1.00 21.90  ? 66   ASP A CB    1 
ATOM   549  C  CG    . ASP A 1 69  ? 39.872 15.231  20.289  1.00 20.93  ? 66   ASP A CG    1 
ATOM   550  O  OD1   . ASP A 1 69  ? 40.582 16.086  19.713  1.00 25.23  ? 66   ASP A OD1   1 
ATOM   551  O  OD2   . ASP A 1 69  ? 38.645 15.367  20.464  1.00 27.31  ? 66   ASP A OD2   1 
ATOM   552  N  N     . ASP A 1 70  ? 42.583 11.574  21.064  1.00 15.99  ? 67   ASP A N     1 
ATOM   553  C  CA    . ASP A 1 70  ? 43.148 10.519  21.897  1.00 16.45  ? 67   ASP A CA    1 
ATOM   554  C  C     . ASP A 1 70  ? 44.661 10.465  21.729  1.00 14.48  ? 67   ASP A C     1 
ATOM   555  O  O     . ASP A 1 70  ? 45.392 10.274  22.701  1.00 16.94  ? 67   ASP A O     1 
ATOM   556  C  CB    . ASP A 1 70  ? 42.508 9.175   21.546  1.00 19.29  ? 67   ASP A CB    1 
ATOM   557  C  CG    . ASP A 1 70  ? 41.018 9.144   21.855  1.00 24.41  ? 67   ASP A CG    1 
ATOM   558  O  OD1   . ASP A 1 70  ? 40.585 9.853   22.793  1.00 25.08  ? 67   ASP A OD1   1 
ATOM   559  O  OD2   . ASP A 1 70  ? 40.280 8.415   21.160  1.00 27.61  ? 67   ASP A OD2   1 
ATOM   560  N  N     . ALA A 1 71  ? 45.141 10.648  20.498  1.00 12.73  ? 68   ALA A N     1 
ATOM   561  C  CA    . ALA A 1 71  ? 46.581 10.712  20.260  1.00 14.70  ? 68   ALA A CA    1 
ATOM   562  C  C     . ALA A 1 71  ? 47.229 11.850  21.052  1.00 13.04  ? 68   ALA A C     1 
ATOM   563  O  O     . ALA A 1 71  ? 48.337 11.698  21.551  1.00 15.94  ? 68   ALA A O     1 
ATOM   564  C  CB    . ALA A 1 71  ? 46.873 10.867  18.776  1.00 13.75  ? 68   ALA A CB    1 
ATOM   565  N  N     . LYS A 1 72  ? 46.547 12.992  21.149  1.00 12.71  ? 69   LYS A N     1 
ATOM   566  C  CA    . LYS A 1 72  ? 47.052 14.126  21.937  1.00 14.05  ? 69   LYS A CA    1 
ATOM   567  C  C     . LYS A 1 72  ? 47.203 13.805  23.434  1.00 15.79  ? 69   LYS A C     1 
ATOM   568  O  O     . LYS A 1 72  ? 47.988 14.437  24.145  1.00 17.28  ? 69   LYS A O     1 
ATOM   569  C  CB    . LYS A 1 72  ? 46.135 15.347  21.757  1.00 17.84  ? 69   LYS A CB    1 
ATOM   570  C  CG    . LYS A 1 72  ? 46.417 16.171  20.491  1.00 21.72  ? 69   LYS A CG    1 
ATOM   571  C  CD    . LYS A 1 72  ? 47.688 16.986  20.668  1.00 24.48  ? 69   LYS A CD    1 
ATOM   572  C  CE    . LYS A 1 72  ? 47.852 18.033  19.581  1.00 25.28  ? 69   LYS A CE    1 
ATOM   573  N  NZ    . LYS A 1 72  ? 49.118 18.804  19.802  1.00 21.86  ? 69   LYS A NZ    1 
ATOM   574  N  N     . LYS A 1 73  ? 46.425 12.841  23.922  1.00 14.51  ? 70   LYS A N     1 
ATOM   575  C  CA    . LYS A 1 73  ? 46.538 12.404  25.313  1.00 13.95  ? 70   LYS A CA    1 
ATOM   576  C  C     . LYS A 1 73  ? 47.870 11.680  25.529  1.00 16.27  ? 70   LYS A C     1 
ATOM   577  O  O     . LYS A 1 73  ? 48.484 11.794  26.594  1.00 20.01  ? 70   LYS A O     1 
ATOM   578  C  CB    . LYS A 1 73  ? 45.360 11.493  25.666  1.00 14.03  ? 70   LYS A CB    1 
ATOM   579  C  CG    . LYS A 1 73  ? 43.997 12.149  25.427  1.00 15.47  ? 70   LYS A CG    1 
ATOM   580  C  CD    . LYS A 1 73  ? 42.830 11.207  25.712  1.00 17.74  ? 70   LYS A CD    1 
ATOM   581  C  CE    . LYS A 1 73  ? 41.499 11.927  25.495  1.00 23.37  ? 70   LYS A CE    1 
ATOM   582  N  NZ    . LYS A 1 73  ? 40.358 10.961  25.456  1.00 26.12  ? 70   LYS A NZ    1 
ATOM   583  N  N     . LEU A 1 74  ? 48.320 10.941  24.518  1.00 15.68  ? 71   LEU A N     1 
ATOM   584  C  CA    . LEU A 1 74  ? 49.591 10.221  24.607  1.00 14.79  ? 71   LEU A CA    1 
ATOM   585  C  C     . LEU A 1 74  ? 50.775 11.124  24.272  1.00 16.68  ? 71   LEU A C     1 
ATOM   586  O  O     . LEU A 1 74  ? 51.873 10.935  24.788  1.00 19.36  ? 71   LEU A O     1 
ATOM   587  C  CB    . LEU A 1 74  ? 49.606 9.041   23.633  1.00 16.14  ? 71   LEU A CB    1 
ATOM   588  C  CG    . LEU A 1 74  ? 48.509 7.998   23.804  1.00 14.88  ? 71   LEU A CG    1 
ATOM   589  C  CD1   . LEU A 1 74  ? 48.522 7.009   22.642  1.00 21.02  ? 71   LEU A CD1   1 
ATOM   590  C  CD2   . LEU A 1 74  ? 48.694 7.281   25.130  1.00 17.50  ? 71   LEU A CD2   1 
ATOM   591  N  N     . CYS A 1 75  ? 50.541 12.087  23.384  1.00 15.57  ? 72   CYS A N     1 
ATOM   592  C  CA    . CYS A 1 75  ? 51.598 12.943  22.858  1.00 14.71  ? 72   CYS A CA    1 
ATOM   593  C  C     . CYS A 1 75  ? 51.081 14.375  22.726  1.00 14.76  ? 72   CYS A C     1 
ATOM   594  O  O     . CYS A 1 75  ? 50.602 14.775  21.662  1.00 14.99  ? 72   CYS A O     1 
ATOM   595  C  CB    . CYS A 1 75  ? 52.014 12.407  21.494  1.00 14.91  ? 72   CYS A CB    1 
ATOM   596  S  SG    . CYS A 1 75  ? 53.372 13.290  20.673  1.00 20.32  ? 72   CYS A SG    1 
ATOM   597  N  N     . PRO A 1 76  ? 51.143 15.150  23.822  1.00 17.70  ? 73   PRO A N     1 
ATOM   598  C  CA    . PRO A 1 76  ? 50.550 16.490  23.853  1.00 18.15  ? 73   PRO A CA    1 
ATOM   599  C  C     . PRO A 1 76  ? 51.136 17.448  22.821  1.00 16.54  ? 73   PRO A C     1 
ATOM   600  O  O     . PRO A 1 76  ? 50.438 18.361  22.395  1.00 20.50  ? 73   PRO A O     1 
ATOM   601  C  CB    . PRO A 1 76  ? 50.883 16.984  25.267  1.00 22.91  ? 73   PRO A CB    1 
ATOM   602  C  CG    . PRO A 1 76  ? 51.039 15.758  26.063  1.00 25.54  ? 73   PRO A CG    1 
ATOM   603  C  CD    . PRO A 1 76  ? 51.639 14.738  25.144  1.00 22.89  ? 73   PRO A CD    1 
ATOM   604  N  N     . ASP A 1 77  ? 52.389 17.234  22.439  1.00 17.87  ? 74   ASP A N     1 
ATOM   605  C  CA    . ASP A 1 77  ? 53.039 18.095  21.459  1.00 22.48  ? 74   ASP A CA    1 
ATOM   606  C  C     . ASP A 1 77  ? 52.922 17.585  20.025  1.00 19.26  ? 74   ASP A C     1 
ATOM   607  O  O     . ASP A 1 77  ? 53.578 18.118  19.125  1.00 19.11  ? 74   ASP A O     1 
ATOM   608  C  CB    . ASP A 1 77  ? 54.513 18.267  21.809  1.00 28.21  ? 74   ASP A CB    1 
ATOM   609  C  CG    . ASP A 1 77  ? 54.713 18.958  23.137  1.00 41.24  ? 74   ASP A CG    1 
ATOM   610  O  OD1   . ASP A 1 77  ? 55.466 18.423  23.980  1.00 44.29  ? 74   ASP A OD1   1 
ATOM   611  O  OD2   . ASP A 1 77  ? 54.113 20.035  23.334  1.00 43.62  ? 74   ASP A OD2   1 
ATOM   612  N  N     . LEU A 1 78  ? 52.077 16.580  19.808  1.00 15.48  ? 75   LEU A N     1 
ATOM   613  C  CA    . LEU A 1 78  ? 51.886 16.013  18.475  1.00 13.09  ? 75   LEU A CA    1 
ATOM   614  C  C     . LEU A 1 78  ? 51.508 17.109  17.481  1.00 12.77  ? 75   LEU A C     1 
ATOM   615  O  O     . LEU A 1 78  ? 50.595 17.888  17.741  1.00 16.47  ? 75   LEU A O     1 
ATOM   616  C  CB    . LEU A 1 78  ? 50.779 14.948  18.516  1.00 14.04  ? 75   LEU A CB    1 
ATOM   617  C  CG    . LEU A 1 78  ? 50.433 14.241  17.201  1.00 11.06  ? 75   LEU A CG    1 
ATOM   618  C  CD1   . LEU A 1 78  ? 51.600 13.373  16.754  1.00 14.18  ? 75   LEU A CD1   1 
ATOM   619  C  CD2   . LEU A 1 78  ? 49.200 13.402  17.422  1.00 13.38  ? 75   LEU A CD2   1 
ATOM   620  N  N     . LEU A 1 79  ? 52.220 17.182  16.360  1.00 12.07  ? 76   LEU A N     1 
ATOM   621  C  CA    . LEU A 1 79  ? 51.822 18.097  15.296  1.00 12.75  ? 76   LEU A CA    1 
ATOM   622  C  C     . LEU A 1 79  ? 50.941 17.368  14.290  1.00 13.88  ? 76   LEU A C     1 
ATOM   623  O  O     . LEU A 1 79  ? 51.076 16.162  14.071  1.00 13.81  ? 76   LEU A O     1 
ATOM   624  C  CB    . LEU A 1 79  ? 53.050 18.690  14.605  1.00 10.58  ? 76   LEU A CB    1 
ATOM   625  C  CG    . LEU A 1 79  ? 54.007 19.413  15.557  1.00 11.45  ? 76   LEU A CG    1 
ATOM   626  C  CD1   . LEU A 1 79  ? 55.196 19.990  14.792  1.00 14.13  ? 76   LEU A CD1   1 
ATOM   627  C  CD2   . LEU A 1 79  ? 53.281 20.498  16.355  1.00 12.67  ? 76   LEU A CD2   1 
ATOM   628  N  N     . LEU A 1 80  ? 50.018 18.101  13.687  1.00 13.19  ? 77   LEU A N     1 
ATOM   629  C  CA    . LEU A 1 80  ? 49.059 17.492  12.772  1.00 13.63  ? 77   LEU A CA    1 
ATOM   630  C  C     . LEU A 1 80  ? 49.002 18.220  11.450  1.00 16.87  ? 77   LEU A C     1 
ATOM   631  O  O     . LEU A 1 80  ? 48.983 19.453  11.403  1.00 21.35  ? 77   LEU A O     1 
ATOM   632  C  CB    . LEU A 1 80  ? 47.665 17.472  13.391  1.00 14.58  ? 77   LEU A CB    1 
ATOM   633  C  CG    . LEU A 1 80  ? 47.528 16.642  14.660  1.00 15.11  ? 77   LEU A CG    1 
ATOM   634  C  CD1   . LEU A 1 80  ? 46.145 16.802  15.247  1.00 17.37  ? 77   LEU A CD1   1 
ATOM   635  C  CD2   . LEU A 1 80  ? 47.826 15.185  14.322  1.00 18.05  ? 77   LEU A CD2   1 
ATOM   636  N  N     . ALA A 1 81  ? 48.985 17.447  10.376  1.00 11.09  ? 78   ALA A N     1 
ATOM   637  C  CA    . ALA A 1 81  ? 48.724 17.976  9.049   1.00 10.41  ? 78   ALA A CA    1 
ATOM   638  C  C     . ALA A 1 81  ? 47.413 17.388  8.559   1.00 13.18  ? 78   ALA A C     1 
ATOM   639  O  O     . ALA A 1 81  ? 47.173 16.190  8.687   1.00 14.13  ? 78   ALA A O     1 
ATOM   640  C  CB    . ALA A 1 81  ? 49.861 17.634  8.090   1.00 13.89  ? 78   ALA A CB    1 
ATOM   641  N  N     . GLN A 1 82  ? 46.556 18.240  8.017   1.00 13.50  ? 79   GLN A N     1 
ATOM   642  C  CA    . GLN A 1 82  ? 45.244 17.793  7.544   1.00 14.20  ? 79   GLN A CA    1 
ATOM   643  C  C     . GLN A 1 82  ? 45.234 17.426  6.073   1.00 12.25  ? 79   GLN A C     1 
ATOM   644  O  O     . GLN A 1 82  ? 45.770 18.149  5.227   1.00 15.96  ? 79   GLN A O     1 
ATOM   645  C  CB    . GLN A 1 82  ? 44.196 18.884  7.748   1.00 16.20  ? 79   GLN A CB    1 
ATOM   646  C  CG    . GLN A 1 82  ? 43.810 19.126  9.182   1.00 19.06  ? 79   GLN A CG    1 
ATOM   647  C  CD    . GLN A 1 82  ? 42.581 19.993  9.270   1.00 30.96  ? 79   GLN A CD    1 
ATOM   648  O  OE1   . GLN A 1 82  ? 41.481 19.581  8.892   1.00 34.38  ? 79   GLN A OE1   1 
ATOM   649  N  NE2   . GLN A 1 82  ? 42.762 21.205  9.744   1.00 23.53  ? 79   GLN A NE2   1 
ATOM   650  N  N     . VAL A 1 83  ? 44.580 16.317  5.765   1.00 13.27  ? 80   VAL A N     1 
ATOM   651  C  CA    . VAL A 1 83  ? 44.269 15.984  4.385   1.00 13.00  ? 80   VAL A CA    1 
ATOM   652  C  C     . VAL A 1 83  ? 43.360 17.075  3.794   1.00 13.15  ? 80   VAL A C     1 
ATOM   653  O  O     . VAL A 1 83  ? 42.425 17.571  4.443   1.00 12.71  ? 80   VAL A O     1 
ATOM   654  C  CB    . VAL A 1 83  ? 43.566 14.615  4.287   1.00 11.96  ? 80   VAL A CB    1 
ATOM   655  C  CG1   . VAL A 1 83  ? 43.146 14.307  2.860   1.00 14.34  ? 80   VAL A CG1   1 
ATOM   656  C  CG2   . VAL A 1 83  ? 44.469 13.508  4.856   1.00 13.34  ? 80   VAL A CG2   1 
ATOM   657  N  N     . ARG A 1 84  ? 43.645 17.437  2.551   1.00 13.95  ? 81   ARG A N     1 
ATOM   658  C  CA    . ARG A 1 84  ? 42.879 18.436  1.816   1.00 12.60  ? 81   ARG A CA    1 
ATOM   659  C  C     . ARG A 1 84  ? 41.419 18.007  1.720   1.00 11.66  ? 81   ARG A C     1 
ATOM   660  O  O     . ARG A 1 84  ? 41.120 16.815  1.608   1.00 13.33  ? 81   ARG A O     1 
ATOM   661  C  CB    . ARG A 1 84  ? 43.473 18.570  0.409   1.00 16.84  ? 81   ARG A CB    1 
ATOM   662  C  CG    . ARG A 1 84  ? 42.640 19.393  -0.583  1.00 18.79  ? 81   ARG A CG    1 
ATOM   663  C  CD    . ARG A 1 84  ? 43.163 19.181  -2.010  1.00 30.61  ? 81   ARG A CD    1 
ATOM   664  N  NE    . ARG A 1 84  ? 42.259 19.737  -3.016  1.00 43.52  ? 81   ARG A NE    1 
ATOM   665  C  CZ    . ARG A 1 84  ? 42.359 19.518  -4.326  1.00 52.89  ? 81   ARG A CZ    1 
ATOM   666  N  NH1   . ARG A 1 84  ? 43.332 18.753  -4.808  1.00 44.81  ? 81   ARG A NH1   1 
ATOM   667  N  NH2   . ARG A 1 84  ? 41.482 20.068  -5.160  1.00 55.94  ? 81   ARG A NH2   1 
ATOM   668  N  N     . GLU A 1 85  ? 40.517 18.981  1.775   1.00 13.59  ? 82   GLU A N     1 
ATOM   669  C  CA    . GLU A 1 85  ? 39.109 18.704  1.528   1.00 16.38  ? 82   GLU A CA    1 
ATOM   670  C  C     . GLU A 1 85  ? 38.620 19.506  0.339   1.00 17.25  ? 82   GLU A C     1 
ATOM   671  O  O     . GLU A 1 85  ? 38.865 20.710  0.250   1.00 20.45  ? 82   GLU A O     1 
ATOM   672  C  CB    . GLU A 1 85  ? 38.277 19.035  2.763   1.00 17.20  ? 82   GLU A CB    1 
ATOM   673  C  CG    . GLU A 1 85  ? 38.517 18.065  3.899   1.00 15.27  ? 82   GLU A CG    1 
ATOM   674  C  CD    . GLU A 1 85  ? 37.725 18.414  5.142   1.00 22.99  ? 82   GLU A CD    1 
ATOM   675  O  OE1   . GLU A 1 85  ? 36.570 18.873  5.005   1.00 25.24  ? 82   GLU A OE1   1 
ATOM   676  O  OE2   . GLU A 1 85  ? 38.266 18.219  6.250   1.00 25.72  ? 82   GLU A OE2   1 
ATOM   677  N  N     . SER A 1 86  ? 37.934 18.820  -0.573  1.00 15.51  ? 83   SER A N     1 
ATOM   678  C  CA    . SER A 1 86  ? 37.357 19.435  -1.757  1.00 17.05  ? 83   SER A CA    1 
ATOM   679  C  C     . SER A 1 86  ? 35.996 18.796  -1.993  1.00 16.60  ? 83   SER A C     1 
ATOM   680  O  O     . SER A 1 86  ? 35.826 17.586  -1.803  1.00 16.62  ? 83   SER A O     1 
ATOM   681  C  CB    . SER A 1 86  ? 38.242 19.178  -2.981  1.00 20.07  ? 83   SER A CB    1 
ATOM   682  O  OG    . SER A 1 86  ? 39.520 19.777  -2.833  1.00 28.72  ? 83   SER A OG    1 
ATOM   683  N  N     . ARG A 1 87  ? 35.034 19.621  -2.399  1.00 21.08  ? 84   ARG A N     1 
ATOM   684  C  CA    . ARG A 1 87  ? 33.676 19.160  -2.678  1.00 19.81  ? 84   ARG A CA    1 
ATOM   685  C  C     . ARG A 1 87  ? 33.092 18.383  -1.509  1.00 20.89  ? 84   ARG A C     1 
ATOM   686  O  O     . ARG A 1 87  ? 32.351 17.417  -1.705  1.00 21.19  ? 84   ARG A O     1 
ATOM   687  C  CB    . ARG A 1 87  ? 33.651 18.296  -3.942  1.00 22.13  ? 84   ARG A CB    1 
ATOM   688  C  CG    . ARG A 1 87  ? 34.211 18.980  -5.174  1.00 31.70  ? 84   ARG A CG    1 
ATOM   689  C  CD    . ARG A 1 87  ? 34.220 18.026  -6.354  1.00 36.74  ? 84   ARG A CD    1 
ATOM   690  N  NE    . ARG A 1 87  ? 35.035 18.532  -7.451  1.00 41.84  ? 84   ARG A NE    1 
ATOM   691  C  CZ    . ARG A 1 87  ? 36.347 18.349  -7.555  1.00 40.57  ? 84   ARG A CZ    1 
ATOM   692  N  NH1   . ARG A 1 87  ? 37.013 17.669  -6.622  1.00 36.72  ? 84   ARG A NH1   1 
ATOM   693  N  NH2   . ARG A 1 87  ? 36.998 18.850  -8.594  1.00 38.53  ? 84   ARG A NH2   1 
ATOM   694  N  N     . GLY A 1 88  ? 33.447 18.791  -0.295  1.00 16.67  ? 85   GLY A N     1 
ATOM   695  C  CA    . GLY A 1 88  ? 32.847 18.226  0.898   1.00 17.98  ? 85   GLY A CA    1 
ATOM   696  C  C     . GLY A 1 88  ? 33.509 16.966  1.429   1.00 19.19  ? 85   GLY A C     1 
ATOM   697  O  O     . GLY A 1 88  ? 33.031 16.381  2.405   1.00 19.17  ? 85   GLY A O     1 
ATOM   698  N  N     . LYS A 1 89  ? 34.614 16.541  0.813   1.00 14.65  ? 86   LYS A N     1 
ATOM   699  C  CA    . LYS A 1 89  ? 35.238 15.276  1.194   1.00 15.19  ? 86   LYS A CA    1 
ATOM   700  C  C     . LYS A 1 89  ? 36.767 15.329  1.193   1.00 13.48  ? 86   LYS A C     1 
ATOM   701  O  O     . LYS A 1 89  ? 37.370 16.205  0.585   1.00 13.87  ? 86   LYS A O     1 
ATOM   702  C  CB    . LYS A 1 89  ? 34.783 14.151  0.255   1.00 17.46  ? 86   LYS A CB    1 
ATOM   703  C  CG    . LYS A 1 89  ? 35.225 14.334  -1.196  1.00 16.26  ? 86   LYS A CG    1 
ATOM   704  C  CD    . LYS A 1 89  ? 34.716 13.222  -2.116  1.00 19.12  ? 86   LYS A CD    1 
ATOM   705  C  CE    . LYS A 1 89  ? 35.355 11.871  -1.809  1.00 17.68  ? 86   LYS A CE    1 
ATOM   706  N  NZ    . LYS A 1 89  ? 36.857 11.884  -1.932  1.00 15.57  ? 86   LYS A NZ    1 
ATOM   707  N  N     . ALA A 1 90  ? 37.381 14.367  1.871   1.00 15.24  ? 87   ALA A N     1 
ATOM   708  C  CA    . ALA A 1 90  ? 38.825 14.239  1.853   1.00 15.42  ? 87   ALA A CA    1 
ATOM   709  C  C     . ALA A 1 90  ? 39.250 14.017  0.419   1.00 16.65  ? 87   ALA A C     1 
ATOM   710  O  O     . ALA A 1 90  ? 38.587 13.294  -0.328  1.00 17.31  ? 87   ALA A O     1 
ATOM   711  C  CB    . ALA A 1 90  ? 39.261 13.067  2.722   1.00 13.78  ? 87   ALA A CB    1 
ATOM   712  N  N     . ASN A 1 91  ? 40.346 14.651  0.023   1.00 14.55  ? 88   ASN A N     1 
ATOM   713  C  CA    . ASN A 1 91  ? 40.850 14.498  -1.339  1.00 16.10  ? 88   ASN A CA    1 
ATOM   714  C  C     . ASN A 1 91  ? 42.325 14.111  -1.301  1.00 15.69  ? 88   ASN A C     1 
ATOM   715  O  O     . ASN A 1 91  ? 43.144 14.834  -0.737  1.00 14.89  ? 88   ASN A O     1 
ATOM   716  C  CB    . ASN A 1 91  ? 40.644 15.792  -2.128  1.00 17.70  ? 88   ASN A CB    1 
ATOM   717  C  CG    . ASN A 1 91  ? 41.074 15.668  -3.587  1.00 21.12  ? 88   ASN A CG    1 
ATOM   718  O  OD1   . ASN A 1 91  ? 42.221 15.358  -3.880  1.00 18.30  ? 88   ASN A OD1   1 
ATOM   719  N  ND2   . ASN A 1 91  ? 40.142 15.910  -4.506  1.00 23.47  ? 88   ASN A ND2   1 
ATOM   720  N  N     . LEU A 1 92  ? 42.662 12.956  -1.868  1.00 12.42  ? 89   LEU A N     1 
ATOM   721  C  CA    . LEU A 1 92  ? 44.003 12.387  -1.707  1.00 11.75  ? 89   LEU A CA    1 
ATOM   722  C  C     . LEU A 1 92  ? 44.999 12.696  -2.835  1.00 10.43  ? 89   LEU A C     1 
ATOM   723  O  O     . LEU A 1 92  ? 46.069 12.079  -2.916  1.00 13.12  ? 89   LEU A O     1 
ATOM   724  C  CB    . LEU A 1 92  ? 43.915 10.864  -1.517  1.00 12.92  ? 89   LEU A CB    1 
ATOM   725  C  CG    . LEU A 1 92  ? 42.968 10.443  -0.387  1.00 17.08  ? 89   LEU A CG    1 
ATOM   726  C  CD1   . LEU A 1 92  ? 42.818 8.931   -0.371  1.00 17.70  ? 89   LEU A CD1   1 
ATOM   727  C  CD2   . LEU A 1 92  ? 43.510 10.939  0.948   1.00 19.16  ? 89   LEU A CD2   1 
ATOM   728  N  N     . THR A 1 93  ? 44.668 13.668  -3.675  1.00 10.95  ? 90   THR A N     1 
ATOM   729  C  CA    . THR A 1 93  ? 45.494 13.967  -4.851  1.00 10.67  ? 90   THR A CA    1 
ATOM   730  C  C     . THR A 1 93  ? 46.973 14.208  -4.534  1.00 12.27  ? 90   THR A C     1 
ATOM   731  O  O     . THR A 1 93  ? 47.838 13.727  -5.262  1.00 12.87  ? 90   THR A O     1 
ATOM   732  C  CB    . THR A 1 93  ? 44.920 15.182  -5.615  1.00 15.12  ? 90   THR A CB    1 
ATOM   733  O  OG1   . THR A 1 93  ? 43.590 14.887  -6.063  1.00 20.37  ? 90   THR A OG1   1 
ATOM   734  C  CG2   . THR A 1 93  ? 45.791 15.547  -6.816  1.00 16.12  ? 90   THR A CG2   1 
ATOM   735  N  N     . LYS A 1 94  ? 47.277 14.951  -3.469  1.00 11.69  ? 91   LYS A N     1 
ATOM   736  C  CA    . LYS A 1 94  ? 48.678 15.253  -3.166  1.00 12.81  ? 91   LYS A CA    1 
ATOM   737  C  C     . LYS A 1 94  ? 49.496 13.964  -3.018  1.00 13.59  ? 91   LYS A C     1 
ATOM   738  O  O     . LYS A 1 94  ? 50.644 13.866  -3.477  1.00 12.76  ? 91   LYS A O     1 
ATOM   739  C  CB    . LYS A 1 94  ? 48.774 16.100  -1.893  1.00 14.33  ? 91   LYS A CB    1 
ATOM   740  C  CG    . LYS A 1 94  ? 50.176 16.641  -1.630  1.00 13.79  ? 91   LYS A CG    1 
ATOM   741  C  CD    . LYS A 1 94  ? 50.313 17.197  -0.212  1.00 16.22  ? 91   LYS A CD    1 
ATOM   742  C  CE    . LYS A 1 94  ? 49.339 18.309  0.058   1.00 22.44  ? 91   LYS A CE    1 
ATOM   743  N  NZ    . LYS A 1 94  ? 49.562 18.869  1.421   1.00 16.71  ? 91   LYS A NZ    1 
ATOM   744  N  N     . TYR A 1 95  ? 48.900 12.966  -2.375  1.00 11.20  ? 92   TYR A N     1 
ATOM   745  C  CA    . TYR A 1 95  ? 49.606 11.737  -2.073  1.00 9.94   ? 92   TYR A CA    1 
ATOM   746  C  C     . TYR A 1 95  ? 49.695 10.864  -3.308  1.00 12.39  ? 92   TYR A C     1 
ATOM   747  O  O     . TYR A 1 95  ? 50.715 10.225  -3.541  1.00 12.35  ? 92   TYR A O     1 
ATOM   748  C  CB    . TYR A 1 95  ? 48.961 11.010  -0.882  1.00 11.08  ? 92   TYR A CB    1 
ATOM   749  C  CG    . TYR A 1 95  ? 48.675 11.982  0.228   1.00 9.63   ? 92   TYR A CG    1 
ATOM   750  C  CD1   . TYR A 1 95  ? 47.380 12.379  0.496   1.00 10.34  ? 92   TYR A CD1   1 
ATOM   751  C  CD2   . TYR A 1 95  ? 49.710 12.600  0.935   1.00 10.22  ? 92   TYR A CD2   1 
ATOM   752  C  CE1   . TYR A 1 95  ? 47.101 13.313  1.462   1.00 13.54  ? 92   TYR A CE1   1 
ATOM   753  C  CE2   . TYR A 1 95  ? 49.437 13.525  1.919   1.00 10.02  ? 92   TYR A CE2   1 
ATOM   754  C  CZ    . TYR A 1 95  ? 48.129 13.875  2.171   1.00 11.61  ? 92   TYR A CZ    1 
ATOM   755  O  OH    . TYR A 1 95  ? 47.802 14.807  3.121   1.00 15.14  ? 92   TYR A OH    1 
ATOM   756  N  N     . ARG A 1 96  ? 48.640 10.861  -4.116  1.00 11.07  ? 93   ARG A N     1 
ATOM   757  C  CA    . ARG A 1 96  ? 48.695 10.115  -5.375  1.00 11.94  ? 93   ARG A CA    1 
ATOM   758  C  C     . ARG A 1 96  ? 49.783 10.685  -6.283  1.00 13.76  ? 93   ARG A C     1 
ATOM   759  O  O     . ARG A 1 96  ? 50.503 9.932   -6.937  1.00 13.42  ? 93   ARG A O     1 
ATOM   760  C  CB    . ARG A 1 96  ? 47.344 10.132  -6.096  1.00 11.12  ? 93   ARG A CB    1 
ATOM   761  C  CG    . ARG A 1 96  ? 46.251 9.346   -5.377  1.00 13.11  ? 93   ARG A CG    1 
ATOM   762  C  CD    . ARG A 1 96  ? 45.027 9.095   -6.261  1.00 16.08  ? 93   ARG A CD    1 
ATOM   763  N  NE    . ARG A 1 96  ? 44.013 8.393   -5.481  1.00 19.67  ? 93   ARG A NE    1 
ATOM   764  C  CZ    . ARG A 1 96  ? 42.985 8.980   -4.874  1.00 16.38  ? 93   ARG A CZ    1 
ATOM   765  N  NH1   . ARG A 1 96  ? 42.151 8.237   -4.155  1.00 15.38  ? 93   ARG A NH1   1 
ATOM   766  N  NH2   . ARG A 1 96  ? 42.787 10.294  -4.985  1.00 17.01  ? 93   ARG A NH2   1 
ATOM   767  N  N     . GLU A 1 97  ? 49.891 12.014  -6.335  1.00 13.19  ? 94   GLU A N     1 
ATOM   768  C  CA    . GLU A 1 97  ? 50.907 12.654  -7.173  1.00 12.42  ? 94   GLU A CA    1 
ATOM   769  C  C     . GLU A 1 97  ? 52.327 12.373  -6.666  1.00 13.55  ? 94   GLU A C     1 
ATOM   770  O  O     . GLU A 1 97  ? 53.241 12.131  -7.455  1.00 13.48  ? 94   GLU A O     1 
ATOM   771  C  CB    . GLU A 1 97  ? 50.624 14.149  -7.321  1.00 12.84  ? 94   GLU A CB    1 
ATOM   772  C  CG    . GLU A 1 97  ? 49.404 14.391  -8.205  1.00 14.85  ? 94   GLU A CG    1 
ATOM   773  C  CD    . GLU A 1 97  ? 49.017 15.849  -8.362  1.00 27.95  ? 94   GLU A CD    1 
ATOM   774  O  OE1   . GLU A 1 97  ? 49.595 16.719  -7.680  1.00 33.69  ? 94   GLU A OE1   1 
ATOM   775  O  OE2   . GLU A 1 97  ? 48.116 16.124  -9.182  1.00 28.70  ? 94   GLU A OE2   1 
ATOM   776  N  N     . ALA A 1 98  ? 52.501 12.377  -5.348  1.00 11.88  ? 95   ALA A N     1 
ATOM   777  C  CA    . ALA A 1 98  ? 53.789 12.040  -4.765  1.00 12.37  ? 95   ALA A CA    1 
ATOM   778  C  C     . ALA A 1 98  ? 54.156 10.593  -5.053  1.00 11.86  ? 95   ALA A C     1 
ATOM   779  O  O     . ALA A 1 98  ? 55.323 10.280  -5.249  1.00 11.75  ? 95   ALA A O     1 
ATOM   780  C  CB    . ALA A 1 98  ? 53.763 12.290  -3.255  1.00 12.04  ? 95   ALA A CB    1 
ATOM   781  N  N     . SER A 1 99  ? 53.160 9.713   -5.059  1.00 11.30  ? 96   SER A N     1 
ATOM   782  C  CA    . SER A 1 99  ? 53.385 8.317   -5.388  1.00 10.98  ? 96   SER A CA    1 
ATOM   783  C  C     . SER A 1 99  ? 53.912 8.179   -6.813  1.00 11.52  ? 96   SER A C     1 
ATOM   784  O  O     . SER A 1 99  ? 54.851 7.436   -7.068  1.00 12.05  ? 96   SER A O     1 
ATOM   785  C  CB    . SER A 1 99  ? 52.076 7.525   -5.237  1.00 12.67  ? 96   SER A CB    1 
ATOM   786  O  OG    . SER A 1 99  ? 52.221 6.180   -5.679  1.00 15.26  ? 96   SER A OG    1 
ATOM   787  N  N     . VAL A 1 100 ? 53.296 8.891   -7.748  1.00 10.16  ? 97   VAL A N     1 
ATOM   788  C  CA    . VAL A 1 100 ? 53.795 8.880   -9.126  1.00 13.76  ? 97   VAL A CA    1 
ATOM   789  C  C     . VAL A 1 100 ? 55.275 9.310   -9.208  1.00 13.22  ? 97   VAL A C     1 
ATOM   790  O  O     . VAL A 1 100 ? 56.049 8.728   -9.965  1.00 14.17  ? 97   VAL A O     1 
ATOM   791  C  CB    . VAL A 1 100 ? 52.907 9.729   -10.064 1.00 14.35  ? 97   VAL A CB    1 
ATOM   792  C  CG1   . VAL A 1 100 ? 53.551 9.870   -11.459 1.00 15.78  ? 97   VAL A CG1   1 
ATOM   793  C  CG2   . VAL A 1 100 ? 51.500 9.113   -10.192 1.00 12.67  ? 97   VAL A CG2   1 
ATOM   794  N  N     . GLU A 1 101 ? 55.684 10.302  -8.417  1.00 12.29  ? 98   GLU A N     1 
ATOM   795  C  CA    . GLU A 1 101 ? 57.104 10.698  -8.406  1.00 15.23  ? 98   GLU A CA    1 
ATOM   796  C  C     . GLU A 1 101 ? 58.002 9.510   -8.107  1.00 14.50  ? 98   GLU A C     1 
ATOM   797  O  O     . GLU A 1 101 ? 59.032 9.297   -8.761  1.00 14.61  ? 98   GLU A O     1 
ATOM   798  C  CB    . GLU A 1 101 ? 57.410 11.767  -7.340  1.00 14.60  ? 98   GLU A CB    1 
ATOM   799  C  CG    . GLU A 1 101 ? 56.841 13.132  -7.579  1.00 17.07  ? 98   GLU A CG    1 
ATOM   800  C  CD    . GLU A 1 101 ? 57.230 14.115  -6.469  1.00 17.02  ? 98   GLU A CD    1 
ATOM   801  O  OE1   . GLU A 1 101 ? 58.440 14.453  -6.349  1.00 17.35  ? 98   GLU A OE1   1 
ATOM   802  O  OE2   . GLU A 1 101 ? 56.320 14.551  -5.721  1.00 20.14  ? 98   GLU A OE2   1 
ATOM   803  N  N     . VAL A 1 102 ? 57.637 8.746   -7.083  1.00 11.02  ? 99   VAL A N     1 
ATOM   804  C  CA    . VAL A 1 102 ? 58.489 7.654   -6.651  1.00 10.98  ? 99   VAL A CA    1 
ATOM   805  C  C     . VAL A 1 102 ? 58.448 6.487   -7.637  1.00 11.72  ? 99   VAL A C     1 
ATOM   806  O  O     . VAL A 1 102 ? 59.492 5.923   -7.989  1.00 16.53  ? 99   VAL A O     1 
ATOM   807  C  CB    . VAL A 1 102 ? 58.085 7.169   -5.249  1.00 14.14  ? 99   VAL A CB    1 
ATOM   808  C  CG1   . VAL A 1 102 ? 58.852 5.920   -4.889  1.00 21.43  ? 99   VAL A CG1   1 
ATOM   809  C  CG2   . VAL A 1 102 ? 58.338 8.284   -4.218  1.00 13.53  ? 99   VAL A CG2   1 
ATOM   810  N  N     . MET A 1 103 ? 57.252 6.132   -8.096  1.00 11.07  ? 100  MET A N     1 
ATOM   811  C  CA    . MET A 1 103 ? 57.100 5.027   -9.030  1.00 13.72  ? 100  MET A CA    1 
ATOM   812  C  C     . MET A 1 103 ? 57.854 5.295   -10.325 1.00 14.51  ? 100  MET A C     1 
ATOM   813  O  O     . MET A 1 103 ? 58.414 4.381   -10.910 1.00 13.34  ? 100  MET A O     1 
ATOM   814  C  CB    . MET A 1 103 ? 55.623 4.779   -9.349  1.00 16.36  ? 100  MET A CB    1 
ATOM   815  C  CG    . MET A 1 103 ? 54.723 4.573   -8.143  1.00 16.57  ? 100  MET A CG    1 
ATOM   816  S  SD    . MET A 1 103 ? 55.014 2.941   -7.424  1.00 20.93  ? 100  MET A SD    1 
ATOM   817  C  CE    . MET A 1 103 ? 54.170 3.044   -5.822  1.00 20.52  ? 100  MET A CE    1 
ATOM   818  N  N     . GLU A 1 104 ? 57.880 6.548   -10.772 1.00 12.15  ? 101  GLU A N     1 
ATOM   819  C  CA    . GLU A 1 104 ? 58.596 6.862   -12.000 1.00 15.18  ? 101  GLU A CA    1 
ATOM   820  C  C     . GLU A 1 104 ? 60.109 6.688   -11.846 1.00 15.37  ? 101  GLU A C     1 
ATOM   821  O  O     . GLU A 1 104 ? 60.783 6.233   -12.771 1.00 17.59  ? 101  GLU A O     1 
ATOM   822  C  CB    . GLU A 1 104 ? 58.209 8.250   -12.529 1.00 14.70  ? 101  GLU A CB    1 
ATOM   823  C  CG    . GLU A 1 104 ? 56.801 8.250   -13.152 1.00 19.69  ? 101  GLU A CG    1 
ATOM   824  C  CD    . GLU A 1 104 ? 56.414 9.570   -13.795 1.00 33.73  ? 101  GLU A CD    1 
ATOM   825  O  OE1   . GLU A 1 104 ? 57.203 10.535  -13.721 1.00 33.15  ? 101  GLU A OE1   1 
ATOM   826  O  OE2   . GLU A 1 104 ? 55.308 9.638   -14.376 1.00 32.64  ? 101  GLU A OE2   1 
ATOM   827  N  N     . ILE A 1 105 ? 60.639 7.011   -10.670 1.00 11.99  ? 102  ILE A N     1 
ATOM   828  C  CA    . ILE A 1 105 ? 62.061 6.799   -10.412 1.00 12.52  ? 102  ILE A CA    1 
ATOM   829  C  C     . ILE A 1 105 ? 62.383 5.310   -10.363 1.00 14.00  ? 102  ILE A C     1 
ATOM   830  O  O     . ILE A 1 105 ? 63.350 4.849   -10.970 1.00 15.04  ? 102  ILE A O     1 
ATOM   831  C  CB    . ILE A 1 105 ? 62.478 7.484   -9.110  1.00 12.66  ? 102  ILE A CB    1 
ATOM   832  C  CG1   . ILE A 1 105 ? 62.389 9.004   -9.265  1.00 14.04  ? 102  ILE A CG1   1 
ATOM   833  C  CG2   . ILE A 1 105 ? 63.883 7.058   -8.703  1.00 13.33  ? 102  ILE A CG2   1 
ATOM   834  C  CD1   . ILE A 1 105 ? 62.326 9.739   -7.936  1.00 15.38  ? 102  ILE A CD1   1 
ATOM   835  N  N     . MET A 1 106 ? 61.551 4.544   -9.664  1.00 12.28  ? 103  MET A N     1 
ATOM   836  C  CA    . MET A 1 106 ? 61.795 3.107   -9.560  1.00 12.95  ? 103  MET A CA    1 
ATOM   837  C  C     . MET A 1 106 ? 61.788 2.448   -10.914 1.00 13.08  ? 103  MET A C     1 
ATOM   838  O  O     . MET A 1 106 ? 62.583 1.543   -11.168 1.00 14.68  ? 103  MET A O     1 
ATOM   839  C  CB    . MET A 1 106 ? 60.766 2.443   -8.648  1.00 14.19  ? 103  MET A CB    1 
ATOM   840  C  CG    . MET A 1 106 ? 60.993 2.794   -7.191  1.00 13.36  ? 103  MET A CG    1 
ATOM   841  S  SD    . MET A 1 106 ? 59.839 1.909   -6.123  1.00 20.30  ? 103  MET A SD    1 
ATOM   842  C  CE    . MET A 1 106 ? 58.294 2.608   -6.657  1.00 37.05  ? 103  MET A CE    1 
ATOM   843  N  N     . SER A 1 107 ? 60.890 2.894   -11.781 1.00 14.62  ? 104  SER A N     1 
ATOM   844  C  CA    . SER A 1 107 ? 60.772 2.285   -13.104 1.00 16.67  ? 104  SER A CA    1 
ATOM   845  C  C     . SER A 1 107 ? 62.025 2.465   -13.971 1.00 16.79  ? 104  SER A C     1 
ATOM   846  O  O     . SER A 1 107 ? 62.162 1.795   -14.997 1.00 18.64  ? 104  SER A O     1 
ATOM   847  C  CB    . SER A 1 107 ? 59.541 2.840   -13.839 1.00 18.19  ? 104  SER A CB    1 
ATOM   848  O  OG    A SER A 1 107 ? 59.758 4.159   -14.295 0.40 23.81  ? 104  SER A OG    1 
ATOM   849  O  OG    B SER A 1 107 ? 58.347 2.491   -13.167 0.60 19.28  ? 104  SER A OG    1 
ATOM   850  N  N     . ARG A 1 108 ? 62.924 3.375   -13.593 1.00 15.97  ? 105  ARG A N     1 
ATOM   851  C  CA    . ARG A 1 108 ? 64.182 3.520   -14.343 1.00 15.83  ? 105  ARG A CA    1 
ATOM   852  C  C     . ARG A 1 108 ? 65.091 2.317   -14.136 1.00 19.59  ? 105  ARG A C     1 
ATOM   853  O  O     . ARG A 1 108 ? 65.920 1.994   -14.992 1.00 21.85  ? 105  ARG A O     1 
ATOM   854  C  CB    . ARG A 1 108 ? 64.951 4.786   -13.945 1.00 19.00  ? 105  ARG A CB    1 
ATOM   855  C  CG    . ARG A 1 108 ? 64.207 6.084   -14.138 1.00 17.08  ? 105  ARG A CG    1 
ATOM   856  C  CD    . ARG A 1 108 ? 65.185 7.249   -14.370 1.00 26.14  ? 105  ARG A CD    1 
ATOM   857  N  NE    . ARG A 1 108 ? 66.211 7.346   -13.332 1.00 29.40  ? 105  ARG A NE    1 
ATOM   858  C  CZ    . ARG A 1 108 ? 66.167 8.207   -12.319 1.00 25.39  ? 105  ARG A CZ    1 
ATOM   859  N  NH1   . ARG A 1 108 ? 67.138 8.228   -11.417 1.00 25.61  ? 105  ARG A NH1   1 
ATOM   860  N  NH2   . ARG A 1 108 ? 65.144 9.037   -12.210 1.00 20.81  ? 105  ARG A NH2   1 
ATOM   861  N  N     . PHE A 1 109 ? 64.947 1.662   -12.991 1.00 20.55  ? 106  PHE A N     1 
ATOM   862  C  CA    . PHE A 1 109 ? 65.842 0.573   -12.618 1.00 22.01  ? 106  PHE A CA    1 
ATOM   863  C  C     . PHE A 1 109 ? 65.338 -0.776  -13.106 1.00 21.87  ? 106  PHE A C     1 
ATOM   864  O  O     . PHE A 1 109 ? 66.125 -1.647  -13.494 1.00 24.56  ? 106  PHE A O     1 
ATOM   865  C  CB    . PHE A 1 109 ? 66.026 0.549   -11.100 1.00 17.06  ? 106  PHE A CB    1 
ATOM   866  C  CG    . PHE A 1 109 ? 66.772 1.733   -10.565 1.00 21.98  ? 106  PHE A CG    1 
ATOM   867  C  CD1   . PHE A 1 109 ? 66.139 2.958   -10.407 1.00 19.66  ? 106  PHE A CD1   1 
ATOM   868  C  CD2   . PHE A 1 109 ? 68.116 1.625   -10.222 1.00 19.05  ? 106  PHE A CD2   1 
ATOM   869  C  CE1   . PHE A 1 109 ? 66.820 4.048   -9.913  1.00 19.56  ? 106  PHE A CE1   1 
ATOM   870  C  CE2   . PHE A 1 109 ? 68.801 2.720   -9.726  1.00 19.98  ? 106  PHE A CE2   1 
ATOM   871  C  CZ    . PHE A 1 109 ? 68.159 3.928   -9.570  1.00 21.44  ? 106  PHE A CZ    1 
ATOM   872  N  N     . ALA A 1 110 ? 64.025 -0.950  -13.096 1.00 23.11  ? 107  ALA A N     1 
ATOM   873  C  CA    . ALA A 1 110 ? 63.434 -2.239  -13.411 1.00 22.78  ? 107  ALA A CA    1 
ATOM   874  C  C     . ALA A 1 110 ? 61.937 -2.107  -13.595 1.00 26.66  ? 107  ALA A C     1 
ATOM   875  O  O     . ALA A 1 110 ? 61.347 -1.082  -13.249 1.00 23.63  ? 107  ALA A O     1 
ATOM   876  C  CB    . ALA A 1 110 ? 63.733 -3.234  -12.304 1.00 24.35  ? 107  ALA A CB    1 
ATOM   877  N  N     . VAL A 1 111 ? 61.324 -3.152  -14.138 1.00 30.39  ? 108  VAL A N     1 
ATOM   878  C  CA    . VAL A 1 111 ? 59.875 -3.215  -14.244 1.00 36.43  ? 108  VAL A CA    1 
ATOM   879  C  C     . VAL A 1 111 ? 59.278 -3.345  -12.848 1.00 22.40  ? 108  VAL A C     1 
ATOM   880  O  O     . VAL A 1 111 ? 59.761 -4.141  -12.027 1.00 26.30  ? 108  VAL A O     1 
ATOM   881  C  CB    . VAL A 1 111 ? 59.426 -4.412  -15.098 1.00 47.41  ? 108  VAL A CB    1 
ATOM   882  C  CG1   . VAL A 1 111 ? 57.911 -4.539  -15.076 1.00 49.55  ? 108  VAL A CG1   1 
ATOM   883  C  CG2   . VAL A 1 111 ? 59.937 -4.261  -16.524 1.00 51.30  ? 108  VAL A CG2   1 
ATOM   884  N  N     . ILE A 1 112 ? 58.255 -2.542  -12.566 1.00 22.41  ? 109  ILE A N     1 
ATOM   885  C  CA    . ILE A 1 112 ? 57.640 -2.564  -11.246 1.00 17.54  ? 109  ILE A CA    1 
ATOM   886  C  C     . ILE A 1 112 ? 56.163 -2.938  -11.264 1.00 14.65  ? 109  ILE A C     1 
ATOM   887  O  O     . ILE A 1 112 ? 55.453 -2.765  -12.260 1.00 17.04  ? 109  ILE A O     1 
ATOM   888  C  CB    . ILE A 1 112 ? 57.817 -1.224  -10.486 1.00 21.59  ? 109  ILE A CB    1 
ATOM   889  C  CG1   . ILE A 1 112 ? 56.908 -0.141  -11.061 1.00 22.75  ? 109  ILE A CG1   1 
ATOM   890  C  CG2   . ILE A 1 112 ? 59.281 -0.801  -10.484 1.00 26.54  ? 109  ILE A CG2   1 
ATOM   891  C  CD1   . ILE A 1 112 ? 56.781 1.080   -10.138 1.00 24.67  ? 109  ILE A CD1   1 
ATOM   892  N  N     . GLU A 1 113 ? 55.714 -3.474  -10.138 1.00 12.09  ? 110  GLU A N     1 
ATOM   893  C  CA    . GLU A 1 113 ? 54.291 -3.703  -9.886  1.00 11.75  ? 110  GLU A CA    1 
ATOM   894  C  C     . GLU A 1 113 ? 53.844 -2.773  -8.773  1.00 13.15  ? 110  GLU A C     1 
ATOM   895  O  O     . GLU A 1 113 ? 54.299 -2.890  -7.637  1.00 13.00  ? 110  GLU A O     1 
ATOM   896  C  CB    . GLU A 1 113 ? 54.027 -5.161  -9.466  1.00 12.86  ? 110  GLU A CB    1 
ATOM   897  C  CG    . GLU A 1 113 ? 52.567 -5.413  -9.122  1.00 15.72  ? 110  GLU A CG    1 
ATOM   898  C  CD    . GLU A 1 113 ? 52.277 -6.851  -8.695  1.00 21.25  ? 110  GLU A CD    1 
ATOM   899  O  OE1   . GLU A 1 113 ? 51.172 -7.090  -8.150  1.00 24.69  ? 110  GLU A OE1   1 
ATOM   900  O  OE2   . GLU A 1 113 ? 53.136 -7.741  -8.902  1.00 18.34  ? 110  GLU A OE2   1 
ATOM   901  N  N     . ARG A 1 114 ? 52.975 -1.825  -9.103  1.00 12.21  ? 111  ARG A N     1 
ATOM   902  C  CA    . ARG A 1 114 ? 52.433 -0.923  -8.090  1.00 12.16  ? 111  ARG A CA    1 
ATOM   903  C  C     . ARG A 1 114 ? 51.531 -1.731  -7.171  1.00 16.28  ? 111  ARG A C     1 
ATOM   904  O  O     . ARG A 1 114 ? 50.472 -2.195  -7.588  1.00 22.94  ? 111  ARG A O     1 
ATOM   905  C  CB    . ARG A 1 114 ? 51.631 0.204   -8.751  1.00 13.19  ? 111  ARG A CB    1 
ATOM   906  C  CG    . ARG A 1 114 ? 50.960 1.164   -7.748  1.00 13.41  ? 111  ARG A CG    1 
ATOM   907  C  CD    . ARG A 1 114 ? 49.909 2.032   -8.447  1.00 15.27  ? 111  ARG A CD    1 
ATOM   908  N  NE    . ARG A 1 114 ? 49.565 3.247   -7.712  1.00 20.27  ? 111  ARG A NE    1 
ATOM   909  C  CZ    . ARG A 1 114 ? 48.644 3.320   -6.759  1.00 25.81  ? 111  ARG A CZ    1 
ATOM   910  N  NH1   . ARG A 1 114 ? 47.976 2.236   -6.390  1.00 21.86  ? 111  ARG A NH1   1 
ATOM   911  N  NH2   . ARG A 1 114 ? 48.400 4.484   -6.169  1.00 21.75  ? 111  ARG A NH2   1 
ATOM   912  N  N     . ALA A 1 115 ? 51.940 -1.900  -5.922  1.00 12.99  ? 112  ALA A N     1 
ATOM   913  C  CA    . ALA A 1 115 ? 51.166 -2.703  -4.980  1.00 13.92  ? 112  ALA A CA    1 
ATOM   914  C  C     . ALA A 1 115 ? 50.210 -1.875  -4.139  1.00 19.97  ? 112  ALA A C     1 
ATOM   915  O  O     . ALA A 1 115 ? 49.189 -2.380  -3.664  1.00 22.37  ? 112  ALA A O     1 
ATOM   916  C  CB    . ALA A 1 115 ? 52.098 -3.490  -4.078  1.00 15.23  ? 112  ALA A CB    1 
ATOM   917  N  N     . SER A 1 116 ? 50.554 -0.609  -3.941  1.00 14.25  ? 113  SER A N     1 
ATOM   918  C  CA    . SER A 1 116 ? 49.705 0.315   -3.202  1.00 15.41  ? 113  SER A CA    1 
ATOM   919  C  C     . SER A 1 116 ? 50.196 1.719   -3.488  1.00 13.17  ? 113  SER A C     1 
ATOM   920  O  O     . SER A 1 116 ? 51.092 1.907   -4.297  1.00 14.47  ? 113  SER A O     1 
ATOM   921  C  CB    . SER A 1 116 ? 49.764 0.046   -1.695  1.00 18.36  ? 113  SER A CB    1 
ATOM   922  O  OG    . SER A 1 116 ? 50.965 0.552   -1.138  1.00 20.89  ? 113  SER A OG    1 
ATOM   923  N  N     . ILE A 1 117 ? 49.614 2.705   -2.815  1.00 12.76  ? 114  ILE A N     1 
ATOM   924  C  CA    . ILE A 1 117 ? 50.002 4.092   -3.044  1.00 12.17  ? 114  ILE A CA    1 
ATOM   925  C  C     . ILE A 1 117 ? 51.487 4.312   -2.729  1.00 12.40  ? 114  ILE A C     1 
ATOM   926  O  O     . ILE A 1 117 ? 52.121 5.201   -3.298  1.00 13.32  ? 114  ILE A O     1 
ATOM   927  C  CB    . ILE A 1 117 ? 49.102 5.059   -2.237  1.00 13.30  ? 114  ILE A CB    1 
ATOM   928  C  CG1   . ILE A 1 117 ? 49.244 6.495   -2.754  1.00 12.59  ? 114  ILE A CG1   1 
ATOM   929  C  CG2   . ILE A 1 117 ? 49.390 4.963   -0.742  1.00 13.93  ? 114  ILE A CG2   1 
ATOM   930  C  CD1   . ILE A 1 117 ? 48.124 7.420   -2.308  1.00 14.50  ? 114  ILE A CD1   1 
ATOM   931  N  N     . ASP A 1 118 ? 52.056 3.509   -1.830  1.00 12.31  ? 115  ASP A N     1 
ATOM   932  C  CA    . ASP A 1 118 ? 53.439 3.763   -1.457  1.00 12.58  ? 115  ASP A CA    1 
ATOM   933  C  C     . ASP A 1 118 ? 54.357 2.570   -1.519  1.00 14.02  ? 115  ASP A C     1 
ATOM   934  O  O     . ASP A 1 118 ? 55.435 2.567   -0.906  1.00 13.71  ? 115  ASP A O     1 
ATOM   935  C  CB    . ASP A 1 118 ? 53.496 4.398   -0.073  1.00 12.51  ? 115  ASP A CB    1 
ATOM   936  C  CG    . ASP A 1 118 ? 53.492 3.379   1.039   1.00 14.18  ? 115  ASP A CG    1 
ATOM   937  O  OD1   . ASP A 1 118 ? 54.201 3.652   2.036   1.00 14.67  ? 115  ASP A OD1   1 
ATOM   938  O  OD2   . ASP A 1 118 ? 52.824 2.313   0.923   1.00 17.17  ? 115  ASP A OD2   1 
ATOM   939  N  N     . GLU A 1 119 ? 53.971 1.565   -2.283  1.00 12.15  ? 116  GLU A N     1 
ATOM   940  C  CA    . GLU A 1 119 ? 54.883 0.461   -2.419  1.00 15.65  ? 116  GLU A CA    1 
ATOM   941  C  C     . GLU A 1 119 ? 54.821 -0.253  -3.727  1.00 11.48  ? 116  GLU A C     1 
ATOM   942  O  O     . GLU A 1 119 ? 53.794 -0.268  -4.382  1.00 13.73  ? 116  GLU A O     1 
ATOM   943  C  CB    . GLU A 1 119 ? 54.720 -0.527  -1.268  1.00 27.37  ? 116  GLU A CB    1 
ATOM   944  C  CG    . GLU A 1 119 ? 53.412 -1.241  -1.253  1.00 24.73  ? 116  GLU A CG    1 
ATOM   945  C  CD    . GLU A 1 119 ? 53.094 -1.827  0.114   1.00 38.65  ? 116  GLU A CD    1 
ATOM   946  O  OE1   . GLU A 1 119 ? 53.606 -2.920  0.435   1.00 34.32  ? 116  GLU A OE1   1 
ATOM   947  O  OE2   . GLU A 1 119 ? 52.339 -1.187  0.872   1.00 43.28  ? 116  GLU A OE2   1 
ATOM   948  N  N     . ALA A 1 120 ? 55.956 -0.815  -4.116  1.00 10.98  ? 117  ALA A N     1 
ATOM   949  C  CA    . ALA A 1 120 ? 56.059 -1.484  -5.387  1.00 10.55  ? 117  ALA A CA    1 
ATOM   950  C  C     . ALA A 1 120 ? 57.025 -2.652  -5.307  1.00 11.09  ? 117  ALA A C     1 
ATOM   951  O  O     . ALA A 1 120 ? 58.062 -2.576  -4.639  1.00 12.86  ? 117  ALA A O     1 
ATOM   952  C  CB    . ALA A 1 120 ? 56.495 -0.502  -6.474  1.00 16.40  ? 117  ALA A CB    1 
ATOM   953  N  N     . TYR A 1 121 ? 56.667 -3.726  -6.002  1.00 10.75  ? 118  TYR A N     1 
ATOM   954  C  CA    . TYR A 1 121 ? 57.579 -4.838  -6.203  1.00 11.83  ? 118  TYR A CA    1 
ATOM   955  C  C     . TYR A 1 121 ? 58.428 -4.597  -7.432  1.00 15.07  ? 118  TYR A C     1 
ATOM   956  O  O     . TYR A 1 121 ? 57.973 -4.007  -8.414  1.00 15.03  ? 118  TYR A O     1 
ATOM   957  C  CB    . TYR A 1 121 ? 56.805 -6.154  -6.339  1.00 9.55   ? 118  TYR A CB    1 
ATOM   958  C  CG    . TYR A 1 121 ? 56.079 -6.541  -5.088  1.00 11.94  ? 118  TYR A CG    1 
ATOM   959  C  CD1   . TYR A 1 121 ? 54.754 -6.189  -4.891  1.00 11.50  ? 118  TYR A CD1   1 
ATOM   960  C  CD2   . TYR A 1 121 ? 56.727 -7.252  -4.085  1.00 14.92  ? 118  TYR A CD2   1 
ATOM   961  C  CE1   . TYR A 1 121 ? 54.087 -6.545  -3.734  1.00 15.44  ? 118  TYR A CE1   1 
ATOM   962  C  CE2   . TYR A 1 121 ? 56.066 -7.616  -2.928  1.00 15.04  ? 118  TYR A CE2   1 
ATOM   963  C  CZ    . TYR A 1 121 ? 54.747 -7.256  -2.757  1.00 17.48  ? 118  TYR A CZ    1 
ATOM   964  O  OH    . TYR A 1 121 ? 54.060 -7.601  -1.618  1.00 18.17  ? 118  TYR A OH    1 
ATOM   965  N  N     . VAL A 1 122 ? 59.663 -5.087  -7.374  1.00 11.32  ? 119  VAL A N     1 
ATOM   966  C  CA    . VAL A 1 122 ? 60.632 -4.956  -8.440  1.00 15.88  ? 119  VAL A CA    1 
ATOM   967  C  C     . VAL A 1 122 ? 61.169 -6.354  -8.759  1.00 18.03  ? 119  VAL A C     1 
ATOM   968  O  O     . VAL A 1 122 ? 61.608 -7.056  -7.845  1.00 15.09  ? 119  VAL A O     1 
ATOM   969  C  CB    . VAL A 1 122 ? 61.817 -4.089  -7.927  1.00 17.91  ? 119  VAL A CB    1 
ATOM   970  C  CG1   . VAL A 1 122 ? 62.623 -3.561  -9.079  1.00 27.67  ? 119  VAL A CG1   1 
ATOM   971  C  CG2   . VAL A 1 122 ? 61.300 -2.942  -7.046  1.00 21.58  ? 119  VAL A CG2   1 
ATOM   972  N  N     . ASP A 1 123 ? 61.144 -6.786  -10.020 1.00 20.08  ? 120  ASP A N     1 
ATOM   973  C  CA    . ASP A 1 123 ? 61.863 -8.013  -10.383 1.00 20.95  ? 120  ASP A CA    1 
ATOM   974  C  C     . ASP A 1 123 ? 63.244 -7.647  -10.896 1.00 21.63  ? 120  ASP A C     1 
ATOM   975  O  O     . ASP A 1 123 ? 63.396 -7.103  -11.991 1.00 23.94  ? 120  ASP A O     1 
ATOM   976  C  CB    . ASP A 1 123 ? 61.115 -8.900  -11.395 1.00 29.29  ? 120  ASP A CB    1 
ATOM   977  C  CG    . ASP A 1 123 ? 61.804 -10.250 -11.609 1.00 34.17  ? 120  ASP A CG    1 
ATOM   978  O  OD1   . ASP A 1 123 ? 63.033 -10.271 -11.805 1.00 26.79  ? 120  ASP A OD1   1 
ATOM   979  O  OD2   . ASP A 1 123 ? 61.133 -11.306 -11.562 1.00 35.38  ? 120  ASP A OD2   1 
ATOM   980  N  N     . LEU A 1 124 ? 64.245 -7.938  -10.077 1.00 15.71  ? 121  LEU A N     1 
ATOM   981  C  CA    . LEU A 1 124 ? 65.612 -7.531  -10.345 1.00 13.62  ? 121  LEU A CA    1 
ATOM   982  C  C     . LEU A 1 124 ? 66.465 -8.610  -10.988 1.00 14.44  ? 121  LEU A C     1 
ATOM   983  O  O     . LEU A 1 124 ? 67.663 -8.410  -11.180 1.00 15.93  ? 121  LEU A O     1 
ATOM   984  C  CB    . LEU A 1 124 ? 66.284 -7.076  -9.047  1.00 16.63  ? 121  LEU A CB    1 
ATOM   985  C  CG    . LEU A 1 124 ? 65.705 -5.817  -8.405  1.00 18.51  ? 121  LEU A CG    1 
ATOM   986  C  CD1   . LEU A 1 124 ? 66.193 -5.655  -6.977  1.00 23.39  ? 121  LEU A CD1   1 
ATOM   987  C  CD2   . LEU A 1 124 ? 66.051 -4.603  -9.254  1.00 21.71  ? 121  LEU A CD2   1 
ATOM   988  N  N     . THR A 1 125 ? 65.864 -9.749  -11.320 1.00 13.80  ? 122  THR A N     1 
ATOM   989  C  CA    . THR A 1 125 ? 66.624 -10.876 -11.854 1.00 16.17  ? 122  THR A CA    1 
ATOM   990  C  C     . THR A 1 125 ? 67.530 -10.483 -13.024 1.00 16.25  ? 122  THR A C     1 
ATOM   991  O  O     . THR A 1 125 ? 68.717 -10.799 -13.016 1.00 17.88  ? 122  THR A O     1 
ATOM   992  C  CB    . THR A 1 125 ? 65.700 -12.026 -12.268 1.00 17.00  ? 122  THR A CB    1 
ATOM   993  O  OG1   . THR A 1 125 ? 64.804 -12.306 -11.186 1.00 16.44  ? 122  THR A OG1   1 
ATOM   994  C  CG2   . THR A 1 125 ? 66.507 -13.283 -12.609 1.00 18.97  ? 122  THR A CG2   1 
ATOM   995  N  N     . SER A 1 126 ? 66.973 -9.791  -14.017 1.00 18.46  ? 123  SER A N     1 
ATOM   996  C  CA    . SER A 1 126 ? 67.762 -9.394  -15.193 1.00 19.16  ? 123  SER A CA    1 
ATOM   997  C  C     . SER A 1 126 ? 68.812 -8.325  -14.878 1.00 20.70  ? 123  SER A C     1 
ATOM   998  O  O     . SER A 1 126 ? 69.942 -8.389  -15.370 1.00 21.66  ? 123  SER A O     1 
ATOM   999  C  CB    . SER A 1 126 ? 66.848 -8.933  -16.332 1.00 23.74  ? 123  SER A CB    1 
ATOM   1000 O  OG    A SER A 1 126 ? 66.054 -9.998  -16.823 0.40 27.01  ? 123  SER A OG    1 
ATOM   1001 O  OG    B SER A 1 126 ? 66.105 -7.786  -15.970 0.60 23.92  ? 123  SER A OG    1 
ATOM   1002 N  N     . ALA A 1 127 ? 68.444 -7.349  -14.059 1.00 20.47  ? 124  ALA A N     1 
ATOM   1003 C  CA    . ALA A 1 127 ? 69.385 -6.308  -13.660 1.00 18.55  ? 124  ALA A CA    1 
ATOM   1004 C  C     . ALA A 1 127 ? 70.573 -6.903  -12.902 1.00 18.43  ? 124  ALA A C     1 
ATOM   1005 O  O     . ALA A 1 127 ? 71.716 -6.470  -13.066 1.00 21.97  ? 124  ALA A O     1 
ATOM   1006 C  CB    . ALA A 1 127 ? 68.694 -5.236  -12.819 1.00 19.16  ? 124  ALA A CB    1 
ATOM   1007 N  N     . VAL A 1 128 ? 70.294 -7.904  -12.073 1.00 16.71  ? 125  VAL A N     1 
ATOM   1008 C  CA    . VAL A 1 128 ? 71.350 -8.586  -11.340 1.00 17.09  ? 125  VAL A CA    1 
ATOM   1009 C  C     . VAL A 1 128 ? 72.313 -9.322  -12.269 1.00 20.40  ? 125  VAL A C     1 
ATOM   1010 O  O     . VAL A 1 128 ? 73.533 -9.240  -12.106 1.00 21.47  ? 125  VAL A O     1 
ATOM   1011 C  CB    . VAL A 1 128 ? 70.762 -9.566  -10.311 1.00 17.84  ? 125  VAL A CB    1 
ATOM   1012 C  CG1   . VAL A 1 128 ? 71.828 -10.553 -9.842  1.00 19.42  ? 125  VAL A CG1   1 
ATOM   1013 C  CG2   . VAL A 1 128 ? 70.172 -8.780  -9.149  1.00 15.22  ? 125  VAL A CG2   1 
ATOM   1014 N  N     . GLN A 1 129 ? 71.769 -10.054 -13.234 1.00 19.80  ? 126  GLN A N     1 
ATOM   1015 C  CA    . GLN A 1 129 ? 72.608 -10.729 -14.218 1.00 27.90  ? 126  GLN A CA    1 
ATOM   1016 C  C     . GLN A 1 129 ? 73.555 -9.741  -14.890 1.00 29.10  ? 126  GLN A C     1 
ATOM   1017 O  O     . GLN A 1 129 ? 74.750 -10.013 -15.015 1.00 28.88  ? 126  GLN A O     1 
ATOM   1018 C  CB    . GLN A 1 129 ? 71.756 -11.433 -15.275 1.00 37.10  ? 126  GLN A CB    1 
ATOM   1019 C  CG    . GLN A 1 129 ? 70.818 -12.499 -14.725 1.00 46.70  ? 126  GLN A CG    1 
ATOM   1020 C  CD    . GLN A 1 129 ? 71.548 -13.665 -14.076 1.00 63.38  ? 126  GLN A CD    1 
ATOM   1021 O  OE1   . GLN A 1 129 ? 72.768 -13.638 -13.902 1.00 68.72  ? 126  GLN A OE1   1 
ATOM   1022 N  NE2   . GLN A 1 129 ? 70.797 -14.700 -13.715 1.00 67.24  ? 126  GLN A NE2   1 
ATOM   1023 N  N     . GLU A 1 130 ? 73.018 -8.597  -15.311 1.00 29.40  ? 127  GLU A N     1 
ATOM   1024 C  CA    . GLU A 1 130 ? 73.821 -7.565  -15.967 1.00 37.55  ? 127  GLU A CA    1 
ATOM   1025 C  C     . GLU A 1 130 ? 74.942 -7.066  -15.061 1.00 34.91  ? 127  GLU A C     1 
ATOM   1026 O  O     . GLU A 1 130 ? 76.091 -6.956  -15.487 1.00 35.43  ? 127  GLU A O     1 
ATOM   1027 C  CB    . GLU A 1 130 ? 72.949 -6.380  -16.394 1.00 41.90  ? 127  GLU A CB    1 
ATOM   1028 C  CG    . GLU A 1 130 ? 71.988 -6.675  -17.528 1.00 56.70  ? 127  GLU A CG    1 
ATOM   1029 C  CD    . GLU A 1 130 ? 71.404 -5.407  -18.127 1.00 71.80  ? 127  GLU A CD    1 
ATOM   1030 O  OE1   . GLU A 1 130 ? 72.143 -4.403  -18.232 1.00 73.47  ? 127  GLU A OE1   1 
ATOM   1031 O  OE2   . GLU A 1 130 ? 70.207 -5.411  -18.485 1.00 77.57  ? 127  GLU A OE2   1 
ATOM   1032 N  N     . ARG A 1 131 ? 74.602 -6.757  -13.814 1.00 23.19  ? 128  ARG A N     1 
ATOM   1033 C  CA    . ARG A 1 131 ? 75.574 -6.217  -12.869 1.00 25.06  ? 128  ARG A CA    1 
ATOM   1034 C  C     . ARG A 1 131 ? 76.673 -7.226  -12.543 1.00 28.67  ? 128  ARG A C     1 
ATOM   1035 O  O     . ARG A 1 131 ? 77.841 -6.852  -12.397 1.00 31.61  ? 128  ARG A O     1 
ATOM   1036 C  CB    . ARG A 1 131 ? 74.874 -5.727  -11.598 1.00 24.20  ? 128  ARG A CB    1 
ATOM   1037 C  CG    A ARG A 1 131 ? 75.833 -5.125  -10.575 0.50 27.44  ? 128  ARG A CG    1 
ATOM   1038 C  CG    B ARG A 1 131 ? 75.761 -4.996  -10.617 0.50 26.88  ? 128  ARG A CG    1 
ATOM   1039 C  CD    A ARG A 1 131 ? 76.564 -3.906  -11.144 0.50 25.53  ? 128  ARG A CD    1 
ATOM   1040 C  CD    B ARG A 1 131 ? 76.307 -3.703  -11.204 0.50 25.11  ? 128  ARG A CD    1 
ATOM   1041 N  NE    A ARG A 1 131 ? 75.608 -2.874  -11.527 0.50 16.79  ? 128  ARG A NE    1 
ATOM   1042 N  NE    B ARG A 1 131 ? 76.946 -2.902  -10.167 0.50 24.74  ? 128  ARG A NE    1 
ATOM   1043 C  CZ    A ARG A 1 131 ? 75.055 -2.018  -10.671 0.50 23.54  ? 128  ARG A CZ    1 
ATOM   1044 C  CZ    B ARG A 1 131 ? 76.303 -2.021  -9.409  0.50 23.13  ? 128  ARG A CZ    1 
ATOM   1045 N  NH1   A ARG A 1 131 ? 75.394 -2.049  -9.388  0.50 20.12  ? 128  ARG A NH1   1 
ATOM   1046 N  NH1   B ARG A 1 131 ? 76.963 -1.344  -8.480  0.50 24.73  ? 128  ARG A NH1   1 
ATOM   1047 N  NH2   A ARG A 1 131 ? 74.177 -1.121  -11.099 0.50 31.14  ? 128  ARG A NH2   1 
ATOM   1048 N  NH2   B ARG A 1 131 ? 75.004 -1.814  -9.585  0.50 20.98  ? 128  ARG A NH2   1 
ATOM   1049 N  N     . LEU A 1 132 ? 76.309 -8.503  -12.450 1.00 24.59  ? 129  LEU A N     1 
ATOM   1050 C  CA    . LEU A 1 132 ? 77.293 -9.559  -12.219 1.00 23.05  ? 129  LEU A CA    1 
ATOM   1051 C  C     . LEU A 1 132 ? 78.330 -9.642  -13.334 1.00 34.58  ? 129  LEU A C     1 
ATOM   1052 O  O     . LEU A 1 132 ? 79.483 -9.987  -13.091 1.00 41.09  ? 129  LEU A O     1 
ATOM   1053 C  CB    . LEU A 1 132 ? 76.608 -10.914 -12.032 1.00 27.02  ? 129  LEU A CB    1 
ATOM   1054 C  CG    . LEU A 1 132 ? 76.121 -11.157 -10.600 1.00 26.63  ? 129  LEU A CG    1 
ATOM   1055 C  CD1   . LEU A 1 132 ? 75.148 -12.329 -10.521 1.00 29.01  ? 129  LEU A CD1   1 
ATOM   1056 C  CD2   . LEU A 1 132 ? 77.313 -11.360 -9.658  1.00 28.08  ? 129  LEU A CD2   1 
ATOM   1057 N  N     . GLN A 1 133 ? 77.913 -9.328  -14.555 1.00 40.04  ? 130  GLN A N     1 
ATOM   1058 C  CA    . GLN A 1 133 ? 78.818 -9.370  -15.700 1.00 54.46  ? 130  GLN A CA    1 
ATOM   1059 C  C     . GLN A 1 133 ? 79.813 -8.211  -15.691 1.00 61.27  ? 130  GLN A C     1 
ATOM   1060 O  O     . GLN A 1 133 ? 80.940 -8.355  -16.161 1.00 68.36  ? 130  GLN A O     1 
ATOM   1061 C  CB    . GLN A 1 133 ? 78.029 -9.395  -17.010 1.00 64.40  ? 130  GLN A CB    1 
ATOM   1062 C  CG    . GLN A 1 133 ? 77.159 -10.632 -17.172 1.00 75.29  ? 130  GLN A CG    1 
ATOM   1063 C  CD    . GLN A 1 133 ? 76.357 -10.620 -18.458 1.00 86.19  ? 130  GLN A CD    1 
ATOM   1064 O  OE1   . GLN A 1 133 ? 76.505 -9.723  -19.289 1.00 92.24  ? 130  GLN A OE1   1 
ATOM   1065 N  NE2   . GLN A 1 133 ? 75.498 -11.620 -18.628 1.00 87.17  ? 130  GLN A NE2   1 
ATOM   1066 N  N     . LYS A 1 134 ? 79.398 -7.066  -15.157 1.00 62.88  ? 131  LYS A N     1 
ATOM   1067 C  CA    . LYS A 1 134 ? 80.300 -5.925  -15.018 1.00 68.50  ? 131  LYS A CA    1 
ATOM   1068 C  C     . LYS A 1 134 ? 81.301 -6.167  -13.894 1.00 67.58  ? 131  LYS A C     1 
ATOM   1069 O  O     . LYS A 1 134 ? 82.490 -5.885  -14.037 1.00 67.74  ? 131  LYS A O     1 
ATOM   1070 C  CB    . LYS A 1 134 ? 79.524 -4.635  -14.748 1.00 71.60  ? 131  LYS A CB    1 
ATOM   1071 C  CG    . LYS A 1 134 ? 78.647 -4.170  -15.895 1.00 75.73  ? 131  LYS A CG    1 
ATOM   1072 C  CD    . LYS A 1 134 ? 78.163 -2.747  -15.657 1.00 77.74  ? 131  LYS A CD    1 
ATOM   1073 C  CE    . LYS A 1 134 ? 77.540 -2.603  -14.277 1.00 77.87  ? 131  LYS A CE    1 
ATOM   1074 N  NZ    . LYS A 1 134 ? 77.145 -1.199  -13.972 1.00 76.41  ? 131  LYS A NZ    1 
ATOM   1075 N  N     . LEU A 1 135 ? 80.810 -6.690  -12.773 1.00 63.72  ? 132  LEU A N     1 
ATOM   1076 C  CA    . LEU A 1 135 ? 81.660 -6.983  -11.625 1.00 65.76  ? 132  LEU A CA    1 
ATOM   1077 C  C     . LEU A 1 135 ? 82.833 -7.880  -12.007 1.00 72.39  ? 132  LEU A C     1 
ATOM   1078 O  O     . LEU A 1 135 ? 83.950 -7.697  -11.524 1.00 71.14  ? 132  LEU A O     1 
ATOM   1079 C  CB    . LEU A 1 135 ? 80.845 -7.630  -10.502 1.00 61.30  ? 132  LEU A CB    1 
ATOM   1080 C  CG    . LEU A 1 135 ? 80.265 -6.682  -9.448  1.00 57.87  ? 132  LEU A CG    1 
ATOM   1081 C  CD1   . LEU A 1 135 ? 79.630 -5.464  -10.094 1.00 58.80  ? 132  LEU A CD1   1 
ATOM   1082 C  CD2   . LEU A 1 135 ? 79.268 -7.411  -8.557  1.00 52.28  ? 132  LEU A CD2   1 
ATOM   1083 N  N     . GLN A 1 136 ? 82.571 -8.847  -12.880 1.00 79.56  ? 133  GLN A N     1 
ATOM   1084 C  CA    . GLN A 1 136 ? 83.591 -9.796  -13.313 1.00 85.94  ? 133  GLN A CA    1 
ATOM   1085 C  C     . GLN A 1 136 ? 84.324 -10.440 -12.139 1.00 82.43  ? 133  GLN A C     1 
ATOM   1086 O  O     . GLN A 1 136 ? 85.527 -10.243 -11.961 1.00 83.51  ? 133  GLN A O     1 
ATOM   1087 C  CB    . GLN A 1 136 ? 84.587 -9.132  -14.268 1.00 95.19  ? 133  GLN A CB    1 
ATOM   1088 C  CG    . GLN A 1 136 ? 84.002 -8.793  -15.629 1.00 102.86 ? 133  GLN A CG    1 
ATOM   1089 C  CD    . GLN A 1 136 ? 85.065 -8.456  -16.655 1.00 110.02 ? 133  GLN A CD    1 
ATOM   1090 O  OE1   . GLN A 1 136 ? 84.769 -8.285  -17.837 1.00 111.85 ? 133  GLN A OE1   1 
ATOM   1091 N  NE2   . GLN A 1 136 ? 86.311 -8.361  -16.209 1.00 113.86 ? 133  GLN A NE2   1 
ATOM   1092 N  N     . GLY A 1 137 ? 83.589 -11.206 -11.341 1.00 77.19  ? 134  GLY A N     1 
ATOM   1093 C  CA    . GLY A 1 137 ? 84.171 -11.954 -10.241 1.00 73.25  ? 134  GLY A CA    1 
ATOM   1094 C  C     . GLY A 1 137 ? 84.749 -11.092 -9.137  1.00 67.83  ? 134  GLY A C     1 
ATOM   1095 O  O     . GLY A 1 137 ? 85.384 -11.600 -8.214  1.00 69.40  ? 134  GLY A O     1 
ATOM   1096 N  N     . GLN A 1 138 ? 84.533 -9.785  -9.230  1.00 61.15  ? 135  GLN A N     1 
ATOM   1097 C  CA    . GLN A 1 138 ? 85.014 -8.865  -8.208  1.00 62.56  ? 135  GLN A CA    1 
ATOM   1098 C  C     . GLN A 1 138 ? 84.125 -8.932  -6.969  1.00 52.91  ? 135  GLN A C     1 
ATOM   1099 O  O     . GLN A 1 138 ? 82.899 -8.878  -7.074  1.00 48.53  ? 135  GLN A O     1 
ATOM   1100 C  CB    . GLN A 1 138 ? 85.058 -7.438  -8.754  1.00 71.02  ? 135  GLN A CB    1 
ATOM   1101 C  CG    . GLN A 1 138 ? 85.715 -6.436  -7.824  1.00 80.94  ? 135  GLN A CG    1 
ATOM   1102 C  CD    . GLN A 1 138 ? 85.746 -5.038  -8.409  1.00 87.92  ? 135  GLN A CD    1 
ATOM   1103 O  OE1   . GLN A 1 138 ? 86.375 -4.136  -7.856  1.00 90.56  ? 135  GLN A OE1   1 
ATOM   1104 N  NE2   . GLN A 1 138 ? 85.062 -4.851  -9.533  1.00 89.04  ? 135  GLN A NE2   1 
ATOM   1105 N  N     . PRO A 1 139 ? 84.746 -9.057  -5.787  1.00 48.29  ? 136  PRO A N     1 
ATOM   1106 C  CA    . PRO A 1 139 ? 84.019 -9.127  -4.514  1.00 44.32  ? 136  PRO A CA    1 
ATOM   1107 C  C     . PRO A 1 139 ? 83.141 -7.903  -4.287  1.00 37.29  ? 136  PRO A C     1 
ATOM   1108 O  O     . PRO A 1 139 ? 83.366 -6.860  -4.889  1.00 37.00  ? 136  PRO A O     1 
ATOM   1109 C  CB    . PRO A 1 139 ? 85.142 -9.176  -3.470  1.00 48.66  ? 136  PRO A CB    1 
ATOM   1110 C  CG    . PRO A 1 139 ? 86.356 -8.661  -4.174  1.00 52.14  ? 136  PRO A CG    1 
ATOM   1111 C  CD    . PRO A 1 139 ? 86.203 -9.106  -5.590  1.00 53.12  ? 136  PRO A CD    1 
ATOM   1112 N  N     . ILE A 1 140 ? 82.139 -8.044  -3.427  1.00 38.05  ? 137  ILE A N     1 
ATOM   1113 C  CA    . ILE A 1 140 ? 81.247 -6.940  -3.105  1.00 34.30  ? 137  ILE A CA    1 
ATOM   1114 C  C     . ILE A 1 140 ? 81.629 -6.336  -1.762  1.00 29.40  ? 137  ILE A C     1 
ATOM   1115 O  O     . ILE A 1 140 ? 81.658 -7.029  -0.745  1.00 30.26  ? 137  ILE A O     1 
ATOM   1116 C  CB    . ILE A 1 140 ? 79.779 -7.400  -3.076  1.00 31.76  ? 137  ILE A CB    1 
ATOM   1117 C  CG1   . ILE A 1 140 ? 79.370 -7.909  -4.459  1.00 42.83  ? 137  ILE A CG1   1 
ATOM   1118 C  CG2   . ILE A 1 140 ? 78.864 -6.264  -2.629  1.00 29.46  ? 137  ILE A CG2   1 
ATOM   1119 C  CD1   . ILE A 1 140 ? 77.993 -8.528  -4.508  1.00 45.47  ? 137  ILE A CD1   1 
ATOM   1120 N  N     . SER A 1 141 ? 81.928 -5.043  -1.773  1.00 29.61  ? 138  SER A N     1 
ATOM   1121 C  CA    . SER A 1 141 ? 82.358 -4.337  -0.574  1.00 28.80  ? 138  SER A CA    1 
ATOM   1122 C  C     . SER A 1 141 ? 81.183 -3.984  0.337   1.00 24.04  ? 138  SER A C     1 
ATOM   1123 O  O     . SER A 1 141 ? 80.093 -3.656  -0.135  1.00 22.87  ? 138  SER A O     1 
ATOM   1124 C  CB    . SER A 1 141 ? 83.108 -3.062  -0.972  1.00 32.95  ? 138  SER A CB    1 
ATOM   1125 O  OG    . SER A 1 141 ? 83.125 -2.115  0.084   1.00 38.34  ? 138  SER A OG    1 
ATOM   1126 N  N     . ALA A 1 142 ? 81.413 -4.043  1.645   1.00 24.67  ? 139  ALA A N     1 
ATOM   1127 C  CA    . ALA A 1 142 ? 80.410 -3.612  2.611   1.00 25.54  ? 139  ALA A CA    1 
ATOM   1128 C  C     . ALA A 1 142 ? 79.970 -2.166  2.361   1.00 21.56  ? 139  ALA A C     1 
ATOM   1129 O  O     . ALA A 1 142 ? 78.835 -1.796  2.675   1.00 22.41  ? 139  ALA A O     1 
ATOM   1130 C  CB    . ALA A 1 142 ? 80.941 -3.767  4.034   1.00 27.41  ? 139  ALA A CB    1 
ATOM   1131 N  N     . ASP A 1 143 ? 80.862 -1.355  1.792   1.00 21.58  ? 140  ASP A N     1 
ATOM   1132 C  CA    . ASP A 1 143 ? 80.554 0.048   1.514   1.00 20.98  ? 140  ASP A CA    1 
ATOM   1133 C  C     . ASP A 1 143 ? 79.444 0.208   0.485   1.00 24.73  ? 140  ASP A C     1 
ATOM   1134 O  O     . ASP A 1 143 ? 78.844 1.278   0.367   1.00 24.54  ? 140  ASP A O     1 
ATOM   1135 C  CB    . ASP A 1 143 ? 81.799 0.800   1.035   1.00 24.55  ? 140  ASP A CB    1 
ATOM   1136 C  CG    . ASP A 1 143 ? 82.901 0.822   2.072   1.00 42.96  ? 140  ASP A CG    1 
ATOM   1137 O  OD1   . ASP A 1 143 ? 82.598 0.623   3.269   1.00 45.81  ? 140  ASP A OD1   1 
ATOM   1138 O  OD2   . ASP A 1 143 ? 84.072 1.044   1.690   1.00 50.98  ? 140  ASP A OD2   1 
ATOM   1139 N  N     . LEU A 1 144 ? 79.170 -0.858  -0.261  1.00 23.53  ? 141  LEU A N     1 
ATOM   1140 C  CA    . LEU A 1 144 ? 78.111 -0.818  -1.255  1.00 21.68  ? 141  LEU A CA    1 
ATOM   1141 C  C     . LEU A 1 144 ? 76.753 -1.136  -0.636  1.00 17.49  ? 141  LEU A C     1 
ATOM   1142 O  O     . LEU A 1 144 ? 75.727 -1.011  -1.290  1.00 18.95  ? 141  LEU A O     1 
ATOM   1143 C  CB    . LEU A 1 144 ? 78.411 -1.789  -2.390  1.00 20.11  ? 141  LEU A CB    1 
ATOM   1144 C  CG    . LEU A 1 144 ? 79.638 -1.443  -3.227  1.00 24.32  ? 141  LEU A CG    1 
ATOM   1145 C  CD1   . LEU A 1 144 ? 79.797 -2.441  -4.366  1.00 29.70  ? 141  LEU A CD1   1 
ATOM   1146 C  CD2   . LEU A 1 144 ? 79.539 -0.015  -3.753  1.00 29.04  ? 141  LEU A CD2   1 
ATOM   1147 N  N     . LEU A 1 145 ? 76.764 -1.517  0.637   1.00 17.23  ? 142  LEU A N     1 
ATOM   1148 C  CA    . LEU A 1 145 ? 75.552 -1.948  1.330   1.00 16.42  ? 142  LEU A CA    1 
ATOM   1149 C  C     . LEU A 1 145 ? 75.429 -1.222  2.673   1.00 16.83  ? 142  LEU A C     1 
ATOM   1150 O  O     . LEU A 1 145 ? 75.307 -1.861  3.718   1.00 17.26  ? 142  LEU A O     1 
ATOM   1151 C  CB    . LEU A 1 145 ? 75.598 -3.470  1.528   1.00 18.12  ? 142  LEU A CB    1 
ATOM   1152 C  CG    . LEU A 1 145 ? 75.542 -4.270  0.222   1.00 15.38  ? 142  LEU A CG    1 
ATOM   1153 C  CD1   . LEU A 1 145 ? 76.013 -5.725  0.387   1.00 16.25  ? 142  LEU A CD1   1 
ATOM   1154 C  CD2   . LEU A 1 145 ? 74.136 -4.230  -0.347  1.00 19.30  ? 142  LEU A CD2   1 
ATOM   1155 N  N     . PRO A 1 146 ? 75.446 0.126   2.646   1.00 18.84  ? 143  PRO A N     1 
ATOM   1156 C  CA    . PRO A 1 146 ? 75.520 0.914   3.880   1.00 21.06  ? 143  PRO A CA    1 
ATOM   1157 C  C     . PRO A 1 146 ? 74.258 0.886   4.744   1.00 20.46  ? 143  PRO A C     1 
ATOM   1158 O  O     . PRO A 1 146 ? 74.333 1.313   5.894   1.00 19.09  ? 143  PRO A O     1 
ATOM   1159 C  CB    . PRO A 1 146 ? 75.787 2.337   3.367   1.00 20.05  ? 143  PRO A CB    1 
ATOM   1160 C  CG    . PRO A 1 146 ? 75.152 2.355   2.014   1.00 18.40  ? 143  PRO A CG    1 
ATOM   1161 C  CD    . PRO A 1 146 ? 75.417 0.980   1.446   1.00 17.26  ? 143  PRO A CD    1 
ATOM   1162 N  N     . SER A 1 147 ? 73.133 0.398   4.223   1.00 17.40  ? 144  SER A N     1 
ATOM   1163 C  CA    . SER A 1 147 ? 71.898 0.371   5.011   1.00 15.99  ? 144  SER A CA    1 
ATOM   1164 C  C     . SER A 1 147 ? 71.208 -1.008  5.011   1.00 12.99  ? 144  SER A C     1 
ATOM   1165 O  O     . SER A 1 147 ? 70.021 -1.123  5.324   1.00 13.68  ? 144  SER A O     1 
ATOM   1166 C  CB    . SER A 1 147 ? 70.936 1.466   4.541   1.00 16.35  ? 144  SER A CB    1 
ATOM   1167 O  OG    . SER A 1 147 ? 70.488 1.226   3.220   1.00 17.54  ? 144  SER A OG    1 
ATOM   1168 N  N     . THR A 1 148 ? 71.983 -2.042  4.705   1.00 15.15  ? 145  THR A N     1 
ATOM   1169 C  CA    . THR A 1 148 ? 71.480 -3.409  4.553   1.00 11.71  ? 145  THR A CA    1 
ATOM   1170 C  C     . THR A 1 148 ? 71.703 -4.268  5.785   1.00 11.96  ? 145  THR A C     1 
ATOM   1171 O  O     . THR A 1 148 ? 72.820 -4.289  6.349   1.00 13.91  ? 145  THR A O     1 
ATOM   1172 C  CB    . THR A 1 148 ? 72.166 -4.079  3.342   1.00 14.77  ? 145  THR A CB    1 
ATOM   1173 O  OG1   . THR A 1 148 ? 71.772 -3.385  2.148   1.00 13.83  ? 145  THR A OG1   1 
ATOM   1174 C  CG2   . THR A 1 148 ? 71.777 -5.565  3.216   1.00 13.48  ? 145  THR A CG2   1 
ATOM   1175 N  N     . TYR A 1 149 ? 70.635 -4.956  6.195   1.00 12.47  ? 146  TYR A N     1 
ATOM   1176 C  CA    . TYR A 1 149 ? 70.674 -6.012  7.211   1.00 11.08  ? 146  TYR A CA    1 
ATOM   1177 C  C     . TYR A 1 149 ? 70.576 -7.358  6.528   1.00 13.68  ? 146  TYR A C     1 
ATOM   1178 O  O     . TYR A 1 149 ? 69.801 -7.517  5.573   1.00 12.69  ? 146  TYR A O     1 
ATOM   1179 C  CB    . TYR A 1 149 ? 69.473 -5.898  8.154   1.00 11.78  ? 146  TYR A CB    1 
ATOM   1180 C  CG    . TYR A 1 149 ? 69.637 -4.826  9.199   1.00 14.10  ? 146  TYR A CG    1 
ATOM   1181 C  CD1   . TYR A 1 149 ? 70.072 -5.148  10.475  1.00 15.93  ? 146  TYR A CD1   1 
ATOM   1182 C  CD2   . TYR A 1 149 ? 69.349 -3.502  8.915   1.00 16.41  ? 146  TYR A CD2   1 
ATOM   1183 C  CE1   . TYR A 1 149 ? 70.233 -4.182  11.437  1.00 17.52  ? 146  TYR A CE1   1 
ATOM   1184 C  CE2   . TYR A 1 149 ? 69.519 -2.518  9.882   1.00 20.45  ? 146  TYR A CE2   1 
ATOM   1185 C  CZ    . TYR A 1 149 ? 69.960 -2.880  11.140  1.00 18.26  ? 146  TYR A CZ    1 
ATOM   1186 O  OH    . TYR A 1 149 ? 70.120 -1.924  12.114  1.00 24.43  ? 146  TYR A OH    1 
ATOM   1187 N  N     . ILE A 1 150 ? 71.336 -8.331  7.034   1.00 11.81  ? 147  ILE A N     1 
ATOM   1188 C  CA    . ILE A 1 150 ? 71.199 -9.710  6.588   1.00 11.71  ? 147  ILE A CA    1 
ATOM   1189 C  C     . ILE A 1 150 ? 70.455 -10.476 7.670   1.00 11.35  ? 147  ILE A C     1 
ATOM   1190 O  O     . ILE A 1 150 ? 70.993 -10.719 8.755   1.00 13.86  ? 147  ILE A O     1 
ATOM   1191 C  CB    . ILE A 1 150 ? 72.566 -10.372 6.367   1.00 11.76  ? 147  ILE A CB    1 
ATOM   1192 C  CG1   . ILE A 1 150 ? 73.467 -9.501  5.472   1.00 13.61  ? 147  ILE A CG1   1 
ATOM   1193 C  CG2   . ILE A 1 150 ? 72.373 -11.782 5.797   1.00 13.25  ? 147  ILE A CG2   1 
ATOM   1194 C  CD1   . ILE A 1 150 ? 72.918 -9.281  4.050   1.00 13.51  ? 147  ILE A CD1   1 
ATOM   1195 N  N     . GLU A 1 151 ? 69.211 -10.859 7.388   1.00 10.67  ? 148  GLU A N     1 
ATOM   1196 C  CA    . GLU A 1 151 ? 68.381 -11.527 8.378   1.00 12.67  ? 148  GLU A CA    1 
ATOM   1197 C  C     . GLU A 1 151 ? 69.024 -12.829 8.833   1.00 13.20  ? 148  GLU A C     1 
ATOM   1198 O  O     . GLU A 1 151 ? 69.446 -13.629 8.006   1.00 13.57  ? 148  GLU A O     1 
ATOM   1199 C  CB    . GLU A 1 151 ? 66.988 -11.808 7.802   1.00 12.17  ? 148  GLU A CB    1 
ATOM   1200 C  CG    . GLU A 1 151 ? 66.046 -12.546 8.766   1.00 15.99  ? 148  GLU A CG    1 
ATOM   1201 C  CD    . GLU A 1 151 ? 65.875 -11.864 10.117  1.00 18.92  ? 148  GLU A CD    1 
ATOM   1202 O  OE1   . GLU A 1 151 ? 65.642 -12.581 11.112  1.00 19.87  ? 148  GLU A OE1   1 
ATOM   1203 O  OE2   . GLU A 1 151 ? 65.930 -10.618 10.191  1.00 19.95  ? 148  GLU A OE2   1 
ATOM   1204 N  N     . GLY A 1 152 ? 69.107 -13.017 10.147  1.00 12.94  ? 149  GLY A N     1 
ATOM   1205 C  CA    . GLY A 1 152 ? 69.679 -14.221 10.717  1.00 14.03  ? 149  GLY A CA    1 
ATOM   1206 C  C     . GLY A 1 152 ? 71.106 -14.045 11.201  1.00 15.44  ? 149  GLY A C     1 
ATOM   1207 O  O     . GLY A 1 152 ? 71.614 -14.889 11.944  1.00 18.08  ? 149  GLY A O     1 
ATOM   1208 N  N     . LEU A 1 153 ? 71.757 -12.961 10.778  1.00 14.89  ? 150  LEU A N     1 
ATOM   1209 C  CA    . LEU A 1 153 ? 73.146 -12.703 11.158  1.00 15.78  ? 150  LEU A CA    1 
ATOM   1210 C  C     . LEU A 1 153 ? 73.249 -11.406 11.957  1.00 19.16  ? 150  LEU A C     1 
ATOM   1211 O  O     . LEU A 1 153 ? 72.400 -10.526 11.825  1.00 19.05  ? 150  LEU A O     1 
ATOM   1212 C  CB    . LEU A 1 153 ? 74.039 -12.634 9.917   1.00 16.24  ? 150  LEU A CB    1 
ATOM   1213 C  CG    . LEU A 1 153 ? 74.086 -13.921 9.087   1.00 18.04  ? 150  LEU A CG    1 
ATOM   1214 C  CD1   . LEU A 1 153 ? 74.973 -13.728 7.869   1.00 17.91  ? 150  LEU A CD1   1 
ATOM   1215 C  CD2   . LEU A 1 153 ? 74.581 -15.105 9.927   1.00 21.97  ? 150  LEU A CD2   1 
ATOM   1216 N  N     . PRO A 1 154 ? 74.284 -11.289 12.807  1.00 18.61  ? 151  PRO A N     1 
ATOM   1217 C  CA    . PRO A 1 154 ? 75.351 -12.273 13.037  1.00 16.66  ? 151  PRO A CA    1 
ATOM   1218 C  C     . PRO A 1 154 ? 74.892 -13.454 13.878  1.00 19.05  ? 151  PRO A C     1 
ATOM   1219 O  O     . PRO A 1 154 ? 73.858 -13.380 14.541  1.00 22.01  ? 151  PRO A O     1 
ATOM   1220 C  CB    . PRO A 1 154 ? 76.390 -11.477 13.828  1.00 18.51  ? 151  PRO A CB    1 
ATOM   1221 C  CG    . PRO A 1 154 ? 75.581 -10.445 14.564  1.00 19.36  ? 151  PRO A CG    1 
ATOM   1222 C  CD    . PRO A 1 154 ? 74.482 -10.063 13.602  1.00 19.75  ? 151  PRO A CD    1 
ATOM   1223 N  N     . GLN A 1 155 ? 75.667 -14.528 13.853  1.00 19.34  ? 152  GLN A N     1 
ATOM   1224 C  CA    . GLN A 1 155 ? 75.351 -15.710 14.640  1.00 24.87  ? 152  GLN A CA    1 
ATOM   1225 C  C     . GLN A 1 155 ? 76.640 -16.407 15.032  1.00 34.69  ? 152  GLN A C     1 
ATOM   1226 O  O     . GLN A 1 155 ? 77.717 -16.025 14.573  1.00 34.63  ? 152  GLN A O     1 
ATOM   1227 C  CB    . GLN A 1 155 ? 74.465 -16.660 13.836  1.00 32.37  ? 152  GLN A CB    1 
ATOM   1228 C  CG    . GLN A 1 155 ? 75.157 -17.266 12.632  1.00 44.26  ? 152  GLN A CG    1 
ATOM   1229 C  CD    . GLN A 1 155 ? 75.345 -18.765 12.767  1.00 47.03  ? 152  GLN A CD    1 
ATOM   1230 O  OE1   . GLN A 1 155 ? 74.759 -19.397 13.644  1.00 51.31  ? 152  GLN A OE1   1 
ATOM   1231 N  NE2   . GLN A 1 155 ? 76.162 -19.339 11.894  1.00 38.12  ? 152  GLN A NE2   1 
ATOM   1232 N  N     . GLY A 1 156 ? 76.527 -17.414 15.892  1.00 36.69  ? 153  GLY A N     1 
ATOM   1233 C  CA    . GLY A 1 156 ? 77.660 -18.251 16.246  1.00 50.01  ? 153  GLY A CA    1 
ATOM   1234 C  C     . GLY A 1 156 ? 78.667 -17.607 17.181  1.00 56.88  ? 153  GLY A C     1 
ATOM   1235 O  O     . GLY A 1 156 ? 78.411 -16.539 17.739  1.00 53.30  ? 153  GLY A O     1 
ATOM   1236 N  N     . PRO A 1 157 ? 79.825 -18.265 17.360  1.00 65.82  ? 154  PRO A N     1 
ATOM   1237 C  CA    . PRO A 1 157 ? 80.902 -17.811 18.248  1.00 65.98  ? 154  PRO A CA    1 
ATOM   1238 C  C     . PRO A 1 157 ? 81.706 -16.661 17.646  1.00 64.14  ? 154  PRO A C     1 
ATOM   1239 O  O     . PRO A 1 157 ? 82.063 -16.723 16.470  1.00 63.70  ? 154  PRO A O     1 
ATOM   1240 C  CB    . PRO A 1 157 ? 81.782 -19.055 18.382  1.00 67.61  ? 154  PRO A CB    1 
ATOM   1241 C  CG    . PRO A 1 157 ? 81.582 -19.783 17.100  1.00 65.16  ? 154  PRO A CG    1 
ATOM   1242 C  CD    . PRO A 1 157 ? 80.147 -19.549 16.713  1.00 65.24  ? 154  PRO A CD    1 
ATOM   1243 N  N     . THR A 1 163 ? 79.924 -5.795  20.338  1.00 109.85 ? 160  THR A N     1 
ATOM   1244 C  CA    . THR A 1 163 ? 79.188 -4.540  20.236  1.00 105.56 ? 160  THR A CA    1 
ATOM   1245 C  C     . THR A 1 163 ? 77.751 -4.701  20.721  1.00 95.95  ? 160  THR A C     1 
ATOM   1246 O  O     . THR A 1 163 ? 77.089 -5.696  20.423  1.00 94.14  ? 160  THR A O     1 
ATOM   1247 C  CB    . THR A 1 163 ? 79.179 -4.005  18.792  1.00 106.54 ? 160  THR A CB    1 
ATOM   1248 O  OG1   . THR A 1 163 ? 78.437 -2.780  18.738  1.00 106.72 ? 160  THR A OG1   1 
ATOM   1249 C  CG2   . THR A 1 163 ? 78.548 -5.020  17.850  1.00 105.57 ? 160  THR A CG2   1 
ATOM   1250 N  N     . VAL A 1 164 ? 77.277 -3.712  21.469  1.00 87.09  ? 161  VAL A N     1 
ATOM   1251 C  CA    . VAL A 1 164 ? 75.937 -3.756  22.038  1.00 78.09  ? 161  VAL A CA    1 
ATOM   1252 C  C     . VAL A 1 164 ? 75.013 -2.745  21.366  1.00 70.40  ? 161  VAL A C     1 
ATOM   1253 O  O     . VAL A 1 164 ? 73.907 -2.494  21.845  1.00 74.02  ? 161  VAL A O     1 
ATOM   1254 C  CB    . VAL A 1 164 ? 75.966 -3.475  23.553  1.00 78.57  ? 161  VAL A CB    1 
ATOM   1255 C  CG1   . VAL A 1 164 ? 76.754 -4.553  24.279  1.00 76.55  ? 161  VAL A CG1   1 
ATOM   1256 C  CG2   . VAL A 1 164 ? 76.559 -2.100  23.825  1.00 79.63  ? 161  VAL A CG2   1 
ATOM   1257 N  N     . GLN A 1 165 ? 75.468 -2.168  20.257  1.00 55.98  ? 162  GLN A N     1 
ATOM   1258 C  CA    . GLN A 1 165 ? 74.690 -1.147  19.559  1.00 52.03  ? 162  GLN A CA    1 
ATOM   1259 C  C     . GLN A 1 165 ? 74.165 -1.639  18.214  1.00 43.18  ? 162  GLN A C     1 
ATOM   1260 O  O     . GLN A 1 165 ? 74.728 -2.556  17.614  1.00 39.14  ? 162  GLN A O     1 
ATOM   1261 C  CB    . GLN A 1 165 ? 75.510 0.131   19.381  1.00 61.54  ? 162  GLN A CB    1 
ATOM   1262 C  CG    . GLN A 1 165 ? 75.998 0.724   20.695  1.00 73.45  ? 162  GLN A CG    1 
ATOM   1263 C  CD    . GLN A 1 165 ? 76.650 2.081   20.522  1.00 82.46  ? 162  GLN A CD    1 
ATOM   1264 O  OE1   . GLN A 1 165 ? 77.471 2.496   21.342  1.00 85.43  ? 162  GLN A OE1   1 
ATOM   1265 N  NE2   . GLN A 1 165 ? 76.282 2.785   19.457  1.00 83.69  ? 162  GLN A NE2   1 
ATOM   1266 N  N     . LYS A 1 166 ? 73.087 -1.015  17.748  1.00 34.60  ? 163  LYS A N     1 
ATOM   1267 C  CA    . LYS A 1 166 ? 72.366 -1.487  16.571  1.00 35.85  ? 163  LYS A CA    1 
ATOM   1268 C  C     . LYS A 1 166 ? 73.204 -1.467  15.290  1.00 32.41  ? 163  LYS A C     1 
ATOM   1269 O  O     . LYS A 1 166 ? 73.240 -2.453  14.559  1.00 26.28  ? 163  LYS A O     1 
ATOM   1270 C  CB    . LYS A 1 166 ? 71.073 -0.687  16.376  1.00 43.86  ? 163  LYS A CB    1 
ATOM   1271 C  CG    . LYS A 1 166 ? 70.083 -1.330  15.424  1.00 54.77  ? 163  LYS A CG    1 
ATOM   1272 C  CD    . LYS A 1 166 ? 68.900 -0.413  15.165  1.00 64.48  ? 163  LYS A CD    1 
ATOM   1273 C  CE    . LYS A 1 166 ? 69.357 0.917   14.578  1.00 72.97  ? 163  LYS A CE    1 
ATOM   1274 N  NZ    . LYS A 1 166 ? 68.215 1.780   14.159  1.00 75.96  ? 163  LYS A NZ    1 
ATOM   1275 N  N     . GLU A 1 167 ? 73.867 -0.351  15.004  1.00 34.50  ? 164  GLU A N     1 
ATOM   1276 C  CA    . GLU A 1 167 ? 74.656 -0.263  13.777  1.00 33.47  ? 164  GLU A CA    1 
ATOM   1277 C  C     . GLU A 1 167 ? 75.803 -1.270  13.798  1.00 32.66  ? 164  GLU A C     1 
ATOM   1278 O  O     . GLU A 1 167 ? 76.208 -1.788  12.760  1.00 28.45  ? 164  GLU A O     1 
ATOM   1279 C  CB    . GLU A 1 167 ? 75.183 1.160   13.552  1.00 35.86  ? 164  GLU A CB    1 
ATOM   1280 C  CG    . GLU A 1 167 ? 76.205 1.295   12.419  1.00 37.19  ? 164  GLU A CG    1 
ATOM   1281 C  CD    . GLU A 1 167 ? 75.627 1.010   11.033  1.00 39.95  ? 164  GLU A CD    1 
ATOM   1282 O  OE1   . GLU A 1 167 ? 76.420 0.912   10.070  1.00 40.65  ? 164  GLU A OE1   1 
ATOM   1283 O  OE2   . GLU A 1 167 ? 74.390 0.896   10.897  1.00 33.13  ? 164  GLU A OE2   1 
ATOM   1284 N  N     . GLY A 1 168 ? 76.318 -1.545  14.991  1.00 32.00  ? 165  GLY A N     1 
ATOM   1285 C  CA    . GLY A 1 168 ? 77.410 -2.483  15.149  1.00 32.35  ? 165  GLY A CA    1 
ATOM   1286 C  C     . GLY A 1 168 ? 76.991 -3.898  14.816  1.00 27.98  ? 165  GLY A C     1 
ATOM   1287 O  O     . GLY A 1 168 ? 77.712 -4.634  14.139  1.00 29.40  ? 165  GLY A O     1 
ATOM   1288 N  N     . MET A 1 169 ? 75.822 -4.287  15.312  1.00 28.57  ? 166  MET A N     1 
ATOM   1289 C  CA    . MET A 1 169 ? 75.256 -5.582  14.982  1.00 26.29  ? 166  MET A CA    1 
ATOM   1290 C  C     . MET A 1 169 ? 75.033 -5.673  13.473  1.00 22.78  ? 166  MET A C     1 
ATOM   1291 O  O     . MET A 1 169 ? 75.359 -6.689  12.860  1.00 23.80  ? 166  MET A O     1 
ATOM   1292 C  CB    . MET A 1 169 ? 73.923 -5.790  15.711  1.00 33.16  ? 166  MET A CB    1 
ATOM   1293 C  CG    . MET A 1 169 ? 74.043 -5.937  17.220  1.00 41.30  ? 166  MET A CG    1 
ATOM   1294 S  SD    . MET A 1 169 ? 74.530 -7.602  17.721  1.00 61.39  ? 166  MET A SD    1 
ATOM   1295 C  CE    . MET A 1 169 ? 73.199 -8.562  17.002  1.00 35.25  ? 166  MET A CE    1 
ATOM   1296 N  N     . ARG A 1 170 ? 74.488 -4.614  12.875  1.00 21.33  ? 167  ARG A N     1 
ATOM   1297 C  CA    . ARG A 1 170 ? 74.211 -4.630  11.437  1.00 20.35  ? 167  ARG A CA    1 
ATOM   1298 C  C     . ARG A 1 170 ? 75.485 -4.935  10.665  1.00 18.90  ? 167  ARG A C     1 
ATOM   1299 O  O     . ARG A 1 170 ? 75.500 -5.807  9.802   1.00 18.23  ? 167  ARG A O     1 
ATOM   1300 C  CB    . ARG A 1 170 ? 73.638 -3.304  10.935  1.00 17.64  ? 167  ARG A CB    1 
ATOM   1301 C  CG    . ARG A 1 170 ? 73.269 -3.372  9.449   1.00 16.58  ? 167  ARG A CG    1 
ATOM   1302 C  CD    . ARG A 1 170 ? 73.061 -2.006  8.802   1.00 16.59  ? 167  ARG A CD    1 
ATOM   1303 N  NE    . ARG A 1 170 ? 74.306 -1.256  8.620   1.00 18.43  ? 167  ARG A NE    1 
ATOM   1304 C  CZ    . ARG A 1 170 ? 75.135 -1.401  7.586   1.00 20.45  ? 167  ARG A CZ    1 
ATOM   1305 N  NH1   . ARG A 1 170 ? 74.862 -2.266  6.614   1.00 17.00  ? 167  ARG A NH1   1 
ATOM   1306 N  NH2   . ARG A 1 170 ? 76.237 -0.665  7.517   1.00 22.03  ? 167  ARG A NH2   1 
ATOM   1307 N  N     . LYS A 1 171 ? 76.557 -4.213  10.984  1.00 18.92  ? 168  LYS A N     1 
ATOM   1308 C  CA    . LYS A 1 171 ? 77.830 -4.417  10.307  1.00 19.80  ? 168  LYS A CA    1 
ATOM   1309 C  C     . LYS A 1 171 ? 78.407 -5.812  10.550  1.00 21.58  ? 168  LYS A C     1 
ATOM   1310 O  O     . LYS A 1 171 ? 78.977 -6.423  9.642   1.00 22.25  ? 168  LYS A O     1 
ATOM   1311 C  CB    . LYS A 1 171 ? 78.845 -3.349  10.724  1.00 24.56  ? 168  LYS A CB    1 
ATOM   1312 C  CG    . LYS A 1 171 ? 78.527 -1.952  10.207  1.00 31.20  ? 168  LYS A CG    1 
ATOM   1313 C  CD    . LYS A 1 171 ? 79.628 -0.987  10.637  1.00 42.52  ? 168  LYS A CD    1 
ATOM   1314 C  CE    . LYS A 1 171 ? 79.429 0.402   10.056  1.00 53.66  ? 168  LYS A CE    1 
ATOM   1315 N  NZ    . LYS A 1 171 ? 80.525 1.322   10.473  1.00 62.15  ? 168  LYS A NZ    1 
ATOM   1316 N  N     . GLN A 1 172 ? 78.278 -6.312  11.774  1.00 21.14  ? 169  GLN A N     1 
ATOM   1317 C  CA    . GLN A 1 172 ? 78.776 -7.644  12.092  1.00 21.41  ? 169  GLN A CA    1 
ATOM   1318 C  C     . GLN A 1 172 ? 78.118 -8.696  11.201  1.00 19.59  ? 169  GLN A C     1 
ATOM   1319 O  O     . GLN A 1 172 ? 78.791 -9.591  10.673  1.00 21.05  ? 169  GLN A O     1 
ATOM   1320 C  CB    . GLN A 1 172 ? 78.518 -7.977  13.563  1.00 34.60  ? 169  GLN A CB    1 
ATOM   1321 C  CG    . GLN A 1 172 ? 79.461 -7.298  14.537  1.00 51.25  ? 169  GLN A CG    1 
ATOM   1322 C  CD    . GLN A 1 172 ? 80.751 -8.070  14.721  1.00 69.48  ? 169  GLN A CD    1 
ATOM   1323 O  OE1   . GLN A 1 172 ? 80.800 -9.280  14.495  1.00 76.15  ? 169  GLN A OE1   1 
ATOM   1324 N  NE2   . GLN A 1 172 ? 81.807 -7.375  15.133  1.00 75.10  ? 169  GLN A NE2   1 
ATOM   1325 N  N     . GLY A 1 173 ? 76.801 -8.597  11.047  1.00 21.24  ? 170  GLY A N     1 
ATOM   1326 C  CA    . GLY A 1 173 ? 76.070 -9.579  10.267  1.00 17.03  ? 170  GLY A CA    1 
ATOM   1327 C  C     . GLY A 1 173 ? 76.432 -9.469  8.803   1.00 18.51  ? 170  GLY A C     1 
ATOM   1328 O  O     . GLY A 1 173 ? 76.607 -10.475 8.114   1.00 16.67  ? 170  GLY A O     1 
ATOM   1329 N  N     . LEU A 1 174 ? 76.561 -8.237  8.329   1.00 17.39  ? 171  LEU A N     1 
ATOM   1330 C  CA    . LEU A 1 174 ? 76.941 -8.000  6.944   1.00 17.13  ? 171  LEU A CA    1 
ATOM   1331 C  C     . LEU A 1 174 ? 78.330 -8.566  6.655   1.00 21.06  ? 171  LEU A C     1 
ATOM   1332 O  O     . LEU A 1 174 ? 78.548 -9.183  5.612   1.00 19.73  ? 171  LEU A O     1 
ATOM   1333 C  CB    . LEU A 1 174 ? 76.887 -6.500  6.619   1.00 17.45  ? 171  LEU A CB    1 
ATOM   1334 C  CG    . LEU A 1 174 ? 77.211 -6.114  5.176   1.00 18.34  ? 171  LEU A CG    1 
ATOM   1335 C  CD1   . LEU A 1 174 ? 76.251 -6.792  4.193   1.00 18.14  ? 171  LEU A CD1   1 
ATOM   1336 C  CD2   . LEU A 1 174 ? 77.170 -4.592  5.005   1.00 20.50  ? 171  LEU A CD2   1 
ATOM   1337 N  N     . PHE A 1 175 ? 79.265 -8.360  7.582   1.00 17.59  ? 172  PHE A N     1 
ATOM   1338 C  CA    . PHE A 1 175 ? 80.607 -8.907  7.424   1.00 21.21  ? 172  PHE A CA    1 
ATOM   1339 C  C     . PHE A 1 175 ? 80.574 -10.429 7.337   1.00 22.40  ? 172  PHE A C     1 
ATOM   1340 O  O     . PHE A 1 175 ? 81.240 -11.016 6.488   1.00 25.21  ? 172  PHE A O     1 
ATOM   1341 C  CB    . PHE A 1 175 ? 81.512 -8.459  8.568   1.00 22.07  ? 172  PHE A CB    1 
ATOM   1342 C  CG    . PHE A 1 175 ? 81.944 -7.021  8.474   1.00 39.90  ? 172  PHE A CG    1 
ATOM   1343 C  CD1   . PHE A 1 175 ? 81.995 -6.377  7.249   1.00 44.55  ? 172  PHE A CD1   1 
ATOM   1344 C  CD2   . PHE A 1 175 ? 82.303 -6.316  9.612   1.00 48.66  ? 172  PHE A CD2   1 
ATOM   1345 C  CE1   . PHE A 1 175 ? 82.395 -5.054  7.159   1.00 52.88  ? 172  PHE A CE1   1 
ATOM   1346 C  CE2   . PHE A 1 175 ? 82.704 -4.993  9.530   1.00 56.75  ? 172  PHE A CE2   1 
ATOM   1347 C  CZ    . PHE A 1 175 ? 82.749 -4.361  8.301   1.00 57.35  ? 172  PHE A CZ    1 
ATOM   1348 N  N     . GLN A 1 176 ? 79.802 -11.074 8.214   1.00 20.40  ? 173  GLN A N     1 
ATOM   1349 C  CA    . GLN A 1 176 ? 79.730 -12.531 8.197   1.00 18.89  ? 173  GLN A CA    1 
ATOM   1350 C  C     . GLN A 1 176 ? 79.186 -13.020 6.861   1.00 23.80  ? 173  GLN A C     1 
ATOM   1351 O  O     . GLN A 1 176 ? 79.693 -13.977 6.278   1.00 22.73  ? 173  GLN A O     1 
ATOM   1352 C  CB    . GLN A 1 176 ? 78.882 -13.077 9.361   1.00 20.00  ? 173  GLN A CB    1 
ATOM   1353 C  CG    . GLN A 1 176 ? 79.501 -12.852 10.745  1.00 23.61  ? 173  GLN A CG    1 
ATOM   1354 C  CD    . GLN A 1 176 ? 78.737 -13.544 11.861  1.00 23.63  ? 173  GLN A CD    1 
ATOM   1355 O  OE1   . GLN A 1 176 ? 77.633 -14.049 11.663  1.00 25.33  ? 173  GLN A OE1   1 
ATOM   1356 N  NE2   . GLN A 1 176 ? 79.339 -13.585 13.046  1.00 29.43  ? 173  GLN A NE2   1 
ATOM   1357 N  N     . TRP A 1 177 ? 78.156 -12.344 6.375   1.00 20.00  ? 174  TRP A N     1 
ATOM   1358 C  CA    . TRP A 1 177 ? 77.529 -12.711 5.115   1.00 17.78  ? 174  TRP A CA    1 
ATOM   1359 C  C     . TRP A 1 177 ? 78.513 -12.578 3.965   1.00 17.64  ? 174  TRP A C     1 
ATOM   1360 O  O     . TRP A 1 177 ? 78.690 -13.512 3.174   1.00 20.87  ? 174  TRP A O     1 
ATOM   1361 C  CB    . TRP A 1 177 ? 76.310 -11.819 4.874   1.00 16.77  ? 174  TRP A CB    1 
ATOM   1362 C  CG    . TRP A 1 177 ? 75.669 -11.980 3.536   1.00 16.35  ? 174  TRP A CG    1 
ATOM   1363 C  CD1   . TRP A 1 177 ? 75.782 -11.135 2.467   1.00 15.75  ? 174  TRP A CD1   1 
ATOM   1364 C  CD2   . TRP A 1 177 ? 74.777 -13.026 3.125   1.00 16.28  ? 174  TRP A CD2   1 
ATOM   1365 N  NE1   . TRP A 1 177 ? 75.022 -11.593 1.417   1.00 16.09  ? 174  TRP A NE1   1 
ATOM   1366 C  CE2   . TRP A 1 177 ? 74.398 -12.755 1.796   1.00 16.31  ? 174  TRP A CE2   1 
ATOM   1367 C  CE3   . TRP A 1 177 ? 74.268 -14.169 3.749   1.00 19.57  ? 174  TRP A CE3   1 
ATOM   1368 C  CZ2   . TRP A 1 177 ? 73.533 -13.590 1.082   1.00 14.95  ? 174  TRP A CZ2   1 
ATOM   1369 C  CZ3   . TRP A 1 177 ? 73.408 -14.998 3.036   1.00 16.48  ? 174  TRP A CZ3   1 
ATOM   1370 C  CH2   . TRP A 1 177 ? 73.045 -14.699 1.720   1.00 19.02  ? 174  TRP A CH2   1 
ATOM   1371 N  N     . LEU A 1 178 ? 79.169 -11.424 3.887   1.00 18.87  ? 175  LEU A N     1 
ATOM   1372 C  CA    . LEU A 1 178 ? 80.080 -11.147 2.780   1.00 16.79  ? 175  LEU A CA    1 
ATOM   1373 C  C     . LEU A 1 178 ? 81.286 -12.081 2.796   1.00 28.15  ? 175  LEU A C     1 
ATOM   1374 O  O     . LEU A 1 178 ? 81.756 -12.510 1.742   1.00 30.37  ? 175  LEU A O     1 
ATOM   1375 C  CB    . LEU A 1 178 ? 80.537 -9.686  2.792   1.00 20.49  ? 175  LEU A CB    1 
ATOM   1376 C  CG    . LEU A 1 178 ? 79.449 -8.657  2.472   1.00 23.10  ? 175  LEU A CG    1 
ATOM   1377 C  CD1   . LEU A 1 178 ? 80.024 -7.251  2.503   1.00 24.29  ? 175  LEU A CD1   1 
ATOM   1378 C  CD2   . LEU A 1 178 ? 78.790 -8.940  1.121   1.00 18.04  ? 175  LEU A CD2   1 
ATOM   1379 N  N     . ASP A 1 179 ? 81.783 -12.391 3.990   1.00 24.15  ? 176  ASP A N     1 
ATOM   1380 C  CA    . ASP A 1 179 ? 82.938 -13.286 4.116   1.00 29.15  ? 176  ASP A CA    1 
ATOM   1381 C  C     . ASP A 1 179 ? 82.661 -14.650 3.503   1.00 34.60  ? 176  ASP A C     1 
ATOM   1382 O  O     . ASP A 1 179 ? 83.545 -15.258 2.900   1.00 34.47  ? 176  ASP A O     1 
ATOM   1383 C  CB    . ASP A 1 179 ? 83.330 -13.466 5.584   1.00 32.42  ? 176  ASP A CB    1 
ATOM   1384 C  CG    . ASP A 1 179 ? 84.040 -12.256 6.146   1.00 48.03  ? 176  ASP A CG    1 
ATOM   1385 O  OD1   . ASP A 1 179 ? 84.655 -11.510 5.355   1.00 55.09  ? 176  ASP A OD1   1 
ATOM   1386 O  OD2   . ASP A 1 179 ? 83.985 -12.050 7.377   1.00 54.69  ? 176  ASP A OD2   1 
ATOM   1387 N  N     . SER A 1 180 ? 81.429 -15.121 3.664   1.00 28.84  ? 177  SER A N     1 
ATOM   1388 C  CA    . SER A 1 180 ? 81.036 -16.456 3.231   1.00 33.34  ? 177  SER A CA    1 
ATOM   1389 C  C     . SER A 1 180 ? 80.619 -16.525 1.767   1.00 34.98  ? 177  SER A C     1 
ATOM   1390 O  O     . SER A 1 180 ? 80.410 -17.612 1.230   1.00 42.27  ? 177  SER A O     1 
ATOM   1391 C  CB    . SER A 1 180 ? 79.872 -16.957 4.088   1.00 36.66  ? 177  SER A CB    1 
ATOM   1392 O  OG    . SER A 1 180 ? 80.149 -16.808 5.467   1.00 43.47  ? 177  SER A OG    1 
ATOM   1393 N  N     . LEU A 1 181 ? 80.473 -15.371 1.127   1.00 25.76  ? 178  LEU A N     1 
ATOM   1394 C  CA    A LEU A 1 181 ? 79.975 -15.326 -0.247  0.40 26.25  ? 178  LEU A CA    1 
ATOM   1395 C  CA    B LEU A 1 181 ? 79.973 -15.318 -0.240  0.60 25.12  ? 178  LEU A CA    1 
ATOM   1396 C  C     . LEU A 1 181 ? 80.925 -15.938 -1.268  1.00 34.54  ? 178  LEU A C     1 
ATOM   1397 O  O     . LEU A 1 181 ? 82.133 -15.712 -1.225  1.00 35.24  ? 178  LEU A O     1 
ATOM   1398 C  CB    A LEU A 1 181 ? 79.645 -13.892 -0.659  0.40 28.17  ? 178  LEU A CB    1 
ATOM   1399 C  CB    B LEU A 1 181 ? 79.672 -13.866 -0.612  0.60 28.96  ? 178  LEU A CB    1 
ATOM   1400 C  CG    A LEU A 1 181 ? 78.312 -13.339 -0.169  0.40 22.98  ? 178  LEU A CG    1 
ATOM   1401 C  CG    B LEU A 1 181 ? 78.637 -13.638 -1.705  0.60 27.18  ? 178  LEU A CG    1 
ATOM   1402 C  CD1   A LEU A 1 181 ? 78.074 -11.963 -0.768  0.40 18.72  ? 178  LEU A CD1   1 
ATOM   1403 C  CD1   B LEU A 1 181 ? 77.333 -14.340 -1.350  0.60 22.18  ? 178  LEU A CD1   1 
ATOM   1404 C  CD2   A LEU A 1 181 ? 77.174 -14.279 -0.531  0.40 21.59  ? 178  LEU A CD2   1 
ATOM   1405 C  CD2   B LEU A 1 181 ? 78.425 -12.145 -1.905  0.60 19.64  ? 178  LEU A CD2   1 
ATOM   1406 N  N     . GLN A 1 182 ? 80.366 -16.711 -2.197  1.00 42.40  ? 179  GLN A N     1 
ATOM   1407 C  CA    . GLN A 1 182 ? 81.147 -17.302 -3.280  1.00 51.70  ? 179  GLN A CA    1 
ATOM   1408 C  C     . GLN A 1 182 ? 80.989 -16.483 -4.560  1.00 53.79  ? 179  GLN A C     1 
ATOM   1409 O  O     . GLN A 1 182 ? 80.189 -16.823 -5.436  1.00 54.69  ? 179  GLN A O     1 
ATOM   1410 C  CB    . GLN A 1 182 ? 80.718 -18.752 -3.523  1.00 62.44  ? 179  GLN A CB    1 
ATOM   1411 C  CG    . GLN A 1 182 ? 81.516 -19.473 -4.602  1.00 74.26  ? 179  GLN A CG    1 
ATOM   1412 C  CD    . GLN A 1 182 ? 82.999 -19.547 -4.284  1.00 84.71  ? 179  GLN A CD    1 
ATOM   1413 O  OE1   . GLN A 1 182 ? 83.785 -18.709 -4.729  1.00 88.83  ? 179  GLN A OE1   1 
ATOM   1414 N  NE2   . GLN A 1 182 ? 83.389 -20.555 -3.512  1.00 85.77  ? 179  GLN A NE2   1 
ATOM   1415 N  N     . ILE A 1 183 ? 81.761 -15.405 -4.662  1.00 52.55  ? 180  ILE A N     1 
ATOM   1416 C  CA    . ILE A 1 183 ? 81.663 -14.478 -5.787  1.00 54.78  ? 180  ILE A CA    1 
ATOM   1417 C  C     . ILE A 1 183 ? 82.074 -15.133 -7.101  1.00 57.69  ? 180  ILE A C     1 
ATOM   1418 O  O     . ILE A 1 183 ? 81.872 -14.573 -8.179  1.00 49.74  ? 180  ILE A O     1 
ATOM   1419 C  CB    . ILE A 1 183 ? 82.539 -13.238 -5.554  1.00 51.38  ? 180  ILE A CB    1 
ATOM   1420 C  CG1   . ILE A 1 183 ? 84.012 -13.643 -5.476  1.00 53.07  ? 180  ILE A CG1   1 
ATOM   1421 C  CG2   . ILE A 1 183 ? 82.113 -12.523 -4.281  1.00 52.23  ? 180  ILE A CG2   1 
ATOM   1422 C  CD1   . ILE A 1 183 ? 84.947 -12.490 -5.200  1.00 55.37  ? 180  ILE A CD1   1 
ATOM   1423 N  N     . ASP A 1 184 ? 82.647 -16.326 -6.998  1.00 70.26  ? 181  ASP A N     1 
ATOM   1424 C  CA    . ASP A 1 184 ? 83.142 -17.055 -8.156  1.00 82.13  ? 181  ASP A CA    1 
ATOM   1425 C  C     . ASP A 1 184 ? 82.002 -17.554 -9.043  1.00 75.85  ? 181  ASP A C     1 
ATOM   1426 O  O     . ASP A 1 184 ? 82.164 -17.699 -10.254 1.00 77.89  ? 181  ASP A O     1 
ATOM   1427 C  CB    . ASP A 1 184 ? 83.995 -18.238 -7.692  1.00 97.72  ? 181  ASP A CB    1 
ATOM   1428 C  CG    . ASP A 1 184 ? 84.965 -18.712 -8.753  1.00 112.34 ? 181  ASP A CG    1 
ATOM   1429 O  OD1   . ASP A 1 184 ? 84.699 -18.485 -9.952  1.00 117.76 ? 181  ASP A OD1   1 
ATOM   1430 O  OD2   . ASP A 1 184 ? 85.996 -19.314 -8.386  1.00 116.87 ? 181  ASP A OD2   1 
ATOM   1431 N  N     . ASN A 1 185 ? 80.847 -17.805 -8.433  1.00 62.82  ? 182  ASN A N     1 
ATOM   1432 C  CA    . ASN A 1 185 ? 79.730 -18.438 -9.129  1.00 50.34  ? 182  ASN A CA    1 
ATOM   1433 C  C     . ASN A 1 185 ? 78.590 -17.476 -9.453  1.00 46.32  ? 182  ASN A C     1 
ATOM   1434 O  O     . ASN A 1 185 ? 77.843 -17.065 -8.565  1.00 43.24  ? 182  ASN A O     1 
ATOM   1435 C  CB    . ASN A 1 185 ? 79.209 -19.614 -8.300  1.00 43.67  ? 182  ASN A CB    1 
ATOM   1436 C  CG    . ASN A 1 185 ? 78.088 -20.363 -8.986  1.00 46.38  ? 182  ASN A CG    1 
ATOM   1437 O  OD1   . ASN A 1 185 ? 77.857 -20.203 -10.185 1.00 47.70  ? 182  ASN A OD1   1 
ATOM   1438 N  ND2   . ASN A 1 185 ? 77.384 -21.195 -8.224  1.00 49.15  ? 182  ASN A ND2   1 
ATOM   1439 N  N     . LEU A 1 186 ? 78.455 -17.133 -10.731 1.00 41.62  ? 183  LEU A N     1 
ATOM   1440 C  CA    . LEU A 1 186 ? 77.438 -16.177 -11.173 1.00 46.68  ? 183  LEU A CA    1 
ATOM   1441 C  C     . LEU A 1 186 ? 76.004 -16.689 -11.017 1.00 42.00  ? 183  LEU A C     1 
ATOM   1442 O  O     . LEU A 1 186 ? 75.051 -15.910 -11.094 1.00 42.45  ? 183  LEU A O     1 
ATOM   1443 C  CB    . LEU A 1 186 ? 77.692 -15.750 -12.622 1.00 53.97  ? 183  LEU A CB    1 
ATOM   1444 C  CG    . LEU A 1 186 ? 78.727 -14.644 -12.854 1.00 62.66  ? 183  LEU A CG    1 
ATOM   1445 C  CD1   . LEU A 1 186 ? 80.030 -14.925 -12.113 1.00 66.99  ? 183  LEU A CD1   1 
ATOM   1446 C  CD2   . LEU A 1 186 ? 78.982 -14.451 -14.342 1.00 63.12  ? 183  LEU A CD2   1 
ATOM   1447 N  N     . THR A 1 187 ? 75.855 -17.992 -10.796 1.00 38.97  ? 184  THR A N     1 
ATOM   1448 C  CA    . THR A 1 187 ? 74.531 -18.590 -10.621 1.00 40.30  ? 184  THR A CA    1 
ATOM   1449 C  C     . THR A 1 187 ? 74.168 -18.819 -9.151  1.00 36.13  ? 184  THR A C     1 
ATOM   1450 O  O     . THR A 1 187 ? 73.100 -19.351 -8.855  1.00 40.07  ? 184  THR A O     1 
ATOM   1451 C  CB    . THR A 1 187 ? 74.393 -19.930 -11.388 1.00 62.94  ? 184  THR A CB    1 
ATOM   1452 O  OG1   . THR A 1 187 ? 75.207 -20.935 -10.768 1.00 63.29  ? 184  THR A OG1   1 
ATOM   1453 C  CG2   . THR A 1 187 ? 74.808 -19.765 -12.844 1.00 62.32  ? 184  THR A CG2   1 
ATOM   1454 N  N     . SER A 1 188 ? 75.052 -18.427 -8.237  1.00 27.80  ? 185  SER A N     1 
ATOM   1455 C  CA    . SER A 1 188 ? 74.787 -18.588 -6.802  1.00 23.21  ? 185  SER A CA    1 
ATOM   1456 C  C     . SER A 1 188 ? 73.632 -17.701 -6.343  1.00 18.70  ? 185  SER A C     1 
ATOM   1457 O  O     . SER A 1 188 ? 73.683 -16.480 -6.484  1.00 17.44  ? 185  SER A O     1 
ATOM   1458 C  CB    . SER A 1 188 ? 76.026 -18.262 -5.973  1.00 29.12  ? 185  SER A CB    1 
ATOM   1459 O  OG    . SER A 1 188 ? 75.700 -18.237 -4.589  1.00 37.18  ? 185  SER A OG    1 
ATOM   1460 N  N     . PRO A 1 189 ? 72.566 -18.308 -5.804  1.00 17.99  ? 186  PRO A N     1 
ATOM   1461 C  CA    . PRO A 1 189 ? 71.429 -17.464 -5.407  1.00 15.17  ? 186  PRO A CA    1 
ATOM   1462 C  C     . PRO A 1 189 ? 71.772 -16.452 -4.328  1.00 15.36  ? 186  PRO A C     1 
ATOM   1463 O  O     . PRO A 1 189 ? 71.231 -15.355 -4.350  1.00 14.64  ? 186  PRO A O     1 
ATOM   1464 C  CB    . PRO A 1 189 ? 70.424 -18.471 -4.851  1.00 15.80  ? 186  PRO A CB    1 
ATOM   1465 C  CG    . PRO A 1 189 ? 70.741 -19.755 -5.599  1.00 20.03  ? 186  PRO A CG    1 
ATOM   1466 C  CD    . PRO A 1 189 ? 72.244 -19.747 -5.765  1.00 20.07  ? 186  PRO A CD    1 
ATOM   1467 N  N     . ASP A 1 190 ? 72.640 -16.805 -3.385  1.00 16.43  ? 187  ASP A N     1 
ATOM   1468 C  CA    . ASP A 1 190 ? 72.997 -15.846 -2.339  1.00 9.58   ? 187  ASP A CA    1 
ATOM   1469 C  C     . ASP A 1 190 ? 73.730 -14.645 -2.929  1.00 14.74  ? 187  ASP A C     1 
ATOM   1470 O  O     . ASP A 1 190 ? 73.513 -13.502 -2.508  1.00 14.94  ? 187  ASP A O     1 
ATOM   1471 C  CB    . ASP A 1 190 ? 73.879 -16.521 -1.269  1.00 14.52  ? 187  ASP A CB    1 
ATOM   1472 C  CG    . ASP A 1 190 ? 73.108 -17.491 -0.373  1.00 18.37  ? 187  ASP A CG    1 
ATOM   1473 O  OD1   . ASP A 1 190 ? 71.860 -17.440 -0.301  1.00 16.44  ? 187  ASP A OD1   1 
ATOM   1474 O  OD2   . ASP A 1 190 ? 73.771 -18.320 0.279   1.00 21.40  ? 187  ASP A OD2   1 
ATOM   1475 N  N     . LEU A 1 191 ? 74.619 -14.901 -3.887  1.00 15.89  ? 188  LEU A N     1 
ATOM   1476 C  CA    . LEU A 1 191 ? 75.310 -13.821 -4.589  1.00 16.81  ? 188  LEU A CA    1 
ATOM   1477 C  C     . LEU A 1 191 ? 74.322 -12.945 -5.353  1.00 15.15  ? 188  LEU A C     1 
ATOM   1478 O  O     . LEU A 1 191 ? 74.428 -11.709 -5.355  1.00 14.26  ? 188  LEU A O     1 
ATOM   1479 C  CB    . LEU A 1 191 ? 76.352 -14.397 -5.556  1.00 18.09  ? 188  LEU A CB    1 
ATOM   1480 C  CG    . LEU A 1 191 ? 77.096 -13.358 -6.400  1.00 21.20  ? 188  LEU A CG    1 
ATOM   1481 C  CD1   . LEU A 1 191 ? 77.825 -12.354 -5.524  1.00 20.66  ? 188  LEU A CD1   1 
ATOM   1482 C  CD2   . LEU A 1 191 ? 78.081 -14.051 -7.352  1.00 20.11  ? 188  LEU A CD2   1 
ATOM   1483 N  N     . GLN A 1 192 ? 73.366 -13.591 -6.016  1.00 14.66  ? 189  GLN A N     1 
ATOM   1484 C  CA    . GLN A 1 192 ? 72.346 -12.866 -6.767  1.00 16.21  ? 189  GLN A CA    1 
ATOM   1485 C  C     . GLN A 1 192 ? 71.553 -11.933 -5.858  1.00 13.23  ? 189  GLN A C     1 
ATOM   1486 O  O     . GLN A 1 192 ? 71.307 -10.783 -6.203  1.00 13.75  ? 189  GLN A O     1 
ATOM   1487 C  CB    . GLN A 1 192 ? 71.437 -13.853 -7.505  1.00 15.44  ? 189  GLN A CB    1 
ATOM   1488 C  CG    . GLN A 1 192 ? 72.186 -14.553 -8.648  1.00 19.74  ? 189  GLN A CG    1 
ATOM   1489 C  CD    . GLN A 1 192 ? 71.379 -15.644 -9.315  1.00 32.02  ? 189  GLN A CD    1 
ATOM   1490 O  OE1   . GLN A 1 192 ? 70.462 -16.207 -8.723  1.00 34.89  ? 189  GLN A OE1   1 
ATOM   1491 N  NE2   . GLN A 1 192 ? 71.726 -15.955 -10.558 1.00 37.31  ? 189  GLN A NE2   1 
ATOM   1492 N  N     . LEU A 1 193 ? 71.157 -12.420 -4.688  1.00 11.77  ? 190  LEU A N     1 
ATOM   1493 C  CA    . LEU A 1 193 ? 70.469 -11.556 -3.737  1.00 10.24  ? 190  LEU A CA    1 
ATOM   1494 C  C     . LEU A 1 193 ? 71.327 -10.387 -3.277  1.00 11.82  ? 190  LEU A C     1 
ATOM   1495 O  O     . LEU A 1 193 ? 70.813 -9.295  -3.035  1.00 13.79  ? 190  LEU A O     1 
ATOM   1496 C  CB    . LEU A 1 193 ? 70.025 -12.342 -2.501  1.00 12.46  ? 190  LEU A CB    1 
ATOM   1497 C  CG    . LEU A 1 193 ? 68.953 -13.419 -2.668  1.00 10.40  ? 190  LEU A CG    1 
ATOM   1498 C  CD1   . LEU A 1 193 ? 68.611 -14.035 -1.303  1.00 15.86  ? 190  LEU A CD1   1 
ATOM   1499 C  CD2   . LEU A 1 193 ? 67.713 -12.831 -3.330  1.00 10.90  ? 190  LEU A CD2   1 
ATOM   1500 N  N     . THR A 1 194 ? 72.622 -10.636 -3.105  1.00 13.10  ? 191  THR A N     1 
ATOM   1501 C  CA    . THR A 1 194 ? 73.533 -9.615  -2.621  1.00 11.84  ? 191  THR A CA    1 
ATOM   1502 C  C     . THR A 1 194 ? 73.649 -8.495  -3.644  1.00 15.33  ? 191  THR A C     1 
ATOM   1503 O  O     . THR A 1 194 ? 73.608 -7.323  -3.290  1.00 13.06  ? 191  THR A O     1 
ATOM   1504 C  CB    . THR A 1 194 ? 74.903 -10.201 -2.320  1.00 13.78  ? 191  THR A CB    1 
ATOM   1505 O  OG1   . THR A 1 194 ? 74.745 -11.252 -1.362  1.00 14.97  ? 191  THR A OG1   1 
ATOM   1506 C  CG2   . THR A 1 194 ? 75.836 -9.133  -1.753  1.00 15.82  ? 191  THR A CG2   1 
ATOM   1507 N  N     . VAL A 1 195 ? 73.794 -8.875  -4.911  1.00 13.28  ? 192  VAL A N     1 
ATOM   1508 C  CA    . VAL A 1 195 ? 73.826 -7.894  -5.988  1.00 16.35  ? 192  VAL A CA    1 
ATOM   1509 C  C     . VAL A 1 195 ? 72.484 -7.159  -6.092  1.00 15.47  ? 192  VAL A C     1 
ATOM   1510 O  O     . VAL A 1 195 ? 72.449 -5.949  -6.320  1.00 15.50  ? 192  VAL A O     1 
ATOM   1511 C  CB    . VAL A 1 195 ? 74.209 -8.556  -7.327  1.00 14.37  ? 192  VAL A CB    1 
ATOM   1512 C  CG1   . VAL A 1 195 ? 74.122 -7.551  -8.467  1.00 15.35  ? 192  VAL A CG1   1 
ATOM   1513 C  CG2   . VAL A 1 195 ? 75.622 -9.106  -7.246  1.00 17.54  ? 192  VAL A CG2   1 
ATOM   1514 N  N     . GLY A 1 196 ? 71.380 -7.885  -5.912  1.00 13.05  ? 193  GLY A N     1 
ATOM   1515 C  CA    . GLY A 1 196 ? 70.072 -7.246  -5.834  1.00 13.12  ? 193  GLY A CA    1 
ATOM   1516 C  C     . GLY A 1 196 ? 70.043 -6.167  -4.765  1.00 14.00  ? 193  GLY A C     1 
ATOM   1517 O  O     . GLY A 1 196 ? 69.518 -5.068  -4.972  1.00 13.60  ? 193  GLY A O     1 
ATOM   1518 N  N     . ALA A 1 197 ? 70.596 -6.480  -3.599  1.00 14.67  ? 194  ALA A N     1 
ATOM   1519 C  CA    . ALA A 1 197 ? 70.656 -5.518  -2.513  1.00 11.36  ? 194  ALA A CA    1 
ATOM   1520 C  C     . ALA A 1 197 ? 71.483 -4.281  -2.877  1.00 13.52  ? 194  ALA A C     1 
ATOM   1521 O  O     . ALA A 1 197 ? 71.112 -3.178  -2.499  1.00 12.23  ? 194  ALA A O     1 
ATOM   1522 C  CB    . ALA A 1 197 ? 71.171 -6.178  -1.226  1.00 13.77  ? 194  ALA A CB    1 
ATOM   1523 N  N     . VAL A 1 198 ? 72.581 -4.459  -3.610  1.00 12.27  ? 195  VAL A N     1 
ATOM   1524 C  CA    . VAL A 1 198 ? 73.386 -3.318  -4.065  1.00 13.75  ? 195  VAL A CA    1 
ATOM   1525 C  C     . VAL A 1 198 ? 72.552 -2.399  -4.963  1.00 17.12  ? 195  VAL A C     1 
ATOM   1526 O  O     . VAL A 1 198 ? 72.559 -1.170  -4.809  1.00 15.56  ? 195  VAL A O     1 
ATOM   1527 C  CB    . VAL A 1 198 ? 74.647 -3.795  -4.804  1.00 15.83  ? 195  VAL A CB    1 
ATOM   1528 C  CG1   . VAL A 1 198 ? 75.376 -2.611  -5.454  1.00 17.32  ? 195  VAL A CG1   1 
ATOM   1529 C  CG2   . VAL A 1 198 ? 75.554 -4.527  -3.836  1.00 16.35  ? 195  VAL A CG2   1 
ATOM   1530 N  N     . ILE A 1 199 ? 71.812 -3.010  -5.880  1.00 13.26  ? 196  ILE A N     1 
ATOM   1531 C  CA    . ILE A 1 199 ? 70.935 -2.251  -6.763  1.00 14.14  ? 196  ILE A CA    1 
ATOM   1532 C  C     . ILE A 1 199 ? 69.858 -1.506  -5.980  1.00 11.61  ? 196  ILE A C     1 
ATOM   1533 O  O     . ILE A 1 199 ? 69.566 -0.344  -6.273  1.00 13.77  ? 196  ILE A O     1 
ATOM   1534 C  CB    . ILE A 1 199 ? 70.326 -3.147  -7.847  1.00 13.86  ? 196  ILE A CB    1 
ATOM   1535 C  CG1   . ILE A 1 199 ? 71.434 -3.583  -8.809  1.00 15.38  ? 196  ILE A CG1   1 
ATOM   1536 C  CG2   . ILE A 1 199 ? 69.243 -2.370  -8.620  1.00 16.83  ? 196  ILE A CG2   1 
ATOM   1537 C  CD1   . ILE A 1 199 ? 71.068 -4.744  -9.688  1.00 17.78  ? 196  ILE A CD1   1 
ATOM   1538 N  N     . VAL A 1 200 ? 69.286 -2.164  -4.973  1.00 12.81  ? 197  VAL A N     1 
ATOM   1539 C  CA    . VAL A 1 200 ? 68.245 -1.527  -4.177  1.00 12.55  ? 197  VAL A CA    1 
ATOM   1540 C  C     . VAL A 1 200 ? 68.787 -0.355  -3.356  1.00 14.60  ? 197  VAL A C     1 
ATOM   1541 O  O     . VAL A 1 200 ? 68.093 0.649   -3.196  1.00 12.56  ? 197  VAL A O     1 
ATOM   1542 C  CB    . VAL A 1 200 ? 67.475 -2.560  -3.333  1.00 10.19  ? 197  VAL A CB    1 
ATOM   1543 C  CG1   . VAL A 1 200 ? 66.460 -1.870  -2.437  1.00 13.18  ? 197  VAL A CG1   1 
ATOM   1544 C  CG2   . VAL A 1 200 ? 66.761 -3.520  -4.277  1.00 13.15  ? 197  VAL A CG2   1 
ATOM   1545 N  N     . GLU A 1 201 ? 70.030 -0.447  -2.872  1.00 12.05  ? 198  GLU A N     1 
ATOM   1546 C  CA    . GLU A 1 201 ? 70.654 0.711   -2.216  1.00 12.05  ? 198  GLU A CA    1 
ATOM   1547 C  C     . GLU A 1 201 ? 70.681 1.893   -3.185  1.00 14.61  ? 198  GLU A C     1 
ATOM   1548 O  O     . GLU A 1 201 ? 70.425 3.052   -2.810  1.00 13.95  ? 198  GLU A O     1 
ATOM   1549 C  CB    . GLU A 1 201 ? 72.099 0.423   -1.774  1.00 12.53  ? 198  GLU A CB    1 
ATOM   1550 C  CG    . GLU A 1 201 ? 72.289 -0.593  -0.637  1.00 15.61  ? 198  GLU A CG    1 
ATOM   1551 C  CD    . GLU A 1 201 ? 72.140 -0.022  0.774   1.00 16.94  ? 198  GLU A CD    1 
ATOM   1552 O  OE1   . GLU A 1 201 ? 71.740 1.154   0.928   1.00 20.40  ? 198  GLU A OE1   1 
ATOM   1553 O  OE2   . GLU A 1 201 ? 72.428 -0.764  1.747   1.00 15.71  ? 198  GLU A OE2   1 
ATOM   1554 N  N     . GLU A 1 202 ? 71.023 1.596   -4.434  1.00 13.28  ? 199  GLU A N     1 
ATOM   1555 C  CA    . GLU A 1 202 ? 71.124 2.631   -5.459  1.00 12.88  ? 199  GLU A CA    1 
ATOM   1556 C  C     . GLU A 1 202 ? 69.750 3.223   -5.772  1.00 15.46  ? 199  GLU A C     1 
ATOM   1557 O  O     . GLU A 1 202 ? 69.609 4.445   -5.893  1.00 12.55  ? 199  GLU A O     1 
ATOM   1558 C  CB    . GLU A 1 202 ? 71.798 2.066   -6.715  1.00 17.60  ? 199  GLU A CB    1 
ATOM   1559 C  CG    . GLU A 1 202 ? 73.269 1.733   -6.488  1.00 17.81  ? 199  GLU A CG    1 
ATOM   1560 C  CD    . GLU A 1 202 ? 73.858 0.803   -7.544  1.00 25.11  ? 199  GLU A CD    1 
ATOM   1561 O  OE1   . GLU A 1 202 ? 75.060 0.481   -7.433  1.00 29.45  ? 199  GLU A OE1   1 
ATOM   1562 O  OE2   . GLU A 1 202 ? 73.136 0.406   -8.477  1.00 28.20  ? 199  GLU A OE2   1 
ATOM   1563 N  N     . MET A 1 203 ? 68.744 2.361   -5.880  1.00 13.18  ? 200  MET A N     1 
ATOM   1564 C  CA    . MET A 1 203 ? 67.380 2.824   -6.138  1.00 11.65  ? 200  MET A CA    1 
ATOM   1565 C  C     . MET A 1 203 ? 66.889 3.697   -4.989  1.00 10.93  ? 200  MET A C     1 
ATOM   1566 O  O     . MET A 1 203 ? 66.295 4.762   -5.201  1.00 12.40  ? 200  MET A O     1 
ATOM   1567 C  CB    . MET A 1 203 ? 66.428 1.640   -6.314  1.00 14.16  ? 200  MET A CB    1 
ATOM   1568 C  CG    A MET A 1 203 ? 66.798 0.685   -7.419  0.50 13.89  ? 200  MET A CG    1 
ATOM   1569 C  CG    B MET A 1 203 ? 65.067 2.034   -6.827  0.50 14.41  ? 200  MET A CG    1 
ATOM   1570 S  SD    A MET A 1 203 ? 65.584 -0.640  -7.580  0.50 21.21  ? 200  MET A SD    1 
ATOM   1571 S  SD    B MET A 1 203 ? 63.946 0.629   -6.926  0.50 21.15  ? 200  MET A SD    1 
ATOM   1572 C  CE    A MET A 1 203 ? 64.100 0.318   -7.880  0.50 7.10   ? 200  MET A CE    1 
ATOM   1573 C  CE    B MET A 1 203 ? 65.091 -0.699  -7.276  0.50 13.56  ? 200  MET A CE    1 
ATOM   1574 N  N     . ARG A 1 204 ? 67.119 3.243   -3.763  1.00 11.35  ? 201  ARG A N     1 
ATOM   1575 C  CA    . ARG A 1 204 ? 66.674 4.011   -2.597  1.00 11.66  ? 201  ARG A CA    1 
ATOM   1576 C  C     . ARG A 1 204 ? 67.383 5.367   -2.476  1.00 13.10  ? 201  ARG A C     1 
ATOM   1577 O  O     . ARG A 1 204 ? 66.758 6.376   -2.130  1.00 12.62  ? 201  ARG A O     1 
ATOM   1578 C  CB    . ARG A 1 204 ? 66.809 3.176   -1.327  1.00 11.73  ? 201  ARG A CB    1 
ATOM   1579 C  CG    . ARG A 1 204 ? 65.802 2.018   -1.318  1.00 11.72  ? 201  ARG A CG    1 
ATOM   1580 C  CD    . ARG A 1 204 ? 65.918 1.144   -0.089  1.00 16.24  ? 201  ARG A CD    1 
ATOM   1581 N  NE    . ARG A 1 204 ? 65.916 1.960   1.108   1.00 14.37  ? 201  ARG A NE    1 
ATOM   1582 C  CZ    . ARG A 1 204 ? 66.955 2.073   1.923   1.00 14.85  ? 201  ARG A CZ    1 
ATOM   1583 N  NH1   . ARG A 1 204 ? 66.889 2.876   2.973   1.00 14.33  ? 201  ARG A NH1   1 
ATOM   1584 N  NH2   . ARG A 1 204 ? 68.054 1.364   1.700   1.00 18.02  ? 201  ARG A NH2   1 
ATOM   1585 N  N     . ALA A 1 205 ? 68.679 5.403   -2.797  1.00 13.35  ? 202  ALA A N     1 
ATOM   1586 C  CA    . ALA A 1 205 ? 69.414 6.673   -2.838  1.00 13.82  ? 202  ALA A CA    1 
ATOM   1587 C  C     . ALA A 1 205 ? 68.843 7.618   -3.892  1.00 11.81  ? 202  ALA A C     1 
ATOM   1588 O  O     . ALA A 1 205 ? 68.699 8.820   -3.649  1.00 13.93  ? 202  ALA A O     1 
ATOM   1589 C  CB    . ALA A 1 205 ? 70.899 6.421   -3.107  1.00 15.50  ? 202  ALA A CB    1 
ATOM   1590 N  N     . ALA A 1 206 ? 68.491 7.077   -5.056  1.00 12.84  ? 203  ALA A N     1 
ATOM   1591 C  CA    . ALA A 1 206 ? 67.893 7.910   -6.107  1.00 15.76  ? 203  ALA A CA    1 
ATOM   1592 C  C     . ALA A 1 206 ? 66.547 8.461   -5.666  1.00 10.99  ? 203  ALA A C     1 
ATOM   1593 O  O     . ALA A 1 206 ? 66.236 9.639   -5.915  1.00 12.20  ? 203  ALA A O     1 
ATOM   1594 C  CB    . ALA A 1 206 ? 67.746 7.127   -7.403  1.00 17.75  ? 203  ALA A CB    1 
ATOM   1595 N  N     . ILE A 1 207 ? 65.735 7.629   -5.013  1.00 11.49  ? 204  ILE A N     1 
ATOM   1596 C  CA    . ILE A 1 207 ? 64.436 8.116   -4.536  1.00 9.57   ? 204  ILE A CA    1 
ATOM   1597 C  C     . ILE A 1 207 ? 64.640 9.271   -3.553  1.00 12.10  ? 204  ILE A C     1 
ATOM   1598 O  O     . ILE A 1 207 ? 63.992 10.312  -3.657  1.00 11.75  ? 204  ILE A O     1 
ATOM   1599 C  CB    . ILE A 1 207 ? 63.591 6.996   -3.902  1.00 10.29  ? 204  ILE A CB    1 
ATOM   1600 C  CG1   . ILE A 1 207 ? 63.166 6.001   -4.985  1.00 12.63  ? 204  ILE A CG1   1 
ATOM   1601 C  CG2   . ILE A 1 207 ? 62.371 7.583   -3.219  1.00 12.09  ? 204  ILE A CG2   1 
ATOM   1602 C  CD1   . ILE A 1 207 ? 62.622 4.683   -4.430  1.00 12.51  ? 204  ILE A CD1   1 
ATOM   1603 N  N     . GLU A 1 208 ? 65.562 9.098   -2.614  1.00 12.17  ? 205  GLU A N     1 
ATOM   1604 C  CA    . GLU A 1 208 ? 65.765 10.148  -1.622  1.00 12.30  ? 205  GLU A CA    1 
ATOM   1605 C  C     . GLU A 1 208 ? 66.360 11.413  -2.236  1.00 11.74  ? 205  GLU A C     1 
ATOM   1606 O  O     . GLU A 1 208 ? 65.923 12.527  -1.931  1.00 12.63  ? 205  GLU A O     1 
ATOM   1607 C  CB    . GLU A 1 208 ? 66.604 9.645   -0.446  1.00 14.37  ? 205  GLU A CB    1 
ATOM   1608 C  CG    . GLU A 1 208 ? 66.630 10.657  0.697   1.00 16.85  ? 205  GLU A CG    1 
ATOM   1609 C  CD    . GLU A 1 208 ? 67.398 10.189  1.926   1.00 19.74  ? 205  GLU A CD    1 
ATOM   1610 O  OE1   . GLU A 1 208 ? 67.397 10.933  2.936   1.00 23.99  ? 205  GLU A OE1   1 
ATOM   1611 O  OE2   . GLU A 1 208 ? 68.006 9.101   1.881   1.00 22.54  ? 205  GLU A OE2   1 
ATOM   1612 N  N     . ARG A 1 209 ? 67.343 11.251  -3.115  1.00 13.44  ? 206  ARG A N     1 
ATOM   1613 C  CA    . ARG A 1 209 ? 67.946 12.416  -3.753  1.00 12.33  ? 206  ARG A CA    1 
ATOM   1614 C  C     . ARG A 1 209 ? 66.899 13.216  -4.532  1.00 13.97  ? 206  ARG A C     1 
ATOM   1615 O  O     . ARG A 1 209 ? 66.862 14.443  -4.463  1.00 14.79  ? 206  ARG A O     1 
ATOM   1616 C  CB    . ARG A 1 209 ? 69.101 12.008  -4.687  1.00 13.47  ? 206  ARG A CB    1 
ATOM   1617 C  CG    . ARG A 1 209 ? 69.844 13.235  -5.263  1.00 19.82  ? 206  ARG A CG    1 
ATOM   1618 C  CD    . ARG A 1 209 ? 70.863 12.890  -6.346  1.00 30.47  ? 206  ARG A CD    1 
ATOM   1619 N  NE    . ARG A 1 209 ? 70.267 12.635  -7.660  1.00 32.11  ? 206  ARG A NE    1 
ATOM   1620 C  CZ    . ARG A 1 209 ? 69.963 13.573  -8.556  1.00 29.85  ? 206  ARG A CZ    1 
ATOM   1621 N  NH1   . ARG A 1 209 ? 69.439 13.223  -9.726  1.00 29.95  ? 206  ARG A NH1   1 
ATOM   1622 N  NH2   . ARG A 1 209 ? 70.173 14.862  -8.294  1.00 27.22  ? 206  ARG A NH2   1 
ATOM   1623 N  N     . GLU A 1 210 ? 66.040 12.515  -5.264  1.00 11.16  ? 207  GLU A N     1 
ATOM   1624 C  CA    . GLU A 1 210 ? 65.197 13.164  -6.254  1.00 11.72  ? 207  GLU A CA    1 
ATOM   1625 C  C     . GLU A 1 210 ? 63.828 13.582  -5.722  1.00 11.04  ? 207  GLU A C     1 
ATOM   1626 O  O     . GLU A 1 210 ? 63.139 14.396  -6.343  1.00 12.79  ? 207  GLU A O     1 
ATOM   1627 C  CB    . GLU A 1 210 ? 65.053 12.274  -7.482  1.00 14.53  ? 207  GLU A CB    1 
ATOM   1628 C  CG    . GLU A 1 210 ? 66.373 12.075  -8.186  1.00 14.53  ? 207  GLU A CG    1 
ATOM   1629 C  CD    . GLU A 1 210 ? 66.289 11.108  -9.334  1.00 22.15  ? 207  GLU A CD    1 
ATOM   1630 O  OE1   . GLU A 1 210 ? 65.259 11.102  -10.038 1.00 22.97  ? 207  GLU A OE1   1 
ATOM   1631 O  OE2   . GLU A 1 210 ? 67.266 10.355  -9.527  1.00 28.38  ? 207  GLU A OE2   1 
ATOM   1632 N  N     . THR A 1 211 ? 63.443 13.052  -4.562  1.00 12.87  ? 208  THR A N     1 
ATOM   1633 C  CA    . THR A 1 211 ? 62.141 13.418  -4.001  1.00 14.28  ? 208  THR A CA    1 
ATOM   1634 C  C     . THR A 1 211 ? 62.220 13.939  -2.587  1.00 14.11  ? 208  THR A C     1 
ATOM   1635 O  O     . THR A 1 211 ? 61.295 14.596  -2.117  1.00 14.45  ? 208  THR A O     1 
ATOM   1636 C  CB    . THR A 1 211 ? 61.153 12.221  -3.975  1.00 12.18  ? 208  THR A CB    1 
ATOM   1637 O  OG1   . THR A 1 211 ? 61.575 11.257  -3.001  1.00 11.03  ? 208  THR A OG1   1 
ATOM   1638 C  CG2   . THR A 1 211 ? 61.066 11.548  -5.327  1.00 14.76  ? 208  THR A CG2   1 
ATOM   1639 N  N     . GLY A 1 212 ? 63.299 13.612  -1.889  1.00 12.22  ? 209  GLY A N     1 
ATOM   1640 C  CA    . GLY A 1 212 ? 63.358 13.872  -0.461  1.00 14.87  ? 209  GLY A CA    1 
ATOM   1641 C  C     . GLY A 1 212 ? 62.832 12.756  0.435   1.00 15.95  ? 209  GLY A C     1 
ATOM   1642 O  O     . GLY A 1 212 ? 63.040 12.813  1.645   1.00 21.09  ? 209  GLY A O     1 
ATOM   1643 N  N     . PHE A 1 213 ? 62.186 11.738  -0.137  1.00 13.33  ? 210  PHE A N     1 
ATOM   1644 C  CA    . PHE A 1 213 ? 61.514 10.723  0.673   1.00 11.16  ? 210  PHE A CA    1 
ATOM   1645 C  C     . PHE A 1 213 ? 62.410 9.538   0.959   1.00 12.26  ? 210  PHE A C     1 
ATOM   1646 O  O     . PHE A 1 213 ? 63.100 9.040   0.067   1.00 15.66  ? 210  PHE A O     1 
ATOM   1647 C  CB    . PHE A 1 213 ? 60.259 10.196  -0.032  1.00 10.47  ? 210  PHE A CB    1 
ATOM   1648 C  CG    . PHE A 1 213 ? 59.261 11.266  -0.408  1.00 8.98   ? 210  PHE A CG    1 
ATOM   1649 C  CD1   . PHE A 1 213 ? 58.582 11.188  -1.620  1.00 13.24  ? 210  PHE A CD1   1 
ATOM   1650 C  CD2   . PHE A 1 213 ? 58.999 12.345  0.429   1.00 11.83  ? 210  PHE A CD2   1 
ATOM   1651 C  CE1   . PHE A 1 213 ? 57.655 12.151  -1.985  1.00 12.35  ? 210  PHE A CE1   1 
ATOM   1652 C  CE2   . PHE A 1 213 ? 58.066 13.308  0.066   1.00 12.82  ? 210  PHE A CE2   1 
ATOM   1653 C  CZ    . PHE A 1 213 ? 57.400 13.215  -1.138  1.00 11.87  ? 210  PHE A CZ    1 
ATOM   1654 N  N     . GLN A 1 214 ? 62.374 9.070   2.205   1.00 10.17  ? 211  GLN A N     1 
ATOM   1655 C  CA    . GLN A 1 214 ? 63.049 7.842   2.608   1.00 11.28  ? 211  GLN A CA    1 
ATOM   1656 C  C     . GLN A 1 214 ? 62.128 6.628   2.531   1.00 10.71  ? 211  GLN A C     1 
ATOM   1657 O  O     . GLN A 1 214 ? 60.903 6.750   2.612   1.00 11.17  ? 211  GLN A O     1 
ATOM   1658 C  CB    . GLN A 1 214 ? 63.586 7.986   4.030   1.00 12.80  ? 211  GLN A CB    1 
ATOM   1659 C  CG    . GLN A 1 214 ? 64.763 8.943   4.091   1.00 13.49  ? 211  GLN A CG    1 
ATOM   1660 C  CD    . GLN A 1 214 ? 65.313 9.120   5.492   1.00 19.36  ? 211  GLN A CD    1 
ATOM   1661 O  OE1   . GLN A 1 214 ? 64.722 8.665   6.469   1.00 19.55  ? 211  GLN A OE1   1 
ATOM   1662 N  NE2   . GLN A 1 214 ? 66.464 9.770   5.591   1.00 21.35  ? 211  GLN A NE2   1 
ATOM   1663 N  N     . CYS A 1 215 ? 62.723 5.459   2.379   1.00 11.26  ? 212  CYS A N     1 
ATOM   1664 C  CA    . CYS A 1 215 ? 61.937 4.238   2.296   1.00 9.54   ? 212  CYS A CA    1 
ATOM   1665 C  C     . CYS A 1 215 ? 62.711 3.082   2.870   1.00 11.78  ? 212  CYS A C     1 
ATOM   1666 O  O     . CYS A 1 215 ? 63.899 3.192   3.169   1.00 14.12  ? 212  CYS A O     1 
ATOM   1667 C  CB    . CYS A 1 215 ? 61.557 3.925   0.857   1.00 12.92  ? 212  CYS A CB    1 
ATOM   1668 S  SG    . CYS A 1 215 ? 62.980 3.640   -0.191  1.00 17.82  ? 212  CYS A SG    1 
ATOM   1669 N  N     . SER A 1 216 ? 62.013 1.967   3.031   1.00 10.87  ? 213  SER A N     1 
ATOM   1670 C  CA    . SER A 1 216 ? 62.643 0.715   3.426   1.00 9.53   ? 213  SER A CA    1 
ATOM   1671 C  C     . SER A 1 216 ? 62.444 -0.271  2.291   1.00 10.86  ? 213  SER A C     1 
ATOM   1672 O  O     . SER A 1 216 ? 61.634 -0.032  1.398   1.00 13.06  ? 213  SER A O     1 
ATOM   1673 C  CB    . SER A 1 216 ? 62.013 0.193   4.717   1.00 12.45  ? 213  SER A CB    1 
ATOM   1674 O  OG    . SER A 1 216 ? 62.223 1.130   5.773   1.00 16.41  ? 213  SER A OG    1 
ATOM   1675 N  N     . ALA A 1 217 ? 63.200 -1.366  2.290   1.00 9.98   ? 214  ALA A N     1 
ATOM   1676 C  CA    . ALA A 1 217 ? 63.020 -2.379  1.263   1.00 8.97   ? 214  ALA A CA    1 
ATOM   1677 C  C     . ALA A 1 217 ? 63.374 -3.754  1.791   1.00 10.55  ? 214  ALA A C     1 
ATOM   1678 O  O     . ALA A 1 217 ? 64.171 -3.876  2.738   1.00 10.88  ? 214  ALA A O     1 
ATOM   1679 C  CB    . ALA A 1 217 ? 63.872 -2.065  0.038   1.00 10.27  ? 214  ALA A CB    1 
ATOM   1680 N  N     . GLY A 1 218 ? 62.784 -4.775  1.170   1.00 10.06  ? 215  GLY A N     1 
ATOM   1681 C  CA    . GLY A 1 218 ? 63.156 -6.165  1.387   1.00 8.68   ? 215  GLY A CA    1 
ATOM   1682 C  C     . GLY A 1 218 ? 63.660 -6.737  0.075   1.00 10.54  ? 215  GLY A C     1 
ATOM   1683 O  O     . GLY A 1 218 ? 63.136 -6.412  -0.996  1.00 10.33  ? 215  GLY A O     1 
ATOM   1684 N  N     . ILE A 1 219 ? 64.677 -7.585  0.159   1.00 8.89   ? 216  ILE A N     1 
ATOM   1685 C  CA    . ILE A 1 219 ? 65.214 -8.269  -1.003  1.00 7.83   ? 216  ILE A CA    1 
ATOM   1686 C  C     . ILE A 1 219 ? 65.199 -9.761  -0.696  1.00 7.95   ? 216  ILE A C     1 
ATOM   1687 O  O     . ILE A 1 219 ? 65.754 -10.206 0.318   1.00 10.92  ? 216  ILE A O     1 
ATOM   1688 C  CB    . ILE A 1 219 ? 66.662 -7.836  -1.330  1.00 11.28  ? 216  ILE A CB    1 
ATOM   1689 C  CG1   . ILE A 1 219 ? 66.760 -6.318  -1.556  1.00 12.26  ? 216  ILE A CG1   1 
ATOM   1690 C  CG2   . ILE A 1 219 ? 67.167 -8.579  -2.557  1.00 12.80  ? 216  ILE A CG2   1 
ATOM   1691 C  CD1   . ILE A 1 219 ? 67.038 -5.523  -0.270  1.00 17.63  ? 216  ILE A CD1   1 
ATOM   1692 N  N     . SER A 1 220 ? 64.554 -10.543 -1.562  1.00 9.10   ? 217  SER A N     1 
ATOM   1693 C  CA    . SER A 1 220 ? 64.528 -11.987 -1.411  1.00 10.84  ? 217  SER A CA    1 
ATOM   1694 C  C     . SER A 1 220 ? 64.237 -12.644 -2.751  1.00 12.98  ? 217  SER A C     1 
ATOM   1695 O  O     . SER A 1 220 ? 64.482 -12.032 -3.790  1.00 9.69   ? 217  SER A O     1 
ATOM   1696 C  CB    . SER A 1 220 ? 63.498 -12.413 -0.365  1.00 11.40  ? 217  SER A CB    1 
ATOM   1697 O  OG    . SER A 1 220 ? 63.695 -13.778 -0.043  1.00 12.48  ? 217  SER A OG    1 
ATOM   1698 N  N     . HIS A 1 221 ? 63.748 -13.886 -2.728  1.00 11.04  ? 218  HIS A N     1 
ATOM   1699 C  CA    . HIS A 1 221 ? 63.530 -14.636 -3.959  1.00 10.36  ? 218  HIS A CA    1 
ATOM   1700 C  C     . HIS A 1 221 ? 62.090 -14.589 -4.467  1.00 11.49  ? 218  HIS A C     1 
ATOM   1701 O  O     . HIS A 1 221 ? 61.790 -15.143 -5.520  1.00 13.66  ? 218  HIS A O     1 
ATOM   1702 C  CB    . HIS A 1 221 ? 63.965 -16.093 -3.777  1.00 11.89  ? 218  HIS A CB    1 
ATOM   1703 C  CG    . HIS A 1 221 ? 65.449 -16.268 -3.711  1.00 13.34  ? 218  HIS A CG    1 
ATOM   1704 N  ND1   . HIS A 1 221 ? 66.289 -15.871 -4.730  1.00 13.84  ? 218  HIS A ND1   1 
ATOM   1705 C  CD2   . HIS A 1 221 ? 66.245 -16.794 -2.747  1.00 12.88  ? 218  HIS A CD2   1 
ATOM   1706 C  CE1   . HIS A 1 221 ? 67.540 -16.150 -4.399  1.00 14.75  ? 218  HIS A CE1   1 
ATOM   1707 N  NE2   . HIS A 1 221 ? 67.540 -16.700 -3.198  1.00 14.63  ? 218  HIS A NE2   1 
ATOM   1708 N  N     . ASN A 1 222 ? 61.198 -13.941 -3.728  1.00 9.26   ? 219  ASN A N     1 
ATOM   1709 C  CA    . ASN A 1 222 ? 59.801 -13.847 -4.149  1.00 8.73   ? 219  ASN A CA    1 
ATOM   1710 C  C     . ASN A 1 222 ? 59.119 -12.693 -3.421  1.00 9.62   ? 219  ASN A C     1 
ATOM   1711 O  O     . ASN A 1 222 ? 59.700 -12.068 -2.539  1.00 10.86  ? 219  ASN A O     1 
ATOM   1712 C  CB    . ASN A 1 222 ? 59.050 -15.172 -3.903  1.00 11.43  ? 219  ASN A CB    1 
ATOM   1713 C  CG    . ASN A 1 222 ? 59.150 -15.634 -2.464  1.00 13.51  ? 219  ASN A CG    1 
ATOM   1714 O  OD1   . ASN A 1 222 ? 58.678 -14.950 -1.561  1.00 12.96  ? 219  ASN A OD1   1 
ATOM   1715 N  ND2   . ASN A 1 222 ? 59.735 -16.813 -2.247  1.00 12.08  ? 219  ASN A ND2   1 
ATOM   1716 N  N     . LYS A 1 223 ? 57.881 -12.396 -3.799  1.00 12.08  ? 220  LYS A N     1 
ATOM   1717 C  CA    . LYS A 1 223 ? 57.217 -11.196 -3.283  1.00 9.66   ? 220  LYS A CA    1 
ATOM   1718 C  C     . LYS A 1 223 ? 56.866 -11.327 -1.810  1.00 11.66  ? 220  LYS A C     1 
ATOM   1719 O  O     . LYS A 1 223 ? 57.016 -10.370 -1.055  1.00 11.29  ? 220  LYS A O     1 
ATOM   1720 C  CB    . LYS A 1 223 ? 55.939 -10.933 -4.111  1.00 11.88  ? 220  LYS A CB    1 
ATOM   1721 C  CG    . LYS A 1 223 ? 56.222 -10.546 -5.574  1.00 12.91  ? 220  LYS A CG    1 
ATOM   1722 C  CD    . LYS A 1 223 ? 54.984 -10.652 -6.477  1.00 22.88  ? 220  LYS A CD    1 
ATOM   1723 C  CE    . LYS A 1 223 ? 53.905 -9.682  -6.105  1.00 23.20  ? 220  LYS A CE    1 
ATOM   1724 N  NZ    . LYS A 1 223 ? 52.732 -9.817  -7.048  1.00 19.68  ? 220  LYS A NZ    1 
ATOM   1725 N  N     . VAL A 1 224 ? 56.404 -12.506 -1.389  1.00 11.45  ? 221  VAL A N     1 
ATOM   1726 C  CA    . VAL A 1 224 ? 56.008 -12.660 0.008   1.00 11.99  ? 221  VAL A CA    1 
ATOM   1727 C  C     . VAL A 1 224 ? 57.203 -12.499 0.948   1.00 11.42  ? 221  VAL A C     1 
ATOM   1728 O  O     . VAL A 1 224 ? 57.116 -11.770 1.950   1.00 12.17  ? 221  VAL A O     1 
ATOM   1729 C  CB    . VAL A 1 224 ? 55.302 -13.998 0.254   1.00 12.52  ? 221  VAL A CB    1 
ATOM   1730 C  CG1   . VAL A 1 224 ? 55.183 -14.257 1.740   1.00 16.69  ? 221  VAL A CG1   1 
ATOM   1731 C  CG2   . VAL A 1 224 ? 53.948 -13.953 -0.403  1.00 15.66  ? 221  VAL A CG2   1 
ATOM   1732 N  N     . LEU A 1 225 ? 58.326 -13.135 0.626   1.00 10.45  ? 222  LEU A N     1 
ATOM   1733 C  CA    . LEU A 1 225 ? 59.519 -12.948 1.448   1.00 10.68  ? 222  LEU A CA    1 
ATOM   1734 C  C     . LEU A 1 225 ? 60.067 -11.521 1.366   1.00 11.44  ? 222  LEU A C     1 
ATOM   1735 O  O     . LEU A 1 225 ? 60.558 -10.998 2.361   1.00 10.42  ? 222  LEU A O     1 
ATOM   1736 C  CB    . LEU A 1 225 ? 60.627 -13.954 1.090   1.00 10.20  ? 222  LEU A CB    1 
ATOM   1737 C  CG    . LEU A 1 225 ? 60.341 -15.398 1.483   1.00 10.58  ? 222  LEU A CG    1 
ATOM   1738 C  CD1   . LEU A 1 225 ? 61.515 -16.305 1.066   1.00 12.88  ? 222  LEU A CD1   1 
ATOM   1739 C  CD2   . LEU A 1 225 ? 60.061 -15.513 2.994   1.00 13.89  ? 222  LEU A CD2   1 
ATOM   1740 N  N     . ALA A 1 226 ? 59.995 -10.895 0.191   1.00 9.52   ? 223  ALA A N     1 
ATOM   1741 C  CA    . ALA A 1 226 ? 60.453 -9.518  0.067   1.00 9.29   ? 223  ALA A CA    1 
ATOM   1742 C  C     . ALA A 1 226 ? 59.623 -8.568  0.926   1.00 9.46   ? 223  ALA A C     1 
ATOM   1743 O  O     . ALA A 1 226 ? 60.181 -7.664  1.567   1.00 10.61  ? 223  ALA A O     1 
ATOM   1744 C  CB    . ALA A 1 226 ? 60.456 -9.077  -1.386  1.00 10.57  ? 223  ALA A CB    1 
ATOM   1745 N  N     . LYS A 1 227 ? 58.306 -8.772  0.948   1.00 10.85  ? 224  LYS A N     1 
ATOM   1746 C  CA    . LYS A 1 227 ? 57.418 -7.958  1.781   1.00 10.93  ? 224  LYS A CA    1 
ATOM   1747 C  C     . LYS A 1 227 ? 57.711 -8.176  3.270   1.00 11.06  ? 224  LYS A C     1 
ATOM   1748 O  O     . LYS A 1 227 ? 57.826 -7.212  4.038   1.00 12.89  ? 224  LYS A O     1 
ATOM   1749 C  CB    . LYS A 1 227 ? 55.954 -8.294  1.451   1.00 12.76  ? 224  LYS A CB    1 
ATOM   1750 C  CG    A LYS A 1 227 ? 54.922 -7.522  2.274   0.50 16.48  ? 224  LYS A CG    1 
ATOM   1751 C  CG    B LYS A 1 227 ? 54.953 -7.725  2.435   0.50 17.59  ? 224  LYS A CG    1 
ATOM   1752 C  CD    A LYS A 1 227 ? 55.003 -6.014  2.066   0.50 22.52  ? 224  LYS A CD    1 
ATOM   1753 C  CD    B LYS A 1 227 ? 55.023 -6.216  2.491   0.50 23.47  ? 224  LYS A CD    1 
ATOM   1754 C  CE    A LYS A 1 227 ? 53.847 -5.308  2.781   0.50 26.80  ? 224  LYS A CE    1 
ATOM   1755 C  CE    B LYS A 1 227 ? 53.886 -5.670  3.332   0.50 28.19  ? 224  LYS A CE    1 
ATOM   1756 N  NZ    A LYS A 1 227 ? 54.088 -3.847  2.981   0.50 24.11  ? 224  LYS A NZ    1 
ATOM   1757 N  NZ    B LYS A 1 227 ? 52.588 -6.168  2.820   0.50 29.92  ? 224  LYS A NZ    1 
ATOM   1758 N  N     . LEU A 1 228 ? 57.872 -9.440  3.664   1.00 10.57  ? 225  LEU A N     1 
ATOM   1759 C  CA    . LEU A 1 228 ? 58.222 -9.769  5.038   1.00 10.36  ? 225  LEU A CA    1 
ATOM   1760 C  C     . LEU A 1 228 ? 59.551 -9.122  5.431   1.00 13.52  ? 225  LEU A C     1 
ATOM   1761 O  O     . LEU A 1 228 ? 59.664 -8.468  6.490   1.00 12.59  ? 225  LEU A O     1 
ATOM   1762 C  CB    . LEU A 1 228 ? 58.280 -11.298 5.217   1.00 12.18  ? 225  LEU A CB    1 
ATOM   1763 C  CG    . LEU A 1 228 ? 58.483 -11.785 6.651   1.00 17.27  ? 225  LEU A CG    1 
ATOM   1764 C  CD1   . LEU A 1 228 ? 57.359 -11.312 7.560   1.00 19.69  ? 225  LEU A CD1   1 
ATOM   1765 C  CD2   . LEU A 1 228 ? 58.578 -13.300 6.682   1.00 16.05  ? 225  LEU A CD2   1 
ATOM   1766 N  N     . ALA A 1 229 ? 60.551 -9.284  4.564   1.00 12.84  ? 226  ALA A N     1 
ATOM   1767 C  CA    . ALA A 1 229 ? 61.882 -8.731  4.785   1.00 11.77  ? 226  ALA A CA    1 
ATOM   1768 C  C     . ALA A 1 229 ? 61.838 -7.227  5.006   1.00 12.29  ? 226  ALA A C     1 
ATOM   1769 O  O     . ALA A 1 229 ? 62.497 -6.697  5.879   1.00 12.31  ? 226  ALA A O     1 
ATOM   1770 C  CB    . ALA A 1 229 ? 62.800 -9.056  3.593   1.00 11.99  ? 226  ALA A CB    1 
ATOM   1771 N  N     . CYS A 1 230 ? 61.051 -6.540  4.185   1.00 11.18  ? 227  CYS A N     1 
ATOM   1772 C  CA    . CYS A 1 230 ? 61.014 -5.090  4.240   1.00 11.72  ? 227  CYS A CA    1 
ATOM   1773 C  C     . CYS A 1 230 ? 60.640 -4.585  5.634   1.00 13.73  ? 227  CYS A C     1 
ATOM   1774 O  O     . CYS A 1 230 ? 61.218 -3.610  6.120   1.00 15.46  ? 227  CYS A O     1 
ATOM   1775 C  CB    . CYS A 1 230 ? 60.009 -4.592  3.209   1.00 9.91   ? 227  CYS A CB    1 
ATOM   1776 S  SG    . CYS A 1 230 ? 59.901 -2.777  3.119   1.00 13.30  ? 227  CYS A SG    1 
ATOM   1777 N  N     . GLY A 1 231 ? 59.711 -5.277  6.285   1.00 12.43  ? 228  GLY A N     1 
ATOM   1778 C  CA    . GLY A 1 231 ? 59.225 -4.849  7.590   1.00 15.90  ? 228  GLY A CA    1 
ATOM   1779 C  C     . GLY A 1 231 ? 60.148 -5.166  8.754   1.00 15.88  ? 228  GLY A C     1 
ATOM   1780 O  O     . GLY A 1 231 ? 59.916 -4.720  9.882   1.00 18.17  ? 228  GLY A O     1 
ATOM   1781 N  N     . LEU A 1 232 ? 61.196 -5.940  8.502   1.00 13.75  ? 229  LEU A N     1 
ATOM   1782 C  CA    . LEU A 1 232 ? 62.057 -6.386  9.601   1.00 13.73  ? 229  LEU A CA    1 
ATOM   1783 C  C     . LEU A 1 232 ? 62.915 -5.266  10.188  1.00 14.53  ? 229  LEU A C     1 
ATOM   1784 O  O     . LEU A 1 232 ? 63.234 -5.287  11.379  1.00 15.98  ? 229  LEU A O     1 
ATOM   1785 C  CB    . LEU A 1 232 ? 62.934 -7.565  9.165   1.00 12.53  ? 229  LEU A CB    1 
ATOM   1786 C  CG    . LEU A 1 232 ? 62.165 -8.841  8.817   1.00 14.75  ? 229  LEU A CG    1 
ATOM   1787 C  CD1   . LEU A 1 232 ? 63.116 -9.974  8.398   1.00 15.63  ? 229  LEU A CD1   1 
ATOM   1788 C  CD2   . LEU A 1 232 ? 61.300 -9.250  10.002  1.00 19.34  ? 229  LEU A CD2   1 
ATOM   1789 N  N     . ASN A 1 233 ? 63.293 -4.296  9.359   1.00 11.92  ? 230  ASN A N     1 
ATOM   1790 C  CA    . ASN A 1 233 ? 64.152 -3.209  9.810   1.00 13.32  ? 230  ASN A CA    1 
ATOM   1791 C  C     . ASN A 1 233 ? 63.671 -1.906  9.187   1.00 19.16  ? 230  ASN A C     1 
ATOM   1792 O  O     . ASN A 1 233 ? 64.103 -1.522  8.105   1.00 30.66  ? 230  ASN A O     1 
ATOM   1793 C  CB    . ASN A 1 233 ? 65.615 -3.488  9.444   1.00 12.38  ? 230  ASN A CB    1 
ATOM   1794 C  CG    . ASN A 1 233 ? 66.186 -4.702  10.175  1.00 11.90  ? 230  ASN A CG    1 
ATOM   1795 O  OD1   . ASN A 1 233 ? 66.542 -4.621  11.354  1.00 17.87  ? 230  ASN A OD1   1 
ATOM   1796 N  ND2   . ASN A 1 233 ? 66.292 -5.824  9.473   1.00 13.44  ? 230  ASN A ND2   1 
ATOM   1797 N  N     . LYS A 1 234 ? 62.717 -1.274  9.853   1.00 26.31  ? 231  LYS A N     1 
ATOM   1798 C  CA    . LYS A 1 234 ? 62.187 0.014   9.419   1.00 21.08  ? 231  LYS A CA    1 
ATOM   1799 C  C     . LYS A 1 234 ? 62.495 1.000   10.529  1.00 23.83  ? 231  LYS A C     1 
ATOM   1800 O  O     . LYS A 1 234 ? 62.618 0.613   11.692  1.00 29.51  ? 231  LYS A O     1 
ATOM   1801 C  CB    . LYS A 1 234 ? 60.669 -0.073  9.186   1.00 25.75  ? 231  LYS A CB    1 
ATOM   1802 C  CG    . LYS A 1 234 ? 60.236 -0.430  7.754   1.00 32.51  ? 231  LYS A CG    1 
ATOM   1803 C  CD    . LYS A 1 234 ? 58.792 0.061   7.464   1.00 33.97  ? 231  LYS A CD    1 
ATOM   1804 C  CE    . LYS A 1 234 ? 58.457 0.121   5.954   1.00 33.53  ? 231  LYS A CE    1 
ATOM   1805 N  NZ    . LYS A 1 234 ? 58.376 1.531   5.384   1.00 18.57  ? 231  LYS A NZ    1 
ATOM   1806 N  N     . PRO A 1 235 ? 62.640 2.281   10.190  1.00 15.50  ? 232  PRO A N     1 
ATOM   1807 C  CA    . PRO A 1 235 ? 62.566 2.842   8.841   1.00 14.57  ? 232  PRO A CA    1 
ATOM   1808 C  C     . PRO A 1 235 ? 63.950 3.059   8.231   1.00 14.60  ? 232  PRO A C     1 
ATOM   1809 O  O     . PRO A 1 235 ? 64.969 2.893   8.908   1.00 17.72  ? 232  PRO A O     1 
ATOM   1810 C  CB    . PRO A 1 235 ? 61.929 4.203   9.095   1.00 20.37  ? 232  PRO A CB    1 
ATOM   1811 C  CG    . PRO A 1 235 ? 62.522 4.618   10.416  1.00 23.56  ? 232  PRO A CG    1 
ATOM   1812 C  CD    . PRO A 1 235 ? 62.669 3.337   11.216  1.00 19.76  ? 232  PRO A CD    1 
ATOM   1813 N  N     . ASN A 1 236 ? 63.967 3.463   6.963   1.00 12.52  ? 233  ASN A N     1 
ATOM   1814 C  CA    . ASN A 1 236 ? 65.191 3.881   6.280   1.00 12.85  ? 233  ASN A CA    1 
ATOM   1815 C  C     . ASN A 1 236 ? 66.271 2.805   6.256   1.00 10.29  ? 233  ASN A C     1 
ATOM   1816 O  O     . ASN A 1 236 ? 67.447 3.114   6.340   1.00 12.89  ? 233  ASN A O     1 
ATOM   1817 C  CB    . ASN A 1 236 ? 65.732 5.174   6.896   1.00 15.36  ? 233  ASN A CB    1 
ATOM   1818 C  CG    . ASN A 1 236 ? 66.739 5.864   6.006   1.00 16.16  ? 233  ASN A CG    1 
ATOM   1819 O  OD1   . ASN A 1 236 ? 66.646 5.800   4.781   1.00 20.01  ? 233  ASN A OD1   1 
ATOM   1820 N  ND2   . ASN A 1 236 ? 67.717 6.528   6.622   1.00 19.99  ? 233  ASN A ND2   1 
ATOM   1821 N  N     . ARG A 1 237 ? 65.863 1.538   6.135   1.00 12.07  ? 234  ARG A N     1 
ATOM   1822 C  CA    . ARG A 1 237 ? 66.814 0.428   6.052   1.00 13.30  ? 234  ARG A CA    1 
ATOM   1823 C  C     . ARG A 1 237 ? 66.292 -0.614  5.092   1.00 11.59  ? 234  ARG A C     1 
ATOM   1824 O  O     . ARG A 1 237 ? 65.106 -0.622  4.753   1.00 13.05  ? 234  ARG A O     1 
ATOM   1825 C  CB    . ARG A 1 237 ? 67.034 -0.235  7.426   1.00 14.29  ? 234  ARG A CB    1 
ATOM   1826 C  CG    . ARG A 1 237 ? 67.669 0.662   8.494   1.00 15.03  ? 234  ARG A CG    1 
ATOM   1827 C  CD    . ARG A 1 237 ? 69.107 1.002   8.135   1.00 17.34  ? 234  ARG A CD    1 
ATOM   1828 N  NE    . ARG A 1 237 ? 69.804 1.745   9.188   1.00 19.82  ? 234  ARG A NE    1 
ATOM   1829 C  CZ    . ARG A 1 237 ? 69.892 3.073   9.228   1.00 29.72  ? 234  ARG A CZ    1 
ATOM   1830 N  NH1   . ARG A 1 237 ? 69.319 3.811   8.287   1.00 27.98  ? 234  ARG A NH1   1 
ATOM   1831 N  NH2   . ARG A 1 237 ? 70.548 3.667   10.215  1.00 30.57  ? 234  ARG A NH2   1 
ATOM   1832 N  N     . GLN A 1 238 ? 67.169 -1.504  4.647   1.00 11.31  ? 235  GLN A N     1 
ATOM   1833 C  CA    . GLN A 1 238 ? 66.720 -2.605  3.806   1.00 10.93  ? 235  GLN A CA    1 
ATOM   1834 C  C     . GLN A 1 238 ? 67.233 -3.930  4.354   1.00 9.89   ? 235  GLN A C     1 
ATOM   1835 O  O     . GLN A 1 238 ? 68.262 -3.978  5.031   1.00 12.66  ? 235  GLN A O     1 
ATOM   1836 C  CB    . GLN A 1 238 ? 67.141 -2.388  2.345   1.00 12.58  ? 235  GLN A CB    1 
ATOM   1837 C  CG    . GLN A 1 238 ? 68.629 -2.225  2.137   1.00 13.85  ? 235  GLN A CG    1 
ATOM   1838 C  CD    . GLN A 1 238 ? 68.989 -1.962  0.689   1.00 13.36  ? 235  GLN A CD    1 
ATOM   1839 O  OE1   . GLN A 1 238 ? 68.626 -0.926  0.118   1.00 15.25  ? 235  GLN A OE1   1 
ATOM   1840 N  NE2   . GLN A 1 238 ? 69.729 -2.887  0.089   1.00 12.67  ? 235  GLN A NE2   1 
ATOM   1841 N  N     . THR A 1 239 ? 66.502 -5.001  4.063   1.00 9.81   ? 236  THR A N     1 
ATOM   1842 C  CA    . THR A 1 239 ? 66.782 -6.312  4.640   1.00 8.77   ? 236  THR A CA    1 
ATOM   1843 C  C     . THR A 1 239 ? 66.815 -7.396  3.567   1.00 10.63  ? 236  THR A C     1 
ATOM   1844 O  O     . THR A 1 239 ? 65.901 -7.503  2.745   1.00 12.02  ? 236  THR A O     1 
ATOM   1845 C  CB    . THR A 1 239 ? 65.751 -6.672  5.714   1.00 11.41  ? 236  THR A CB    1 
ATOM   1846 O  OG1   . THR A 1 239 ? 65.721 -5.627  6.692   1.00 11.39  ? 236  THR A OG1   1 
ATOM   1847 C  CG2   . THR A 1 239 ? 66.112 -7.996  6.409   1.00 14.82  ? 236  THR A CG2   1 
ATOM   1848 N  N     . LEU A 1 240 ? 67.872 -8.203  3.604   1.00 10.78  ? 237  LEU A N     1 
ATOM   1849 C  CA    . LEU A 1 240 ? 68.038 -9.327  2.701   1.00 10.28  ? 237  LEU A CA    1 
ATOM   1850 C  C     . LEU A 1 240 ? 67.645 -10.598 3.449   1.00 10.90  ? 237  LEU A C     1 
ATOM   1851 O  O     . LEU A 1 240 ? 68.225 -10.928 4.497   1.00 11.86  ? 237  LEU A O     1 
ATOM   1852 C  CB    . LEU A 1 240 ? 69.500 -9.388  2.233   1.00 11.53  ? 237  LEU A CB    1 
ATOM   1853 C  CG    . LEU A 1 240 ? 69.900 -10.395 1.153   1.00 12.59  ? 237  LEU A CG    1 
ATOM   1854 C  CD1   . LEU A 1 240 ? 71.231 -10.006 0.501   1.00 14.42  ? 237  LEU A CD1   1 
ATOM   1855 C  CD2   . LEU A 1 240 ? 69.956 -11.826 1.717   1.00 12.79  ? 237  LEU A CD2   1 
ATOM   1856 N  N     . VAL A 1 241 ? 66.636 -11.292 2.923   1.00 9.77   ? 238  VAL A N     1 
ATOM   1857 C  CA    . VAL A 1 241 ? 66.210 -12.584 3.457   1.00 10.09  ? 238  VAL A CA    1 
ATOM   1858 C  C     . VAL A 1 241 ? 66.589 -13.661 2.457   1.00 12.69  ? 238  VAL A C     1 
ATOM   1859 O  O     . VAL A 1 241 ? 66.000 -13.767 1.374   1.00 12.86  ? 238  VAL A O     1 
ATOM   1860 C  CB    . VAL A 1 241 ? 64.704 -12.601 3.737   1.00 9.12   ? 238  VAL A CB    1 
ATOM   1861 C  CG1   . VAL A 1 241 ? 64.182 -14.046 3.951   1.00 11.58  ? 238  VAL A CG1   1 
ATOM   1862 C  CG2   . VAL A 1 241 ? 64.391 -11.770 4.969   1.00 12.10  ? 238  VAL A CG2   1 
ATOM   1863 N  N     . SER A 1 242 ? 67.591 -14.453 2.828   1.00 10.42  ? 239  SER A N     1 
ATOM   1864 C  CA    . SER A 1 242 ? 68.088 -15.512 1.969   1.00 9.03   ? 239  SER A CA    1 
ATOM   1865 C  C     . SER A 1 242 ? 67.231 -16.769 2.119   1.00 10.50  ? 239  SER A C     1 
ATOM   1866 O  O     . SER A 1 242 ? 66.490 -16.931 3.088   1.00 11.31  ? 239  SER A O     1 
ATOM   1867 C  CB    . SER A 1 242 ? 69.546 -15.831 2.317   1.00 13.23  ? 239  SER A CB    1 
ATOM   1868 O  OG    . SER A 1 242 ? 69.621 -16.334 3.642   1.00 16.47  ? 239  SER A OG    1 
ATOM   1869 N  N     . HIS A 1 243 ? 67.328 -17.675 1.157   1.00 10.73  ? 240  HIS A N     1 
ATOM   1870 C  CA    . HIS A 1 243 ? 66.600 -18.925 1.266   1.00 10.49  ? 240  HIS A CA    1 
ATOM   1871 C  C     . HIS A 1 243 ? 66.992 -19.690 2.529   1.00 10.98  ? 240  HIS A C     1 
ATOM   1872 O  O     . HIS A 1 243 ? 66.128 -20.232 3.226   1.00 11.85  ? 240  HIS A O     1 
ATOM   1873 C  CB    . HIS A 1 243 ? 66.835 -19.791 0.029   1.00 12.10  ? 240  HIS A CB    1 
ATOM   1874 C  CG    . HIS A 1 243 ? 66.047 -21.062 0.031   1.00 13.95  ? 240  HIS A CG    1 
ATOM   1875 N  ND1   . HIS A 1 243 ? 64.693 -21.098 -0.216  1.00 17.65  ? 240  HIS A ND1   1 
ATOM   1876 C  CD2   . HIS A 1 243 ? 66.428 -22.346 0.237   1.00 21.01  ? 240  HIS A CD2   1 
ATOM   1877 C  CE1   . HIS A 1 243 ? 64.270 -22.348 -0.153  1.00 19.24  ? 240  HIS A CE1   1 
ATOM   1878 N  NE2   . HIS A 1 243 ? 65.302 -23.126 0.120   1.00 20.25  ? 240  HIS A NE2   1 
ATOM   1879 N  N     . GLY A 1 244 ? 68.284 -19.694 2.843   1.00 12.22  ? 241  GLY A N     1 
ATOM   1880 C  CA    . GLY A 1 244 ? 68.771 -20.408 4.017   1.00 13.02  ? 241  GLY A CA    1 
ATOM   1881 C  C     . GLY A 1 244 ? 68.309 -19.818 5.339   1.00 11.05  ? 241  GLY A C     1 
ATOM   1882 O  O     . GLY A 1 244 ? 68.290 -20.518 6.348   1.00 13.63  ? 241  GLY A O     1 
ATOM   1883 N  N     . SER A 1 245 ? 67.929 -18.542 5.338   1.00 9.78   ? 242  SER A N     1 
ATOM   1884 C  CA    . SER A 1 245 ? 67.437 -17.899 6.557   1.00 10.34  ? 242  SER A CA    1 
ATOM   1885 C  C     . SER A 1 245 ? 66.020 -18.318 6.919   1.00 11.04  ? 242  SER A C     1 
ATOM   1886 O  O     . SER A 1 245 ? 65.557 -18.053 8.029   1.00 13.02  ? 242  SER A O     1 
ATOM   1887 C  CB    . SER A 1 245 ? 67.491 -16.366 6.443   1.00 10.46  ? 242  SER A CB    1 
ATOM   1888 O  OG    . SER A 1 245 ? 66.441 -15.875 5.615   1.00 13.24  ? 242  SER A OG    1 
ATOM   1889 N  N     . VAL A 1 246 ? 65.316 -18.957 5.990   1.00 11.58  ? 243  VAL A N     1 
ATOM   1890 C  CA    . VAL A 1 246 ? 63.883 -19.208 6.184   1.00 12.02  ? 243  VAL A CA    1 
ATOM   1891 C  C     . VAL A 1 246 ? 63.517 -20.151 7.364   1.00 12.13  ? 243  VAL A C     1 
ATOM   1892 O  O     . VAL A 1 246 ? 62.612 -19.820 8.134   1.00 12.65  ? 243  VAL A O     1 
ATOM   1893 C  CB    . VAL A 1 246 ? 63.229 -19.652 4.869   1.00 10.65  ? 243  VAL A CB    1 
ATOM   1894 C  CG1   . VAL A 1 246 ? 61.779 -20.098 5.114   1.00 15.72  ? 243  VAL A CG1   1 
ATOM   1895 C  CG2   . VAL A 1 246 ? 63.273 -18.501 3.852   1.00 12.71  ? 243  VAL A CG2   1 
ATOM   1896 N  N     . PRO A 1 247 ? 64.210 -21.300 7.521   1.00 11.51  ? 244  PRO A N     1 
ATOM   1897 C  CA    . PRO A 1 247 ? 63.777 -22.173 8.626   1.00 11.09  ? 244  PRO A CA    1 
ATOM   1898 C  C     . PRO A 1 247 ? 63.815 -21.474 9.992   1.00 12.50  ? 244  PRO A C     1 
ATOM   1899 O  O     . PRO A 1 247 ? 62.850 -21.575 10.760  1.00 13.73  ? 244  PRO A O     1 
ATOM   1900 C  CB    . PRO A 1 247 ? 64.758 -23.346 8.559   1.00 12.28  ? 244  PRO A CB    1 
ATOM   1901 C  CG    . PRO A 1 247 ? 65.059 -23.460 7.074   1.00 11.04  ? 244  PRO A CG    1 
ATOM   1902 C  CD    . PRO A 1 247 ? 65.162 -21.992 6.625   1.00 11.01  ? 244  PRO A CD    1 
ATOM   1903 N  N     . GLN A 1 248 ? 64.898 -20.772 10.303  1.00 11.45  ? 245  GLN A N     1 
ATOM   1904 C  CA    . GLN A 1 248 ? 64.954 -20.078 11.584  1.00 12.39  ? 245  GLN A CA    1 
ATOM   1905 C  C     . GLN A 1 248 ? 63.945 -18.938 11.667  1.00 13.11  ? 245  GLN A C     1 
ATOM   1906 O  O     . GLN A 1 248 ? 63.255 -18.780 12.673  1.00 12.04  ? 245  GLN A O     1 
ATOM   1907 C  CB    . GLN A 1 248 ? 66.374 -19.591 11.897  1.00 13.53  ? 245  GLN A CB    1 
ATOM   1908 C  CG    . GLN A 1 248 ? 67.335 -20.735 12.186  1.00 19.39  ? 245  GLN A CG    1 
ATOM   1909 C  CD    . GLN A 1 248 ? 68.443 -20.365 13.167  1.00 35.47  ? 245  GLN A CD    1 
ATOM   1910 O  OE1   . GLN A 1 248 ? 68.202 -20.243 14.370  1.00 42.12  ? 245  GLN A OE1   1 
ATOM   1911 N  NE2   . GLN A 1 248 ? 69.669 -20.202 12.658  1.00 30.80  ? 245  GLN A NE2   1 
ATOM   1912 N  N     . LEU A 1 249 ? 63.847 -18.151 10.598  1.00 10.41  ? 246  LEU A N     1 
ATOM   1913 C  CA    . LEU A 1 249 ? 62.915 -17.030 10.567  1.00 10.57  ? 246  LEU A CA    1 
ATOM   1914 C  C     . LEU A 1 249 ? 61.472 -17.483 10.778  1.00 8.21   ? 246  LEU A C     1 
ATOM   1915 O  O     . LEU A 1 249 ? 60.712 -16.874 11.538  1.00 12.18  ? 246  LEU A O     1 
ATOM   1916 C  CB    . LEU A 1 249 ? 63.042 -16.305 9.220   1.00 12.86  ? 246  LEU A CB    1 
ATOM   1917 C  CG    . LEU A 1 249 ? 62.142 -15.083 9.013   1.00 14.60  ? 246  LEU A CG    1 
ATOM   1918 C  CD1   . LEU A 1 249 ? 62.445 -14.020 10.059  1.00 15.60  ? 246  LEU A CD1   1 
ATOM   1919 C  CD2   . LEU A 1 249 ? 62.307 -14.539 7.607   1.00 15.59  ? 246  LEU A CD2   1 
ATOM   1920 N  N     . PHE A 1 250 ? 61.093 -18.547 10.088  1.00 10.33  ? 247  PHE A N     1 
ATOM   1921 C  CA    . PHE A 1 250 ? 59.717 -19.014 10.177  1.00 9.51   ? 247  PHE A CA    1 
ATOM   1922 C  C     . PHE A 1 250 ? 59.418 -19.776 11.464  1.00 11.35  ? 247  PHE A C     1 
ATOM   1923 O  O     . PHE A 1 250 ? 58.250 -19.983 11.796  1.00 11.99  ? 247  PHE A O     1 
ATOM   1924 C  CB    . PHE A 1 250 ? 59.361 -19.880 8.963   1.00 10.05  ? 247  PHE A CB    1 
ATOM   1925 C  CG    . PHE A 1 250 ? 58.980 -19.090 7.734   1.00 9.54   ? 247  PHE A CG    1 
ATOM   1926 C  CD1   . PHE A 1 250 ? 58.479 -19.758 6.630   1.00 12.40  ? 247  PHE A CD1   1 
ATOM   1927 C  CD2   . PHE A 1 250 ? 59.124 -17.699 7.674   1.00 13.78  ? 247  PHE A CD2   1 
ATOM   1928 C  CE1   . PHE A 1 250 ? 58.116 -19.071 5.485   1.00 11.53  ? 247  PHE A CE1   1 
ATOM   1929 C  CE2   . PHE A 1 250 ? 58.777 -17.009 6.516   1.00 11.79  ? 247  PHE A CE2   1 
ATOM   1930 C  CZ    . PHE A 1 250 ? 58.257 -17.710 5.425   1.00 11.63  ? 247  PHE A CZ    1 
ATOM   1931 N  N     . SER A 1 251 ? 60.459 -20.209 12.177  1.00 10.82  ? 248  SER A N     1 
ATOM   1932 C  CA    . SER A 1 251 ? 60.250 -21.066 13.347  1.00 11.76  ? 248  SER A CA    1 
ATOM   1933 C  C     . SER A 1 251 ? 59.506 -20.369 14.478  1.00 12.19  ? 248  SER A C     1 
ATOM   1934 O  O     . SER A 1 251 ? 58.847 -21.031 15.270  1.00 13.05  ? 248  SER A O     1 
ATOM   1935 C  CB    . SER A 1 251 ? 61.576 -21.640 13.868  1.00 10.52  ? 248  SER A CB    1 
ATOM   1936 O  OG    . SER A 1 251 ? 62.351 -20.645 14.521  1.00 12.99  ? 248  SER A OG    1 
ATOM   1937 N  N     . GLN A 1 252 ? 59.605 -19.039 14.536  1.00 12.67  ? 249  GLN A N     1 
ATOM   1938 C  CA    . GLN A 1 252 ? 58.891 -18.267 15.545  1.00 13.44  ? 249  GLN A CA    1 
ATOM   1939 C  C     . GLN A 1 252 ? 58.020 -17.170 14.935  1.00 14.46  ? 249  GLN A C     1 
ATOM   1940 O  O     . GLN A 1 252 ? 57.641 -16.220 15.628  1.00 16.67  ? 249  GLN A O     1 
ATOM   1941 C  CB    . GLN A 1 252 ? 59.881 -17.613 16.506  1.00 18.45  ? 249  GLN A CB    1 
ATOM   1942 C  CG    . GLN A 1 252 ? 60.701 -18.580 17.314  1.00 17.93  ? 249  GLN A CG    1 
ATOM   1943 C  CD    . GLN A 1 252 ? 61.471 -17.873 18.403  1.00 21.24  ? 249  GLN A CD    1 
ATOM   1944 O  OE1   . GLN A 1 252 ? 60.988 -17.735 19.530  1.00 26.30  ? 249  GLN A OE1   1 
ATOM   1945 N  NE2   . GLN A 1 252 ? 62.665 -17.393 18.067  1.00 20.53  ? 249  GLN A NE2   1 
ATOM   1946 N  N     . MET A 1 253 ? 57.679 -17.308 13.659  1.00 12.26  ? 250  MET A N     1 
ATOM   1947 C  CA    . MET A 1 253 ? 56.964 -16.252 12.935  1.00 12.44  ? 250  MET A CA    1 
ATOM   1948 C  C     . MET A 1 253 ? 55.473 -16.541 12.975  1.00 11.22  ? 250  MET A C     1 
ATOM   1949 O  O     . MET A 1 253 ? 55.029 -17.532 12.398  1.00 10.87  ? 250  MET A O     1 
ATOM   1950 C  CB    . MET A 1 253 ? 57.427 -16.208 11.471  1.00 13.19  ? 250  MET A CB    1 
ATOM   1951 C  CG    . MET A 1 253 ? 56.781 -15.083 10.611  1.00 14.39  ? 250  MET A CG    1 
ATOM   1952 S  SD    . MET A 1 253 ? 57.163 -13.413 11.172  1.00 17.95  ? 250  MET A SD    1 
ATOM   1953 C  CE    . MET A 1 253 ? 58.942 -13.296 10.917  1.00 17.76  ? 250  MET A CE    1 
ATOM   1954 N  N     . PRO A 1 254 ? 54.691 -15.686 13.654  1.00 13.39  ? 251  PRO A N     1 
ATOM   1955 C  CA    . PRO A 1 254 ? 53.245 -15.915 13.658  1.00 12.91  ? 251  PRO A CA    1 
ATOM   1956 C  C     . PRO A 1 254 ? 52.693 -15.960 12.242  1.00 14.10  ? 251  PRO A C     1 
ATOM   1957 O  O     . PRO A 1 254 ? 53.069 -15.158 11.397  1.00 13.05  ? 251  PRO A O     1 
ATOM   1958 C  CB    . PRO A 1 254 ? 52.692 -14.704 14.428  1.00 14.70  ? 251  PRO A CB    1 
ATOM   1959 C  CG    . PRO A 1 254 ? 53.842 -14.258 15.272  1.00 14.12  ? 251  PRO A CG    1 
ATOM   1960 C  CD    . PRO A 1 254 ? 55.057 -14.477 14.413  1.00 13.00  ? 251  PRO A CD    1 
ATOM   1961 N  N     . ILE A 1 255 ? 51.798 -16.901 11.997  1.00 12.30  ? 252  ILE A N     1 
ATOM   1962 C  CA    . ILE A 1 255 ? 51.201 -17.086 10.682  1.00 11.41  ? 252  ILE A CA    1 
ATOM   1963 C  C     . ILE A 1 255 ? 50.601 -15.786 10.118  1.00 13.19  ? 252  ILE A C     1 
ATOM   1964 O  O     . ILE A 1 255 ? 50.728 -15.507 8.925   1.00 13.13  ? 252  ILE A O     1 
ATOM   1965 C  CB    . ILE A 1 255 ? 50.182 -18.231 10.746  1.00 11.75  ? 252  ILE A CB    1 
ATOM   1966 C  CG1   . ILE A 1 255 ? 50.949 -19.560 10.848  1.00 17.71  ? 252  ILE A CG1   1 
ATOM   1967 C  CG2   . ILE A 1 255 ? 49.213 -18.189 9.550   1.00 14.79  ? 252  ILE A CG2   1 
ATOM   1968 C  CD1   . ILE A 1 255 ? 50.126 -20.718 11.331  1.00 21.75  ? 252  ILE A CD1   1 
ATOM   1969 N  N     . ARG A 1 256 ? 49.987 -14.976 10.981  1.00 12.04  ? 253  ARG A N     1 
ATOM   1970 C  CA    . ARG A 1 256 ? 49.307 -13.761 10.542  1.00 10.33  ? 253  ARG A CA    1 
ATOM   1971 C  C     . ARG A 1 256 ? 50.259 -12.720 9.933   1.00 13.83  ? 253  ARG A C     1 
ATOM   1972 O  O     . ARG A 1 256 ? 49.799 -11.773 9.297   1.00 15.34  ? 253  ARG A O     1 
ATOM   1973 C  CB    . ARG A 1 256 ? 48.522 -13.117 11.700  1.00 12.89  ? 253  ARG A CB    1 
ATOM   1974 C  CG    . ARG A 1 256 ? 49.410 -12.524 12.775  1.00 14.30  ? 253  ARG A CG    1 
ATOM   1975 C  CD    . ARG A 1 256 ? 48.595 -11.924 13.912  1.00 18.01  ? 253  ARG A CD    1 
ATOM   1976 N  NE    . ARG A 1 256 ? 49.477 -11.480 14.987  1.00 18.94  ? 253  ARG A NE    1 
ATOM   1977 C  CZ    . ARG A 1 256 ? 49.890 -12.245 15.994  1.00 19.68  ? 253  ARG A CZ    1 
ATOM   1978 N  NH1   . ARG A 1 256 ? 49.488 -13.511 16.083  1.00 20.76  ? 253  ARG A NH1   1 
ATOM   1979 N  NH2   . ARG A 1 256 ? 50.705 -11.737 16.920  1.00 20.02  ? 253  ARG A NH2   1 
ATOM   1980 N  N     . LYS A 1 257 ? 51.566 -12.877 10.137  1.00 14.33  ? 254  LYS A N     1 
ATOM   1981 C  CA    . LYS A 1 257 ? 52.528 -11.886 9.627   1.00 13.94  ? 254  LYS A CA    1 
ATOM   1982 C  C     . LYS A 1 257 ? 52.783 -12.016 8.140   1.00 17.26  ? 254  LYS A C     1 
ATOM   1983 O  O     . LYS A 1 257 ? 53.326 -11.096 7.524   1.00 17.83  ? 254  LYS A O     1 
ATOM   1984 C  CB    . LYS A 1 257 ? 53.871 -11.950 10.358  1.00 14.41  ? 254  LYS A CB    1 
ATOM   1985 C  CG    . LYS A 1 257 ? 53.784 -11.755 11.857  1.00 18.37  ? 254  LYS A CG    1 
ATOM   1986 C  CD    . LYS A 1 257 ? 53.130 -10.440 12.215  1.00 20.81  ? 254  LYS A CD    1 
ATOM   1987 C  CE    . LYS A 1 257 ? 53.114 -10.241 13.729  1.00 27.89  ? 254  LYS A CE    1 
ATOM   1988 N  NZ    . LYS A 1 257 ? 52.554 -8.912  14.113  1.00 31.64  ? 254  LYS A NZ    1 
ATOM   1989 N  N     . ILE A 1 258 ? 52.422 -13.164 7.571   1.00 12.62  ? 255  ILE A N     1 
ATOM   1990 C  CA    . ILE A 1 258 ? 52.683 -13.422 6.160   1.00 13.34  ? 255  ILE A CA    1 
ATOM   1991 C  C     . ILE A 1 258 ? 51.546 -12.848 5.316   1.00 15.28  ? 255  ILE A C     1 
ATOM   1992 O  O     . ILE A 1 258 ? 50.370 -13.022 5.633   1.00 15.00  ? 255  ILE A O     1 
ATOM   1993 C  CB    . ILE A 1 258 ? 52.833 -14.933 5.877   1.00 14.09  ? 255  ILE A CB    1 
ATOM   1994 C  CG1   . ILE A 1 258 ? 54.213 -15.441 6.312   1.00 19.58  ? 255  ILE A CG1   1 
ATOM   1995 C  CG2   . ILE A 1 258 ? 52.662 -15.235 4.405   1.00 15.69  ? 255  ILE A CG2   1 
ATOM   1996 C  CD1   . ILE A 1 258 ? 54.579 -15.144 7.738   1.00 26.83  ? 255  ILE A CD1   1 
ATOM   1997 N  N     . ARG A 1 259 ? 51.898 -12.150 4.241   1.00 14.48  ? 256  ARG A N     1 
ATOM   1998 C  CA    . ARG A 1 259 ? 50.894 -11.499 3.411   1.00 16.13  ? 256  ARG A CA    1 
ATOM   1999 C  C     . ARG A 1 259 ? 49.837 -12.478 2.898   1.00 18.51  ? 256  ARG A C     1 
ATOM   2000 O  O     . ARG A 1 259 ? 50.179 -13.502 2.293   1.00 16.10  ? 256  ARG A O     1 
ATOM   2001 C  CB    . ARG A 1 259 ? 51.555 -10.779 2.232   1.00 17.77  ? 256  ARG A CB    1 
ATOM   2002 C  CG    . ARG A 1 259 ? 50.585 -9.916  1.432   1.00 22.33  ? 256  ARG A CG    1 
ATOM   2003 C  CD    . ARG A 1 259 ? 51.262 -9.279  0.226   1.00 27.62  ? 256  ARG A CD    1 
ATOM   2004 N  NE    . ARG A 1 259 ? 50.535 -8.088  -0.217  1.00 38.15  ? 256  ARG A NE    1 
ATOM   2005 C  CZ    . ARG A 1 259 ? 49.744 -8.041  -1.285  1.00 57.75  ? 256  ARG A CZ    1 
ATOM   2006 N  NH1   . ARG A 1 259 ? 49.579 -9.117  -2.042  1.00 61.46  ? 256  ARG A NH1   1 
ATOM   2007 N  NH2   . ARG A 1 259 ? 49.125 -6.911  -1.602  1.00 64.80  ? 256  ARG A NH2   1 
ATOM   2008 N  N     . SER A 1 260 ? 48.571 -12.138 3.162   1.00 16.08  ? 257  SER A N     1 
ATOM   2009 C  CA    . SER A 1 260 ? 47.359 -12.881 2.773   1.00 14.06  ? 257  SER A CA    1 
ATOM   2010 C  C     . SER A 1 260 ? 46.841 -13.769 3.905   1.00 15.10  ? 257  SER A C     1 
ATOM   2011 O  O     . SER A 1 260 ? 45.715 -14.276 3.837   1.00 15.45  ? 257  SER A O     1 
ATOM   2012 C  CB    . SER A 1 260 ? 47.525 -13.684 1.471   1.00 18.53  ? 257  SER A CB    1 
ATOM   2013 O  OG    . SER A 1 260 ? 48.130 -14.943 1.718   1.00 18.84  ? 257  SER A OG    1 
ATOM   2014 N  N     . LEU A 1 261 ? 47.653 -13.934 4.950   1.00 12.26  ? 258  LEU A N     1 
ATOM   2015 C  CA    . LEU A 1 261 ? 47.263 -14.777 6.082   1.00 11.84  ? 258  LEU A CA    1 
ATOM   2016 C  C     . LEU A 1 261 ? 46.899 -13.945 7.309   1.00 15.03  ? 258  LEU A C     1 
ATOM   2017 O  O     . LEU A 1 261 ? 46.734 -14.476 8.396   1.00 13.20  ? 258  LEU A O     1 
ATOM   2018 C  CB    . LEU A 1 261 ? 48.368 -15.787 6.427   1.00 11.54  ? 258  LEU A CB    1 
ATOM   2019 C  CG    . LEU A 1 261 ? 48.721 -16.773 5.311   1.00 12.80  ? 258  LEU A CG    1 
ATOM   2020 C  CD1   . LEU A 1 261 ? 49.811 -17.725 5.779   1.00 12.26  ? 258  LEU A CD1   1 
ATOM   2021 C  CD2   . LEU A 1 261 ? 47.489 -17.540 4.846   1.00 14.65  ? 258  LEU A CD2   1 
ATOM   2022 N  N     . GLY A 1 262 ? 46.762 -12.637 7.132   1.00 14.53  ? 259  GLY A N     1 
ATOM   2023 C  CA    . GLY A 1 262 ? 46.422 -11.761 8.250   1.00 14.97  ? 259  GLY A CA    1 
ATOM   2024 C  C     . GLY A 1 262 ? 44.946 -11.713 8.636   1.00 14.54  ? 259  GLY A C     1 
ATOM   2025 O  O     . GLY A 1 262 ? 44.575 -10.979 9.565   1.00 16.64  ? 259  GLY A O     1 
ATOM   2026 N  N     . GLY A 1 263 ? 44.104 -12.477 7.938   1.00 13.97  ? 260  GLY A N     1 
ATOM   2027 C  CA    . GLY A 1 263 ? 42.667 -12.443 8.149   1.00 17.34  ? 260  GLY A CA    1 
ATOM   2028 C  C     . GLY A 1 263 ? 42.056 -13.788 8.510   1.00 16.04  ? 260  GLY A C     1 
ATOM   2029 O  O     . GLY A 1 263 ? 42.643 -14.561 9.271   1.00 16.19  ? 260  GLY A O     1 
ATOM   2030 N  N     . LYS A 1 264 ? 40.879 -14.069 7.955   1.00 16.67  ? 261  LYS A N     1 
ATOM   2031 C  CA    . LYS A 1 264 ? 40.137 -15.291 8.285   1.00 16.05  ? 261  LYS A CA    1 
ATOM   2032 C  C     . LYS A 1 264 ? 40.868 -16.575 7.869   1.00 17.99  ? 261  LYS A C     1 
ATOM   2033 O  O     . LYS A 1 264 ? 40.849 -17.573 8.598   1.00 18.31  ? 261  LYS A O     1 
ATOM   2034 C  CB    . LYS A 1 264 ? 38.732 -15.257 7.663   1.00 17.73  ? 261  LYS A CB    1 
ATOM   2035 C  CG    . LYS A 1 264 ? 37.843 -14.135 8.197   1.00 21.31  ? 261  LYS A CG    1 
ATOM   2036 C  CD    . LYS A 1 264 ? 36.466 -14.179 7.544   1.00 27.39  ? 261  LYS A CD    1 
ATOM   2037 C  CE    . LYS A 1 264 ? 35.534 -13.152 8.160   1.00 35.55  ? 261  LYS A CE    1 
ATOM   2038 N  NZ    . LYS A 1 264 ? 34.150 -13.256 7.610   1.00 38.97  ? 261  LYS A NZ    1 
ATOM   2039 N  N     . LEU A 1 265 ? 41.500 -16.577 6.700   1.00 15.10  ? 262  LEU A N     1 
ATOM   2040 C  CA    . LEU A 1 265 ? 42.227 -17.776 6.289   1.00 14.20  ? 262  LEU A CA    1 
ATOM   2041 C  C     . LEU A 1 265 ? 43.335 -18.122 7.281   1.00 13.00  ? 262  LEU A C     1 
ATOM   2042 O  O     . LEU A 1 265 ? 43.475 -19.269 7.698   1.00 17.21  ? 262  LEU A O     1 
ATOM   2043 C  CB    . LEU A 1 265 ? 42.795 -17.649 4.874   1.00 15.73  ? 262  LEU A CB    1 
ATOM   2044 C  CG    . LEU A 1 265 ? 43.707 -18.798 4.420   1.00 18.38  ? 262  LEU A CG    1 
ATOM   2045 C  CD1   . LEU A 1 265 ? 42.963 -20.130 4.428   1.00 19.41  ? 262  LEU A CD1   1 
ATOM   2046 C  CD2   . LEU A 1 265 ? 44.296 -18.534 3.042   1.00 17.93  ? 262  LEU A CD2   1 
ATOM   2047 N  N     . GLY A 1 266 ? 44.133 -17.130 7.647   1.00 13.38  ? 263  GLY A N     1 
ATOM   2048 C  CA    . GLY A 1 266 ? 45.197 -17.356 8.602   1.00 12.09  ? 263  GLY A CA    1 
ATOM   2049 C  C     . GLY A 1 266 ? 44.644 -17.841 9.926   1.00 11.82  ? 263  GLY A C     1 
ATOM   2050 O  O     . GLY A 1 266 ? 45.232 -18.724 10.561  1.00 13.38  ? 263  GLY A O     1 
ATOM   2051 N  N     . ALA A 1 267 ? 43.526 -17.255 10.361  1.00 14.38  ? 264  ALA A N     1 
ATOM   2052 C  CA    . ALA A 1 267 ? 42.917 -17.698 11.613  1.00 18.10  ? 264  ALA A CA    1 
ATOM   2053 C  C     . ALA A 1 267 ? 42.475 -19.160 11.512  1.00 15.07  ? 264  ALA A C     1 
ATOM   2054 O  O     . ALA A 1 267 ? 42.585 -19.919 12.482  1.00 17.15  ? 264  ALA A O     1 
ATOM   2055 C  CB    . ALA A 1 267 ? 41.738 -16.794 11.987  1.00 19.15  ? 264  ALA A CB    1 
ATOM   2056 N  N     . SER A 1 268 ? 41.992 -19.564 10.337  1.00 14.45  ? 265  SER A N     1 
ATOM   2057 C  CA    . SER A 1 268 ? 41.553 -20.945 10.123  1.00 15.85  ? 265  SER A CA    1 
ATOM   2058 C  C     . SER A 1 268 ? 42.724 -21.934 10.107  1.00 15.69  ? 265  SER A C     1 
ATOM   2059 O  O     . SER A 1 268 ? 42.623 -23.039 10.644  1.00 15.55  ? 265  SER A O     1 
ATOM   2060 C  CB    . SER A 1 268 ? 40.672 -21.051 8.868   1.00 17.20  ? 265  SER A CB    1 
ATOM   2061 O  OG    B SER A 1 268 ? 41.426 -21.040 7.674   0.50 15.16  ? 265  SER A OG    1 
ATOM   2062 O  OG    C SER A 1 268 ? 40.279 -22.387 8.609   0.50 16.10  ? 265  SER A OG    1 
ATOM   2063 N  N     . VAL A 1 269 ? 43.841 -21.530 9.510   1.00 13.10  ? 266  VAL A N     1 
ATOM   2064 C  CA    . VAL A 1 269 ? 45.050 -22.343 9.547   1.00 13.12  ? 266  VAL A CA    1 
ATOM   2065 C  C     . VAL A 1 269 ? 45.442 -22.640 10.998  1.00 16.70  ? 266  VAL A C     1 
ATOM   2066 O  O     . VAL A 1 269 ? 45.681 -23.796 11.382  1.00 13.57  ? 266  VAL A O     1 
ATOM   2067 C  CB    . VAL A 1 269 ? 46.214 -21.650 8.809   1.00 12.96  ? 266  VAL A CB    1 
ATOM   2068 C  CG1   . VAL A 1 269 ? 47.532 -22.382 9.041   1.00 14.02  ? 266  VAL A CG1   1 
ATOM   2069 C  CG2   . VAL A 1 269 ? 45.909 -21.545 7.305   1.00 15.17  ? 266  VAL A CG2   1 
ATOM   2070 N  N     . ILE A 1 270 ? 45.485 -21.589 11.810  1.00 14.50  ? 267  ILE A N     1 
ATOM   2071 C  CA    . ILE A 1 270 ? 45.838 -21.715 13.221  1.00 14.16  ? 267  ILE A CA    1 
ATOM   2072 C  C     . ILE A 1 270 ? 44.876 -22.628 13.979  1.00 14.10  ? 267  ILE A C     1 
ATOM   2073 O  O     . ILE A 1 270 ? 45.310 -23.524 14.722  1.00 17.51  ? 267  ILE A O     1 
ATOM   2074 C  CB    . ILE A 1 270 ? 45.884 -20.339 13.882  1.00 16.27  ? 267  ILE A CB    1 
ATOM   2075 C  CG1   . ILE A 1 270 ? 47.084 -19.562 13.351  1.00 16.12  ? 267  ILE A CG1   1 
ATOM   2076 C  CG2   . ILE A 1 270 ? 45.935 -20.475 15.406  1.00 21.49  ? 267  ILE A CG2   1 
ATOM   2077 C  CD1   . ILE A 1 270 ? 47.035 -18.062 13.658  1.00 24.06  ? 267  ILE A CD1   1 
ATOM   2078 N  N     . GLU A 1 271 ? 43.574 -22.423 13.780  1.00 14.13  ? 268  GLU A N     1 
ATOM   2079 C  CA    . GLU A 1 271 ? 42.563 -23.170 14.523  1.00 16.03  ? 268  GLU A CA    1 
ATOM   2080 C  C     . GLU A 1 271 ? 42.463 -24.627 14.090  1.00 18.20  ? 268  GLU A C     1 
ATOM   2081 O  O     . GLU A 1 271 ? 42.444 -25.529 14.930  1.00 22.55  ? 268  GLU A O     1 
ATOM   2082 C  CB    . GLU A 1 271 ? 41.190 -22.503 14.413  1.00 28.38  ? 268  GLU A CB    1 
ATOM   2083 C  CG    . GLU A 1 271 ? 40.070 -23.341 15.021  1.00 45.79  ? 268  GLU A CG    1 
ATOM   2084 C  CD    . GLU A 1 271 ? 38.804 -22.546 15.281  1.00 61.53  ? 268  GLU A CD    1 
ATOM   2085 O  OE1   . GLU A 1 271 ? 38.853 -21.300 15.214  1.00 69.54  ? 268  GLU A OE1   1 
ATOM   2086 O  OE2   . GLU A 1 271 ? 37.759 -23.172 15.555  1.00 66.20  ? 268  GLU A OE2   1 
ATOM   2087 N  N     . ILE A 1 272 ? 42.399 -24.850 12.781  1.00 17.32  ? 269  ILE A N     1 
ATOM   2088 C  CA    . ILE A 1 272 ? 42.231 -26.196 12.246  1.00 15.76  ? 269  ILE A CA    1 
ATOM   2089 C  C     . ILE A 1 272 ? 43.446 -27.090 12.484  1.00 15.72  ? 269  ILE A C     1 
ATOM   2090 O  O     . ILE A 1 272 ? 43.296 -28.265 12.827  1.00 17.65  ? 269  ILE A O     1 
ATOM   2091 C  CB    . ILE A 1 272 ? 41.880 -26.161 10.742  1.00 15.71  ? 269  ILE A CB    1 
ATOM   2092 C  CG1   . ILE A 1 272 ? 40.492 -25.547 10.531  1.00 21.50  ? 269  ILE A CG1   1 
ATOM   2093 C  CG2   . ILE A 1 272 ? 41.949 -27.560 10.138  1.00 21.53  ? 269  ILE A CG2   1 
ATOM   2094 C  CD1   . ILE A 1 272 ? 40.062 -25.456 9.072   1.00 24.34  ? 269  ILE A CD1   1 
ATOM   2095 N  N     . LEU A 1 273 ? 44.644 -26.534 12.316  1.00 17.54  ? 270  LEU A N     1 
ATOM   2096 C  CA    . LEU A 1 273 ? 45.858 -27.336 12.430  1.00 15.67  ? 270  LEU A CA    1 
ATOM   2097 C  C     . LEU A 1 273 ? 46.427 -27.346 13.850  1.00 15.25  ? 270  LEU A C     1 
ATOM   2098 O  O     . LEU A 1 273 ? 47.255 -28.199 14.192  1.00 17.47  ? 270  LEU A O     1 
ATOM   2099 C  CB    . LEU A 1 273 ? 46.914 -26.866 11.423  1.00 15.41  ? 270  LEU A CB    1 
ATOM   2100 C  CG    . LEU A 1 273 ? 46.469 -26.917 9.964   1.00 15.22  ? 270  LEU A CG    1 
ATOM   2101 C  CD1   . LEU A 1 273 ? 47.583 -26.399 9.072   1.00 17.25  ? 270  LEU A CD1   1 
ATOM   2102 C  CD2   . LEU A 1 273 ? 46.084 -28.357 9.593   1.00 18.53  ? 270  LEU A CD2   1 
ATOM   2103 N  N     . GLY A 1 274 ? 45.975 -26.408 14.675  1.00 16.00  ? 271  GLY A N     1 
ATOM   2104 C  CA    . GLY A 1 274 ? 46.472 -26.296 16.034  1.00 18.05  ? 271  GLY A CA    1 
ATOM   2105 C  C     . GLY A 1 274 ? 47.935 -25.889 16.090  1.00 20.26  ? 271  GLY A C     1 
ATOM   2106 O  O     . GLY A 1 274 ? 48.712 -26.434 16.873  1.00 22.52  ? 271  GLY A O     1 
ATOM   2107 N  N     . ILE A 1 275 ? 48.308 -24.920 15.259  1.00 13.17  ? 272  ILE A N     1 
ATOM   2108 C  CA    . ILE A 1 275 ? 49.684 -24.422 15.212  1.00 14.02  ? 272  ILE A CA    1 
ATOM   2109 C  C     . ILE A 1 275 ? 49.700 -22.907 15.370  1.00 13.81  ? 272  ILE A C     1 
ATOM   2110 O  O     . ILE A 1 275 ? 48.649 -22.268 15.323  1.00 16.29  ? 272  ILE A O     1 
ATOM   2111 C  CB    . ILE A 1 275 ? 50.386 -24.785 13.892  1.00 12.82  ? 272  ILE A CB    1 
ATOM   2112 C  CG1   . ILE A 1 275 ? 49.655 -24.174 12.693  1.00 16.70  ? 272  ILE A CG1   1 
ATOM   2113 C  CG2   . ILE A 1 275 ? 50.516 -26.313 13.752  1.00 14.73  ? 272  ILE A CG2   1 
ATOM   2114 C  CD1   . ILE A 1 275 ? 50.398 -24.428 11.363  1.00 14.90  ? 272  ILE A CD1   1 
ATOM   2115 N  N     . GLU A 1 276 ? 50.887 -22.334 15.560  1.00 13.16  ? 273  GLU A N     1 
ATOM   2116 C  CA    . GLU A 1 276 ? 51.034 -20.882 15.721  1.00 14.35  ? 273  GLU A CA    1 
ATOM   2117 C  C     . GLU A 1 276 ? 51.987 -20.236 14.711  1.00 12.42  ? 273  GLU A C     1 
ATOM   2118 O  O     . GLU A 1 276 ? 51.798 -19.074 14.329  1.00 14.71  ? 273  GLU A O     1 
ATOM   2119 C  CB    . GLU A 1 276 ? 51.546 -20.558 17.125  1.00 15.57  ? 273  GLU A CB    1 
ATOM   2120 C  CG    . GLU A 1 276 ? 50.522 -20.794 18.230  1.00 22.60  ? 273  GLU A CG    1 
ATOM   2121 C  CD    . GLU A 1 276 ? 51.151 -20.824 19.616  1.00 42.90  ? 273  GLU A CD    1 
ATOM   2122 O  OE1   . GLU A 1 276 ? 50.557 -21.440 20.529  1.00 53.58  ? 273  GLU A OE1   1 
ATOM   2123 O  OE2   . GLU A 1 276 ? 52.237 -20.234 19.794  1.00 43.44  ? 273  GLU A OE2   1 
ATOM   2124 N  N     . TYR A 1 277 ? 53.026 -20.962 14.302  1.00 11.00  ? 274  TYR A N     1 
ATOM   2125 C  CA    . TYR A 1 277 ? 54.106 -20.347 13.529  1.00 11.80  ? 274  TYR A CA    1 
ATOM   2126 C  C     . TYR A 1 277 ? 54.177 -20.923 12.129  1.00 11.79  ? 274  TYR A C     1 
ATOM   2127 O  O     . TYR A 1 277 ? 53.833 -22.085 11.891  1.00 12.85  ? 274  TYR A O     1 
ATOM   2128 C  CB    . TYR A 1 277 ? 55.454 -20.565 14.225  1.00 13.19  ? 274  TYR A CB    1 
ATOM   2129 C  CG    . TYR A 1 277 ? 55.467 -20.076 15.654  1.00 12.18  ? 274  TYR A CG    1 
ATOM   2130 C  CD1   . TYR A 1 277 ? 55.681 -20.949 16.702  1.00 14.62  ? 274  TYR A CD1   1 
ATOM   2131 C  CD2   . TYR A 1 277 ? 55.204 -18.743 15.944  1.00 13.33  ? 274  TYR A CD2   1 
ATOM   2132 C  CE1   . TYR A 1 277 ? 55.666 -20.504 18.017  1.00 19.53  ? 274  TYR A CE1   1 
ATOM   2133 C  CE2   . TYR A 1 277 ? 55.187 -18.288 17.249  1.00 16.15  ? 274  TYR A CE2   1 
ATOM   2134 C  CZ    . TYR A 1 277 ? 55.420 -19.175 18.281  1.00 19.33  ? 274  TYR A CZ    1 
ATOM   2135 O  OH    . TYR A 1 277 ? 55.416 -18.742 19.586  1.00 20.21  ? 274  TYR A OH    1 
ATOM   2136 N  N     . MET A 1 278 ? 54.651 -20.104 11.203  1.00 10.78  ? 275  MET A N     1 
ATOM   2137 C  CA    . MET A 1 278 ? 54.714 -20.495 9.803   1.00 10.38  ? 275  MET A CA    1 
ATOM   2138 C  C     . MET A 1 278 ? 55.494 -21.787 9.613   1.00 11.20  ? 275  MET A C     1 
ATOM   2139 O  O     . MET A 1 278 ? 55.099 -22.637 8.820   1.00 14.63  ? 275  MET A O     1 
ATOM   2140 C  CB    . MET A 1 278 ? 55.370 -19.372 8.993   1.00 13.93  ? 275  MET A CB    1 
ATOM   2141 C  CG    A MET A 1 278 ? 55.076 -19.413 7.489   0.60 9.50   ? 275  MET A CG    1 
ATOM   2142 C  CG    B MET A 1 278 ? 54.451 -18.226 8.689   0.40 20.01  ? 275  MET A CG    1 
ATOM   2143 S  SD    A MET A 1 278 ? 53.321 -19.307 7.032   0.60 13.99  ? 275  MET A SD    1 
ATOM   2144 S  SD    B MET A 1 278 ? 53.167 -18.706 7.525   0.40 17.71  ? 275  MET A SD    1 
ATOM   2145 C  CE    A MET A 1 278 ? 53.341 -19.624 5.259   0.60 13.14  ? 275  MET A CE    1 
ATOM   2146 C  CE    B MET A 1 278 ? 54.163 -19.232 6.132   0.40 14.68  ? 275  MET A CE    1 
ATOM   2147 N  N     . GLY A 1 279 ? 56.600 -21.950 10.340  1.00 10.82  ? 276  GLY A N     1 
ATOM   2148 C  CA    . GLY A 1 279 ? 57.436 -23.129 10.168  1.00 12.75  ? 276  GLY A CA    1 
ATOM   2149 C  C     . GLY A 1 279 ? 56.708 -24.430 10.452  1.00 13.68  ? 276  GLY A C     1 
ATOM   2150 O  O     . GLY A 1 279 ? 57.003 -25.479 9.858   1.00 13.12  ? 276  GLY A O     1 
ATOM   2151 N  N     . GLU A 1 280 ? 55.750 -24.383 11.375  1.00 12.10  ? 277  GLU A N     1 
ATOM   2152 C  CA    . GLU A 1 280 ? 55.050 -25.589 11.772  1.00 9.02   ? 277  GLU A CA    1 
ATOM   2153 C  C     . GLU A 1 280 ? 54.255 -26.180 10.612  1.00 11.10  ? 277  GLU A C     1 
ATOM   2154 O  O     . GLU A 1 280 ? 53.892 -27.359 10.638  1.00 11.76  ? 277  GLU A O     1 
ATOM   2155 C  CB    . GLU A 1 280 ? 54.097 -25.292 12.927  1.00 10.85  ? 277  GLU A CB    1 
ATOM   2156 C  CG    . GLU A 1 280 ? 54.803 -24.956 14.214  1.00 11.73  ? 277  GLU A CG    1 
ATOM   2157 C  CD    . GLU A 1 280 ? 53.821 -24.689 15.322  1.00 15.74  ? 277  GLU A CD    1 
ATOM   2158 O  OE1   . GLU A 1 280 ? 53.453 -23.516 15.522  1.00 15.61  ? 277  GLU A OE1   1 
ATOM   2159 O  OE2   . GLU A 1 280 ? 53.406 -25.657 15.983  1.00 18.02  ? 277  GLU A OE2   1 
ATOM   2160 N  N     . LEU A 1 281 ? 53.970 -25.366 9.602   1.00 11.79  ? 278  LEU A N     1 
ATOM   2161 C  CA    . LEU A 1 281 ? 53.263 -25.881 8.427   1.00 11.04  ? 278  LEU A CA    1 
ATOM   2162 C  C     . LEU A 1 281 ? 54.035 -26.963 7.669   1.00 10.68  ? 278  LEU A C     1 
ATOM   2163 O  O     . LEU A 1 281 ? 53.429 -27.739 6.933   1.00 11.26  ? 278  LEU A O     1 
ATOM   2164 C  CB    . LEU A 1 281 ? 52.903 -24.744 7.468   1.00 11.25  ? 278  LEU A CB    1 
ATOM   2165 C  CG    . LEU A 1 281 ? 51.693 -23.891 7.860   1.00 12.75  ? 278  LEU A CG    1 
ATOM   2166 C  CD1   . LEU A 1 281 ? 51.688 -22.563 7.083   1.00 13.86  ? 278  LEU A CD1   1 
ATOM   2167 C  CD2   . LEU A 1 281 ? 50.390 -24.654 7.635   1.00 15.95  ? 278  LEU A CD2   1 
ATOM   2168 N  N     . THR A 1 282 ? 55.357 -27.029 7.816   1.00 9.91   ? 279  THR A N     1 
ATOM   2169 C  CA    . THR A 1 282 ? 56.118 -28.007 7.023   1.00 11.31  ? 279  THR A CA    1 
ATOM   2170 C  C     . THR A 1 282 ? 55.726 -29.439 7.355   1.00 10.96  ? 279  THR A C     1 
ATOM   2171 O  O     . THR A 1 282 ? 56.011 -30.337 6.582   1.00 14.50  ? 279  THR A O     1 
ATOM   2172 C  CB    . THR A 1 282 ? 57.644 -27.882 7.199   1.00 13.63  ? 279  THR A CB    1 
ATOM   2173 O  OG1   . THR A 1 282 ? 57.991 -28.173 8.559   1.00 14.12  ? 279  THR A OG1   1 
ATOM   2174 C  CG2   . THR A 1 282 ? 58.139 -26.500 6.798   1.00 11.97  ? 279  THR A CG2   1 
ATOM   2175 N  N     . GLN A 1 283 ? 55.076 -29.656 8.496   1.00 12.50  ? 280  GLN A N     1 
ATOM   2176 C  CA    . GLN A 1 283 ? 54.745 -31.014 8.939   1.00 15.00  ? 280  GLN A CA    1 
ATOM   2177 C  C     . GLN A 1 283 ? 53.498 -31.635 8.324   1.00 18.06  ? 280  GLN A C     1 
ATOM   2178 O  O     . GLN A 1 283 ? 53.124 -32.746 8.679   1.00 24.41  ? 280  GLN A O     1 
ATOM   2179 C  CB    . GLN A 1 283 ? 54.677 -31.060 10.464  1.00 15.85  ? 280  GLN A CB    1 
ATOM   2180 C  CG    . GLN A 1 283 ? 56.052 -30.833 11.058  1.00 20.78  ? 280  GLN A CG    1 
ATOM   2181 C  CD    . GLN A 1 283 ? 57.108 -31.670 10.353  1.00 25.30  ? 280  GLN A CD    1 
ATOM   2182 O  OE1   . GLN A 1 283 ? 57.135 -32.893 10.496  1.00 25.67  ? 280  GLN A OE1   1 
ATOM   2183 N  NE2   . GLN A 1 283 ? 57.972 -31.017 9.572   1.00 24.51  ? 280  GLN A NE2   1 
ATOM   2184 N  N     . PHE A 1 284 ? 52.872 -30.931 7.396   1.00 12.13  ? 281  PHE A N     1 
ATOM   2185 C  CA    . PHE A 1 284 ? 51.677 -31.435 6.728   1.00 13.05  ? 281  PHE A CA    1 
ATOM   2186 C  C     . PHE A 1 284 ? 51.973 -31.721 5.267   1.00 13.74  ? 281  PHE A C     1 
ATOM   2187 O  O     . PHE A 1 284 ? 52.788 -31.032 4.654   1.00 16.32  ? 281  PHE A O     1 
ATOM   2188 C  CB    . PHE A 1 284 ? 50.559 -30.403 6.861   1.00 12.72  ? 281  PHE A CB    1 
ATOM   2189 C  CG    . PHE A 1 284 ? 50.226 -30.096 8.288   1.00 14.00  ? 281  PHE A CG    1 
ATOM   2190 C  CD1   . PHE A 1 284 ? 49.322 -30.889 8.981   1.00 17.21  ? 281  PHE A CD1   1 
ATOM   2191 C  CD2   . PHE A 1 284 ? 50.857 -29.056 8.955   1.00 12.93  ? 281  PHE A CD2   1 
ATOM   2192 C  CE1   . PHE A 1 284 ? 49.024 -30.627 10.312  1.00 20.56  ? 281  PHE A CE1   1 
ATOM   2193 C  CE2   . PHE A 1 284 ? 50.570 -28.785 10.282  1.00 13.68  ? 281  PHE A CE2   1 
ATOM   2194 C  CZ    . PHE A 1 284 ? 49.656 -29.578 10.968  1.00 18.19  ? 281  PHE A CZ    1 
ATOM   2195 N  N     . THR A 1 285 ? 51.323 -32.736 4.703   1.00 13.31  ? 282  THR A N     1 
ATOM   2196 C  CA    . THR A 1 285 ? 51.499 -32.989 3.280   1.00 13.86  ? 282  THR A CA    1 
ATOM   2197 C  C     . THR A 1 285 ? 50.716 -31.959 2.479   1.00 11.25  ? 282  THR A C     1 
ATOM   2198 O  O     . THR A 1 285 ? 49.796 -31.317 2.994   1.00 12.25  ? 282  THR A O     1 
ATOM   2199 C  CB    . THR A 1 285 ? 51.019 -34.391 2.871   1.00 13.77  ? 282  THR A CB    1 
ATOM   2200 O  OG1   . THR A 1 285 ? 49.595 -34.462 2.997   1.00 15.01  ? 282  THR A OG1   1 
ATOM   2201 C  CG2   . THR A 1 285 ? 51.660 -35.449 3.754   1.00 16.14  ? 282  THR A CG2   1 
ATOM   2202 N  N     . GLU A 1 286 ? 51.075 -31.813 1.211   1.00 13.28  ? 283  GLU A N     1 
ATOM   2203 C  CA    . GLU A 1 286 ? 50.355 -30.909 0.335   1.00 14.08  ? 283  GLU A CA    1 
ATOM   2204 C  C     . GLU A 1 286 ? 48.870 -31.284 0.275   1.00 13.36  ? 283  GLU A C     1 
ATOM   2205 O  O     . GLU A 1 286 ? 47.997 -30.406 0.326   1.00 13.40  ? 283  GLU A O     1 
ATOM   2206 C  CB    . GLU A 1 286 ? 50.992 -30.902 -1.061  1.00 11.74  ? 283  GLU A CB    1 
ATOM   2207 C  CG    . GLU A 1 286 ? 50.440 -29.810 -1.957  1.00 14.59  ? 283  GLU A CG    1 
ATOM   2208 C  CD    . GLU A 1 286 ? 51.185 -29.707 -3.264  1.00 26.50  ? 283  GLU A CD    1 
ATOM   2209 O  OE1   . GLU A 1 286 ? 52.089 -30.538 -3.504  1.00 26.40  ? 283  GLU A OE1   1 
ATOM   2210 O  OE2   . GLU A 1 286 ? 50.860 -28.794 -4.050  1.00 25.51  ? 283  GLU A OE2   1 
ATOM   2211 N  N     . SER A 1 287 ? 48.575 -32.582 0.189   1.00 13.82  ? 284  SER A N     1 
ATOM   2212 C  CA    . SER A 1 287 ? 47.183 -33.028 0.150   1.00 13.20  ? 284  SER A CA    1 
ATOM   2213 C  C     . SER A 1 287 ? 46.450 -32.702 1.445   1.00 13.44  ? 284  SER A C     1 
ATOM   2214 O  O     . SER A 1 287 ? 45.269 -32.330 1.417   1.00 15.06  ? 284  SER A O     1 
ATOM   2215 C  CB    . SER A 1 287 ? 47.063 -34.527 -0.190  1.00 15.94  ? 284  SER A CB    1 
ATOM   2216 O  OG    A SER A 1 287 ? 47.755 -34.836 -1.387  0.70 18.53  ? 284  SER A OG    1 
ATOM   2217 O  OG    B SER A 1 287 ? 47.853 -35.326 0.671   0.30 18.09  ? 284  SER A OG    1 
ATOM   2218 N  N     . GLN A 1 288 ? 47.128 -32.837 2.585   1.00 11.47  ? 285  GLN A N     1 
ATOM   2219 C  CA    . GLN A 1 288 ? 46.487 -32.450 3.842   1.00 12.58  ? 285  GLN A CA    1 
ATOM   2220 C  C     . GLN A 1 288 ? 46.100 -30.963 3.825   1.00 13.57  ? 285  GLN A C     1 
ATOM   2221 O  O     . GLN A 1 288 ? 44.983 -30.589 4.208   1.00 14.78  ? 285  GLN A O     1 
ATOM   2222 C  CB    . GLN A 1 288 ? 47.399 -32.732 5.039   1.00 13.52  ? 285  GLN A CB    1 
ATOM   2223 C  CG    . GLN A 1 288 ? 47.497 -34.199 5.408   1.00 16.98  ? 285  GLN A CG    1 
ATOM   2224 C  CD    . GLN A 1 288 ? 48.418 -34.412 6.587   1.00 20.79  ? 285  GLN A CD    1 
ATOM   2225 O  OE1   . GLN A 1 288 ? 49.580 -34.000 6.564   1.00 17.54  ? 285  GLN A OE1   1 
ATOM   2226 N  NE2   . GLN A 1 288 ? 47.898 -35.043 7.639   1.00 24.02  ? 285  GLN A NE2   1 
ATOM   2227 N  N     . LEU A 1 289 ? 47.021 -30.107 3.393   1.00 12.39  ? 286  LEU A N     1 
ATOM   2228 C  CA    . LEU A 1 289 ? 46.731 -28.680 3.377   1.00 10.87  ? 286  LEU A CA    1 
ATOM   2229 C  C     . LEU A 1 289 ? 45.612 -28.357 2.381   1.00 13.42  ? 286  LEU A C     1 
ATOM   2230 O  O     . LEU A 1 289 ? 44.754 -27.509 2.641   1.00 14.76  ? 286  LEU A O     1 
ATOM   2231 C  CB    . LEU A 1 289 ? 47.992 -27.869 3.078   1.00 11.19  ? 286  LEU A CB    1 
ATOM   2232 C  CG    . LEU A 1 289 ? 49.063 -28.011 4.160   1.00 12.43  ? 286  LEU A CG    1 
ATOM   2233 C  CD1   . LEU A 1 289 ? 50.303 -27.221 3.741   1.00 13.09  ? 286  LEU A CD1   1 
ATOM   2234 C  CD2   . LEU A 1 289 ? 48.525 -27.534 5.508   1.00 14.41  ? 286  LEU A CD2   1 
ATOM   2235 N  N     . GLN A 1 290 ? 45.617 -29.034 1.237   1.00 13.99  ? 287  GLN A N     1 
ATOM   2236 C  CA    . GLN A 1 290 ? 44.578 -28.809 0.241   1.00 14.25  ? 287  GLN A CA    1 
ATOM   2237 C  C     . GLN A 1 290 ? 43.218 -29.254 0.766   1.00 18.01  ? 287  GLN A C     1 
ATOM   2238 O  O     . GLN A 1 290 ? 42.175 -28.675 0.423   1.00 16.67  ? 287  GLN A O     1 
ATOM   2239 C  CB    . GLN A 1 290 ? 44.913 -29.570 -1.042  1.00 15.38  ? 287  GLN A CB    1 
ATOM   2240 C  CG    . GLN A 1 290 ? 46.074 -28.993 -1.834  1.00 14.35  ? 287  GLN A CG    1 
ATOM   2241 C  CD    . GLN A 1 290 ? 46.428 -29.855 -3.027  1.00 15.84  ? 287  GLN A CD    1 
ATOM   2242 O  OE1   . GLN A 1 290 ? 46.397 -31.086 -2.943  1.00 19.74  ? 287  GLN A OE1   1 
ATOM   2243 N  NE2   . GLN A 1 290 ? 46.768 -29.215 -4.144  1.00 20.21  ? 287  GLN A NE2   1 
ATOM   2244 N  N     . SER A 1 291 ? 43.224 -30.292 1.593   1.00 12.61  ? 288  SER A N     1 
ATOM   2245 C  CA    . SER A 1 291 ? 41.973 -30.817 2.126   1.00 14.64  ? 288  SER A CA    1 
ATOM   2246 C  C     . SER A 1 291 ? 41.258 -29.818 3.038   1.00 19.61  ? 288  SER A C     1 
ATOM   2247 O  O     . SER A 1 291 ? 40.034 -29.793 3.089   1.00 25.60  ? 288  SER A O     1 
ATOM   2248 C  CB    . SER A 1 291 ? 42.180 -32.163 2.834   1.00 21.39  ? 288  SER A CB    1 
ATOM   2249 O  OG    . SER A 1 291 ? 42.724 -31.985 4.137   1.00 23.13  ? 288  SER A OG    1 
ATOM   2250 N  N     . HIS A 1 292 ? 42.018 -28.983 3.737   1.00 18.30  ? 289  HIS A N     1 
ATOM   2251 C  CA    . HIS A 1 292 ? 41.414 -28.000 4.635   1.00 18.57  ? 289  HIS A CA    1 
ATOM   2252 C  C     . HIS A 1 292 ? 41.173 -26.642 3.985   1.00 19.51  ? 289  HIS A C     1 
ATOM   2253 O  O     . HIS A 1 292 ? 40.194 -25.960 4.289   1.00 26.34  ? 289  HIS A O     1 
ATOM   2254 C  CB    . HIS A 1 292 ? 42.290 -27.789 5.861   1.00 19.29  ? 289  HIS A CB    1 
ATOM   2255 C  CG    . HIS A 1 292 ? 42.413 -28.994 6.735   1.00 18.38  ? 289  HIS A CG    1 
ATOM   2256 N  ND1   . HIS A 1 292 ? 41.346 -29.530 7.423   1.00 23.68  ? 289  HIS A ND1   1 
ATOM   2257 C  CD2   . HIS A 1 292 ? 43.488 -29.750 7.057   1.00 22.00  ? 289  HIS A CD2   1 
ATOM   2258 C  CE1   . HIS A 1 292 ? 41.758 -30.568 8.128   1.00 25.56  ? 289  HIS A CE1   1 
ATOM   2259 N  NE2   . HIS A 1 292 ? 43.053 -30.725 7.922   1.00 24.28  ? 289  HIS A NE2   1 
ATOM   2260 N  N     . PHE A 1 293 ? 42.076 -26.235 3.100   1.00 14.05  ? 290  PHE A N     1 
ATOM   2261 C  CA    . PHE A 1 293 ? 42.096 -24.849 2.650   1.00 15.20  ? 290  PHE A CA    1 
ATOM   2262 C  C     . PHE A 1 293 ? 41.857 -24.708 1.154   1.00 18.35  ? 290  PHE A C     1 
ATOM   2263 O  O     . PHE A 1 293 ? 41.885 -23.598 0.617   1.00 21.03  ? 290  PHE A O     1 
ATOM   2264 C  CB    . PHE A 1 293 ? 43.413 -24.199 3.093   1.00 14.38  ? 290  PHE A CB    1 
ATOM   2265 C  CG    . PHE A 1 293 ? 43.731 -24.450 4.551   1.00 14.77  ? 290  PHE A CG    1 
ATOM   2266 C  CD1   . PHE A 1 293 ? 42.914 -23.921 5.548   1.00 14.59  ? 290  PHE A CD1   1 
ATOM   2267 C  CD2   . PHE A 1 293 ? 44.822 -25.230 4.926   1.00 13.94  ? 290  PHE A CD2   1 
ATOM   2268 C  CE1   . PHE A 1 293 ? 43.178 -24.171 6.892   1.00 14.37  ? 290  PHE A CE1   1 
ATOM   2269 C  CE2   . PHE A 1 293 ? 45.094 -25.485 6.268   1.00 16.35  ? 290  PHE A CE2   1 
ATOM   2270 C  CZ    . PHE A 1 293 ? 44.268 -24.952 7.252   1.00 14.57  ? 290  PHE A CZ    1 
ATOM   2271 N  N     . GLY A 1 294 ? 41.592 -25.827 0.487   1.00 15.79  ? 291  GLY A N     1 
ATOM   2272 C  CA    . GLY A 1 294 ? 41.375 -25.791 -0.946  1.00 16.47  ? 291  GLY A CA    1 
ATOM   2273 C  C     . GLY A 1 294 ? 42.630 -26.116 -1.722  1.00 18.10  ? 291  GLY A C     1 
ATOM   2274 O  O     . GLY A 1 294 ? 43.750 -26.002 -1.217  1.00 16.21  ? 291  GLY A O     1 
ATOM   2275 N  N     . GLU A 1 295 ? 42.441 -26.505 -2.975  1.00 16.19  ? 292  GLU A N     1 
ATOM   2276 C  CA    . GLU A 1 295 ? 43.544 -26.855 -3.853  1.00 15.62  ? 292  GLU A CA    1 
ATOM   2277 C  C     . GLU A 1 295 ? 44.578 -25.740 -3.980  1.00 16.39  ? 292  GLU A C     1 
ATOM   2278 O  O     . GLU A 1 295 ? 45.770 -25.972 -3.785  1.00 16.09  ? 292  GLU A O     1 
ATOM   2279 C  CB    . GLU A 1 295 ? 42.986 -27.192 -5.235  1.00 15.54  ? 292  GLU A CB    1 
ATOM   2280 C  CG    . GLU A 1 295 ? 44.025 -27.576 -6.249  1.00 19.75  ? 292  GLU A CG    1 
ATOM   2281 C  CD    . GLU A 1 295 ? 43.403 -27.861 -7.604  1.00 30.06  ? 292  GLU A CD    1 
ATOM   2282 O  OE1   . GLU A 1 295 ? 43.930 -27.351 -8.616  1.00 38.52  ? 292  GLU A OE1   1 
ATOM   2283 O  OE2   . GLU A 1 295 ? 42.383 -28.588 -7.655  1.00 29.47  ? 292  GLU A OE2   1 
ATOM   2284 N  N     . LYS A 1 296 ? 44.121 -24.532 -4.311  1.00 14.53  ? 293  LYS A N     1 
ATOM   2285 C  CA    . LYS A 1 296 ? 45.014 -23.403 -4.554  1.00 13.79  ? 293  LYS A CA    1 
ATOM   2286 C  C     . LYS A 1 296 ? 45.734 -22.971 -3.272  1.00 15.71  ? 293  LYS A C     1 
ATOM   2287 O  O     . LYS A 1 296 ? 46.965 -22.858 -3.250  1.00 16.50  ? 293  LYS A O     1 
ATOM   2288 C  CB    . LYS A 1 296 ? 44.238 -22.229 -5.172  1.00 19.08  ? 293  LYS A CB    1 
ATOM   2289 C  CG    . LYS A 1 296 ? 45.116 -21.076 -5.663  1.00 23.77  ? 293  LYS A CG    1 
ATOM   2290 C  CD    . LYS A 1 296 ? 44.283 -19.979 -6.325  1.00 28.03  ? 293  LYS A CD    1 
ATOM   2291 C  CE    . LYS A 1 296 ? 45.136 -18.746 -6.617  1.00 37.83  ? 293  LYS A CE    1 
ATOM   2292 N  NZ    . LYS A 1 296 ? 44.348 -17.659 -7.259  1.00 47.77  ? 293  LYS A NZ    1 
ATOM   2293 N  N     . ASN A 1 297 ? 44.975 -22.744 -2.207  1.00 14.75  ? 294  ASN A N     1 
ATOM   2294 C  CA    . ASN A 1 297 ? 45.574 -22.291 -0.948  1.00 14.96  ? 294  ASN A CA    1 
ATOM   2295 C  C     . ASN A 1 297 ? 46.499 -23.349 -0.374  1.00 13.33  ? 294  ASN A C     1 
ATOM   2296 O  O     . ASN A 1 297 ? 47.532 -23.023 0.216   1.00 13.42  ? 294  ASN A O     1 
ATOM   2297 C  CB    . ASN A 1 297 ? 44.513 -21.989 0.109   1.00 18.07  ? 294  ASN A CB    1 
ATOM   2298 C  CG    . ASN A 1 297 ? 43.778 -20.704 -0.136  1.00 23.06  ? 294  ASN A CG    1 
ATOM   2299 O  OD1   . ASN A 1 297 ? 44.295 -19.772 -0.756  1.00 24.25  ? 294  ASN A OD1   1 
ATOM   2300 N  ND2   . ASN A 1 297 ? 42.559 -20.630 0.386   1.00 21.76  ? 294  ASN A ND2   1 
ATOM   2301 N  N     . GLY A 1 298 ? 46.104 -24.616 -0.498  1.00 15.18  ? 295  GLY A N     1 
ATOM   2302 C  CA    . GLY A 1 298 ? 46.873 -25.709 0.083   1.00 15.13  ? 295  GLY A CA    1 
ATOM   2303 C  C     . GLY A 1 298 ? 48.233 -25.826 -0.584  1.00 14.67  ? 295  GLY A C     1 
ATOM   2304 O  O     . GLY A 1 298 ? 49.267 -25.981 0.080   1.00 13.67  ? 295  GLY A O     1 
ATOM   2305 N  N     . SER A 1 299 ? 48.243 -25.756 -1.909  1.00 12.53  ? 296  SER A N     1 
ATOM   2306 C  CA    . SER A 1 299 ? 49.500 -25.790 -2.643  1.00 12.97  ? 296  SER A CA    1 
ATOM   2307 C  C     . SER A 1 299 ? 50.346 -24.565 -2.312  1.00 12.03  ? 296  SER A C     1 
ATOM   2308 O  O     . SER A 1 299 ? 51.570 -24.663 -2.152  1.00 13.15  ? 296  SER A O     1 
ATOM   2309 C  CB    . SER A 1 299 ? 49.245 -25.867 -4.156  1.00 17.48  ? 296  SER A CB    1 
ATOM   2310 O  OG    . SER A 1 299 ? 48.738 -27.147 -4.509  1.00 17.65  ? 296  SER A OG    1 
ATOM   2311 N  N     . TRP A 1 300 ? 49.699 -23.407 -2.178  1.00 13.40  ? 297  TRP A N     1 
ATOM   2312 C  CA    . TRP A 1 300 ? 50.432 -22.185 -1.862  1.00 11.83  ? 297  TRP A CA    1 
ATOM   2313 C  C     . TRP A 1 300 ? 51.085 -22.267 -0.486  1.00 12.35  ? 297  TRP A C     1 
ATOM   2314 O  O     . TRP A 1 300 ? 52.252 -21.916 -0.330  1.00 13.08  ? 297  TRP A O     1 
ATOM   2315 C  CB    . TRP A 1 300 ? 49.505 -20.966 -1.978  1.00 14.11  ? 297  TRP A CB    1 
ATOM   2316 C  CG    . TRP A 1 300 ? 50.187 -19.662 -1.739  1.00 14.39  ? 297  TRP A CG    1 
ATOM   2317 C  CD1   . TRP A 1 300 ? 50.811 -18.879 -2.671  1.00 19.72  ? 297  TRP A CD1   1 
ATOM   2318 C  CD2   . TRP A 1 300 ? 50.288 -18.959 -0.492  1.00 13.14  ? 297  TRP A CD2   1 
ATOM   2319 N  NE1   . TRP A 1 300 ? 51.305 -17.746 -2.075  1.00 23.62  ? 297  TRP A NE1   1 
ATOM   2320 C  CE2   . TRP A 1 300 ? 51.004 -17.774 -0.738  1.00 17.11  ? 297  TRP A CE2   1 
ATOM   2321 C  CE3   . TRP A 1 300 ? 49.856 -19.230 0.811   1.00 14.99  ? 297  TRP A CE3   1 
ATOM   2322 C  CZ2   . TRP A 1 300 ? 51.289 -16.848 0.267   1.00 15.92  ? 297  TRP A CZ2   1 
ATOM   2323 C  CZ3   . TRP A 1 300 ? 50.144 -18.309 1.809   1.00 20.53  ? 297  TRP A CZ3   1 
ATOM   2324 C  CH2   . TRP A 1 300 ? 50.853 -17.139 1.529   1.00 17.77  ? 297  TRP A CH2   1 
ATOM   2325 N  N     . LEU A 1 301 ? 50.332 -22.744 0.496   1.00 12.12  ? 298  LEU A N     1 
ATOM   2326 C  CA    . LEU A 1 301 ? 50.864 -22.894 1.851   1.00 12.22  ? 298  LEU A CA    1 
ATOM   2327 C  C     . LEU A 1 301 ? 52.014 -23.901 1.909   1.00 12.27  ? 298  LEU A C     1 
ATOM   2328 O  O     . LEU A 1 301 ? 53.003 -23.685 2.604   1.00 11.76  ? 298  LEU A O     1 
ATOM   2329 C  CB    . LEU A 1 301 ? 49.757 -23.307 2.824   1.00 10.83  ? 298  LEU A CB    1 
ATOM   2330 C  CG    . LEU A 1 301 ? 48.694 -22.236 3.146   1.00 12.81  ? 298  LEU A CG    1 
ATOM   2331 C  CD1   . LEU A 1 301 ? 47.465 -22.870 3.781   1.00 15.15  ? 298  LEU A CD1   1 
ATOM   2332 C  CD2   . LEU A 1 301 ? 49.280 -21.133 4.028   1.00 14.54  ? 298  LEU A CD2   1 
ATOM   2333 N  N     . TYR A 1 302 ? 51.888 -25.003 1.177   1.00 11.00  ? 299  TYR A N     1 
ATOM   2334 C  CA    . TYR A 1 302 ? 52.903 -26.051 1.201   1.00 11.51  ? 299  TYR A CA    1 
ATOM   2335 C  C     . TYR A 1 302 ? 54.245 -25.500 0.726   1.00 12.40  ? 299  TYR A C     1 
ATOM   2336 O  O     . TYR A 1 302 ? 55.287 -25.737 1.341   1.00 11.85  ? 299  TYR A O     1 
ATOM   2337 C  CB    . TYR A 1 302 ? 52.460 -27.233 0.327   1.00 10.60  ? 299  TYR A CB    1 
ATOM   2338 C  CG    . TYR A 1 302 ? 53.461 -28.347 0.337   1.00 11.48  ? 299  TYR A CG    1 
ATOM   2339 C  CD1   . TYR A 1 302 ? 53.423 -29.316 1.324   1.00 12.59  ? 299  TYR A CD1   1 
ATOM   2340 C  CD2   . TYR A 1 302 ? 54.469 -28.409 -0.612  1.00 17.92  ? 299  TYR A CD2   1 
ATOM   2341 C  CE1   . TYR A 1 302 ? 54.350 -30.353 1.353   1.00 14.55  ? 299  TYR A CE1   1 
ATOM   2342 C  CE2   . TYR A 1 302 ? 55.413 -29.427 -0.583  1.00 18.53  ? 299  TYR A CE2   1 
ATOM   2343 C  CZ    . TYR A 1 302 ? 55.340 -30.396 0.398   1.00 20.44  ? 299  TYR A CZ    1 
ATOM   2344 O  OH    . TYR A 1 302 ? 56.267 -31.415 0.436   1.00 25.34  ? 299  TYR A OH    1 
ATOM   2345 N  N     . ALA A 1 303 ? 54.220 -24.747 -0.357  1.00 11.23  ? 300  ALA A N     1 
ATOM   2346 C  CA    . ALA A 1 303 ? 55.433 -24.130 -0.851  1.00 10.82  ? 300  ALA A CA    1 
ATOM   2347 C  C     . ALA A 1 303 ? 55.879 -22.959 0.026   1.00 10.45  ? 300  ALA A C     1 
ATOM   2348 O  O     . ALA A 1 303 ? 57.083 -22.796 0.303   1.00 11.31  ? 300  ALA A O     1 
ATOM   2349 C  CB    . ALA A 1 303 ? 55.226 -23.665 -2.296  1.00 14.70  ? 300  ALA A CB    1 
ATOM   2350 N  N     . MET A 1 304 ? 54.926 -22.128 0.440   1.00 10.89  ? 301  MET A N     1 
ATOM   2351 C  CA    . MET A 1 304 ? 55.286 -20.891 1.133   1.00 11.79  ? 301  MET A CA    1 
ATOM   2352 C  C     . MET A 1 304 ? 55.997 -21.142 2.445   1.00 11.72  ? 301  MET A C     1 
ATOM   2353 O  O     . MET A 1 304 ? 56.917 -20.397 2.809   1.00 11.46  ? 301  MET A O     1 
ATOM   2354 C  CB    . MET A 1 304 ? 54.062 -19.995 1.368   1.00 14.01  ? 301  MET A CB    1 
ATOM   2355 C  CG    . MET A 1 304 ? 54.417 -18.587 1.848   1.00 13.79  ? 301  MET A CG    1 
ATOM   2356 S  SD    . MET A 1 304 ? 55.145 -17.642 0.490   1.00 16.32  ? 301  MET A SD    1 
ATOM   2357 C  CE    . MET A 1 304 ? 56.845 -17.471 1.043   1.00 14.95  ? 301  MET A CE    1 
ATOM   2358 N  N     . CYS A 1 305 ? 55.581 -22.179 3.172   1.00 10.53  ? 302  CYS A N     1 
ATOM   2359 C  CA    . CYS A 1 305 ? 56.205 -22.443 4.473   1.00 12.10  ? 302  CYS A CA    1 
ATOM   2360 C  C     . CYS A 1 305 ? 57.649 -22.928 4.308   1.00 11.57  ? 302  CYS A C     1 
ATOM   2361 O  O     . CYS A 1 305 ? 58.405 -22.984 5.283   1.00 13.49  ? 302  CYS A O     1 
ATOM   2362 C  CB    . CYS A 1 305 ? 55.379 -23.430 5.314   1.00 11.74  ? 302  CYS A CB    1 
ATOM   2363 S  SG    . CYS A 1 305 ? 55.409 -25.112 4.718   1.00 11.88  ? 302  CYS A SG    1 
ATOM   2364 N  N     . ARG A 1 306 ? 58.028 -23.249 3.070   1.00 10.31  ? 303  ARG A N     1 
ATOM   2365 C  CA    . ARG A 1 306 ? 59.400 -23.631 2.731   1.00 11.04  ? 303  ARG A CA    1 
ATOM   2366 C  C     . ARG A 1 306 ? 60.160 -22.477 2.052   1.00 11.16  ? 303  ARG A C     1 
ATOM   2367 O  O     . ARG A 1 306 ? 61.309 -22.656 1.606   1.00 15.93  ? 303  ARG A O     1 
ATOM   2368 C  CB    . ARG A 1 306 ? 59.393 -24.877 1.826   1.00 11.89  ? 303  ARG A CB    1 
ATOM   2369 C  CG    . ARG A 1 306 ? 58.891 -26.126 2.524   1.00 10.49  ? 303  ARG A CG    1 
ATOM   2370 C  CD    . ARG A 1 306 ? 58.528 -27.280 1.567   1.00 14.06  ? 303  ARG A CD    1 
ATOM   2371 N  NE    . ARG A 1 306 ? 58.322 -28.491 2.358   1.00 15.86  ? 303  ARG A NE    1 
ATOM   2372 C  CZ    . ARG A 1 306 ? 57.225 -28.752 3.065   1.00 12.71  ? 303  ARG A CZ    1 
ATOM   2373 N  NH1   . ARG A 1 306 ? 57.151 -29.859 3.793   1.00 13.60  ? 303  ARG A NH1   1 
ATOM   2374 N  NH2   . ARG A 1 306 ? 56.189 -27.927 3.037   1.00 11.60  ? 303  ARG A NH2   1 
ATOM   2375 N  N     . GLY A 1 307 ? 59.526 -21.308 1.991   1.00 11.15  ? 304  GLY A N     1 
ATOM   2376 C  CA    . GLY A 1 307 ? 60.144 -20.105 1.447   1.00 11.62  ? 304  GLY A CA    1 
ATOM   2377 C  C     . GLY A 1 307 ? 59.957 -19.929 -0.052  1.00 13.05  ? 304  GLY A C     1 
ATOM   2378 O  O     . GLY A 1 307 ? 60.632 -19.104 -0.678  1.00 13.34  ? 304  GLY A O     1 
ATOM   2379 N  N     . ILE A 1 308 ? 59.050 -20.707 -0.626  1.00 11.57  ? 305  ILE A N     1 
ATOM   2380 C  CA    . ILE A 1 308 ? 58.877 -20.791 -2.079  1.00 12.22  ? 305  ILE A CA    1 
ATOM   2381 C  C     . ILE A 1 308 ? 57.521 -20.230 -2.498  1.00 13.31  ? 305  ILE A C     1 
ATOM   2382 O  O     . ILE A 1 308 ? 56.498 -20.625 -1.957  1.00 13.93  ? 305  ILE A O     1 
ATOM   2383 C  CB    . ILE A 1 308 ? 58.974 -22.244 -2.547  1.00 16.49  ? 305  ILE A CB    1 
ATOM   2384 C  CG1   . ILE A 1 308 ? 60.351 -22.800 -2.184  1.00 15.14  ? 305  ILE A CG1   1 
ATOM   2385 C  CG2   . ILE A 1 308 ? 58.714 -22.336 -4.045  1.00 14.97  ? 305  ILE A CG2   1 
ATOM   2386 C  CD1   . ILE A 1 308 ? 60.502 -24.321 -2.387  1.00 18.85  ? 305  ILE A CD1   1 
ATOM   2387 N  N     . GLU A 1 309 ? 57.522 -19.287 -3.441  1.00 10.40  ? 306  GLU A N     1 
ATOM   2388 C  CA    . GLU A 1 309 ? 56.282 -18.746 -3.990  1.00 16.32  ? 306  GLU A CA    1 
ATOM   2389 C  C     . GLU A 1 309 ? 56.576 -18.303 -5.410  1.00 17.42  ? 306  GLU A C     1 
ATOM   2390 O  O     . GLU A 1 309 ? 57.687 -17.864 -5.703  1.00 17.12  ? 306  GLU A O     1 
ATOM   2391 C  CB    . GLU A 1 309 ? 55.776 -17.557 -3.187  1.00 25.61  ? 306  GLU A CB    1 
ATOM   2392 C  CG    . GLU A 1 309 ? 54.480 -17.035 -3.759  1.00 36.92  ? 306  GLU A CG    1 
ATOM   2393 C  CD    . GLU A 1 309 ? 54.189 -15.603 -3.400  1.00 32.33  ? 306  GLU A CD    1 
ATOM   2394 O  OE1   . GLU A 1 309 ? 55.121 -14.759 -3.395  1.00 20.43  ? 306  GLU A OE1   1 
ATOM   2395 O  OE2   . GLU A 1 309 ? 53.007 -15.327 -3.126  1.00 36.48  ? 306  GLU A OE2   1 
ATOM   2396 N  N     . HIS A 1 310 ? 55.593 -18.414 -6.296  1.00 25.44  ? 307  HIS A N     1 
ATOM   2397 C  CA    . HIS A 1 310 ? 55.842 -18.151 -7.711  1.00 22.68  ? 307  HIS A CA    1 
ATOM   2398 C  C     . HIS A 1 310 ? 55.079 -16.962 -8.287  1.00 18.65  ? 307  HIS A C     1 
ATOM   2399 O  O     . HIS A 1 310 ? 55.180 -16.697 -9.483  1.00 27.42  ? 307  HIS A O     1 
ATOM   2400 C  CB    . HIS A 1 310 ? 55.540 -19.401 -8.537  1.00 31.25  ? 307  HIS A CB    1 
ATOM   2401 C  CG    . HIS A 1 310 ? 56.397 -20.574 -8.177  1.00 42.88  ? 307  HIS A CG    1 
ATOM   2402 N  ND1   . HIS A 1 310 ? 57.767 -20.483 -8.056  1.00 44.09  ? 307  HIS A ND1   1 
ATOM   2403 C  CD2   . HIS A 1 310 ? 56.079 -21.862 -7.906  1.00 46.78  ? 307  HIS A CD2   1 
ATOM   2404 C  CE1   . HIS A 1 310 ? 58.257 -21.665 -7.727  1.00 43.97  ? 307  HIS A CE1   1 
ATOM   2405 N  NE2   . HIS A 1 310 ? 57.254 -22.519 -7.630  1.00 46.46  ? 307  HIS A NE2   1 
ATOM   2406 N  N     . ASP A 1 311 ? 54.327 -16.240 -7.463  1.00 18.93  ? 308  ASP A N     1 
ATOM   2407 C  CA    . ASP A 1 311 ? 53.506 -15.147 -7.989  1.00 21.63  ? 308  ASP A CA    1 
ATOM   2408 C  C     . ASP A 1 311 ? 54.396 -14.117 -8.690  1.00 20.54  ? 308  ASP A C     1 
ATOM   2409 O  O     . ASP A 1 311 ? 55.309 -13.571 -8.077  1.00 18.45  ? 308  ASP A O     1 
ATOM   2410 C  CB    . ASP A 1 311 ? 52.712 -14.488 -6.863  1.00 24.43  ? 308  ASP A CB    1 
ATOM   2411 C  CG    . ASP A 1 311 ? 51.789 -13.382 -7.367  1.00 31.10  ? 308  ASP A CG    1 
ATOM   2412 O  OD1   . ASP A 1 311 ? 51.692 -12.334 -6.705  1.00 30.58  ? 308  ASP A OD1   1 
ATOM   2413 O  OD2   . ASP A 1 311 ? 51.151 -13.572 -8.424  1.00 38.23  ? 308  ASP A OD2   1 
ATOM   2414 N  N     . PRO A 1 312 ? 54.141 -13.845 -9.979  1.00 16.78  ? 309  PRO A N     1 
ATOM   2415 C  CA    . PRO A 1 312 ? 55.042 -12.933 -10.687 1.00 21.27  ? 309  PRO A CA    1 
ATOM   2416 C  C     . PRO A 1 312 ? 54.881 -11.473 -10.293 1.00 15.43  ? 309  PRO A C     1 
ATOM   2417 O  O     . PRO A 1 312 ? 53.819 -11.031 -9.849  1.00 16.19  ? 309  PRO A O     1 
ATOM   2418 C  CB    . PRO A 1 312 ? 54.647 -13.125 -12.159 1.00 20.46  ? 309  PRO A CB    1 
ATOM   2419 C  CG    . PRO A 1 312 ? 53.237 -13.596 -12.105 1.00 22.96  ? 309  PRO A CG    1 
ATOM   2420 C  CD    . PRO A 1 312 ? 53.148 -14.460 -10.881 1.00 18.47  ? 309  PRO A CD    1 
ATOM   2421 N  N     . VAL A 1 313 ? 55.961 -10.712 -10.446 1.00 17.01  ? 310  VAL A N     1 
ATOM   2422 C  CA    . VAL A 1 313 ? 55.890 -9.261  -10.391 1.00 15.81  ? 310  VAL A CA    1 
ATOM   2423 C  C     . VAL A 1 313 ? 55.226 -8.810  -11.688 1.00 14.15  ? 310  VAL A C     1 
ATOM   2424 O  O     . VAL A 1 313 ? 55.790 -8.987  -12.766 1.00 17.99  ? 310  VAL A O     1 
ATOM   2425 C  CB    . VAL A 1 313 ? 57.302 -8.666  -10.299 1.00 17.85  ? 310  VAL A CB    1 
ATOM   2426 C  CG1   . VAL A 1 313 ? 57.255 -7.154  -10.350 1.00 15.93  ? 310  VAL A CG1   1 
ATOM   2427 C  CG2   . VAL A 1 313 ? 58.010 -9.162  -9.026  1.00 17.01  ? 310  VAL A CG2   1 
ATOM   2428 N  N     . LYS A 1 314 ? 54.008 -8.297  -11.577 1.00 15.91  ? 311  LYS A N     1 
ATOM   2429 C  CA    . LYS A 1 314 ? 53.234 -7.899  -12.751 1.00 18.54  ? 311  LYS A CA    1 
ATOM   2430 C  C     . LYS A 1 314 ? 53.740 -6.568  -13.293 1.00 15.35  ? 311  LYS A C     1 
ATOM   2431 O  O     . LYS A 1 314 ? 53.962 -5.629  -12.535 1.00 19.11  ? 311  LYS A O     1 
ATOM   2432 C  CB    . LYS A 1 314 ? 51.761 -7.743  -12.381 1.00 19.74  ? 311  LYS A CB    1 
ATOM   2433 C  CG    . LYS A 1 314 ? 51.205 -8.838  -11.481 1.00 31.19  ? 311  LYS A CG    1 
ATOM   2434 C  CD    . LYS A 1 314 ? 51.085 -10.152 -12.205 1.00 35.76  ? 311  LYS A CD    1 
ATOM   2435 C  CE    . LYS A 1 314 ? 50.353 -11.182 -11.354 1.00 36.15  ? 311  LYS A CE    1 
ATOM   2436 N  NZ    . LYS A 1 314 ? 51.006 -11.422 -10.027 1.00 34.67  ? 311  LYS A NZ    1 
ATOM   2437 N  N     . PRO A 1 315 ? 53.911 -6.473  -14.616 1.00 13.74  ? 312  PRO A N     1 
ATOM   2438 C  CA    . PRO A 1 315 ? 54.316 -5.204  -15.226 1.00 14.96  ? 312  PRO A CA    1 
ATOM   2439 C  C     . PRO A 1 315 ? 53.150 -4.226  -15.242 1.00 19.21  ? 312  PRO A C     1 
ATOM   2440 O  O     . PRO A 1 315 ? 52.443 -4.099  -16.249 1.00 20.95  ? 312  PRO A O     1 
ATOM   2441 C  CB    . PRO A 1 315 ? 54.697 -5.612  -16.650 1.00 20.15  ? 312  PRO A CB    1 
ATOM   2442 C  CG    . PRO A 1 315 ? 53.849 -6.815  -16.929 1.00 21.42  ? 312  PRO A CG    1 
ATOM   2443 C  CD    . PRO A 1 315 ? 53.741 -7.544  -15.613 1.00 18.58  ? 312  PRO A CD    1 
ATOM   2444 N  N     . ARG A 1 316 ? 52.943 -3.544  -14.120 1.00 15.11  ? 313  ARG A N     1 
ATOM   2445 C  CA    . ARG A 1 316 ? 51.855 -2.584  -14.002 1.00 14.26  ? 313  ARG A CA    1 
ATOM   2446 C  C     . ARG A 1 316 ? 52.219 -1.471  -13.034 1.00 18.10  ? 313  ARG A C     1 
ATOM   2447 O  O     . ARG A 1 316 ? 52.303 -1.694  -11.832 1.00 21.18  ? 313  ARG A O     1 
ATOM   2448 C  CB    . ARG A 1 316 ? 50.577 -3.267  -13.539 1.00 18.98  ? 313  ARG A CB    1 
ATOM   2449 C  CG    . ARG A 1 316 ? 49.400 -2.314  -13.436 1.00 20.43  ? 313  ARG A CG    1 
ATOM   2450 C  CD    . ARG A 1 316 ? 48.168 -3.030  -12.951 1.00 23.48  ? 313  ARG A CD    1 
ATOM   2451 N  NE    . ARG A 1 316 ? 48.368 -3.583  -11.618 1.00 26.53  ? 313  ARG A NE    1 
ATOM   2452 C  CZ    . ARG A 1 316 ? 48.412 -2.868  -10.498 1.00 28.90  ? 313  ARG A CZ    1 
ATOM   2453 N  NH1   . ARG A 1 316 ? 48.277 -1.542  -10.533 1.00 24.67  ? 313  ARG A NH1   1 
ATOM   2454 N  NH2   . ARG A 1 316 ? 48.598 -3.483  -9.333  1.00 32.59  ? 313  ARG A NH2   1 
ATOM   2455 N  N     . GLN A 1 317 ? 52.411 -0.273  -13.569 1.00 16.32  ? 314  GLN A N     1 
ATOM   2456 C  CA    . GLN A 1 317 ? 52.818 0.878   -12.780 1.00 20.22  ? 314  GLN A CA    1 
ATOM   2457 C  C     . GLN A 1 317 ? 51.626 1.767   -12.415 1.00 22.24  ? 314  GLN A C     1 
ATOM   2458 O  O     . GLN A 1 317 ? 51.693 2.568   -11.477 1.00 20.53  ? 314  GLN A O     1 
ATOM   2459 C  CB    . GLN A 1 317 ? 53.855 1.675   -13.566 1.00 30.34  ? 314  GLN A CB    1 
ATOM   2460 C  CG    . GLN A 1 317 ? 54.418 2.849   -12.827 1.00 37.53  ? 314  GLN A CG    1 
ATOM   2461 C  CD    . GLN A 1 317 ? 55.492 3.551   -13.612 1.00 31.21  ? 314  GLN A CD    1 
ATOM   2462 O  OE1   . GLN A 1 317 ? 55.953 3.058   -14.647 1.00 40.39  ? 314  GLN A OE1   1 
ATOM   2463 N  NE2   . GLN A 1 317 ? 55.903 4.707   -13.128 1.00 33.07  ? 314  GLN A NE2   1 
ATOM   2464 N  N     . LEU A 1 318 ? 50.525 1.617   -13.144 1.00 15.88  ? 315  LEU A N     1 
ATOM   2465 C  CA    . LEU A 1 318 ? 49.357 2.467   -12.923 1.00 16.46  ? 315  LEU A CA    1 
ATOM   2466 C  C     . LEU A 1 318 ? 48.228 1.687   -12.267 1.00 14.20  ? 315  LEU A C     1 
ATOM   2467 O  O     . LEU A 1 318 ? 48.050 0.504   -12.531 1.00 15.15  ? 315  LEU A O     1 
ATOM   2468 C  CB    . LEU A 1 318 ? 48.839 2.998   -14.261 1.00 13.83  ? 315  LEU A CB    1 
ATOM   2469 C  CG    . LEU A 1 318 ? 49.801 3.784   -15.145 1.00 17.47  ? 315  LEU A CG    1 
ATOM   2470 C  CD1   . LEU A 1 318 ? 49.134 4.099   -16.485 1.00 22.29  ? 315  LEU A CD1   1 
ATOM   2471 C  CD2   . LEU A 1 318 ? 50.283 5.068   -14.461 1.00 18.69  ? 315  LEU A CD2   1 
ATOM   2472 N  N     . PRO A 1 319 ? 47.429 2.354   -11.428 1.00 14.93  ? 316  PRO A N     1 
ATOM   2473 C  CA    . PRO A 1 319 ? 46.258 1.671   -10.866 1.00 13.67  ? 316  PRO A CA    1 
ATOM   2474 C  C     . PRO A 1 319 ? 45.251 1.240   -11.944 1.00 15.68  ? 316  PRO A C     1 
ATOM   2475 O  O     . PRO A 1 319 ? 45.152 1.903   -12.973 1.00 17.68  ? 316  PRO A O     1 
ATOM   2476 C  CB    . PRO A 1 319 ? 45.663 2.707   -9.906  1.00 16.78  ? 316  PRO A CB    1 
ATOM   2477 C  CG    . PRO A 1 319 ? 46.259 3.998   -10.296 1.00 20.11  ? 316  PRO A CG    1 
ATOM   2478 C  CD    . PRO A 1 319 ? 47.567 3.742   -10.951 1.00 15.30  ? 316  PRO A CD    1 
ATOM   2479 N  N     . LYS A 1 320 ? 44.544 0.140   -11.705 1.00 15.48  ? 317  LYS A N     1 
ATOM   2480 C  CA    . LYS A 1 320 ? 43.583 -0.433  -12.652 1.00 16.80  ? 317  LYS A CA    1 
ATOM   2481 C  C     . LYS A 1 320 ? 42.197 0.170   -12.482 1.00 17.93  ? 317  LYS A C     1 
ATOM   2482 O  O     . LYS A 1 320 ? 41.300 -0.083  -13.291 1.00 17.90  ? 317  LYS A O     1 
ATOM   2483 C  CB    . LYS A 1 320 ? 43.429 -1.946  -12.418 1.00 22.81  ? 317  LYS A CB    1 
ATOM   2484 C  CG    . LYS A 1 320 ? 44.647 -2.807  -12.680 1.00 30.25  ? 317  LYS A CG    1 
ATOM   2485 C  CD    . LYS A 1 320 ? 44.274 -4.281  -12.481 1.00 36.67  ? 317  LYS A CD    1 
ATOM   2486 C  CE    . LYS A 1 320 ? 45.390 -5.216  -12.906 1.00 47.25  ? 317  LYS A CE    1 
ATOM   2487 N  NZ    . LYS A 1 320 ? 44.956 -6.638  -12.820 1.00 48.64  ? 317  LYS A NZ    1 
ATOM   2488 N  N     . THR A 1 321 ? 42.008 0.900   -11.387 1.00 16.96  ? 318  THR A N     1 
ATOM   2489 C  CA    . THR A 1 321 ? 40.727 1.532   -11.093 1.00 17.36  ? 318  THR A CA    1 
ATOM   2490 C  C     . THR A 1 321 ? 40.965 2.907   -10.492 1.00 15.37  ? 318  THR A C     1 
ATOM   2491 O  O     . THR A 1 321 ? 42.025 3.180   -9.909  1.00 19.18  ? 318  THR A O     1 
ATOM   2492 C  CB    . THR A 1 321 ? 39.852 0.691   -10.128 1.00 22.96  ? 318  THR A CB    1 
ATOM   2493 O  OG1   . THR A 1 321 ? 40.553 0.480   -8.897  1.00 20.70  ? 318  THR A OG1   1 
ATOM   2494 C  CG2   . THR A 1 321 ? 39.478 -0.649  -10.744 1.00 18.65  ? 318  THR A CG2   1 
ATOM   2495 N  N     . ILE A 1 322 ? 39.988 3.785   -10.685 1.00 13.81  ? 319  ILE A N     1 
ATOM   2496 C  CA    . ILE A 1 322 ? 40.040 5.129   -10.140 1.00 14.14  ? 319  ILE A CA    1 
ATOM   2497 C  C     . ILE A 1 322 ? 38.700 5.365   -9.460  1.00 14.47  ? 319  ILE A C     1 
ATOM   2498 O  O     . ILE A 1 322 ? 37.651 5.362   -10.112 1.00 15.96  ? 319  ILE A O     1 
ATOM   2499 C  CB    . ILE A 1 322 ? 40.275 6.161   -11.247 1.00 11.78  ? 319  ILE A CB    1 
ATOM   2500 C  CG1   . ILE A 1 322 ? 41.663 5.948   -11.874 1.00 16.25  ? 319  ILE A CG1   1 
ATOM   2501 C  CG2   . ILE A 1 322 ? 40.126 7.582   -10.698 1.00 17.23  ? 319  ILE A CG2   1 
ATOM   2502 C  CD1   . ILE A 1 322 ? 42.006 6.944   -12.986 1.00 16.59  ? 319  ILE A CD1   1 
ATOM   2503 N  N     . GLY A 1 323 ? 38.725 5.518   -8.142  1.00 12.53  ? 320  GLY A N     1 
ATOM   2504 C  CA    . GLY A 1 323 ? 37.495 5.558   -7.387  1.00 13.85  ? 320  GLY A CA    1 
ATOM   2505 C  C     . GLY A 1 323 ? 37.445 6.630   -6.324  1.00 13.44  ? 320  GLY A C     1 
ATOM   2506 O  O     . GLY A 1 323 ? 38.469 7.168   -5.910  1.00 15.63  ? 320  GLY A O     1 
ATOM   2507 N  N     . CYS A 1 324 ? 36.237 6.910   -5.859  1.00 14.91  ? 321  CYS A N     1 
ATOM   2508 C  CA    B CYS A 1 324 ? 35.969 7.973   -4.880  0.37 18.80  ? 321  CYS A CA    1 
ATOM   2509 C  CA    C CYS A 1 324 ? 36.104 7.799   -4.730  0.63 18.72  ? 321  CYS A CA    1 
ATOM   2510 C  C     . CYS A 1 324 ? 34.839 7.512   -3.971  1.00 16.90  ? 321  CYS A C     1 
ATOM   2511 O  O     . CYS A 1 324 ? 33.843 6.997   -4.487  1.00 18.13  ? 321  CYS A O     1 
ATOM   2512 C  CB    B CYS A 1 324 ? 35.466 9.249   -5.577  0.37 21.99  ? 321  CYS A CB    1 
ATOM   2513 C  CB    C CYS A 1 324 ? 36.164 9.250   -5.166  0.63 21.35  ? 321  CYS A CB    1 
ATOM   2514 S  SG    B CYS A 1 324 ? 36.458 10.013  -6.897  0.37 20.36  ? 321  CYS A SG    1 
ATOM   2515 S  SG    C CYS A 1 324 ? 34.862 9.672   -6.300  0.63 24.48  ? 321  CYS A SG    1 
ATOM   2516 N  N     . SER A 1 325 ? 34.925 7.775   -2.680  1.00 16.69  ? 322  SER A N     1 
ATOM   2517 C  CA    A SER A 1 325 ? 33.838 7.348   -1.806  0.50 16.99  ? 322  SER A CA    1 
ATOM   2518 C  CA    B SER A 1 325 ? 33.981 7.255   -1.732  0.50 17.94  ? 322  SER A CA    1 
ATOM   2519 C  C     . SER A 1 325 ? 33.726 8.231   -0.580  1.00 14.26  ? 322  SER A C     1 
ATOM   2520 O  O     . SER A 1 325 ? 34.632 8.990   -0.213  1.00 16.61  ? 322  SER A O     1 
ATOM   2521 C  CB    A SER A 1 325 ? 34.022 5.887   -1.379  0.50 19.26  ? 322  SER A CB    1 
ATOM   2522 C  CB    B SER A 1 325 ? 34.459 5.911   -1.185  0.50 20.08  ? 322  SER A CB    1 
ATOM   2523 O  OG    A SER A 1 325 ? 35.112 5.749   -0.482  0.50 17.77  ? 322  SER A OG    1 
ATOM   2524 O  OG    B SER A 1 325 ? 33.523 5.395   -0.259  0.50 19.02  ? 322  SER A OG    1 
ATOM   2525 N  N     . LYS A 1 326 ? 32.549 8.159   0.023   1.00 15.98  ? 323  LYS A N     1 
ATOM   2526 C  CA    . LYS A 1 326 ? 32.263 8.924   1.224   1.00 16.60  ? 323  LYS A CA    1 
ATOM   2527 C  C     . LYS A 1 326 ? 31.356 8.110   2.124   1.00 16.89  ? 323  LYS A C     1 
ATOM   2528 O  O     . LYS A 1 326 ? 30.329 7.597   1.678   1.00 19.42  ? 323  LYS A O     1 
ATOM   2529 C  CB    . LYS A 1 326 ? 31.585 10.250  0.877   1.00 19.42  ? 323  LYS A CB    1 
ATOM   2530 C  CG    . LYS A 1 326 ? 31.281 11.127  2.095   1.00 18.61  ? 323  LYS A CG    1 
ATOM   2531 C  CD    . LYS A 1 326 ? 32.520 11.877  2.544   1.00 22.11  ? 323  LYS A CD    1 
ATOM   2532 C  CE    . LYS A 1 326 ? 32.398 12.403  3.974   1.00 23.52  ? 323  LYS A CE    1 
ATOM   2533 N  NZ    . LYS A 1 326 ? 32.645 11.333  5.002   1.00 18.19  ? 323  LYS A NZ    1 
ATOM   2534 N  N     . ASN A 1 327 ? 31.728 8.005   3.397   1.00 16.86  ? 324  ASN A N     1 
ATOM   2535 C  CA    . ASN A 1 327 ? 30.847 7.435   4.410   1.00 20.34  ? 324  ASN A CA    1 
ATOM   2536 C  C     . ASN A 1 327 ? 29.954 8.496   5.024   1.00 25.44  ? 324  ASN A C     1 
ATOM   2537 O  O     . ASN A 1 327 ? 30.311 9.675   5.046   1.00 22.52  ? 324  ASN A O     1 
ATOM   2538 C  CB    . ASN A 1 327 ? 31.655 6.848   5.561   1.00 28.55  ? 324  ASN A CB    1 
ATOM   2539 C  CG    . ASN A 1 327 ? 32.348 5.571   5.203   1.00 30.67  ? 324  ASN A CG    1 
ATOM   2540 O  OD1   . ASN A 1 327 ? 32.064 4.947   4.178   1.00 35.58  ? 324  ASN A OD1   1 
ATOM   2541 N  ND2   . ASN A 1 327 ? 33.260 5.150   6.071   1.00 33.98  ? 324  ASN A ND2   1 
ATOM   2542 N  N     . PHE A 1 328 ? 28.823 8.052   5.565   1.00 27.29  ? 325  PHE A N     1 
ATOM   2543 C  CA    . PHE A 1 328 ? 27.882 8.926   6.259   1.00 30.47  ? 325  PHE A CA    1 
ATOM   2544 C  C     . PHE A 1 328 ? 27.490 8.297   7.588   1.00 34.83  ? 325  PHE A C     1 
ATOM   2545 O  O     . PHE A 1 328 ? 26.477 7.600   7.685   1.00 39.53  ? 325  PHE A O     1 
ATOM   2546 C  CB    . PHE A 1 328 ? 26.666 9.191   5.370   1.00 32.65  ? 325  PHE A CB    1 
ATOM   2547 C  CG    . PHE A 1 328 ? 27.034 9.741   4.027   1.00 31.23  ? 325  PHE A CG    1 
ATOM   2548 C  CD1   . PHE A 1 328 ? 27.193 8.899   2.937   1.00 27.67  ? 325  PHE A CD1   1 
ATOM   2549 C  CD2   . PHE A 1 328 ? 27.276 11.093  3.861   1.00 28.94  ? 325  PHE A CD2   1 
ATOM   2550 C  CE1   . PHE A 1 328 ? 27.566 9.401   1.699   1.00 28.15  ? 325  PHE A CE1   1 
ATOM   2551 C  CE2   . PHE A 1 328 ? 27.640 11.601  2.631   1.00 27.87  ? 325  PHE A CE2   1 
ATOM   2552 C  CZ    . PHE A 1 328 ? 27.790 10.750  1.542   1.00 29.25  ? 325  PHE A CZ    1 
ATOM   2553 N  N     . PRO A 1 329 ? 28.309 8.543   8.622   1.00 33.10  ? 326  PRO A N     1 
ATOM   2554 C  CA    . PRO A 1 329 ? 28.216 7.889   9.931   1.00 41.39  ? 326  PRO A CA    1 
ATOM   2555 C  C     . PRO A 1 329 ? 27.073 8.395   10.800  1.00 48.68  ? 326  PRO A C     1 
ATOM   2556 O  O     . PRO A 1 329 ? 26.750 9.585   10.781  1.00 46.20  ? 326  PRO A O     1 
ATOM   2557 C  CB    . PRO A 1 329 ? 29.551 8.242   10.585  1.00 39.56  ? 326  PRO A CB    1 
ATOM   2558 C  CG    . PRO A 1 329 ? 29.924 9.548   9.972   1.00 36.48  ? 326  PRO A CG    1 
ATOM   2559 C  CD    . PRO A 1 329 ? 29.458 9.463   8.547   1.00 33.01  ? 326  PRO A CD    1 
ATOM   2560 N  N     . GLY A 1 330 ? 26.484 7.477   11.561  1.00 51.58  ? 327  GLY A N     1 
ATOM   2561 C  CA    . GLY A 1 330 ? 25.451 7.799   12.527  1.00 54.35  ? 327  GLY A CA    1 
ATOM   2562 C  C     . GLY A 1 330 ? 24.388 8.743   12.009  1.00 59.27  ? 327  GLY A C     1 
ATOM   2563 O  O     . GLY A 1 330 ? 23.558 8.374   11.178  1.00 58.12  ? 327  GLY A O     1 
ATOM   2564 N  N     . LYS A 1 331 ? 24.432 9.975   12.500  1.00 67.01  ? 328  LYS A N     1 
ATOM   2565 C  CA    . LYS A 1 331 ? 23.385 10.957  12.251  1.00 75.03  ? 328  LYS A CA    1 
ATOM   2566 C  C     . LYS A 1 331 ? 23.331 11.446  10.806  1.00 61.03  ? 328  LYS A C     1 
ATOM   2567 O  O     . LYS A 1 331 ? 22.284 11.890  10.336  1.00 60.46  ? 328  LYS A O     1 
ATOM   2568 C  CB    . LYS A 1 331 ? 23.571 12.141  13.204  1.00 91.10  ? 328  LYS A CB    1 
ATOM   2569 C  CG    . LYS A 1 331 ? 22.561 13.258  13.045  1.00 105.17 ? 328  LYS A CG    1 
ATOM   2570 C  CD    . LYS A 1 331 ? 22.771 14.322  14.108  1.00 114.24 ? 328  LYS A CD    1 
ATOM   2571 C  CE    . LYS A 1 331 ? 21.857 15.509  13.885  1.00 120.96 ? 328  LYS A CE    1 
ATOM   2572 N  NZ    . LYS A 1 331 ? 22.122 16.151  12.570  1.00 122.34 ? 328  LYS A NZ    1 
ATOM   2573 N  N     . THR A 1 332 ? 24.452 11.355  10.100  1.00 46.14  ? 329  THR A N     1 
ATOM   2574 C  CA    . THR A 1 332 ? 24.547 11.947  8.768   1.00 42.31  ? 329  THR A CA    1 
ATOM   2575 C  C     . THR A 1 332 ? 24.062 11.027  7.649   1.00 34.36  ? 329  THR A C     1 
ATOM   2576 O  O     . THR A 1 332 ? 24.127 11.394  6.480   1.00 39.29  ? 329  THR A O     1 
ATOM   2577 C  CB    . THR A 1 332 ? 25.983 12.420  8.446   1.00 44.00  ? 329  THR A CB    1 
ATOM   2578 O  OG1   . THR A 1 332 ? 26.829 11.285  8.225   1.00 42.39  ? 329  THR A OG1   1 
ATOM   2579 C  CG2   . THR A 1 332 ? 26.540 13.261  9.589   1.00 43.96  ? 329  THR A CG2   1 
ATOM   2580 N  N     . ALA A 1 333 ? 23.572 9.843   7.999   1.00 39.18  ? 330  ALA A N     1 
ATOM   2581 C  CA    . ALA A 1 333 ? 23.097 8.911   6.980   1.00 35.98  ? 330  ALA A CA    1 
ATOM   2582 C  C     . ALA A 1 333 ? 22.073 9.575   6.059   1.00 35.94  ? 330  ALA A C     1 
ATOM   2583 O  O     . ALA A 1 333 ? 21.128 10.212  6.524   1.00 39.53  ? 330  ALA A O     1 
ATOM   2584 C  CB    . ALA A 1 333 ? 22.526 7.651   7.616   1.00 39.97  ? 330  ALA A CB    1 
ATOM   2585 N  N     . LEU A 1 334 ? 22.271 9.422   4.752   1.00 36.56  ? 331  LEU A N     1 
ATOM   2586 C  CA    . LEU A 1 334 ? 21.445 10.106  3.759   1.00 38.69  ? 331  LEU A CA    1 
ATOM   2587 C  C     . LEU A 1 334 ? 20.012 9.573   3.718   1.00 40.69  ? 331  LEU A C     1 
ATOM   2588 O  O     . LEU A 1 334 ? 19.764 8.447   3.280   1.00 45.32  ? 331  LEU A O     1 
ATOM   2589 C  CB    . LEU A 1 334 ? 22.086 10.012  2.375   1.00 31.92  ? 331  LEU A CB    1 
ATOM   2590 C  CG    . LEU A 1 334 ? 23.566 10.405  2.335   1.00 28.08  ? 331  LEU A CG    1 
ATOM   2591 C  CD1   . LEU A 1 334 ? 24.112 10.316  0.919   1.00 26.77  ? 331  LEU A CD1   1 
ATOM   2592 C  CD2   . LEU A 1 334 ? 23.786 11.799  2.916   1.00 33.37  ? 331  LEU A CD2   1 
ATOM   2593 N  N     . ALA A 1 335 ? 19.072 10.398  4.165   1.00 42.54  ? 332  ALA A N     1 
ATOM   2594 C  CA    . ALA A 1 335 ? 17.679 9.974   4.296   1.00 44.94  ? 332  ALA A CA    1 
ATOM   2595 C  C     . ALA A 1 335 ? 16.738 10.707  3.343   1.00 46.10  ? 332  ALA A C     1 
ATOM   2596 O  O     . ALA A 1 335 ? 15.517 10.575  3.446   1.00 49.11  ? 332  ALA A O     1 
ATOM   2597 C  CB    . ALA A 1 335 ? 17.215 10.149  5.734   1.00 48.50  ? 332  ALA A CB    1 
ATOM   2598 N  N     . THR A 1 336 ? 17.301 11.481  2.420   1.00 40.02  ? 333  THR A N     1 
ATOM   2599 C  CA    . THR A 1 336 ? 16.497 12.146  1.399   1.00 50.38  ? 333  THR A CA    1 
ATOM   2600 C  C     . THR A 1 336 ? 17.109 11.931  0.022   1.00 48.33  ? 333  THR A C     1 
ATOM   2601 O  O     . THR A 1 336 ? 18.327 11.793  -0.109  1.00 44.60  ? 333  THR A O     1 
ATOM   2602 C  CB    . THR A 1 336 ? 16.368 13.657  1.659   1.00 51.19  ? 333  THR A CB    1 
ATOM   2603 O  OG1   . THR A 1 336 ? 17.657 14.271  1.578   1.00 43.66  ? 333  THR A OG1   1 
ATOM   2604 C  CG2   . THR A 1 336 ? 15.770 13.924  3.039   1.00 51.94  ? 333  THR A CG2   1 
ATOM   2605 N  N     . ARG A 1 337 ? 16.263 11.898  -1.003  1.00 50.87  ? 334  ARG A N     1 
ATOM   2606 C  CA    . ARG A 1 337 ? 16.735 11.716  -2.372  1.00 51.33  ? 334  ARG A CA    1 
ATOM   2607 C  C     . ARG A 1 337 ? 17.667 12.852  -2.791  1.00 46.93  ? 334  ARG A C     1 
ATOM   2608 O  O     . ARG A 1 337 ? 18.698 12.621  -3.430  1.00 42.21  ? 334  ARG A O     1 
ATOM   2609 C  CB    . ARG A 1 337 ? 15.553 11.613  -3.338  1.00 59.85  ? 334  ARG A CB    1 
ATOM   2610 C  CG    . ARG A 1 337 ? 15.957 11.438  -4.792  1.00 65.80  ? 334  ARG A CG    1 
ATOM   2611 C  CD    . ARG A 1 337 ? 14.744 11.272  -5.692  1.00 75.71  ? 334  ARG A CD    1 
ATOM   2612 N  NE    . ARG A 1 337 ? 13.747 12.312  -5.459  1.00 87.33  ? 334  ARG A NE    1 
ATOM   2613 C  CZ    . ARG A 1 337 ? 13.850 13.561  -5.902  1.00 93.33  ? 334  ARG A CZ    1 
ATOM   2614 N  NH1   . ARG A 1 337 ? 14.914 13.936  -6.600  1.00 90.81  ? 334  ARG A NH1   1 
ATOM   2615 N  NH2   . ARG A 1 337 ? 12.889 14.437  -5.641  1.00 97.51  ? 334  ARG A NH2   1 
ATOM   2616 N  N     . GLU A 1 338 ? 17.301 14.078  -2.427  1.00 48.35  ? 335  GLU A N     1 
ATOM   2617 C  CA    . GLU A 1 338 ? 18.122 15.249  -2.728  1.00 44.46  ? 335  GLU A CA    1 
ATOM   2618 C  C     . GLU A 1 338 ? 19.539 15.120  -2.172  1.00 36.71  ? 335  GLU A C     1 
ATOM   2619 O  O     . GLU A 1 338 ? 20.507 15.555  -2.802  1.00 34.57  ? 335  GLU A O     1 
ATOM   2620 C  CB    . GLU A 1 338 ? 17.482 16.513  -2.150  1.00 42.58  ? 335  GLU A CB    1 
ATOM   2621 C  CG    . GLU A 1 338 ? 16.207 16.946  -2.856  1.00 61.44  ? 335  GLU A CG    1 
ATOM   2622 C  CD    . GLU A 1 338 ? 16.464 17.422  -4.272  1.00 71.07  ? 335  GLU A CD    1 
ATOM   2623 O  OE1   . GLU A 1 338 ? 17.627 17.754  -4.586  1.00 69.79  ? 335  GLU A OE1   1 
ATOM   2624 O  OE2   . GLU A 1 338 ? 15.505 17.463  -5.071  1.00 78.00  ? 335  GLU A OE2   1 
ATOM   2625 N  N     . GLN A 1 339 ? 19.651 14.552  -0.975  1.00 39.83  ? 336  GLN A N     1 
ATOM   2626 C  CA    . GLN A 1 339 ? 20.949 14.363  -0.329  1.00 39.70  ? 336  GLN A CA    1 
ATOM   2627 C  C     . GLN A 1 339 ? 21.785 13.340  -1.079  1.00 35.96  ? 336  GLN A C     1 
ATOM   2628 O  O     . GLN A 1 339 ? 22.987 13.533  -1.321  1.00 33.91  ? 336  GLN A O     1 
ATOM   2629 C  CB    . GLN A 1 339 ? 20.766 13.858  1.097   1.00 48.37  ? 336  GLN A CB    1 
ATOM   2630 C  CG    . GLN A 1 339 ? 20.596 14.919  2.150   1.00 52.85  ? 336  GLN A CG    1 
ATOM   2631 C  CD    . GLN A 1 339 ? 20.764 14.342  3.541   1.00 54.33  ? 336  GLN A CD    1 
ATOM   2632 O  OE1   . GLN A 1 339 ? 19.840 13.740  4.095   1.00 59.00  ? 336  GLN A OE1   1 
ATOM   2633 N  NE2   . GLN A 1 339 ? 21.957 14.499  4.103   1.00 37.78  ? 336  GLN A NE2   1 
ATOM   2634 N  N     . VAL A 1 340 ? 21.148 12.224  -1.408  1.00 39.22  ? 337  VAL A N     1 
ATOM   2635 C  CA    . VAL A 1 340 ? 21.805 11.168  -2.156  1.00 37.81  ? 337  VAL A CA    1 
ATOM   2636 C  C     . VAL A 1 340 ? 22.320 11.745  -3.465  1.00 35.58  ? 337  VAL A C     1 
ATOM   2637 O  O     . VAL A 1 340 ? 23.443 11.466  -3.874  1.00 32.29  ? 337  VAL A O     1 
ATOM   2638 C  CB    . VAL A 1 340 ? 20.848 9.991   -2.416  1.00 34.70  ? 337  VAL A CB    1 
ATOM   2639 C  CG1   . VAL A 1 340 ? 21.503 8.948   -3.312  1.00 29.51  ? 337  VAL A CG1   1 
ATOM   2640 C  CG2   . VAL A 1 340 ? 20.423 9.374   -1.097  1.00 36.63  ? 337  VAL A CG2   1 
ATOM   2641 N  N     . GLN A 1 341 ? 21.507 12.582  -4.102  1.00 34.63  ? 338  GLN A N     1 
ATOM   2642 C  CA    . GLN A 1 341 ? 21.888 13.187  -5.376  1.00 40.33  ? 338  GLN A CA    1 
ATOM   2643 C  C     . GLN A 1 341 ? 23.021 14.213  -5.260  1.00 36.69  ? 338  GLN A C     1 
ATOM   2644 O  O     . GLN A 1 341 ? 23.897 14.266  -6.124  1.00 34.82  ? 338  GLN A O     1 
ATOM   2645 C  CB    . GLN A 1 341 ? 20.670 13.792  -6.084  1.00 44.96  ? 338  GLN A CB    1 
ATOM   2646 C  CG    . GLN A 1 341 ? 19.670 12.747  -6.576  1.00 46.21  ? 338  GLN A CG    1 
ATOM   2647 C  CD    . GLN A 1 341 ? 18.466 13.349  -7.289  1.00 50.86  ? 338  GLN A CD    1 
ATOM   2648 O  OE1   . GLN A 1 341 ? 18.112 14.509  -7.077  1.00 53.36  ? 338  GLN A OE1   1 
ATOM   2649 N  NE2   . GLN A 1 341 ? 17.832 12.552  -8.144  1.00 50.32  ? 338  GLN A NE2   1 
ATOM   2650 N  N     . TRP A 1 342 ? 23.008 15.017  -4.199  1.00 30.39  ? 339  TRP A N     1 
ATOM   2651 C  CA    . TRP A 1 342 ? 24.061 16.012  -3.994  1.00 32.69  ? 339  TRP A CA    1 
ATOM   2652 C  C     . TRP A 1 342 ? 25.426 15.353  -3.843  1.00 31.68  ? 339  TRP A C     1 
ATOM   2653 O  O     . TRP A 1 342 ? 26.401 15.767  -4.477  1.00 26.85  ? 339  TRP A O     1 
ATOM   2654 C  CB    . TRP A 1 342 ? 23.766 16.892  -2.773  1.00 31.54  ? 339  TRP A CB    1 
ATOM   2655 C  CG    . TRP A 1 342 ? 24.751 18.033  -2.597  1.00 32.31  ? 339  TRP A CG    1 
ATOM   2656 C  CD1   . TRP A 1 342 ? 24.692 19.261  -3.195  1.00 40.19  ? 339  TRP A CD1   1 
ATOM   2657 C  CD2   . TRP A 1 342 ? 25.924 18.052  -1.764  1.00 29.24  ? 339  TRP A CD2   1 
ATOM   2658 N  NE1   . TRP A 1 342 ? 25.749 20.038  -2.791  1.00 37.42  ? 339  TRP A NE1   1 
ATOM   2659 C  CE2   . TRP A 1 342 ? 26.523 19.321  -1.916  1.00 31.97  ? 339  TRP A CE2   1 
ATOM   2660 C  CE3   . TRP A 1 342 ? 26.521 17.125  -0.905  1.00 29.87  ? 339  TRP A CE3   1 
ATOM   2661 C  CZ2   . TRP A 1 342 ? 27.689 19.686  -1.246  1.00 27.86  ? 339  TRP A CZ2   1 
ATOM   2662 C  CZ3   . TRP A 1 342 ? 27.684 17.488  -0.238  1.00 30.54  ? 339  TRP A CZ3   1 
ATOM   2663 C  CH2   . TRP A 1 342 ? 28.255 18.759  -0.413  1.00 32.83  ? 339  TRP A CH2   1 
ATOM   2664 N  N     . TRP A 1 343 ? 25.497 14.329  -2.999  1.00 27.03  ? 340  TRP A N     1 
ATOM   2665 C  CA    . TRP A 1 343 ? 26.757 13.625  -2.781  1.00 22.04  ? 340  TRP A CA    1 
ATOM   2666 C  C     . TRP A 1 343 ? 27.215 12.849  -4.020  1.00 22.30  ? 340  TRP A C     1 
ATOM   2667 O  O     . TRP A 1 343 ? 28.403 12.838  -4.341  1.00 20.96  ? 340  TRP A O     1 
ATOM   2668 C  CB    . TRP A 1 343 ? 26.677 12.716  -1.551  1.00 25.94  ? 340  TRP A CB    1 
ATOM   2669 C  CG    . TRP A 1 343 ? 26.886 13.452  -0.239  1.00 24.44  ? 340  TRP A CG    1 
ATOM   2670 C  CD1   . TRP A 1 343 ? 25.954 13.692  0.727   1.00 32.61  ? 340  TRP A CD1   1 
ATOM   2671 C  CD2   . TRP A 1 343 ? 28.112 14.024  0.234   1.00 24.76  ? 340  TRP A CD2   1 
ATOM   2672 N  NE1   . TRP A 1 343 ? 26.523 14.385  1.773   1.00 28.63  ? 340  TRP A NE1   1 
ATOM   2673 C  CE2   . TRP A 1 343 ? 27.848 14.597  1.493   1.00 29.32  ? 340  TRP A CE2   1 
ATOM   2674 C  CE3   . TRP A 1 343 ? 29.408 14.106  -0.287  1.00 23.21  ? 340  TRP A CE3   1 
ATOM   2675 C  CZ2   . TRP A 1 343 ? 28.831 15.243  2.239   1.00 30.12  ? 340  TRP A CZ2   1 
ATOM   2676 C  CZ3   . TRP A 1 343 ? 30.380 14.748  0.456   1.00 28.89  ? 340  TRP A CZ3   1 
ATOM   2677 C  CH2   . TRP A 1 343 ? 30.088 15.308  1.703   1.00 32.57  ? 340  TRP A CH2   1 
ATOM   2678 N  N     . LEU A 1 344 ? 26.284 12.209  -4.724  1.00 23.12  ? 341  LEU A N     1 
ATOM   2679 C  CA    . LEU A 1 344 ? 26.665 11.487  -5.939  1.00 23.53  ? 341  LEU A CA    1 
ATOM   2680 C  C     . LEU A 1 344 ? 27.305 12.470  -6.911  1.00 20.14  ? 341  LEU A C     1 
ATOM   2681 O  O     . LEU A 1 344 ? 28.277 12.146  -7.589  1.00 19.32  ? 341  LEU A O     1 
ATOM   2682 C  CB    . LEU A 1 344 ? 25.477 10.778  -6.597  1.00 22.01  ? 341  LEU A CB    1 
ATOM   2683 C  CG    . LEU A 1 344 ? 25.005 9.431   -6.037  1.00 29.04  ? 341  LEU A CG    1 
ATOM   2684 C  CD1   . LEU A 1 344 ? 23.763 8.947   -6.778  1.00 26.11  ? 341  LEU A CD1   1 
ATOM   2685 C  CD2   . LEU A 1 344 ? 26.106 8.383   -6.101  1.00 27.32  ? 341  LEU A CD2   1 
ATOM   2686 N  N     . LEU A 1 345 ? 26.778 13.687  -6.957  1.00 22.87  ? 342  LEU A N     1 
ATOM   2687 C  CA    . LEU A 1 345 ? 27.373 14.708  -7.811  1.00 22.25  ? 342  LEU A CA    1 
ATOM   2688 C  C     . LEU A 1 345 ? 28.776 15.129  -7.361  1.00 25.86  ? 342  LEU A C     1 
ATOM   2689 O  O     . LEU A 1 345 ? 29.672 15.292  -8.187  1.00 21.81  ? 342  LEU A O     1 
ATOM   2690 C  CB    . LEU A 1 345 ? 26.458 15.931  -7.917  1.00 26.03  ? 342  LEU A CB    1 
ATOM   2691 C  CG    . LEU A 1 345 ? 27.003 17.073  -8.774  1.00 29.79  ? 342  LEU A CG    1 
ATOM   2692 C  CD1   . LEU A 1 345 ? 27.338 16.586  -10.180 1.00 29.02  ? 342  LEU A CD1   1 
ATOM   2693 C  CD2   . LEU A 1 345 ? 25.992 18.204  -8.833  1.00 30.97  ? 342  LEU A CD2   1 
ATOM   2694 N  N     . GLN A 1 346 ? 28.981 15.303  -6.061  1.00 20.68  ? 343  GLN A N     1 
ATOM   2695 C  CA    . GLN A 1 346 ? 30.313 15.665  -5.580  1.00 17.69  ? 343  GLN A CA    1 
ATOM   2696 C  C     . GLN A 1 346 ? 31.326 14.589  -5.960  1.00 18.76  ? 343  GLN A C     1 
ATOM   2697 O  O     . GLN A 1 346 ? 32.427 14.894  -6.430  1.00 17.24  ? 343  GLN A O     1 
ATOM   2698 C  CB    . GLN A 1 346 ? 30.328 15.874  -4.058  1.00 18.75  ? 343  GLN A CB    1 
ATOM   2699 C  CG    . GLN A 1 346 ? 29.243 16.825  -3.521  1.00 19.61  ? 343  GLN A CG    1 
ATOM   2700 C  CD    . GLN A 1 346 ? 29.142 18.129  -4.303  1.00 24.14  ? 343  GLN A CD    1 
ATOM   2701 O  OE1   . GLN A 1 346 ? 30.108 18.898  -4.406  1.00 24.58  ? 343  GLN A OE1   1 
ATOM   2702 N  NE2   . GLN A 1 346 ? 27.960 18.390  -4.847  1.00 28.09  ? 343  GLN A NE2   1 
ATOM   2703 N  N     . LEU A 1 347 ? 30.957 13.333  -5.734  1.00 19.29  ? 344  LEU A N     1 
ATOM   2704 C  CA    . LEU A 1 347 ? 31.841 12.217  -6.050  1.00 17.89  ? 344  LEU A CA    1 
ATOM   2705 C  C     . LEU A 1 347 ? 32.116 12.193  -7.547  1.00 17.89  ? 344  LEU A C     1 
ATOM   2706 O  O     . LEU A 1 347 ? 33.247 11.988  -7.970  1.00 16.08  ? 344  LEU A O     1 
ATOM   2707 C  CB    . LEU A 1 347 ? 31.233 10.882  -5.601  1.00 17.26  ? 344  LEU A CB    1 
ATOM   2708 C  CG    . LEU A 1 347 ? 31.081 10.651  -4.097  1.00 26.40  ? 344  LEU A CG    1 
ATOM   2709 C  CD1   . LEU A 1 347 ? 30.265 9.395   -3.817  1.00 25.33  ? 344  LEU A CD1   1 
ATOM   2710 C  CD2   . LEU A 1 347 ? 32.430 10.557  -3.437  1.00 23.85  ? 344  LEU A CD2   1 
ATOM   2711 N  N     . ALA A 1 348 ? 31.080 12.420  -8.350  1.00 18.89  ? 345  ALA A N     1 
ATOM   2712 C  CA    . ALA A 1 348 ? 31.238 12.323  -9.798  1.00 18.83  ? 345  ALA A CA    1 
ATOM   2713 C  C     . ALA A 1 348 ? 32.138 13.436  -10.334 1.00 16.37  ? 345  ALA A C     1 
ATOM   2714 O  O     . ALA A 1 348 ? 32.876 13.231  -11.288 1.00 17.86  ? 345  ALA A O     1 
ATOM   2715 C  CB    . ALA A 1 348 ? 29.879 12.352  -10.496 1.00 19.62  ? 345  ALA A CB    1 
ATOM   2716 N  N     . GLN A 1 349 ? 32.070 14.615  -9.720  1.00 16.67  ? 346  GLN A N     1 
ATOM   2717 C  CA    . GLN A 1 349 ? 32.939 15.722  -10.104 1.00 17.06  ? 346  GLN A CA    1 
ATOM   2718 C  C     . GLN A 1 349 ? 34.403 15.438  -9.779  1.00 18.04  ? 346  GLN A C     1 
ATOM   2719 O  O     . GLN A 1 349 ? 35.295 15.712  -10.585 1.00 16.77  ? 346  GLN A O     1 
ATOM   2720 C  CB    . GLN A 1 349 ? 32.475 17.032  -9.450  1.00 16.94  ? 346  GLN A CB    1 
ATOM   2721 C  CG    . GLN A 1 349 ? 31.188 17.573  -10.085 1.00 21.20  ? 346  GLN A CG    1 
ATOM   2722 C  CD    . GLN A 1 349 ? 30.701 18.875  -9.468  1.00 29.35  ? 346  GLN A CD    1 
ATOM   2723 O  OE1   . GLN A 1 349 ? 30.982 19.179  -8.309  1.00 32.58  ? 346  GLN A OE1   1 
ATOM   2724 N  NE2   . GLN A 1 349 ? 29.959 19.645  -10.245 1.00 32.21  ? 346  GLN A NE2   1 
ATOM   2725 N  N     . GLU A 1 350 ? 34.668 14.875  -8.608  1.00 15.53  ? 347  GLU A N     1 
ATOM   2726 C  CA    . GLU A 1 350 ? 36.042 14.499  -8.318  1.00 15.33  ? 347  GLU A CA    1 
ATOM   2727 C  C     . GLU A 1 350 ? 36.511 13.416  -9.297  1.00 14.58  ? 347  GLU A C     1 
ATOM   2728 O  O     . GLU A 1 350 ? 37.631 13.460  -9.798  1.00 14.79  ? 347  GLU A O     1 
ATOM   2729 C  CB    . GLU A 1 350 ? 36.212 14.000  -6.887  1.00 15.70  ? 347  GLU A CB    1 
ATOM   2730 C  CG    . GLU A 1 350 ? 37.653 13.545  -6.647  1.00 18.20  ? 347  GLU A CG    1 
ATOM   2731 C  CD    . GLU A 1 350 ? 37.903 12.979  -5.263  1.00 20.42  ? 347  GLU A CD    1 
ATOM   2732 O  OE1   . GLU A 1 350 ? 37.195 13.363  -4.306  1.00 20.91  ? 347  GLU A OE1   1 
ATOM   2733 O  OE2   . GLU A 1 350 ? 38.818 12.143  -5.138  1.00 19.93  ? 347  GLU A OE2   1 
ATOM   2734 N  N     . LEU A 1 351 ? 35.650 12.440  -9.554  1.00 15.00  ? 348  LEU A N     1 
ATOM   2735 C  CA    . LEU A 1 351 ? 35.983 11.361  -10.470 1.00 17.07  ? 348  LEU A CA    1 
ATOM   2736 C  C     . LEU A 1 351 ? 36.268 11.883  -11.884 1.00 17.77  ? 348  LEU A C     1 
ATOM   2737 O  O     . LEU A 1 351 ? 37.260 11.483  -12.506 1.00 15.13  ? 348  LEU A O     1 
ATOM   2738 C  CB    . LEU A 1 351 ? 34.859 10.329  -10.483 1.00 18.32  ? 348  LEU A CB    1 
ATOM   2739 C  CG    . LEU A 1 351 ? 35.133 9.027   -11.237 1.00 20.00  ? 348  LEU A CG    1 
ATOM   2740 C  CD1   . LEU A 1 351 ? 36.368 8.355   -10.668 1.00 21.96  ? 348  LEU A CD1   1 
ATOM   2741 C  CD2   . LEU A 1 351 ? 33.913 8.124   -11.142 1.00 24.10  ? 348  LEU A CD2   1 
ATOM   2742 N  N     . GLU A 1 352 ? 35.412 12.776  -12.382 1.00 18.77  ? 349  GLU A N     1 
ATOM   2743 C  CA    . GLU A 1 352 ? 35.614 13.359  -13.706 1.00 20.98  ? 349  GLU A CA    1 
ATOM   2744 C  C     . GLU A 1 352 ? 36.968 14.045  -13.780 1.00 18.86  ? 349  GLU A C     1 
ATOM   2745 O  O     . GLU A 1 352 ? 37.696 13.896  -14.765 1.00 17.84  ? 349  GLU A O     1 
ATOM   2746 C  CB    . GLU A 1 352 ? 34.518 14.370  -14.070 1.00 20.96  ? 349  GLU A CB    1 
ATOM   2747 C  CG    . GLU A 1 352 ? 34.770 15.036  -15.421 1.00 28.77  ? 349  GLU A CG    1 
ATOM   2748 C  CD    . GLU A 1 352 ? 33.783 16.152  -15.747 1.00 45.49  ? 349  GLU A CD    1 
ATOM   2749 O  OE1   . GLU A 1 352 ? 34.063 16.934  -16.681 1.00 52.39  ? 349  GLU A OE1   1 
ATOM   2750 O  OE2   . GLU A 1 352 ? 32.728 16.250  -15.084 1.00 44.65  ? 349  GLU A OE2   1 
ATOM   2751 N  N     . GLU A 1 353 ? 37.321 14.784  -12.731 1.00 16.29  ? 350  GLU A N     1 
ATOM   2752 C  CA    . GLU A 1 353 ? 38.592 15.498  -12.736 1.00 17.62  ? 350  GLU A CA    1 
ATOM   2753 C  C     . GLU A 1 353 ? 39.767 14.517  -12.805 1.00 14.91  ? 350  GLU A C     1 
ATOM   2754 O  O     . GLU A 1 353 ? 40.719 14.703  -13.572 1.00 18.36  ? 350  GLU A O     1 
ATOM   2755 C  CB    . GLU A 1 353 ? 38.713 16.385  -11.493 1.00 18.12  ? 350  GLU A CB    1 
ATOM   2756 C  CG    . GLU A 1 353 ? 40.058 17.070  -11.373 1.00 30.02  ? 350  GLU A CG    1 
ATOM   2757 C  CD    . GLU A 1 353 ? 40.113 18.058  -10.225 1.00 43.19  ? 350  GLU A CD    1 
ATOM   2758 O  OE1   . GLU A 1 353 ? 39.109 18.765  -10.003 1.00 44.11  ? 350  GLU A OE1   1 
ATOM   2759 O  OE2   . GLU A 1 353 ? 41.161 18.124  -9.547  1.00 50.60  ? 350  GLU A OE2   1 
ATOM   2760 N  N     . ARG A 1 354 ? 39.696 13.462  -12.007 1.00 13.51  ? 351  ARG A N     1 
ATOM   2761 C  CA    . ARG A 1 354 ? 40.781 12.484  -11.985 1.00 13.04  ? 351  ARG A CA    1 
ATOM   2762 C  C     . ARG A 1 354 ? 40.861 11.688  -13.284 1.00 15.32  ? 351  ARG A C     1 
ATOM   2763 O  O     . ARG A 1 354 ? 41.959 11.396  -13.756 1.00 16.18  ? 351  ARG A O     1 
ATOM   2764 C  CB    . ARG A 1 354 ? 40.663 11.573  -10.769 1.00 16.14  ? 351  ARG A CB    1 
ATOM   2765 C  CG    . ARG A 1 354 ? 40.972 12.334  -9.489  1.00 14.98  ? 351  ARG A CG    1 
ATOM   2766 C  CD    . ARG A 1 354 ? 40.500 11.589  -8.266  1.00 16.47  ? 351  ARG A CD    1 
ATOM   2767 N  NE    . ARG A 1 354 ? 41.044 10.241  -8.183  1.00 16.01  ? 351  ARG A NE    1 
ATOM   2768 C  CZ    . ARG A 1 354 ? 40.597 9.326   -7.326  1.00 16.63  ? 351  ARG A CZ    1 
ATOM   2769 N  NH1   . ARG A 1 354 ? 39.608 9.634   -6.487  1.00 17.60  ? 351  ARG A NH1   1 
ATOM   2770 N  NH2   . ARG A 1 354 ? 41.130 8.115   -7.314  1.00 16.47  ? 351  ARG A NH2   1 
ATOM   2771 N  N     . LEU A 1 355 ? 39.705 11.357  -13.858 1.00 16.68  ? 352  LEU A N     1 
ATOM   2772 C  CA    . LEU A 1 355 ? 39.654 10.594  -15.108 1.00 16.26  ? 352  LEU A CA    1 
ATOM   2773 C  C     . LEU A 1 355 ? 40.203 11.400  -16.279 1.00 16.31  ? 352  LEU A C     1 
ATOM   2774 O  O     . LEU A 1 355 ? 40.931 10.866  -17.113 1.00 17.01  ? 352  LEU A O     1 
ATOM   2775 C  CB    . LEU A 1 355 ? 38.219 10.167  -15.435 1.00 15.57  ? 352  LEU A CB    1 
ATOM   2776 C  CG    . LEU A 1 355 ? 37.664 9.004   -14.619 1.00 14.05  ? 352  LEU A CG    1 
ATOM   2777 C  CD1   . LEU A 1 355 ? 36.185 8.815   -14.936 1.00 16.12  ? 352  LEU A CD1   1 
ATOM   2778 C  CD2   . LEU A 1 355 ? 38.457 7.737   -14.898 1.00 18.57  ? 352  LEU A CD2   1 
ATOM   2779 N  N     . THR A 1 356 ? 39.826 12.675  -16.359 1.00 16.10  ? 353  THR A N     1 
ATOM   2780 C  CA    . THR A 1 356 ? 40.281 13.515  -17.450 1.00 16.90  ? 353  THR A CA    1 
ATOM   2781 C  C     . THR A 1 356 ? 41.797 13.653  -17.401 1.00 19.56  ? 353  THR A C     1 
ATOM   2782 O  O     . THR A 1 356 ? 42.473 13.527  -18.416 1.00 19.37  ? 353  THR A O     1 
ATOM   2783 C  CB    . THR A 1 356 ? 39.598 14.886  -17.414 1.00 22.02  ? 353  THR A CB    1 
ATOM   2784 O  OG1   . THR A 1 356 ? 38.191 14.704  -17.614 1.00 24.31  ? 353  THR A OG1   1 
ATOM   2785 C  CG2   . THR A 1 356 ? 40.138 15.757  -18.519 1.00 22.69  ? 353  THR A CG2   1 
ATOM   2786 N  N     . LYS A 1 357 ? 42.341 13.883  -16.213 1.00 19.81  ? 354  LYS A N     1 
ATOM   2787 C  CA    . LYS A 1 357 ? 43.787 13.910  -16.061 1.00 16.44  ? 354  LYS A CA    1 
ATOM   2788 C  C     . LYS A 1 357 ? 44.417 12.566  -16.436 1.00 17.74  ? 354  LYS A C     1 
ATOM   2789 O  O     . LYS A 1 357 ? 45.445 12.521  -17.120 1.00 19.45  ? 354  LYS A O     1 
ATOM   2790 C  CB    . LYS A 1 357 ? 44.176 14.276  -14.625 1.00 19.92  ? 354  LYS A CB    1 
ATOM   2791 C  CG    . LYS A 1 357 ? 45.679 14.357  -14.419 1.00 30.21  ? 354  LYS A CG    1 
ATOM   2792 C  CD    . LYS A 1 357 ? 46.035 15.215  -13.219 1.00 41.58  ? 354  LYS A CD    1 
ATOM   2793 C  CE    . LYS A 1 357 ? 47.360 15.934  -13.440 1.00 44.53  ? 354  LYS A CE    1 
ATOM   2794 N  NZ    . LYS A 1 357 ? 48.412 15.001  -13.929 1.00 38.23  ? 354  LYS A NZ    1 
ATOM   2795 N  N     . ASP A 1 358 ? 43.792 11.473  -16.002 1.00 14.92  ? 355  ASP A N     1 
ATOM   2796 C  CA    . ASP A 1 358 ? 44.307 10.136  -16.308 1.00 15.43  ? 355  ASP A CA    1 
ATOM   2797 C  C     . ASP A 1 358 ? 44.368 9.883   -17.813 1.00 18.68  ? 355  ASP A C     1 
ATOM   2798 O  O     . ASP A 1 358 ? 45.333 9.303   -18.312 1.00 18.09  ? 355  ASP A O     1 
ATOM   2799 C  CB    . ASP A 1 358 ? 43.471 9.041   -15.623 1.00 14.80  ? 355  ASP A CB    1 
ATOM   2800 C  CG    . ASP A 1 358 ? 44.009 7.650   -15.896 1.00 18.85  ? 355  ASP A CG    1 
ATOM   2801 O  OD1   . ASP A 1 358 ? 45.008 7.240   -15.255 1.00 17.94  ? 355  ASP A OD1   1 
ATOM   2802 O  OD2   . ASP A 1 358 ? 43.435 6.953   -16.764 1.00 17.55  ? 355  ASP A OD2   1 
ATOM   2803 N  N     . ARG A 1 359 ? 43.339 10.330  -18.532 1.00 14.47  ? 356  ARG A N     1 
ATOM   2804 C  CA    . ARG A 1 359 ? 43.249 10.099  -19.965 1.00 19.17  ? 356  ARG A CA    1 
ATOM   2805 C  C     . ARG A 1 359 ? 44.362 10.843  -20.699 1.00 17.96  ? 356  ARG A C     1 
ATOM   2806 O  O     . ARG A 1 359 ? 44.977 10.314  -21.627 1.00 18.20  ? 356  ARG A O     1 
ATOM   2807 C  CB    . ARG A 1 359 ? 41.877 10.549  -20.480 1.00 19.44  ? 356  ARG A CB    1 
ATOM   2808 C  CG    . ARG A 1 359 ? 41.608 10.198  -21.950 1.00 23.07  ? 356  ARG A CG    1 
ATOM   2809 C  CD    . ARG A 1 359 ? 40.208 10.656  -22.382 1.00 26.00  ? 356  ARG A CD    1 
ATOM   2810 N  NE    . ARG A 1 359 ? 40.048 12.103  -22.279 1.00 32.02  ? 356  ARG A NE    1 
ATOM   2811 C  CZ    . ARG A 1 359 ? 38.879 12.726  -22.135 1.00 38.69  ? 356  ARG A CZ    1 
ATOM   2812 N  NH1   . ARG A 1 359 ? 37.752 12.028  -22.071 1.00 39.76  ? 356  ARG A NH1   1 
ATOM   2813 N  NH2   . ARG A 1 359 ? 38.837 14.050  -22.049 1.00 41.06  ? 356  ARG A NH2   1 
ATOM   2814 N  N     . ASN A 1 360 ? 44.627 12.073  -20.275 1.00 14.69  ? 357  ASN A N     1 
ATOM   2815 C  CA    . ASN A 1 360 ? 45.687 12.882  -20.875 1.00 16.53  ? 357  ASN A CA    1 
ATOM   2816 C  C     . ASN A 1 360 ? 47.093 12.340  -20.586 1.00 20.59  ? 357  ASN A C     1 
ATOM   2817 O  O     . ASN A 1 360 ? 47.962 12.339  -21.463 1.00 25.71  ? 357  ASN A O     1 
ATOM   2818 C  CB    . ASN A 1 360 ? 45.570 14.316  -20.373 1.00 16.01  ? 357  ASN A CB    1 
ATOM   2819 C  CG    . ASN A 1 360 ? 44.474 15.077  -21.071 1.00 20.55  ? 357  ASN A CG    1 
ATOM   2820 O  OD1   . ASN A 1 360 ? 44.299 14.953  -22.284 1.00 27.53  ? 357  ASN A OD1   1 
ATOM   2821 N  ND2   . ASN A 1 360 ? 43.731 15.871  -20.316 1.00 26.19  ? 357  ASN A ND2   1 
ATOM   2822 N  N     . ASP A 1 361 ? 47.305 11.898  -19.352 1.00 17.93  ? 358  ASP A N     1 
ATOM   2823 C  CA    . ASP A 1 361 ? 48.608 11.391  -18.923 1.00 20.35  ? 358  ASP A CA    1 
ATOM   2824 C  C     . ASP A 1 361 ? 48.922 10.002  -19.475 1.00 20.17  ? 358  ASP A C     1 
ATOM   2825 O  O     . ASP A 1 361 ? 50.056 9.731   -19.872 1.00 19.44  ? 358  ASP A O     1 
ATOM   2826 C  CB    . ASP A 1 361 ? 48.673 11.322  -17.392 1.00 19.11  ? 358  ASP A CB    1 
ATOM   2827 C  CG    . ASP A 1 361 ? 48.755 12.694  -16.739 1.00 29.36  ? 358  ASP A CG    1 
ATOM   2828 O  OD1   . ASP A 1 361 ? 48.939 13.705  -17.459 1.00 29.21  ? 358  ASP A OD1   1 
ATOM   2829 O  OD2   . ASP A 1 361 ? 48.648 12.752  -15.492 1.00 32.03  ? 358  ASP A OD2   1 
ATOM   2830 N  N     . ASN A 1 362 ? 47.916 9.132   -19.498 1.00 17.60  ? 359  ASN A N     1 
ATOM   2831 C  CA    . ASN A 1 362 ? 48.153 7.694   -19.648 1.00 18.21  ? 359  ASN A CA    1 
ATOM   2832 C  C     . ASN A 1 362 ? 47.533 7.040   -20.882 1.00 17.65  ? 359  ASN A C     1 
ATOM   2833 O  O     . ASN A 1 362 ? 47.643 5.841   -21.064 1.00 18.69  ? 359  ASN A O     1 
ATOM   2834 C  CB    . ASN A 1 362 ? 47.725 6.963   -18.372 1.00 16.00  ? 359  ASN A CB    1 
ATOM   2835 C  CG    . ASN A 1 362 ? 48.490 7.444   -17.149 1.00 18.64  ? 359  ASN A CG    1 
ATOM   2836 O  OD1   . ASN A 1 362 ? 49.697 7.647   -17.207 1.00 20.37  ? 359  ASN A OD1   1 
ATOM   2837 N  ND2   . ASN A 1 362 ? 47.783 7.642   -16.043 1.00 16.16  ? 359  ASN A ND2   1 
ATOM   2838 N  N     . ASP A 1 363 ? 46.879 7.828   -21.726 1.00 17.64  ? 360  ASP A N     1 
ATOM   2839 C  CA    . ASP A 1 363 ? 46.396 7.312   -23.009 1.00 19.32  ? 360  ASP A CA    1 
ATOM   2840 C  C     . ASP A 1 363 ? 45.465 6.135   -22.844 1.00 19.63  ? 360  ASP A C     1 
ATOM   2841 O  O     . ASP A 1 363 ? 45.629 5.100   -23.495 1.00 22.36  ? 360  ASP A O     1 
ATOM   2842 C  CB    . ASP A 1 363 ? 47.570 6.882   -23.878 1.00 24.90  ? 360  ASP A CB    1 
ATOM   2843 C  CG    . ASP A 1 363 ? 48.439 8.035   -24.269 1.00 34.46  ? 360  ASP A CG    1 
ATOM   2844 O  OD1   . ASP A 1 363 ? 47.881 9.041   -24.747 1.00 27.56  ? 360  ASP A OD1   1 
ATOM   2845 O  OD2   . ASP A 1 363 ? 49.668 7.935   -24.087 1.00 41.08  ? 360  ASP A OD2   1 
ATOM   2846 N  N     . ARG A 1 364 ? 44.488 6.289   -21.963 1.00 19.36  ? 361  ARG A N     1 
ATOM   2847 C  CA    . ARG A 1 364 ? 43.508 5.248   -21.748 1.00 19.35  ? 361  ARG A CA    1 
ATOM   2848 C  C     . ARG A 1 364 ? 42.215 5.869   -21.270 1.00 20.36  ? 361  ARG A C     1 
ATOM   2849 O  O     . ARG A 1 364 ? 42.198 7.016   -20.799 1.00 18.44  ? 361  ARG A O     1 
ATOM   2850 C  CB    . ARG A 1 364 ? 44.007 4.253   -20.709 1.00 17.88  ? 361  ARG A CB    1 
ATOM   2851 C  CG    . ARG A 1 364 ? 44.191 4.860   -19.322 1.00 13.80  ? 361  ARG A CG    1 
ATOM   2852 C  CD    . ARG A 1 364 ? 44.793 3.852   -18.367 1.00 13.91  ? 361  ARG A CD    1 
ATOM   2853 N  NE    . ARG A 1 364 ? 44.826 4.407   -17.026 1.00 15.93  ? 361  ARG A NE    1 
ATOM   2854 C  CZ    . ARG A 1 364 ? 45.058 3.700   -15.927 1.00 18.77  ? 361  ARG A CZ    1 
ATOM   2855 N  NH1   . ARG A 1 364 ? 45.061 4.311   -14.748 1.00 17.49  ? 361  ARG A NH1   1 
ATOM   2856 N  NH2   . ARG A 1 364 ? 45.281 2.398   -16.006 1.00 18.04  ? 361  ARG A NH2   1 
ATOM   2857 N  N     . VAL A 1 365 ? 41.137 5.102   -21.399 1.00 20.12  ? 362  VAL A N     1 
ATOM   2858 C  CA    . VAL A 1 365 ? 39.816 5.561   -21.012 1.00 19.58  ? 362  VAL A CA    1 
ATOM   2859 C  C     . VAL A 1 365 ? 39.092 4.452   -20.268 1.00 21.96  ? 362  VAL A C     1 
ATOM   2860 O  O     . VAL A 1 365 ? 39.148 3.294   -20.665 1.00 21.10  ? 362  VAL A O     1 
ATOM   2861 C  CB    . VAL A 1 365 ? 38.982 6.005   -22.235 1.00 21.72  ? 362  VAL A CB    1 
ATOM   2862 C  CG1   . VAL A 1 365 ? 39.654 7.179   -22.929 1.00 29.05  ? 362  VAL A CG1   1 
ATOM   2863 C  CG2   . VAL A 1 365 ? 38.793 4.861   -23.199 1.00 25.20  ? 362  VAL A CG2   1 
ATOM   2864 N  N     . ALA A 1 366 ? 38.421 4.809   -19.179 1.00 16.22  ? 363  ALA A N     1 
ATOM   2865 C  CA    . ALA A 1 366 ? 37.622 3.849   -18.430 1.00 18.12  ? 363  ALA A CA    1 
ATOM   2866 C  C     . ALA A 1 366 ? 36.320 3.616   -19.188 1.00 18.74  ? 363  ALA A C     1 
ATOM   2867 O  O     . ALA A 1 366 ? 35.787 4.538   -19.816 1.00 23.68  ? 363  ALA A O     1 
ATOM   2868 C  CB    . ALA A 1 366 ? 37.336 4.393   -17.037 1.00 18.28  ? 363  ALA A CB    1 
ATOM   2869 N  N     . THR A 1 367 ? 35.798 2.391   -19.132 1.00 18.14  ? 364  THR A N     1 
ATOM   2870 C  CA    . THR A 1 367 ? 34.587 2.079   -19.889 1.00 18.70  ? 364  THR A CA    1 
ATOM   2871 C  C     . THR A 1 367 ? 33.413 1.626   -19.016 1.00 20.43  ? 364  THR A C     1 
ATOM   2872 O  O     . THR A 1 367 ? 32.289 1.474   -19.500 1.00 22.56  ? 364  THR A O     1 
ATOM   2873 C  CB    . THR A 1 367 ? 34.865 1.032   -20.995 1.00 21.85  ? 364  THR A CB    1 
ATOM   2874 O  OG1   . THR A 1 367 ? 35.151 -0.245  -20.405 1.00 24.48  ? 364  THR A OG1   1 
ATOM   2875 C  CG2   . THR A 1 367 ? 36.043 1.481   -21.859 1.00 26.09  ? 364  THR A CG2   1 
ATOM   2876 N  N     . GLN A 1 368 ? 33.673 1.410   -17.734 1.00 18.64  ? 365  GLN A N     1 
ATOM   2877 C  CA    . GLN A 1 368 ? 32.630 0.944   -16.844 1.00 21.06  ? 365  GLN A CA    1 
ATOM   2878 C  C     . GLN A 1 368 ? 32.611 1.787   -15.584 1.00 17.52  ? 365  GLN A C     1 
ATOM   2879 O  O     . GLN A 1 368 ? 33.658 2.126   -15.038 1.00 19.14  ? 365  GLN A O     1 
ATOM   2880 C  CB    . GLN A 1 368 ? 32.849 -0.524  -16.480 1.00 22.60  ? 365  GLN A CB    1 
ATOM   2881 C  CG    . GLN A 1 368 ? 31.765 -1.098  -15.581 1.00 26.10  ? 365  GLN A CG    1 
ATOM   2882 C  CD    . GLN A 1 368 ? 31.935 -2.585  -15.349 1.00 32.40  ? 365  GLN A CD    1 
ATOM   2883 O  OE1   . GLN A 1 368 ? 32.868 -3.018  -14.675 1.00 37.19  ? 365  GLN A OE1   1 
ATOM   2884 N  NE2   . GLN A 1 368 ? 31.034 -3.376  -15.911 1.00 37.23  ? 365  GLN A NE2   1 
ATOM   2885 N  N     . LEU A 1 369 ? 31.411 2.118   -15.129 1.00 16.98  ? 366  LEU A N     1 
ATOM   2886 C  CA    . LEU A 1 369 ? 31.249 2.812   -13.860 1.00 23.36  ? 366  LEU A CA    1 
ATOM   2887 C  C     . LEU A 1 369 ? 30.605 1.861   -12.862 1.00 23.27  ? 366  LEU A C     1 
ATOM   2888 O  O     . LEU A 1 369 ? 29.563 1.272   -13.139 1.00 23.05  ? 366  LEU A O     1 
ATOM   2889 C  CB    . LEU A 1 369 ? 30.369 4.046   -14.043 1.00 23.52  ? 366  LEU A CB    1 
ATOM   2890 C  CG    . LEU A 1 369 ? 30.107 4.861   -12.783 1.00 23.35  ? 366  LEU A CG    1 
ATOM   2891 C  CD1   . LEU A 1 369 ? 31.385 5.604   -12.393 1.00 22.60  ? 366  LEU A CD1   1 
ATOM   2892 C  CD2   . LEU A 1 369 ? 28.962 5.838   -13.024 1.00 26.96  ? 366  LEU A CD2   1 
ATOM   2893 N  N     . VAL A 1 370 ? 31.240 1.701   -11.710 1.00 20.03  ? 367  VAL A N     1 
ATOM   2894 C  CA    . VAL A 1 370 ? 30.721 0.826   -10.677 1.00 21.21  ? 367  VAL A CA    1 
ATOM   2895 C  C     . VAL A 1 370 ? 30.220 1.665   -9.514  1.00 20.85  ? 367  VAL A C     1 
ATOM   2896 O  O     . VAL A 1 370 ? 30.955 2.500   -8.984  1.00 23.14  ? 367  VAL A O     1 
ATOM   2897 C  CB    . VAL A 1 370 ? 31.797 -0.144  -10.174 1.00 21.55  ? 367  VAL A CB    1 
ATOM   2898 C  CG1   . VAL A 1 370 ? 31.261 -0.940  -8.990  1.00 28.88  ? 367  VAL A CG1   1 
ATOM   2899 C  CG2   . VAL A 1 370 ? 32.234 -1.078  -11.300 1.00 20.66  ? 367  VAL A CG2   1 
ATOM   2900 N  N     . VAL A 1 371 ? 28.969 1.442   -9.131  1.00 23.76  ? 368  VAL A N     1 
ATOM   2901 C  CA    . VAL A 1 371 ? 28.373 2.152   -8.006  1.00 27.20  ? 368  VAL A CA    1 
ATOM   2902 C  C     . VAL A 1 371 ? 28.096 1.183   -6.868  1.00 25.21  ? 368  VAL A C     1 
ATOM   2903 O  O     . VAL A 1 371 ? 27.470 0.132   -7.054  1.00 27.38  ? 368  VAL A O     1 
ATOM   2904 C  CB    . VAL A 1 371 ? 27.057 2.840   -8.403  1.00 32.04  ? 368  VAL A CB    1 
ATOM   2905 C  CG1   . VAL A 1 371 ? 26.608 3.798   -7.307  1.00 34.12  ? 368  VAL A CG1   1 
ATOM   2906 C  CG2   . VAL A 1 371 ? 27.221 3.572   -9.726  1.00 29.55  ? 368  VAL A CG2   1 
ATOM   2907 N  N     . SER A 1 372 ? 28.580 1.536   -5.687  1.00 25.67  ? 369  SER A N     1 
ATOM   2908 C  CA    . SER A 1 372 ? 28.396 0.700   -4.516  1.00 23.14  ? 369  SER A CA    1 
ATOM   2909 C  C     . SER A 1 372 ? 27.822 1.533   -3.384  1.00 22.35  ? 369  SER A C     1 
ATOM   2910 O  O     . SER A 1 372 ? 28.144 2.715   -3.238  1.00 25.01  ? 369  SER A O     1 
ATOM   2911 C  CB    . SER A 1 372 ? 29.737 0.098   -4.099  1.00 30.30  ? 369  SER A CB    1 
ATOM   2912 O  OG    . SER A 1 372 ? 29.629 -0.589  -2.864  1.00 41.01  ? 369  SER A OG    1 
ATOM   2913 N  N     . ILE A 1 373 ? 26.965 0.919   -2.586  1.00 23.23  ? 370  ILE A N     1 
ATOM   2914 C  CA    . ILE A 1 373 ? 26.421 1.604   -1.427  1.00 26.56  ? 370  ILE A CA    1 
ATOM   2915 C  C     . ILE A 1 373 ? 26.456 0.713   -0.197  1.00 31.88  ? 370  ILE A C     1 
ATOM   2916 O  O     . ILE A 1 373 ? 26.630 -0.504  -0.295  1.00 30.39  ? 370  ILE A O     1 
ATOM   2917 C  CB    . ILE A 1 373 ? 24.979 2.090   -1.678  1.00 30.83  ? 370  ILE A CB    1 
ATOM   2918 C  CG1   . ILE A 1 373 ? 24.025 0.904   -1.864  1.00 33.02  ? 370  ILE A CG1   1 
ATOM   2919 C  CG2   . ILE A 1 373 ? 24.925 3.026   -2.885  1.00 30.75  ? 370  ILE A CG2   1 
ATOM   2920 C  CD1   . ILE A 1 373 ? 22.596 1.324   -2.135  1.00 42.44  ? 370  ILE A CD1   1 
ATOM   2921 N  N     . ARG A 1 374 ? 26.315 1.338   0.964   1.00 31.78  ? 371  ARG A N     1 
ATOM   2922 C  CA    . ARG A 1 374 ? 26.091 0.615   2.204   1.00 34.22  ? 371  ARG A CA    1 
ATOM   2923 C  C     . ARG A 1 374 ? 24.796 1.160   2.777   1.00 36.73  ? 371  ARG A C     1 
ATOM   2924 O  O     . ARG A 1 374 ? 24.559 2.369   2.749   1.00 35.90  ? 371  ARG A O     1 
ATOM   2925 C  CB    . ARG A 1 374 ? 27.246 0.852   3.172   1.00 39.84  ? 371  ARG A CB    1 
ATOM   2926 C  CG    . ARG A 1 374 ? 27.270 -0.067  4.379   1.00 53.34  ? 371  ARG A CG    1 
ATOM   2927 C  CD    . ARG A 1 374 ? 28.501 0.222   5.224   1.00 67.02  ? 371  ARG A CD    1 
ATOM   2928 N  NE    . ARG A 1 374 ? 28.619 -0.669  6.374   1.00 79.36  ? 371  ARG A NE    1 
ATOM   2929 C  CZ    . ARG A 1 374 ? 29.565 -0.561  7.301   1.00 84.91  ? 371  ARG A CZ    1 
ATOM   2930 N  NH1   . ARG A 1 374 ? 30.472 0.403   7.213   1.00 84.50  ? 371  ARG A NH1   1 
ATOM   2931 N  NH2   . ARG A 1 374 ? 29.604 -1.412  8.317   1.00 87.34  ? 371  ARG A NH2   1 
ATOM   2932 N  N     . VAL A 1 375 ? 23.945 0.268   3.266   1.00 35.68  ? 372  VAL A N     1 
ATOM   2933 C  CA    . VAL A 1 375 ? 22.689 0.682   3.877   1.00 42.53  ? 372  VAL A CA    1 
ATOM   2934 C  C     . VAL A 1 375 ? 22.803 0.597   5.393   1.00 43.21  ? 372  VAL A C     1 
ATOM   2935 O  O     . VAL A 1 375 ? 23.512 -0.259  5.923   1.00 44.44  ? 372  VAL A O     1 
ATOM   2936 C  CB    . VAL A 1 375 ? 21.512 -0.176  3.388   1.00 56.31  ? 372  VAL A CB    1 
ATOM   2937 C  CG1   . VAL A 1 375 ? 21.259 0.076   1.910   1.00 57.71  ? 372  VAL A CG1   1 
ATOM   2938 C  CG2   . VAL A 1 375 ? 21.790 -1.648  3.646   1.00 63.71  ? 372  VAL A CG2   1 
ATOM   2939 N  N     . GLN A 1 376 ? 22.119 1.494   6.091   1.00 41.63  ? 373  GLN A N     1 
ATOM   2940 C  CA    . GLN A 1 376 ? 22.223 1.554   7.543   1.00 54.18  ? 373  GLN A CA    1 
ATOM   2941 C  C     . GLN A 1 376 ? 21.779 0.248   8.197   1.00 66.53  ? 373  GLN A C     1 
ATOM   2942 O  O     . GLN A 1 376 ? 20.670 -0.230  7.958   1.00 68.46  ? 373  GLN A O     1 
ATOM   2943 C  CB    . GLN A 1 376 ? 21.402 2.723   8.088   1.00 59.77  ? 373  GLN A CB    1 
ATOM   2944 C  CG    . GLN A 1 376 ? 21.697 3.059   9.538   1.00 64.16  ? 373  GLN A CG    1 
ATOM   2945 C  CD    . GLN A 1 376 ? 20.998 4.324   9.990   1.00 70.17  ? 373  GLN A CD    1 
ATOM   2946 O  OE1   . GLN A 1 376 ? 19.839 4.561   9.650   1.00 72.85  ? 373  GLN A OE1   1 
ATOM   2947 N  NE2   . GLN A 1 376 ? 21.706 5.152   10.750  1.00 72.13  ? 373  GLN A NE2   1 
ATOM   2948 N  N     . GLY A 1 377 ? 22.653 -0.325  9.018   1.00 78.03  ? 374  GLY A N     1 
ATOM   2949 C  CA    . GLY A 1 377 ? 22.344 -1.553  9.728   1.00 91.14  ? 374  GLY A CA    1 
ATOM   2950 C  C     . GLY A 1 377 ? 23.145 -2.746  9.243   1.00 95.38  ? 374  GLY A C     1 
ATOM   2951 O  O     . GLY A 1 377 ? 23.314 -3.727  9.968   1.00 99.46  ? 374  GLY A O     1 
ATOM   2952 N  N     . ASP A 1 378 ? 23.641 -2.662  8.013   1.00 90.16  ? 375  ASP A N     1 
ATOM   2953 C  CA    . ASP A 1 378 ? 24.423 -3.741  7.422   1.00 83.48  ? 375  ASP A CA    1 
ATOM   2954 C  C     . ASP A 1 378 ? 25.864 -3.695  7.919   1.00 86.70  ? 375  ASP A C     1 
ATOM   2955 O  O     . ASP A 1 378 ? 26.563 -2.701  7.725   1.00 86.38  ? 375  ASP A O     1 
ATOM   2956 C  CB    . ASP A 1 378 ? 24.391 -3.639  5.896   1.00 71.30  ? 375  ASP A CB    1 
ATOM   2957 C  CG    . ASP A 1 378 ? 24.921 -4.884  5.218   1.00 61.24  ? 375  ASP A CG    1 
ATOM   2958 O  OD1   . ASP A 1 378 ? 25.547 -5.718  5.905   1.00 58.61  ? 375  ASP A OD1   1 
ATOM   2959 O  OD2   . ASP A 1 378 ? 24.713 -5.026  3.994   1.00 55.21  ? 375  ASP A OD2   1 
ATOM   2960 N  N     . LYS A 1 379 ? 26.308 -4.773  8.559   1.00 90.12  ? 376  LYS A N     1 
ATOM   2961 C  CA    . LYS A 1 379 ? 27.660 -4.822  9.105   1.00 91.62  ? 376  LYS A CA    1 
ATOM   2962 C  C     . LYS A 1 379 ? 28.694 -4.960  7.995   1.00 84.46  ? 376  LYS A C     1 
ATOM   2963 O  O     . LYS A 1 379 ? 29.876 -4.678  8.196   1.00 83.62  ? 376  LYS A O     1 
ATOM   2964 C  CB    . LYS A 1 379 ? 27.811 -5.975  10.100  1.00 99.78  ? 376  LYS A CB    1 
ATOM   2965 C  CG    . LYS A 1 379 ? 28.978 -5.797  11.063  1.00 103.41 ? 376  LYS A CG    1 
ATOM   2966 C  CD    . LYS A 1 379 ? 29.420 -7.117  11.674  1.00 105.53 ? 376  LYS A CD    1 
ATOM   2967 C  CE    . LYS A 1 379 ? 30.189 -7.960  10.668  1.00 104.35 ? 376  LYS A CE    1 
ATOM   2968 N  NZ    . LYS A 1 379 ? 30.758 -9.186  11.291  1.00 104.40 ? 376  LYS A NZ    1 
ATOM   2969 N  N     . ARG A 1 380 ? 28.242 -5.400  6.826   1.00 77.03  ? 377  ARG A N     1 
ATOM   2970 C  CA    . ARG A 1 380 ? 29.121 -5.544  5.673   1.00 72.11  ? 377  ARG A CA    1 
ATOM   2971 C  C     . ARG A 1 380 ? 29.581 -4.180  5.170   1.00 70.51  ? 377  ARG A C     1 
ATOM   2972 O  O     . ARG A 1 380 ? 28.801 -3.227  5.128   1.00 70.38  ? 377  ARG A O     1 
ATOM   2973 C  CB    . ARG A 1 380 ? 28.407 -6.295  4.549   1.00 67.04  ? 377  ARG A CB    1 
ATOM   2974 C  CG    . ARG A 1 380 ? 27.918 -7.681  4.929   1.00 63.95  ? 377  ARG A CG    1 
ATOM   2975 C  CD    . ARG A 1 380 ? 27.137 -8.298  3.786   1.00 62.88  ? 377  ARG A CD    1 
ATOM   2976 N  NE    . ARG A 1 380 ? 25.944 -7.520  3.460   1.00 61.01  ? 377  ARG A NE    1 
ATOM   2977 C  CZ    . ARG A 1 380 ? 25.253 -7.649  2.332   1.00 54.24  ? 377  ARG A CZ    1 
ATOM   2978 N  NH1   . ARG A 1 380 ? 25.641 -8.521  1.410   1.00 53.04  ? 377  ARG A NH1   1 
ATOM   2979 N  NH2   . ARG A 1 380 ? 24.178 -6.903  2.119   1.00 47.47  ? 377  ARG A NH2   1 
ATOM   2980 N  N     . LEU A 1 381 ? 30.851 -4.092  4.787   1.00 69.05  ? 378  LEU A N     1 
ATOM   2981 C  CA    . LEU A 1 381 ? 31.411 -2.846  4.277   1.00 68.42  ? 378  LEU A CA    1 
ATOM   2982 C  C     . LEU A 1 381 ? 30.684 -2.384  3.016   1.00 63.81  ? 378  LEU A C     1 
ATOM   2983 O  O     . LEU A 1 381 ? 30.573 -1.185  2.757   1.00 64.52  ? 378  LEU A O     1 
ATOM   2984 C  CB    . LEU A 1 381 ? 32.911 -3.005  4.012   1.00 72.43  ? 378  LEU A CB    1 
ATOM   2985 C  CG    . LEU A 1 381 ? 33.859 -2.786  5.199   1.00 74.40  ? 378  LEU A CG    1 
ATOM   2986 C  CD1   . LEU A 1 381 ? 33.274 -3.309  6.504   1.00 74.86  ? 378  LEU A CD1   1 
ATOM   2987 C  CD2   . LEU A 1 381 ? 35.220 -3.413  4.924   1.00 74.74  ? 378  LEU A CD2   1 
ATOM   2988 N  N     . SER A 1 382 ? 30.189 -3.340  2.236   1.00 58.16  ? 379  SER A N     1 
ATOM   2989 C  CA    . SER A 1 382 ? 29.403 -3.032  1.045   1.00 53.63  ? 379  SER A CA    1 
ATOM   2990 C  C     . SER A 1 382 ? 28.081 -3.779  1.075   1.00 50.73  ? 379  SER A C     1 
ATOM   2991 O  O     . SER A 1 382 ? 28.047 -4.981  1.333   1.00 52.05  ? 379  SER A O     1 
ATOM   2992 C  CB    . SER A 1 382 ? 30.169 -3.399  -0.226  1.00 51.10  ? 379  SER A CB    1 
ATOM   2993 O  OG    . SER A 1 382 ? 29.315 -3.358  -1.358  1.00 52.40  ? 379  SER A OG    1 
ATOM   2994 N  N     . SER A 1 383 ? 26.992 -3.066  0.809   1.00 47.34  ? 380  SER A N     1 
ATOM   2995 C  CA    . SER A 1 383 ? 25.667 -3.674  0.814   1.00 44.48  ? 380  SER A CA    1 
ATOM   2996 C  C     . SER A 1 383 ? 25.241 -4.113  -0.580  1.00 37.55  ? 380  SER A C     1 
ATOM   2997 O  O     . SER A 1 383 ? 24.530 -5.105  -0.740  1.00 40.44  ? 380  SER A O     1 
ATOM   2998 C  CB    . SER A 1 383 ? 24.622 -2.708  1.388   1.00 48.73  ? 380  SER A CB    1 
ATOM   2999 O  OG    . SER A 1 383 ? 24.807 -2.499  2.778   1.00 47.03  ? 380  SER A OG    1 
ATOM   3000 N  N     . LEU A 1 384 ? 25.677 -3.368  -1.588  1.00 35.57  ? 381  LEU A N     1 
ATOM   3001 C  CA    . LEU A 1 384 ? 25.230 -3.610  -2.951  1.00 32.80  ? 381  LEU A CA    1 
ATOM   3002 C  C     . LEU A 1 384 ? 26.153 -2.952  -3.956  1.00 30.95  ? 381  LEU A C     1 
ATOM   3003 O  O     . LEU A 1 384 ? 26.605 -1.827  -3.750  1.00 30.92  ? 381  LEU A O     1 
ATOM   3004 C  CB    . LEU A 1 384 ? 23.807 -3.078  -3.143  1.00 38.23  ? 381  LEU A CB    1 
ATOM   3005 C  CG    . LEU A 1 384 ? 23.294 -2.965  -4.583  1.00 45.15  ? 381  LEU A CG    1 
ATOM   3006 C  CD1   . LEU A 1 384 ? 21.809 -3.250  -4.662  1.00 49.24  ? 381  LEU A CD1   1 
ATOM   3007 C  CD2   . LEU A 1 384 ? 23.612 -1.601  -5.180  1.00 45.62  ? 381  LEU A CD2   1 
ATOM   3008 N  N     . ARG A 1 385 ? 26.429 -3.662  -5.045  1.00 32.64  ? 382  ARG A N     1 
ATOM   3009 C  CA    . ARG A 1 385 ? 27.250 -3.129  -6.117  1.00 31.66  ? 382  ARG A CA    1 
ATOM   3010 C  C     . ARG A 1 385 ? 26.514 -3.303  -7.439  1.00 32.87  ? 382  ARG A C     1 
ATOM   3011 O  O     . ARG A 1 385 ? 25.935 -4.356  -7.708  1.00 34.17  ? 382  ARG A O     1 
ATOM   3012 C  CB    . ARG A 1 385 ? 28.597 -3.854  -6.167  1.00 39.37  ? 382  ARG A CB    1 
ATOM   3013 C  CG    . ARG A 1 385 ? 29.671 -3.111  -6.926  1.00 49.08  ? 382  ARG A CG    1 
ATOM   3014 C  CD    . ARG A 1 385 ? 30.689 -4.060  -7.534  1.00 55.15  ? 382  ARG A CD    1 
ATOM   3015 N  NE    . ARG A 1 385 ? 30.183 -4.681  -8.755  1.00 60.41  ? 382  ARG A NE    1 
ATOM   3016 C  CZ    . ARG A 1 385 ? 30.931 -4.955  -9.820  1.00 57.28  ? 382  ARG A CZ    1 
ATOM   3017 N  NH1   . ARG A 1 385 ? 30.382 -5.516  -10.888 1.00 56.36  ? 382  ARG A NH1   1 
ATOM   3018 N  NH2   . ARG A 1 385 ? 32.226 -4.667  -9.817  1.00 53.42  ? 382  ARG A NH2   1 
ATOM   3019 N  N     . ARG A 1 386 ? 26.518 -2.261  -8.257  1.00 27.19  ? 383  ARG A N     1 
ATOM   3020 C  CA    . ARG A 1 386 ? 25.872 -2.315  -9.559  1.00 28.46  ? 383  ARG A CA    1 
ATOM   3021 C  C     . ARG A 1 386 ? 26.751 -1.566  -10.540 1.00 25.49  ? 383  ARG A C     1 
ATOM   3022 O  O     . ARG A 1 386 ? 27.473 -0.663  -10.151 1.00 26.25  ? 383  ARG A O     1 
ATOM   3023 C  CB    . ARG A 1 386 ? 24.481 -1.679  -9.504  1.00 31.57  ? 383  ARG A CB    1 
ATOM   3024 C  CG    . ARG A 1 386 ? 23.438 -2.455  -8.712  1.00 32.69  ? 383  ARG A CG    1 
ATOM   3025 C  CD    . ARG A 1 386 ? 22.981 -3.706  -9.452  1.00 31.02  ? 383  ARG A CD    1 
ATOM   3026 N  NE    . ARG A 1 386 ? 21.915 -4.407  -8.746  1.00 35.50  ? 383  ARG A NE    1 
ATOM   3027 C  CZ    . ARG A 1 386 ? 22.113 -5.273  -7.758  1.00 38.72  ? 383  ARG A CZ    1 
ATOM   3028 N  NH1   . ARG A 1 386 ? 23.345 -5.551  -7.352  1.00 42.90  ? 383  ARG A NH1   1 
ATOM   3029 N  NH2   . ARG A 1 386 ? 21.076 -5.863  -7.177  1.00 41.64  ? 383  ARG A NH2   1 
ATOM   3030 N  N     . CYS A 1 387 ? 26.698 -1.933  -11.812 1.00 31.69  ? 384  CYS A N     1 
ATOM   3031 C  CA    . CYS A 1 387 ? 27.539 -1.261  -12.792 1.00 28.48  ? 384  CYS A CA    1 
ATOM   3032 C  C     . CYS A 1 387 ? 26.742 -0.748  -13.982 1.00 32.78  ? 384  CYS A C     1 
ATOM   3033 O  O     . CYS A 1 387 ? 25.643 -1.225  -14.262 1.00 33.84  ? 384  CYS A O     1 
ATOM   3034 C  CB    . CYS A 1 387 ? 28.666 -2.189  -13.258 1.00 26.51  ? 384  CYS A CB    1 
ATOM   3035 S  SG    . CYS A 1 387 ? 28.106 -3.716  -14.043 1.00 54.49  ? 384  CYS A SG    1 
ATOM   3036 N  N     . CYS A 1 388 ? 27.303 0.231   -14.680 1.00 31.73  ? 385  CYS A N     1 
ATOM   3037 C  CA    . CYS A 1 388 ? 26.729 0.681   -15.941 1.00 36.87  ? 385  CYS A CA    1 
ATOM   3038 C  C     . CYS A 1 388 ? 27.842 1.158   -16.861 1.00 31.85  ? 385  CYS A C     1 
ATOM   3039 O  O     . CYS A 1 388 ? 28.999 1.254   -16.451 1.00 28.81  ? 385  CYS A O     1 
ATOM   3040 C  CB    . CYS A 1 388 ? 25.705 1.794   -15.712 1.00 38.02  ? 385  CYS A CB    1 
ATOM   3041 S  SG    . CYS A 1 388 ? 26.385 3.292   -14.976 1.00 34.37  ? 385  CYS A SG    1 
ATOM   3042 N  N     . ALA A 1 389 ? 27.492 1.453   -18.107 1.00 31.99  ? 386  ALA A N     1 
ATOM   3043 C  CA    . ALA A 1 389 ? 28.467 1.941   -19.073 1.00 29.09  ? 386  ALA A CA    1 
ATOM   3044 C  C     . ALA A 1 389 ? 28.975 3.330   -18.702 1.00 26.69  ? 386  ALA A C     1 
ATOM   3045 O  O     . ALA A 1 389 ? 28.202 4.205   -18.321 1.00 29.99  ? 386  ALA A O     1 
ATOM   3046 C  CB    . ALA A 1 389 ? 27.858 1.961   -20.472 1.00 28.20  ? 386  ALA A CB    1 
ATOM   3047 N  N     . LEU A 1 390 ? 30.282 3.522   -18.820 1.00 23.58  ? 387  LEU A N     1 
ATOM   3048 C  CA    . LEU A 1 390 ? 30.885 4.841   -18.672 1.00 25.47  ? 387  LEU A CA    1 
ATOM   3049 C  C     . LEU A 1 390 ? 31.289 5.259   -20.074 1.00 24.98  ? 387  LEU A C     1 
ATOM   3050 O  O     . LEU A 1 390 ? 32.328 4.834   -20.581 1.00 26.54  ? 387  LEU A O     1 
ATOM   3051 C  CB    . LEU A 1 390 ? 32.114 4.776   -17.766 1.00 22.42  ? 387  LEU A CB    1 
ATOM   3052 C  CG    . LEU A 1 390 ? 32.524 6.067   -17.056 1.00 24.27  ? 387  LEU A CG    1 
ATOM   3053 C  CD1   . LEU A 1 390 ? 33.637 5.775   -16.066 1.00 24.16  ? 387  LEU A CD1   1 
ATOM   3054 C  CD2   . LEU A 1 390 ? 32.938 7.151   -18.045 1.00 29.45  ? 387  LEU A CD2   1 
ATOM   3055 N  N     . THR A 1 391 ? 30.459 6.073   -20.708 1.00 27.10  ? 388  THR A N     1 
ATOM   3056 C  CA    . THR A 1 391 ? 30.658 6.387   -22.116 1.00 33.42  ? 388  THR A CA    1 
ATOM   3057 C  C     . THR A 1 391 ? 31.161 7.808   -22.321 1.00 33.91  ? 388  THR A C     1 
ATOM   3058 O  O     . THR A 1 391 ? 31.660 8.146   -23.393 1.00 36.08  ? 388  THR A O     1 
ATOM   3059 C  CB    . THR A 1 391 ? 29.363 6.208   -22.919 1.00 37.33  ? 388  THR A CB    1 
ATOM   3060 O  OG1   . THR A 1 391 ? 28.356 7.079   -22.392 1.00 39.08  ? 388  THR A OG1   1 
ATOM   3061 C  CG2   . THR A 1 391 ? 28.876 4.762   -22.843 1.00 30.21  ? 388  THR A CG2   1 
ATOM   3062 N  N     . ARG A 1 392 ? 31.011 8.642   -21.297 1.00 30.85  ? 389  ARG A N     1 
ATOM   3063 C  CA    . ARG A 1 392 ? 31.459 10.025  -21.370 1.00 32.49  ? 389  ARG A CA    1 
ATOM   3064 C  C     . ARG A 1 392 ? 31.988 10.505  -20.022 1.00 26.80  ? 389  ARG A C     1 
ATOM   3065 O  O     . ARG A 1 392 ? 31.383 10.260  -18.976 1.00 28.67  ? 389  ARG A O     1 
ATOM   3066 C  CB    . ARG A 1 392 ? 30.328 10.943  -21.846 1.00 37.97  ? 389  ARG A CB    1 
ATOM   3067 C  CG    . ARG A 1 392 ? 30.030 10.840  -23.338 1.00 49.90  ? 389  ARG A CG    1 
ATOM   3068 C  CD    . ARG A 1 392 ? 28.947 11.817  -23.769 1.00 67.11  ? 389  ARG A CD    1 
ATOM   3069 N  NE    . ARG A 1 392 ? 29.239 13.181  -23.339 1.00 81.39  ? 389  ARG A NE    1 
ATOM   3070 C  CZ    . ARG A 1 392 ? 28.551 13.834  -22.408 1.00 92.37  ? 389  ARG A CZ    1 
ATOM   3071 N  NH1   . ARG A 1 392 ? 27.518 13.252  -21.815 1.00 97.00  ? 389  ARG A NH1   1 
ATOM   3072 N  NH2   . ARG A 1 392 ? 28.889 15.073  -22.076 1.00 94.93  ? 389  ARG A NH2   1 
ATOM   3073 N  N     . TYR A 1 393 ? 33.129 11.179  -20.053 1.00 24.68  ? 390  TYR A N     1 
ATOM   3074 C  CA    . TYR A 1 393 ? 33.677 11.790  -18.848 1.00 21.69  ? 390  TYR A CA    1 
ATOM   3075 C  C     . TYR A 1 393 ? 32.915 13.076  -18.551 1.00 30.01  ? 390  TYR A C     1 
ATOM   3076 O  O     . TYR A 1 393 ? 33.380 14.179  -18.853 1.00 31.18  ? 390  TYR A O     1 
ATOM   3077 C  CB    . TYR A 1 393 ? 35.167 12.083  -19.023 1.00 23.78  ? 390  TYR A CB    1 
ATOM   3078 C  CG    . TYR A 1 393 ? 36.067 10.870  -18.922 1.00 23.26  ? 390  TYR A CG    1 
ATOM   3079 C  CD1   . TYR A 1 393 ? 37.446 11.003  -18.991 1.00 18.89  ? 390  TYR A CD1   1 
ATOM   3080 C  CD2   . TYR A 1 393 ? 35.541 9.593   -18.752 1.00 26.85  ? 390  TYR A CD2   1 
ATOM   3081 C  CE1   . TYR A 1 393 ? 38.277 9.916   -18.894 1.00 18.33  ? 390  TYR A CE1   1 
ATOM   3082 C  CE2   . TYR A 1 393 ? 36.370 8.489   -18.655 1.00 25.60  ? 390  TYR A CE2   1 
ATOM   3083 C  CZ    . TYR A 1 393 ? 37.736 8.653   -18.728 1.00 19.46  ? 390  TYR A CZ    1 
ATOM   3084 O  OH    . TYR A 1 393 ? 38.564 7.560   -18.624 1.00 20.95  ? 390  TYR A OH    1 
ATOM   3085 N  N     . ASP A 1 394 ? 31.727 12.925  -17.979 1.00 26.35  ? 391  ASP A N     1 
ATOM   3086 C  CA    . ASP A 1 394 ? 30.886 14.063  -17.643 1.00 23.45  ? 391  ASP A CA    1 
ATOM   3087 C  C     . ASP A 1 394 ? 30.260 13.787  -16.287 1.00 22.23  ? 391  ASP A C     1 
ATOM   3088 O  O     . ASP A 1 394 ? 29.524 12.811  -16.127 1.00 27.70  ? 391  ASP A O     1 
ATOM   3089 C  CB    . ASP A 1 394 ? 29.806 14.248  -18.707 1.00 30.47  ? 391  ASP A CB    1 
ATOM   3090 C  CG    . ASP A 1 394 ? 28.891 15.409  -18.403 1.00 39.49  ? 391  ASP A CG    1 
ATOM   3091 O  OD1   . ASP A 1 394 ? 27.950 15.224  -17.606 1.00 37.64  ? 391  ASP A OD1   1 
ATOM   3092 O  OD2   . ASP A 1 394 ? 29.116 16.505  -18.957 1.00 55.47  ? 391  ASP A OD2   1 
ATOM   3093 N  N     . ALA A 1 395 ? 30.573 14.633  -15.307 1.00 21.65  ? 392  ALA A N     1 
ATOM   3094 C  CA    . ALA A 1 395 ? 30.134 14.412  -13.930 1.00 25.59  ? 392  ALA A CA    1 
ATOM   3095 C  C     . ALA A 1 395 ? 28.611 14.346  -13.785 1.00 23.45  ? 392  ALA A C     1 
ATOM   3096 O  O     . ALA A 1 395 ? 28.084 13.503  -13.061 1.00 29.38  ? 392  ALA A O     1 
ATOM   3097 C  CB    . ALA A 1 395 ? 30.725 15.485  -13.000 1.00 22.48  ? 392  ALA A CB    1 
ATOM   3098 N  N     . HIS A 1 396 ? 27.898 15.245  -14.460 1.00 27.76  ? 393  HIS A N     1 
ATOM   3099 C  CA    . HIS A 1 396 ? 26.443 15.237  -14.387 1.00 33.85  ? 393  HIS A CA    1 
ATOM   3100 C  C     . HIS A 1 396 ? 25.844 13.940  -14.915 1.00 30.72  ? 393  HIS A C     1 
ATOM   3101 O  O     . HIS A 1 396 ? 24.911 13.399  -14.324 1.00 33.25  ? 393  HIS A O     1 
ATOM   3102 C  CB    . HIS A 1 396 ? 25.851 16.450  -15.110 1.00 34.86  ? 393  HIS A CB    1 
ATOM   3103 C  CG    . HIS A 1 396 ? 26.004 17.732  -14.351 1.00 51.09  ? 393  HIS A CG    1 
ATOM   3104 N  ND1   . HIS A 1 396 ? 27.077 18.579  -14.526 1.00 59.07  ? 393  HIS A ND1   1 
ATOM   3105 C  CD2   . HIS A 1 396 ? 25.229 18.301  -13.397 1.00 58.35  ? 393  HIS A CD2   1 
ATOM   3106 C  CE1   . HIS A 1 396 ? 26.951 19.620  -13.722 1.00 62.09  ? 393  HIS A CE1   1 
ATOM   3107 N  NE2   . HIS A 1 396 ? 25.838 19.475  -13.026 1.00 61.30  ? 393  HIS A NE2   1 
ATOM   3108 N  N     . LYS A 1 397 ? 26.378 13.443  -16.027 1.00 28.20  ? 394  LYS A N     1 
ATOM   3109 C  CA    . LYS A 1 397 ? 25.912 12.179  -16.582 1.00 29.67  ? 394  LYS A CA    1 
ATOM   3110 C  C     . LYS A 1 397 ? 26.243 10.989  -15.680 1.00 29.69  ? 394  LYS A C     1 
ATOM   3111 O  O     . LYS A 1 397 ? 25.423 10.082  -15.509 1.00 32.26  ? 394  LYS A O     1 
ATOM   3112 C  CB    . LYS A 1 397 ? 26.485 11.943  -17.983 1.00 35.49  ? 394  LYS A CB    1 
ATOM   3113 C  CG    . LYS A 1 397 ? 26.189 10.549  -18.530 1.00 39.78  ? 394  LYS A CG    1 
ATOM   3114 C  CD    . LYS A 1 397 ? 26.661 10.386  -19.965 1.00 44.73  ? 394  LYS A CD    1 
ATOM   3115 C  CE    . LYS A 1 397 ? 26.522 8.942   -20.430 1.00 45.19  ? 394  LYS A CE    1 
ATOM   3116 N  NZ    . LYS A 1 397 ? 25.136 8.430   -20.255 1.00 47.18  ? 394  LYS A NZ    1 
ATOM   3117 N  N     . MET A 1 398 ? 27.444 10.984  -15.113 1.00 25.78  ? 395  MET A N     1 
ATOM   3118 C  CA    . MET A 1 398 ? 27.853 9.884   -14.247 1.00 24.22  ? 395  MET A CA    1 
ATOM   3119 C  C     . MET A 1 398 ? 27.007 9.843   -12.972 1.00 28.59  ? 395  MET A C     1 
ATOM   3120 O  O     . MET A 1 398 ? 26.577 8.772   -12.547 1.00 25.91  ? 395  MET A O     1 
ATOM   3121 C  CB    . MET A 1 398 ? 29.352 9.961   -13.920 1.00 23.73  ? 395  MET A CB    1 
ATOM   3122 C  CG    . MET A 1 398 ? 30.258 9.554   -15.087 1.00 21.83  ? 395  MET A CG    1 
ATOM   3123 S  SD    . MET A 1 398 ? 32.005 9.371   -14.660 1.00 28.65  ? 395  MET A SD    1 
ATOM   3124 C  CE    . MET A 1 398 ? 32.457 11.092  -14.469 1.00 31.41  ? 395  MET A CE    1 
ATOM   3125 N  N     . SER A 1 399 ? 26.767 11.006  -12.370 1.00 28.27  ? 396  SER A N     1 
ATOM   3126 C  CA    . SER A 1 399 ? 25.950 11.074  -11.155 1.00 29.34  ? 396  SER A CA    1 
ATOM   3127 C  C     . SER A 1 399 ? 24.505 10.650  -11.421 1.00 28.54  ? 396  SER A C     1 
ATOM   3128 O  O     . SER A 1 399 ? 23.882 9.978   -10.596 1.00 31.10  ? 396  SER A O     1 
ATOM   3129 C  CB    . SER A 1 399 ? 26.001 12.472  -10.517 1.00 29.42  ? 396  SER A CB    1 
ATOM   3130 O  OG    . SER A 1 399 ? 25.400 13.463  -11.337 1.00 32.96  ? 396  SER A OG    1 
ATOM   3131 N  N     . HIS A 1 400 ? 23.973 11.044  -12.572 1.00 28.58  ? 397  HIS A N     1 
ATOM   3132 C  CA    . HIS A 1 400 ? 22.609 10.677  -12.934 1.00 33.84  ? 397  HIS A CA    1 
ATOM   3133 C  C     . HIS A 1 400 ? 22.534 9.173   -13.206 1.00 34.57  ? 397  HIS A C     1 
ATOM   3134 O  O     . HIS A 1 400 ? 21.608 8.492   -12.760 1.00 34.99  ? 397  HIS A O     1 
ATOM   3135 C  CB    . HIS A 1 400 ? 22.149 11.467  -14.159 1.00 40.69  ? 397  HIS A CB    1 
ATOM   3136 C  CG    . HIS A 1 400 ? 20.710 11.254  -14.511 1.00 55.34  ? 397  HIS A CG    1 
ATOM   3137 N  ND1   . HIS A 1 400 ? 20.282 10.199  -15.288 1.00 62.71  ? 397  HIS A ND1   1 
ATOM   3138 C  CD2   . HIS A 1 400 ? 19.600 11.961  -14.191 1.00 61.87  ? 397  HIS A CD2   1 
ATOM   3139 C  CE1   . HIS A 1 400 ? 18.970 10.265  -15.433 1.00 62.74  ? 397  HIS A CE1   1 
ATOM   3140 N  NE2   . HIS A 1 400 ? 18.532 11.325  -14.777 1.00 64.03  ? 397  HIS A NE2   1 
ATOM   3141 N  N     . ASP A 1 401 ? 23.520 8.655   -13.929 1.00 32.26  ? 398  ASP A N     1 
ATOM   3142 C  CA    . ASP A 1 401 ? 23.581 7.226   -14.200 1.00 31.12  ? 398  ASP A CA    1 
ATOM   3143 C  C     . ASP A 1 401 ? 23.724 6.406   -12.922 1.00 30.89  ? 398  ASP A C     1 
ATOM   3144 O  O     . ASP A 1 401 ? 23.116 5.348   -12.788 1.00 33.70  ? 398  ASP A O     1 
ATOM   3145 C  CB    . ASP A 1 401 ? 24.723 6.895   -15.160 1.00 32.02  ? 398  ASP A CB    1 
ATOM   3146 C  CG    . ASP A 1 401 ? 24.443 7.348   -16.577 1.00 36.37  ? 398  ASP A CG    1 
ATOM   3147 O  OD1   . ASP A 1 401 ? 23.280 7.702   -16.869 1.00 35.33  ? 398  ASP A OD1   1 
ATOM   3148 O  OD2   . ASP A 1 401 ? 25.380 7.328   -17.401 1.00 38.37  ? 398  ASP A OD2   1 
ATOM   3149 N  N     . ALA A 1 402 ? 24.534 6.890   -11.984 1.00 30.77  ? 399  ALA A N     1 
ATOM   3150 C  CA    . ALA A 1 402 ? 24.723 6.176   -10.729 1.00 29.98  ? 399  ALA A CA    1 
ATOM   3151 C  C     . ALA A 1 402 ? 23.412 6.108   -9.961  1.00 31.79  ? 399  ALA A C     1 
ATOM   3152 O  O     . ALA A 1 402 ? 23.053 5.065   -9.412  1.00 33.61  ? 399  ALA A O     1 
ATOM   3153 C  CB    . ALA A 1 402 ? 25.805 6.843   -9.881  1.00 27.57  ? 399  ALA A CB    1 
ATOM   3154 N  N     . PHE A 1 403 ? 22.694 7.225   -9.923  1.00 29.70  ? 400  PHE A N     1 
ATOM   3155 C  CA    . PHE A 1 403 ? 21.412 7.255   -9.235  1.00 30.39  ? 400  PHE A CA    1 
ATOM   3156 C  C     . PHE A 1 403 ? 20.455 6.254   -9.861  1.00 37.40  ? 400  PHE A C     1 
ATOM   3157 O  O     . PHE A 1 403 ? 19.817 5.468   -9.160  1.00 39.94  ? 400  PHE A O     1 
ATOM   3158 C  CB    . PHE A 1 403 ? 20.797 8.655   -9.262  1.00 34.80  ? 400  PHE A CB    1 
ATOM   3159 C  CG    . PHE A 1 403 ? 19.510 8.754   -8.505  1.00 41.95  ? 400  PHE A CG    1 
ATOM   3160 C  CD1   . PHE A 1 403 ? 18.295 8.653   -9.164  1.00 43.98  ? 400  PHE A CD1   1 
ATOM   3161 C  CD2   . PHE A 1 403 ? 19.509 8.929   -7.132  1.00 43.02  ? 400  PHE A CD2   1 
ATOM   3162 C  CE1   . PHE A 1 403 ? 17.108 8.732   -8.470  1.00 48.68  ? 400  PHE A CE1   1 
ATOM   3163 C  CE2   . PHE A 1 403 ? 18.318 9.011   -6.433  1.00 49.71  ? 400  PHE A CE2   1 
ATOM   3164 C  CZ    . PHE A 1 403 ? 17.119 8.913   -7.103  1.00 50.40  ? 400  PHE A CZ    1 
ATOM   3165 N  N     . THR A 1 404 ? 20.364 6.283   -11.186 1.00 36.90  ? 401  THR A N     1 
ATOM   3166 C  CA    . THR A 1 404 ? 19.456 5.400   -11.908 1.00 39.31  ? 401  THR A CA    1 
ATOM   3167 C  C     . THR A 1 404 ? 19.694 3.945   -11.533 1.00 36.27  ? 401  THR A C     1 
ATOM   3168 O  O     . THR A 1 404 ? 18.753 3.158   -11.396 1.00 44.87  ? 401  THR A O     1 
ATOM   3169 C  CB    . THR A 1 404 ? 19.602 5.567   -13.432 1.00 39.94  ? 401  THR A CB    1 
ATOM   3170 O  OG1   . THR A 1 404 ? 19.236 6.902   -13.805 1.00 40.23  ? 401  THR A OG1   1 
ATOM   3171 C  CG2   . THR A 1 404 ? 18.695 4.585   -14.166 1.00 39.04  ? 401  THR A CG2   1 
ATOM   3172 N  N     . VAL A 1 405 ? 20.961 3.597   -11.358 1.00 31.32  ? 402  VAL A N     1 
ATOM   3173 C  CA    . VAL A 1 405 ? 21.348 2.230   -11.055 1.00 38.44  ? 402  VAL A CA    1 
ATOM   3174 C  C     . VAL A 1 405 ? 20.995 1.814   -9.624  1.00 39.14  ? 402  VAL A C     1 
ATOM   3175 O  O     . VAL A 1 405 ? 20.776 0.634   -9.358  1.00 41.38  ? 402  VAL A O     1 
ATOM   3176 C  CB    . VAL A 1 405 ? 22.853 2.021   -11.316 1.00 50.25  ? 402  VAL A CB    1 
ATOM   3177 C  CG1   . VAL A 1 405 ? 23.245 0.608   -11.007 1.00 52.63  ? 402  VAL A CG1   1 
ATOM   3178 C  CG2   . VAL A 1 405 ? 23.182 2.342   -12.764 1.00 52.25  ? 402  VAL A CG2   1 
ATOM   3179 N  N     . ILE A 1 406 ? 20.927 2.777   -8.706  1.00 37.38  ? 403  ILE A N     1 
ATOM   3180 C  CA    . ILE A 1 406 ? 20.634 2.460   -7.307  1.00 41.11  ? 403  ILE A CA    1 
ATOM   3181 C  C     . ILE A 1 406 ? 19.273 2.949   -6.801  1.00 45.79  ? 403  ILE A C     1 
ATOM   3182 O  O     . ILE A 1 406 ? 18.889 2.649   -5.668  1.00 47.82  ? 403  ILE A O     1 
ATOM   3183 C  CB    . ILE A 1 406 ? 21.719 3.019   -6.355  1.00 44.30  ? 403  ILE A CB    1 
ATOM   3184 C  CG1   . ILE A 1 406 ? 21.634 4.546   -6.279  1.00 40.87  ? 403  ILE A CG1   1 
ATOM   3185 C  CG2   . ILE A 1 406 ? 23.095 2.564   -6.791  1.00 41.50  ? 403  ILE A CG2   1 
ATOM   3186 C  CD1   . ILE A 1 406 ? 22.460 5.145   -5.165  1.00 44.61  ? 403  ILE A CD1   1 
ATOM   3187 N  N     . LYS A 1 407 ? 18.548 3.699   -7.625  1.00 43.55  ? 404  LYS A N     1 
ATOM   3188 C  CA    . LYS A 1 407 ? 17.320 4.337   -7.163  1.00 49.14  ? 404  LYS A CA    1 
ATOM   3189 C  C     . LYS A 1 407 ? 16.293 3.307   -6.701  1.00 56.45  ? 404  LYS A C     1 
ATOM   3190 O  O     . LYS A 1 407 ? 15.439 3.600   -5.862  1.00 55.27  ? 404  LYS A O     1 
ATOM   3191 C  CB    . LYS A 1 407 ? 16.730 5.246   -8.244  1.00 52.09  ? 404  LYS A CB    1 
ATOM   3192 C  CG    . LYS A 1 407 ? 16.132 4.515   -9.432  1.00 52.55  ? 404  LYS A CG    1 
ATOM   3193 C  CD    . LYS A 1 407 ? 15.659 5.500   -10.486 1.00 56.74  ? 404  LYS A CD    1 
ATOM   3194 C  CE    . LYS A 1 407 ? 15.048 4.784   -11.679 1.00 64.72  ? 404  LYS A CE    1 
ATOM   3195 N  NZ    . LYS A 1 407 ? 16.018 3.850   -12.314 1.00 67.29  ? 404  LYS A NZ    1 
ATOM   3196 N  N     . ASN A 1 408 ? 16.394 2.097   -7.240  1.00 62.10  ? 405  ASN A N     1 
ATOM   3197 C  CA    . ASN A 1 408 ? 15.473 1.021   -6.894  1.00 69.05  ? 405  ASN A CA    1 
ATOM   3198 C  C     . ASN A 1 408 ? 15.712 0.472   -5.490  1.00 63.22  ? 405  ASN A C     1 
ATOM   3199 O  O     . ASN A 1 408 ? 14.926 -0.329  -4.986  1.00 65.42  ? 405  ASN A O     1 
ATOM   3200 C  CB    . ASN A 1 408 ? 15.561 -0.112  -7.919  1.00 77.43  ? 405  ASN A CB    1 
ATOM   3201 C  CG    . ASN A 1 408 ? 15.297 0.362   -9.336  1.00 83.92  ? 405  ASN A CG    1 
ATOM   3202 O  OD1   . ASN A 1 408 ? 16.011 -0.005  -10.269 1.00 83.68  ? 405  ASN A OD1   1 
ATOM   3203 N  ND2   . ASN A 1 408 ? 14.270 1.188   -9.501  1.00 87.03  ? 405  ASN A ND2   1 
ATOM   3204 N  N     . CYS A 1 409 ? 16.798 0.911   -4.861  1.00 56.06  ? 406  CYS A N     1 
ATOM   3205 C  CA    . CYS A 1 409 ? 17.144 0.447   -3.523  1.00 51.64  ? 406  CYS A CA    1 
ATOM   3206 C  C     . CYS A 1 409 ? 16.327 1.165   -2.461  1.00 53.63  ? 406  CYS A C     1 
ATOM   3207 O  O     . CYS A 1 409 ? 16.265 0.729   -1.312  1.00 55.09  ? 406  CYS A O     1 
ATOM   3208 C  CB    . CYS A 1 409 ? 18.636 0.646   -3.251  1.00 49.80  ? 406  CYS A CB    1 
ATOM   3209 S  SG    . CYS A 1 409 ? 19.711 -0.398  -4.254  1.00 62.63  ? 406  CYS A SG    1 
ATOM   3210 N  N     . ASN A 1 410 ? 15.703 2.269   -2.853  1.00 52.46  ? 407  ASN A N     1 
ATOM   3211 C  CA    . ASN A 1 410 ? 14.894 3.059   -1.937  1.00 48.02  ? 407  ASN A CA    1 
ATOM   3212 C  C     . ASN A 1 410 ? 13.547 2.387   -1.662  1.00 56.30  ? 407  ASN A C     1 
ATOM   3213 O  O     . ASN A 1 410 ? 12.758 2.167   -2.579  1.00 62.03  ? 407  ASN A O     1 
ATOM   3214 C  CB    . ASN A 1 410 ? 14.686 4.464   -2.508  1.00 48.39  ? 407  ASN A CB    1 
ATOM   3215 C  CG    . ASN A 1 410 ? 13.995 5.392   -1.538  1.00 53.55  ? 407  ASN A CG    1 
ATOM   3216 O  OD1   . ASN A 1 410 ? 13.773 5.045   -0.379  1.00 59.67  ? 407  ASN A OD1   1 
ATOM   3217 N  ND2   . ASN A 1 410 ? 13.650 6.586   -2.007  1.00 58.65  ? 407  ASN A ND2   1 
ATOM   3218 N  N     . THR A 1 411 ? 13.298 2.060   -0.396  1.00 56.86  ? 408  THR A N     1 
ATOM   3219 C  CA    . THR A 1 411 ? 12.061 1.395   0.004   1.00 64.61  ? 408  THR A CA    1 
ATOM   3220 C  C     . THR A 1 411 ? 10.963 2.415   0.283   1.00 67.00  ? 408  THR A C     1 
ATOM   3221 O  O     . THR A 1 411 ? 9.778  2.084   0.281   1.00 72.63  ? 408  THR A O     1 
ATOM   3222 C  CB    . THR A 1 411 ? 12.265 0.515   1.257   1.00 71.08  ? 408  THR A CB    1 
ATOM   3223 O  OG1   . THR A 1 411 ? 13.231 -0.504  0.977   1.00 77.01  ? 408  THR A OG1   1 
ATOM   3224 C  CG2   . THR A 1 411 ? 10.960 -0.146  1.669   1.00 81.10  ? 408  THR A CG2   1 
ATOM   3225 N  N     . SER A 1 412 ? 11.369 3.658   0.514   1.00 67.81  ? 409  SER A N     1 
ATOM   3226 C  CA    . SER A 1 412 ? 10.439 4.730   0.850   1.00 73.56  ? 409  SER A CA    1 
ATOM   3227 C  C     . SER A 1 412 ? 9.217  4.770   -0.060  1.00 86.49  ? 409  SER A C     1 
ATOM   3228 O  O     . SER A 1 412 ? 9.332  4.642   -1.279  1.00 90.43  ? 409  SER A O     1 
ATOM   3229 C  CB    . SER A 1 412 ? 11.148 6.085   0.813   1.00 71.11  ? 409  SER A CB    1 
ATOM   3230 O  OG    . SER A 1 412 ? 10.235 7.145   1.044   1.00 73.29  ? 409  SER A OG    1 
ATOM   3231 N  N     . GLY A 1 413 ? 8.048  4.949   0.544   1.00 92.83  ? 410  GLY A N     1 
ATOM   3232 C  CA    . GLY A 1 413 ? 6.824  5.138   -0.209  1.00 99.49  ? 410  GLY A CA    1 
ATOM   3233 C  C     . GLY A 1 413 ? 6.779  6.541   -0.777  1.00 103.50 ? 410  GLY A C     1 
ATOM   3234 O  O     . GLY A 1 413 ? 6.397  6.748   -1.928  1.00 104.09 ? 410  GLY A O     1 
ATOM   3235 N  N     . ILE A 1 414 ? 7.176  7.510   0.043   1.00 106.00 ? 411  ILE A N     1 
ATOM   3236 C  CA    . ILE A 1 414 ? 7.270  8.897   -0.389  1.00 110.05 ? 411  ILE A CA    1 
ATOM   3237 C  C     . ILE A 1 414 ? 8.392  9.029   -1.411  1.00 113.58 ? 411  ILE A C     1 
ATOM   3238 O  O     . ILE A 1 414 ? 9.492  8.512   -1.207  1.00 111.19 ? 411  ILE A O     1 
ATOM   3239 C  CB    . ILE A 1 414 ? 7.563  9.829   0.797   1.00 108.23 ? 411  ILE A CB    1 
ATOM   3240 C  CG1   . ILE A 1 414 ? 6.692  9.450   1.997   1.00 111.12 ? 411  ILE A CG1   1 
ATOM   3241 C  CG2   . ILE A 1 414 ? 7.354  11.284  0.399   1.00 107.34 ? 411  ILE A CG2   1 
ATOM   3242 C  CD1   . ILE A 1 414 ? 7.075  10.155  3.276   1.00 110.39 ? 411  ILE A CD1   1 
ATOM   3243 N  N     . GLN A 1 415 ? 8.117  9.726   -2.507  1.00 119.01 ? 412  GLN A N     1 
ATOM   3244 C  CA    . GLN A 1 415 ? 9.069  9.810   -3.609  1.00 119.45 ? 412  GLN A CA    1 
ATOM   3245 C  C     . GLN A 1 415 ? 10.266 10.709  -3.295  1.00 109.88 ? 412  GLN A C     1 
ATOM   3246 O  O     . GLN A 1 415 ? 11.290 10.652  -3.977  1.00 110.70 ? 412  GLN A O     1 
ATOM   3247 C  CB    . GLN A 1 415 ? 8.369  10.273  -4.890  1.00 129.60 ? 412  GLN A CB    1 
ATOM   3248 C  CG    . GLN A 1 415 ? 9.148  9.978   -6.162  1.00 133.92 ? 412  GLN A CG    1 
ATOM   3249 C  CD    . GLN A 1 415 ? 8.291  10.089  -7.408  1.00 141.23 ? 412  GLN A CD    1 
ATOM   3250 O  OE1   . GLN A 1 415 ? 7.159  10.569  -7.357  1.00 146.38 ? 412  GLN A OE1   1 
ATOM   3251 N  NE2   . GLN A 1 415 ? 8.827  9.637   -8.537  1.00 140.89 ? 412  GLN A NE2   1 
ATOM   3252 N  N     . THR A 1 416 ? 10.136 11.527  -2.255  1.00 97.80  ? 413  THR A N     1 
ATOM   3253 C  CA    . THR A 1 416 ? 11.178 12.485  -1.898  1.00 83.72  ? 413  THR A CA    1 
ATOM   3254 C  C     . THR A 1 416 ? 12.203 11.909  -0.922  1.00 71.78  ? 413  THR A C     1 
ATOM   3255 O  O     . THR A 1 416 ? 13.385 12.242  -0.984  1.00 67.81  ? 413  THR A O     1 
ATOM   3256 C  CB    . THR A 1 416 ? 10.572 13.762  -1.282  1.00 81.37  ? 413  THR A CB    1 
ATOM   3257 O  OG1   . THR A 1 416 ? 9.797  14.448  -2.272  1.00 81.61  ? 413  THR A OG1   1 
ATOM   3258 C  CG2   . THR A 1 416 ? 11.667 14.688  -0.775  1.00 78.68  ? 413  THR A CG2   1 
ATOM   3259 N  N     . GLU A 1 417 ? 11.746 11.041  -0.027  1.00 69.53  ? 414  GLU A N     1 
ATOM   3260 C  CA    . GLU A 1 417 ? 12.593 10.508  1.034   1.00 65.99  ? 414  GLU A CA    1 
ATOM   3261 C  C     . GLU A 1 417 ? 13.356 9.254   0.607   1.00 65.36  ? 414  GLU A C     1 
ATOM   3262 O  O     . GLU A 1 417 ? 12.978 8.579   -0.352  1.00 66.35  ? 414  GLU A O     1 
ATOM   3263 C  CB    . GLU A 1 417 ? 11.752 10.197  2.273   1.00 72.46  ? 414  GLU A CB    1 
ATOM   3264 C  CG    . GLU A 1 417 ? 10.826 11.324  2.692   1.00 76.01  ? 414  GLU A CG    1 
ATOM   3265 C  CD    . GLU A 1 417 ? 11.576 12.595  3.031   1.00 76.34  ? 414  GLU A CD    1 
ATOM   3266 O  OE1   . GLU A 1 417 ? 12.292 12.608  4.054   1.00 76.33  ? 414  GLU A OE1   1 
ATOM   3267 O  OE2   . GLU A 1 417 ? 11.452 13.578  2.272   1.00 79.20  ? 414  GLU A OE2   1 
ATOM   3268 N  N     . TRP A 1 418 ? 14.429 8.948   1.331   1.00 55.14  ? 415  TRP A N     1 
ATOM   3269 C  CA    . TRP A 1 418 ? 15.210 7.746   1.068   1.00 53.78  ? 415  TRP A CA    1 
ATOM   3270 C  C     . TRP A 1 418 ? 15.265 6.830   2.287   1.00 54.75  ? 415  TRP A C     1 
ATOM   3271 O  O     . TRP A 1 418 ? 15.693 7.243   3.366   1.00 55.96  ? 415  TRP A O     1 
ATOM   3272 C  CB    . TRP A 1 418 ? 16.638 8.101   0.634   1.00 44.74  ? 415  TRP A CB    1 
ATOM   3273 C  CG    . TRP A 1 418 ? 17.335 6.950   -0.015  1.00 44.95  ? 415  TRP A CG    1 
ATOM   3274 C  CD1   . TRP A 1 418 ? 17.849 5.848   0.603   1.00 47.22  ? 415  TRP A CD1   1 
ATOM   3275 C  CD2   . TRP A 1 418 ? 17.572 6.773   -1.416  1.00 45.24  ? 415  TRP A CD2   1 
ATOM   3276 N  NE1   . TRP A 1 418 ? 18.396 4.996   -0.327  1.00 49.29  ? 415  TRP A NE1   1 
ATOM   3277 C  CE2   . TRP A 1 418 ? 18.240 5.542   -1.574  1.00 48.28  ? 415  TRP A CE2   1 
ATOM   3278 C  CE3   . TRP A 1 418 ? 17.286 7.537   -2.552  1.00 47.63  ? 415  TRP A CE3   1 
ATOM   3279 C  CZ2   . TRP A 1 418 ? 18.629 5.058   -2.823  1.00 48.77  ? 415  TRP A CZ2   1 
ATOM   3280 C  CZ3   . TRP A 1 418 ? 17.675 7.055   -3.792  1.00 46.52  ? 415  TRP A CZ3   1 
ATOM   3281 C  CH2   . TRP A 1 418 ? 18.338 5.827   -3.917  1.00 47.11  ? 415  TRP A CH2   1 
ATOM   3282 N  N     . SER A 1 419 ? 14.839 5.583   2.107   1.00 53.60  ? 416  SER A N     1 
ATOM   3283 C  CA    . SER A 1 419 ? 14.920 4.591   3.172   1.00 60.21  ? 416  SER A CA    1 
ATOM   3284 C  C     . SER A 1 419 ? 15.295 3.216   2.628   1.00 62.76  ? 416  SER A C     1 
ATOM   3285 O  O     . SER A 1 419 ? 14.911 2.860   1.518   1.00 63.02  ? 416  SER A O     1 
ATOM   3286 C  CB    . SER A 1 419 ? 13.602 4.519   3.947   1.00 68.57  ? 416  SER A CB    1 
ATOM   3287 O  OG    . SER A 1 419 ? 12.520 4.216   3.087   1.00 68.23  ? 416  SER A OG    1 
ATOM   3288 N  N     . PRO A 1 420 ? 16.084 2.456   3.400   1.00 65.97  ? 417  PRO A N     1 
ATOM   3289 C  CA    . PRO A 1 420 ? 16.689 2.961   4.635   1.00 68.54  ? 417  PRO A CA    1 
ATOM   3290 C  C     . PRO A 1 420 ? 17.868 3.859   4.289   1.00 55.53  ? 417  PRO A C     1 
ATOM   3291 O  O     . PRO A 1 420 ? 18.435 3.713   3.207   1.00 53.57  ? 417  PRO A O     1 
ATOM   3292 C  CB    . PRO A 1 420 ? 17.178 1.686   5.324   1.00 73.62  ? 417  PRO A CB    1 
ATOM   3293 C  CG    . PRO A 1 420 ? 17.457 0.748   4.203   1.00 71.43  ? 417  PRO A CG    1 
ATOM   3294 C  CD    . PRO A 1 420 ? 16.422 1.043   3.154   1.00 69.63  ? 417  PRO A CD    1 
ATOM   3295 N  N     . PRO A 1 421 ? 18.224 4.785   5.189   1.00 51.38  ? 418  PRO A N     1 
ATOM   3296 C  CA    . PRO A 1 421 ? 19.311 5.737   4.940   1.00 44.80  ? 418  PRO A CA    1 
ATOM   3297 C  C     . PRO A 1 421 ? 20.596 5.055   4.479   1.00 40.57  ? 418  PRO A C     1 
ATOM   3298 O  O     . PRO A 1 421 ? 20.862 3.906   4.842   1.00 40.20  ? 418  PRO A O     1 
ATOM   3299 C  CB    . PRO A 1 421 ? 19.519 6.383   6.310   1.00 45.60  ? 418  PRO A CB    1 
ATOM   3300 C  CG    . PRO A 1 421 ? 18.180 6.308   6.950   1.00 52.59  ? 418  PRO A CG    1 
ATOM   3301 C  CD    . PRO A 1 421 ? 17.589 5.006   6.501   1.00 52.36  ? 418  PRO A CD    1 
ATOM   3302 N  N     . LEU A 1 422 ? 21.376 5.766   3.673   1.00 36.37  ? 419  LEU A N     1 
ATOM   3303 C  CA    . LEU A 1 422 ? 22.640 5.247   3.158   1.00 36.00  ? 419  LEU A CA    1 
ATOM   3304 C  C     . LEU A 1 422 ? 23.815 5.646   4.042   1.00 35.75  ? 419  LEU A C     1 
ATOM   3305 O  O     . LEU A 1 422 ? 23.960 6.809   4.410   1.00 38.55  ? 419  LEU A O     1 
ATOM   3306 C  CB    . LEU A 1 422 ? 22.880 5.749   1.730   1.00 37.80  ? 419  LEU A CB    1 
ATOM   3307 C  CG    . LEU A 1 422 ? 21.833 5.391   0.671   1.00 36.42  ? 419  LEU A CG    1 
ATOM   3308 C  CD1   . LEU A 1 422 ? 22.288 5.874   -0.705  1.00 33.92  ? 419  LEU A CD1   1 
ATOM   3309 C  CD2   . LEU A 1 422 ? 21.561 3.895   0.657   1.00 42.10  ? 419  LEU A CD2   1 
ATOM   3310 N  N     . THR A 1 423 ? 24.670 4.680   4.364   1.00 32.50  ? 420  THR A N     1 
ATOM   3311 C  CA    . THR A 1 423 ? 25.827 4.957   5.204   1.00 32.88  ? 420  THR A CA    1 
ATOM   3312 C  C     . THR A 1 423 ? 27.117 5.094   4.385   1.00 29.72  ? 420  THR A C     1 
ATOM   3313 O  O     . THR A 1 423 ? 28.166 5.435   4.930   1.00 28.86  ? 420  THR A O     1 
ATOM   3314 C  CB    . THR A 1 423 ? 25.990 3.899   6.315   1.00 33.10  ? 420  THR A CB    1 
ATOM   3315 O  OG1   . THR A 1 423 ? 26.032 2.592   5.730   1.00 39.14  ? 420  THR A OG1   1 
ATOM   3316 C  CG2   . THR A 1 423 ? 24.810 3.971   7.298   1.00 35.67  ? 420  THR A CG2   1 
ATOM   3317 N  N     . MET A 1 424 ? 27.034 4.839   3.080   1.00 28.40  ? 421  MET A N     1 
ATOM   3318 C  CA    . MET A 1 424 ? 28.196 4.979   2.199   1.00 25.44  ? 421  MET A CA    1 
ATOM   3319 C  C     . MET A 1 424 ? 27.803 5.075   0.723   1.00 23.85  ? 421  MET A C     1 
ATOM   3320 O  O     . MET A 1 424 ? 26.828 4.452   0.290   1.00 24.76  ? 421  MET A O     1 
ATOM   3321 C  CB    . MET A 1 424 ? 29.173 3.812   2.411   1.00 27.94  ? 421  MET A CB    1 
ATOM   3322 C  CG    . MET A 1 424 ? 30.472 3.893   1.613   1.00 26.74  ? 421  MET A CG    1 
ATOM   3323 S  SD    . MET A 1 424 ? 30.333 3.168   -0.033  1.00 33.88  ? 421  MET A SD    1 
ATOM   3324 C  CE    . MET A 1 424 ? 29.878 1.480   0.366   1.00 30.65  ? 421  MET A CE    1 
ATOM   3325 N  N     . LEU A 1 425 ? 28.558 5.880   -0.025  1.00 23.24  ? 422  LEU A N     1 
ATOM   3326 C  CA    . LEU A 1 425 ? 28.475 5.937   -1.485  1.00 22.60  ? 422  LEU A CA    1 
ATOM   3327 C  C     . LEU A 1 425 ? 29.878 5.780   -2.060  1.00 19.92  ? 422  LEU A C     1 
ATOM   3328 O  O     . LEU A 1 425 ? 30.840 6.331   -1.519  1.00 20.25  ? 422  LEU A O     1 
ATOM   3329 C  CB    . LEU A 1 425 ? 27.895 7.272   -1.957  1.00 22.06  ? 422  LEU A CB    1 
ATOM   3330 C  CG    . LEU A 1 425 ? 26.432 7.587   -1.645  1.00 31.88  ? 422  LEU A CG    1 
ATOM   3331 C  CD1   . LEU A 1 425 ? 26.129 9.054   -1.956  1.00 31.14  ? 422  LEU A CD1   1 
ATOM   3332 C  CD2   . LEU A 1 425 ? 25.485 6.661   -2.402  1.00 31.06  ? 422  LEU A CD2   1 
ATOM   3333 N  N     . PHE A 1 426 ? 29.982 5.049   -3.165  1.00 22.35  ? 423  PHE A N     1 
ATOM   3334 C  CA    . PHE A 1 426 ? 31.267 4.721   -3.776  1.00 19.41  ? 423  PHE A CA    1 
ATOM   3335 C  C     . PHE A 1 426 ? 31.085 4.716   -5.288  1.00 21.21  ? 423  PHE A C     1 
ATOM   3336 O  O     . PHE A 1 426 ? 30.238 3.987   -5.805  1.00 21.43  ? 423  PHE A O     1 
ATOM   3337 C  CB    . PHE A 1 426 ? 31.704 3.325   -3.301  1.00 23.07  ? 423  PHE A CB    1 
ATOM   3338 C  CG    . PHE A 1 426 ? 33.058 2.887   -3.797  1.00 29.28  ? 423  PHE A CG    1 
ATOM   3339 C  CD1   . PHE A 1 426 ? 33.438 1.560   -3.690  1.00 41.60  ? 423  PHE A CD1   1 
ATOM   3340 C  CD2   . PHE A 1 426 ? 33.953 3.786   -4.353  1.00 24.28  ? 423  PHE A CD2   1 
ATOM   3341 C  CE1   . PHE A 1 426 ? 34.674 1.136   -4.139  1.00 41.84  ? 423  PHE A CE1   1 
ATOM   3342 C  CE2   . PHE A 1 426 ? 35.192 3.368   -4.799  1.00 28.97  ? 423  PHE A CE2   1 
ATOM   3343 C  CZ    . PHE A 1 426 ? 35.553 2.045   -4.692  1.00 37.48  ? 423  PHE A CZ    1 
ATOM   3344 N  N     . LEU A 1 427 ? 31.855 5.538   -5.994  1.00 17.35  ? 424  LEU A N     1 
ATOM   3345 C  CA    . LEU A 1 427 ? 31.891 5.501   -7.456  1.00 18.34  ? 424  LEU A CA    1 
ATOM   3346 C  C     . LEU A 1 427 ? 33.272 5.064   -7.910  1.00 17.29  ? 424  LEU A C     1 
ATOM   3347 O  O     . LEU A 1 427 ? 34.273 5.585   -7.435  1.00 19.14  ? 424  LEU A O     1 
ATOM   3348 C  CB    . LEU A 1 427 ? 31.594 6.877   -8.054  1.00 22.18  ? 424  LEU A CB    1 
ATOM   3349 C  CG    . LEU A 1 427 ? 30.207 7.482   -7.899  1.00 26.76  ? 424  LEU A CG    1 
ATOM   3350 C  CD1   . LEU A 1 427 ? 30.162 8.810   -8.652  1.00 26.31  ? 424  LEU A CD1   1 
ATOM   3351 C  CD2   . LEU A 1 427 ? 29.141 6.525   -8.412  1.00 24.67  ? 424  LEU A CD2   1 
ATOM   3352 N  N     . CYS A 1 428 ? 33.328 4.105   -8.830  1.00 17.89  ? 425  CYS A N     1 
ATOM   3353 C  CA    . CYS A 1 428 ? 34.614 3.605   -9.293  1.00 18.30  ? 425  CYS A CA    1 
ATOM   3354 C  C     . CYS A 1 428 ? 34.619 3.416   -10.804 1.00 21.40  ? 425  CYS A C     1 
ATOM   3355 O  O     . CYS A 1 428 ? 33.739 2.760   -11.358 1.00 24.37  ? 425  CYS A O     1 
ATOM   3356 C  CB    . CYS A 1 428 ? 34.942 2.279   -8.595  1.00 20.47  ? 425  CYS A CB    1 
ATOM   3357 S  SG    . CYS A 1 428 ? 36.633 1.661   -8.885  1.00 28.99  ? 425  CYS A SG    1 
ATOM   3358 N  N     . ALA A 1 429 ? 35.609 4.007   -11.465 1.00 14.96  ? 426  ALA A N     1 
ATOM   3359 C  CA    . ALA A 1 429 ? 35.795 3.808   -12.898 1.00 14.21  ? 426  ALA A CA    1 
ATOM   3360 C  C     . ALA A 1 429 ? 36.735 2.638   -13.129 1.00 15.08  ? 426  ALA A C     1 
ATOM   3361 O  O     . ALA A 1 429 ? 37.779 2.521   -12.466 1.00 17.43  ? 426  ALA A O     1 
ATOM   3362 C  CB    . ALA A 1 429 ? 36.355 5.079   -13.543 1.00 17.63  ? 426  ALA A CB    1 
ATOM   3363 N  N     . THR A 1 430 ? 36.366 1.778   -14.074 1.00 16.73  ? 427  THR A N     1 
ATOM   3364 C  CA    . THR A 1 430 ? 37.080 0.517   -14.282 1.00 19.74  ? 427  THR A CA    1 
ATOM   3365 C  C     . THR A 1 430 ? 37.060 0.121   -15.747 1.00 20.67  ? 427  THR A C     1 
ATOM   3366 O  O     . THR A 1 430 ? 36.449 0.801   -16.564 1.00 17.96  ? 427  THR A O     1 
ATOM   3367 C  CB    . THR A 1 430 ? 36.427 -0.627  -13.479 1.00 27.07  ? 427  THR A CB    1 
ATOM   3368 O  OG1   . THR A 1 430 ? 35.131 -0.910  -14.020 1.00 32.15  ? 427  THR A OG1   1 
ATOM   3369 C  CG2   . THR A 1 430 ? 36.274 -0.247  -12.011 1.00 31.60  ? 427  THR A CG2   1 
ATOM   3370 N  N     . LYS A 1 431 ? 37.720 -0.992  -16.063 1.00 22.10  ? 428  LYS A N     1 
ATOM   3371 C  CA    . LYS A 1 431 ? 37.740 -1.530  -17.423 1.00 18.83  ? 428  LYS A CA    1 
ATOM   3372 C  C     . LYS A 1 431 ? 38.335 -0.534  -18.415 1.00 16.63  ? 428  LYS A C     1 
ATOM   3373 O  O     . LYS A 1 431 ? 37.665 -0.068  -19.344 1.00 18.24  ? 428  LYS A O     1 
ATOM   3374 C  CB    . LYS A 1 431 ? 36.345 -1.957  -17.868 1.00 20.81  ? 428  LYS A CB    1 
ATOM   3375 C  CG    . LYS A 1 431 ? 35.769 -3.083  -17.019 1.00 33.69  ? 428  LYS A CG    1 
ATOM   3376 C  CD    . LYS A 1 431 ? 34.668 -3.834  -17.758 1.00 42.31  ? 428  LYS A CD    1 
ATOM   3377 C  CE    . LYS A 1 431 ? 34.131 -4.986  -16.918 1.00 49.55  ? 428  LYS A CE    1 
ATOM   3378 N  NZ    . LYS A 1 431 ? 35.225 -5.849  -16.394 1.00 51.49  ? 428  LYS A NZ    1 
ATOM   3379 N  N     . PHE A 1 432 ? 39.604 -0.220  -18.208 1.00 21.76  ? 429  PHE A N     1 
ATOM   3380 C  CA    . PHE A 1 432 ? 40.318 0.714   -19.067 1.00 20.21  ? 429  PHE A CA    1 
ATOM   3381 C  C     . PHE A 1 432 ? 40.657 0.100   -20.414 1.00 24.56  ? 429  PHE A C     1 
ATOM   3382 O  O     . PHE A 1 432 ? 41.027 -1.074  -20.499 1.00 27.28  ? 429  PHE A O     1 
ATOM   3383 C  CB    . PHE A 1 432 ? 41.594 1.202   -18.375 1.00 20.04  ? 429  PHE A CB    1 
ATOM   3384 C  CG    . PHE A 1 432 ? 41.347 2.233   -17.306 1.00 20.71  ? 429  PHE A CG    1 
ATOM   3385 C  CD1   . PHE A 1 432 ? 41.203 3.572   -17.632 1.00 16.99  ? 429  PHE A CD1   1 
ATOM   3386 C  CD2   . PHE A 1 432 ? 41.251 1.862   -15.977 1.00 25.05  ? 429  PHE A CD2   1 
ATOM   3387 C  CE1   . PHE A 1 432 ? 40.973 4.523   -16.653 1.00 18.59  ? 429  PHE A CE1   1 
ATOM   3388 C  CE2   . PHE A 1 432 ? 41.016 2.814   -14.989 1.00 27.34  ? 429  PHE A CE2   1 
ATOM   3389 C  CZ    . PHE A 1 432 ? 40.876 4.153   -15.335 1.00 23.03  ? 429  PHE A CZ    1 
ATOM   3390 N  N     . SER A 1 433 ? 40.508 0.908   -21.459 1.00 21.87  ? 430  SER A N     1 
ATOM   3391 C  CA    . SER A 1 433 ? 40.911 0.544   -22.813 1.00 19.46  ? 430  SER A CA    1 
ATOM   3392 C  C     . SER A 1 433 ? 41.827 1.632   -23.345 1.00 26.40  ? 430  SER A C     1 
ATOM   3393 O  O     . SER A 1 433 ? 41.748 2.782   -22.913 1.00 21.79  ? 430  SER A O     1 
ATOM   3394 C  CB    . SER A 1 433 ? 39.692 0.407   -23.726 1.00 30.12  ? 430  SER A CB    1 
ATOM   3395 O  OG    . SER A 1 433 ? 38.899 -0.703  -23.353 1.00 43.81  ? 430  SER A OG    1 
ATOM   3396 N  N     . ALA A 1 434 ? 42.701 1.269   -24.277 1.00 28.55  ? 431  ALA A N     1 
ATOM   3397 C  CA    . ALA A 1 434 ? 43.645 2.219   -24.845 1.00 28.97  ? 431  ALA A CA    1 
ATOM   3398 C  C     . ALA A 1 434 ? 42.906 3.317   -25.579 1.00 31.69  ? 431  ALA A C     1 
ATOM   3399 O  O     . ALA A 1 434 ? 41.821 3.094   -26.120 1.00 37.98  ? 431  ALA A O     1 
ATOM   3400 C  CB    . ALA A 1 434 ? 44.608 1.512   -25.787 1.00 32.26  ? 431  ALA A CB    1 
ATOM   3401 N  N     . SER A 1 435 ? 43.495 4.507   -25.591 1.00 28.93  ? 432  SER A N     1 
ATOM   3402 C  CA    . SER A 1 435 ? 42.936 5.626   -26.335 1.00 37.06  ? 432  SER A CA    1 
ATOM   3403 C  C     . SER A 1 435 ? 44.053 6.517   -26.867 1.00 44.96  ? 432  SER A C     1 
ATOM   3404 O  O     . SER A 1 435 ? 43.805 7.544   -27.496 1.00 41.85  ? 432  SER A O     1 
ATOM   3405 C  CB    . SER A 1 435 ? 41.980 6.431   -25.458 1.00 41.77  ? 432  SER A CB    1 
ATOM   3406 O  OG    . SER A 1 435 ? 42.647 6.940   -24.316 1.00 50.29  ? 432  SER A OG    1 
ATOM   3407 O  OXT   . SER A 1 435 ? 45.234 6.222   -26.678 1.00 52.64  ? 432  SER A OXT   1 
ATOM   3408 P  P     . DA  B 2 2   ? 35.204 3.631   15.769  1.00 133.04 ? 2    DA  T P     1 
ATOM   3409 O  OP1   . DA  B 2 2   ? 34.659 5.007   15.745  1.00 132.19 ? 2    DA  T OP1   1 
ATOM   3410 O  OP2   . DA  B 2 2   ? 34.416 2.513   15.201  1.00 132.59 ? 2    DA  T OP2   1 
ATOM   3411 O  "O5'" . DA  B 2 2   ? 36.644 3.624   15.069  1.00 71.44  ? 2    DA  T "O5'" 1 
ATOM   3412 C  "C5'" . DA  B 2 2   ? 36.730 3.450   13.661  1.00 66.18  ? 2    DA  T "C5'" 1 
ATOM   3413 C  "C4'" . DA  B 2 2   ? 37.521 4.580   13.027  1.00 60.92  ? 2    DA  T "C4'" 1 
ATOM   3414 O  "O4'" . DA  B 2 2   ? 38.936 4.315   13.157  1.00 59.99  ? 2    DA  T "O4'" 1 
ATOM   3415 C  "C3'" . DA  B 2 2   ? 37.269 4.766   11.539  1.00 57.39  ? 2    DA  T "C3'" 1 
ATOM   3416 O  "O3'" . DA  B 2 2   ? 36.281 5.754   11.400  1.00 49.53  ? 2    DA  T "O3'" 1 
ATOM   3417 C  "C2'" . DA  B 2 2   ? 38.595 5.286   11.002  1.00 58.43  ? 2    DA  T "C2'" 1 
ATOM   3418 C  "C1'" . DA  B 2 2   ? 39.612 4.705   11.977  1.00 61.42  ? 2    DA  T "C1'" 1 
ATOM   3419 N  N9    . DA  B 2 2   ? 40.326 3.549   11.449  1.00 65.34  ? 2    DA  T N9    1 
ATOM   3420 C  C8    . DA  B 2 2   ? 40.042 2.226   11.655  1.00 66.47  ? 2    DA  T C8    1 
ATOM   3421 N  N7    . DA  B 2 2   ? 40.873 1.412   11.046  1.00 66.85  ? 2    DA  T N7    1 
ATOM   3422 C  C5    . DA  B 2 2   ? 41.761 2.262   10.402  1.00 65.57  ? 2    DA  T C5    1 
ATOM   3423 C  C6    . DA  B 2 2   ? 42.883 2.027   9.584   1.00 66.35  ? 2    DA  T C6    1 
ATOM   3424 N  N6    . DA  B 2 2   ? 43.319 0.803   9.265   1.00 70.51  ? 2    DA  T N6    1 
ATOM   3425 N  N1    . DA  B 2 2   ? 43.540 3.104   9.105   1.00 61.38  ? 2    DA  T N1    1 
ATOM   3426 C  C2    . DA  B 2 2   ? 43.108 4.330   9.422   1.00 57.06  ? 2    DA  T C2    1 
ATOM   3427 N  N3    . DA  B 2 2   ? 42.070 4.675   10.178  1.00 59.18  ? 2    DA  T N3    1 
ATOM   3428 C  C4    . DA  B 2 2   ? 41.436 3.584   10.638  1.00 64.06  ? 2    DA  T C4    1 
ATOM   3429 P  P     . DT  B 2 3   ? 35.134 5.601   10.292  1.00 30.05  ? 3    DT  T P     1 
ATOM   3430 O  OP1   . DT  B 2 3   ? 33.948 6.356   10.763  1.00 37.32  ? 3    DT  T OP1   1 
ATOM   3431 O  OP2   . DT  B 2 3   ? 35.010 4.166   9.945   1.00 30.07  ? 3    DT  T OP2   1 
ATOM   3432 O  "O5'" . DT  B 2 3   ? 35.743 6.345   9.014   1.00 19.29  ? 3    DT  T "O5'" 1 
ATOM   3433 C  "C5'" . DT  B 2 3   ? 36.031 7.732   9.040   1.00 21.10  ? 3    DT  T "C5'" 1 
ATOM   3434 C  "C4'" . DT  B 2 3   ? 36.661 8.142   7.723   1.00 19.79  ? 3    DT  T "C4'" 1 
ATOM   3435 O  "O4'" . DT  B 2 3   ? 37.898 7.409   7.553   1.00 18.22  ? 3    DT  T "O4'" 1 
ATOM   3436 C  "C3'" . DT  B 2 3   ? 35.850 7.855   6.465   1.00 16.29  ? 3    DT  T "C3'" 1 
ATOM   3437 O  "O3'" . DT  B 2 3   ? 36.141 8.919   5.577   1.00 15.97  ? 3    DT  T "O3'" 1 
ATOM   3438 C  "C2'" . DT  B 2 3   ? 36.402 6.516   5.982   1.00 17.82  ? 3    DT  T "C2'" 1 
ATOM   3439 C  "C1'" . DT  B 2 3   ? 37.873 6.670   6.345   1.00 18.32  ? 3    DT  T "C1'" 1 
ATOM   3440 N  N1    . DT  B 2 3   ? 38.613 5.412   6.614   1.00 14.72  ? 3    DT  T N1    1 
ATOM   3441 C  C2    . DT  B 2 3   ? 39.919 5.382   6.191   1.00 14.00  ? 3    DT  T C2    1 
ATOM   3442 O  O2    . DT  B 2 3   ? 40.462 6.311   5.609   1.00 13.72  ? 3    DT  T O2    1 
ATOM   3443 N  N3    . DT  B 2 3   ? 40.577 4.216   6.476   1.00 17.16  ? 3    DT  T N3    1 
ATOM   3444 C  C4    . DT  B 2 3   ? 40.089 3.110   7.128   1.00 15.93  ? 3    DT  T C4    1 
ATOM   3445 O  O4    . DT  B 2 3   ? 40.787 2.112   7.322   1.00 18.60  ? 3    DT  T O4    1 
ATOM   3446 C  C5    . DT  B 2 3   ? 38.710 3.211   7.550   1.00 18.80  ? 3    DT  T C5    1 
ATOM   3447 C  C7    . DT  B 2 3   ? 38.072 2.057   8.266   1.00 20.36  ? 3    DT  T C7    1 
ATOM   3448 C  C6    . DT  B 2 3   ? 38.045 4.352   7.292   1.00 16.42  ? 3    DT  T C6    1 
ATOM   3449 P  P     . DT  B 2 4   ? 35.434 9.009   4.136   1.00 16.52  ? 4    DT  T P     1 
ATOM   3450 O  OP1   . DT  B 2 4   ? 35.130 10.435  3.875   1.00 17.75  ? 4    DT  T OP1   1 
ATOM   3451 O  OP2   . DT  B 2 4   ? 34.351 8.003   4.081   1.00 17.48  ? 4    DT  T OP2   1 
ATOM   3452 O  "O5'" . DT  B 2 4   ? 36.583 8.542   3.137   1.00 15.73  ? 4    DT  T "O5'" 1 
ATOM   3453 C  "C5'" . DT  B 2 4   ? 37.775 9.332   3.005   1.00 14.94  ? 4    DT  T "C5'" 1 
ATOM   3454 C  "C4'" . DT  B 2 4   ? 38.742 8.662   2.051   1.00 14.51  ? 4    DT  T "C4'" 1 
ATOM   3455 O  "O4'" . DT  B 2 4   ? 39.264 7.466   2.676   1.00 15.40  ? 4    DT  T "O4'" 1 
ATOM   3456 C  "C3'" . DT  B 2 4   ? 38.142 8.229   0.713   1.00 15.14  ? 4    DT  T "C3'" 1 
ATOM   3457 O  "O3'" . DT  B 2 4   ? 39.093 8.497   -0.321  1.00 15.64  ? 4    DT  T "O3'" 1 
ATOM   3458 C  "C2'" . DT  B 2 4   ? 37.924 6.728   0.905   1.00 15.22  ? 4    DT  T "C2'" 1 
ATOM   3459 C  "C1'" . DT  B 2 4   ? 39.166 6.405   1.741   1.00 17.07  ? 4    DT  T "C1'" 1 
ATOM   3460 N  N1    . DT  B 2 4   ? 39.124 5.108   2.457   1.00 14.70  ? 4    DT  T N1    1 
ATOM   3461 C  C2    . DT  B 2 4   ? 40.294 4.377   2.555   1.00 16.18  ? 4    DT  T C2    1 
ATOM   3462 O  O2    . DT  B 2 4   ? 41.368 4.715   2.095   1.00 18.74  ? 4    DT  T O2    1 
ATOM   3463 N  N3    . DT  B 2 4   ? 40.178 3.200   3.219   1.00 17.32  ? 4    DT  T N3    1 
ATOM   3464 C  C4    . DT  B 2 4   ? 39.059 2.669   3.804   1.00 19.47  ? 4    DT  T C4    1 
ATOM   3465 O  O4    . DT  B 2 4   ? 39.110 1.587   4.385   1.00 22.00  ? 4    DT  T O4    1 
ATOM   3466 C  C5    . DT  B 2 4   ? 37.864 3.469   3.684   1.00 17.68  ? 4    DT  T C5    1 
ATOM   3467 C  C7    . DT  B 2 4   ? 36.582 2.957   4.297   1.00 20.22  ? 4    DT  T C7    1 
ATOM   3468 C  C6    . DT  B 2 4   ? 37.948 4.640   3.026   1.00 16.45  ? 4    DT  T C6    1 
ATOM   3469 P  P     . DA  B 2 5   ? 38.657 8.475   -1.864  1.00 15.73  ? 5    DA  T P     1 
ATOM   3470 O  OP1   . DA  B 2 5   ? 39.836 8.857   -2.674  1.00 20.74  ? 5    DA  T OP1   1 
ATOM   3471 O  OP2   . DA  B 2 5   ? 37.411 9.249   -2.011  1.00 16.62  ? 5    DA  T OP2   1 
ATOM   3472 O  "O5'" . DA  B 2 5   ? 38.287 6.943   -2.122  1.00 18.23  ? 5    DA  T "O5'" 1 
ATOM   3473 C  "C5'" . DA  B 2 5   ? 39.017 6.086   -3.014  1.00 19.57  ? 5    DA  T "C5'" 1 
ATOM   3474 C  "C4'" . DA  B 2 5   ? 40.285 5.524   -2.412  1.00 17.85  ? 5    DA  T "C4'" 1 
ATOM   3475 O  "O4'" . DA  B 2 5   ? 40.008 4.802   -1.193  1.00 23.06  ? 5    DA  T "O4'" 1 
ATOM   3476 C  "C3'" . DA  B 2 5   ? 40.909 4.493   -3.332  1.00 17.32  ? 5    DA  T "C3'" 1 
ATOM   3477 O  "O3'" . DA  B 2 5   ? 41.834 5.206   -4.122  1.00 19.64  ? 5    DA  T "O3'" 1 
ATOM   3478 C  "C2'" . DA  B 2 5   ? 41.552 3.443   -2.423  1.00 24.83  ? 5    DA  T "C2'" 1 
ATOM   3479 C  "C1'" . DA  B 2 5   ? 40.966 3.769   -1.053  1.00 25.82  ? 5    DA  T "C1'" 1 
ATOM   3480 N  N9    . DA  B 2 5   ? 40.313 2.657   -0.382  1.00 20.65  ? 5    DA  T N9    1 
ATOM   3481 C  C8    . DA  B 2 5   ? 39.005 2.586   0.017   1.00 21.48  ? 5    DA  T C8    1 
ATOM   3482 N  N7    . DA  B 2 5   ? 38.701 1.464   0.630   1.00 23.87  ? 5    DA  T N7    1 
ATOM   3483 C  C5    . DA  B 2 5   ? 39.901 0.761   0.642   1.00 14.67  ? 5    DA  T C5    1 
ATOM   3484 C  C6    . DA  B 2 5   ? 40.251 -0.514  1.153   1.00 25.43  ? 5    DA  T C6    1 
ATOM   3485 N  N6    . DA  B 2 5   ? 39.378 -1.318  1.772   1.00 29.39  ? 5    DA  T N6    1 
ATOM   3486 N  N1    . DA  B 2 5   ? 41.532 -0.931  1.005   1.00 24.35  ? 5    DA  T N1    1 
ATOM   3487 C  C2    . DA  B 2 5   ? 42.389 -0.109  0.376   1.00 26.41  ? 5    DA  T C2    1 
ATOM   3488 N  N3    . DA  B 2 5   ? 42.176 1.113   -0.140  1.00 24.35  ? 5    DA  T N3    1 
ATOM   3489 C  C4    . DA  B 2 5   ? 40.905 1.483   0.030   1.00 18.91  ? 5    DA  T C4    1 
ATOM   3490 P  P     . DT  B 2 6   ? 42.163 4.712   -5.605  1.00 20.38  ? 6    DT  T P     1 
ATOM   3491 O  OP1   . DT  B 2 6   ? 43.277 5.531   -6.129  1.00 24.84  ? 6    DT  T OP1   1 
ATOM   3492 O  OP2   . DT  B 2 6   ? 40.905 4.699   -6.381  1.00 20.99  ? 6    DT  T OP2   1 
ATOM   3493 O  "O5'" . DT  B 2 6   ? 42.726 3.245   -5.355  1.00 22.46  ? 6    DT  T "O5'" 1 
ATOM   3494 C  "C5'" . DT  B 2 6   ? 42.605 2.243   -6.237  1.00 22.51  ? 6    DT  T "C5'" 1 
ATOM   3495 C  "C4'" . DT  B 2 6   ? 43.573 1.186   -5.765  1.00 18.92  ? 6    DT  T "C4'" 1 
ATOM   3496 O  "O4'" . DT  B 2 6   ? 43.211 0.719   -4.449  1.00 20.54  ? 6    DT  T "O4'" 1 
ATOM   3497 C  "C3'" . DT  B 2 6   ? 43.486 0.020   -6.713  1.00 22.21  ? 6    DT  T "C3'" 1 
ATOM   3498 O  "O3'" . DT  B 2 6   ? 44.783 -0.306  -7.082  1.00 24.52  ? 6    DT  T "O3'" 1 
ATOM   3499 C  "C2'" . DT  B 2 6   ? 42.787 -1.065  -5.917  1.00 24.19  ? 6    DT  T "C2'" 1 
ATOM   3500 C  "C1'" . DT  B 2 6   ? 43.067 -0.681  -4.467  1.00 21.81  ? 6    DT  T "C1'" 1 
ATOM   3501 N  N1    . DT  B 2 6   ? 41.935 -1.069  -3.608  1.00 19.03  ? 6    DT  T N1    1 
ATOM   3502 C  C2    . DT  B 2 6   ? 42.047 -2.208  -2.849  1.00 21.58  ? 6    DT  T C2    1 
ATOM   3503 O  O2    . DT  B 2 6   ? 43.050 -2.910  -2.840  1.00 23.44  ? 6    DT  T O2    1 
ATOM   3504 N  N3    . DT  B 2 6   ? 40.941 -2.503  -2.103  1.00 19.80  ? 6    DT  T N3    1 
ATOM   3505 C  C4    . DT  B 2 6   ? 39.760 -1.790  -2.031  1.00 23.11  ? 6    DT  T C4    1 
ATOM   3506 O  O4    . DT  B 2 6   ? 38.825 -2.148  -1.326  1.00 27.82  ? 6    DT  T O4    1 
ATOM   3507 C  C5    . DT  B 2 6   ? 39.711 -0.615  -2.847  1.00 20.68  ? 6    DT  T C5    1 
ATOM   3508 C  C7    . DT  B 2 6   ? 38.465 0.229   -2.849  1.00 22.88  ? 6    DT  T C7    1 
ATOM   3509 C  C6    . DT  B 2 6   ? 40.778 -0.311  -3.596  1.00 21.93  ? 6    DT  T C6    1 
ATOM   3510 P  P     . DG  B 2 7   ? 45.035 -1.170  -8.400  1.00 31.23  ? 7    DG  T P     1 
ATOM   3511 O  OP1   . DG  B 2 7   ? 46.433 -0.942  -8.828  1.00 35.69  ? 7    DG  T OP1   1 
ATOM   3512 O  OP2   . DG  B 2 7   ? 43.890 -0.964  -9.296  1.00 31.10  ? 7    DG  T OP2   1 
ATOM   3513 O  "O5'" . DG  B 2 7   ? 44.879 -2.684  -7.883  1.00 25.93  ? 7    DG  T "O5'" 1 
ATOM   3514 C  "C5'" . DG  B 2 7   ? 45.831 -3.237  -7.008  1.00 27.02  ? 7    DG  T "C5'" 1 
ATOM   3515 C  "C4'" . DG  B 2 7   ? 45.431 -4.674  -6.757  1.00 23.37  ? 7    DG  T "C4'" 1 
ATOM   3516 O  "O4'" . DG  B 2 7   ? 44.333 -4.682  -5.819  1.00 25.85  ? 7    DG  T "O4'" 1 
ATOM   3517 C  "C3'" . DG  B 2 7   ? 44.963 -5.448  -7.988  1.00 27.63  ? 7    DG  T "C3'" 1 
ATOM   3518 O  "O3'" . DG  B 2 7   ? 45.715 -6.658  -8.012  1.00 25.75  ? 7    DG  T "O3'" 1 
ATOM   3519 C  "C2'" . DG  B 2 7   ? 43.473 -5.674  -7.739  1.00 26.89  ? 7    DG  T "C2'" 1 
ATOM   3520 C  "C1'" . DG  B 2 7   ? 43.422 -5.682  -6.218  1.00 24.64  ? 7    DG  T "C1'" 1 
ATOM   3521 N  N9    . DG  B 2 7   ? 42.130 -5.327  -5.646  1.00 21.24  ? 7    DG  T N9    1 
ATOM   3522 C  C8    . DG  B 2 7   ? 41.316 -4.271  -5.990  1.00 20.53  ? 7    DG  T C8    1 
ATOM   3523 N  N7    . DG  B 2 7   ? 40.224 -4.205  -5.277  1.00 20.59  ? 7    DG  T N7    1 
ATOM   3524 C  C5    . DG  B 2 7   ? 40.329 -5.292  -4.411  1.00 18.42  ? 7    DG  T C5    1 
ATOM   3525 C  C6    . DG  B 2 7   ? 39.441 -5.741  -3.412  1.00 17.56  ? 7    DG  T C6    1 
ATOM   3526 O  O6    . DG  B 2 7   ? 38.348 -5.249  -3.079  1.00 20.71  ? 7    DG  T O6    1 
ATOM   3527 N  N1    . DG  B 2 7   ? 39.923 -6.874  -2.763  1.00 17.93  ? 7    DG  T N1    1 
ATOM   3528 C  C2    . DG  B 2 7   ? 41.118 -7.488  -3.046  1.00 16.41  ? 7    DG  T C2    1 
ATOM   3529 N  N2    . DG  B 2 7   ? 41.422 -8.579  -2.321  1.00 20.09  ? 7    DG  T N2    1 
ATOM   3530 N  N3    . DG  B 2 7   ? 41.960 -7.087  -3.983  1.00 20.41  ? 7    DG  T N3    1 
ATOM   3531 C  C4    . DG  B 2 7   ? 41.498 -5.984  -4.623  1.00 18.48  ? 7    DG  T C4    1 
ATOM   3532 P  P     . DA  B 2 8   ? 45.493 -7.748  -9.178  1.00 29.63  ? 8    DA  T P     1 
ATOM   3533 O  OP1   . DA  B 2 8   ? 46.825 -8.145  -9.682  1.00 39.00  ? 8    DA  T OP1   1 
ATOM   3534 O  OP2   . DA  B 2 8   ? 44.483 -7.222  -10.121 1.00 41.56  ? 8    DA  T OP2   1 
ATOM   3535 O  "O5'" . DA  B 2 8   ? 44.824 -8.983  -8.418  1.00 23.89  ? 8    DA  T "O5'" 1 
ATOM   3536 C  "C5'" . DA  B 2 8   ? 45.505 -9.464  -7.269  1.00 25.66  ? 8    DA  T "C5'" 1 
ATOM   3537 C  "C4'" . DA  B 2 8   ? 44.761 -10.588 -6.583  1.00 26.54  ? 8    DA  T "C4'" 1 
ATOM   3538 O  "O4'" . DA  B 2 8   ? 43.583 -10.063 -5.929  1.00 32.58  ? 8    DA  T "O4'" 1 
ATOM   3539 C  "C3'" . DA  B 2 8   ? 44.301 -11.703 -7.509  1.00 29.71  ? 8    DA  T "C3'" 1 
ATOM   3540 O  "O3'" . DA  B 2 8   ? 44.646 -12.918 -6.892  1.00 32.34  ? 8    DA  T "O3'" 1 
ATOM   3541 C  "C2'" . DA  B 2 8   ? 42.792 -11.507 -7.601  1.00 29.17  ? 8    DA  T "C2'" 1 
ATOM   3542 C  "C1'" . DA  B 2 8   ? 42.473 -10.876 -6.252  1.00 27.81  ? 8    DA  T "C1'" 1 
ATOM   3543 N  N9    . DA  B 2 8   ? 41.338 -9.972  -6.276  1.00 24.93  ? 8    DA  T N9    1 
ATOM   3544 C  C8    . DA  B 2 8   ? 41.178 -8.890  -7.094  1.00 24.39  ? 8    DA  T C8    1 
ATOM   3545 N  N7    . DA  B 2 8   ? 40.062 -8.236  -6.893  1.00 30.17  ? 8    DA  T N7    1 
ATOM   3546 C  C5    . DA  B 2 8   ? 39.454 -8.936  -5.863  1.00 19.04  ? 8    DA  T C5    1 
ATOM   3547 C  C6    . DA  B 2 8   ? 38.240 -8.733  -5.193  1.00 27.01  ? 8    DA  T C6    1 
ATOM   3548 N  N6    . DA  B 2 8   ? 37.413 -7.726  -5.495  1.00 27.61  ? 8    DA  T N6    1 
ATOM   3549 N  N1    . DA  B 2 8   ? 37.920 -9.600  -4.211  1.00 31.30  ? 8    DA  T N1    1 
ATOM   3550 C  C2    . DA  B 2 8   ? 38.768 -10.598 -3.928  1.00 32.01  ? 8    DA  T C2    1 
ATOM   3551 N  N3    . DA  B 2 8   ? 39.942 -10.883 -4.495  1.00 24.93  ? 8    DA  T N3    1 
ATOM   3552 C  C4    . DA  B 2 8   ? 40.228 -10.000 -5.462  1.00 24.66  ? 8    DA  T C4    1 
ATOM   3553 P  P     . DC  B 2 9   ? 44.530 -14.300 -7.703  1.00 37.55  ? 9    DC  T P     1 
ATOM   3554 O  OP1   . DC  B 2 9   ? 45.597 -15.201 -7.216  1.00 46.62  ? 9    DC  T OP1   1 
ATOM   3555 O  OP2   . DC  B 2 9   ? 44.397 -13.980 -9.140  1.00 39.88  ? 9    DC  T OP2   1 
ATOM   3556 O  "O5'" . DC  B 2 9   ? 43.111 -14.875 -7.247  1.00 29.31  ? 9    DC  T "O5'" 1 
ATOM   3557 C  "C5'" . DC  B 2 9   ? 42.875 -15.020 -5.873  1.00 27.18  ? 9    DC  T "C5'" 1 
ATOM   3558 C  "C4'" . DC  B 2 9   ? 41.437 -15.426 -5.667  1.00 22.66  ? 9    DC  T "C4'" 1 
ATOM   3559 O  "O4'" . DC  B 2 9   ? 40.602 -14.260 -5.798  1.00 23.53  ? 9    DC  T "O4'" 1 
ATOM   3560 C  "C3'" . DC  B 2 9   ? 40.917 -16.464 -6.655  1.00 23.59  ? 9    DC  T "C3'" 1 
ATOM   3561 O  "O3'" . DC  B 2 9   ? 40.543 -17.543 -5.799  1.00 26.42  ? 9    DC  T "O3'" 1 
ATOM   3562 C  "C2'" . DC  B 2 9   ? 39.772 -15.742 -7.376  1.00 27.96  ? 9    DC  T "C2'" 1 
ATOM   3563 C  "C1'" . DC  B 2 9   ? 39.379 -14.661 -6.374  1.00 26.20  ? 9    DC  T "C1'" 1 
ATOM   3564 N  N1    . DC  B 2 9   ? 38.748 -13.414 -6.910  1.00 26.64  ? 9    DC  T N1    1 
ATOM   3565 C  C2    . DC  B 2 9   ? 37.566 -12.927 -6.332  1.00 25.50  ? 9    DC  T C2    1 
ATOM   3566 O  O2    . DC  B 2 9   ? 37.058 -13.559 -5.400  1.00 29.13  ? 9    DC  T O2    1 
ATOM   3567 N  N3    . DC  B 2 9   ? 37.003 -11.784 -6.813  1.00 23.51  ? 9    DC  T N3    1 
ATOM   3568 C  C4    . DC  B 2 9   ? 37.584 -11.134 -7.815  1.00 25.05  ? 9    DC  T C4    1 
ATOM   3569 N  N4    . DC  B 2 9   ? 36.990 -10.019 -8.257  1.00 24.40  ? 9    DC  T N4    1 
ATOM   3570 C  C5    . DC  B 2 9   ? 38.792 -11.616 -8.414  1.00 19.98  ? 9    DC  T C5    1 
ATOM   3571 C  C6    . DC  B 2 9   ? 39.336 -12.737 -7.935  1.00 25.12  ? 9    DC  T C6    1 
ATOM   3572 P  P     . DG  B 2 10  ? 39.851 -18.861 -6.391  1.00 27.63  ? 10   DG  T P     1 
ATOM   3573 O  OP1   . DG  B 2 10  ? 40.372 -20.019 -5.640  1.00 29.88  ? 10   DG  T OP1   1 
ATOM   3574 O  OP2   . DG  B 2 10  ? 39.930 -18.810 -7.866  1.00 30.63  ? 10   DG  T OP2   1 
ATOM   3575 O  "O5'" . DG  B 2 10  ? 38.320 -18.673 -6.005  1.00 31.06  ? 10   DG  T "O5'" 1 
ATOM   3576 C  "C5'" . DG  B 2 10  ? 37.965 -18.484 -4.650  1.00 25.56  ? 10   DG  T "C5'" 1 
ATOM   3577 C  "C4'" . DG  B 2 10  ? 36.455 -18.582 -4.541  1.00 24.74  ? 10   DG  T "C4'" 1 
ATOM   3578 O  "O4'" . DG  B 2 10  ? 35.840 -17.380 -5.068  1.00 22.68  ? 10   DG  T "O4'" 1 
ATOM   3579 C  "C3'" . DG  B 2 10  ? 35.809 -19.731 -5.300  1.00 20.69  ? 10   DG  T "C3'" 1 
ATOM   3580 O  "O3'" . DG  B 2 10  ? 34.738 -20.139 -4.456  1.00 20.93  ? 10   DG  T "O3'" 1 
ATOM   3581 C  "C2'" . DG  B 2 10  ? 35.358 -19.077 -6.613  1.00 20.99  ? 10   DG  T "C2'" 1 
ATOM   3582 C  "C1'" . DG  B 2 10  ? 34.958 -17.686 -6.140  1.00 20.70  ? 10   DG  T "C1'" 1 
ATOM   3583 N  N9    . DG  B 2 10  ? 35.182 -16.579 -7.063  1.00 20.74  ? 10   DG  T N9    1 
ATOM   3584 C  C8    . DG  B 2 10  ? 36.295 -16.365 -7.842  1.00 27.95  ? 10   DG  T C8    1 
ATOM   3585 N  N7    . DG  B 2 10  ? 36.225 -15.268 -8.551  1.00 23.86  ? 10   DG  T N7    1 
ATOM   3586 C  C5    . DG  B 2 10  ? 34.997 -14.713 -8.214  1.00 21.03  ? 10   DG  T C5    1 
ATOM   3587 C  C6    . DG  B 2 10  ? 34.380 -13.516 -8.655  1.00 26.17  ? 10   DG  T C6    1 
ATOM   3588 O  O6    . DG  B 2 10  ? 34.811 -12.679 -9.470  1.00 28.01  ? 10   DG  T O6    1 
ATOM   3589 N  N1    . DG  B 2 10  ? 33.128 -13.323 -8.065  1.00 25.55  ? 10   DG  T N1    1 
ATOM   3590 C  C2    . DG  B 2 10  ? 32.554 -14.181 -7.150  1.00 28.33  ? 10   DG  T C2    1 
ATOM   3591 N  N2    . DG  B 2 10  ? 31.341 -13.822 -6.690  1.00 29.81  ? 10   DG  T N2    1 
ATOM   3592 N  N3    . DG  B 2 10  ? 33.131 -15.305 -6.719  1.00 22.58  ? 10   DG  T N3    1 
ATOM   3593 C  C4    . DG  B 2 10  ? 34.345 -15.510 -7.289  1.00 20.98  ? 10   DG  T C4    1 
ATOM   3594 P  P     . DC  B 2 11  ? 33.911 -21.475 -4.758  1.00 21.56  ? 11   DC  T P     1 
ATOM   3595 O  OP1   . DC  B 2 11  ? 33.408 -21.995 -3.469  1.00 21.87  ? 11   DC  T OP1   1 
ATOM   3596 O  OP2   . DC  B 2 11  ? 34.728 -22.353 -5.629  1.00 25.54  ? 11   DC  T OP2   1 
ATOM   3597 O  "O5'" . DC  B 2 11  ? 32.657 -20.948 -5.578  1.00 22.04  ? 11   DC  T "O5'" 1 
ATOM   3598 C  "C5'" . DC  B 2 11  ? 31.665 -20.268 -4.802  1.00 22.21  ? 11   DC  T "C5'" 1 
ATOM   3599 C  "C4'" . DC  B 2 11  ? 30.540 -19.845 -5.715  1.00 22.89  ? 11   DC  T "C4'" 1 
ATOM   3600 O  "O4'" . DC  B 2 11  ? 31.035 -18.762 -6.542  1.00 23.52  ? 11   DC  T "O4'" 1 
ATOM   3601 C  "C3'" . DC  B 2 11  ? 30.072 -20.939 -6.669  1.00 23.98  ? 11   DC  T "C3'" 1 
ATOM   3602 O  "O3'" . DC  B 2 11  ? 28.643 -20.916 -6.824  1.00 29.03  ? 11   DC  T "O3'" 1 
ATOM   3603 C  "C2'" . DC  B 2 11  ? 30.751 -20.538 -7.983  1.00 23.52  ? 11   DC  T "C2'" 1 
ATOM   3604 C  "C1'" . DC  B 2 11  ? 30.617 -19.024 -7.862  1.00 23.38  ? 11   DC  T "C1'" 1 
ATOM   3605 N  N1    . DC  B 2 11  ? 31.474 -18.200 -8.755  1.00 28.64  ? 11   DC  T N1    1 
ATOM   3606 C  C2    . DC  B 2 11  ? 30.971 -16.956 -9.167  1.00 30.79  ? 11   DC  T C2    1 
ATOM   3607 O  O2    . DC  B 2 11  ? 29.846 -16.590 -8.790  1.00 26.65  ? 11   DC  T O2    1 
ATOM   3608 N  N3    . DC  B 2 11  ? 31.731 -16.178 -9.970  1.00 24.74  ? 11   DC  T N3    1 
ATOM   3609 C  C4    . DC  B 2 11  ? 32.930 -16.590 -10.367 1.00 23.18  ? 11   DC  T C4    1 
ATOM   3610 N  N4    . DC  B 2 11  ? 33.606 -15.750 -11.176 1.00 23.32  ? 11   DC  T N4    1 
ATOM   3611 C  C5    . DC  B 2 11  ? 33.466 -17.846 -9.954  1.00 22.83  ? 11   DC  T C5    1 
ATOM   3612 C  C6    . DC  B 2 11  ? 32.711 -18.623 -9.152  1.00 22.84  ? 11   DC  T C6    1 
ATOM   3613 P  P     . DG  B 2 12  ? 27.667 -21.315 -5.599  1.00 26.76  ? 12   DG  T P     1 
ATOM   3614 O  OP1   . DG  B 2 12  ? 28.404 -22.243 -4.693  1.00 29.50  ? 12   DG  T OP1   1 
ATOM   3615 O  OP2   . DG  B 2 12  ? 26.350 -21.674 -6.172  1.00 25.95  ? 12   DG  T OP2   1 
ATOM   3616 O  "O5'" . DG  B 2 12  ? 27.499 -19.942 -4.806  1.00 31.82  ? 12   DG  T "O5'" 1 
ATOM   3617 C  "C5'" . DG  B 2 12  ? 26.620 -19.867 -3.717  1.00 33.39  ? 12   DG  T "C5'" 1 
ATOM   3618 C  "C4'" . DG  B 2 12  ? 27.159 -18.829 -2.764  1.00 31.81  ? 12   DG  T "C4'" 1 
ATOM   3619 O  "O4'" . DG  B 2 12  ? 26.137 -18.509 -1.795  1.00 42.10  ? 12   DG  T "O4'" 1 
ATOM   3620 C  "C3'" . DG  B 2 12  ? 28.364 -19.295 -1.959  1.00 33.17  ? 12   DG  T "C3'" 1 
ATOM   3621 O  "O3'" . DG  B 2 12  ? 29.137 -18.167 -1.582  1.00 36.29  ? 12   DG  T "O3'" 1 
ATOM   3622 C  "C2'" . DG  B 2 12  ? 27.688 -19.965 -0.764  1.00 48.38  ? 12   DG  T "C2'" 1 
ATOM   3623 C  "C1'" . DG  B 2 12  ? 26.490 -19.044 -0.536  1.00 51.17  ? 12   DG  T "C1'" 1 
ATOM   3624 N  N9    . DG  B 2 12  ? 25.289 -19.675 0.005   1.00 57.97  ? 12   DG  T N9    1 
ATOM   3625 C  C8    . DG  B 2 12  ? 24.398 -19.071 0.857   1.00 62.43  ? 12   DG  T C8    1 
ATOM   3626 N  N7    . DG  B 2 12  ? 23.400 -19.833 1.194   1.00 65.26  ? 12   DG  T N7    1 
ATOM   3627 C  C5    . DG  B 2 12  ? 23.639 -21.021 0.519   1.00 61.08  ? 12   DG  T C5    1 
ATOM   3628 C  C6    . DG  B 2 12  ? 22.884 -22.213 0.511   1.00 60.94  ? 12   DG  T C6    1 
ATOM   3629 O  O6    . DG  B 2 12  ? 21.829 -22.454 1.114   1.00 65.04  ? 12   DG  T O6    1 
ATOM   3630 N  N1    . DG  B 2 12  ? 23.466 -23.183 -0.298  1.00 55.16  ? 12   DG  T N1    1 
ATOM   3631 C  C2    . DG  B 2 12  ? 24.631 -23.019 -1.008  1.00 50.32  ? 12   DG  T C2    1 
ATOM   3632 N  N2    . DG  B 2 12  ? 25.028 -24.076 -1.732  1.00 45.19  ? 12   DG  T N2    1 
ATOM   3633 N  N3    . DG  B 2 12  ? 25.351 -21.904 -1.009  1.00 49.18  ? 12   DG  T N3    1 
ATOM   3634 C  C4    . DG  B 2 12  ? 24.798 -20.946 -0.222  1.00 56.90  ? 12   DG  T C4    1 
ATOM   3635 O  "O5'" . DT  C 3 1   ? 29.581 -7.789  -21.982 1.00 86.25  ? 1    DT  P "O5'" 1 
ATOM   3636 C  "C5'" . DT  C 3 1   ? 28.492 -7.814  -21.066 1.00 80.51  ? 1    DT  P "C5'" 1 
ATOM   3637 C  "C4'" . DT  C 3 1   ? 28.845 -8.589  -19.807 1.00 70.86  ? 1    DT  P "C4'" 1 
ATOM   3638 O  "O4'" . DT  C 3 1   ? 29.259 -9.936  -20.160 1.00 70.40  ? 1    DT  P "O4'" 1 
ATOM   3639 C  "C3'" . DT  C 3 1   ? 29.989 -8.017  -18.979 1.00 62.63  ? 1    DT  P "C3'" 1 
ATOM   3640 O  "O3'" . DT  C 3 1   ? 29.760 -8.325  -17.610 1.00 53.81  ? 1    DT  P "O3'" 1 
ATOM   3641 C  "C2'" . DT  C 3 1   ? 31.188 -8.786  -19.526 1.00 65.13  ? 1    DT  P "C2'" 1 
ATOM   3642 C  "C1'" . DT  C 3 1   ? 30.567 -10.170 -19.675 1.00 64.61  ? 1    DT  P "C1'" 1 
ATOM   3643 N  N1    . DT  C 3 1   ? 31.277 -11.089 -20.622 1.00 63.25  ? 1    DT  P N1    1 
ATOM   3644 C  C2    . DT  C 3 1   ? 31.757 -12.298 -20.157 1.00 57.76  ? 1    DT  P C2    1 
ATOM   3645 O  O2    . DT  C 3 1   ? 31.637 -12.668 -19.002 1.00 51.10  ? 1    DT  P O2    1 
ATOM   3646 N  N3    . DT  C 3 1   ? 32.388 -13.068 -21.102 1.00 59.78  ? 1    DT  P N3    1 
ATOM   3647 C  C4    . DT  C 3 1   ? 32.583 -12.757 -22.435 1.00 61.03  ? 1    DT  P C4    1 
ATOM   3648 O  O4    . DT  C 3 1   ? 33.164 -13.516 -23.204 1.00 57.82  ? 1    DT  P O4    1 
ATOM   3649 C  C5    . DT  C 3 1   ? 32.058 -11.480 -22.857 1.00 66.49  ? 1    DT  P C5    1 
ATOM   3650 C  C7    . DT  C 3 1   ? 32.210 -11.037 -24.284 1.00 71.24  ? 1    DT  P C7    1 
ATOM   3651 C  C6    . DT  C 3 1   ? 31.438 -10.719 -21.944 1.00 65.15  ? 1    DT  P C6    1 
ATOM   3652 P  P     . DG  C 3 2   ? 29.616 -7.148  -16.526 1.00 57.35  ? 2    DG  P P     1 
ATOM   3653 O  OP1   . DG  C 3 2   ? 28.941 -6.003  -17.183 1.00 59.99  ? 2    DG  P OP1   1 
ATOM   3654 O  OP2   . DG  C 3 2   ? 30.933 -6.964  -15.871 1.00 58.61  ? 2    DG  P OP2   1 
ATOM   3655 O  "O5'" . DG  C 3 2   ? 28.649 -7.775  -15.418 1.00 39.92  ? 2    DG  P "O5'" 1 
ATOM   3656 C  "C5'" . DG  C 3 2   ? 27.388 -8.332  -15.767 1.00 39.33  ? 2    DG  P "C5'" 1 
ATOM   3657 C  "C4'" . DG  C 3 2   ? 26.683 -8.748  -14.490 1.00 38.25  ? 2    DG  P "C4'" 1 
ATOM   3658 O  "O4'" . DG  C 3 2   ? 27.245 -9.993  -13.999 1.00 38.48  ? 2    DG  P "O4'" 1 
ATOM   3659 C  "C3'" . DG  C 3 2   ? 26.803 -7.754  -13.341 1.00 37.77  ? 2    DG  P "C3'" 1 
ATOM   3660 O  "O3'" . DG  C 3 2   ? 25.602 -7.781  -12.602 1.00 39.27  ? 2    DG  P "O3'" 1 
ATOM   3661 C  "C2'" . DG  C 3 2   ? 27.972 -8.283  -12.517 1.00 33.39  ? 2    DG  P "C2'" 1 
ATOM   3662 C  "C1'" . DG  C 3 2   ? 27.858 -9.790  -12.736 1.00 33.82  ? 2    DG  P "C1'" 1 
ATOM   3663 N  N9    . DG  C 3 2   ? 29.154 -10.467 -12.736 1.00 36.16  ? 2    DG  P N9    1 
ATOM   3664 C  C8    . DG  C 3 2   ? 30.271 -10.122 -13.458 1.00 43.03  ? 2    DG  P C8    1 
ATOM   3665 N  N7    . DG  C 3 2   ? 31.289 -10.912 -13.252 1.00 41.46  ? 2    DG  P N7    1 
ATOM   3666 C  C5    . DG  C 3 2   ? 30.819 -11.847 -12.334 1.00 33.01  ? 2    DG  P C5    1 
ATOM   3667 C  C6    . DG  C 3 2   ? 31.476 -12.947 -11.731 1.00 36.25  ? 2    DG  P C6    1 
ATOM   3668 O  O6    . DG  C 3 2   ? 32.643 -13.339 -11.900 1.00 33.18  ? 2    DG  P O6    1 
ATOM   3669 N  N1    . DG  C 3 2   ? 30.630 -13.632 -10.857 1.00 34.07  ? 2    DG  P N1    1 
ATOM   3670 C  C2    . DG  C 3 2   ? 29.321 -13.294 -10.594 1.00 28.00  ? 2    DG  P C2    1 
ATOM   3671 N  N2    . DG  C 3 2   ? 28.669 -14.082 -9.719  1.00 28.25  ? 2    DG  P N2    1 
ATOM   3672 N  N3    . DG  C 3 2   ? 28.696 -12.260 -11.151 1.00 33.00  ? 2    DG  P N3    1 
ATOM   3673 C  C4    . DG  C 3 2   ? 29.505 -11.585 -12.006 1.00 34.58  ? 2    DG  P C4    1 
ATOM   3674 P  P     . DC  C 3 3   ? 25.301 -6.649  -11.505 1.00 46.05  ? 3    DC  P P     1 
ATOM   3675 O  OP1   . DC  C 3 3   ? 23.832 -6.557  -11.345 1.00 43.27  ? 3    DC  P OP1   1 
ATOM   3676 O  OP2   . DC  C 3 3   ? 26.078 -5.442  -11.868 1.00 55.08  ? 3    DC  P OP2   1 
ATOM   3677 O  "O5'" . DC  C 3 3   ? 25.944 -7.237  -10.171 1.00 40.99  ? 3    DC  P "O5'" 1 
ATOM   3678 C  "C5'" . DC  C 3 3   ? 25.303 -8.320  -9.537  1.00 43.22  ? 3    DC  P "C5'" 1 
ATOM   3679 C  "C4'" . DC  C 3 3   ? 26.188 -8.914  -8.464  1.00 36.16  ? 3    DC  P "C4'" 1 
ATOM   3680 O  "O4'" . DC  C 3 3   ? 27.422 -9.411  -9.030  1.00 34.70  ? 3    DC  P "O4'" 1 
ATOM   3681 C  "C3'" . DC  C 3 3   ? 26.591 -7.974  -7.326  1.00 36.56  ? 3    DC  P "C3'" 1 
ATOM   3682 O  "O3'" . DC  C 3 3   ? 25.908 -8.476  -6.192  1.00 40.45  ? 3    DC  P "O3'" 1 
ATOM   3683 C  "C2'" . DC  C 3 3   ? 28.112 -8.119  -7.225  1.00 35.48  ? 3    DC  P "C2'" 1 
ATOM   3684 C  "C1'" . DC  C 3 3   ? 28.362 -9.423  -7.981  1.00 30.52  ? 3    DC  P "C1'" 1 
ATOM   3685 N  N1    . DC  C 3 3   ? 29.709 -9.600  -8.591  1.00 34.41  ? 3    DC  P N1    1 
ATOM   3686 C  C2    . DC  C 3 3   ? 30.447 -10.737 -8.250  1.00 31.48  ? 3    DC  P C2    1 
ATOM   3687 O  O2    . DC  C 3 3   ? 29.966 -11.537 -7.438  1.00 33.79  ? 3    DC  P O2    1 
ATOM   3688 N  N3    . DC  C 3 3   ? 31.671 -10.923 -8.796  1.00 31.53  ? 3    DC  P N3    1 
ATOM   3689 C  C4    . DC  C 3 3   ? 32.155 -10.034 -9.664  1.00 32.53  ? 3    DC  P C4    1 
ATOM   3690 N  N4    . DC  C 3 3   ? 33.370 -10.274 -10.178 1.00 30.34  ? 3    DC  P N4    1 
ATOM   3691 C  C5    . DC  C 3 3   ? 31.413 -8.875  -10.042 1.00 34.38  ? 3    DC  P C5    1 
ATOM   3692 C  C6    . DC  C 3 3   ? 30.204 -8.698  -9.491  1.00 37.80  ? 3    DC  P C6    1 
ATOM   3693 P  P     . DG  C 3 4   ? 25.969 -7.708  -4.783  1.00 39.63  ? 4    DG  P P     1 
ATOM   3694 O  OP1   . DG  C 3 4   ? 24.590 -7.631  -4.254  1.00 47.95  ? 4    DG  P OP1   1 
ATOM   3695 O  OP2   . DG  C 3 4   ? 26.764 -6.469  -4.962  1.00 41.53  ? 4    DG  P OP2   1 
ATOM   3696 O  "O5'" . DG  C 3 4   ? 26.820 -8.699  -3.861  1.00 33.85  ? 4    DG  P "O5'" 1 
ATOM   3697 C  "C5'" . DG  C 3 4   ? 26.571 -10.093 -3.960  1.00 34.02  ? 4    DG  P "C5'" 1 
ATOM   3698 C  "C4'" . DG  C 3 4   ? 27.636 -10.850 -3.194  1.00 30.25  ? 4    DG  P "C4'" 1 
ATOM   3699 O  "O4'" . DG  C 3 4   ? 28.818 -10.966 -4.020  1.00 32.79  ? 4    DG  P "O4'" 1 
ATOM   3700 C  "C3'" . DG  C 3 4   ? 28.074 -10.183 -1.896  1.00 32.58  ? 4    DG  P "C3'" 1 
ATOM   3701 O  "O3'" . DG  C 3 4   ? 28.196 -11.174 -0.890  1.00 29.27  ? 4    DG  P "O3'" 1 
ATOM   3702 C  "C2'" . DG  C 3 4   ? 29.425 -9.562  -2.243  1.00 31.96  ? 4    DG  P "C2'" 1 
ATOM   3703 C  "C1'" . DG  C 3 4   ? 29.947 -10.548 -3.277  1.00 31.79  ? 4    DG  P "C1'" 1 
ATOM   3704 N  N9    . DG  C 3 4   ? 30.869 -9.949  -4.230  1.00 33.38  ? 4    DG  P N9    1 
ATOM   3705 C  C8    . DG  C 3 4   ? 30.706 -8.759  -4.897  1.00 33.20  ? 4    DG  P C8    1 
ATOM   3706 N  N7    . DG  C 3 4   ? 31.694 -8.479  -5.701  1.00 33.98  ? 4    DG  P N7    1 
ATOM   3707 C  C5    . DG  C 3 4   ? 32.565 -9.552  -5.560  1.00 29.04  ? 4    DG  P C5    1 
ATOM   3708 C  C6    . DG  C 3 4   ? 33.810 -9.802  -6.184  1.00 29.97  ? 4    DG  P C6    1 
ATOM   3709 O  O6    . DG  C 3 4   ? 34.404 -9.088  -7.012  1.00 32.70  ? 4    DG  P O6    1 
ATOM   3710 N  N1    . DG  C 3 4   ? 34.357 -11.005 -5.753  1.00 24.93  ? 4    DG  P N1    1 
ATOM   3711 C  C2    . DG  C 3 4   ? 33.783 -11.864 -4.842  1.00 30.15  ? 4    DG  P C2    1 
ATOM   3712 N  N2    . DG  C 3 4   ? 34.468 -12.986 -4.557  1.00 27.23  ? 4    DG  P N2    1 
ATOM   3713 N  N3    . DG  C 3 4   ? 32.614 -11.638 -4.252  1.00 27.77  ? 4    DG  P N3    1 
ATOM   3714 C  C4    . DG  C 3 4   ? 32.068 -10.471 -4.661  1.00 28.68  ? 4    DG  P C4    1 
ATOM   3715 P  P     . DT  C 3 5   ? 28.579 -10.761 0.614   1.00 36.08  ? 5    DT  P P     1 
ATOM   3716 O  OP1   . DT  C 3 5   ? 27.832 -11.648 1.532   1.00 42.46  ? 5    DT  P OP1   1 
ATOM   3717 O  OP2   . DT  C 3 5   ? 28.463 -9.289  0.735   1.00 41.57  ? 5    DT  P OP2   1 
ATOM   3718 O  "O5'" . DT  C 3 5   ? 30.124 -11.139 0.717   1.00 33.67  ? 5    DT  P "O5'" 1 
ATOM   3719 C  "C5'" . DT  C 3 5   ? 30.499 -12.476 0.506   1.00 30.78  ? 5    DT  P "C5'" 1 
ATOM   3720 C  "C4'" . DT  C 3 5   ? 32.008 -12.552 0.518   1.00 33.99  ? 5    DT  P "C4'" 1 
ATOM   3721 O  "O4'" . DT  C 3 5   ? 32.514 -11.820 -0.621  1.00 34.66  ? 5    DT  P "O4'" 1 
ATOM   3722 C  "C3'" . DT  C 3 5   ? 32.658 -11.936 1.757   1.00 33.38  ? 5    DT  P "C3'" 1 
ATOM   3723 O  "O3'" . DT  C 3 5   ? 33.277 -13.006 2.452   1.00 36.06  ? 5    DT  P "O3'" 1 
ATOM   3724 C  "C2'" . DT  C 3 5   ? 33.643 -10.905 1.200   1.00 32.50  ? 5    DT  P "C2'" 1 
ATOM   3725 C  "C1'" . DT  C 3 5   ? 33.786 -11.322 -0.261  1.00 30.77  ? 5    DT  P "C1'" 1 
ATOM   3726 N  N1    . DT  C 3 5   ? 34.127 -10.228 -1.221  1.00 27.29  ? 5    DT  P N1    1 
ATOM   3727 C  C2    . DT  C 3 5   ? 35.283 -10.338 -1.967  1.00 22.13  ? 5    DT  P C2    1 
ATOM   3728 O  O2    . DT  C 3 5   ? 36.049 -11.275 -1.877  1.00 25.55  ? 5    DT  P O2    1 
ATOM   3729 N  N3    . DT  C 3 5   ? 35.504 -9.298  -2.827  1.00 30.43  ? 5    DT  P N3    1 
ATOM   3730 C  C4    . DT  C 3 5   ? 34.716 -8.190  -3.026  1.00 31.60  ? 5    DT  P C4    1 
ATOM   3731 O  O4    . DT  C 3 5   ? 35.022 -7.315  -3.829  1.00 39.27  ? 5    DT  P O4    1 
ATOM   3732 C  C5    . DT  C 3 5   ? 33.518 -8.134  -2.223  1.00 34.78  ? 5    DT  P C5    1 
ATOM   3733 C  C7    . DT  C 3 5   ? 32.579 -6.968  -2.342  1.00 40.94  ? 5    DT  P C7    1 
ATOM   3734 C  C6    . DT  C 3 5   ? 33.289 -9.143  -1.373  1.00 28.10  ? 5    DT  P C6    1 
ATOM   3735 P  P     . DC  C 3 6   ? 33.971 -12.765 3.884   1.00 35.09  ? 6    DC  P P     1 
ATOM   3736 O  OP1   . DC  C 3 6   ? 33.824 -14.001 4.667   1.00 32.37  ? 6    DC  P OP1   1 
ATOM   3737 O  OP2   . DC  C 3 6   ? 33.522 -11.457 4.407   1.00 34.44  ? 6    DC  P OP2   1 
ATOM   3738 O  "O5'" . DC  C 3 6   ? 35.526 -12.623 3.521   1.00 29.50  ? 6    DC  P "O5'" 1 
ATOM   3739 C  "C5'" . DC  C 3 6   ? 36.140 -13.591 2.699   1.00 24.27  ? 6    DC  P "C5'" 1 
ATOM   3740 C  "C4'" . DC  C 3 6   ? 37.505 -13.093 2.264   1.00 18.52  ? 6    DC  P "C4'" 1 
ATOM   3741 O  "O4'" . DC  C 3 6   ? 37.352 -12.036 1.287   1.00 19.41  ? 6    DC  P "O4'" 1 
ATOM   3742 C  "C3'" . DC  C 3 6   ? 38.353 -12.511 3.388   1.00 17.48  ? 6    DC  P "C3'" 1 
ATOM   3743 O  "O3'" . DC  C 3 6   ? 39.532 -13.297 3.443   1.00 16.43  ? 6    DC  P "O3'" 1 
ATOM   3744 C  "C2'" . DC  C 3 6   ? 38.638 -11.068 2.960   1.00 18.51  ? 6    DC  P "C2'" 1 
ATOM   3745 C  "C1'" . DC  C 3 6   ? 38.415 -11.118 1.456   1.00 17.34  ? 6    DC  P "C1'" 1 
ATOM   3746 N  N1    . DC  C 3 6   ? 37.943 -9.848  0.841   1.00 19.80  ? 6    DC  P N1    1 
ATOM   3747 C  C2    . DC  C 3 6   ? 38.696 -9.265  -0.179  1.00 16.90  ? 6    DC  P C2    1 
ATOM   3748 O  O2    . DC  C 3 6   ? 39.749 -9.824  -0.529  1.00 18.90  ? 6    DC  P O2    1 
ATOM   3749 N  N3    . DC  C 3 6   ? 38.247 -8.121  -0.747  1.00 18.20  ? 6    DC  P N3    1 
ATOM   3750 C  C4    . DC  C 3 6   ? 37.110 -7.562  -0.342  1.00 17.64  ? 6    DC  P C4    1 
ATOM   3751 N  N4    . DC  C 3 6   ? 36.726 -6.421  -0.934  1.00 19.65  ? 6    DC  P N4    1 
ATOM   3752 C  C5    . DC  C 3 6   ? 36.324 -8.135  0.702   1.00 20.95  ? 6    DC  P C5    1 
ATOM   3753 C  C6    . DC  C 3 6   ? 36.778 -9.270  1.255   1.00 18.11  ? 6    DC  P C6    1 
ATOM   3754 P  P     . DA  C 3 7   ? 40.590 -13.112 4.635   1.00 17.73  ? 7    DA  P P     1 
ATOM   3755 O  OP1   . DA  C 3 7   ? 41.335 -14.397 4.778   1.00 20.52  ? 7    DA  P OP1   1 
ATOM   3756 O  OP2   . DA  C 3 7   ? 39.883 -12.556 5.805   1.00 20.42  ? 7    DA  P OP2   1 
ATOM   3757 O  "O5'" . DA  C 3 7   ? 41.580 -12.006 4.092   1.00 15.08  ? 7    DA  P "O5'" 1 
ATOM   3758 C  "C5'" . DA  C 3 7   ? 42.520 -12.313 3.088   1.00 15.07  ? 7    DA  P "C5'" 1 
ATOM   3759 C  "C4'" . DA  C 3 7   ? 43.269 -11.042 2.746   1.00 19.03  ? 7    DA  P "C4'" 1 
ATOM   3760 O  "O4'" . DA  C 3 7   ? 42.335 -10.141 2.103   1.00 17.62  ? 7    DA  P "O4'" 1 
ATOM   3761 C  "C3'" . DA  C 3 7   ? 43.833 -10.289 3.955   1.00 16.86  ? 7    DA  P "C3'" 1 
ATOM   3762 O  "O3'" . DA  C 3 7   ? 45.257 -10.398 3.905   1.00 17.23  ? 7    DA  P "O3'" 1 
ATOM   3763 C  "C2'" . DA  C 3 7   ? 43.309 -8.859  3.778   1.00 16.77  ? 7    DA  P "C2'" 1 
ATOM   3764 C  "C1'" . DA  C 3 7   ? 42.812 -8.845  2.333   1.00 17.77  ? 7    DA  P "C1'" 1 
ATOM   3765 N  N9    . DA  C 3 7   ? 41.726 -7.897  2.086   1.00 15.79  ? 7    DA  P N9    1 
ATOM   3766 C  C8    . DA  C 3 7   ? 40.532 -7.785  2.754   1.00 18.15  ? 7    DA  P C8    1 
ATOM   3767 N  N7    . DA  C 3 7   ? 39.765 -6.816  2.301   1.00 19.72  ? 7    DA  P N7    1 
ATOM   3768 C  C5    . DA  C 3 7   ? 40.501 -6.276  1.247   1.00 15.93  ? 7    DA  P C5    1 
ATOM   3769 C  C6    . DA  C 3 7   ? 40.249 -5.212  0.355   1.00 22.75  ? 7    DA  P C6    1 
ATOM   3770 N  N6    . DA  C 3 7   ? 39.117 -4.487  0.375   1.00 24.12  ? 7    DA  P N6    1 
ATOM   3771 N  N1    . DA  C 3 7   ? 41.202 -4.927  -0.561  1.00 24.13  ? 7    DA  P N1    1 
ATOM   3772 C  C2    . DA  C 3 7   ? 42.334 -5.657  -0.580  1.00 20.79  ? 7    DA  P C2    1 
ATOM   3773 N  N3    . DA  C 3 7   ? 42.688 -6.685  0.211   1.00 16.92  ? 7    DA  P N3    1 
ATOM   3774 C  C4    . DA  C 3 7   ? 41.715 -6.924  1.108   1.00 16.03  ? 7    DA  P C4    1 
ATOM   3775 P  P     . DT  C 3 8   ? 46.182 -9.665  5.000   1.00 18.07  ? 8    DT  P P     1 
ATOM   3776 O  OP1   . DT  C 3 8   ? 47.414 -10.461 5.160   1.00 21.53  ? 8    DT  P OP1   1 
ATOM   3777 O  OP2   . DT  C 3 8   ? 45.348 -9.374  6.181   1.00 18.65  ? 8    DT  P OP2   1 
ATOM   3778 O  "O5'" . DT  C 3 8   ? 46.516 -8.268  4.322   1.00 19.25  ? 8    DT  P "O5'" 1 
ATOM   3779 C  "C5'" A DT  C 3 8   ? 47.203 -8.215  3.082   0.50 22.16  ? 8    DT  P "C5'" 1 
ATOM   3780 C  "C5'" B DT  C 3 8   ? 47.300 -8.147  3.152   0.50 23.96  ? 8    DT  P "C5'" 1 
ATOM   3781 C  "C4'" A DT  C 3 8   ? 47.132 -6.797  2.542   0.50 24.16  ? 8    DT  P "C4'" 1 
ATOM   3782 C  "C4'" B DT  C 3 8   ? 47.192 -6.720  2.635   0.50 25.65  ? 8    DT  P "C4'" 1 
ATOM   3783 O  "O4'" A DT  C 3 8   ? 45.758 -6.497  2.196   0.50 25.52  ? 8    DT  P "O4'" 1 
ATOM   3784 O  "O4'" B DT  C 3 8   ? 45.845 -6.477  2.158   0.50 26.16  ? 8    DT  P "O4'" 1 
ATOM   3785 C  "C3'" A DT  C 3 8   ? 47.501 -5.705  3.544   0.50 29.48  ? 8    DT  P "C3'" 1 
ATOM   3786 C  "C3'" B DT  C 3 8   ? 47.344 -5.602  3.664   0.50 29.91  ? 8    DT  P "C3'" 1 
ATOM   3787 O  "O3'" A DT  C 3 8   ? 48.848 -5.285  3.444   0.50 32.71  ? 8    DT  P "O3'" 1 
ATOM   3788 O  "O3'" B DT  C 3 8   ? 48.693 -5.412  4.141   0.50 33.69  ? 8    DT  P "O3'" 1 
ATOM   3789 C  "C2'" A DT  C 3 8   ? 46.624 -4.523  3.163   0.50 30.01  ? 8    DT  P "C2'" 1 
ATOM   3790 C  "C2'" B DT  C 3 8   ? 46.775 -4.411  2.903   0.50 31.76  ? 8    DT  P "C2'" 1 
ATOM   3791 C  "C1'" A DT  C 3 8   ? 45.639 -5.089  2.156   0.50 27.06  ? 8    DT  P "C1'" 1 
ATOM   3792 C  "C1'" B DT  C 3 8   ? 45.660 -5.069  2.097   0.50 27.08  ? 8    DT  P "C1'" 1 
ATOM   3793 N  N1    . DT  C 3 8   ? 44.298 -4.661  2.562   1.00 22.67  ? 8    DT  P N1    1 
ATOM   3794 C  C2    . DT  C 3 8   ? 43.694 -3.646  1.863   1.00 22.20  ? 8    DT  P C2    1 
ATOM   3795 O  O2    . DT  C 3 8   ? 44.223 -3.110  0.911   1.00 25.80  ? 8    DT  P O2    1 
ATOM   3796 N  N3    . DT  C 3 8   ? 42.462 -3.300  2.313   1.00 20.62  ? 8    DT  P N3    1 
ATOM   3797 C  C4    . DT  C 3 8   ? 41.782 -3.843  3.380   1.00 19.34  ? 8    DT  P C4    1 
ATOM   3798 O  O4    . DT  C 3 8   ? 40.664 -3.438  3.691   1.00 26.78  ? 8    DT  P O4    1 
ATOM   3799 C  C5    . DT  C 3 8   ? 42.476 -4.892  4.079   1.00 18.89  ? 8    DT  P C5    1 
ATOM   3800 C  C7    . DT  C 3 8   ? 41.825 -5.560  5.257   1.00 32.98  ? 8    DT  P C7    1 
ATOM   3801 C  C6    . DT  C 3 8   ? 43.690 -5.251  3.650   1.00 19.75  ? 8    DT  P C6    1 
ATOM   3802 P  P     A DA  C 3 9   ? 49.369 -4.039  4.324   0.50 29.26  ? 9    DA  P P     1 
ATOM   3803 P  P     B DA  C 3 9   ? 49.806 -4.684  3.228   0.50 38.98  ? 9    DA  P P     1 
ATOM   3804 O  OP1   A DA  C 3 9   ? 50.843 -4.118  4.402   0.50 33.55  ? 9    DA  P OP1   1 
ATOM   3805 O  OP1   B DA  C 3 9   ? 49.885 -5.400  1.938   0.50 31.26  ? 9    DA  P OP1   1 
ATOM   3806 O  OP2   A DA  C 3 9   ? 48.567 -3.985  5.564   0.50 27.28  ? 9    DA  P OP2   1 
ATOM   3807 O  OP2   B DA  C 3 9   ? 51.010 -4.481  4.061   0.50 40.92  ? 9    DA  P OP2   1 
ATOM   3808 O  "O5'" A DA  C 3 9   ? 49.012 -2.758  3.427   0.50 28.22  ? 9    DA  P "O5'" 1 
ATOM   3809 O  "O5'" B DA  C 3 9   ? 49.188 -3.246  2.934   0.50 34.23  ? 9    DA  P "O5'" 1 
ATOM   3810 C  "C5'" A DA  C 3 9   ? 49.583 -2.561  2.130   0.50 30.48  ? 9    DA  P "C5'" 1 
ATOM   3811 C  "C5'" B DA  C 3 9   ? 49.735 -2.579  1.823   0.50 31.63  ? 9    DA  P "C5'" 1 
ATOM   3812 C  "C4'" . DA  C 3 9   ? 49.258 -1.147  1.706   1.00 24.28  ? 9    DA  P "C4'" 1 
ATOM   3813 O  "O4'" . DA  C 3 9   ? 47.816 -1.087  1.680   1.00 22.56  ? 9    DA  P "O4'" 1 
ATOM   3814 C  "C3'" . DA  C 3 9   ? 49.732 -0.162  2.767   1.00 31.51  ? 9    DA  P "C3'" 1 
ATOM   3815 O  "O3'" . DA  C 3 9   ? 50.616 0.781   2.191   1.00 29.46  ? 9    DA  P "O3'" 1 
ATOM   3816 C  "C2'" . DA  C 3 9   ? 48.466 0.530   3.272   1.00 35.08  ? 9    DA  P "C2'" 1 
ATOM   3817 C  "C1'" . DA  C 3 9   ? 47.381 0.117   2.286   1.00 27.12  ? 9    DA  P "C1'" 1 
ATOM   3818 N  N9    . DA  C 3 9   ? 46.108 -0.157  2.948   1.00 20.43  ? 9    DA  P N9    1 
ATOM   3819 C  C8    . DA  C 3 9   ? 45.797 -1.232  3.726   1.00 19.22  ? 9    DA  P C8    1 
ATOM   3820 N  N7    . DA  C 3 9   ? 44.566 -1.215  4.186   1.00 19.68  ? 9    DA  P N7    1 
ATOM   3821 C  C5    . DA  C 3 9   ? 44.033 -0.041  3.677   1.00 21.15  ? 9    DA  P C5    1 
ATOM   3822 C  C6    . DA  C 3 9   ? 42.764 0.560   3.791   1.00 30.47  ? 9    DA  P C6    1 
ATOM   3823 N  N6    . DA  C 3 9   ? 41.752 0.033   4.494   1.00 26.64  ? 9    DA  P N6    1 
ATOM   3824 N  N1    . DA  C 3 9   ? 42.573 1.732   3.148   1.00 33.86  ? 9    DA  P N1    1 
ATOM   3825 C  C2    . DA  C 3 9   ? 43.587 2.257   2.446   1.00 33.48  ? 9    DA  P C2    1 
ATOM   3826 N  N3    . DA  C 3 9   ? 44.821 1.776   2.265   1.00 23.34  ? 9    DA  P N3    1 
ATOM   3827 C  C4    . DA  C 3 9   ? 44.972 0.620   2.911   1.00 20.56  ? 9    DA  P C4    1 
HETATM 3828 MG MG    . MG  D 4 .   ? 52.886 0.289   2.271   0.50 13.51  ? 502  MG  A MG    1 
HETATM 3829 CA CA    A CA  E 5 .   ? 54.821 2.640   3.941   0.50 9.60   ? 503  CA  A CA    1 
HETATM 3830 MG MG    B MG  F 4 .   ? 54.821 2.600   3.941   0.50 11.88  ? 504  MG  A MG    1 
HETATM 3831 C  C1    . GOL G 6 .   ? 60.457 -25.018 12.414  1.00 18.33  ? 505  GOL A C1    1 
HETATM 3832 O  O1    . GOL G 6 .   ? 59.058 -24.952 12.408  1.00 18.73  ? 505  GOL A O1    1 
HETATM 3833 C  C2    . GOL G 6 .   ? 61.079 -24.546 11.093  1.00 21.64  ? 505  GOL A C2    1 
HETATM 3834 O  O2    . GOL G 6 .   ? 60.681 -23.226 10.832  1.00 14.41  ? 505  GOL A O2    1 
HETATM 3835 C  C3    . GOL G 6 .   ? 60.729 -25.432 9.895   1.00 23.02  ? 505  GOL A C3    1 
HETATM 3836 O  O3    . GOL G 6 .   ? 61.527 -25.059 8.774   1.00 18.20  ? 505  GOL A O3    1 
HETATM 3837 C  C1    . GOL H 6 .   ? 54.619 28.258  4.833   1.00 41.79  ? 506  GOL A C1    1 
HETATM 3838 O  O1    . GOL H 6 .   ? 53.267 28.015  4.491   1.00 38.19  ? 506  GOL A O1    1 
HETATM 3839 C  C2    . GOL H 6 .   ? 55.076 27.303  5.935   1.00 46.36  ? 506  GOL A C2    1 
HETATM 3840 O  O2    . GOL H 6 .   ? 54.287 26.134  5.915   1.00 47.34  ? 506  GOL A O2    1 
HETATM 3841 C  C3    . GOL H 6 .   ? 56.540 26.932  5.720   1.00 41.99  ? 506  GOL A C3    1 
HETATM 3842 O  O3    . GOL H 6 .   ? 56.997 26.040  6.720   1.00 27.20  ? 506  GOL A O3    1 
HETATM 3843 P  PG    . DTP I 7 .   ? 55.289 2.656   7.442   1.00 12.71  ? 501  DTP P PG    1 
HETATM 3844 O  O1G   . DTP I 7 .   ? 54.956 1.726   8.589   1.00 14.23  ? 501  DTP P O1G   1 
HETATM 3845 O  O2G   . DTP I 7 .   ? 56.545 3.434   7.654   1.00 13.25  ? 501  DTP P O2G   1 
HETATM 3846 O  O3G   . DTP I 7 .   ? 55.138 1.997   6.093   1.00 14.26  ? 501  DTP P O3G   1 
HETATM 3847 P  PB    . DTP I 7 .   ? 53.096 4.200   6.338   1.00 11.99  ? 501  DTP P PB    1 
HETATM 3848 O  O1B   . DTP I 7 .   ? 53.811 4.380   5.020   1.00 12.08  ? 501  DTP P O1B   1 
HETATM 3849 O  O2B   . DTP I 7 .   ? 52.321 5.384   6.875   1.00 12.20  ? 501  DTP P O2B   1 
HETATM 3850 O  O3B   . DTP I 7 .   ? 54.122 3.785   7.516   1.00 13.17  ? 501  DTP P O3B   1 
HETATM 3851 P  PA    . DTP I 7 .   ? 51.558 2.110   5.023   1.00 17.94  ? 501  DTP P PA    1 
HETATM 3852 O  O1A   . DTP I 7 .   ? 50.661 1.029   5.592   1.00 17.68  ? 501  DTP P O1A   1 
HETATM 3853 O  O2A   . DTP I 7 .   ? 52.684 1.646   4.127   1.00 15.13  ? 501  DTP P O2A   1 
HETATM 3854 O  O3A   . DTP I 7 .   ? 52.116 2.930   6.306   1.00 13.50  ? 501  DTP P O3A   1 
HETATM 3855 O  "O5'" . DTP I 7 .   ? 50.568 3.091   4.217   1.00 13.59  ? 501  DTP P "O5'" 1 
HETATM 3856 C  "C5'" . DTP I 7 .   ? 51.004 4.011   3.219   1.00 13.28  ? 501  DTP P "C5'" 1 
HETATM 3857 C  "C4'" . DTP I 7 .   ? 50.095 5.233   3.257   1.00 11.67  ? 501  DTP P "C4'" 1 
HETATM 3858 O  "O4'" . DTP I 7 .   ? 48.749 4.883   2.916   1.00 13.15  ? 501  DTP P "O4'" 1 
HETATM 3859 C  "C3'" . DTP I 7 .   ? 50.009 5.869   4.642   1.00 13.26  ? 501  DTP P "C3'" 1 
HETATM 3860 O  "O3'" . DTP I 7 .   ? 51.030 6.854   4.858   1.00 11.93  ? 501  DTP P "O3'" 1 
HETATM 3861 C  "C2'" . DTP I 7 .   ? 48.615 6.481   4.665   1.00 11.15  ? 501  DTP P "C2'" 1 
HETATM 3862 C  "C1'" . DTP I 7 .   ? 47.809 5.552   3.770   1.00 11.91  ? 501  DTP P "C1'" 1 
HETATM 3863 N  N9    . DTP I 7 .   ? 47.063 4.516   4.528   1.00 12.82  ? 501  DTP P N9    1 
HETATM 3864 C  C8    . DTP I 7 .   ? 47.542 3.354   5.006   1.00 14.57  ? 501  DTP P C8    1 
HETATM 3865 N  N7    . DTP I 7 .   ? 46.531 2.675   5.602   1.00 14.11  ? 501  DTP P N7    1 
HETATM 3866 C  C5    . DTP I 7 .   ? 45.411 3.434   5.488   1.00 12.32  ? 501  DTP P C5    1 
HETATM 3867 C  C6    . DTP I 7 .   ? 44.096 3.266   5.886   1.00 17.11  ? 501  DTP P C6    1 
HETATM 3868 N  N6    . DTP I 7 .   ? 43.715 2.151   6.563   1.00 19.45  ? 501  DTP P N6    1 
HETATM 3869 N  N1    . DTP I 7 .   ? 43.194 4.234   5.603   1.00 13.96  ? 501  DTP P N1    1 
HETATM 3870 C  C2    . DTP I 7 .   ? 43.567 5.340   4.943   1.00 16.21  ? 501  DTP P C2    1 
HETATM 3871 N  N3    . DTP I 7 .   ? 44.827 5.522   4.526   1.00 15.23  ? 501  DTP P N3    1 
HETATM 3872 C  C4    . DTP I 7 .   ? 45.759 4.578   4.800   1.00 12.75  ? 501  DTP P C4    1 
HETATM 3873 O  O     . HOH J 8 .   ? 53.054 -1.078  3.944   1.00 29.61  ? 601  HOH A O     1 
HETATM 3874 O  O     . HOH J 8 .   ? 67.492 -20.769 8.942   1.00 11.74  ? 602  HOH A O     1 
HETATM 3875 O  O     . HOH J 8 .   ? 64.048 -3.479  6.203   1.00 14.67  ? 603  HOH A O     1 
HETATM 3876 O  O     . HOH J 8 .   ? 43.920 -14.442 5.877   1.00 14.15  ? 604  HOH A O     1 
HETATM 3877 O  O     . HOH J 8 .   ? 56.392 -14.003 -5.708  1.00 13.81  ? 605  HOH A O     1 
HETATM 3878 O  O     . HOH J 8 .   ? 57.970 -23.534 14.384  1.00 12.56  ? 606  HOH A O     1 
HETATM 3879 O  O     . HOH J 8 .   ? 53.778 -28.475 4.339   1.00 15.01  ? 607  HOH A O     1 
HETATM 3880 O  O     . HOH J 8 .   ? 69.164 -17.659 -1.197  1.00 13.49  ? 608  HOH A O     1 
HETATM 3881 O  O     . HOH J 8 .   ? 69.231 -13.577 5.177   1.00 13.87  ? 609  HOH A O     1 
HETATM 3882 O  O     . HOH J 8 .   ? 60.423 -18.546 -4.437  1.00 13.68  ? 610  HOH A O     1 
HETATM 3883 O  O     . HOH J 8 .   ? 54.707 -11.456 3.672   1.00 14.55  ? 611  HOH A O     1 
HETATM 3884 O  O     . HOH J 8 .   ? 52.027 5.804   9.449   1.00 15.10  ? 612  HOH A O     1 
HETATM 3885 O  O     . HOH J 8 .   ? 73.194 -7.520  9.158   1.00 15.38  ? 613  HOH A O     1 
HETATM 3886 O  O     . HOH J 8 .   ? 55.537 17.485  -0.529  1.00 13.71  ? 614  HOH A O     1 
HETATM 3887 O  O     . HOH J 8 .   ? 59.549 9.598   10.941  1.00 13.56  ? 615  HOH A O     1 
HETATM 3888 O  O     . HOH J 8 .   ? 62.444 7.383   7.257   1.00 17.53  ? 616  HOH A O     1 
HETATM 3889 O  O     . HOH J 8 .   ? 43.629 12.114  -7.038  1.00 17.61  ? 617  HOH A O     1 
HETATM 3890 O  O     . HOH J 8 .   ? 46.285 16.726  1.418   1.00 14.33  ? 618  HOH A O     1 
HETATM 3891 O  O     . HOH J 8 .   ? 62.598 14.783  -8.984  1.00 15.18  ? 619  HOH A O     1 
HETATM 3892 O  O     . HOH J 8 .   ? 68.817 16.346  -3.856  1.00 14.81  ? 620  HOH A O     1 
HETATM 3893 O  O     . HOH J 8 .   ? 58.488 -12.091 -11.305 1.00 15.89  ? 621  HOH A O     1 
HETATM 3894 O  O     . HOH J 8 .   ? 54.280 -9.534  5.505   1.00 19.52  ? 622  HOH A O     1 
HETATM 3895 O  O     . HOH J 8 .   ? 67.115 -16.683 9.876   1.00 15.76  ? 623  HOH A O     1 
HETATM 3896 O  O     . HOH J 8 .   ? 65.586 -23.001 3.412   1.00 15.99  ? 624  HOH A O     1 
HETATM 3897 O  O     . HOH J 8 .   ? 70.777 16.236  -5.909  1.00 18.49  ? 625  HOH A O     1 
HETATM 3898 O  O     . HOH J 8 .   ? 45.560 15.949  -1.321  1.00 14.93  ? 626  HOH A O     1 
HETATM 3899 O  O     . HOH J 8 .   ? 53.716 -20.444 -2.351  1.00 18.73  ? 627  HOH A O     1 
HETATM 3900 O  O     . HOH J 8 .   ? 53.962 17.378  -3.098  1.00 18.21  ? 628  HOH A O     1 
HETATM 3901 O  O     . HOH J 8 .   ? 44.144 -15.090 1.551   1.00 22.11  ? 629  HOH A O     1 
HETATM 3902 O  O     . HOH J 8 .   ? 41.246 7.699   -18.325 1.00 16.82  ? 630  HOH A O     1 
HETATM 3903 O  O     . HOH J 8 .   ? 53.402 -28.233 15.468  1.00 21.43  ? 631  HOH A O     1 
HETATM 3904 O  O     . HOH J 8 .   ? 51.210 5.521   -8.160  1.00 19.60  ? 632  HOH A O     1 
HETATM 3905 O  O     . HOH J 8 .   ? 65.895 -15.294 11.824  1.00 20.06  ? 633  HOH A O     1 
HETATM 3906 O  O     . HOH J 8 .   ? 60.036 11.602  -10.117 1.00 20.17  ? 634  HOH A O     1 
HETATM 3907 O  O     . HOH J 8 .   ? 49.144 -15.659 13.747  1.00 20.55  ? 635  HOH A O     1 
HETATM 3908 O  O     . HOH J 8 .   ? 60.779 -23.558 6.545   1.00 18.85  ? 636  HOH A O     1 
HETATM 3909 O  O     . HOH J 8 .   ? 71.163 3.538   -0.172  1.00 20.05  ? 637  HOH A O     1 
HETATM 3910 O  O     . HOH J 8 .   ? 42.046 8.158   3.334   1.00 17.11  ? 638  HOH A O     1 
HETATM 3911 O  O     . HOH J 8 .   ? 70.801 -19.102 1.596   1.00 16.98  ? 639  HOH A O     1 
HETATM 3912 O  O     . HOH J 8 .   ? 48.583 -22.212 -5.493  1.00 23.88  ? 640  HOH A O     1 
HETATM 3913 O  O     . HOH J 8 .   ? 44.528 7.271   2.274   1.00 15.99  ? 641  HOH A O     1 
HETATM 3914 O  O     . HOH J 8 .   ? 51.404 5.177   -10.803 1.00 19.26  ? 642  HOH A O     1 
HETATM 3915 O  O     . HOH J 8 .   ? 42.106 -22.569 -2.318  1.00 18.97  ? 643  HOH A O     1 
HETATM 3916 O  O     . HOH J 8 .   ? 52.346 15.781  -4.488  1.00 17.50  ? 644  HOH A O     1 
HETATM 3917 O  O     . HOH J 8 .   ? 52.322 20.108  5.218   1.00 19.71  ? 645  HOH A O     1 
HETATM 3918 O  O     . HOH J 8 .   ? 52.622 1.240   9.737   1.00 24.08  ? 646  HOH A O     1 
HETATM 3919 O  O     . HOH J 8 .   ? 45.112 -14.260 10.699  1.00 18.44  ? 647  HOH A O     1 
HETATM 3920 O  O     . HOH J 8 .   ? 48.952 6.781   -11.642 1.00 18.39  ? 648  HOH A O     1 
HETATM 3921 O  O     . HOH J 8 .   ? 45.033 7.407   -10.016 1.00 19.61  ? 649  HOH A O     1 
HETATM 3922 O  O     . HOH J 8 .   ? 50.208 -17.254 15.693  1.00 17.35  ? 650  HOH A O     1 
HETATM 3923 O  O     . HOH J 8 .   ? 48.371 -36.849 2.809   1.00 23.41  ? 651  HOH A O     1 
HETATM 3924 O  O     . HOH J 8 .   ? 59.968 10.536  19.960  1.00 21.68  ? 652  HOH A O     1 
HETATM 3925 O  O     . HOH J 8 .   ? 43.557 9.703   -9.723  1.00 19.84  ? 653  HOH A O     1 
HETATM 3926 O  O     . HOH J 8 .   ? 43.355 -33.168 -0.318  1.00 18.88  ? 654  HOH A O     1 
HETATM 3927 O  O     . HOH J 8 .   ? 37.111 16.033  -3.948  1.00 20.56  ? 655  HOH A O     1 
HETATM 3928 O  O     . HOH J 8 .   ? 53.505 13.553  -9.742  1.00 21.95  ? 656  HOH A O     1 
HETATM 3929 O  O     . HOH J 8 .   ? 59.368 11.081  8.640   1.00 19.66  ? 657  HOH A O     1 
HETATM 3930 O  O     . HOH J 8 .   ? 41.471 17.034  -14.775 1.00 19.92  ? 658  HOH A O     1 
HETATM 3931 O  O     . HOH J 8 .   ? 53.162 -33.531 0.016   1.00 23.25  ? 659  HOH A O     1 
HETATM 3932 O  O     . HOH J 8 .   ? 48.056 10.826  -9.323  1.00 22.66  ? 660  HOH A O     1 
HETATM 3933 O  O     . HOH J 8 .   ? 49.274 7.343   -7.469  1.00 21.30  ? 661  HOH A O     1 
HETATM 3934 O  O     . HOH J 8 .   ? 47.758 7.935   -9.485  1.00 21.48  ? 662  HOH A O     1 
HETATM 3935 O  O     . HOH J 8 .   ? 64.016 -9.344  -14.239 1.00 22.84  ? 663  HOH A O     1 
HETATM 3936 O  O     . HOH J 8 .   ? 64.525 6.555   -0.394  1.00 17.63  ? 664  HOH A O     1 
HETATM 3937 O  O     . HOH J 8 .   ? 65.690 -6.644  -13.612 1.00 21.67  ? 665  HOH A O     1 
HETATM 3938 O  O     . HOH J 8 .   ? 41.338 6.580   19.317  1.00 21.29  ? 666  HOH A O     1 
HETATM 3939 O  O     . HOH J 8 .   ? 41.785 -30.477 -6.127  1.00 21.66  ? 667  HOH A O     1 
HETATM 3940 O  O     . HOH J 8 .   ? 50.156 2.872   13.015  1.00 30.14  ? 668  HOH A O     1 
HETATM 3941 O  O     . HOH J 8 .   ? 60.482 -17.566 -7.168  1.00 25.71  ? 669  HOH A O     1 
HETATM 3942 O  O     . HOH J 8 .   ? 50.370 -34.834 -0.471  1.00 21.31  ? 670  HOH A O     1 
HETATM 3943 O  O     . HOH J 8 .   ? 71.586 6.138   -6.979  1.00 20.79  ? 671  HOH A O     1 
HETATM 3944 O  O     . HOH J 8 .   ? 68.318 -15.759 -7.428  1.00 26.56  ? 672  HOH A O     1 
HETATM 3945 O  O     . HOH J 8 .   ? 51.228 3.399   10.520  1.00 23.94  ? 673  HOH A O     1 
HETATM 3946 O  O     . HOH J 8 .   ? 41.404 23.716  9.027   1.00 19.15  ? 674  HOH A O     1 
HETATM 3947 O  O     . HOH J 8 .   ? 59.928 14.078  -8.564  1.00 22.33  ? 675  HOH A O     1 
HETATM 3948 O  O     . HOH J 8 .   ? 49.920 -3.144  -17.105 1.00 25.25  ? 676  HOH A O     1 
HETATM 3949 O  O     . HOH J 8 .   ? 65.576 5.643   2.359   1.00 21.39  ? 677  HOH A O     1 
HETATM 3950 O  O     . HOH J 8 .   ? 40.929 16.947  6.647   1.00 20.15  ? 678  HOH A O     1 
HETATM 3951 O  O     . HOH J 8 .   ? 49.371 8.516   -13.569 1.00 24.11  ? 679  HOH A O     1 
HETATM 3952 O  O     . HOH J 8 .   ? 78.129 -1.090  5.488   1.00 22.41  ? 680  HOH A O     1 
HETATM 3953 O  O     . HOH J 8 .   ? 44.111 11.118  -12.115 1.00 20.75  ? 681  HOH A O     1 
HETATM 3954 O  O     . HOH J 8 .   ? 51.044 -8.713  -5.006  1.00 29.57  ? 682  HOH A O     1 
HETATM 3955 O  O     . HOH J 8 .   ? 51.690 -8.705  5.155   1.00 25.66  ? 683  HOH A O     1 
HETATM 3956 O  O     . HOH J 8 .   ? 46.858 -0.177  -15.004 1.00 21.50  ? 684  HOH A O     1 
HETATM 3957 O  O     . HOH J 8 .   ? 48.981 -9.414  10.674  1.00 27.11  ? 685  HOH A O     1 
HETATM 3958 O  O     . HOH J 8 .   ? 53.714 6.100   -12.179 1.00 25.84  ? 686  HOH A O     1 
HETATM 3959 O  O     . HOH J 8 .   ? 67.415 -8.367  9.982   1.00 22.21  ? 687  HOH A O     1 
HETATM 3960 O  O     . HOH J 8 .   ? 57.255 -16.571 -11.228 1.00 25.54  ? 688  HOH A O     1 
HETATM 3961 O  O     . HOH J 8 .   ? 36.844 13.083  12.423  1.00 22.84  ? 689  HOH A O     1 
HETATM 3962 O  O     . HOH J 8 .   ? 34.700 14.861  11.313  1.00 22.03  ? 690  HOH A O     1 
HETATM 3963 O  O     . HOH J 8 .   ? 48.555 10.964  -13.548 1.00 28.28  ? 691  HOH A O     1 
HETATM 3964 O  O     . HOH J 8 .   ? 43.114 -1.516  -24.703 1.00 30.54  ? 692  HOH A O     1 
HETATM 3965 O  O     . HOH J 8 .   ? 46.944 -14.734 15.151  1.00 29.17  ? 693  HOH A O     1 
HETATM 3966 O  O     . HOH J 8 .   ? 59.385 4.834   16.766  1.00 23.80  ? 694  HOH A O     1 
HETATM 3967 O  O     . HOH J 8 .   ? 50.726 17.538  -5.669  1.00 30.63  ? 695  HOH A O     1 
HETATM 3968 O  O     . HOH J 8 .   ? 47.709 -27.293 -7.119  1.00 32.70  ? 696  HOH A O     1 
HETATM 3969 O  O     . HOH J 8 .   ? 53.025 -26.421 -3.749  1.00 28.33  ? 697  HOH A O     1 
HETATM 3970 O  O     . HOH J 8 .   ? 58.945 4.604   23.324  1.00 28.94  ? 698  HOH A O     1 
HETATM 3971 O  O     . HOH J 8 .   ? 41.188 -1.594  -15.961 1.00 30.66  ? 699  HOH A O     1 
HETATM 3972 O  O     . HOH J 8 .   ? 54.005 15.349  -6.563  1.00 21.45  ? 700  HOH A O     1 
HETATM 3973 O  O     . HOH J 8 .   ? 72.261 -7.777  11.878  1.00 20.15  ? 701  HOH A O     1 
HETATM 3974 O  O     . HOH J 8 .   ? 53.495 19.294  -1.338  1.00 22.08  ? 702  HOH A O     1 
HETATM 3975 O  O     . HOH J 8 .   ? 47.148 2.358   -1.225  1.00 24.08  ? 703  HOH A O     1 
HETATM 3976 O  O     . HOH J 8 .   ? 53.818 -8.511  8.911   1.00 33.19  ? 704  HOH A O     1 
HETATM 3977 O  O     . HOH J 8 .   ? 58.084 -27.533 11.495  1.00 21.74  ? 705  HOH A O     1 
HETATM 3978 O  O     . HOH J 8 .   ? 58.496 15.473  -10.493 1.00 26.87  ? 706  HOH A O     1 
HETATM 3979 O  O     . HOH J 8 .   ? 34.662 20.013  -15.987 1.00 31.02  ? 707  HOH A O     1 
HETATM 3980 O  O     . HOH J 8 .   ? 83.801 -5.408  2.661   1.00 33.43  ? 708  HOH A O     1 
HETATM 3981 O  O     . HOH J 8 .   ? 58.369 -9.114  -13.859 1.00 25.99  ? 709  HOH A O     1 
HETATM 3982 O  O     . HOH J 8 .   ? 51.253 0.598   -15.926 1.00 28.65  ? 710  HOH A O     1 
HETATM 3983 O  O     . HOH J 8 .   ? 48.045 -33.285 -3.443  1.00 28.35  ? 711  HOH A O     1 
HETATM 3984 O  O     . HOH J 8 .   ? 61.689 8.070   10.015  1.00 28.55  ? 712  HOH A O     1 
HETATM 3985 O  O     . HOH J 8 .   ? 53.577 7.425   -14.500 1.00 29.86  ? 713  HOH A O     1 
HETATM 3986 O  O     . HOH J 8 .   ? 40.774 -29.517 -2.092  1.00 27.09  ? 714  HOH A O     1 
HETATM 3987 O  O     . HOH J 8 .   ? 57.875 -14.345 -12.807 1.00 25.35  ? 715  HOH A O     1 
HETATM 3988 O  O     . HOH J 8 .   ? 48.471 3.388   -20.153 1.00 43.15  ? 716  HOH A O     1 
HETATM 3989 O  O     . HOH J 8 .   ? 61.317 21.109  12.061  1.00 28.70  ? 717  HOH A O     1 
HETATM 3990 O  O     . HOH J 8 .   ? 63.294 -19.060 -1.379  1.00 21.11  ? 718  HOH A O     1 
HETATM 3991 O  O     . HOH J 8 .   ? 58.419 -18.101 20.076  1.00 27.33  ? 719  HOH A O     1 
HETATM 3992 O  O     . HOH J 8 .   ? 51.502 13.386  -11.432 1.00 28.67  ? 720  HOH A O     1 
HETATM 3993 O  O     . HOH J 8 .   ? 49.878 -8.941  13.160  1.00 32.12  ? 721  HOH A O     1 
HETATM 3994 O  O     . HOH J 8 .   ? 34.752 5.747   2.351   1.00 26.06  ? 722  HOH A O     1 
HETATM 3995 O  O     . HOH J 8 .   ? 76.655 1.020   -5.661  1.00 30.48  ? 723  HOH A O     1 
HETATM 3996 O  O     . HOH J 8 .   ? 61.261 -16.025 14.017  1.00 33.01  ? 724  HOH A O     1 
HETATM 3997 O  O     . HOH J 8 .   ? 52.937 -19.718 22.398  1.00 30.24  ? 725  HOH A O     1 
HETATM 3998 O  O     . HOH J 8 .   ? 54.319 -0.629  6.410   1.00 32.25  ? 726  HOH A O     1 
HETATM 3999 O  O     . HOH J 8 .   ? 53.151 -20.194 -4.860  1.00 26.89  ? 727  HOH A O     1 
HETATM 4000 O  O     . HOH J 8 .   ? 76.644 -17.838 0.544   1.00 32.87  ? 728  HOH A O     1 
HETATM 4001 O  O     . HOH J 8 .   ? 38.591 -17.927 10.425  1.00 24.05  ? 729  HOH A O     1 
HETATM 4002 O  O     . HOH J 8 .   ? 45.074 16.996  -18.077 1.00 31.47  ? 730  HOH A O     1 
HETATM 4003 O  O     . HOH J 8 .   ? 23.362 14.161  -8.865  1.00 35.50  ? 731  HOH A O     1 
HETATM 4004 O  O     . HOH J 8 .   ? 45.258 0.544   -18.244 1.00 23.80  ? 732  HOH A O     1 
HETATM 4005 O  O     . HOH J 8 .   ? 51.543 6.298   -18.847 1.00 32.63  ? 733  HOH A O     1 
HETATM 4006 O  O     . HOH J 8 .   ? 61.491 14.577  8.921   1.00 30.27  ? 734  HOH A O     1 
HETATM 4007 O  O     . HOH J 8 .   ? 29.276 8.286   -18.771 1.00 27.90  ? 735  HOH A O     1 
HETATM 4008 O  O     . HOH J 8 .   ? 62.747 9.516   -13.317 1.00 30.70  ? 736  HOH A O     1 
HETATM 4009 O  O     . HOH J 8 .   ? 55.709 -7.338  6.608   1.00 29.21  ? 737  HOH A O     1 
HETATM 4010 O  O     . HOH J 8 .   ? 52.565 8.268   25.518  1.00 32.51  ? 738  HOH A O     1 
HETATM 4011 O  O     . HOH J 8 .   ? 70.639 0.494   11.708  1.00 31.76  ? 739  HOH A O     1 
HETATM 4012 O  O     . HOH J 8 .   ? 34.583 3.377   7.399   1.00 31.02  ? 740  HOH A O     1 
HETATM 4013 O  O     . HOH J 8 .   ? 48.293 19.775  4.730   1.00 31.03  ? 741  HOH A O     1 
HETATM 4014 O  O     . HOH J 8 .   ? 55.509 -20.669 21.417  1.00 24.57  ? 742  HOH A O     1 
HETATM 4015 O  O     . HOH J 8 .   ? 59.951 13.049  11.394  1.00 29.03  ? 743  HOH A O     1 
HETATM 4016 O  O     . HOH J 8 .   ? 48.934 2.793   21.443  1.00 24.19  ? 744  HOH A O     1 
HETATM 4017 O  O     . HOH J 8 .   ? 55.887 13.639  -11.318 1.00 31.18  ? 745  HOH A O     1 
HETATM 4018 O  O     . HOH J 8 .   ? 57.824 -7.739  8.291   1.00 23.28  ? 746  HOH A O     1 
HETATM 4019 O  O     . HOH J 8 .   ? 46.741 19.506  1.712   1.00 27.55  ? 747  HOH A O     1 
HETATM 4020 O  O     . HOH J 8 .   ? 56.406 -3.456  4.442   1.00 42.12  ? 748  HOH A O     1 
HETATM 4021 O  O     . HOH J 8 .   ? 53.838 16.294  -9.043  1.00 29.81  ? 749  HOH A O     1 
HETATM 4022 O  O     . HOH J 8 .   ? 42.783 15.549  23.998  1.00 27.30  ? 750  HOH A O     1 
HETATM 4023 O  O     . HOH J 8 .   ? 80.949 -16.020 7.699   1.00 35.14  ? 751  HOH A O     1 
HETATM 4024 O  O     . HOH J 8 .   ? 48.932 13.722  28.386  1.00 38.68  ? 752  HOH A O     1 
HETATM 4025 O  O     . HOH J 8 .   ? 46.348 -9.526  11.089  1.00 31.97  ? 753  HOH A O     1 
HETATM 4026 O  O     . HOH J 8 .   ? 39.315 0.388   -6.523  1.00 24.55  ? 754  HOH A O     1 
HETATM 4027 O  O     . HOH J 8 .   ? 52.765 -12.623 -3.763  1.00 27.81  ? 755  HOH A O     1 
HETATM 4028 O  O     . HOH J 8 .   ? 52.258 -5.673  -0.713  1.00 31.32  ? 756  HOH A O     1 
HETATM 4029 O  O     . HOH J 8 .   ? 63.557 12.952  -10.820 1.00 27.67  ? 757  HOH A O     1 
HETATM 4030 O  O     . HOH J 8 .   ? 70.539 -6.967  13.920  1.00 35.88  ? 758  HOH A O     1 
HETATM 4031 O  O     . HOH J 8 .   ? 45.671 18.100  -3.170  1.00 32.41  ? 759  HOH A O     1 
HETATM 4032 O  O     . HOH J 8 .   ? 51.396 8.682   -15.315 1.00 26.62  ? 760  HOH A O     1 
HETATM 4033 O  O     . HOH J 8 .   ? 70.392 -17.183 12.686  1.00 30.73  ? 761  HOH A O     1 
HETATM 4034 O  O     . HOH J 8 .   ? 41.401 21.639  2.483   1.00 25.71  ? 762  HOH A O     1 
HETATM 4035 O  O     . HOH J 8 .   ? 41.499 15.843  -22.901 1.00 27.84  ? 763  HOH A O     1 
HETATM 4036 O  O     . HOH J 8 .   ? 46.145 6.999   -12.620 1.00 30.91  ? 764  HOH A O     1 
HETATM 4037 O  O     . HOH J 8 .   ? 51.054 -23.126 -5.367  1.00 32.00  ? 765  HOH A O     1 
HETATM 4038 O  O     . HOH J 8 .   ? 40.088 7.253   13.709  1.00 28.21  ? 766  HOH A O     1 
HETATM 4039 O  O     . HOH J 8 .   ? 40.132 -18.260 -1.512  1.00 35.05  ? 767  HOH A O     1 
HETATM 4040 O  O     . HOH J 8 .   ? 41.744 20.283  5.119   1.00 24.21  ? 768  HOH A O     1 
HETATM 4041 O  O     . HOH J 8 .   ? 57.372 -19.082 22.356  1.00 29.07  ? 769  HOH A O     1 
HETATM 4042 O  O     . HOH J 8 .   ? 62.074 -25.344 5.135   1.00 35.81  ? 770  HOH A O     1 
HETATM 4043 O  O     . HOH J 8 .   ? 69.735 -12.979 -11.405 1.00 29.05  ? 771  HOH A O     1 
HETATM 4044 O  O     . HOH J 8 .   ? 45.359 6.120   -0.081  1.00 31.50  ? 772  HOH A O     1 
HETATM 4045 O  O     . HOH J 8 .   ? 44.508 15.726  26.275  1.00 31.84  ? 773  HOH A O     1 
HETATM 4046 O  O     . HOH J 8 .   ? 44.662 13.420  -10.713 1.00 31.95  ? 774  HOH A O     1 
HETATM 4047 O  O     . HOH J 8 .   ? 42.307 -18.987 15.073  1.00 25.05  ? 775  HOH A O     1 
HETATM 4048 O  O     . HOH J 8 .   ? 65.545 -22.463 -7.775  1.00 28.68  ? 776  HOH A O     1 
HETATM 4049 O  O     . HOH J 8 .   ? 75.270 0.316   -3.492  1.00 30.91  ? 777  HOH A O     1 
HETATM 4050 O  O     . HOH J 8 .   ? 68.115 -14.669 -9.935  1.00 26.58  ? 778  HOH A O     1 
HETATM 4051 O  O     . HOH J 8 .   ? 65.292 12.949  3.266   1.00 29.78  ? 779  HOH A O     1 
HETATM 4052 O  O     . HOH J 8 .   ? 73.695 -20.753 1.205   1.00 30.53  ? 780  HOH A O     1 
HETATM 4053 O  O     . HOH J 8 .   ? 38.135 10.739  21.984  1.00 39.03  ? 781  HOH A O     1 
HETATM 4054 O  O     . HOH J 8 .   ? 62.995 -7.435  13.097  1.00 37.45  ? 782  HOH A O     1 
HETATM 4055 O  O     . HOH J 8 .   ? 41.097 -3.039  -22.945 1.00 31.31  ? 783  HOH A O     1 
HETATM 4056 O  O     . HOH J 8 .   ? 42.957 17.512  -16.776 1.00 37.05  ? 784  HOH A O     1 
HETATM 4057 O  O     . HOH J 8 .   ? 81.630 -20.104 0.071   1.00 36.43  ? 785  HOH A O     1 
HETATM 4058 O  O     . HOH J 8 .   ? 51.798 18.143  -9.642  1.00 34.61  ? 786  HOH A O     1 
HETATM 4059 O  O     . HOH J 8 .   ? 56.749 21.592  18.316  1.00 29.43  ? 787  HOH A O     1 
HETATM 4060 O  O     . HOH J 8 .   ? 76.464 2.566   6.936   1.00 30.83  ? 788  HOH A O     1 
HETATM 4061 O  O     . HOH J 8 .   ? 55.573 -1.388  -14.732 1.00 33.48  ? 789  HOH A O     1 
HETATM 4062 O  O     . HOH J 8 .   ? 82.254 -5.819  12.413  1.00 51.20  ? 790  HOH A O     1 
HETATM 4063 O  O     . HOH J 8 .   ? 42.444 -8.902  9.961   1.00 37.71  ? 791  HOH A O     1 
HETATM 4064 O  O     . HOH J 8 .   ? 44.701 -23.397 17.772  1.00 36.72  ? 792  HOH A O     1 
HETATM 4065 O  O     . HOH J 8 .   ? 79.005 3.481   2.355   1.00 37.42  ? 793  HOH A O     1 
HETATM 4066 O  O     . HOH J 8 .   ? 60.642 -28.532 8.312   1.00 27.51  ? 794  HOH A O     1 
HETATM 4067 O  O     . HOH J 8 .   ? 49.106 12.272  -11.290 1.00 31.70  ? 795  HOH A O     1 
HETATM 4068 O  O     . HOH J 8 .   ? 44.768 -16.956 -0.308  1.00 31.31  ? 796  HOH A O     1 
HETATM 4069 O  O     . HOH J 8 .   ? 69.332 4.455   3.991   1.00 26.54  ? 797  HOH A O     1 
HETATM 4070 O  O     . HOH J 8 .   ? 35.029 21.015  0.797   1.00 31.46  ? 798  HOH A O     1 
HETATM 4071 O  O     . HOH J 8 .   ? 84.588 -15.886 0.121   1.00 42.44  ? 799  HOH A O     1 
HETATM 4072 O  O     . HOH J 8 .   ? 57.859 12.181  -11.943 1.00 36.98  ? 800  HOH A O     1 
HETATM 4073 O  O     . HOH J 8 .   ? 43.332 -2.758  -20.070 1.00 31.41  ? 801  HOH A O     1 
HETATM 4074 O  O     . HOH J 8 .   ? 47.130 16.365  25.808  1.00 31.58  ? 802  HOH A O     1 
HETATM 4075 O  O     . HOH J 8 .   ? 45.844 -10.587 0.231   1.00 29.35  ? 803  HOH A O     1 
HETATM 4076 O  O     . HOH J 8 .   ? 54.428 15.471  23.418  1.00 37.04  ? 804  HOH A O     1 
HETATM 4077 O  O     . HOH J 8 .   ? 38.869 -19.746 12.567  1.00 36.29  ? 805  HOH A O     1 
HETATM 4078 O  O     . HOH J 8 .   ? 58.101 17.989  20.182  1.00 32.00  ? 806  HOH A O     1 
HETATM 4079 O  O     . HOH J 8 .   ? 67.489 -6.522  12.969  1.00 29.52  ? 807  HOH A O     1 
HETATM 4080 O  O     . HOH J 8 .   ? 37.057 15.022  -20.193 1.00 41.54  ? 808  HOH A O     1 
HETATM 4081 O  O     . HOH J 8 .   ? 49.093 -24.135 19.309  1.00 52.04  ? 809  HOH A O     1 
HETATM 4082 O  O     . HOH J 8 .   ? 69.683 10.062  -8.430  1.00 25.30  ? 810  HOH A O     1 
HETATM 4083 O  O     . HOH J 8 .   ? 46.270 9.688   -13.079 1.00 46.31  ? 811  HOH A O     1 
HETATM 4084 O  O     . HOH J 8 .   ? 71.271 -12.226 14.583  1.00 34.17  ? 812  HOH A O     1 
HETATM 4085 O  O     . HOH J 8 .   ? 51.953 11.518  -19.717 1.00 33.80  ? 813  HOH A O     1 
HETATM 4086 O  O     . HOH J 8 .   ? 73.134 1.982   8.363   1.00 29.56  ? 814  HOH A O     1 
HETATM 4087 O  O     . HOH J 8 .   ? 65.811 -4.258  -15.079 1.00 30.77  ? 815  HOH A O     1 
HETATM 4088 O  O     . HOH J 8 .   ? 67.473 6.534   0.960   1.00 29.86  ? 816  HOH A O     1 
HETATM 4089 O  O     . HOH J 8 .   ? 60.374 6.302   -15.425 1.00 29.47  ? 817  HOH A O     1 
HETATM 4090 O  O     . HOH J 8 .   ? 65.166 -9.274  12.583  1.00 40.39  ? 818  HOH A O     1 
HETATM 4091 O  O     . HOH J 8 .   ? 34.021 15.085  18.901  1.00 43.45  ? 819  HOH A O     1 
HETATM 4092 O  O     . HOH J 8 .   ? 44.277 -32.969 -2.992  1.00 41.39  ? 820  HOH A O     1 
HETATM 4093 O  O     . HOH J 8 .   ? 68.202 10.237  8.016   1.00 45.84  ? 821  HOH A O     1 
HETATM 4094 O  O     . HOH J 8 .   ? 34.925 17.785  -12.426 1.00 29.10  ? 822  HOH A O     1 
HETATM 4095 O  O     . HOH J 8 .   ? 49.180 -0.311  -16.593 1.00 34.92  ? 823  HOH A O     1 
HETATM 4096 O  O     . HOH J 8 .   ? 47.551 21.630  10.025  1.00 37.94  ? 824  HOH A O     1 
HETATM 4097 O  O     . HOH J 8 .   ? 38.942 -3.454  -20.144 1.00 31.66  ? 825  HOH A O     1 
HETATM 4098 O  O     . HOH J 8 .   ? 45.006 20.721  3.992   1.00 35.46  ? 826  HOH A O     1 
HETATM 4099 O  O     . HOH J 8 .   ? 53.818 -32.403 -2.633  1.00 33.20  ? 827  HOH A O     1 
HETATM 4100 O  O     . HOH J 8 .   ? 57.482 -34.889 8.660   1.00 32.25  ? 828  HOH A O     1 
HETATM 4101 O  O     . HOH J 8 .   ? 78.142 -16.930 10.512  1.00 38.96  ? 829  HOH A O     1 
HETATM 4102 O  O     . HOH J 8 .   ? 66.483 -2.548  12.944  1.00 35.55  ? 830  HOH A O     1 
HETATM 4103 O  O     . HOH J 8 .   ? 49.720 -9.424  -8.259  1.00 31.13  ? 831  HOH A O     1 
HETATM 4104 O  O     . HOH J 8 .   ? 48.286 -17.879 17.528  1.00 32.43  ? 832  HOH A O     1 
HETATM 4105 O  O     . HOH J 8 .   ? 41.161 14.136  -20.884 1.00 37.57  ? 833  HOH A O     1 
HETATM 4106 O  O     . HOH J 8 .   ? 39.287 21.516  5.912   1.00 34.03  ? 834  HOH A O     1 
HETATM 4107 O  O     . HOH J 8 .   ? 58.781 -31.059 -0.670  1.00 38.18  ? 835  HOH A O     1 
HETATM 4108 O  O     . HOH J 8 .   ? 34.469 5.997   -21.673 1.00 31.25  ? 836  HOH A O     1 
HETATM 4109 O  O     . HOH J 8 .   ? 39.937 -22.321 3.518   1.00 28.87  ? 837  HOH A O     1 
HETATM 4110 O  O     . HOH J 8 .   ? 62.812 -17.212 -7.014  1.00 28.33  ? 838  HOH A O     1 
HETATM 4111 O  O     . HOH J 8 .   ? 72.268 -3.831  -13.886 1.00 29.46  ? 839  HOH A O     1 
HETATM 4112 O  O     . HOH J 8 .   ? 45.894 17.472  -10.024 1.00 40.04  ? 840  HOH A O     1 
HETATM 4113 O  O     . HOH J 8 .   ? 56.582 1.319   13.592  1.00 31.82  ? 841  HOH A O     1 
HETATM 4114 O  O     . HOH J 8 .   ? 55.560 -33.043 5.123   1.00 35.56  ? 842  HOH A O     1 
HETATM 4115 O  O     . HOH J 8 .   ? 38.562 -28.382 7.380   1.00 34.03  ? 843  HOH A O     1 
HETATM 4116 O  O     . HOH J 8 .   ? 63.071 -23.872 3.291   1.00 29.82  ? 844  HOH A O     1 
HETATM 4117 O  O     . HOH J 8 .   ? 44.193 0.592   -20.901 1.00 35.47  ? 845  HOH A O     1 
HETATM 4118 O  O     . HOH J 8 .   ? 47.445 -20.194 18.694  1.00 36.34  ? 846  HOH A O     1 
HETATM 4119 O  O     . HOH J 8 .   ? 47.120 14.148  -10.623 1.00 35.54  ? 847  HOH A O     1 
HETATM 4120 O  O     . HOH J 8 .   ? 38.271 -25.442 6.169   1.00 36.81  ? 848  HOH A O     1 
HETATM 4121 O  O     . HOH J 8 .   ? 49.607 -14.877 18.742  1.00 34.52  ? 849  HOH A O     1 
HETATM 4122 O  O     . HOH J 8 .   ? 71.905 -19.006 14.104  1.00 32.49  ? 850  HOH A O     1 
HETATM 4123 O  O     . HOH J 8 .   ? 69.741 -8.995  10.816  1.00 30.40  ? 851  HOH A O     1 
HETATM 4124 O  O     . HOH J 8 .   ? 46.604 -18.668 -2.224  1.00 40.55  ? 852  HOH A O     1 
HETATM 4125 O  O     . HOH J 8 .   ? 44.535 10.176  -24.320 1.00 35.48  ? 853  HOH A O     1 
HETATM 4126 O  O     . HOH J 8 .   ? 45.573 11.703  -8.885  1.00 28.17  ? 854  HOH A O     1 
HETATM 4127 O  O     . HOH J 8 .   ? 80.858 -4.037  13.899  1.00 41.29  ? 855  HOH A O     1 
HETATM 4128 O  O     . HOH J 8 .   ? 27.928 6.760   -16.905 1.00 30.04  ? 856  HOH A O     1 
HETATM 4129 O  O     . HOH J 8 .   ? 61.669 11.708  -12.087 1.00 27.01  ? 857  HOH A O     1 
HETATM 4130 O  O     . HOH J 8 .   ? 52.151 2.038   14.594  1.00 49.90  ? 858  HOH A O     1 
HETATM 4131 O  O     . HOH J 8 .   ? 51.503 -29.226 16.905  1.00 34.15  ? 859  HOH A O     1 
HETATM 4132 O  O     . HOH J 8 .   ? 71.433 9.055   -6.426  1.00 32.74  ? 860  HOH A O     1 
HETATM 4133 O  O     . HOH J 8 .   ? 35.390 22.399  -2.974  1.00 35.48  ? 861  HOH A O     1 
HETATM 4134 O  O     . HOH J 8 .   ? 65.757 8.550   9.091   1.00 31.88  ? 862  HOH A O     1 
HETATM 4135 O  O     . HOH J 8 .   ? 43.119 -25.411 17.564  1.00 42.68  ? 863  HOH A O     1 
HETATM 4136 O  O     . HOH J 8 .   ? 51.668 -35.316 7.922   1.00 41.38  ? 864  HOH A O     1 
HETATM 4137 O  O     . HOH J 8 .   ? 47.508 -16.599 -0.672  1.00 31.77  ? 865  HOH A O     1 
HETATM 4138 O  O     . HOH J 8 .   ? 39.523 -2.165  -13.925 1.00 32.63  ? 866  HOH A O     1 
HETATM 4139 O  O     . HOH J 8 .   ? 57.825 23.229  14.354  1.00 34.36  ? 867  HOH A O     1 
HETATM 4140 O  O     . HOH J 8 .   ? 54.981 -27.032 17.927  1.00 38.27  ? 868  HOH A O     1 
HETATM 4141 O  O     . HOH J 8 .   ? 69.208 -11.019 12.320  1.00 31.29  ? 869  HOH A O     1 
HETATM 4142 O  O     . HOH J 8 .   ? 59.200 -18.415 -10.107 1.00 45.95  ? 870  HOH A O     1 
HETATM 4143 O  O     . HOH J 8 .   ? 49.199 -34.747 10.373  1.00 42.68  ? 871  HOH A O     1 
HETATM 4144 O  O     . HOH J 8 .   ? 35.345 20.857  3.572   1.00 37.07  ? 872  HOH A O     1 
HETATM 4145 O  O     . HOH J 8 .   ? 63.099 -4.908  -15.756 1.00 41.13  ? 873  HOH A O     1 
HETATM 4146 O  O     . HOH J 8 .   ? 31.578 -6.649  -13.059 1.00 39.25  ? 874  HOH A O     1 
HETATM 4147 O  O     . HOH J 8 .   ? 73.581 4.632   -1.075  1.00 38.27  ? 875  HOH A O     1 
HETATM 4148 O  O     . HOH J 8 .   ? 48.750 21.887  3.181   1.00 51.23  ? 876  HOH A O     1 
HETATM 4149 O  O     . HOH J 8 .   ? 57.788 0.013   -14.498 1.00 35.00  ? 877  HOH A O     1 
HETATM 4150 O  O     . HOH J 8 .   ? 68.687 -1.408  -13.902 1.00 36.35  ? 878  HOH A O     1 
HETATM 4151 O  O     . HOH J 8 .   ? 84.002 -7.929  0.871   1.00 53.58  ? 879  HOH A O     1 
HETATM 4152 O  O     . HOH J 8 .   ? 83.759 -18.453 -0.824  1.00 43.24  ? 880  HOH A O     1 
HETATM 4153 O  O     . HOH J 8 .   ? 47.900 16.183  -17.457 1.00 37.58  ? 881  HOH A O     1 
HETATM 4154 O  O     . HOH J 8 .   ? 66.611 4.068   10.828  1.00 38.43  ? 882  HOH A O     1 
HETATM 4155 O  O     . HOH J 8 .   ? 34.597 11.553  -22.442 1.00 36.85  ? 883  HOH A O     1 
HETATM 4156 O  O     . HOH J 8 .   ? 55.811 5.562   25.146  1.00 36.19  ? 884  HOH A O     1 
HETATM 4157 O  O     . HOH J 8 .   ? 57.514 5.525   -15.478 1.00 34.82  ? 885  HOH A O     1 
HETATM 4158 O  O     . HOH J 8 .   ? 29.930 3.317   6.503   1.00 40.36  ? 886  HOH A O     1 
HETATM 4159 O  O     . HOH J 8 .   ? 56.296 18.795  18.375  1.00 25.99  ? 887  HOH A O     1 
HETATM 4160 O  O     . HOH J 8 .   ? 42.674 15.507  -8.622  1.00 35.60  ? 888  HOH A O     1 
HETATM 4161 O  O     . HOH J 8 .   ? 59.946 14.328  3.620   1.00 30.59  ? 889  HOH A O     1 
HETATM 4162 O  O     . HOH J 8 .   ? 51.848 -17.924 -5.965  1.00 35.02  ? 890  HOH A O     1 
HETATM 4163 O  O     . HOH J 8 .   ? 45.591 1.888   18.508  1.00 39.13  ? 891  HOH A O     1 
HETATM 4164 O  O     . HOH J 8 .   ? 45.027 -14.973 13.285  1.00 37.65  ? 892  HOH A O     1 
HETATM 4165 O  O     . HOH J 8 .   ? 50.506 -13.042 -0.712  1.00 37.65  ? 893  HOH A O     1 
HETATM 4166 O  O     . HOH J 8 .   ? 69.484 -24.192 -1.957  1.00 47.97  ? 894  HOH A O     1 
HETATM 4167 O  O     . HOH J 8 .   ? 38.371 -22.505 10.885  1.00 37.39  ? 895  HOH A O     1 
HETATM 4168 O  O     . HOH J 8 .   ? 56.031 -33.284 2.532   1.00 31.77  ? 896  HOH A O     1 
HETATM 4169 O  O     . HOH J 8 .   ? 77.379 -16.022 2.779   1.00 35.39  ? 897  HOH A O     1 
HETATM 4170 O  O     . HOH J 8 .   ? 65.002 -19.427 15.651  1.00 25.68  ? 898  HOH A O     1 
HETATM 4171 O  O     . HOH J 8 .   ? 63.174 -26.674 7.198   1.00 22.88  ? 899  HOH A O     1 
HETATM 4172 O  O     . HOH J 8 .   ? 25.802 14.639  4.732   1.00 26.27  ? 900  HOH A O     1 
HETATM 4173 O  O     . HOH J 8 .   ? 69.481 5.093   1.276   1.00 36.74  ? 901  HOH A O     1 
HETATM 4174 O  O     . HOH J 8 .   ? 51.702 -16.159 17.791  1.00 31.57  ? 902  HOH A O     1 
HETATM 4175 O  O     . HOH J 8 .   ? 53.073 0.047   12.138  1.00 30.59  ? 903  HOH A O     1 
HETATM 4176 O  O     . HOH J 8 .   ? 48.101 -19.163 -5.258  1.00 33.11  ? 904  HOH A O     1 
HETATM 4177 O  O     . HOH J 8 .   ? 47.830 0.238   6.242   1.00 30.54  ? 905  HOH A O     1 
HETATM 4178 O  O     . HOH J 8 .   ? 61.720 -27.301 -0.756  1.00 45.27  ? 906  HOH A O     1 
HETATM 4179 O  O     . HOH J 8 .   ? 23.463 16.413  3.410   1.00 35.54  ? 907  HOH A O     1 
HETATM 4180 O  O     . HOH J 8 .   ? 60.953 9.746   7.020   1.00 32.70  ? 908  HOH A O     1 
HETATM 4181 O  O     . HOH J 8 .   ? 47.007 20.045  -2.118  1.00 39.40  ? 909  HOH A O     1 
HETATM 4182 O  O     . HOH J 8 .   ? 61.931 15.896  2.501   1.00 36.81  ? 910  HOH A O     1 
HETATM 4183 O  O     . HOH J 8 .   ? 62.625 12.057  6.031   1.00 40.00  ? 911  HOH A O     1 
HETATM 4184 O  O     . HOH J 8 .   ? 48.969 -29.380 16.075  1.00 38.23  ? 912  HOH A O     1 
HETATM 4185 O  O     . HOH J 8 .   ? 62.048 -13.196 -13.469 1.00 37.88  ? 913  HOH A O     1 
HETATM 4186 O  O     . HOH J 8 .   ? 30.756 21.618  -3.148  1.00 30.82  ? 914  HOH A O     1 
HETATM 4187 O  O     . HOH J 8 .   ? 46.411 2.515   -3.830  1.00 42.21  ? 915  HOH A O     1 
HETATM 4188 O  O     . HOH J 8 .   ? 43.490 17.455  28.100  1.00 37.71  ? 916  HOH A O     1 
HETATM 4189 O  O     . HOH J 8 .   ? 41.041 -29.690 13.232  1.00 36.72  ? 917  HOH A O     1 
HETATM 4190 O  O     . HOH J 8 .   ? 59.375 -19.792 23.783  1.00 39.38  ? 918  HOH A O     1 
HETATM 4191 O  O     . HOH J 8 .   ? 68.577 5.485   -14.123 1.00 38.99  ? 919  HOH A O     1 
HETATM 4192 O  O     . HOH J 8 .   ? 39.686 -18.702 14.827  1.00 44.40  ? 920  HOH A O     1 
HETATM 4193 O  O     . HOH J 8 .   ? 36.973 22.715  0.181   1.00 33.57  ? 921  HOH A O     1 
HETATM 4194 O  O     . HOH J 8 .   ? 47.174 -22.792 17.703  1.00 31.81  ? 922  HOH A O     1 
HETATM 4195 O  O     . HOH J 8 .   ? 45.762 -16.437 17.046  1.00 38.68  ? 923  HOH A O     1 
HETATM 4196 O  O     . HOH J 8 .   ? 34.853 0.858   6.476   1.00 34.50  ? 924  HOH A O     1 
HETATM 4197 O  O     . HOH J 8 .   ? 67.570 6.441   9.751   1.00 32.62  ? 925  HOH A O     1 
HETATM 4198 O  O     . HOH J 8 .   ? 35.772 11.052  1.040   1.00 30.15  ? 926  HOH A O     1 
HETATM 4199 O  O     . HOH J 8 .   ? 40.144 -13.176 11.497  1.00 38.11  ? 927  HOH A O     1 
HETATM 4200 O  O     . HOH J 8 .   ? 48.676 -6.090  -10.792 1.00 42.30  ? 928  HOH A O     1 
HETATM 4201 O  O     . HOH J 8 .   ? 42.737 13.224  -23.488 1.00 38.20  ? 929  HOH A O     1 
HETATM 4202 O  O     . HOH J 8 .   ? 47.169 -8.694  -4.094  1.00 47.08  ? 930  HOH A O     1 
HETATM 4203 O  O     . HOH J 8 .   ? 46.278 0.473   14.281  1.00 53.58  ? 931  HOH A O     1 
HETATM 4204 O  O     . HOH J 8 .   ? 64.290 -15.515 13.902  1.00 35.20  ? 932  HOH A O     1 
HETATM 4205 O  O     . HOH J 8 .   ? 21.970 11.637  -9.046  1.00 36.35  ? 933  HOH A O     1 
HETATM 4206 O  O     . HOH J 8 .   ? 42.476 11.693  -25.486 1.00 45.55  ? 934  HOH A O     1 
HETATM 4207 O  O     . HOH J 8 .   ? 43.524 17.747  -12.538 1.00 42.04  ? 935  HOH A O     1 
HETATM 4208 O  O     . HOH J 8 .   ? 83.200 -14.157 9.532   1.00 39.74  ? 936  HOH A O     1 
HETATM 4209 O  O     . HOH J 8 .   ? 70.412 -21.918 0.814   1.00 36.05  ? 937  HOH A O     1 
HETATM 4210 O  O     . HOH J 8 .   ? 52.919 -18.131 -11.381 1.00 33.35  ? 938  HOH A O     1 
HETATM 4211 O  O     . HOH J 8 .   ? 65.948 -0.833  -17.343 1.00 52.11  ? 939  HOH A O     1 
HETATM 4212 O  O     . HOH J 8 .   ? 50.201 -14.826 -3.292  1.00 41.98  ? 940  HOH A O     1 
HETATM 4213 O  O     . HOH J 8 .   ? 73.845 5.212   -7.843  1.00 38.08  ? 941  HOH A O     1 
HETATM 4214 O  O     . HOH J 8 .   ? 46.403 18.785  24.706  1.00 42.22  ? 942  HOH A O     1 
HETATM 4215 O  O     . HOH J 8 .   ? 58.849 -24.711 -7.078  1.00 36.97  ? 943  HOH A O     1 
HETATM 4216 O  O     . HOH J 8 .   ? 43.149 20.353  -11.980 1.00 42.37  ? 944  HOH A O     1 
HETATM 4217 O  O     . HOH J 8 .   ? 23.640 13.772  6.049   1.00 39.01  ? 945  HOH A O     1 
HETATM 4218 O  O     . HOH J 8 .   ? 66.262 3.467   -17.348 1.00 40.29  ? 946  HOH A O     1 
HETATM 4219 O  O     . HOH J 8 .   ? 39.560 18.653  18.600  1.00 38.09  ? 947  HOH A O     1 
HETATM 4220 O  O     . HOH J 8 .   ? 37.191 22.564  4.472   1.00 36.21  ? 948  HOH A O     1 
HETATM 4221 O  O     . HOH J 8 .   ? 52.491 2.482   -17.608 1.00 42.64  ? 949  HOH A O     1 
HETATM 4222 O  O     . HOH J 8 .   ? 49.322 -16.831 -5.460  1.00 39.95  ? 950  HOH A O     1 
HETATM 4223 O  O     . HOH J 8 .   ? 38.797 13.623  24.864  1.00 39.46  ? 951  HOH A O     1 
HETATM 4224 O  O     . HOH J 8 .   ? 38.297 -23.482 1.736   1.00 44.80  ? 952  HOH A O     1 
HETATM 4225 O  O     . HOH J 8 .   ? 62.211 12.020  9.438   1.00 48.09  ? 953  HOH A O     1 
HETATM 4226 O  O     . HOH J 8 .   ? 47.346 3.141   -24.057 1.00 40.79  ? 954  HOH A O     1 
HETATM 4227 O  O     . HOH J 8 .   ? 38.035 7.586   22.104  1.00 43.05  ? 955  HOH A O     1 
HETATM 4228 O  O     . HOH J 8 .   ? 65.986 -21.686 14.802  1.00 49.66  ? 956  HOH A O     1 
HETATM 4229 O  O     . HOH J 8 .   ? 85.522 -18.215 2.165   1.00 54.38  ? 957  HOH A O     1 
HETATM 4230 O  O     . HOH J 8 .   ? 32.424 3.082   -23.707 1.00 46.78  ? 958  HOH A O     1 
HETATM 4231 O  O     . HOH J 8 .   ? 67.828 -25.730 -6.350  1.00 44.98  ? 959  HOH A O     1 
HETATM 4232 O  O     . HOH J 8 .   ? 65.416 19.681  6.673   1.00 32.91  ? 960  HOH A O     1 
HETATM 4233 O  O     . HOH J 8 .   ? 20.568 17.222  -4.902  1.00 33.32  ? 961  HOH A O     1 
HETATM 4234 O  O     . HOH J 8 .   ? 34.795 13.829  22.249  1.00 40.65  ? 962  HOH A O     1 
HETATM 4235 O  O     . HOH J 8 .   ? 31.115 1.738   -21.920 1.00 33.51  ? 963  HOH A O     1 
HETATM 4236 O  O     . HOH J 8 .   ? 42.515 9.253   -25.603 1.00 43.23  ? 964  HOH A O     1 
HETATM 4237 O  O     . HOH J 8 .   ? 69.789 -18.734 -9.282  1.00 46.72  ? 965  HOH A O     1 
HETATM 4238 O  O     . HOH J 8 .   ? 38.268 -21.750 -3.077  1.00 43.92  ? 966  HOH A O     1 
HETATM 4239 O  O     . HOH J 8 .   ? 68.491 -26.297 -0.557  1.00 34.86  ? 967  HOH A O     1 
HETATM 4240 O  O     . HOH J 8 .   ? 44.809 -18.968 18.889  1.00 48.22  ? 968  HOH A O     1 
HETATM 4241 O  O     . HOH J 8 .   ? 62.621 -2.172  12.852  1.00 41.86  ? 969  HOH A O     1 
HETATM 4242 O  O     . HOH J 8 .   ? 42.719 -20.426 17.567  1.00 44.77  ? 970  HOH A O     1 
HETATM 4243 O  O     . HOH J 8 .   ? 61.723 -23.304 -7.461  1.00 46.85  ? 971  HOH A O     1 
HETATM 4244 O  O     . HOH J 8 .   ? 59.539 -28.619 -1.781  1.00 47.88  ? 972  HOH A O     1 
HETATM 4245 O  O     . HOH J 8 .   ? 47.890 16.818  28.267  1.00 37.95  ? 973  HOH A O     1 
HETATM 4246 O  O     . HOH J 8 .   ? 46.256 1.721   21.158  1.00 39.49  ? 974  HOH A O     1 
HETATM 4247 O  O     . HOH J 8 .   ? 53.376 5.337   -16.924 1.00 45.34  ? 975  HOH A O     1 
HETATM 4248 O  O     . HOH J 8 .   ? 38.287 -15.582 11.991  1.00 38.97  ? 976  HOH A O     1 
HETATM 4249 O  O     . HOH J 8 .   ? 42.949 3.277   18.407  1.00 45.00  ? 977  HOH A O     1 
HETATM 4250 O  O     . HOH J 8 .   ? 38.829 18.358  -15.364 1.00 36.38  ? 978  HOH A O     1 
HETATM 4251 O  O     . HOH J 8 .   ? 61.361 16.540  18.228  1.00 48.62  ? 979  HOH A O     1 
HETATM 4252 O  O     . HOH J 8 .   ? 55.560 -29.627 17.905  1.00 43.99  ? 980  HOH A O     1 
HETATM 4253 O  O     . HOH J 8 .   ? 30.111 -1.105  -21.643 1.00 49.53  ? 981  HOH A O     1 
HETATM 4254 O  O     . HOH J 8 .   ? 36.456 16.972  19.863  1.00 47.92  ? 982  HOH A O     1 
HETATM 4255 O  O     . HOH J 8 .   ? 45.226 -32.911 8.772   1.00 48.12  ? 983  HOH A O     1 
HETATM 4256 O  O     . HOH J 8 .   ? 50.967 5.677   -23.164 1.00 36.76  ? 984  HOH A O     1 
HETATM 4257 O  O     . HOH J 8 .   ? 70.245 -9.543  -18.189 1.00 39.12  ? 985  HOH A O     1 
HETATM 4258 O  O     . HOH J 8 .   ? 77.575 -17.362 -3.168  1.00 40.35  ? 986  HOH A O     1 
HETATM 4259 O  O     . HOH J 8 .   ? 37.451 13.275  22.103  1.00 38.16  ? 987  HOH A O     1 
HETATM 4260 O  O     . HOH J 8 .   ? 76.962 -19.905 2.317   1.00 50.17  ? 988  HOH A O     1 
HETATM 4261 O  O     . HOH J 8 .   ? 65.775 -6.767  15.272  1.00 43.49  ? 989  HOH A O     1 
HETATM 4262 O  O     . HOH J 8 .   ? 60.548 19.039  19.490  1.00 53.08  ? 990  HOH A O     1 
HETATM 4263 O  O     . HOH J 8 .   ? 39.054 -22.357 -0.694  1.00 38.49  ? 991  HOH A O     1 
HETATM 4264 O  O     . HOH J 8 .   ? 79.238 1.548   4.968   1.00 41.15  ? 992  HOH A O     1 
HETATM 4265 O  O     . HOH J 8 .   ? 77.505 2.995   -1.691  1.00 39.22  ? 993  HOH A O     1 
HETATM 4266 O  O     . HOH J 8 .   ? 63.254 15.681  6.567   1.00 50.88  ? 994  HOH A O     1 
HETATM 4267 O  O     . HOH J 8 .   ? 60.289 9.892   22.554  1.00 49.77  ? 995  HOH A O     1 
HETATM 4268 O  O     . HOH J 8 .   ? 59.765 15.431  -13.077 1.00 40.41  ? 996  HOH A O     1 
HETATM 4269 O  O     . HOH J 8 .   ? 51.485 -18.184 -9.101  1.00 43.81  ? 997  HOH A O     1 
HETATM 4270 O  O     . HOH J 8 .   ? 57.097 -8.873  10.775  1.00 50.68  ? 998  HOH A O     1 
HETATM 4271 O  O     . HOH J 8 .   ? 49.852 -15.854 -9.079  1.00 50.27  ? 999  HOH A O     1 
HETATM 4272 O  O     . HOH J 8 .   ? 47.259 -30.445 -6.734  1.00 54.36  ? 1000 HOH A O     1 
HETATM 4273 O  O     . HOH J 8 .   ? 38.910 23.063  2.499   1.00 37.95  ? 1001 HOH A O     1 
HETATM 4274 O  O     . HOH J 8 .   ? 19.595 12.051  -10.742 1.00 47.34  ? 1002 HOH A O     1 
HETATM 4275 O  O     . HOH J 8 .   ? 63.461 -1.270  -16.867 1.00 50.67  ? 1003 HOH A O     1 
HETATM 4276 O  O     . HOH J 8 .   ? 65.170 17.231  7.843   1.00 50.52  ? 1004 HOH A O     1 
HETATM 4277 O  O     . HOH J 8 .   ? 50.799 -6.253  -5.384  1.00 42.35  ? 1005 HOH A O     1 
HETATM 4278 O  O     . HOH J 8 .   ? 47.662 -23.941 -7.593  1.00 46.00  ? 1006 HOH A O     1 
HETATM 4279 O  O     . HOH J 8 .   ? 61.464 -29.295 1.891   1.00 50.02  ? 1007 HOH A O     1 
HETATM 4280 O  O     . HOH J 8 .   ? 61.932 8.817   18.760  1.00 47.15  ? 1008 HOH A O     1 
HETATM 4281 O  O     . HOH J 8 .   ? 48.229 -11.152 -1.262  1.00 48.73  ? 1009 HOH A O     1 
HETATM 4282 O  O     . HOH J 8 .   ? 42.957 17.185  18.992  1.00 42.04  ? 1010 HOH A O     1 
HETATM 4283 O  O     . HOH J 8 .   ? 69.303 8.256   4.290   1.00 43.71  ? 1011 HOH A O     1 
HETATM 4284 O  O     . HOH J 8 .   ? 52.420 -17.795 19.790  1.00 43.63  ? 1012 HOH A O     1 
HETATM 4285 O  O     . HOH J 8 .   ? 52.406 -10.051 -2.740  1.00 35.79  ? 1013 HOH A O     1 
HETATM 4286 O  O     . HOH J 8 .   ? 51.276 21.747  7.350   1.00 32.38  ? 1014 HOH A O     1 
HETATM 4287 O  O     . HOH J 8 .   ? 73.369 -19.628 -2.643  1.00 27.64  ? 1015 HOH A O     1 
HETATM 4288 O  O     . HOH J 8 .   ? 61.394 -28.273 4.569   1.00 36.85  ? 1016 HOH A O     1 
HETATM 4289 O  O     . HOH J 8 .   ? 54.418 -32.257 14.164  1.00 31.70  ? 1017 HOH A O     1 
HETATM 4290 O  O     . HOH J 8 .   ? 53.141 -29.067 12.802  1.00 23.87  ? 1018 HOH A O     1 
HETATM 4291 O  O     . HOH J 8 .   ? 32.154 1.128   -6.401  1.00 33.93  ? 1019 HOH A O     1 
HETATM 4292 O  O     . HOH J 8 .   ? 40.930 -18.132 0.983   1.00 33.27  ? 1020 HOH A O     1 
HETATM 4293 O  O     . HOH K 8 .   ? 40.624 11.388  -3.250  1.00 14.63  ? 101  HOH T O     1 
HETATM 4294 O  O     . HOH K 8 .   ? 24.823 -23.948 -5.891  1.00 24.99  ? 102  HOH T O     1 
HETATM 4295 O  O     . HOH K 8 .   ? 43.457 5.375   -8.689  1.00 22.74  ? 103  HOH T O     1 
HETATM 4296 O  O     . HOH K 8 .   ? 37.268 -23.238 -5.080  1.00 20.78  ? 104  HOH T O     1 
HETATM 4297 O  O     . HOH K 8 .   ? 41.367 -20.019 -3.166  1.00 27.81  ? 105  HOH T O     1 
HETATM 4298 O  O     . HOH K 8 .   ? 45.367 -4.525  -3.130  1.00 31.02  ? 106  HOH T O     1 
HETATM 4299 O  O     . HOH K 8 .   ? 38.967 3.033   -5.778  1.00 29.58  ? 107  HOH T O     1 
HETATM 4300 O  O     . HOH K 8 .   ? 41.724 -2.390  -8.935  1.00 40.00  ? 108  HOH T O     1 
HETATM 4301 O  O     . HOH K 8 .   ? 35.108 1.650   10.804  1.00 36.92  ? 109  HOH T O     1 
HETATM 4302 O  O     . HOH K 8 .   ? 36.384 -1.443  -1.090  1.00 42.51  ? 110  HOH T O     1 
HETATM 4303 O  O     . HOH K 8 .   ? 45.726 5.290   -4.804  1.00 26.61  ? 111  HOH T O     1 
HETATM 4304 O  O     . HOH K 8 .   ? 40.432 -0.570  8.005   1.00 34.05  ? 112  HOH T O     1 
HETATM 4305 O  O     . HOH K 8 .   ? 27.754 -26.105 -2.923  1.00 34.29  ? 113  HOH T O     1 
HETATM 4306 O  O     . HOH K 8 .   ? 37.336 -0.186  5.125   1.00 28.53  ? 114  HOH T O     1 
HETATM 4307 O  O     . HOH K 8 .   ? 26.631 -24.289 -3.850  1.00 28.82  ? 115  HOH T O     1 
HETATM 4308 O  O     . HOH K 8 .   ? 25.457 -19.250 -7.385  1.00 36.58  ? 116  HOH T O     1 
HETATM 4309 O  O     . HOH K 8 .   ? 40.619 -22.309 -6.654  1.00 31.53  ? 117  HOH T O     1 
HETATM 4310 O  O     . HOH K 8 .   ? 36.639 -3.012  -3.918  1.00 36.07  ? 118  HOH T O     1 
HETATM 4311 O  O     . HOH K 8 .   ? 33.328 6.410   13.366  1.00 40.09  ? 119  HOH T O     1 
HETATM 4312 O  O     . HOH K 8 .   ? 41.165 -13.015 -2.978  1.00 38.09  ? 120  HOH T O     1 
HETATM 4313 O  O     . HOH K 8 .   ? 38.351 -2.224  -6.023  1.00 41.26  ? 121  HOH T O     1 
HETATM 4314 O  O     . HOH K 8 .   ? 44.762 -7.586  -3.419  1.00 37.37  ? 122  HOH T O     1 
HETATM 4315 O  O     . HOH K 8 .   ? 32.406 7.041   8.753   1.00 28.76  ? 123  HOH T O     1 
HETATM 4316 O  O     . HOH K 8 .   ? 40.213 8.600   8.953   1.00 33.51  ? 124  HOH T O     1 
HETATM 4317 O  O     . HOH K 8 .   ? 44.201 1.356   -1.920  1.00 37.67  ? 125  HOH T O     1 
HETATM 4318 O  O     . HOH K 8 .   ? 28.347 -28.202 -4.117  1.00 32.56  ? 126  HOH T O     1 
HETATM 4319 O  O     . HOH K 8 .   ? 35.925 -16.870 -12.442 1.00 34.65  ? 127  HOH T O     1 
HETATM 4320 O  O     . HOH K 8 .   ? 32.041 -16.283 -4.216  1.00 36.04  ? 128  HOH T O     1 
HETATM 4321 O  O     . HOH K 8 .   ? 28.786 -16.301 -5.946  1.00 49.57  ? 129  HOH T O     1 
HETATM 4322 O  O     . HOH K 8 .   ? 35.800 1.281   0.972   1.00 39.17  ? 130  HOH T O     1 
HETATM 4323 O  O     . HOH K 8 .   ? 36.274 -1.352  2.845   1.00 30.85  ? 131  HOH T O     1 
HETATM 4324 O  O     . HOH K 8 .   ? 41.424 7.302   11.004  1.00 26.49  ? 132  HOH T O     1 
HETATM 4325 O  O     . HOH L 8 .   ? 49.521 -10.056 6.916   1.00 22.80  ? 101  HOH P O     1 
HETATM 4326 O  O     . HOH L 8 .   ? 45.040 -7.958  -0.715  1.00 26.96  ? 102  HOH P O     1 
HETATM 4327 O  O     . HOH L 8 .   ? 41.560 -15.602 2.085   1.00 19.37  ? 103  HOH P O     1 
HETATM 4328 O  O     . HOH L 8 .   ? 41.685 -11.754 -0.609  1.00 23.79  ? 104  HOH P O     1 
HETATM 4329 O  O     . HOH L 8 .   ? 40.397 -8.831  6.013   1.00 28.29  ? 105  HOH P O     1 
HETATM 4330 O  O     . HOH L 8 .   ? 46.435 3.722   1.049   1.00 27.61  ? 106  HOH P O     1 
HETATM 4331 O  O     . HOH L 8 .   ? 42.883 -8.941  7.250   1.00 23.23  ? 107  HOH P O     1 
HETATM 4332 O  O     . HOH L 8 .   ? 44.072 -12.849 -0.082  1.00 25.44  ? 108  HOH P O     1 
HETATM 4333 O  O     . HOH L 8 .   ? 38.427 -10.652 6.646   1.00 30.05  ? 109  HOH P O     1 
HETATM 4334 O  O     . HOH L 8 .   ? 36.612 -3.901  2.002   1.00 34.57  ? 110  HOH P O     1 
HETATM 4335 O  O     . HOH L 8 .   ? 40.175 -14.113 0.185   1.00 27.70  ? 111  HOH P O     1 
HETATM 4336 O  O     . HOH L 8 .   ? 38.860 -4.207  5.378   1.00 33.75  ? 112  HOH P O     1 
HETATM 4337 O  O     . HOH L 8 .   ? 35.004 -13.023 -13.544 1.00 45.37  ? 113  HOH P O     1 
HETATM 4338 O  O     . HOH L 8 .   ? 34.540 -4.777  0.234   1.00 31.93  ? 114  HOH P O     1 
HETATM 4339 O  O     . HOH L 8 .   ? 47.355 -2.225  7.019   1.00 40.74  ? 115  HOH P O     1 
HETATM 4340 O  O     . HOH L 8 .   ? 38.370 -2.004  6.766   1.00 34.50  ? 116  HOH P O     1 
HETATM 4341 O  O     . HOH L 8 .   ? 31.542 -13.848 -2.855  1.00 34.21  ? 117  HOH P O     1 
HETATM 4342 O  O     . HOH L 8 .   ? 44.208 -2.398  6.405   1.00 37.87  ? 118  HOH P O     1 
HETATM 4343 O  O     . HOH L 8 .   ? 46.110 -2.807  -0.788  1.00 36.59  ? 119  HOH P O     1 
HETATM 4344 O  O     . HOH L 8 .   ? 27.807 -5.170  -9.953  1.00 43.16  ? 120  HOH P O     1 
HETATM 4345 O  O     . HOH L 8 .   ? 27.464 -12.511 -7.123  1.00 41.41  ? 121  HOH P O     1 
HETATM 4346 O  O     . HOH L 8 .   ? 39.295 -6.317  7.332   1.00 41.71  ? 122  HOH P O     1 
HETATM 4347 O  O     . HOH L 8 .   ? 28.665 -14.511 -3.185  1.00 43.63  ? 123  HOH P O     1 
HETATM 4348 O  O     . HOH L 8 .   ? 37.416 -6.040  3.735   1.00 35.71  ? 124  HOH P O     1 
HETATM 4349 O  O     . HOH L 8 .   ? 39.022 -10.490 9.452   1.00 48.32  ? 125  HOH P O     1 
HETATM 4350 O  O     . HOH L 8 .   ? 24.399 -3.495  -13.015 1.00 42.96  ? 126  HOH P O     1 
HETATM 4351 O  O     . HOH L 8 .   ? 28.538 -6.069  -2.868  1.00 42.09  ? 127  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 1   ? 0.8663 0.5896 0.8459 0.0305  0.0195  -0.0177 -2  GLY A N     
2    C CA    . GLY A 1   ? 0.8312 0.5534 0.8027 0.0422  0.0256  -0.0172 -2  GLY A CA    
3    C C     . GLY A 1   ? 0.7554 0.4840 0.7140 0.0463  0.0253  -0.0238 -2  GLY A C     
4    O O     . GLY A 1   ? 0.6622 0.4085 0.6222 0.0424  0.0231  -0.0223 -2  GLY A O     
5    N N     . PRO A 2   ? 0.7499 0.4632 0.6952 0.0549  0.0282  -0.0310 -1  PRO A N     
6    C CA    . PRO A 2   ? 0.7531 0.4694 0.6834 0.0610  0.0297  -0.0369 -1  PRO A CA    
7    C C     . PRO A 2   ? 0.7608 0.4749 0.6818 0.0542  0.0212  -0.0467 -1  PRO A C     
8    O O     . PRO A 2   ? 0.8214 0.5404 0.7300 0.0584  0.0218  -0.0505 -1  PRO A O     
9    C CB    . PRO A 2   ? 0.7963 0.4920 0.7142 0.0723  0.0354  -0.0421 -1  PRO A CB    
10   C CG    . PRO A 2   ? 0.8066 0.4829 0.7297 0.0685  0.0325  -0.0441 -1  PRO A CG    
11   C CD    . PRO A 2   ? 0.7607 0.4514 0.7036 0.0603  0.0312  -0.0333 -1  PRO A CD    
12   N N     . HIS A 3   ? 0.6540 0.3612 0.5820 0.0442  0.0134  -0.0500 0   HIS A N     
13   C CA    . HIS A 3   ? 0.6641 0.3686 0.5856 0.0376  0.0039  -0.0596 0   HIS A CA    
14   C C     . HIS A 3   ? 0.6897 0.4135 0.6260 0.0267  -0.0008 -0.0543 0   HIS A C     
15   O O     . HIS A 3   ? 0.6686 0.3939 0.6031 0.0205  -0.0090 -0.0607 0   HIS A O     
16   C CB    . HIS A 3   ? 0.6260 0.3054 0.5441 0.0346  -0.0027 -0.0696 0   HIS A CB    
17   C CG    . HIS A 3   ? 0.6141 0.2720 0.5176 0.0455  0.0022  -0.0748 0   HIS A CG    
18   N ND1   . HIS A 3   ? 0.6491 0.3016 0.5310 0.0562  0.0052  -0.0811 0   HIS A ND1   
19   C CD2   . HIS A 3   ? 0.5638 0.2039 0.4709 0.0483  0.0055  -0.0743 0   HIS A CD2   
20   C CE1   . HIS A 3   ? 0.6424 0.2746 0.5147 0.0654  0.0103  -0.0845 0   HIS A CE1   
21   N NE2   . HIS A 3   ? 0.6509 0.2751 0.5385 0.0606  0.0102  -0.0806 0   HIS A NE2   
22   N N     . MET A 4   ? 0.7242 0.4623 0.6743 0.0251  0.0041  -0.0427 1   MET A N     
23   C CA    . MET A 4   ? 0.7109 0.4668 0.6739 0.0162  0.0012  -0.0369 1   MET A CA    
24   C C     . MET A 4   ? 0.6467 0.4212 0.6043 0.0182  0.0018  -0.0354 1   MET A C     
25   O O     . MET A 4   ? 0.5825 0.3666 0.5392 0.0244  0.0081  -0.0293 1   MET A O     
26   C CB    . MET A 4   ? 0.7719 0.5338 0.7491 0.0147  0.0060  -0.0253 1   MET A CB    
27   C CG    . MET A 4   ? 0.7947 0.5706 0.7847 0.0055  0.0034  -0.0195 1   MET A CG    
28   S SD    . MET A 4   ? 1.7439 1.5083 1.7437 -0.0053 -0.0039 -0.0254 1   MET A SD    
29   C CE    . MET A 4   ? 0.6854 0.4268 0.6888 -0.0031 -0.0004 -0.0243 1   MET A CE    
30   N N     . ALA A 5   ? 0.6699 0.4494 0.6251 0.0129  -0.0049 -0.0408 2   ALA A N     
31   C CA    . ALA A 5   ? 0.6375 0.4336 0.5879 0.0141  -0.0047 -0.0394 2   ALA A CA    
32   C C     . ALA A 5   ? 0.5804 0.3948 0.5438 0.0110  -0.0016 -0.0288 2   ALA A C     
33   O O     . ALA A 5   ? 0.5921 0.4082 0.5677 0.0048  -0.0025 -0.0243 2   ALA A O     
34   C CB    . ALA A 5   ? 0.6239 0.4208 0.5702 0.0090  -0.0133 -0.0472 2   ALA A CB    
35   N N     . THR A 6   ? 0.4311 0.2580 0.3912 0.0156  0.0024  -0.0247 3   THR A N     
36   C CA    . THR A 6   ? 0.3838 0.2267 0.3540 0.0137  0.0047  -0.0155 3   THR A CA    
37   C C     . THR A 6   ? 0.3548 0.2122 0.3238 0.0110  0.0022  -0.0154 3   THR A C     
38   O O     . THR A 6   ? 0.3905 0.2607 0.3657 0.0098  0.0034  -0.0090 3   THR A O     
39   C CB    . THR A 6   ? 0.4370 0.2832 0.4083 0.0212  0.0111  -0.0094 3   THR A CB    
40   O OG1   . THR A 6   ? 0.4023 0.2495 0.3643 0.0276  0.0141  -0.0124 3   THR A OG1   
41   C CG2   . THR A 6   ? 0.4608 0.2933 0.4344 0.0244  0.0140  -0.0083 3   THR A CG2   
42   N N     . GLY A 7   ? 0.3928 0.2470 0.3528 0.0106  -0.0017 -0.0228 4   GLY A N     
43   C CA    . GLY A 7   ? 0.3798 0.2462 0.3382 0.0085  -0.0044 -0.0230 4   GLY A CA    
44   C C     . GLY A 7   ? 0.3531 0.2307 0.3106 0.0130  0.0006  -0.0175 4   GLY A C     
45   O O     . GLY A 7   ? 0.3293 0.2194 0.2925 0.0100  -0.0001 -0.0133 4   GLY A O     
46   N N     . GLN A 8   ? 0.3158 0.1885 0.2670 0.0204  0.0059  -0.0175 5   GLN A N     
47   C CA    . GLN A 8   ? 0.2628 0.1461 0.2163 0.0246  0.0111  -0.0119 5   GLN A CA    
48   C C     . GLN A 8   ? 0.3146 0.1955 0.2554 0.0306  0.0140  -0.0151 5   GLN A C     
49   O O     . GLN A 8   ? 0.3453 0.2311 0.2874 0.0359  0.0203  -0.0107 5   GLN A O     
50   C CB    . GLN A 8   ? 0.3243 0.2070 0.2853 0.0289  0.0162  -0.0064 5   GLN A CB    
51   C CG    . GLN A 8   ? 0.2777 0.1649 0.2504 0.0245  0.0141  -0.0011 5   GLN A CG    
52   C CD    . GLN A 8   ? 0.2699 0.1551 0.2491 0.0296  0.0184  0.0039  5   GLN A CD    
53   O OE1   . GLN A 8   ? 0.3490 0.2217 0.3249 0.0331  0.0206  0.0016  5   GLN A OE1   
54   N NE2   . GLN A 8   ? 0.2946 0.1917 0.2832 0.0306  0.0191  0.0106  5   GLN A NE2   
55   N N     . ASP A 9   ? 0.3331 0.2067 0.2623 0.0297  0.0094  -0.0224 6   ASP A N     
56   C CA    . ASP A 9   ? 0.3600 0.2277 0.2728 0.0364  0.0116  -0.0264 6   ASP A CA    
57   C C     . ASP A 9   ? 0.3245 0.2035 0.2355 0.0368  0.0127  -0.0233 6   ASP A C     
58   O O     . ASP A 9   ? 0.3884 0.2647 0.2876 0.0438  0.0176  -0.0234 6   ASP A O     
59   C CB    . ASP A 9   ? 0.4244 0.2785 0.3243 0.0356  0.0043  -0.0363 6   ASP A CB    
60   C CG    . ASP A 9   ? 0.5579 0.4172 0.4659 0.0262  -0.0049 -0.0385 6   ASP A CG    
61   O OD1   . ASP A 9   ? 0.5240 0.3881 0.4471 0.0200  -0.0061 -0.0349 6   ASP A OD1   
62   O OD2   . ASP A 9   ? 0.6244 0.4834 0.5238 0.0255  -0.0108 -0.0434 6   ASP A OD2   
63   N N     . ARG A 10  ? 0.2618 0.1524 0.1835 0.0299  0.0087  -0.0202 7   ARG A N     
64   C CA    . ARG A 10  ? 0.2511 0.1513 0.1714 0.0296  0.0088  -0.0177 7   ARG A CA    
65   C C     . ARG A 10  ? 0.2600 0.1730 0.1953 0.0269  0.0115  -0.0100 7   ARG A C     
66   O O     . ARG A 10  ? 0.2260 0.1415 0.1723 0.0237  0.0108  -0.0073 7   ARG A O     
67   C CB    . ARG A 10  ? 0.2466 0.1488 0.1651 0.0242  0.0003  -0.0219 7   ARG A CB    
68   C CG    . ARG A 10  ? 0.2798 0.1702 0.1839 0.0260  -0.0052 -0.0305 7   ARG A CG    
69   C CD    . ARG A 10  ? 0.2896 0.1851 0.1965 0.0200  -0.0139 -0.0335 7   ARG A CD    
70   N NE    . ARG A 10  ? 0.2610 0.1597 0.1833 0.0123  -0.0176 -0.0329 7   ARG A NE    
71   C CZ    . ARG A 10  ? 0.2319 0.1396 0.1640 0.0063  -0.0223 -0.0319 7   ARG A CZ    
72   N NH1   . ARG A 10  ? 0.2347 0.1441 0.1802 0.0002  -0.0240 -0.0306 7   ARG A NH1   
73   N NH2   . ARG A 10  ? 0.2347 0.1494 0.1633 0.0069  -0.0248 -0.0318 7   ARG A NH2   
74   N N     . VAL A 11  ? 0.2092 0.1292 0.1441 0.0283  0.0141  -0.0065 8   VAL A N     
75   C CA    . VAL A 11  ? 0.1748 0.1063 0.1231 0.0244  0.0138  -0.0008 8   VAL A CA    
76   C C     . VAL A 11  ? 0.2099 0.1458 0.1551 0.0208  0.0090  -0.0023 8   VAL A C     
77   O O     . VAL A 11  ? 0.2346 0.1690 0.1701 0.0241  0.0101  -0.0034 8   VAL A O     
78   C CB    . VAL A 11  ? 0.1855 0.1222 0.1403 0.0283  0.0209  0.0054  8   VAL A CB    
79   C CG1   . VAL A 11  ? 0.1935 0.1407 0.1622 0.0236  0.0187  0.0100  8   VAL A CG1   
80   C CG2   . VAL A 11  ? 0.2093 0.1422 0.1677 0.0330  0.0264  0.0072  8   VAL A CG2   
81   N N     . VAL A 12  ? 0.1736 0.1148 0.1265 0.0150  0.0042  -0.0020 9   VAL A N     
82   C CA    . VAL A 12  ? 0.1733 0.1189 0.1246 0.0119  -0.0003 -0.0033 9   VAL A CA    
83   C C     . VAL A 12  ? 0.1521 0.1059 0.1129 0.0089  -0.0006 0.0011  9   VAL A C     
84   O O     . VAL A 12  ? 0.1686 0.1241 0.1371 0.0070  -0.0008 0.0033  9   VAL A O     
85   C CB    . VAL A 12  ? 0.1595 0.1026 0.1105 0.0080  -0.0060 -0.0078 9   VAL A CB    
86   C CG1   . VAL A 12  ? 0.1965 0.1462 0.1490 0.0050  -0.0100 -0.0082 9   VAL A CG1   
87   C CG2   . VAL A 12  ? 0.1758 0.1094 0.1166 0.0107  -0.0075 -0.0135 9   VAL A CG2   
88   N N     . ALA A 13  ? 0.1505 0.1083 0.1099 0.0090  -0.0009 0.0022  10  ALA A N     
89   C CA    . ALA A 13  ? 0.1523 0.1161 0.1188 0.0063  -0.0022 0.0051  10  ALA A CA    
90   C C     . ALA A 13  ? 0.1759 0.1424 0.1401 0.0042  -0.0059 0.0033  10  ALA A C     
91   O O     . ALA A 13  ? 0.1861 0.1513 0.1438 0.0054  -0.0073 0.0007  10  ALA A O     
92   C CB    . ALA A 13  ? 0.1734 0.1393 0.1434 0.0082  0.0013  0.0090  10  ALA A CB    
93   N N     . LEU A 14  ? 0.1488 0.1189 0.1179 0.0016  -0.0077 0.0048  11  LEU A N     
94   C CA    . LEU A 14  ? 0.1416 0.1151 0.1096 0.0005  -0.0100 0.0041  11  LEU A CA    
95   C C     . LEU A 14  ? 0.1762 0.1514 0.1463 0.0008  -0.0097 0.0064  11  LEU A C     
96   O O     . LEU A 14  ? 0.1738 0.1490 0.1476 -0.0002 -0.0102 0.0079  11  LEU A O     
97   C CB    . LEU A 14  ? 0.1769 0.1518 0.1478 -0.0021 -0.0117 0.0035  11  LEU A CB    
98   C CG    . LEU A 14  ? 0.2109 0.1902 0.1826 -0.0029 -0.0131 0.0033  11  LEU A CG    
99   C CD1   . LEU A 14  ? 0.2040 0.1845 0.1756 -0.0025 -0.0126 0.0054  11  LEU A CD1   
100  C CD2   . LEU A 14  ? 0.1785 0.1594 0.1469 -0.0013 -0.0146 0.0014  11  LEU A CD2   
101  N N     . VAL A 15  ? 0.1453 0.1210 0.1125 0.0023  -0.0094 0.0066  12  VAL A N     
102  C CA    . VAL A 15  ? 0.1660 0.1417 0.1352 0.0023  -0.0095 0.0083  12  VAL A CA    
103  C C     . VAL A 15  ? 0.1815 0.1590 0.1483 0.0023  -0.0114 0.0072  12  VAL A C     
104  O O     . VAL A 15  ? 0.1714 0.1508 0.1354 0.0035  -0.0118 0.0061  12  VAL A O     
105  C CB    . VAL A 15  ? 0.1451 0.1191 0.1135 0.0045  -0.0068 0.0103  12  VAL A CB    
106  C CG1   . VAL A 15  ? 0.2118 0.1847 0.1837 0.0039  -0.0074 0.0118  12  VAL A CG1   
107  C CG2   . VAL A 15  ? 0.2275 0.2003 0.1989 0.0054  -0.0035 0.0121  12  VAL A CG2   
108  N N     . ASP A 16  ? 0.1680 0.1449 0.1357 0.0016  -0.0128 0.0074  13  ASP A N     
109  C CA    A ASP A 16  ? 0.1821 0.1601 0.1469 0.0026  -0.0135 0.0067  13  ASP A CA    
110  C CA    B ASP A 16  ? 0.1839 0.1620 0.1487 0.0025  -0.0135 0.0066  13  ASP A CA    
111  C C     . ASP A 16  ? 0.1644 0.1385 0.1277 0.0035  -0.0146 0.0066  13  ASP A C     
112  O O     . ASP A 16  ? 0.1993 0.1705 0.1634 0.0025  -0.0166 0.0064  13  ASP A O     
113  C CB    A ASP A 16  ? 0.1770 0.1566 0.1417 0.0017  -0.0135 0.0066  13  ASP A CB    
114  C CB    B ASP A 16  ? 0.2028 0.1820 0.1676 0.0015  -0.0136 0.0067  13  ASP A CB    
115  C CG    A ASP A 16  ? 0.2120 0.1928 0.1738 0.0036  -0.0128 0.0066  13  ASP A CG    
116  C CG    B ASP A 16  ? 0.2211 0.2022 0.1835 0.0031  -0.0127 0.0068  13  ASP A CG    
117  O OD1   A ASP A 16  ? 0.2633 0.2402 0.2207 0.0050  -0.0136 0.0063  13  ASP A OD1   
118  O OD1   B ASP A 16  ? 0.1743 0.1543 0.1340 0.0052  -0.0127 0.0063  13  ASP A OD1   
119  O OD2   A ASP A 16  ? 0.2820 0.2673 0.2460 0.0039  -0.0116 0.0068  13  ASP A OD2   
120  O OD2   B ASP A 16  ? 0.2667 0.2501 0.2304 0.0024  -0.0113 0.0077  13  ASP A OD2   
121  N N     . MET A 17  ? 0.1461 0.1195 0.1072 0.0056  -0.0140 0.0065  14  MET A N     
122  C CA    . MET A 17  ? 0.1555 0.1233 0.1152 0.0064  -0.0153 0.0060  14  MET A CA    
123  C C     . MET A 17  ? 0.1703 0.1354 0.1251 0.0073  -0.0171 0.0042  14  MET A C     
124  O O     . MET A 17  ? 0.1912 0.1596 0.1431 0.0086  -0.0156 0.0042  14  MET A O     
125  C CB    . MET A 17  ? 0.2259 0.1926 0.1835 0.0092  -0.0139 0.0066  14  MET A CB    
126  C CG    . MET A 17  ? 0.1925 0.1613 0.1515 0.0099  -0.0119 0.0087  14  MET A CG    
127  S SD    . MET A 17  ? 0.2265 0.1922 0.1911 0.0077  -0.0106 0.0110  14  MET A SD    
128  C CE    . MET A 17  ? 0.3266 0.2848 0.2942 0.0073  -0.0118 0.0114  14  MET A CE    
129  N N     . ASP A 18  ? 0.1489 0.1078 0.1028 0.0068  -0.0204 0.0028  15  ASP A N     
130  C CA    . ASP A 18  ? 0.1770 0.1313 0.1227 0.0087  -0.0227 0.0005  15  ASP A CA    
131  C C     . ASP A 18  ? 0.1558 0.1065 0.0947 0.0127  -0.0210 -0.0008 15  ASP A C     
132  O O     . ASP A 18  ? 0.1717 0.1193 0.1126 0.0132  -0.0208 -0.0009 15  ASP A O     
133  C CB    . ASP A 18  ? 0.1514 0.0996 0.0982 0.0070  -0.0286 -0.0014 15  ASP A CB    
134  C CG    . ASP A 18  ? 0.1896 0.1419 0.1443 0.0037  -0.0302 0.0003  15  ASP A CG    
135  O OD1   . ASP A 18  ? 0.2301 0.1878 0.1849 0.0037  -0.0274 0.0021  15  ASP A OD1   
136  O OD2   . ASP A 18  ? 0.2476 0.1975 0.2094 0.0014  -0.0343 -0.0001 15  ASP A OD2   
137  N N     . CYS A 19  ? 0.1382 0.1280 0.1115 0.0115  0.0062  0.0246  16  CYS A N     
138  C CA    . CYS A 19  ? 0.1388 0.1248 0.1084 0.0102  0.0057  0.0216  16  CYS A CA    
139  C C     . CYS A 19  ? 0.1400 0.1215 0.1059 0.0117  0.0058  0.0194  16  CYS A C     
140  O O     . CYS A 19  ? 0.1570 0.1364 0.1191 0.0096  0.0054  0.0191  16  CYS A O     
141  C CB    . CYS A 19  ? 0.1708 0.1581 0.1378 0.0061  0.0050  0.0227  16  CYS A CB    
142  S SG    . CYS A 19  ? 0.2098 0.1997 0.1754 0.0027  0.0043  0.0259  16  CYS A SG    
143  N N     . PHE A 20  ? 0.1385 0.1179 0.1050 0.0151  0.0060  0.0177  17  PHE A N     
144  C CA    . PHE A 20  ? 0.1303 0.1065 0.0933 0.0167  0.0061  0.0169  17  PHE A CA    
145  C C     . PHE A 20  ? 0.1455 0.1172 0.1045 0.0158  0.0053  0.0150  17  PHE A C     
146  O O     . PHE A 20  ? 0.1574 0.1274 0.1131 0.0146  0.0052  0.0161  17  PHE A O     
147  C CB    . PHE A 20  ? 0.1635 0.1379 0.1271 0.0206  0.0060  0.0150  17  PHE A CB    
148  C CG    . PHE A 20  ? 0.1495 0.1209 0.1087 0.0224  0.0061  0.0144  17  PHE A CG    
149  C CD1   . PHE A 20  ? 0.1691 0.1422 0.1262 0.0217  0.0074  0.0170  17  PHE A CD1   
150  C CD2   . PHE A 20  ? 0.1945 0.1616 0.1517 0.0248  0.0047  0.0115  17  PHE A CD2   
151  C CE1   . PHE A 20  ? 0.2019 0.1722 0.1543 0.0233  0.0076  0.0169  17  PHE A CE1   
152  C CE2   . PHE A 20  ? 0.1977 0.1618 0.1501 0.0265  0.0045  0.0113  17  PHE A CE2   
153  C CZ    . PHE A 20  ? 0.1990 0.1646 0.1486 0.0257  0.0061  0.0140  17  PHE A CZ    
154  N N     . PHE A 21  ? 0.1370 0.1068 0.0965 0.0163  0.0047  0.0124  18  PHE A N     
155  C CA    . PHE A 21  ? 0.1411 0.1062 0.0973 0.0165  0.0039  0.0103  18  PHE A CA    
156  C C     . PHE A 21  ? 0.1416 0.1059 0.0948 0.0130  0.0039  0.0113  18  PHE A C     
157  O O     . PHE A 21  ? 0.1526 0.1122 0.1021 0.0126  0.0032  0.0108  18  PHE A O     
158  C CB    . PHE A 21  ? 0.1639 0.1284 0.1223 0.0180  0.0036  0.0073  18  PHE A CB    
159  C CG    . PHE A 21  ? 0.1689 0.1329 0.1297 0.0211  0.0026  0.0059  18  PHE A CG    
160  C CD1   . PHE A 21  ? 0.1744 0.1386 0.1350 0.0226  0.0024  0.0068  18  PHE A CD1   
161  C CD2   . PHE A 21  ? 0.1652 0.1287 0.1283 0.0227  0.0019  0.0034  18  PHE A CD2   
162  C CE1   . PHE A 21  ? 0.1921 0.1551 0.1541 0.0252  0.0010  0.0050  18  PHE A CE1   
163  C CE2   . PHE A 21  ? 0.1661 0.1293 0.1317 0.0251  0.0004  0.0020  18  PHE A CE2   
164  C CZ    . PHE A 21  ? 0.1638 0.1262 0.1284 0.0262  -0.0003 0.0027  18  PHE A CZ    
165  N N     . VAL A 22  ? 0.1431 0.1113 0.0977 0.0104  0.0044  0.0128  19  VAL A N     
166  C CA    . VAL A 22  ? 0.1328 0.1004 0.0843 0.0066  0.0039  0.0138  19  VAL A CA    
167  C C     . VAL A 22  ? 0.1521 0.1192 0.1020 0.0049  0.0034  0.0166  19  VAL A C     
168  O O     . VAL A 22  ? 0.1554 0.1181 0.1015 0.0028  0.0024  0.0165  19  VAL A O     
169  C CB    . VAL A 22  ? 0.1271 0.0996 0.0802 0.0040  0.0041  0.0153  19  VAL A CB    
170  C CG1   . VAL A 22  ? 0.1793 0.1520 0.1294 -0.0003 0.0029  0.0172  19  VAL A CG1   
171  C CG2   . VAL A 22  ? 0.1756 0.1480 0.1287 0.0047  0.0048  0.0126  19  VAL A CG2   
172  N N     . GLN A 23  ? 0.1328 0.1044 0.0859 0.0060  0.0042  0.0192  20  GLN A N     
173  C CA    . GLN A 23  ? 0.1079 0.0804 0.0602 0.0045  0.0043  0.0222  20  GLN A CA    
174  C C     . GLN A 23  ? 0.1409 0.1072 0.0891 0.0057  0.0040  0.0213  20  GLN A C     
175  O O     . GLN A 23  ? 0.1707 0.1352 0.1165 0.0030  0.0034  0.0233  20  GLN A O     
176  C CB    . GLN A 23  ? 0.1360 0.1146 0.0925 0.0063  0.0058  0.0248  20  GLN A CB    
177  C CG    . GLN A 23  ? 0.1831 0.1683 0.1442 0.0048  0.0059  0.0272  20  GLN A CG    
178  C CD    . GLN A 23  ? 0.1837 0.1748 0.1487 0.0064  0.0075  0.0304  20  GLN A CD    
179  O OE1   . GLN A 23  ? 0.2193 0.2137 0.1851 0.0041  0.0078  0.0335  20  GLN A OE1   
180  N NE2   . GLN A 23  ? 0.2163 0.2088 0.1841 0.0105  0.0087  0.0295  20  GLN A NE2   
181  N N     . VAL A 24  ? 0.1305 0.0938 0.0781 0.0095  0.0040  0.0185  21  VAL A N     
182  C CA    . VAL A 24  ? 0.1271 0.0843 0.0705 0.0109  0.0032  0.0179  21  VAL A CA    
183  C C     . VAL A 24  ? 0.1552 0.1064 0.0952 0.0084  0.0017  0.0168  21  VAL A C     
184  O O     . VAL A 24  ? 0.1625 0.1093 0.0990 0.0070  0.0009  0.0184  21  VAL A O     
185  C CB    . VAL A 24  ? 0.1310 0.0862 0.0746 0.0153  0.0028  0.0149  21  VAL A CB    
186  C CG1   . VAL A 24  ? 0.1661 0.1148 0.1054 0.0167  0.0014  0.0144  21  VAL A CG1   
187  C CG2   . VAL A 24  ? 0.1440 0.1036 0.0898 0.0177  0.0040  0.0156  21  VAL A CG2   
188  N N     . GLU A 25  ? 0.1510 0.1017 0.0917 0.0080  0.0014  0.0142  22  GLU A N     
189  C CA    . GLU A 25  ? 0.1702 0.1144 0.1071 0.0063  0.0002  0.0123  22  GLU A CA    
190  C C     . GLU A 25  ? 0.1660 0.1100 0.1009 0.0011  -0.0007 0.0148  22  GLU A C     
191  O O     . GLU A 25  ? 0.1753 0.1125 0.1062 -0.0008 -0.0022 0.0146  22  GLU A O     
192  C CB    . GLU A 25  ? 0.1561 0.1005 0.0940 0.0076  0.0006  0.0086  22  GLU A CB    
193  C CG    . GLU A 25  ? 0.1648 0.1094 0.1054 0.0122  0.0010  0.0061  22  GLU A CG    
194  C CD    . GLU A 25  ? 0.2088 0.1463 0.1469 0.0148  -0.0003 0.0048  22  GLU A CD    
195  O OE1   . GLU A 25  ? 0.2534 0.1847 0.1875 0.0132  -0.0014 0.0047  22  GLU A OE1   
196  O OE2   . GLU A 25  ? 0.2417 0.1797 0.1820 0.0184  -0.0007 0.0040  22  GLU A OE2   
197  N N     . GLN A 26  ? 0.1680 0.1193 0.1061 -0.0011 0.0000  0.0175  23  GLN A N     
198  C CA    . GLN A 26  ? 0.1545 0.1070 0.0917 -0.0064 -0.0012 0.0203  23  GLN A CA    
199  C C     . GLN A 26  ? 0.1810 0.1327 0.1177 -0.0081 -0.0015 0.0240  23  GLN A C     
200  O O     . GLN A 26  ? 0.1806 0.1292 0.1151 -0.0125 -0.0032 0.0256  23  GLN A O     
201  C CB    . GLN A 26  ? 0.1425 0.1038 0.0840 -0.0080 -0.0007 0.0225  23  GLN A CB    
202  C CG    . GLN A 26  ? 0.1526 0.1147 0.0935 -0.0080 -0.0008 0.0199  23  GLN A CG    
203  C CD    . GLN A 26  ? 0.1859 0.1566 0.1314 -0.0091 -0.0005 0.0227  23  GLN A CD    
204  O OE1   . GLN A 26  ? 0.1853 0.1614 0.1355 -0.0071 0.0007  0.0251  23  GLN A OE1   
205  N NE2   . GLN A 26  ? 0.2038 0.1757 0.1474 -0.0121 -0.0017 0.0223  23  GLN A NE2   
206  N N     . ARG A 27  ? 0.1538 0.1082 0.0923 -0.0048 0.0002  0.0254  24  ARG A N     
207  C CA    . ARG A 27  ? 0.1464 0.1001 0.0837 -0.0061 0.0004  0.0290  24  ARG A CA    
208  C C     . ARG A 27  ? 0.2302 0.1733 0.1620 -0.0070 -0.0016 0.0278  24  ARG A C     
209  O O     . ARG A 27  ? 0.1942 0.1344 0.1241 -0.0112 -0.0029 0.0307  24  ARG A O     
210  C CB    . ARG A 27  ? 0.1613 0.1186 0.0997 -0.0018 0.0026  0.0299  24  ARG A CB    
211  C CG    . ARG A 27  ? 0.1726 0.1300 0.1091 -0.0031 0.0034  0.0340  24  ARG A CG    
212  C CD    . ARG A 27  ? 0.1952 0.1571 0.1322 0.0012  0.0060  0.0347  24  ARG A CD    
213  N NE    . ARG A 27  ? 0.1800 0.1361 0.1135 0.0056  0.0053  0.0312  24  ARG A NE    
214  C CZ    . ARG A 27  ? 0.1880 0.1452 0.1196 0.0094  0.0067  0.0311  24  ARG A CZ    
215  N NH1   . ARG A 27  ? 0.1735 0.1376 0.1065 0.0098  0.0095  0.0340  24  ARG A NH1   
216  N NH2   . ARG A 27  ? 0.2104 0.1622 0.1389 0.0129  0.0053  0.0280  24  ARG A NH2   
217  N N     . GLN A 28  ? 0.1655 0.1030 0.0952 -0.0031 -0.0021 0.0238  25  GLN A N     
218  C CA    . GLN A 28  ? 0.1763 0.1035 0.1013 -0.0026 -0.0040 0.0224  25  GLN A CA    
219  C C     . GLN A 28  ? 0.1928 0.1136 0.1150 -0.0065 -0.0061 0.0209  25  GLN A C     
220  O O     . GLN A 28  ? 0.2038 0.1163 0.1223 -0.0085 -0.0080 0.0218  25  GLN A O     
221  C CB    . GLN A 28  ? 0.1895 0.1138 0.1144 0.0030  -0.0040 0.0184  25  GLN A CB    
222  C CG    . GLN A 28  ? 0.2152 0.1292 0.1360 0.0045  -0.0061 0.0173  25  GLN A CG    
223  C CD    . GLN A 28  ? 0.2779 0.1903 0.1999 0.0101  -0.0063 0.0135  25  GLN A CD    
224  O OE1   . GLN A 28  ? 0.2688 0.1874 0.1940 0.0128  -0.0051 0.0128  25  GLN A OE1   
225  N NE2   . GLN A 28  ? 0.3625 0.2664 0.2823 0.0117  -0.0080 0.0110  25  GLN A NE2   
226  N N     . ASN A 29  ? 0.1757 0.0997 0.0992 -0.0074 -0.0058 0.0185  26  ASN A N     
227  C CA    . ASN A 29  ? 0.2093 0.1272 0.1290 -0.0108 -0.0078 0.0162  26  ASN A CA    
228  C C     . ASN A 29  ? 0.1898 0.1141 0.1111 -0.0159 -0.0083 0.0184  26  ASN A C     
229  O O     . ASN A 29  ? 0.1844 0.1146 0.1076 -0.0154 -0.0073 0.0170  26  ASN A O     
230  C CB    . ASN A 29  ? 0.2097 0.1243 0.1280 -0.0070 -0.0072 0.0106  26  ASN A CB    
231  C CG    . ASN A 29  ? 0.2515 0.1587 0.1646 -0.0098 -0.0089 0.0074  26  ASN A CG    
232  O OD1   . ASN A 29  ? 0.2670 0.1711 0.1775 -0.0151 -0.0111 0.0093  26  ASN A OD1   
233  N ND2   . ASN A 29  ? 0.3157 0.2200 0.2271 -0.0063 -0.0080 0.0024  26  ASN A ND2   
234  N N     . PRO A 30  ? 0.1812 0.1048 0.1021 -0.0211 -0.0100 0.0222  27  PRO A N     
235  C CA    . PRO A 30  ? 0.2319 0.1625 0.1552 -0.0262 -0.0109 0.0250  27  PRO A CA    
236  C C     . PRO A 30  ? 0.2320 0.1607 0.1519 -0.0283 -0.0125 0.0213  27  PRO A C     
237  O O     . PRO A 30  ? 0.2502 0.1869 0.1729 -0.0310 -0.0129 0.0232  27  PRO A O     
238  C CB    . PRO A 30  ? 0.2237 0.1508 0.1461 -0.0317 -0.0131 0.0290  27  PRO A CB    
239  C CG    . PRO A 30  ? 0.2552 0.1785 0.1769 -0.0285 -0.0119 0.0303  27  PRO A CG    
240  C CD    . PRO A 30  ? 0.2172 0.1344 0.1361 -0.0224 -0.0111 0.0249  27  PRO A CD    
241  N N     . HIS A 31  ? 0.2329 0.1516 0.1470 -0.0266 -0.0132 0.0163  28  HIS A N     
242  C CA    . HIS A 31  ? 0.2906 0.2073 0.2003 -0.0280 -0.0142 0.0123  28  HIS A CA    
243  C C     . HIS A 31  ? 0.2821 0.2082 0.1950 -0.0252 -0.0117 0.0116  28  HIS A C     
244  O O     . HIS A 31  ? 0.2711 0.1988 0.1811 -0.0274 -0.0125 0.0100  28  HIS A O     
245  C CB    . HIS A 31  ? 0.3259 0.2305 0.2291 -0.0254 -0.0146 0.0065  28  HIS A CB    
246  C CG    . HIS A 31  ? 0.4026 0.2959 0.3006 -0.0296 -0.0180 0.0062  28  HIS A CG    
247  N ND1   . HIS A 31  ? 0.5243 0.4063 0.4192 -0.0268 -0.0186 0.0041  28  HIS A ND1   
248  C CD2   . HIS A 31  ? 0.4113 0.3022 0.3065 -0.0364 -0.0215 0.0079  28  HIS A CD2   
249  C CE1   . HIS A 31  ? 0.5263 0.3989 0.4167 -0.0319 -0.0221 0.0044  28  HIS A CE1   
250  N NE2   . HIS A 31  ? 0.5132 0.3910 0.4037 -0.0380 -0.0240 0.0067  28  HIS A NE2   
251  N N     . LEU A 32  ? 0.2418 0.1738 0.1602 -0.0206 -0.0090 0.0128  29  LEU A N     
252  C CA    . LEU A 32  ? 0.1937 0.1338 0.1156 -0.0179 -0.0068 0.0124  29  LEU A CA    
253  C C     . LEU A 32  ? 0.2105 0.1608 0.1379 -0.0201 -0.0069 0.0173  29  LEU A C     
254  O O     . LEU A 32  ? 0.1964 0.1534 0.1267 -0.0188 -0.0057 0.0177  29  LEU A O     
255  C CB    . LEU A 32  ? 0.1843 0.1249 0.1094 -0.0118 -0.0043 0.0109  29  LEU A CB    
256  C CG    . LEU A 32  ? 0.2352 0.1672 0.1565 -0.0084 -0.0040 0.0062  29  LEU A CG    
257  C CD1   . LEU A 32  ? 0.2326 0.1666 0.1581 -0.0029 -0.0021 0.0054  29  LEU A CD1   
258  C CD2   . LEU A 32  ? 0.2945 0.2248 0.2115 -0.0089 -0.0036 0.0021  29  LEU A CD2   
259  N N     . ARG A 33  ? 0.2054 0.1575 0.1349 -0.0234 -0.0082 0.0214  30  ARG A N     
260  C CA    . ARG A 33  ? 0.2077 0.1704 0.1438 -0.0246 -0.0078 0.0262  30  ARG A CA    
261  C C     . ARG A 33  ? 0.2327 0.2001 0.1686 -0.0284 -0.0098 0.0272  30  ARG A C     
262  O O     . ARG A 33  ? 0.2328 0.1953 0.1633 -0.0327 -0.0125 0.0257  30  ARG A O     
263  C CB    . ARG A 33  ? 0.1942 0.1585 0.1329 -0.0274 -0.0085 0.0306  30  ARG A CB    
264  C CG    . ARG A 33  ? 0.2049 0.1655 0.1435 -0.0235 -0.0065 0.0304  30  ARG A CG    
265  C CD    . ARG A 33  ? 0.1973 0.1591 0.1376 -0.0265 -0.0068 0.0349  30  ARG A CD    
266  N NE    . ARG A 33  ? 0.2085 0.1660 0.1472 -0.0230 -0.0051 0.0347  30  ARG A NE    
267  C CZ    . ARG A 33  ? 0.2630 0.2215 0.2026 -0.0246 -0.0046 0.0388  30  ARG A CZ    
268  N NH1   . ARG A 33  ? 0.2956 0.2598 0.2386 -0.0299 -0.0056 0.0433  30  ARG A NH1   
269  N NH2   . ARG A 33  ? 0.2158 0.1700 0.1529 -0.0213 -0.0033 0.0386  30  ARG A NH2   
270  N N     . ASN A 34  ? 0.2132 0.1894 0.1545 -0.0268 -0.0086 0.0296  31  ASN A N     
271  C CA    . ASN A 34  ? 0.2285 0.2104 0.1704 -0.0303 -0.0108 0.0316  31  ASN A CA    
272  C C     . ASN A 34  ? 0.2900 0.2665 0.2243 -0.0314 -0.0117 0.0273  31  ASN A C     
273  O O     . ASN A 34  ? 0.3424 0.3190 0.2729 -0.0361 -0.0147 0.0278  31  ASN A O     
274  C CB    . ASN A 34  ? 0.2922 0.2772 0.2359 -0.0361 -0.0138 0.0356  31  ASN A CB    
275  C CG    . ASN A 34  ? 0.3767 0.3684 0.3283 -0.0349 -0.0123 0.0402  31  ASN A CG    
276  O OD1   . ASN A 34  ? 0.4496 0.4485 0.4074 -0.0312 -0.0101 0.0422  31  ASN A OD1   
277  N ND2   . ASN A 34  ? 0.4338 0.4228 0.3850 -0.0380 -0.0133 0.0417  31  ASN A ND2   
278  N N     . LYS A 35  ? 0.2136 0.1857 0.1455 -0.0271 -0.0092 0.0232  32  LYS A N     
279  C CA    . LYS A 35  ? 0.2290 0.1965 0.1539 -0.0271 -0.0090 0.0188  32  LYS A CA    
280  C C     . LYS A 35  ? 0.2280 0.1993 0.1557 -0.0227 -0.0060 0.0180  32  LYS A C     
281  O O     . LYS A 35  ? 0.2135 0.1875 0.1472 -0.0190 -0.0041 0.0193  32  LYS A O     
282  C CB    . LYS A 35  ? 0.2484 0.2054 0.1675 -0.0258 -0.0086 0.0140  32  LYS A CB    
283  C CG    . LYS A 35  ? 0.3028 0.2535 0.2179 -0.0304 -0.0118 0.0142  32  LYS A CG    
284  C CD    . LYS A 35  ? 0.4359 0.3827 0.3429 -0.0346 -0.0143 0.0116  32  LYS A CD    
285  C CE    . LYS A 35  ? 0.5216 0.4611 0.4246 -0.0396 -0.0180 0.0116  32  LYS A CE    
286  N NZ    . LYS A 35  ? 0.5394 0.4733 0.4329 -0.0435 -0.0207 0.0080  32  LYS A NZ    
287  N N     . PRO A 36  ? 0.2113 0.1826 0.1342 -0.0234 -0.0056 0.0160  33  PRO A N     
288  C CA    . PRO A 36  ? 0.2063 0.1801 0.1314 -0.0194 -0.0025 0.0147  33  PRO A CA    
289  C C     . PRO A 36  ? 0.2066 0.1742 0.1310 -0.0154 -0.0003 0.0103  33  PRO A C     
290  O O     . PRO A 36  ? 0.2232 0.1841 0.1412 -0.0156 -0.0004 0.0062  33  PRO A O     
291  C CB    . PRO A 36  ? 0.2393 0.2138 0.1579 -0.0217 -0.0025 0.0134  33  PRO A CB    
292  C CG    . PRO A 36  ? 0.3185 0.2869 0.2290 -0.0256 -0.0051 0.0111  33  PRO A CG    
293  C CD    . PRO A 36  ? 0.2675 0.2361 0.1821 -0.0278 -0.0078 0.0144  33  PRO A CD    
294  N N     . CYS A 37  ? 0.1948 0.1643 0.1256 -0.0115 0.0012  0.0110  34  CYS A N     
295  C CA    A CYS A 37  ? 0.2110 0.1754 0.1424 -0.0077 0.0025  0.0079  34  CYS A CA    
296  C CA    B CYS A 37  ? 0.1963 0.1608 0.1272 -0.0077 0.0027  0.0074  34  CYS A CA    
297  C C     . CYS A 37  ? 0.1973 0.1657 0.1348 -0.0038 0.0046  0.0079  34  CYS A C     
298  O O     . CYS A 37  ? 0.2086 0.1827 0.1508 -0.0040 0.0046  0.0112  34  CYS A O     
299  C CB    A CYS A 37  ? 0.2946 0.2560 0.2270 -0.0081 0.0009  0.0096  34  CYS A CB    
300  C CB    B CYS A 37  ? 0.2353 0.1940 0.1651 -0.0079 0.0011  0.0074  34  CYS A CB    
301  S SG    A CYS A 37  ? 0.2398 0.1949 0.1730 -0.0037 0.0015  0.0071  34  CYS A SG    
302  S SG    B CYS A 37  ? 0.2127 0.1763 0.1489 -0.0080 0.0004  0.0124  34  CYS A SG    
303  N N     . ALA A 38  ? 0.1637 0.1290 0.1016 -0.0003 0.0059  0.0045  35  ALA A N     
304  C CA    . ALA A 38  ? 0.1599 0.1285 0.1039 0.0031  0.0073  0.0045  35  ALA A CA    
305  C C     . ALA A 38  ? 0.1570 0.1208 0.1017 0.0067  0.0073  0.0019  35  ALA A C     
306  O O     . ALA A 38  ? 0.1905 0.1486 0.1309 0.0070  0.0068  -0.0006 35  ALA A O     
307  C CB    . ALA A 38  ? 0.1583 0.1308 0.1029 0.0032  0.0094  0.0035  35  ALA A CB    
308  N N     . VAL A 39  ? 0.1455 0.1115 0.0957 0.0095  0.0074  0.0024  36  VAL A N     
309  C CA    . VAL A 39  ? 0.1491 0.1115 0.1007 0.0131  0.0070  0.0001  36  VAL A CA    
310  C C     . VAL A 39  ? 0.1817 0.1474 0.1374 0.0154  0.0085  -0.0021 36  VAL A C     
311  O O     . VAL A 39  ? 0.1737 0.1449 0.1336 0.0148  0.0093  -0.0006 36  VAL A O     
312  C CB    . VAL A 39  ? 0.1485 0.1107 0.1026 0.0145  0.0056  0.0020  36  VAL A CB    
313  C CG1   . VAL A 39  ? 0.1649 0.1241 0.1205 0.0183  0.0047  -0.0001 36  VAL A CG1   
314  C CG2   . VAL A 39  ? 0.1791 0.1386 0.1293 0.0123  0.0045  0.0043  36  VAL A CG2   
315  N N     . VAL A 40  ? 0.2125 0.1749 0.1672 0.0179  0.0090  -0.0053 37  VAL A N     
316  C CA    . VAL A 40  ? 0.1933 0.1596 0.1522 0.0202  0.0109  -0.0074 37  VAL A CA    
317  C C     . VAL A 40  ? 0.2166 0.1815 0.1798 0.0243  0.0097  -0.0089 37  VAL A C     
318  O O     . VAL A 40  ? 0.2315 0.1902 0.1920 0.0257  0.0077  -0.0094 37  VAL A O     
319  C CB    . VAL A 40  ? 0.2275 0.1925 0.1819 0.0201  0.0132  -0.0103 37  VAL A CB    
320  C CG1   A VAL A 40  ? 0.2476 0.2161 0.1986 0.0161  0.0146  -0.0088 37  VAL A CG1   
321  C CG1   B VAL A 40  ? 0.2248 0.1818 0.1753 0.0225  0.0122  -0.0132 37  VAL A CG1   
322  C CG2   A VAL A 40  ? 0.1934 0.1496 0.1417 0.0208  0.0119  -0.0124 37  VAL A CG2   
323  C CG2   B VAL A 40  ? 0.2247 0.1964 0.1838 0.0216  0.0162  -0.0117 37  VAL A CG2   
324  N N     . GLN A 41  ? 0.2038 0.1745 0.1738 0.0259  0.0106  -0.0094 38  GLN A N     
325  C CA    . GLN A 41  ? 0.2415 0.2123 0.2167 0.0296  0.0091  -0.0106 38  GLN A CA    
326  C C     . GLN A 41  ? 0.1776 0.1516 0.1562 0.0322  0.0116  -0.0133 38  GLN A C     
327  O O     . GLN A 41  ? 0.2045 0.1853 0.1865 0.0311  0.0143  -0.0131 38  GLN A O     
328  C CB    . GLN A 41  ? 0.3010 0.2768 0.2826 0.0290  0.0078  -0.0086 38  GLN A CB    
329  C CG    . GLN A 41  ? 0.3271 0.3017 0.3123 0.0317  0.0047  -0.0089 38  GLN A CG    
330  C CD    . GLN A 41  ? 0.2692 0.2457 0.2571 0.0302  0.0028  -0.0070 38  GLN A CD    
331  O OE1   . GLN A 41  ? 0.2459 0.2183 0.2311 0.0309  0.0002  -0.0065 38  GLN A OE1   
332  N NE2   . GLN A 41  ? 0.2665 0.2487 0.2592 0.0280  0.0041  -0.0059 38  GLN A NE2   
333  N N     . TYR A 42  ? 0.1869 0.1561 0.1645 0.0358  0.0108  -0.0157 39  TYR A N     
334  C CA    . TYR A 42  ? 0.2265 0.1979 0.2070 0.0393  0.0134  -0.0187 39  TYR A CA    
335  C C     . TYR A 42  ? 0.2487 0.2188 0.2225 0.0376  0.0168  -0.0205 39  TYR A C     
336  O O     . TYR A 42  ? 0.2656 0.2327 0.2328 0.0337  0.0164  -0.0191 39  TYR A O     
337  C CB    . TYR A 42  ? 0.2419 0.2232 0.2327 0.0407  0.0145  -0.0184 39  TYR A CB    
338  C CG    . TYR A 42  ? 0.1683 0.1505 0.1650 0.0418  0.0104  -0.0168 39  TYR A CG    
339  C CD1   . TYR A 42  ? 0.1928 0.1695 0.1893 0.0454  0.0073  -0.0177 39  TYR A CD1   
340  C CD2   . TYR A 42  ? 0.1843 0.1719 0.1859 0.0391  0.0093  -0.0143 39  TYR A CD2   
341  C CE1   . TYR A 42  ? 0.2249 0.2022 0.2256 0.0463  0.0033  -0.0163 39  TYR A CE1   
342  C CE2   . TYR A 42  ? 0.1776 0.1652 0.1834 0.0400  0.0053  -0.0133 39  TYR A CE2   
343  C CZ    . TYR A 42  ? 0.1961 0.1788 0.2012 0.0436  0.0023  -0.0143 39  TYR A CZ    
344  O OH    . TYR A 42  ? 0.1980 0.1805 0.2062 0.0444  -0.0020 -0.0134 39  TYR A OH    
345  N N     . LYS A 43  ? 0.2955 0.2678 0.2706 0.0407  0.0199  -0.0237 40  LYS A N     
346  C CA    . LYS A 43  ? 0.3122 0.2814 0.2792 0.0398  0.0229  -0.0263 40  LYS A CA    
347  C C     . LYS A 43  ? 0.3629 0.3391 0.3333 0.0426  0.0277  -0.0289 40  LYS A C     
348  O O     . LYS A 43  ? 0.3357 0.3132 0.3003 0.0409  0.0311  -0.0303 40  LYS A O     
349  C CB    . LYS A 43  ? 0.4081 0.3654 0.3679 0.0416  0.0209  -0.0288 40  LYS A CB    
350  C CG    . LYS A 43  ? 0.6225 0.5732 0.5713 0.0377  0.0211  -0.0298 40  LYS A CG    
351  C CD    . LYS A 43  ? 0.6298 0.5786 0.5759 0.0327  0.0179  -0.0257 40  LYS A CD    
352  C CE    . LYS A 43  ? 0.6055 0.5485 0.5416 0.0285  0.0175  -0.0263 40  LYS A CE    
353  N NZ    . LYS A 43  ? 0.5949 0.5436 0.5279 0.0265  0.0209  -0.0272 40  LYS A NZ    
354  N N     . SER A 44  ? 0.3813 0.3627 0.3613 0.0469  0.0281  -0.0295 41  SER A N     
355  C CA    . SER A 44  ? 0.3375 0.3261 0.3220 0.0506  0.0329  -0.0322 41  SER A CA    
356  C C     . SER A 44  ? 0.4279 0.4271 0.4144 0.0471  0.0369  -0.0302 41  SER A C     
357  O O     . SER A 44  ? 0.5590 0.5604 0.5409 0.0475  0.0415  -0.0326 41  SER A O     
358  C CB    . SER A 44  ? 0.4037 0.3966 0.3995 0.0558  0.0318  -0.0325 41  SER A CB    
359  O OG    . SER A 44  ? 0.4814 0.4638 0.4744 0.0591  0.0281  -0.0340 41  SER A OG    
360  N N     . TRP A 45  ? 0.3432 0.3484 0.3359 0.0436  0.0351  -0.0259 42  TRP A N     
361  C CA    . TRP A 45  ? 0.3326 0.3475 0.3279 0.0399  0.0384  -0.0232 42  TRP A CA    
362  C C     . TRP A 45  ? 0.3380 0.3489 0.3232 0.0346  0.0380  -0.0215 42  TRP A C     
363  O O     . TRP A 45  ? 0.3059 0.3127 0.2897 0.0316  0.0341  -0.0188 42  TRP A O     
364  C CB    . TRP A 45  ? 0.3782 0.4008 0.3850 0.0383  0.0363  -0.0194 42  TRP A CB    
365  C CG    . TRP A 45  ? 0.4592 0.4919 0.4698 0.0346  0.0398  -0.0163 42  TRP A CG    
366  C CD1   . TRP A 45  ? 0.5239 0.5575 0.5333 0.0292  0.0385  -0.0122 42  TRP A CD1   
367  C CD2   . TRP A 45  ? 0.5540 0.5973 0.5702 0.0359  0.0452  -0.0167 42  TRP A CD2   
368  N NE1   . TRP A 45  ? 0.5578 0.6013 0.5714 0.0268  0.0424  -0.0098 42  TRP A NE1   
369  C CE2   . TRP A 45  ? 0.5733 0.6234 0.5911 0.0307  0.0468  -0.0124 42  TRP A CE2   
370  C CE3   . TRP A 45  ? 0.6270 0.6750 0.6474 0.0412  0.0491  -0.0202 42  TRP A CE3   
371  C CZ2   . TRP A 45  ? 0.6532 0.7148 0.6763 0.0302  0.0523  -0.0112 42  TRP A CZ2   
372  C CZ3   . TRP A 45  ? 0.6945 0.7545 0.7205 0.0411  0.0547  -0.0192 42  TRP A CZ3   
373  C CH2   . TRP A 45  ? 0.7216 0.7885 0.7488 0.0354  0.0564  -0.0146 42  TRP A CH2   
374  N N     . LYS A 46  ? 0.3530 0.3654 0.3312 0.0337  0.0423  -0.0230 43  LYS A N     
375  C CA    . LYS A 46  ? 0.3318 0.3421 0.3006 0.0286  0.0423  -0.0212 43  LYS A CA    
376  C C     . LYS A 46  ? 0.3218 0.3213 0.2828 0.0268  0.0377  -0.0213 43  LYS A C     
377  O O     . LYS A 46  ? 0.2648 0.2635 0.2222 0.0223  0.0358  -0.0180 43  LYS A O     
378  C CB    . LYS A 46  ? 0.3658 0.3842 0.3401 0.0242  0.0423  -0.0158 43  LYS A CB    
379  C CG    . LYS A 46  ? 0.4094 0.4393 0.3898 0.0246  0.0475  -0.0149 43  LYS A CG    
380  C CD    . LYS A 46  ? 0.4534 0.4901 0.4396 0.0199  0.0469  -0.0091 43  LYS A CD    
381  C CE    . LYS A 46  ? 0.5857 0.6343 0.5792 0.0200  0.0520  -0.0078 43  LYS A CE    
382  N NZ    . LYS A 46  ? 0.6282 0.6828 0.6285 0.0152  0.0510  -0.0018 43  LYS A NZ    
383  N N     . GLY A 47  ? 0.2918 0.2834 0.2509 0.0304  0.0360  -0.0247 44  GLY A N     
384  C CA    . GLY A 47  ? 0.2438 0.2250 0.1955 0.0288  0.0320  -0.0249 44  GLY A CA    
385  C C     . GLY A 47  ? 0.2706 0.2496 0.2270 0.0278  0.0275  -0.0217 44  GLY A C     
386  O O     . GLY A 47  ? 0.2678 0.2391 0.2190 0.0265  0.0243  -0.0214 44  GLY A O     
387  N N     . GLY A 48  ? 0.2625 0.2484 0.2285 0.0284  0.0271  -0.0192 45  GLY A N     
388  C CA    . GLY A 48  ? 0.2297 0.2136 0.1994 0.0277  0.0231  -0.0165 45  GLY A CA    
389  C C     . GLY A 48  ? 0.2208 0.2095 0.1925 0.0236  0.0225  -0.0123 45  GLY A C     
390  O O     . GLY A 48  ? 0.2306 0.2217 0.1984 0.0204  0.0243  -0.0111 45  GLY A O     
391  N N     . GLY A 49  ? 0.1930 0.1826 0.1706 0.0237  0.0198  -0.0101 46  GLY A N     
392  C CA    . GLY A 49  ? 0.1683 0.1614 0.1484 0.0203  0.0189  -0.0064 46  GLY A CA    
393  C C     . GLY A 49  ? 0.2032 0.1909 0.1783 0.0184  0.0162  -0.0046 46  GLY A C     
394  O O     . GLY A 49  ? 0.1921 0.1748 0.1663 0.0201  0.0138  -0.0052 46  GLY A O     
395  N N     . ILE A 50  ? 0.1859 0.1751 0.1580 0.0149  0.0166  -0.0020 47  ILE A N     
396  C CA    . ILE A 50  ? 0.2018 0.1870 0.1700 0.0132  0.0143  0.0000  47  ILE A CA    
397  C C     . ILE A 50  ? 0.2166 0.2026 0.1900 0.0135  0.0123  0.0023  47  ILE A C     
398  O O     . ILE A 50  ? 0.2417 0.2317 0.2199 0.0125  0.0126  0.0042  47  ILE A O     
399  C CB    . ILE A 50  ? 0.1867 0.1736 0.1501 0.0095  0.0151  0.0021  47  ILE A CB    
400  C CG1   . ILE A 50  ? 0.2841 0.2682 0.2402 0.0091  0.0165  -0.0008 47  ILE A CG1   
401  C CG2   . ILE A 50  ? 0.2240 0.2091 0.1859 0.0076  0.0127  0.0051  47  ILE A CG2   
402  C CD1   . ILE A 50  ? 0.3721 0.3576 0.3224 0.0052  0.0168  0.0010  47  ILE A CD1   
403  N N     . ILE A 51  ? 0.1748 0.1562 0.1467 0.0147  0.0102  0.0022  48  ILE A N     
404  C CA    . ILE A 51  ? 0.1934 0.1748 0.1688 0.0154  0.0084  0.0038  48  ILE A CA    
405  C C     . ILE A 51  ? 0.1734 0.1534 0.1461 0.0141  0.0075  0.0064  48  ILE A C     
406  O O     . ILE A 51  ? 0.1786 0.1588 0.1540 0.0148  0.0064  0.0077  48  ILE A O     
407  C CB    . ILE A 51  ? 0.2182 0.1969 0.1957 0.0187  0.0067  0.0018  48  ILE A CB    
408  C CG1   . ILE A 51  ? 0.1879 0.1613 0.1601 0.0200  0.0059  0.0005  48  ILE A CG1   
409  C CG2   . ILE A 51  ? 0.2438 0.2256 0.2264 0.0200  0.0073  -0.0001 48  ILE A CG2   
410  C CD1   . ILE A 51  ? 0.2351 0.2056 0.2084 0.0230  0.0037  -0.0007 48  ILE A CD1   
411  N N     . ALA A 52  ? 0.1669 0.1458 0.1346 0.0122  0.0078  0.0070  49  ALA A N     
412  C CA    . ALA A 52  ? 0.1451 0.1243 0.1114 0.0106  0.0071  0.0098  49  ALA A CA    
413  C C     . ALA A 52  ? 0.1323 0.1120 0.0940 0.0074  0.0074  0.0107  49  ALA A C     
414  O O     . ALA A 52  ? 0.1409 0.1181 0.0987 0.0071  0.0079  0.0083  49  ALA A O     
415  C CB    . ALA A 52  ? 0.1528 0.1284 0.1175 0.0124  0.0060  0.0096  49  ALA A CB    
416  N N     . VAL A 53  ? 0.1388 0.1216 0.1010 0.0052  0.0068  0.0141  50  VAL A N     
417  C CA    . VAL A 53  ? 0.1219 0.1062 0.0801 0.0016  0.0066  0.0153  50  VAL A CA    
418  C C     . VAL A 53  ? 0.1539 0.1399 0.1122 -0.0002 0.0051  0.0188  50  VAL A C     
419  O O     . VAL A 53  ? 0.1561 0.1450 0.1190 0.0008  0.0049  0.0214  50  VAL A O     
420  C CB    . VAL A 53  ? 0.1449 0.1333 0.1044 0.0002  0.0074  0.0168  50  VAL A CB    
421  C CG1   . VAL A 53  ? 0.1601 0.1497 0.1141 -0.0036 0.0069  0.0178  50  VAL A CG1   
422  C CG2   . VAL A 53  ? 0.1918 0.1802 0.1528 0.0020  0.0092  0.0141  50  VAL A CG2   
423  N N     . SER A 54  ? 0.1392 0.1233 0.0929 -0.0029 0.0041  0.0186  51  SER A N     
424  C CA    . SER A 54  ? 0.1731 0.1601 0.1277 -0.0053 0.0025  0.0222  51  SER A CA    
425  C C     . SER A 54  ? 0.1453 0.1378 0.1017 -0.0074 0.0017  0.0257  51  SER A C     
426  O O     . SER A 54  ? 0.1607 0.1539 0.1150 -0.0084 0.0021  0.0251  51  SER A O     
427  C CB    . SER A 54  ? 0.1741 0.1575 0.1234 -0.0084 0.0011  0.0214  51  SER A CB    
428  O OG    . SER A 54  ? 0.1795 0.1626 0.1237 -0.0117 0.0002  0.0207  51  SER A OG    
429  N N     . TYR A 55  ? 0.1626 0.1595 0.1230 -0.0081 0.0006  0.0296  52  TYR A N     
430  C CA    . TYR A 55  ? 0.1661 0.1685 0.1290 -0.0098 -0.0007 0.0335  52  TYR A CA    
431  C C     . TYR A 55  ? 0.1900 0.1927 0.1468 -0.0144 -0.0025 0.0338  52  TYR A C     
432  O O     . TYR A 55  ? 0.2045 0.2098 0.1606 -0.0157 -0.0031 0.0356  52  TYR A O     
433  C CB    . TYR A 55  ? 0.1718 0.1793 0.1412 -0.0089 -0.0014 0.0377  52  TYR A CB    
434  C CG    . TYR A 55  ? 0.1609 0.1683 0.1356 -0.0040 0.0004  0.0376  52  TYR A CG    
435  C CD1   . TYR A 55  ? 0.1706 0.1744 0.1454 -0.0010 0.0020  0.0347  52  TYR A CD1   
436  C CD2   . TYR A 55  ? 0.2250 0.2350 0.2041 -0.0027 0.0001  0.0400  52  TYR A CD2   
437  C CE1   . TYR A 55  ? 0.1976 0.2005 0.1761 0.0033  0.0033  0.0341  52  TYR A CE1   
438  C CE2   . TYR A 55  ? 0.1896 0.1982 0.1730 0.0016  0.0014  0.0394  52  TYR A CE2   
439  C CZ    . TYR A 55  ? 0.1966 0.2016 0.1794 0.0045  0.0030  0.0362  52  TYR A CZ    
440  O OH    . TYR A 55  ? 0.2153 0.2184 0.2017 0.0086  0.0039  0.0352  52  TYR A OH    
441  N N     . GLU A 56  ? 0.1969 0.1962 0.1487 -0.0170 -0.0036 0.0319  53  GLU A N     
442  C CA    . GLU A 56  ? 0.1941 0.1919 0.1384 -0.0213 -0.0054 0.0309  53  GLU A CA    
443  C C     . GLU A 56  ? 0.2055 0.2006 0.1447 -0.0204 -0.0034 0.0275  53  GLU A C     
444  O O     . GLU A 56  ? 0.2358 0.2327 0.1705 -0.0231 -0.0043 0.0283  53  GLU A O     
445  C CB    . GLU A 56  ? 0.2275 0.2202 0.1673 -0.0238 -0.0068 0.0287  53  GLU A CB    
446  C CG    . GLU A 56  ? 0.2792 0.2757 0.2238 -0.0258 -0.0089 0.0328  53  GLU A CG    
447  C CD    . GLU A 56  ? 0.3895 0.3858 0.3397 -0.0221 -0.0068 0.0331  53  GLU A CD    
448  O OE1   . GLU A 56  ? 0.2920 0.2859 0.2432 -0.0178 -0.0042 0.0307  53  GLU A OE1   
449  O OE2   . GLU A 56  ? 0.4325 0.4314 0.3859 -0.0238 -0.0079 0.0359  53  GLU A OE2   
450  N N     . ALA A 57  ? 0.1744 0.1659 0.1144 -0.0168 -0.0008 0.0239  54  ALA A N     
451  C CA    . ALA A 57  ? 0.1657 0.1558 0.1022 -0.0156 0.0016  0.0209  54  ALA A CA    
452  C C     . ALA A 57  ? 0.1673 0.1627 0.1083 -0.0148 0.0026  0.0239  54  ALA A C     
453  O O     . ALA A 57  ? 0.1860 0.1826 0.1233 -0.0158 0.0038  0.0234  54  ALA A O     
454  C CB    . ALA A 57  ? 0.1798 0.1652 0.1172 -0.0117 0.0038  0.0166  54  ALA A CB    
455  N N     . ARG A 58  ? 0.1865 0.1847 0.1349 -0.0130 0.0021  0.0272  55  ARG A N     
456  C CA    . ARG A 58  ? 0.1999 0.2021 0.1529 -0.0123 0.0026  0.0304  55  ARG A CA    
457  C C     . ARG A 58  ? 0.1947 0.2007 0.1445 -0.0160 0.0009  0.0341  55  ARG A C     
458  O O     . ARG A 58  ? 0.2132 0.2215 0.1632 -0.0166 0.0017  0.0360  55  ARG A O     
459  C CB    . ARG A 58  ? 0.1691 0.1726 0.1302 -0.0095 0.0021  0.0328  55  ARG A CB    
460  C CG    . ARG A 58  ? 0.1876 0.1876 0.1515 -0.0058 0.0036  0.0294  55  ARG A CG    
461  C CD    . ARG A 58  ? 0.1780 0.1789 0.1485 -0.0029 0.0032  0.0315  55  ARG A CD    
462  N NE    . ARG A 58  ? 0.1924 0.1896 0.1636 0.0001  0.0041  0.0283  55  ARG A NE    
463  C CZ    . ARG A 58  ? 0.2216 0.2180 0.1974 0.0034  0.0044  0.0283  55  ARG A CZ    
464  N NH1   . ARG A 58  ? 0.2278 0.2263 0.2082 0.0044  0.0038  0.0313  55  ARG A NH1   
465  N NH2   . ARG A 58  ? 0.2150 0.2078 0.1899 0.0059  0.0050  0.0253  55  ARG A NH2   
466  N N     . ALA A 59  ? 0.2174 0.2241 0.1640 -0.0189 -0.0017 0.0353  56  ALA A N     
467  C CA    . ALA A 59  ? 0.2138 0.2241 0.1566 -0.0228 -0.0042 0.0388  56  ALA A CA    
468  C C     . ALA A 59  ? 0.2671 0.2762 0.2011 -0.0249 -0.0028 0.0365  56  ALA A C     
469  O O     . ALA A 59  ? 0.2936 0.3060 0.2245 -0.0274 -0.0040 0.0398  56  ALA A O     
470  C CB    . ALA A 59  ? 0.2344 0.2456 0.1757 -0.0258 -0.0075 0.0401  56  ALA A CB    
471  N N     . PHE A 60  ? 0.2219 0.2264 0.1518 -0.0235 -0.0002 0.0310  57  PHE A N     
472  C CA    . PHE A 60  ? 0.2383 0.2418 0.1600 -0.0245 0.0020  0.0281  57  PHE A CA    
473  C C     . PHE A 60  ? 0.2684 0.2743 0.1941 -0.0222 0.0055  0.0284  57  PHE A C     
474  O O     . PHE A 60  ? 0.3009 0.3074 0.2210 -0.0227 0.0081  0.0267  57  PHE A O     
475  C CB    . PHE A 60  ? 0.1946 0.1917 0.1103 -0.0237 0.0033  0.0217  57  PHE A CB    
476  C CG    . PHE A 60  ? 0.2337 0.2274 0.1430 -0.0271 -0.0002 0.0207  57  PHE A CG    
477  C CD1   . PHE A 60  ? 0.2902 0.2823 0.1887 -0.0304 -0.0010 0.0189  57  PHE A CD1   
478  C CD2   . PHE A 60  ? 0.2738 0.2658 0.1876 -0.0272 -0.0025 0.0215  57  PHE A CD2   
479  C CE1   . PHE A 60  ? 0.3761 0.3644 0.2686 -0.0340 -0.0048 0.0178  57  PHE A CE1   
480  C CE2   . PHE A 60  ? 0.2964 0.2854 0.2049 -0.0309 -0.0059 0.0209  57  PHE A CE2   
481  C CZ    . PHE A 60  ? 0.3672 0.3541 0.2653 -0.0345 -0.0073 0.0190  57  PHE A CZ    
482  N N     . GLY A 61  ? 0.2457 0.2528 0.1810 -0.0195 0.0057  0.0305  58  GLY A N     
483  C CA    . GLY A 61  ? 0.2460 0.2551 0.1862 -0.0177 0.0084  0.0312  58  GLY A CA    
484  C C     . GLY A 61  ? 0.2106 0.2170 0.1542 -0.0141 0.0110  0.0265  58  GLY A C     
485  O O     . GLY A 61  ? 0.2241 0.2325 0.1718 -0.0128 0.0132  0.0265  58  GLY A O     
486  N N     . VAL A 62  ? 0.1987 0.2008 0.1408 -0.0126 0.0103  0.0229  59  VAL A N     
487  C CA    . VAL A 62  ? 0.1867 0.1860 0.1322 -0.0090 0.0121  0.0188  59  VAL A CA    
488  C C     . VAL A 62  ? 0.2107 0.2106 0.1650 -0.0067 0.0113  0.0208  59  VAL A C     
489  O O     . VAL A 62  ? 0.1926 0.1927 0.1496 -0.0069 0.0091  0.0237  59  VAL A O     
490  C CB    . VAL A 62  ? 0.1899 0.1836 0.1312 -0.0082 0.0112  0.0150  59  VAL A CB    
491  C CG1   . VAL A 62  ? 0.2040 0.1949 0.1489 -0.0043 0.0127  0.0113  59  VAL A CG1   
492  C CG2   . VAL A 62  ? 0.2329 0.2246 0.1646 -0.0105 0.0115  0.0125  59  VAL A CG2   
493  N N     . THR A 63  ? 0.2208 0.2213 0.1798 -0.0045 0.0131  0.0192  60  THR A N     
494  C CA    . THR A 63  ? 0.2123 0.2127 0.1790 -0.0023 0.0122  0.0204  60  THR A CA    
495  C C     . THR A 63  ? 0.2140 0.2121 0.1836 0.0009  0.0130  0.0165  60  THR A C     
496  O O     . THR A 63  ? 0.2415 0.2397 0.2090 0.0016  0.0149  0.0134  60  THR A O     
497  C CB    . THR A 63  ? 0.2752 0.2792 0.2466 -0.0036 0.0126  0.0240  60  THR A CB    
498  O OG1   . THR A 63  ? 0.2990 0.3058 0.2711 -0.0038 0.0153  0.0224  60  THR A OG1   
499  C CG2   . THR A 63  ? 0.2812 0.2876 0.2498 -0.0068 0.0116  0.0285  60  THR A CG2   
500  N N     . ARG A 64  ? 0.2209 0.2172 0.1955 0.0030  0.0114  0.0167  61  ARG A N     
501  C CA    . ARG A 64  ? 0.2584 0.2533 0.2369 0.0058  0.0115  0.0138  61  ARG A CA    
502  C C     . ARG A 64  ? 0.2930 0.2920 0.2755 0.0052  0.0133  0.0138  61  ARG A C     
503  O O     . ARG A 64  ? 0.2752 0.2776 0.2593 0.0027  0.0139  0.0170  61  ARG A O     
504  C CB    . ARG A 64  ? 0.3652 0.3577 0.3477 0.0075  0.0093  0.0147  61  ARG A CB    
505  C CG    . ARG A 64  ? 0.4544 0.4461 0.4419 0.0097  0.0086  0.0127  61  ARG A CG    
506  C CD    . ARG A 64  ? 0.4828 0.4709 0.4719 0.0116  0.0064  0.0129  61  ARG A CD    
507  N NE    . ARG A 64  ? 0.4808 0.4660 0.4652 0.0129  0.0060  0.0120  61  ARG A NE    
508  C CZ    . ARG A 64  ? 0.4207 0.4047 0.4040 0.0134  0.0053  0.0137  61  ARG A CZ    
509  N NH1   . ARG A 64  ? 0.3697 0.3543 0.3564 0.0133  0.0047  0.0160  61  ARG A NH1   
510  N NH2   . ARG A 64  ? 0.2727 0.2548 0.2520 0.0142  0.0053  0.0132  61  ARG A NH2   
511  N N     . SER A 65  ? 0.2837 0.2828 0.2683 0.0074  0.0141  0.0105  62  SER A N     
512  C CA    . SER A 65  ? 0.2875 0.2916 0.2772 0.0073  0.0160  0.0102  62  SER A CA    
513  C C     . SER A 65  ? 0.2748 0.2824 0.2604 0.0063  0.0195  0.0093  62  SER A C     
514  O O     . SER A 65  ? 0.3553 0.3676 0.3447 0.0068  0.0219  0.0083  62  SER A O     
515  C CB    . SER A 65  ? 0.3090 0.3160 0.3048 0.0051  0.0153  0.0138  62  SER A CB    
516  O OG    . SER A 65  ? 0.3839 0.3939 0.3770 0.0019  0.0168  0.0172  62  SER A OG    
517  N N     . MET A 66  ? 0.2799 0.2856 0.2578 0.0048  0.0198  0.0095  63  MET A N     
518  C CA    . MET A 66  ? 0.2443 0.2520 0.2163 0.0041  0.0229  0.0079  63  MET A CA    
519  C C     . MET A 66  ? 0.2441 0.2492 0.2146 0.0076  0.0240  0.0030  63  MET A C     
520  O O     . MET A 66  ? 0.2243 0.2240 0.1946 0.0097  0.0218  0.0012  63  MET A O     
521  C CB    . MET A 66  ? 0.2802 0.2852 0.2440 0.0014  0.0218  0.0093  63  MET A CB    
522  C CG    . MET A 66  ? 0.3613 0.3687 0.3179 -0.0007 0.0243  0.0090  63  MET A CG    
523  S SD    . MET A 66  ? 0.3359 0.3413 0.2857 -0.0046 0.0213  0.0126  63  MET A SD    
524  C CE    . MET A 66  ? 0.3274 0.3379 0.2833 -0.0070 0.0206  0.0188  63  MET A CE    
525  N N     . TRP A 67  ? 0.2364 0.2452 0.2058 0.0084  0.0277  0.0009  64  TRP A N     
526  C CA    . TRP A 67  ? 0.1998 0.2053 0.1665 0.0120  0.0290  -0.0040 64  TRP A CA    
527  C C     . TRP A 67  ? 0.2193 0.2182 0.1752 0.0108  0.0282  -0.0058 64  TRP A C     
528  O O     . TRP A 67  ? 0.2123 0.2123 0.1625 0.0073  0.0285  -0.0038 64  TRP A O     
529  C CB    . TRP A 67  ? 0.2470 0.2589 0.2159 0.0137  0.0336  -0.0060 64  TRP A CB    
530  C CG    . TRP A 67  ? 0.2193 0.2382 0.1995 0.0144  0.0342  -0.0041 64  TRP A CG    
531  C CD1   . TRP A 67  ? 0.3113 0.3383 0.2961 0.0119  0.0365  -0.0007 64  TRP A CD1   
532  C CD2   . TRP A 67  ? 0.2779 0.2963 0.2664 0.0175  0.0319  -0.0051 64  TRP A CD2   
533  N NE1   . TRP A 67  ? 0.3536 0.3852 0.3496 0.0130  0.0358  0.0003  64  TRP A NE1   
534  C CE2   . TRP A 67  ? 0.3482 0.3747 0.3464 0.0165  0.0328  -0.0025 64  TRP A CE2   
535  C CE3   . TRP A 67  ? 0.2647 0.2766 0.2531 0.0208  0.0290  -0.0077 64  TRP A CE3   
536  C CZ2   . TRP A 67  ? 0.3651 0.3934 0.3729 0.0186  0.0306  -0.0027 64  TRP A CZ2   
537  C CZ3   . TRP A 67  ? 0.2870 0.3006 0.2843 0.0231  0.0269  -0.0078 64  TRP A CZ3   
538  C CH2   . TRP A 67  ? 0.3580 0.3799 0.3649 0.0220  0.0276  -0.0055 64  TRP A CH2   
539  N N     . ALA A 68  ? 0.2111 0.2031 0.1644 0.0134  0.0268  -0.0092 65  ALA A N     
540  C CA    . ALA A 68  ? 0.2182 0.2031 0.1618 0.0119  0.0254  -0.0109 65  ALA A CA    
541  C C     . ALA A 68  ? 0.2178 0.2035 0.1532 0.0108  0.0285  -0.0132 65  ALA A C     
542  O O     . ALA A 68  ? 0.2393 0.2220 0.1667 0.0074  0.0271  -0.0127 65  ALA A O     
543  C CB    . ALA A 68  ? 0.2285 0.2054 0.1710 0.0150  0.0235  -0.0141 65  ALA A CB    
544  N N     . ASP A 69  ? 0.2280 0.2181 0.1655 0.0136  0.0326  -0.0157 66  ASP A N     
545  C CA    . ASP A 69  ? 0.2643 0.2553 0.1932 0.0130  0.0361  -0.0182 66  ASP A CA    
546  C C     . ASP A 69  ? 0.2512 0.2472 0.1764 0.0079  0.0362  -0.0139 66  ASP A C     
547  O O     . ASP A 69  ? 0.2753 0.2691 0.1901 0.0055  0.0367  -0.0151 66  ASP A O     
548  C CB    . ASP A 69  ? 0.3005 0.2977 0.2338 0.0170  0.0412  -0.0209 66  ASP A CB    
549  C CG    . ASP A 69  ? 0.2900 0.2813 0.2239 0.0225  0.0416  -0.0262 66  ASP A CG    
550  O OD1   . ASP A 69  ? 0.3492 0.3308 0.2789 0.0228  0.0380  -0.0280 66  ASP A OD1   
551  O OD2   . ASP A 69  ? 0.3674 0.3641 0.3063 0.0265  0.0457  -0.0284 66  ASP A OD2   
552  N N     . ASP A 70  ? 0.2239 0.2261 0.1574 0.0063  0.0355  -0.0090 67  ASP A N     
553  C CA    . ASP A 70  ? 0.2290 0.2359 0.1602 0.0017  0.0354  -0.0041 67  ASP A CA    
554  C C     . ASP A 70  ? 0.2071 0.2091 0.1341 -0.0016 0.0306  -0.0017 67  ASP A C     
555  O O     . ASP A 70  ? 0.2405 0.2431 0.1602 -0.0052 0.0300  0.0003  67  ASP A O     
556  C CB    . ASP A 70  ? 0.2589 0.2732 0.2009 0.0013  0.0361  0.0003  67  ASP A CB    
557  C CG    . ASP A 70  ? 0.3198 0.3409 0.2667 0.0037  0.0410  -0.0013 67  ASP A CG    
558  O OD1   . ASP A 70  ? 0.3301 0.3524 0.2703 0.0048  0.0448  -0.0046 67  ASP A OD1   
559  O OD2   . ASP A 70  ? 0.3554 0.3809 0.3130 0.0047  0.0410  0.0006  67  ASP A OD2   
560  N N     . ALA A 71  ? 0.1849 0.1824 0.1164 -0.0003 0.0273  -0.0016 68  ALA A N     
561  C CA    . ALA A 71  ? 0.2122 0.2057 0.1405 -0.0031 0.0231  0.0006  68  ALA A CA    
562  C C     . ALA A 71  ? 0.1968 0.1848 0.1139 -0.0049 0.0223  -0.0024 68  ALA A C     
563  O O     . ALA A 71  ? 0.2351 0.2228 0.1476 -0.0088 0.0196  0.0002  68  ALA A O     
564  C CB    . ALA A 71  ? 0.1994 0.1890 0.1338 -0.0010 0.0205  0.0006  68  ALA A CB    
565  N N     . LYS A 72  ? 0.1955 0.1790 0.1084 -0.0022 0.0242  -0.0079 69  LYS A N     
566  C CA    . LYS A 72  ? 0.2184 0.1955 0.1199 -0.0038 0.0234  -0.0115 69  LYS A CA    
567  C C     . LYS A 72  ? 0.2421 0.2228 0.1350 -0.0071 0.0249  -0.0109 69  LYS A C     
568  O O     . LYS A 72  ? 0.2658 0.2418 0.1488 -0.0101 0.0227  -0.0123 69  LYS A O     
569  C CB    . LYS A 72  ? 0.2691 0.2403 0.1683 0.0007  0.0256  -0.0178 69  LYS A CB    
570  C CG    . LYS A 72  ? 0.3198 0.2834 0.2221 0.0026  0.0226  -0.0192 69  LYS A CG    
571  C CD    . LYS A 72  ? 0.3600 0.3158 0.2542 -0.0012 0.0186  -0.0196 69  LYS A CD    
572  C CE    . LYS A 72  ? 0.3727 0.3197 0.2680 0.0007  0.0162  -0.0215 69  LYS A CE    
573  N NZ    . LYS A 72  ? 0.3343 0.2742 0.2221 -0.0039 0.0120  -0.0215 69  LYS A NZ    
574  N N     . LYS A 73  ? 0.2220 0.2108 0.1184 -0.0067 0.0283  -0.0086 70  LYS A N     
575  C CA    . LYS A 73  ? 0.2162 0.2092 0.1045 -0.0100 0.0299  -0.0070 70  LYS A CA    
576  C C     . LYS A 73  ? 0.2456 0.2399 0.1328 -0.0149 0.0253  -0.0013 70  LYS A C     
577  O O     . LYS A 73  ? 0.2963 0.2903 0.1736 -0.0185 0.0240  -0.0008 70  LYS A O     
578  C CB    . LYS A 73  ? 0.2124 0.2143 0.1061 -0.0086 0.0347  -0.0051 70  LYS A CB    
579  C CG    . LYS A 73  ? 0.2296 0.2319 0.1264 -0.0034 0.0394  -0.0103 70  LYS A CG    
580  C CD    . LYS A 73  ? 0.2527 0.2650 0.1565 -0.0025 0.0441  -0.0078 70  LYS A CD    
581  C CE    . LYS A 73  ? 0.3223 0.3359 0.2298 0.0030  0.0487  -0.0129 70  LYS A CE    
582  N NZ    . LYS A 73  ? 0.3501 0.3742 0.2682 0.0038  0.0526  -0.0098 70  LYS A NZ    
583  N N     . LEU A 74  ? 0.2342 0.2301 0.1315 -0.0149 0.0227  0.0029  71  LEU A N     
584  C CA    . LEU A 74  ? 0.2221 0.2197 0.1201 -0.0188 0.0184  0.0084  71  LEU A CA    
585  C C     . LEU A 74  ? 0.2494 0.2409 0.1437 -0.0205 0.0140  0.0073  71  LEU A C     
586  O O     . LEU A 74  ? 0.2841 0.2765 0.1749 -0.0245 0.0105  0.0105  71  LEU A O     
587  C CB    . LEU A 74  ? 0.2338 0.2352 0.1441 -0.0175 0.0177  0.0131  71  LEU A CB    
588  C CG    . LEU A 74  ? 0.2139 0.2214 0.1300 -0.0164 0.0212  0.0152  71  LEU A CG    
589  C CD1   . LEU A 74  ? 0.2873 0.2962 0.2151 -0.0148 0.0198  0.0185  71  LEU A CD1   
590  C CD2   . LEU A 74  ? 0.2474 0.2597 0.1580 -0.0201 0.0216  0.0193  71  LEU A CD2   
591  N N     . CYS A 75  ? 0.2367 0.2223 0.1325 -0.0178 0.0141  0.0030  72  CYS A N     
592  C CA    . CYS A 75  ? 0.2284 0.2080 0.1223 -0.0194 0.0101  0.0024  72  CYS A CA    
593  C C     . CYS A 75  ? 0.2338 0.2051 0.1220 -0.0173 0.0110  -0.0042 72  CYS A C     
594  O O     . CYS A 75  ? 0.2360 0.2041 0.1296 -0.0137 0.0118  -0.0061 72  CYS A O     
595  C CB    . CYS A 75  ? 0.2269 0.2081 0.1317 -0.0179 0.0085  0.0057  72  CYS A CB    
596  S SG    . CYS A 75  ? 0.2971 0.2730 0.2019 -0.0201 0.0040  0.0064  72  CYS A SG    
597  N N     . PRO A 76  ? 0.2761 0.2434 0.1529 -0.0193 0.0109  -0.0077 73  PRO A N     
598  C CA    . PRO A 76  ? 0.2870 0.2454 0.1573 -0.0169 0.0122  -0.0145 73  PRO A CA    
599  C C     . PRO A 76  ? 0.2686 0.2191 0.1408 -0.0169 0.0088  -0.0156 73  PRO A C     
600  O O     . PRO A 76  ? 0.3213 0.2651 0.1927 -0.0132 0.0102  -0.0203 73  PRO A O     
601  C CB    . PRO A 76  ? 0.3527 0.3083 0.2095 -0.0204 0.0114  -0.0172 73  PRO A CB    
602  C CG    . PRO A 76  ? 0.3829 0.3477 0.2397 -0.0229 0.0120  -0.0124 73  PRO A CG    
603  C CD    . PRO A 76  ? 0.3434 0.3141 0.2122 -0.0236 0.0099  -0.0058 73  PRO A CD    
604  N N     . ASP A 77  ? 0.2842 0.2357 0.1591 -0.0208 0.0045  -0.0111 74  ASP A N     
605  C CA    . ASP A 77  ? 0.3441 0.2889 0.2210 -0.0215 0.0014  -0.0112 74  ASP A CA    
606  C C     . ASP A 77  ? 0.2985 0.2465 0.1868 -0.0185 0.0020  -0.0081 74  ASP A C     
607  O O     . ASP A 77  ? 0.2971 0.2412 0.1879 -0.0194 -0.0005 -0.0068 74  ASP A O     
608  C CB    . ASP A 77  ? 0.4179 0.3625 0.2916 -0.0278 -0.0036 -0.0081 74  ASP A CB    
609  C CG    . ASP A 77  ? 0.5888 0.5283 0.4498 -0.0313 -0.0053 -0.0117 74  ASP A CG    
610  O OD1   . ASP A 77  ? 0.6268 0.5713 0.4848 -0.0356 -0.0076 -0.0086 74  ASP A OD1   
611  O OD2   . ASP A 77  ? 0.6245 0.5547 0.4783 -0.0296 -0.0044 -0.0178 74  ASP A OD2   
612  N N     . LEU A 78  ? 0.2463 0.2009 0.1410 -0.0150 0.0053  -0.0069 75  LEU A N     
613  C CA    . LEU A 78  ? 0.2117 0.1691 0.1165 -0.0120 0.0058  -0.0044 75  LEU A CA    
614  C C     . LEU A 78  ? 0.2102 0.1596 0.1153 -0.0091 0.0055  -0.0075 75  LEU A C     
615  O O     . LEU A 78  ? 0.2601 0.2044 0.1613 -0.0064 0.0072  -0.0123 75  LEU A O     
616  C CB    . LEU A 78  ? 0.2197 0.1837 0.1300 -0.0086 0.0094  -0.0040 75  LEU A CB    
617  C CG    . LEU A 78  ? 0.1777 0.1446 0.0979 -0.0054 0.0099  -0.0018 75  LEU A CG    
618  C CD1   . LEU A 78  ? 0.2144 0.1854 0.1391 -0.0078 0.0075  0.0035  75  LEU A CD1   
619  C CD2   . LEU A 78  ? 0.2038 0.1761 0.1285 -0.0027 0.0132  -0.0023 75  LEU A CD2   
620  N N     . LEU A 79  ? 0.2003 0.1487 0.1098 -0.0096 0.0033  -0.0046 76  LEU A N     
621  C CA    . LEU A 79  ? 0.2109 0.1524 0.1213 -0.0067 0.0030  -0.0066 76  LEU A CA    
622  C C     . LEU A 79  ? 0.2213 0.1666 0.1395 -0.0020 0.0049  -0.0059 76  LEU A C     
623  O O     . LEU A 79  ? 0.2160 0.1687 0.1399 -0.0020 0.0056  -0.0027 76  LEU A O     
624  C CB    . LEU A 79  ? 0.1847 0.1226 0.0947 -0.0101 -0.0003 -0.0038 76  LEU A CB    
625  C CG    . LEU A 79  ? 0.1995 0.1335 0.1022 -0.0155 -0.0031 -0.0041 76  LEU A CG    
626  C CD1   . LEU A 79  ? 0.2339 0.1653 0.1377 -0.0191 -0.0063 -0.0007 76  LEU A CD1   
627  C CD2   . LEU A 79  ? 0.2206 0.1457 0.1149 -0.0146 -0.0027 -0.0101 76  LEU A CD2   
628  N N     . LEU A 80  ? 0.2142 0.1542 0.1328 0.0019  0.0056  -0.0090 77  LEU A N     
629  C CA    . LEU A 80  ? 0.2163 0.1597 0.1420 0.0063  0.0070  -0.0088 77  LEU A CA    
630  C C     . LEU A 80  ? 0.2589 0.1964 0.1858 0.0085  0.0053  -0.0087 77  LEU A C     
631  O O     . LEU A 80  ? 0.3199 0.2490 0.2421 0.0088  0.0041  -0.0109 77  LEU A O     
632  C CB    . LEU A 80  ? 0.2275 0.1725 0.1541 0.0099  0.0099  -0.0126 77  LEU A CB    
633  C CG    . LEU A 80  ? 0.2322 0.1841 0.1579 0.0081  0.0122  -0.0124 77  LEU A CG    
634  C CD1   . LEU A 80  ? 0.2600 0.2135 0.1864 0.0117  0.0156  -0.0162 77  LEU A CD1   
635  C CD2   . LEU A 80  ? 0.2646 0.2245 0.1969 0.0069  0.0121  -0.0079 77  LEU A CD2   
636  N N     . ALA A 81  ? 0.1825 0.1238 0.1150 0.0100  0.0050  -0.0061 78  ALA A N     
637  C CA    . ALA A 81  ? 0.1749 0.1118 0.1087 0.0127  0.0035  -0.0058 78  ALA A CA    
638  C C     . ALA A 81  ? 0.2070 0.1473 0.1465 0.0172  0.0046  -0.0072 78  ALA A C     
639  O O     . ALA A 81  ? 0.2151 0.1626 0.1593 0.0174  0.0058  -0.0061 78  ALA A O     
640  C CB    . ALA A 81  ? 0.2184 0.1565 0.1530 0.0106  0.0021  -0.0016 78  ALA A CB    
641  N N     . GLN A 82  ? 0.2127 0.1479 0.1523 0.0208  0.0039  -0.0094 79  GLN A N     
642  C CA    . GLN A 82  ? 0.2184 0.1571 0.1641 0.0251  0.0044  -0.0107 79  GLN A CA    
643  C C     . GLN A 82  ? 0.1928 0.1316 0.1411 0.0267  0.0023  -0.0085 79  GLN A C     
644  O O     . GLN A 82  ? 0.2429 0.1757 0.1876 0.0265  0.0003  -0.0071 79  GLN A O     
645  C CB    . GLN A 82  ? 0.2455 0.1794 0.1908 0.0290  0.0047  -0.0144 79  GLN A CB    
646  C CG    . GLN A 82  ? 0.2819 0.2169 0.2254 0.0290  0.0075  -0.0176 79  GLN A CG    
647  C CD    . GLN A 82  ? 0.4331 0.3651 0.3782 0.0340  0.0083  -0.0214 79  GLN A CD    
648  O OE1   . GLN A 82  ? 0.4723 0.4095 0.4245 0.0376  0.0089  -0.0218 79  GLN A OE1   
649  N NE2   . GLN A 82  ? 0.3440 0.2673 0.2828 0.0345  0.0082  -0.0241 79  GLN A NE2   
650  N N     . VAL A 83  ? 0.2016 0.1469 0.1559 0.0281  0.0026  -0.0081 80  VAL A N     
651  C CA    . VAL A 83  ? 0.1974 0.1425 0.1540 0.0303  0.0004  -0.0070 80  VAL A CA    
652  C C     . VAL A 83  ? 0.2010 0.1409 0.1576 0.0341  -0.0014 -0.0087 80  VAL A C     
653  O O     . VAL A 83  ? 0.1946 0.1347 0.1535 0.0364  -0.0004 -0.0113 80  VAL A O     
654  C CB    . VAL A 83  ? 0.1796 0.1319 0.1428 0.0310  0.0006  -0.0069 80  VAL A CB    
655  C CG1   . VAL A 83  ? 0.2095 0.1611 0.1744 0.0333  -0.0022 -0.0063 80  VAL A CG1   
656  C CG2   . VAL A 83  ? 0.1956 0.1524 0.1590 0.0275  0.0021  -0.0050 80  VAL A CG2   
657  N N     . ARG A 84  ? 0.2136 0.1490 0.1674 0.0349  -0.0039 -0.0069 81  ARG A N     
658  C CA    . ARG A 84  ? 0.1984 0.1284 0.1519 0.0386  -0.0063 -0.0076 81  ARG A CA    
659  C C     . ARG A 84  ? 0.1823 0.1174 0.1433 0.0423  -0.0069 -0.0095 81  ARG A C     
660  O O     . ARG A 84  ? 0.1997 0.1415 0.1652 0.0418  -0.0068 -0.0093 81  ARG A O     
661  C CB    . ARG A 84  ? 0.2548 0.1809 0.2040 0.0383  -0.0089 -0.0047 81  ARG A CB    
662  C CG    . ARG A 84  ? 0.2813 0.2023 0.2302 0.0422  -0.0122 -0.0046 81  ARG A CG    
663  C CD    . ARG A 84  ? 0.4331 0.3523 0.3776 0.0417  -0.0144 -0.0015 81  ARG A CD    
664  N NE    . ARG A 84  ? 0.5977 0.5134 0.5423 0.0455  -0.0181 -0.0012 81  ARG A NE    
665  C CZ    . ARG A 84  ? 0.7180 0.6326 0.6590 0.0460  -0.0206 0.0010  81  ARG A CZ    
666  N NH1   . ARG A 84  ? 0.6163 0.5330 0.5534 0.0434  -0.0195 0.0027  81  ARG A NH1   
667  N NH2   . ARG A 84  ? 0.7576 0.6690 0.6987 0.0495  -0.0243 0.0015  81  ARG A NH2   
668  N N     . GLU A 85  ? 0.2073 0.1392 0.1700 0.0459  -0.0077 -0.0113 82  GLU A N     
669  C CA    . GLU A 85  ? 0.2382 0.1753 0.2089 0.0498  -0.0089 -0.0127 82  GLU A CA    
670  C C     . GLU A 85  ? 0.2512 0.1829 0.2213 0.0533  -0.0129 -0.0117 82  GLU A C     
671  O O     . GLU A 85  ? 0.2961 0.2194 0.2615 0.0545  -0.0138 -0.0117 82  GLU A O     
672  C CB    . GLU A 85  ? 0.2459 0.1862 0.2213 0.0519  -0.0058 -0.0158 82  GLU A CB    
673  C CG    . GLU A 85  ? 0.2185 0.1660 0.1956 0.0486  -0.0020 -0.0163 82  GLU A CG    
674  C CD    . GLU A 85  ? 0.3139 0.2649 0.2945 0.0507  0.0016  -0.0193 82  GLU A CD    
675  O OE1   . GLU A 85  ? 0.3399 0.2927 0.3264 0.0552  0.0012  -0.0209 82  GLU A OE1   
676  O OE2   . GLU A 85  ? 0.3492 0.3015 0.3265 0.0478  0.0048  -0.0201 82  GLU A OE2   
677  N N     . SER A 86  ? 0.2263 0.1623 0.2008 0.0547  -0.0157 -0.0109 83  SER A N     
678  C CA    . SER A 86  ? 0.2471 0.1791 0.2214 0.0581  -0.0202 -0.0097 83  SER A CA    
679  C C     . SER A 86  ? 0.2355 0.1756 0.2195 0.0608  -0.0222 -0.0107 83  SER A C     
680  O O     . SER A 86  ? 0.2319 0.1794 0.2203 0.0587  -0.0213 -0.0110 83  SER A O     
681  C CB    . SER A 86  ? 0.2893 0.2173 0.2559 0.0559  -0.0227 -0.0068 83  SER A CB    
682  O OG    . SER A 86  ? 0.4039 0.3252 0.3623 0.0531  -0.0211 -0.0054 83  SER A OG    
683  N N     . ARG A 87  ? 0.2915 0.2301 0.2793 0.0653  -0.0250 -0.0108 84  ARG A N     
684  C CA    . ARG A 87  ? 0.2693 0.2160 0.2675 0.0682  -0.0275 -0.0114 84  ARG A CA    
685  C C     . ARG A 87  ? 0.2766 0.2334 0.2837 0.0674  -0.0235 -0.0135 84  ARG A C     
686  O O     . ARG A 87  ? 0.2750 0.2401 0.2898 0.0668  -0.0249 -0.0133 84  ARG A O     
687  C CB    . ARG A 87  ? 0.2987 0.2468 0.2955 0.0667  -0.0321 -0.0095 84  ARG A CB    
688  C CG    . ARG A 87  ? 0.4261 0.3650 0.4132 0.0673  -0.0360 -0.0071 84  ARG A CG    
689  C CD    . ARG A 87  ? 0.4902 0.4307 0.4748 0.0656  -0.0401 -0.0058 84  ARG A CD    
690  N NE    . ARG A 87  ? 0.5615 0.4935 0.5348 0.0652  -0.0425 -0.0033 84  ARG A NE    
691  C CZ    . ARG A 87  ? 0.5498 0.4776 0.5139 0.0618  -0.0399 -0.0023 84  ARG A CZ    
692  N NH1   . ARG A 87  ? 0.4997 0.4308 0.4647 0.0587  -0.0352 -0.0036 84  ARG A NH1   
693  N NH2   . ARG A 87  ? 0.5295 0.4505 0.4838 0.0616  -0.0420 0.0004  84  ARG A NH2   
694  N N     . GLY A 88  ? 0.2239 0.1798 0.2296 0.0670  -0.0185 -0.0152 85  GLY A N     
695  C CA    . GLY A 88  ? 0.2348 0.2000 0.2482 0.0666  -0.0142 -0.0171 85  GLY A CA    
696  C C     . GLY A 88  ? 0.2492 0.2188 0.2613 0.0612  -0.0116 -0.0165 85  GLY A C     
697  O O     . GLY A 88  ? 0.2441 0.2219 0.2624 0.0603  -0.0081 -0.0174 85  GLY A O     
698  N N     . LYS A 89  ? 0.1960 0.1605 0.2002 0.0578  -0.0132 -0.0148 86  LYS A N     
699  C CA    . LYS A 89  ? 0.2017 0.1702 0.2053 0.0532  -0.0113 -0.0139 86  LYS A CA    
700  C C     . LYS A 89  ? 0.1858 0.1475 0.1790 0.0499  -0.0103 -0.0128 86  LYS A C     
701  O O     . LYS A 89  ? 0.1956 0.1495 0.1819 0.0507  -0.0118 -0.0121 86  LYS A O     
702  C CB    . LYS A 89  ? 0.2276 0.2002 0.2356 0.0521  -0.0151 -0.0128 86  LYS A CB    
703  C CG    . LYS A 89  ? 0.2169 0.1827 0.2183 0.0527  -0.0197 -0.0116 86  LYS A CG    
704  C CD    . LYS A 89  ? 0.2508 0.2200 0.2558 0.0518  -0.0238 -0.0111 86  LYS A CD    
705  C CE    . LYS A 89  ? 0.2320 0.2034 0.2363 0.0477  -0.0221 -0.0108 86  LYS A CE    
706  N NZ    . LYS A 89  ? 0.2109 0.1759 0.2049 0.0458  -0.0204 -0.0099 86  LYS A NZ    
707  N N     . ALA A 90  ? 0.2071 0.1722 0.1999 0.0462  -0.0077 -0.0123 87  ALA A N     
708  C CA    . ALA A 90  ? 0.2136 0.1740 0.1982 0.0431  -0.0069 -0.0109 87  ALA A CA    
709  C C     . ALA A 90  ? 0.2319 0.1883 0.2125 0.0432  -0.0105 -0.0094 87  ALA A C     
710  O O     . ALA A 90  ? 0.2379 0.1971 0.2225 0.0440  -0.0132 -0.0094 87  ALA A O     
711  C CB    . ALA A 90  ? 0.1905 0.1562 0.1769 0.0395  -0.0042 -0.0102 87  ALA A CB    
712  N N     . ASN A 91  ? 0.1792 0.2038 0.1698 0.0870  0.0080  0.0292  88  ASN A N     
713  C CA    . ASN A 91  ? 0.1996 0.2241 0.1883 0.0835  0.0005  0.0291  88  ASN A CA    
714  C C     . ASN A 91  ? 0.2020 0.2148 0.1793 0.0762  -0.0007 0.0256  88  ASN A C     
715  O O     . ASN A 91  ? 0.2003 0.1986 0.1668 0.0765  0.0023  0.0238  88  ASN A O     
716  C CB    . ASN A 91  ? 0.2232 0.2419 0.2072 0.0908  -0.0005 0.0316  88  ASN A CB    
717  C CG    . ASN A 91  ? 0.2679 0.2864 0.2481 0.0889  -0.0075 0.0325  88  ASN A CG    
718  O OD1   . ASN A 91  ? 0.2379 0.2481 0.2095 0.0832  -0.0088 0.0305  88  ASN A OD1   
719  N ND2   . ASN A 91  ? 0.2924 0.3204 0.2790 0.0943  -0.0119 0.0357  88  ASN A ND2   
720  N N     . LEU A 92  ? 0.1574 0.1765 0.1381 0.0695  -0.0053 0.0244  89  LEU A N     
721  C CA    . LEU A 92  ? 0.1544 0.1649 0.1271 0.0625  -0.0058 0.0215  89  LEU A CA    
722  C C     . LEU A 92  ? 0.1433 0.1455 0.1074 0.0611  -0.0090 0.0216  89  LEU A C     
723  O O     . LEU A 92  ? 0.1804 0.1780 0.1403 0.0553  -0.0099 0.0197  89  LEU A O     
724  C CB    . LEU A 92  ? 0.1634 0.1836 0.1440 0.0562  -0.0076 0.0201  89  LEU A CB    
725  C CG    . LEU A 92  ? 0.2100 0.2388 0.2002 0.0573  -0.0031 0.0212  89  LEU A CG    
726  C CD1   . LEU A 92  ? 0.2113 0.2496 0.2114 0.0508  -0.0052 0.0207  89  LEU A CD1   
727  C CD2   . LEU A 92  ? 0.2433 0.2608 0.2237 0.0588  0.0030  0.0199  89  LEU A CD2   
728  N N     . THR A 93  ? 0.1517 0.1515 0.1130 0.0668  -0.0100 0.0244  90  THR A N     
729  C CA    . THR A 93  ? 0.1533 0.1459 0.1063 0.0666  -0.0121 0.0258  90  THR A CA    
730  C C     . THR A 93  ? 0.1803 0.1596 0.1263 0.0622  -0.0091 0.0247  90  THR A C     
731  O O     . THR A 93  ? 0.1899 0.1669 0.1321 0.0587  -0.0103 0.0249  90  THR A O     
732  C CB    . THR A 93  ? 0.2116 0.2014 0.1616 0.0747  -0.0122 0.0299  90  THR A CB    
733  O OG1   . THR A 93  ? 0.2708 0.2745 0.2287 0.0788  -0.0165 0.0312  90  THR A OG1   
734  C CG2   . THR A 93  ? 0.2304 0.2115 0.1705 0.0754  -0.0128 0.0326  90  THR A CG2   
735  N N     . LYS A 94  ? 0.1765 0.1467 0.1209 0.0625  -0.0055 0.0234  91  LYS A N     
736  C CA    . LYS A 94  ? 0.1963 0.1541 0.1365 0.0580  -0.0040 0.0222  91  LYS A CA    
737  C C     . LYS A 94  ? 0.2043 0.1659 0.1460 0.0508  -0.0055 0.0198  91  LYS A C     
738  O O     . LYS A 94  ? 0.1961 0.1524 0.1363 0.0471  -0.0053 0.0205  91  LYS A O     
739  C CB    . LYS A 94  ? 0.2197 0.1674 0.1576 0.0593  -0.0016 0.0197  91  LYS A CB    
740  C CG    . LYS A 94  ? 0.2182 0.1521 0.1536 0.0549  -0.0014 0.0185  91  LYS A CG    
741  C CD    . LYS A 94  ? 0.2535 0.1774 0.1852 0.0554  -0.0010 0.0140  91  LYS A CD    
742  C CE    . LYS A 94  ? 0.3352 0.2537 0.2637 0.0631  0.0014  0.0144  91  LYS A CE    
743  N NZ    . LYS A 94  ? 0.2689 0.1751 0.1910 0.0641  0.0015  0.0093  91  LYS A NZ    
744  N N     . TYR A 95  ? 0.1696 0.1406 0.1154 0.0490  -0.0064 0.0176  92  TYR A N     
745  C CA    . TYR A 95  ? 0.1521 0.1260 0.0996 0.0427  -0.0076 0.0154  92  TYR A CA    
746  C C     . TYR A 95  ? 0.1809 0.1610 0.1291 0.0410  -0.0103 0.0163  92  TYR A C     
747  O O     . TYR A 95  ? 0.1815 0.1592 0.1285 0.0367  -0.0105 0.0156  92  TYR A O     
748  C CB    . TYR A 95  ? 0.1633 0.1434 0.1144 0.0418  -0.0067 0.0133  92  TYR A CB    
749  C CG    . TYR A 95  ? 0.1484 0.1216 0.0957 0.0458  -0.0037 0.0124  92  TYR A CG    
750  C CD1   . TYR A 95  ? 0.1547 0.1333 0.1048 0.0516  -0.0015 0.0137  92  TYR A CD1   
751  C CD2   . TYR A 95  ? 0.1622 0.1227 0.1032 0.0444  -0.0035 0.0101  92  TYR A CD2   
752  C CE1   . TYR A 95  ? 0.1996 0.1704 0.1445 0.0565  0.0018  0.0127  92  TYR A CE1   
753  C CE2   . TYR A 95  ? 0.1644 0.1166 0.0998 0.0487  -0.0016 0.0084  92  TYR A CE2   
754  C CZ    . TYR A 95  ? 0.1826 0.1394 0.1189 0.0551  0.0016  0.0097  92  TYR A CZ    
755  O OH    . TYR A 95  ? 0.2328 0.1805 0.1621 0.0607  0.0043  0.0078  92  TYR A OH    
756  N N     . ARG A 96  ? 0.1611 0.1486 0.1110 0.0449  -0.0126 0.0178  93  ARG A N     
757  C CA    . ARG A 96  ? 0.1714 0.1629 0.1193 0.0443  -0.0162 0.0180  93  ARG A CA    
758  C C     . ARG A 96  ? 0.2006 0.1825 0.1400 0.0454  -0.0143 0.0205  93  ARG A C     
759  O O     . ARG A 96  ? 0.1977 0.1786 0.1336 0.0431  -0.0148 0.0200  93  ARG A O     
760  C CB    . ARG A 96  ? 0.1569 0.1577 0.1079 0.0489  -0.0205 0.0189  93  ARG A CB    
761  C CG    . ARG A 96  ? 0.1743 0.1867 0.1370 0.0472  -0.0223 0.0172  93  ARG A CG    
762  C CD    . ARG A 96  ? 0.2064 0.2295 0.1749 0.0503  -0.0287 0.0176  93  ARG A CD    
763  N NE    . ARG A 96  ? 0.2431 0.2778 0.2263 0.0481  -0.0293 0.0169  93  ARG A NE    
764  C CZ    . ARG A 96  ? 0.1962 0.2377 0.1886 0.0520  -0.0271 0.0192  93  ARG A CZ    
765  N NH1   . ARG A 96  ? 0.1750 0.2273 0.1820 0.0496  -0.0264 0.0193  93  ARG A NH1   
766  N NH2   . ARG A 96  ? 0.2071 0.2444 0.1948 0.0587  -0.0249 0.0219  93  ARG A NH2   
767  N N     . GLU A 97  ? 0.1968 0.1712 0.1333 0.0492  -0.0114 0.0235  94  GLU A N     
768  C CA    . GLU A 97  ? 0.1922 0.1571 0.1225 0.0504  -0.0084 0.0271  94  GLU A CA    
769  C C     . GLU A 97  ? 0.2076 0.1667 0.1404 0.0443  -0.0055 0.0263  94  GLU A C     
770  O O     . GLU A 97  ? 0.2088 0.1648 0.1386 0.0435  -0.0034 0.0285  94  GLU A O     
771  C CB    . GLU A 97  ? 0.2007 0.1584 0.1289 0.0559  -0.0059 0.0310  94  GLU A CB    
772  C CG    . GLU A 97  ? 0.2255 0.1889 0.1500 0.0629  -0.0090 0.0331  94  GLU A CG    
773  C CD    . GLU A 97  ? 0.3945 0.3508 0.3168 0.0693  -0.0066 0.0374  94  GLU A CD    
774  O OE1   . GLU A 97  ? 0.4699 0.4162 0.3941 0.0680  -0.0027 0.0379  94  GLU A OE1   
775  O OE2   . GLU A 97  ? 0.4038 0.3641 0.3225 0.0759  -0.0093 0.0400  94  GLU A OE2   
776  N N     . ALA A 98  ? 0.1851 0.1431 0.1231 0.0406  -0.0055 0.0232  95  ALA A N     
777  C CA    . ALA A 98  ? 0.1915 0.1453 0.1331 0.0349  -0.0044 0.0220  95  ALA A CA    
778  C C     . ALA A 98  ? 0.1828 0.1430 0.1249 0.0316  -0.0056 0.0204  95  ALA A C     
779  O O     . ALA A 98  ? 0.1817 0.1391 0.1256 0.0286  -0.0038 0.0214  95  ALA A O     
780  C CB    . ALA A 98  ? 0.1873 0.1383 0.1317 0.0328  -0.0055 0.0184  95  ALA A CB    
781  N N     . SER A 99  ? 0.1730 0.1416 0.1148 0.0321  -0.0086 0.0181  96  SER A N     
782  C CA    . SER A 99  ? 0.1672 0.1408 0.1092 0.0293  -0.0102 0.0162  96  SER A CA    
783  C C     . SER A 99  ? 0.1771 0.1482 0.1126 0.0316  -0.0090 0.0186  96  SER A C     
784  O O     . SER A 99  ? 0.1843 0.1540 0.1194 0.0293  -0.0075 0.0184  96  SER A O     
785  C CB    . SER A 99  ? 0.1847 0.1674 0.1293 0.0295  -0.0139 0.0137  96  SER A CB    
786  O OG    . SER A 99  ? 0.2164 0.2025 0.1610 0.0269  -0.0161 0.0116  96  SER A OG    
787  N N     . VAL A 100 ? 0.1622 0.1324 0.0916 0.0370  -0.0093 0.0211  97  VAL A N     
788  C CA    . VAL A 100 ? 0.2122 0.1784 0.1324 0.0408  -0.0074 0.0240  97  VAL A CA    
789  C C     . VAL A 100 ? 0.2073 0.1661 0.1290 0.0392  -0.0009 0.0279  97  VAL A C     
790  O O     . VAL A 100 ? 0.2215 0.1783 0.1387 0.0399  0.0019  0.0292  97  VAL A O     
791  C CB    . VAL A 100 ? 0.2224 0.1879 0.1348 0.0478  -0.0088 0.0269  97  VAL A CB    
792  C CG1   . VAL A 100 ? 0.2468 0.2059 0.1470 0.0529  -0.0053 0.0310  97  VAL A CG1   
793  C CG2   . VAL A 100 ? 0.1980 0.1725 0.1107 0.0493  -0.0163 0.0231  97  VAL A CG2   
794  N N     . GLU A 101 ? 0.1945 0.1489 0.1234 0.0372  0.0015  0.0296  98  GLU A N     
795  C CA    . GLU A 101 ? 0.2320 0.1804 0.1665 0.0347  0.0068  0.0333  98  GLU A CA    
796  C C     . GLU A 101 ? 0.2201 0.1716 0.1592 0.0302  0.0070  0.0311  98  GLU A C     
797  O O     . GLU A 101 ? 0.2220 0.1713 0.1618 0.0305  0.0119  0.0346  98  GLU A O     
798  C CB    . GLU A 101 ? 0.2226 0.1659 0.1661 0.0316  0.0069  0.0334  98  GLU A CB    
799  C CG    . GLU A 101 ? 0.2568 0.1940 0.1977 0.0358  0.0082  0.0365  98  GLU A CG    
800  C CD    . GLU A 101 ? 0.2557 0.1859 0.2050 0.0324  0.0076  0.0354  98  GLU A CD    
801  O OE1   . GLU A 101 ? 0.2587 0.1838 0.2168 0.0285  0.0100  0.0378  98  GLU A OE1   
802  O OE2   . GLU A 101 ? 0.2961 0.2256 0.2436 0.0338  0.0045  0.0322  98  GLU A OE2   
803  N N     . VAL A 102 ? 0.1732 0.1296 0.1160 0.0264  0.0025  0.0260  99  VAL A N     
804  C CA    . VAL A 102 ? 0.1702 0.1290 0.1181 0.0223  0.0024  0.0241  99  VAL A CA    
805  C C     . VAL A 102 ? 0.1811 0.1423 0.1217 0.0244  0.0029  0.0233  99  VAL A C     
806  O O     . VAL A 102 ? 0.2419 0.2020 0.1842 0.0239  0.0065  0.0249  99  VAL A O     
807  C CB    . VAL A 102 ? 0.2076 0.1699 0.1599 0.0184  -0.0021 0.0195  99  VAL A CB    
808  C CG1   . VAL A 102 ? 0.2977 0.2626 0.2539 0.0150  -0.0025 0.0179  99  VAL A CG1   
809  C CG2   . VAL A 102 ? 0.1995 0.1573 0.1573 0.0166  -0.0029 0.0195  99  VAL A CG2   
810  N N     . MET A 103 ? 0.1745 0.1387 0.1075 0.0272  -0.0009 0.0207  100 MET A N     
811  C CA    . MET A 103 ? 0.2105 0.1755 0.1352 0.0293  -0.0020 0.0186  100 MET A CA    
812  C C     . MET A 103 ? 0.2254 0.1847 0.1412 0.0344  0.0035  0.0229  100 MET A C     
813  O O     . MET A 103 ? 0.2128 0.1703 0.1236 0.0357  0.0054  0.0221  100 MET A O     
814  C CB    . MET A 103 ? 0.2443 0.2135 0.1640 0.0314  -0.0084 0.0152  100 MET A CB    
815  C CG    . MET A 103 ? 0.2418 0.2173 0.1707 0.0274  -0.0125 0.0122  100 MET A CG    
816  S SD    . MET A 103 ? 0.2941 0.2722 0.2288 0.0218  -0.0142 0.0081  100 MET A SD    
817  C CE    . MET A 103 ? 0.2835 0.2674 0.2287 0.0181  -0.0160 0.0070  100 MET A CE    
818  N N     . GLU A 104 ? 0.1975 0.1531 0.1109 0.0379  0.0069  0.0279  101 GLU A N     
819  C CA    . GLU A 104 ? 0.2409 0.1906 0.1453 0.0435  0.0136  0.0333  101 GLU A CA    
820  C C     . GLU A 104 ? 0.2409 0.1888 0.1543 0.0410  0.0208  0.0369  101 GLU A C     
821  O O     . GLU A 104 ? 0.2724 0.2172 0.1786 0.0451  0.0264  0.0395  101 GLU A O     
822  C CB    . GLU A 104 ? 0.2377 0.1834 0.1375 0.0482  0.0159  0.0385  101 GLU A CB    
823  C CG    . GLU A 104 ? 0.3045 0.2518 0.1918 0.0533  0.0092  0.0359  101 GLU A CG    
824  C CD    . GLU A 104 ? 0.4861 0.4288 0.3668 0.0594  0.0115  0.0417  101 GLU A CD    
825  O OE1   . GLU A 104 ? 0.4786 0.4161 0.3651 0.0591  0.0187  0.0479  101 GLU A OE1   
826  O OE2   . GLU A 104 ? 0.4751 0.4194 0.3458 0.0644  0.0059  0.0402  101 GLU A OE2   
827  N N     . ILE A 105 ? 0.1922 0.1422 0.1213 0.0347  0.0205  0.0370  102 ILE A N     
828  C CA    . ILE A 105 ? 0.1949 0.1450 0.1359 0.0317  0.0257  0.0401  102 ILE A CA    
829  C C     . ILE A 105 ? 0.2131 0.1661 0.1527 0.0309  0.0247  0.0362  102 ILE A C     
830  O O     . ILE A 105 ? 0.2266 0.1783 0.1665 0.0332  0.0311  0.0394  102 ILE A O     
831  C CB    . ILE A 105 ? 0.1909 0.1420 0.1482 0.0253  0.0233  0.0399  102 ILE A CB    
832  C CG1   . ILE A 105 ? 0.2092 0.1552 0.1691 0.0263  0.0256  0.0445  102 ILE A CG1   
833  C CG2   . ILE A 105 ? 0.1938 0.1471 0.1655 0.0215  0.0262  0.0420  102 ILE A CG2   
834  C CD1   . ILE A 105 ? 0.2228 0.1679 0.1935 0.0209  0.0204  0.0418  102 ILE A CD1   
835  N N     . MET A 106 ? 0.1906 0.1471 0.1287 0.0281  0.0174  0.0297  103 MET A N     
836  C CA    . MET A 106 ? 0.1988 0.1570 0.1361 0.0270  0.0161  0.0260  103 MET A CA    
837  C C     . MET A 106 ? 0.2068 0.1609 0.1294 0.0332  0.0191  0.0258  103 MET A C     
838  O O     . MET A 106 ? 0.2274 0.1803 0.1499 0.0343  0.0226  0.0257  103 MET A O     
839  C CB    . MET A 106 ? 0.2130 0.1751 0.1511 0.0232  0.0083  0.0198  103 MET A CB    
840  C CG    . MET A 106 ? 0.1972 0.1623 0.1480 0.0178  0.0058  0.0196  103 MET A CG    
841  S SD    . MET A 106 ? 0.2836 0.2529 0.2348 0.0143  -0.0011 0.0138  103 MET A SD    
842  C CE    . MET A 106 ? 0.4980 0.4684 0.4415 0.0172  -0.0042 0.0126  103 MET A CE    
843  N N     . SER A 107 ? 0.2316 0.1831 0.1410 0.0379  0.0175  0.0255  104 SER A N     
844  C CA    . SER A 107 ? 0.2652 0.2114 0.1569 0.0448  0.0189  0.0243  104 SER A CA    
845  C C     . SER A 107 ? 0.2696 0.2108 0.1575 0.0502  0.0297  0.0308  104 SER A C     
846  O O     . SER A 107 ? 0.3000 0.2356 0.1725 0.0565  0.0322  0.0298  104 SER A O     
847  C CB    . SER A 107 ? 0.2894 0.2340 0.1676 0.0493  0.0138  0.0231  104 SER A CB    
848  O OG    A SER A 107 ? 0.3622 0.3042 0.2384 0.0531  0.0194  0.0301  104 SER A OG    
849  O OG    B SER A 107 ? 0.3000 0.2500 0.1824 0.0451  0.0043  0.0171  104 SER A OG    
850  N N     . ARG A 108 ? 0.2541 0.1968 0.1559 0.0481  0.0362  0.0376  105 ARG A N     
851  C CA    . ARG A 108 ? 0.2532 0.1927 0.1557 0.0527  0.0477  0.0450  105 ARG A CA    
852  C C     . ARG A 108 ? 0.2984 0.2393 0.2067 0.0518  0.0505  0.0434  105 ARG A C     
853  O O     . ARG A 108 ? 0.3301 0.2673 0.2329 0.0579  0.0596  0.0475  105 ARG A O     
854  C CB    . ARG A 108 ? 0.2868 0.2280 0.2069 0.0495  0.0535  0.0529  105 ARG A CB    
855  C CG    . ARG A 108 ? 0.2648 0.2034 0.1809 0.0507  0.0523  0.0556  105 ARG A CG    
856  C CD    . ARG A 108 ? 0.3761 0.3125 0.3045 0.0511  0.0621  0.0657  105 ARG A CD    
857  N NE    . ARG A 108 ? 0.4074 0.3489 0.3607 0.0433  0.0627  0.0672  105 ARG A NE    
858  C CZ    . ARG A 108 ? 0.3510 0.2940 0.3195 0.0366  0.0578  0.0667  105 ARG A CZ    
859  N NH1   . ARG A 108 ? 0.3452 0.2925 0.3353 0.0300  0.0571  0.0675  105 ARG A NH1   
860  N NH2   . ARG A 108 ? 0.2965 0.2362 0.2579 0.0369  0.0531  0.0650  105 ARG A NH2   
861  N N     . PHE A 109 ? 0.3052 0.2511 0.2245 0.0449  0.0434  0.0381  106 PHE A N     
862  C CA    . PHE A 109 ? 0.3203 0.2681 0.2478 0.0436  0.0455  0.0371  106 PHE A CA    
863  C C     . PHE A 109 ? 0.3254 0.2684 0.2371 0.0470  0.0422  0.0303  106 PHE A C     
864  O O     . PHE A 109 ? 0.3611 0.3014 0.2708 0.0506  0.0476  0.0307  106 PHE A O     
865  C CB    . PHE A 109 ? 0.2490 0.2036 0.1957 0.0351  0.0396  0.0354  106 PHE A CB    
866  C CG    . PHE A 109 ? 0.3041 0.2624 0.2685 0.0315  0.0423  0.0415  106 PHE A CG    
867  C CD1   . PHE A 109 ? 0.2751 0.2326 0.2395 0.0297  0.0397  0.0425  106 PHE A CD1   
868  C CD2   . PHE A 109 ? 0.2599 0.2221 0.2420 0.0298  0.0470  0.0462  106 PHE A CD2   
869  C CE1   . PHE A 109 ? 0.2676 0.2269 0.2485 0.0261  0.0415  0.0475  106 PHE A CE1   
870  C CE2   . PHE A 109 ? 0.2645 0.2299 0.2648 0.0257  0.0482  0.0513  106 PHE A CE2   
871  C CZ    . PHE A 109 ? 0.2840 0.2472 0.2833 0.0237  0.0453  0.0517  106 PHE A CZ    
872  N N     . ALA A 110 ? 0.3450 0.2868 0.2464 0.0458  0.0333  0.0239  107 ALA A N     
873  C CA    . ALA A 110 ? 0.3462 0.2836 0.2357 0.0473  0.0280  0.0165  107 ALA A CA    
874  C C     . ALA A 110 ? 0.3987 0.3357 0.2785 0.0466  0.0185  0.0110  107 ALA A C     
875  O O     . ALA A 110 ? 0.3574 0.2988 0.2417 0.0443  0.0159  0.0129  107 ALA A O     
876  C CB    . ALA A 110 ? 0.3605 0.3012 0.2633 0.0413  0.0251  0.0136  107 ALA A CB    
877  N N     . VAL A 111 ? 0.4520 0.3835 0.3192 0.0487  0.0130  0.0042  108 VAL A N     
878  C CA    . VAL A 111 ? 0.5300 0.4625 0.3917 0.0471  0.0025  -0.0016 108 VAL A CA    
879  C C     . VAL A 111 ? 0.3435 0.2844 0.2234 0.0382  -0.0031 -0.0033 108 VAL A C     
880  O O     . VAL A 111 ? 0.3890 0.3311 0.2792 0.0339  -0.0021 -0.0041 108 VAL A O     
881  C CB    . VAL A 111 ? 0.6771 0.6011 0.5232 0.0506  -0.0031 -0.0093 108 VAL A CB    
882  C CG1   . VAL A 111 ? 0.7034 0.6302 0.5490 0.0475  -0.0152 -0.0154 108 VAL A CG1   
883  C CG2   . VAL A 111 ? 0.7370 0.6512 0.5609 0.0610  0.0025  -0.0080 108 VAL A CG2   
884  N N     . ILE A 112 ? 0.3405 0.2870 0.2239 0.0362  -0.0082 -0.0032 109 ILE A N     
885  C CA    . ILE A 112 ? 0.2710 0.2253 0.1702 0.0289  -0.0122 -0.0040 109 ILE A CA    
886  C C     . ILE A 112 ? 0.2330 0.1906 0.1330 0.0268  -0.0216 -0.0091 109 ILE A C     
887  O O     . ILE A 112 ? 0.2675 0.2232 0.1566 0.0309  -0.0264 -0.0115 109 ILE A O     
888  C CB    . ILE A 112 ? 0.3175 0.2770 0.2259 0.0273  -0.0088 0.0016  109 ILE A CB    
889  C CG1   . ILE A 112 ? 0.3337 0.2947 0.2360 0.0307  -0.0115 0.0027  109 ILE A CG1   
890  C CG2   . ILE A 112 ? 0.3801 0.3371 0.2911 0.0287  -0.0003 0.0069  109 ILE A CG2   
891  C CD1   . ILE A 112 ? 0.3532 0.3188 0.2655 0.0284  -0.0099 0.0066  109 ILE A CD1   
892  N N     . GLU A 113 ? 0.1944 0.1572 0.1079 0.0205  -0.0242 -0.0104 110 GLU A N     
893  C CA    . GLU A 113 ? 0.1858 0.1544 0.1061 0.0174  -0.0318 -0.0136 110 GLU A CA    
894  C C     . GLU A 113 ? 0.1971 0.1738 0.1289 0.0147  -0.0302 -0.0097 110 GLU A C     
895  O O     . GLU A 113 ? 0.1918 0.1703 0.1321 0.0112  -0.0265 -0.0075 110 GLU A O     
896  C CB    . GLU A 113 ? 0.1978 0.1653 0.1254 0.0124  -0.0352 -0.0178 110 GLU A CB    
897  C CG    . GLU A 113 ? 0.2279 0.2026 0.1669 0.0084  -0.0423 -0.0200 110 GLU A CG    
898  C CD    . GLU A 113 ? 0.2954 0.2684 0.2436 0.0029  -0.0452 -0.0234 110 GLU A CD    
899  O OE1   . GLU A 113 ? 0.3319 0.3121 0.2940 -0.0014 -0.0491 -0.0236 110 GLU A OE1   
900  O OE2   . GLU A 113 ? 0.2632 0.2277 0.2059 0.0032  -0.0433 -0.0253 110 GLU A OE2   
901  N N     . ARG A 114 ? 0.1840 0.1650 0.1147 0.0173  -0.0331 -0.0088 111 ARG A N     
902  C CA    . ARG A 114 ? 0.1779 0.1658 0.1183 0.0158  -0.0316 -0.0056 111 ARG A CA    
903  C C     . ARG A 114 ? 0.2235 0.2177 0.1772 0.0107  -0.0344 -0.0071 111 ARG A C     
904  O O     . ARG A 114 ? 0.3050 0.3034 0.2631 0.0099  -0.0406 -0.0099 111 ARG A O     
905  C CB    . ARG A 114 ? 0.1913 0.1820 0.1276 0.0205  -0.0342 -0.0042 111 ARG A CB    
906  C CG    . ARG A 114 ? 0.1889 0.1860 0.1346 0.0200  -0.0325 -0.0012 111 ARG A CG    
907  C CD    . ARG A 114 ? 0.2117 0.2130 0.1555 0.0247  -0.0366 -0.0004 111 ARG A CD    
908  N NE    . ARG A 114 ? 0.2726 0.2766 0.2209 0.0265  -0.0332 0.0033  111 ARG A NE    
909  C CZ    . ARG A 114 ? 0.3364 0.3480 0.2964 0.0249  -0.0334 0.0038  111 ARG A CZ    
910  N NH1   . ARG A 114 ? 0.2808 0.2987 0.2512 0.0208  -0.0364 0.0016  111 ARG A NH1   
911  N NH2   . ARG A 114 ? 0.2843 0.2964 0.2458 0.0277  -0.0299 0.0068  111 ARG A NH2   
912  N N     . ALA A 115 ? 0.1792 0.1743 0.1399 0.0074  -0.0299 -0.0050 112 ALA A N     
913  C CA    . ALA A 115 ? 0.1852 0.1856 0.1581 0.0030  -0.0308 -0.0052 112 ALA A CA    
914  C C     . ALA A 115 ? 0.2567 0.2647 0.2374 0.0035  -0.0294 -0.0024 112 ALA A C     
915  O O     . ALA A 115 ? 0.2810 0.2956 0.2733 0.0011  -0.0306 -0.0020 112 ALA A O     
916  C CB    . ALA A 115 ? 0.2025 0.1989 0.1771 0.0000  -0.0267 -0.0043 112 ALA A CB    
917  N N     . SER A 116 ? 0.1866 0.1932 0.1618 0.0070  -0.0263 0.0000  113 SER A N     
918  C CA    . SER A 116 ? 0.1978 0.2098 0.1779 0.0089  -0.0244 0.0024  113 SER A CA    
919  C C     . SER A 116 ? 0.1738 0.1814 0.1453 0.0132  -0.0226 0.0039  113 SER A C     
920  O O     . SER A 116 ? 0.1949 0.1966 0.1583 0.0143  -0.0227 0.0035  113 SER A O     
921  C CB    . SER A 116 ? 0.2334 0.2460 0.2182 0.0069  -0.0198 0.0044  113 SER A CB    
922  O OG    . SER A 116 ? 0.2705 0.2759 0.2475 0.0075  -0.0167 0.0051  113 SER A OG    
923  N N     . ILE A 117 ? 0.1671 0.1771 0.1407 0.0158  -0.0204 0.0059  114 ILE A N     
924  C CA    . ILE A 117 ? 0.1637 0.1684 0.1302 0.0198  -0.0187 0.0074  114 ILE A CA    
925  C C     . ILE A 117 ? 0.1715 0.1674 0.1321 0.0183  -0.0161 0.0075  114 ILE A C     
926  O O     . ILE A 117 ? 0.1868 0.1771 0.1421 0.0204  -0.0151 0.0088  114 ILE A O     
927  C CB    . ILE A 117 ? 0.1761 0.1836 0.1456 0.0233  -0.0164 0.0090  114 ILE A CB    
928  C CG1   . ILE A 117 ? 0.1710 0.1732 0.1342 0.0280  -0.0158 0.0105  114 ILE A CG1   
929  C CG2   . ILE A 117 ? 0.1849 0.1898 0.1546 0.0219  -0.0125 0.0091  114 ILE A CG2   
930  C CD1   . ILE A 117 ? 0.1930 0.1986 0.1593 0.0328  -0.0143 0.0121  114 ILE A CD1   
931  N N     . ASP A 118 ? 0.1701 0.1649 0.1327 0.0147  -0.0149 0.0067  115 ASP A N     
932  C CA    . ASP A 118 ? 0.1771 0.1647 0.1363 0.0133  -0.0134 0.0070  115 ASP A CA    
933  C C     . ASP A 118 ? 0.1953 0.1819 0.1556 0.0099  -0.0136 0.0062  115 ASP A C     
934  O O     . ASP A 118 ? 0.1928 0.1752 0.1530 0.0083  -0.0128 0.0065  115 ASP A O     
935  C CB    . ASP A 118 ? 0.1775 0.1621 0.1358 0.0138  -0.0120 0.0070  115 ASP A CB    
936  C CG    . ASP A 118 ? 0.1976 0.1837 0.1574 0.0116  -0.0115 0.0065  115 ASP A CG    
937  O OD1   . ASP A 118 ? 0.2067 0.1876 0.1632 0.0114  -0.0114 0.0060  115 ASP A OD1   
938  O OD2   . ASP A 118 ? 0.2320 0.2239 0.1964 0.0101  -0.0115 0.0066  115 ASP A OD2   
939  N N     . GLU A 119 ? 0.1701 0.1598 0.1316 0.0090  -0.0152 0.0051  116 GLU A N     
940  C CA    . GLU A 119 ? 0.2152 0.2025 0.1770 0.0065  -0.0150 0.0043  116 GLU A CA    
941  C C     . GLU A 119 ? 0.1636 0.1504 0.1224 0.0071  -0.0167 0.0026  116 GLU A C     
942  O O     . GLU A 119 ? 0.1911 0.1811 0.1494 0.0084  -0.0197 0.0013  116 GLU A O     
943  C CB    . GLU A 119 ? 0.3615 0.3505 0.3279 0.0036  -0.0147 0.0041  116 GLU A CB    
944  C CG    . GLU A 119 ? 0.3244 0.3190 0.2961 0.0024  -0.0162 0.0033  116 GLU A CG    
945  C CD    . GLU A 119 ? 0.4987 0.4950 0.4750 0.0006  -0.0141 0.0049  116 GLU A CD    
946  O OE1   . GLU A 119 ? 0.4441 0.4381 0.4219 -0.0018 -0.0137 0.0050  116 GLU A OE1   
947  O OE2   . GLU A 119 ? 0.5559 0.5552 0.5334 0.0023  -0.0124 0.0064  116 GLU A OE2   
948  N N     . ALA A 120 ? 0.1595 0.1419 0.1159 0.0068  -0.0151 0.0026  117 ALA A N     
949  C CA    . ALA A 120 ? 0.1568 0.1365 0.1074 0.0086  -0.0161 0.0007  117 ALA A CA    
950  C C     . ALA A 120 ? 0.1647 0.1406 0.1160 0.0071  -0.0144 -0.0001 117 ALA A C     
951  O O     . ALA A 120 ? 0.1862 0.1611 0.1413 0.0061  -0.0114 0.0023  117 ALA A O     
952  C CB    . ALA A 120 ? 0.2347 0.2111 0.1775 0.0130  -0.0139 0.0026  117 ALA A CB    
953  N N     . TYR A 121 ? 0.1622 0.1359 0.1104 0.0071  -0.0169 -0.0035 118 TYR A N     
954  C CA    . TYR A 121 ? 0.1781 0.1465 0.1248 0.0071  -0.0150 -0.0045 118 TYR A CA    
955  C C     . TYR A 121 ? 0.2242 0.1873 0.1611 0.0122  -0.0117 -0.0040 118 TYR A C     
956  O O     . TYR A 121 ? 0.2269 0.1889 0.1552 0.0157  -0.0129 -0.0047 118 TYR A O     
957  C CB    . TYR A 121 ? 0.1495 0.1160 0.0975 0.0047  -0.0194 -0.0089 118 TYR A CB    
958  C CG    . TYR A 121 ? 0.1744 0.1458 0.1335 -0.0001 -0.0208 -0.0081 118 TYR A CG    
959  C CD1   . TYR A 121 ? 0.1651 0.1426 0.1293 -0.0017 -0.0242 -0.0086 118 TYR A CD1   
960  C CD2   . TYR A 121 ? 0.2108 0.1808 0.1752 -0.0023 -0.0181 -0.0061 118 TYR A CD2   
961  C CE1   . TYR A 121 ? 0.2101 0.1921 0.1845 -0.0055 -0.0239 -0.0068 118 TYR A CE1   
962  C CE2   . TYR A 121 ? 0.2083 0.1820 0.1812 -0.0058 -0.0183 -0.0045 118 TYR A CE2   
963  C CZ    . TYR A 121 ? 0.2355 0.2151 0.2134 -0.0073 -0.0207 -0.0047 118 TYR A CZ    
964  O OH    . TYR A 121 ? 0.2402 0.2236 0.2266 -0.0102 -0.0194 -0.0022 118 TYR A OH    
965  N N     . VAL A 122 ? 0.1774 0.1372 0.1154 0.0131  -0.0071 -0.0023 119 VAL A N     
966  C CA    . VAL A 122 ? 0.2394 0.1943 0.1697 0.0184  -0.0019 -0.0007 119 VAL A CA    
967  C C     . VAL A 122 ? 0.2698 0.2185 0.1969 0.0198  -0.0006 -0.0034 119 VAL A C     
968  O O     . VAL A 122 ? 0.2291 0.1789 0.1652 0.0168  -0.0002 -0.0027 119 VAL A O     
969  C CB    . VAL A 122 ? 0.2611 0.2192 0.2002 0.0183  0.0037  0.0053  119 VAL A CB    
970  C CG1   . VAL A 122 ? 0.3881 0.3427 0.3206 0.0240  0.0102  0.0087  119 VAL A CG1   
971  C CG2   . VAL A 122 ? 0.3036 0.2672 0.2494 0.0149  0.0011  0.0070  119 VAL A CG2   
972  N N     . ASP A 123 ? 0.3028 0.2441 0.2161 0.0250  0.0000  -0.0064 120 ASP A N     
973  C CA    . ASP A 123 ? 0.3177 0.2515 0.2269 0.0278  0.0028  -0.0085 120 ASP A CA    
974  C C     . ASP A 123 ? 0.3272 0.2596 0.2348 0.0334  0.0123  -0.0032 120 ASP A C     
975  O O     . ASP A 123 ? 0.3618 0.2906 0.2573 0.0394  0.0161  -0.0020 120 ASP A O     
976  C CB    . ASP A 123 ? 0.4313 0.3558 0.3258 0.0305  -0.0023 -0.0159 120 ASP A CB    
977  C CG    . ASP A 123 ? 0.4974 0.4127 0.3882 0.0330  0.0002  -0.0188 120 ASP A CG    
978  O OD1   . ASP A 123 ? 0.4046 0.3182 0.2950 0.0376  0.0086  -0.0147 120 ASP A OD1   
979  O OD2   . ASP A 123 ? 0.5149 0.4246 0.4047 0.0303  -0.0059 -0.0248 120 ASP A OD2   
980  N N     . LEU A 124 ? 0.2468 0.1825 0.1675 0.0317  0.0162  0.0005  121 LEU A N     
981  C CA    . LEU A 124 ? 0.2182 0.1555 0.1438 0.0358  0.0252  0.0068  121 LEU A CA    
982  C C     . LEU A 124 ? 0.2328 0.1629 0.1528 0.0418  0.0311  0.0062  121 LEU A C     
983  O O     . LEU A 124 ? 0.2488 0.1810 0.1754 0.0456  0.0395  0.0120  121 LEU A O     
984  C CB    . LEU A 124 ? 0.2467 0.1932 0.1920 0.0306  0.0252  0.0117  121 LEU A CB    
985  C CG    . LEU A 124 ? 0.2664 0.2194 0.2176 0.0258  0.0211  0.0132  121 LEU A CG    
986  C CD1   . LEU A 124 ? 0.3205 0.2802 0.2879 0.0206  0.0184  0.0157  121 LEU A CD1   
987  C CD2   . LEU A 124 ? 0.3076 0.2610 0.2563 0.0294  0.0266  0.0178  121 LEU A CD2   
988  N N     . THR A 125 ? 0.2313 0.1527 0.1404 0.0429  0.0270  -0.0006 122 THR A N     
989  C CA    . THR A 125 ? 0.2663 0.1788 0.1691 0.0488  0.0323  -0.0021 122 THR A CA    
990  C C     . THR A 125 ? 0.2718 0.1807 0.1650 0.0581  0.0428  0.0020  122 THR A C     
991  O O     . THR A 125 ? 0.2897 0.1994 0.1902 0.0622  0.0511  0.0066  122 THR A O     
992  C CB    . THR A 125 ? 0.2852 0.1864 0.1745 0.0490  0.0254  -0.0111 122 THR A CB    
993  O OG1   . THR A 125 ? 0.2731 0.1785 0.1731 0.0403  0.0169  -0.0136 122 THR A OG1   
994  C CG2   . THR A 125 ? 0.3150 0.2060 0.1995 0.0547  0.0305  -0.0130 122 THR A CG2   
995  N N     . SER A 126 ? 0.3064 0.2115 0.1834 0.0621  0.0428  0.0009  123 SER A N     
996  C CA    . SER A 126 ? 0.3208 0.2213 0.1858 0.0720  0.0537  0.0054  123 SER A CA    
997  C C     . SER A 126 ? 0.3306 0.2420 0.2138 0.0715  0.0628  0.0160  123 SER A C     
998  O O     . SER A 126 ? 0.3423 0.2531 0.2276 0.0782  0.0742  0.0218  123 SER A O     
999  C CB    . SER A 126 ? 0.3893 0.2821 0.2305 0.0769  0.0507  0.0016  123 SER A CB    
1000 O OG    A SER A 126 ? 0.4406 0.3216 0.2640 0.0788  0.0429  -0.0085 123 SER A OG    
1001 O OG    B SER A 126 ? 0.3868 0.2879 0.2341 0.0713  0.0454  0.0036  123 SER A OG    
1002 N N     . ALA A 127 ? 0.3197 0.2410 0.2170 0.0638  0.0578  0.0186  124 ALA A N     
1003 C CA    . ALA A 127 ? 0.2856 0.2167 0.2023 0.0619  0.0644  0.0278  124 ALA A CA    
1004 C C     . ALA A 127 ? 0.2754 0.2124 0.2123 0.0606  0.0682  0.0316  124 ALA A C     
1005 O O     . ALA A 127 ? 0.3142 0.2563 0.2643 0.0633  0.0776  0.0396  124 ALA A O     
1006 C CB    . ALA A 127 ? 0.2876 0.2262 0.2143 0.0537  0.0568  0.0283  124 ALA A CB    
1007 N N     . VAL A 128 ? 0.2526 0.1891 0.1930 0.0564  0.0609  0.0262  125 VAL A N     
1008 C CA    . VAL A 128 ? 0.2500 0.1914 0.2080 0.0559  0.0634  0.0293  125 VAL A CA    
1009 C C     . VAL A 128 ? 0.2956 0.2312 0.2483 0.0655  0.0745  0.0318  125 VAL A C     
1010 O O     . VAL A 128 ? 0.3009 0.2436 0.2713 0.0676  0.0819  0.0390  125 VAL A O     
1011 C CB    . VAL A 128 ? 0.2593 0.1994 0.2192 0.0503  0.0538  0.0234  125 VAL A CB    
1012 C CG1   . VAL A 128 ? 0.2748 0.2163 0.2469 0.0526  0.0572  0.0259  125 VAL A CG1   
1013 C CG2   . VAL A 128 ? 0.2199 0.1680 0.1903 0.0415  0.0450  0.0233  125 VAL A CG2   
1014 N N     . GLN A 129 ? 0.3002 0.2230 0.2292 0.0717  0.0754  0.0258  126 GLN A N     
1015 C CA    . GLN A 129 ? 0.4085 0.3236 0.3281 0.0824  0.0867  0.0275  126 GLN A CA    
1016 C C     . GLN A 129 ? 0.4197 0.3403 0.3457 0.0880  0.0994  0.0374  126 GLN A C     
1017 O O     . GLN A 129 ? 0.4118 0.3359 0.3498 0.0933  0.1097  0.0438  126 GLN A O     
1018 C CB    . GLN A 129 ? 0.5406 0.4393 0.4297 0.0886  0.0846  0.0186  126 GLN A CB    
1019 C CG    . GLN A 129 ? 0.6663 0.5581 0.5500 0.0833  0.0726  0.0089  126 GLN A CG    
1020 C CD    . GLN A 129 ? 0.8740 0.7648 0.7694 0.0837  0.0743  0.0090  126 GLN A CD    
1021 O OE1   . GLN A 129 ? 0.9344 0.8319 0.8449 0.0872  0.0833  0.0165  126 GLN A OE1   
1022 N NE2   . GLN A 129 ? 0.9274 0.8100 0.8172 0.0802  0.0655  0.0010  126 GLN A NE2   
1023 N N     . GLU A 130 ? 0.4253 0.3470 0.3446 0.0869  0.0990  0.0392  127 GLU A N     
1024 C CA    . GLU A 130 ? 0.5249 0.4512 0.4505 0.0917  0.1114  0.0494  127 GLU A CA    
1025 C C     . GLU A 130 ? 0.4750 0.4163 0.4351 0.0863  0.1147  0.0582  127 GLU A C     
1026 O O     . GLU A 130 ? 0.4764 0.4217 0.4482 0.0921  0.1274  0.0669  127 GLU A O     
1027 C CB    . GLU A 130 ? 0.5843 0.5093 0.4986 0.0900  0.1085  0.0498  127 GLU A CB    
1028 C CG    . GLU A 130 ? 0.7878 0.6985 0.6679 0.0974  0.1067  0.0430  127 GLU A CG    
1029 C CD    . GLU A 130 ? 0.9827 0.8926 0.8526 0.0985  0.1073  0.0463  127 GLU A CD    
1030 O OE1   . GLU A 130 ? 0.9970 0.9135 0.8810 0.0990  0.1169  0.0566  127 GLU A OE1   
1031 O OE2   . GLU A 130 ? 1.0650 0.9680 0.9143 0.0986  0.0981  0.0390  127 GLU A OE2   
1032 N N     . ARG A 131 ? 0.3185 0.2679 0.2948 0.0755  0.1031  0.0561  128 ARG A N     
1033 C CA    . ARG A 131 ? 0.3268 0.2900 0.3352 0.0695  0.1032  0.0631  128 ARG A CA    
1034 C C     . ARG A 131 ? 0.3662 0.3336 0.3897 0.0727  0.1076  0.0658  128 ARG A C     
1035 O O     . ARG A 131 ? 0.3916 0.3692 0.4400 0.0731  0.1144  0.0745  128 ARG A O     
1036 C CB    . ARG A 131 ? 0.3112 0.2798 0.3286 0.0584  0.0889  0.0589  128 ARG A CB    
1037 C CG    A ARG A 131 ? 0.3374 0.3190 0.3863 0.0521  0.0867  0.0649  128 ARG A CG    
1038 C CG    B ARG A 131 ? 0.3306 0.3119 0.3787 0.0518  0.0867  0.0650  128 ARG A CG    
1039 C CD    A ARG A 131 ? 0.3067 0.2935 0.3700 0.0530  0.0961  0.0743  128 ARG A CD    
1040 C CD    B ARG A 131 ? 0.3031 0.2885 0.3626 0.0524  0.0951  0.0736  128 ARG A CD    
1041 N NE    A ARG A 131 ? 0.2022 0.1839 0.2517 0.0511  0.0941  0.0730  128 ARG A NE    
1042 N NE    B ARG A 131 ? 0.2851 0.2815 0.3735 0.0442  0.0895  0.0775  128 ARG A NE    
1043 C CZ    A ARG A 131 ? 0.2847 0.2691 0.3405 0.0427  0.0840  0.0705  128 ARG A CZ    
1044 C CZ    B ARG A 131 ? 0.2636 0.2608 0.3543 0.0364  0.0794  0.0743  128 ARG A CZ    
1045 N NH1   A ARG A 131 ? 0.2327 0.2244 0.3073 0.0357  0.0748  0.0691  128 ARG A NH1   
1046 N NH1   B ARG A 131 ? 0.2725 0.2783 0.3888 0.0296  0.0737  0.0772  128 ARG A NH1   
1047 N NH2   A ARG A 131 ? 0.3872 0.3665 0.4297 0.0422  0.0831  0.0696  128 ARG A NH2   
1048 N NH2   B ARG A 131 ? 0.2468 0.2359 0.3144 0.0358  0.0746  0.0681  128 ARG A NH2   
1049 N N     . LEU A 132 ? 0.3216 0.2812 0.3316 0.0752  0.1038  0.0586  129 LEU A N     
1050 C CA    . LEU A 132 ? 0.2975 0.2592 0.3191 0.0796  0.1083  0.0608  129 LEU A CA    
1051 C C     . LEU A 132 ? 0.4436 0.4043 0.4660 0.0906  0.1250  0.0683  129 LEU A C     
1052 O O     . LEU A 132 ? 0.5163 0.4850 0.5600 0.0935  0.1313  0.0747  129 LEU A O     
1053 C CB    . LEU A 132 ? 0.3574 0.3079 0.3614 0.0807  0.1017  0.0515  129 LEU A CB    
1054 C CG    . LEU A 132 ? 0.3476 0.3028 0.3616 0.0709  0.0878  0.0474  129 LEU A CG    
1055 C CD1   . LEU A 132 ? 0.3883 0.3310 0.3828 0.0708  0.0810  0.0380  129 LEU A CD1   
1056 C CD2   . LEU A 132 ? 0.3525 0.3196 0.3947 0.0696  0.0879  0.0538  129 LEU A CD2   
1057 N N     . GLN A 133 ? 0.5239 0.4748 0.5227 0.0974  0.1325  0.0679  130 GLN A N     
1058 C CA    . GLN A 133 ? 0.7085 0.6568 0.7039 0.1093  0.1498  0.0753  130 GLN A CA    
1059 C C     . GLN A 133 ? 0.7805 0.7431 0.8044 0.1078  0.1591  0.0881  130 GLN A C     
1060 O O     . GLN A 133 ? 0.8646 0.8316 0.9014 0.1155  0.1732  0.0968  130 GLN A O     
1061 C CB    . GLN A 133 ? 0.8522 0.7842 0.8105 0.1179  0.1543  0.0707  130 GLN A CB    
1062 C CG    . GLN A 133 ? 1.0043 0.9209 0.9354 0.1204  0.1462  0.0582  130 GLN A CG    
1063 C CD    . GLN A 133 ? 1.1602 1.0605 1.0542 0.1288  0.1483  0.0528  130 GLN A CD    
1064 O OE1   . GLN A 133 ? 1.2395 1.1394 1.1260 0.1341  0.1576  0.0592  130 GLN A OE1   
1065 N NE2   . GLN A 133 ? 1.1850 1.0713 1.0556 0.1300  0.1394  0.0411  130 GLN A NE2   
1066 N N     . LYS A 134 ? 0.7951 0.7645 0.8298 0.0981  0.1513  0.0892  131 LYS A N     
1067 C CA    . LYS A 134 ? 0.8517 0.8344 0.9166 0.0947  0.1579  0.1007  131 LYS A CA    
1068 C C     . LYS A 134 ? 0.8231 0.8205 0.9240 0.0889  0.1536  0.1044  131 LYS A C     
1069 O O     . LYS A 134 ? 0.8127 0.8207 0.9402 0.0914  0.1641  0.1149  131 LYS A O     
1070 C CB    . LYS A 134 ? 0.8907 0.8744 0.9556 0.0859  0.1499  0.0999  131 LYS A CB    
1071 C CG    . LYS A 134 ? 0.9575 0.9288 0.9910 0.0918  0.1547  0.0985  131 LYS A CG    
1072 C CD    . LYS A 134 ? 0.9797 0.9540 1.0200 0.0841  0.1498  0.1010  131 LYS A CD    
1073 C CE    . LYS A 134 ? 0.9764 0.9556 1.0267 0.0719  0.1319  0.0934  131 LYS A CE    
1074 N NZ    . LYS A 134 ? 0.9542 0.9360 1.0129 0.0645  0.1272  0.0957  131 LYS A NZ    
1075 N N     . LEU A 135 ? 0.7737 0.7720 0.8755 0.0816  0.1382  0.0962  132 LEU A N     
1076 C CA    . LEU A 135 ? 0.7851 0.7962 0.9174 0.0766  0.1318  0.0986  132 LEU A CA    
1077 C C     . LEU A 135 ? 0.8635 0.8786 1.0083 0.0859  0.1437  0.1048  132 LEU A C     
1078 O O     . LEU A 135 ? 0.8318 0.8613 1.0101 0.0842  0.1454  0.1126  132 LEU A O     
1079 C CB    . LEU A 135 ? 0.7325 0.7404 0.8560 0.0700  0.1152  0.0884  132 LEU A CB    
1080 C CG    . LEU A 135 ? 0.6850 0.6975 0.8162 0.0584  0.1009  0.0853  132 LEU A CG    
1081 C CD1   . LEU A 135 ? 0.7014 0.7101 0.8226 0.0565  0.1036  0.0862  132 LEU A CD1   
1082 C CD2   . LEU A 135 ? 0.6217 0.6280 0.7369 0.0542  0.0874  0.0753  132 LEU A CD2   
1083 N N     . GLN A 136 ? 0.9675 0.9697 1.0856 0.0960  0.1516  0.1011  133 GLN A N     
1084 C CA    . GLN A 136 ? 1.0456 1.0489 1.1709 0.1065  0.1638  0.1061  133 GLN A CA    
1085 C C     . GLN A 136 ? 0.9882 1.0029 1.1407 0.1030  0.1561  0.1073  133 GLN A C     
1086 O O     . GLN A 136 ? 0.9863 1.0155 1.1712 0.1042  0.1622  0.1170  133 GLN A O     
1087 C CB    . GLN A 136 ? 1.1556 1.1656 1.2956 0.1137  0.1823  0.1186  133 GLN A CB    
1088 C CG    . GLN A 136 ? 1.2682 1.2641 1.3760 0.1218  0.1934  0.1183  133 GLN A CG    
1089 C CD    . GLN A 136 ? 1.3538 1.3539 1.4724 0.1323  0.2148  0.1313  133 GLN A CD    
1090 O OE1   . GLN A 136 ? 1.3899 1.3782 1.4815 0.1415  0.2264  0.1325  133 GLN A OE1   
1091 N NE2   . GLN A 136 ? 1.3835 1.4008 1.5419 0.1314  0.2203  0.1414  133 GLN A NE2   
1092 N N     . GLY A 137 ? 0.9284 0.9366 1.0681 0.0987  0.1425  0.0978  134 GLY A N     
1093 C CA    . GLY A 137 ? 0.8691 0.8853 1.0289 0.0967  0.1347  0.0982  134 GLY A CA    
1094 C C     . GLY A 137 ? 0.7833 0.8171 0.9768 0.0871  0.1249  0.1032  134 GLY A C     
1095 O O     . GLY A 137 ? 0.7937 0.8361 1.0070 0.0858  0.1182  0.1049  134 GLY A O     
1096 N N     . GLN A 138 ? 0.6953 0.7335 0.8947 0.0805  0.1236  0.1053  135 GLN A N     
1097 C CA    . GLN A 138 ? 0.6982 0.7510 0.9280 0.0708  0.1131  0.1089  135 GLN A CA    
1098 C C     . GLN A 138 ? 0.5803 0.6298 0.8001 0.0621  0.0946  0.0998  135 GLN A C     
1099 O O     . GLN A 138 ? 0.5383 0.5758 0.7300 0.0597  0.0904  0.0920  135 GLN A O     
1100 C CB    . GLN A 138 ? 0.8009 0.8576 1.0398 0.0669  0.1185  0.1142  135 GLN A CB    
1101 C CG    . GLN A 138 ? 0.9100 0.9815 1.1838 0.0573  0.1089  0.1186  135 GLN A CG    
1102 C CD    . GLN A 138 ? 0.9947 1.0682 1.2776 0.0535  0.1149  0.1241  135 GLN A CD    
1103 O OE1   . GLN A 138 ? 1.0140 1.0989 1.3278 0.0461  0.1094  0.1287  135 GLN A OE1   
1104 N NE2   . GLN A 138 ? 1.0217 1.0836 1.2779 0.0586  0.1258  0.1236  135 GLN A NE2   
1105 N N     . PRO A 139 ? 0.5107 0.5708 0.7533 0.0578  0.0834  0.1011  136 PRO A N     
1106 C CA    . PRO A 139 ? 0.4642 0.5216 0.6982 0.0506  0.0663  0.0935  136 PRO A CA    
1107 C C     . PRO A 139 ? 0.3790 0.4333 0.6044 0.0421  0.0589  0.0893  136 PRO A C     
1108 O O     . PRO A 139 ? 0.3709 0.4288 0.6063 0.0402  0.0648  0.0936  136 PRO A O     
1109 C CB    . PRO A 139 ? 0.5036 0.5757 0.7696 0.0485  0.0574  0.0982  136 PRO A CB    
1110 C CG    . PRO A 139 ? 0.5334 0.6180 0.8298 0.0511  0.0685  0.1083  136 PRO A CG    
1111 C CD    . PRO A 139 ? 0.5545 0.6304 0.8336 0.0601  0.0866  0.1103  136 PRO A CD    
1112 N N     . ILE A 140 ? 0.3972 0.4445 0.6042 0.0375  0.0470  0.0814  137 ILE A N     
1113 C CA    . ILE A 140 ? 0.3539 0.3976 0.5516 0.0300  0.0395  0.0769  137 ILE A CA    
1114 C C     . ILE A 140 ? 0.2835 0.3349 0.4988 0.0231  0.0248  0.0763  137 ILE A C     
1115 O O     . ILE A 140 ? 0.2946 0.3466 0.5085 0.0230  0.0154  0.0737  137 ILE A O     
1116 C CB    . ILE A 140 ? 0.3372 0.3676 0.5020 0.0297  0.0366  0.0685  137 ILE A CB    
1117 C CG1   . ILE A 140 ? 0.4865 0.5080 0.6327 0.0364  0.0495  0.0681  137 ILE A CG1   
1118 C CG2   . ILE A 140 ? 0.3118 0.3393 0.4683 0.0226  0.0285  0.0641  137 ILE A CG2   
1119 C CD1   . ILE A 140 ? 0.5339 0.5430 0.6510 0.0364  0.0465  0.0600  137 ILE A CD1   
1120 N N     . SER A 141 ? 0.2790 0.3356 0.5103 0.0177  0.0229  0.0787  138 SER A N     
1121 C CA    . SER A 141 ? 0.2607 0.3238 0.5097 0.0111  0.0083  0.0777  138 SER A CA    
1122 C C     . SER A 141 ? 0.2111 0.2650 0.4373 0.0064  -0.0035 0.0690  138 SER A C     
1123 O O     . SER A 141 ? 0.2066 0.2513 0.4110 0.0059  0.0004  0.0653  138 SER A O     
1124 C CB    . SER A 141 ? 0.3018 0.3725 0.5777 0.0067  0.0109  0.0834  138 SER A CB    
1125 O OG    . SER A 141 ? 0.3666 0.4385 0.6516 -0.0010 -0.0041 0.0797  138 SER A OG    
1126 N N     . ALA A 142 ? 0.2166 0.2730 0.4477 0.0037  -0.0178 0.0661  139 ALA A N     
1127 C CA    . ALA A 142 ? 0.2372 0.2852 0.4482 -0.0001 -0.0290 0.0585  139 ALA A CA    
1128 C C     . ALA A 142 ? 0.1880 0.2323 0.3989 -0.0055 -0.0296 0.0567  139 ALA A C     
1129 O O     . ALA A 142 ? 0.2093 0.2444 0.3980 -0.0071 -0.0329 0.0508  139 ALA A O     
1130 C CB    . ALA A 142 ? 0.2570 0.3088 0.4756 -0.0014 -0.0445 0.0566  139 ALA A CB    
1131 N N     . ASP A 143 ? 0.1772 0.2287 0.4139 -0.0081 -0.0259 0.0622  140 ASP A N     
1132 C CA    . ASP A 143 ? 0.1700 0.2175 0.4095 -0.0132 -0.0260 0.0614  140 ASP A CA    
1133 C C     . ASP A 143 ? 0.2282 0.2670 0.4445 -0.0109 -0.0144 0.0606  140 ASP A C     
1134 O O     . ASP A 143 ? 0.2299 0.2625 0.4401 -0.0142 -0.0153 0.0585  140 ASP A O     
1135 C CB    . ASP A 143 ? 0.2002 0.2575 0.4749 -0.0163 -0.0226 0.0690  140 ASP A CB    
1136 C CG    . ASP A 143 ? 0.4214 0.4882 0.7225 -0.0196 -0.0363 0.0695  140 ASP A CG    
1137 O OD1   . ASP A 143 ? 0.4627 0.5258 0.7519 -0.0207 -0.0505 0.0626  140 ASP A OD1   
1138 O OD2   . ASP A 143 ? 0.5084 0.5863 0.8423 -0.0209 -0.0328 0.0770  140 ASP A OD2   
1139 N N     . LEU A 144 ? 0.2178 0.2554 0.4209 -0.0048 -0.0043 0.0620  141 LEU A N     
1140 C CA    . LEU A 144 ? 0.2048 0.2340 0.3849 -0.0019 0.0053  0.0607  141 LEU A CA    
1141 C C     . LEU A 144 ? 0.1638 0.1842 0.3163 -0.0022 -0.0012 0.0527  141 LEU A C     
1142 O O     . LEU A 144 ? 0.1911 0.2047 0.3244 -0.0007 0.0038  0.0505  141 LEU A O     
1143 C CB    . LEU A 144 ? 0.1856 0.2159 0.3628 0.0051  0.0186  0.0652  141 LEU A CB    
1144 C CG    . LEU A 144 ? 0.2277 0.2661 0.4301 0.0068  0.0289  0.0744  141 LEU A CG    
1145 C CD1   . LEU A 144 ? 0.2993 0.3362 0.4929 0.0153  0.0428  0.0778  141 LEU A CD1   
1146 C CD2   . LEU A 144 ? 0.2861 0.3228 0.4947 0.0033  0.0325  0.0774  141 LEU A CD2   
1147 N N     . LEU A 145 ? 0.1608 0.1818 0.3121 -0.0039 -0.0125 0.0489  142 LEU A N     
1148 C CA    . LEU A 145 ? 0.1611 0.1746 0.2881 -0.0036 -0.0178 0.0424  142 LEU A CA    
1149 C C     . LEU A 145 ? 0.1671 0.1788 0.2938 -0.0077 -0.0310 0.0381  142 LEU A C     
1150 O O     . LEU A 145 ? 0.1754 0.1859 0.2946 -0.0068 -0.0385 0.0354  142 LEU A O     
1151 C CB    . LEU A 145 ? 0.1847 0.1986 0.3052 0.0006  -0.0166 0.0425  142 LEU A CB    
1152 C CG    . LEU A 145 ? 0.1521 0.1646 0.2676 0.0054  -0.0042 0.0450  142 LEU A CG    
1153 C CD1   . LEU A 145 ? 0.1624 0.1762 0.2789 0.0098  -0.0027 0.0464  142 LEU A CD1   
1154 C CD2   . LEU A 145 ? 0.2121 0.2163 0.3048 0.0058  -0.0006 0.0408  142 LEU A CD2   
1155 N N     . PRO A 146 ? 0.1907 0.2009 0.3241 -0.0117 -0.0336 0.0375  143 PRO A N     
1156 C CA    . PRO A 146 ? 0.2192 0.2267 0.3542 -0.0153 -0.0467 0.0331  143 PRO A CA    
1157 C C     . PRO A 146 ? 0.2233 0.2220 0.3322 -0.0144 -0.0519 0.0266  143 PRO A C     
1158 O O     . PRO A 146 ? 0.2079 0.2034 0.3142 -0.0158 -0.0631 0.0225  143 PRO A O     
1159 C CB    . PRO A 146 ? 0.2023 0.2088 0.3508 -0.0195 -0.0455 0.0346  143 PRO A CB    
1160 C CG    . PRO A 146 ? 0.1848 0.1894 0.3250 -0.0171 -0.0320 0.0376  143 PRO A CG    
1161 C CD    . PRO A 146 ? 0.1690 0.1786 0.3080 -0.0125 -0.0243 0.0410  143 PRO A CD    
1162 N N     . SER A 147 ? 0.1919 0.1868 0.2824 -0.0117 -0.0442 0.0257  144 SER A N     
1163 C CA    . SER A 147 ? 0.1838 0.1716 0.2520 -0.0106 -0.0476 0.0206  144 SER A CA    
1164 C C     . SER A 147 ? 0.1506 0.1380 0.2051 -0.0071 -0.0431 0.0207  144 SER A C     
1165 O O     . SER A 147 ? 0.1666 0.1491 0.2039 -0.0059 -0.0423 0.0179  144 SER A O     
1166 C CB    . SER A 147 ? 0.1931 0.1753 0.2526 -0.0117 -0.0445 0.0184  144 SER A CB    
1167 O OG    . SER A 147 ? 0.2086 0.1921 0.2659 -0.0102 -0.0340 0.0212  144 SER A OG    
1168 N N     . THR A 148 ? 0.1733 0.1657 0.2368 -0.0053 -0.0403 0.0243  145 THR A N     
1169 C CA    . THR A 148 ? 0.1334 0.1246 0.1868 -0.0023 -0.0354 0.0249  145 THR A CA    
1170 C C     . THR A 148 ? 0.1381 0.1287 0.1875 -0.0004 -0.0419 0.0248  145 THR A C     
1171 O O     . THR A 148 ? 0.1573 0.1521 0.2190 -0.0002 -0.0482 0.0265  145 THR A O     
1172 C CB    . THR A 148 ? 0.1673 0.1626 0.2312 -0.0003 -0.0269 0.0289  145 THR A CB    
1173 O OG1   . THR A 148 ? 0.1562 0.1504 0.2189 -0.0009 -0.0200 0.0291  145 THR A OG1   
1174 C CG2   . THR A 148 ? 0.1549 0.1476 0.2097 0.0029  -0.0228 0.0291  145 THR A CG2   
1175 N N     . TYR A 149 ? 0.1517 0.1373 0.1847 0.0012  -0.0403 0.0232  146 TYR A N     
1176 C CA    . TYR A 149 ? 0.1369 0.1206 0.1634 0.0039  -0.0436 0.0244  146 TYR A CA    
1177 C C     . TYR A 149 ? 0.1699 0.1532 0.1966 0.0059  -0.0361 0.0268  146 TYR A C     
1178 O O     . TYR A 149 ? 0.1595 0.1408 0.1819 0.0051  -0.0293 0.0257  146 TYR A O     
1179 C CB    . TYR A 149 ? 0.1539 0.1315 0.1621 0.0046  -0.0454 0.0219  146 TYR A CB    
1180 C CG    . TYR A 149 ? 0.1856 0.1611 0.1893 0.0044  -0.0544 0.0192  146 TYR A CG    
1181 C CD1   . TYR A 149 ? 0.2115 0.1848 0.2092 0.0074  -0.0621 0.0196  146 TYR A CD1   
1182 C CD2   . TYR A 149 ? 0.2150 0.1894 0.2191 0.0019  -0.0555 0.0160  146 TYR A CD2   
1183 C CE1   . TYR A 149 ? 0.2348 0.2046 0.2263 0.0078  -0.0714 0.0161  146 TYR A CE1   
1184 C CE2   . TYR A 149 ? 0.2691 0.2396 0.2682 0.0019  -0.0644 0.0127  146 TYR A CE2   
1185 C CZ    . TYR A 149 ? 0.2445 0.2126 0.2369 0.0049  -0.0726 0.0124  146 TYR A CZ    
1186 O OH    . TYR A 149 ? 0.3268 0.2894 0.3119 0.0055  -0.0824 0.0081  146 TYR A OH    
1187 N N     . ILE A 150 ? 0.1445 0.1288 0.1756 0.0087  -0.0382 0.0298  147 ILE A N     
1188 C CA    . ILE A 150 ? 0.1447 0.1262 0.1742 0.0111  -0.0318 0.0318  147 ILE A CA    
1189 C C     . ILE A 150 ? 0.1465 0.1222 0.1627 0.0127  -0.0334 0.0325  147 ILE A C     
1190 O O     . ILE A 150 ? 0.1786 0.1544 0.1937 0.0152  -0.0395 0.0346  147 ILE A O     
1191 C CB    . ILE A 150 ? 0.1389 0.1249 0.1831 0.0141  -0.0316 0.0356  147 ILE A CB    
1192 C CG1   . ILE A 150 ? 0.1546 0.1477 0.2148 0.0128  -0.0301 0.0364  147 ILE A CG1   
1193 C CG2   . ILE A 150 ? 0.1604 0.1415 0.2017 0.0168  -0.0244 0.0370  147 ILE A CG2   
1194 C CD1   . ILE A 150 ? 0.1548 0.1461 0.2123 0.0119  -0.0211 0.0347  147 ILE A CD1   
1195 N N     . GLU A 151 ? 0.1427 0.1135 0.1491 0.0114  -0.0281 0.0311  148 GLU A N     
1196 C CA    . GLU A 151 ? 0.1738 0.1391 0.1685 0.0126  -0.0280 0.0326  148 GLU A CA    
1197 C C     . GLU A 151 ? 0.1807 0.1433 0.1775 0.0163  -0.0278 0.0369  148 GLU A C     
1198 O O     . GLU A 151 ? 0.1832 0.1451 0.1874 0.0170  -0.0236 0.0377  148 GLU A O     
1199 C CB    . GLU A 151 ? 0.1705 0.1322 0.1595 0.0100  -0.0217 0.0308  148 GLU A CB    
1200 C CG    . GLU A 151 ? 0.2238 0.1803 0.2034 0.0109  -0.0198 0.0335  148 GLU A CG    
1201 C CD    . GLU A 151 ? 0.2645 0.2206 0.2339 0.0131  -0.0241 0.0345  148 GLU A CD    
1202 O OE1   . GLU A 151 ? 0.2805 0.2321 0.2423 0.0160  -0.0233 0.0385  148 GLU A OE1   
1203 O OE2   . GLU A 151 ? 0.2772 0.2361 0.2447 0.0123  -0.0280 0.0314  148 GLU A OE2   
1204 N N     . GLY A 152 ? 0.1808 0.1411 0.1698 0.0193  -0.0322 0.0397  149 GLY A N     
1205 C CA    . GLY A 152 ? 0.1955 0.1526 0.1850 0.0235  -0.0325 0.0445  149 GLY A CA    
1206 C C     . GLY A 152 ? 0.2090 0.1713 0.2063 0.0269  -0.0404 0.0463  149 GLY A C     
1207 O O     . GLY A 152 ? 0.2439 0.2037 0.2395 0.0314  -0.0427 0.0508  149 GLY A O     
1208 N N     . LEU A 153 ? 0.1965 0.1659 0.2035 0.0247  -0.0448 0.0434  150 LEU A N     
1209 C CA    . LEU A 153 ? 0.2016 0.1775 0.2204 0.0269  -0.0531 0.0449  150 LEU A CA    
1210 C C     . LEU A 153 ? 0.2452 0.2230 0.2599 0.0257  -0.0630 0.0416  150 LEU A C     
1211 O O     . LEU A 153 ? 0.2471 0.2228 0.2541 0.0224  -0.0616 0.0377  150 LEU A O     
1212 C CB    . LEU A 153 ? 0.1985 0.1815 0.2370 0.0257  -0.0494 0.0452  150 LEU A CB    
1213 C CG    . LEU A 153 ? 0.2211 0.2010 0.2633 0.0280  -0.0402 0.0478  150 LEU A CG    
1214 C CD1   . LEU A 153 ? 0.2114 0.1981 0.2711 0.0278  -0.0358 0.0482  150 LEU A CD1   
1215 C CD2   . LEU A 153 ? 0.2722 0.2493 0.3132 0.0335  -0.0425 0.0527  150 LEU A CD2   
1216 N N     . PRO A 154 ? 0.2355 0.2166 0.2550 0.0286  -0.0735 0.0430  151 PRO A N     
1217 C CA    . PRO A 154 ? 0.2062 0.1908 0.2360 0.0332  -0.0762 0.0480  151 PRO A CA    
1218 C C     . PRO A 154 ? 0.2446 0.2210 0.2582 0.0386  -0.0743 0.0521  151 PRO A C     
1219 O O     . PRO A 154 ? 0.2912 0.2599 0.2852 0.0391  -0.0731 0.0512  151 PRO A O     
1220 C CB    . PRO A 154 ? 0.2250 0.2154 0.2627 0.0340  -0.0906 0.0468  151 PRO A CB    
1221 C CG    . PRO A 154 ? 0.2439 0.2281 0.2634 0.0323  -0.0960 0.0416  151 PRO A CG    
1222 C CD    . PRO A 154 ? 0.2511 0.2327 0.2666 0.0275  -0.0848 0.0389  151 PRO A CD    
1223 N N     . GLN A 155 ? 0.2448 0.2228 0.2672 0.0429  -0.0735 0.0572  152 GLN A N     
1224 C CA    . GLN A 155 ? 0.3221 0.2918 0.3309 0.0485  -0.0715 0.0622  152 GLN A CA    
1225 C C     . GLN A 155 ? 0.4412 0.4155 0.4613 0.0544  -0.0778 0.0672  152 GLN A C     
1226 O O     . GLN A 155 ? 0.4303 0.4148 0.4708 0.0537  -0.0823 0.0668  152 GLN A O     
1227 C CB    . GLN A 155 ? 0.4203 0.3832 0.4263 0.0470  -0.0581 0.0635  152 GLN A CB    
1228 C CG    . GLN A 155 ? 0.5636 0.5303 0.5880 0.0469  -0.0519 0.0645  152 GLN A CG    
1229 C CD    . GLN A 155 ? 0.6010 0.5612 0.6249 0.0522  -0.0472 0.0702  152 GLN A CD    
1230 O OE1   . GLN A 155 ? 0.6629 0.6146 0.6722 0.0550  -0.0465 0.0736  152 GLN A OE1   
1231 N NE2   . GLN A 155 ? 0.4819 0.4451 0.5213 0.0541  -0.0430 0.0716  152 GLN A NE2   
1232 N N     . GLY A 156 ? 0.4731 0.4400 0.4808 0.0606  -0.0779 0.0726  153 GLY A N     
1233 C CA    . GLY A 156 ? 0.6376 0.6076 0.6550 0.0672  -0.0827 0.0783  153 GLY A CA    
1234 C C     . GLY A 156 ? 0.7210 0.6983 0.7419 0.0706  -0.0989 0.0781  153 GLY A C     
1235 O O     . GLY A 156 ? 0.6788 0.6562 0.6902 0.0683  -0.1070 0.0733  153 GLY A O     
1236 N N     . PRO A 157 ? 0.8276 0.8107 0.8626 0.0763  -0.1041 0.0832  154 PRO A N     
1237 C CA    . PRO A 157 ? 0.8248 0.8158 0.8662 0.0802  -0.1211 0.0836  154 PRO A CA    
1238 C C     . PRO A 157 ? 0.7886 0.7933 0.8549 0.0742  -0.1279 0.0789  154 PRO A C     
1239 O O     . PRO A 157 ? 0.7735 0.7854 0.8613 0.0709  -0.1192 0.0794  154 PRO A O     
1240 C CB    . PRO A 157 ? 0.8414 0.8344 0.8931 0.0882  -0.1211 0.0915  154 PRO A CB    
1241 C CG    . PRO A 157 ? 0.8067 0.7987 0.8702 0.0860  -0.1048 0.0931  154 PRO A CG    
1242 C CD    . PRO A 157 ? 0.8171 0.7989 0.8628 0.0800  -0.0942 0.0888  154 PRO A CD    
1243 N N     . THR A 163 ? 1.3906 1.3741 1.4091 0.0379  -0.2020 0.0169  160 THR A N     
1244 C CA    . THR A 163 ? 1.3421 1.3175 1.3510 0.0331  -0.2016 0.0095  160 THR A CA    
1245 C C     . THR A 163 ? 1.2374 1.1988 1.2094 0.0380  -0.1921 0.0083  160 THR A C     
1246 O O     . THR A 163 ? 1.2173 1.1783 1.1811 0.0408  -0.1777 0.0143  160 THR A O     
1247 C CB    . THR A 163 ? 1.3429 1.3266 1.3784 0.0243  -0.1900 0.0104  160 THR A CB    
1248 O OG1   . THR A 163 ? 1.3518 1.3266 1.3766 0.0203  -0.1898 0.0035  160 THR A OG1   
1249 C CG2   . THR A 163 ? 1.3296 1.3165 1.3652 0.0250  -0.1702 0.0171  160 THR A CG2   
1250 N N     . VAL A 164 ? 1.1362 1.0858 1.0869 0.0391  -0.2002 0.0007  161 VAL A N     
1251 C CA    . VAL A 164 ? 1.0384 0.9746 0.9541 0.0446  -0.1918 -0.0004 161 VAL A CA    
1252 C C     . VAL A 164 ? 0.9427 0.8750 0.8571 0.0392  -0.1826 -0.0049 161 VAL A C     
1253 O O     . VAL A 164 ? 1.0014 0.9224 0.8886 0.0432  -0.1770 -0.0071 161 VAL A O     
1254 C CB    . VAL A 164 ? 1.0591 0.9821 0.9441 0.0529  -0.2067 -0.0055 161 VAL A CB    
1255 C CG1   . VAL A 164 ? 1.0336 0.9595 0.9156 0.0599  -0.2150 -0.0003 161 VAL A CG1   
1256 C CG2   . VAL A 164 ? 1.0718 0.9910 0.9629 0.0489  -0.2239 -0.0154 161 VAL A CG2   
1257 N N     . GLN A 165 ? 0.7472 0.6886 0.6911 0.0305  -0.1807 -0.0055 162 GLN A N     
1258 C CA    . GLN A 165 ? 0.6980 0.6360 0.6429 0.0253  -0.1730 -0.0094 162 GLN A CA    
1259 C C     . GLN A 165 ? 0.5785 0.5248 0.5374 0.0213  -0.1548 -0.0035 162 GLN A C     
1260 O O     . GLN A 165 ? 0.5180 0.4745 0.4946 0.0203  -0.1501 0.0026  162 GLN A O     
1261 C CB    . GLN A 165 ? 0.8116 0.7504 0.7761 0.0188  -0.1854 -0.0155 162 GLN A CB    
1262 C CG    . GLN A 165 ? 0.9707 0.8995 0.9205 0.0225  -0.2053 -0.0230 162 GLN A CG    
1263 C CD    . GLN A 165 ? 1.0790 1.0063 1.0476 0.0153  -0.2174 -0.0299 162 GLN A CD    
1264 O OE1   . GLN A 165 ? 1.1175 1.0411 1.0874 0.0158  -0.2363 -0.0355 162 GLN A OE1   
1265 N NE2   . GLN A 165 ? 1.0890 1.0185 1.0722 0.0086  -0.2070 -0.0297 162 GLN A NE2   
1266 N N     . LYS A 166 ? 0.4743 0.4158 0.4247 0.0194  -0.1452 -0.0057 163 LYS A N     
1267 C CA    . LYS A 166 ? 0.4858 0.4330 0.4435 0.0168  -0.1286 -0.0009 163 LYS A CA    
1268 C C     . LYS A 166 ? 0.4279 0.3868 0.4168 0.0104  -0.1252 0.0022  163 LYS A C     
1269 O O     . LYS A 166 ? 0.3450 0.3108 0.3428 0.0103  -0.1157 0.0078  163 LYS A O     
1270 C CB    . LYS A 166 ? 0.5945 0.5344 0.5376 0.0164  -0.1208 -0.0042 163 LYS A CB    
1271 C CG    . LYS A 166 ? 0.7311 0.6750 0.6749 0.0155  -0.1048 0.0003  163 LYS A CG    
1272 C CD    . LYS A 166 ? 0.8594 0.7977 0.7928 0.0149  -0.0984 -0.0029 163 LYS A CD    
1273 C CE    . LYS A 166 ? 0.9623 0.9005 0.9098 0.0096  -0.1031 -0.0070 163 LYS A CE    
1274 N NZ    . LYS A 166 ? 1.0044 0.9379 0.9440 0.0092  -0.0959 -0.0094 163 LYS A NZ    
1275 N N     . GLU A 167 ? 0.4485 0.4088 0.4538 0.0054  -0.1322 -0.0012 164 GLU A N     
1276 C CA    . GLU A 167 ? 0.4218 0.3930 0.4569 -0.0001 -0.1275 0.0027  164 GLU A CA    
1277 C C     . GLU A 167 ? 0.4025 0.3837 0.4548 0.0012  -0.1308 0.0079  164 GLU A C     
1278 O O     . GLU A 167 ? 0.3400 0.3303 0.4106 -0.0005 -0.1218 0.0132  164 GLU A O     
1279 C CB    . GLU A 167 ? 0.4471 0.4174 0.4981 -0.0059 -0.1347 -0.0012 164 GLU A CB    
1280 C CG    . GLU A 167 ? 0.4489 0.4310 0.5333 -0.0112 -0.1309 0.0038  164 GLU A CG    
1281 C CD    . GLU A 167 ? 0.4814 0.4674 0.5693 -0.0121 -0.1135 0.0086  164 GLU A CD    
1282 O OE1   . GLU A 167 ? 0.4790 0.4745 0.5910 -0.0147 -0.1080 0.0139  164 GLU A OE1   
1283 O OE2   . GLU A 167 ? 0.4042 0.3839 0.4708 -0.0099 -0.1056 0.0073  164 GLU A OE2   
1284 N N     . GLY A 168 ? 0.3972 0.3762 0.4424 0.0049  -0.1438 0.0062  165 GLY A N     
1285 C CA    . GLY A 168 ? 0.3934 0.3815 0.4541 0.0071  -0.1485 0.0111  165 GLY A CA    
1286 C C     . GLY A 168 ? 0.3399 0.3300 0.3933 0.0114  -0.1362 0.0171  165 GLY A C     
1287 O O     . GLY A 168 ? 0.3481 0.3478 0.4211 0.0114  -0.1312 0.0226  165 GLY A O     
1288 N N     . MET A 169 ? 0.3599 0.3405 0.3853 0.0154  -0.1310 0.0161  166 MET A N     
1289 C CA    . MET A 169 ? 0.3335 0.3141 0.3514 0.0187  -0.1188 0.0214  166 MET A CA    
1290 C C     . MET A 169 ? 0.2822 0.2684 0.3149 0.0144  -0.1052 0.0237  166 MET A C     
1291 O O     . MET A 169 ? 0.2902 0.2813 0.3326 0.0158  -0.0980 0.0286  166 MET A O     
1292 C CB    . MET A 169 ? 0.4342 0.4038 0.4220 0.0226  -0.1145 0.0201  166 MET A CB    
1293 C CG    . MET A 169 ? 0.5464 0.5087 0.5141 0.0290  -0.1256 0.0190  166 MET A CG    
1294 S SD    . MET A 169 ? 0.8010 0.7649 0.7665 0.0356  -0.1249 0.0267  166 MET A SD    
1295 C CE    . MET A 169 ? 0.4737 0.4346 0.4311 0.0354  -0.1056 0.0310  166 MET A CE    
1296 N N     . ARG A 170 ? 0.2643 0.2487 0.2975 0.0100  -0.1017 0.0202  167 ARG A N     
1297 C CA    . ARG A 170 ? 0.2470 0.2355 0.2908 0.0068  -0.0892 0.0222  167 ARG A CA    
1298 C C     . ARG A 170 ? 0.2163 0.2151 0.2866 0.0056  -0.0880 0.0265  167 ARG A C     
1299 O O     . ARG A 170 ? 0.2051 0.2069 0.2804 0.0069  -0.0780 0.0303  167 ARG A O     
1300 C CB    . ARG A 170 ? 0.2138 0.1995 0.2568 0.0025  -0.0875 0.0182  167 ARG A CB    
1301 C CG    . ARG A 170 ? 0.1969 0.1858 0.2473 0.0003  -0.0745 0.0205  167 ARG A CG    
1302 C CD    . ARG A 170 ? 0.1956 0.1835 0.2513 -0.0038 -0.0732 0.0181  167 ARG A CD    
1303 N NE    . ARG A 170 ? 0.2093 0.2029 0.2882 -0.0072 -0.0788 0.0193  167 ARG A NE    
1304 C CZ    . ARG A 170 ? 0.2251 0.2268 0.3249 -0.0084 -0.0726 0.0241  167 ARG A CZ    
1305 N NH1   . ARG A 170 ? 0.1814 0.1851 0.2793 -0.0061 -0.0610 0.0275  167 ARG A NH1   
1306 N NH2   . ARG A 170 ? 0.2357 0.2429 0.3584 -0.0117 -0.0779 0.0256  167 ARG A NH2   
1307 N N     . LYS A 171 ? 0.2091 0.2131 0.2968 0.0035  -0.0983 0.0259  168 LYS A N     
1308 C CA    . LYS A 171 ? 0.2070 0.2222 0.3232 0.0025  -0.0971 0.0308  168 LYS A CA    
1309 C C     . LYS A 171 ? 0.2270 0.2463 0.3465 0.0078  -0.0965 0.0356  168 LYS A C     
1310 O O     . LYS A 171 ? 0.2280 0.2542 0.3633 0.0090  -0.0879 0.0406  168 LYS A O     
1311 C CB    . LYS A 171 ? 0.2588 0.2790 0.3952 -0.0014 -0.1098 0.0292  168 LYS A CB    
1312 C CG    . LYS A 171 ? 0.3425 0.3597 0.4832 -0.0072 -0.1086 0.0261  168 LYS A CG    
1313 C CD    . LYS A 171 ? 0.4765 0.4985 0.6406 -0.0116 -0.1219 0.0247  168 LYS A CD    
1314 C CE    . LYS A 171 ? 0.6160 0.6349 0.7880 -0.0176 -0.1200 0.0225  168 LYS A CE    
1315 N NZ    . LYS A 171 ? 0.7136 0.7368 0.9112 -0.0226 -0.1336 0.0212  168 LYS A NZ    
1316 N N     . GLN A 172 ? 0.2282 0.2429 0.3323 0.0117  -0.1053 0.0344  169 GLN A N     
1317 C CA    . GLN A 172 ? 0.2303 0.2475 0.3357 0.0174  -0.1051 0.0393  169 GLN A CA    
1318 C C     . GLN A 172 ? 0.2106 0.2249 0.3090 0.0194  -0.0897 0.0423  169 GLN A C     
1319 O O     . GLN A 172 ? 0.2229 0.2424 0.3345 0.0224  -0.0843 0.0472  169 GLN A O     
1320 C CB    . GLN A 172 ? 0.4068 0.4168 0.4911 0.0220  -0.1157 0.0377  169 GLN A CB    
1321 C CG    . GLN A 172 ? 0.6137 0.6271 0.7064 0.0219  -0.1334 0.0354  169 GLN A CG    
1322 C CD    . GLN A 172 ? 0.8345 0.8579 0.9475 0.0256  -0.1394 0.0408  169 GLN A CD    
1323 O OE1   . GLN A 172 ? 0.9189 0.9432 1.0312 0.0302  -0.1315 0.0461  169 GLN A OE1   
1324 N NE2   . GLN A 172 ? 0.8967 0.9276 1.0292 0.0236  -0.1537 0.0394  169 GLN A NE2   
1325 N N     . GLY A 173 ? 0.2412 0.2467 0.3191 0.0182  -0.0831 0.0393  170 GLY A N     
1326 C CA    . GLY A 173 ? 0.1918 0.1932 0.2620 0.0196  -0.0702 0.0411  170 GLY A CA    
1327 C C     . GLY A 173 ? 0.2035 0.2103 0.2897 0.0176  -0.0607 0.0425  170 GLY A C     
1328 O O     . GLY A 173 ? 0.1789 0.1858 0.2688 0.0205  -0.0524 0.0455  170 GLY A O     
1329 N N     . LEU A 174 ? 0.1851 0.1955 0.2803 0.0133  -0.0616 0.0404  171 LEU A N     
1330 C CA    . LEU A 174 ? 0.1753 0.1905 0.2850 0.0120  -0.0521 0.0425  171 LEU A CA    
1331 C C     . LEU A 174 ? 0.2144 0.2389 0.3470 0.0150  -0.0510 0.0480  171 LEU A C     
1332 O O     . LEU A 174 ? 0.1954 0.2210 0.3332 0.0177  -0.0403 0.0509  171 LEU A O     
1333 C CB    . LEU A 174 ? 0.1766 0.1936 0.2927 0.0069  -0.0539 0.0401  171 LEU A CB    
1334 C CG    . LEU A 174 ? 0.1821 0.2032 0.3114 0.0059  -0.0432 0.0429  171 LEU A CG    
1335 C CD1   . LEU A 174 ? 0.1871 0.2018 0.3002 0.0081  -0.0317 0.0421  171 LEU A CD1   
1336 C CD2   . LEU A 174 ? 0.2071 0.2289 0.3429 0.0008  -0.0459 0.0412  171 LEU A CD2   
1337 N N     . PHE A 175 ? 0.1639 0.1946 0.3098 0.0152  -0.0624 0.0494  172 PHE A N     
1338 C CA    . PHE A 175 ? 0.1983 0.2392 0.3682 0.0185  -0.0625 0.0551  172 PHE A CA    
1339 C C     . PHE A 175 ? 0.2170 0.2546 0.3794 0.0248  -0.0561 0.0581  172 PHE A C     
1340 O O     . PHE A 175 ? 0.2465 0.2887 0.4226 0.0283  -0.0472 0.0625  172 PHE A O     
1341 C CB    . PHE A 175 ? 0.2023 0.2501 0.3862 0.0176  -0.0783 0.0553  172 PHE A CB    
1342 C CG    . PHE A 175 ? 0.4205 0.4739 0.6216 0.0113  -0.0842 0.0537  172 PHE A CG    
1343 C CD1   . PHE A 175 ? 0.4744 0.5308 0.6875 0.0082  -0.0734 0.0555  172 PHE A CD1   
1344 C CD2   . PHE A 175 ? 0.5298 0.5843 0.7346 0.0088  -0.1008 0.0504  172 PHE A CD2   
1345 C CE1   . PHE A 175 ? 0.5728 0.6335 0.8031 0.0023  -0.0783 0.0547  172 PHE A CE1   
1346 C CE2   . PHE A 175 ? 0.6254 0.6837 0.8472 0.0026  -0.1068 0.0486  172 PHE A CE2   
1347 C CZ    . PHE A 175 ? 0.6273 0.6888 0.8628 -0.0010 -0.0952 0.0511  172 PHE A CZ    
1348 N N     . GLN A 176 ? 0.2020 0.2306 0.3427 0.0268  -0.0599 0.0560  173 GLN A N     
1349 C CA    . GLN A 176 ? 0.1868 0.2105 0.3202 0.0325  -0.0542 0.0590  173 GLN A CA    
1350 C C     . GLN A 176 ? 0.2526 0.2711 0.3808 0.0331  -0.0398 0.0585  173 GLN A C     
1351 O O     . GLN A 176 ? 0.2367 0.2554 0.3716 0.0379  -0.0325 0.0619  173 GLN A O     
1352 C CB    . GLN A 176 ? 0.2118 0.2259 0.3221 0.0342  -0.0597 0.0575  173 GLN A CB    
1353 C CG    . GLN A 176 ? 0.2559 0.2734 0.3679 0.0360  -0.0744 0.0584  173 GLN A CG    
1354 C CD    . GLN A 176 ? 0.2675 0.2747 0.3555 0.0394  -0.0777 0.0585  173 GLN A CD    
1355 O OE1   . GLN A 176 ? 0.2978 0.2957 0.3688 0.0391  -0.0694 0.0576  173 GLN A OE1   
1356 N NE2   . GLN A 176 ? 0.3406 0.3497 0.4277 0.0431  -0.0900 0.0601  173 GLN A NE2   
1357 N N     . TRP A 177 ? 0.2103 0.2236 0.3259 0.0286  -0.0361 0.0540  174 TRP A N     
1358 C CA    . TRP A 177 ? 0.1867 0.1942 0.2947 0.0290  -0.0241 0.0525  174 TRP A CA    
1359 C C     . TRP A 177 ? 0.1766 0.1910 0.3027 0.0313  -0.0162 0.0559  174 TRP A C     
1360 O O     . TRP A 177 ? 0.2189 0.2297 0.3443 0.0360  -0.0073 0.0574  174 TRP A O     
1361 C CB    . TRP A 177 ? 0.1804 0.1830 0.2739 0.0238  -0.0236 0.0474  174 TRP A CB    
1362 C CG    . TRP A 177 ? 0.1794 0.1767 0.2652 0.0239  -0.0131 0.0453  174 TRP A CG    
1363 C CD1   . TRP A 177 ? 0.1691 0.1693 0.2601 0.0227  -0.0077 0.0450  174 TRP A CD1   
1364 C CD2   . TRP A 177 ? 0.1868 0.1741 0.2577 0.0255  -0.0076 0.0430  174 TRP A CD2   
1365 N NE1   . TRP A 177 ? 0.1801 0.1727 0.2583 0.0240  0.0004  0.0424  174 TRP A NE1   
1366 C CE2   . TRP A 177 ? 0.1896 0.1742 0.2561 0.0254  0.0000  0.0407  174 TRP A CE2   
1367 C CE3   . TRP A 177 ? 0.2342 0.2141 0.2953 0.0270  -0.0086 0.0429  174 TRP A CE3   
1368 C CZ2   . TRP A 177 ? 0.1802 0.1550 0.2330 0.0265  0.0053  0.0374  174 TRP A CZ2   
1369 C CZ3   . TRP A 177 ? 0.2021 0.1723 0.2517 0.0275  -0.0026 0.0400  174 TRP A CZ3   
1370 C CH2   . TRP A 177 ? 0.2364 0.2042 0.2819 0.0271  0.0036  0.0368  174 TRP A CH2   
1371 N N     . LEU A 178 ? 0.1835 0.2072 0.3261 0.0282  -0.0193 0.0573  175 LEU A N     
1372 C CA    . LEU A 178 ? 0.1486 0.1796 0.3097 0.0302  -0.0105 0.0615  175 LEU A CA    
1373 C C     . LEU A 178 ? 0.2844 0.3220 0.4631 0.0364  -0.0082 0.0673  175 LEU A C     
1374 O O     . LEU A 178 ? 0.3103 0.3486 0.4951 0.0412  0.0033  0.0705  175 LEU A O     
1375 C CB    . LEU A 178 ? 0.1872 0.2267 0.3648 0.0249  -0.0147 0.0625  175 LEU A CB    
1376 C CG    . LEU A 178 ? 0.2272 0.2606 0.3899 0.0198  -0.0141 0.0577  175 LEU A CG    
1377 C CD1   . LEU A 178 ? 0.2334 0.2746 0.4150 0.0148  -0.0182 0.0593  175 LEU A CD1   
1378 C CD2   . LEU A 178 ? 0.1701 0.1964 0.3189 0.0224  -0.0011 0.0568  175 LEU A CD2   
1379 N N     . ASP A 179 ? 0.2300 0.2718 0.4157 0.0371  -0.0190 0.0688  176 ASP A N     
1380 C CA    . ASP A 179 ? 0.2851 0.3339 0.4886 0.0435  -0.0181 0.0747  176 ASP A CA    
1381 C C     . ASP A 179 ? 0.3617 0.4007 0.5523 0.0500  -0.0075 0.0751  176 ASP A C     
1382 O O     . ASP A 179 ? 0.3539 0.3971 0.5585 0.0562  0.0004  0.0799  176 ASP A O     
1383 C CB    . ASP A 179 ? 0.3238 0.3765 0.5316 0.0437  -0.0329 0.0756  176 ASP A CB    
1384 C CG    . ASP A 179 ? 0.5108 0.5752 0.7391 0.0388  -0.0443 0.0762  176 ASP A CG    
1385 O OD1   . ASP A 179 ? 0.5903 0.6635 0.8393 0.0367  -0.0391 0.0789  176 ASP A OD1   
1386 O OD2   . ASP A 179 ? 0.5967 0.6610 0.8202 0.0372  -0.0583 0.0741  176 ASP A OD2   
1387 N N     . SER A 180 ? 0.3019 0.3275 0.4666 0.0487  -0.0073 0.0700  177 SER A N     
1388 C CA    . SER A 180 ? 0.3673 0.3813 0.5182 0.0539  0.0006  0.0693  177 SER A CA    
1389 C C     . SER A 180 ? 0.3933 0.4003 0.5354 0.0553  0.0132  0.0667  177 SER A C     
1390 O O     . SER A 180 ? 0.4925 0.4892 0.6245 0.0602  0.0203  0.0656  177 SER A O     
1391 C CB    . SER A 180 ? 0.4204 0.4231 0.5494 0.0515  -0.0050 0.0655  177 SER A CB    
1392 O OG    . SER A 180 ? 0.5039 0.5115 0.6364 0.0507  -0.0168 0.0675  177 SER A OG    
1393 N N     . LEU A 181 ? 0.2743 0.2856 0.4187 0.0513  0.0155  0.0654  178 LEU A N     
1394 C CA    A LEU A 181 ? 0.2870 0.2909 0.4195 0.0529  0.0264  0.0626  178 LEU A CA    
1395 C CA    B LEU A 181 ? 0.2726 0.2765 0.4051 0.0528  0.0263  0.0626  178 LEU A CA    
1396 C C     . LEU A 181 ? 0.3888 0.3933 0.5301 0.0612  0.0383  0.0667  178 LEU A C     
1397 O O     . LEU A 181 ? 0.3859 0.4026 0.5506 0.0641  0.0401  0.0731  178 LEU A O     
1398 C CB    A LEU A 181 ? 0.3096 0.3180 0.4428 0.0473  0.0262  0.0613  178 LEU A CB    
1399 C CB    B LEU A 181 ? 0.3191 0.3280 0.4531 0.0471  0.0258  0.0614  178 LEU A CB    
1400 C CG    A LEU A 181 ? 0.2516 0.2542 0.3673 0.0404  0.0189  0.0553  178 LEU A CG    
1401 C CG    B LEU A 181 ? 0.3067 0.3057 0.4204 0.0465  0.0323  0.0565  178 LEU A CG    
1402 C CD1   A LEU A 181 ? 0.1961 0.2022 0.3130 0.0364  0.0206  0.0547  178 LEU A CD1   
1403 C CD1   B LEU A 181 ? 0.2548 0.2417 0.3465 0.0442  0.0281  0.0502  178 LEU A CD1   
1404 C CD2   A LEU A 181 ? 0.2463 0.2349 0.3391 0.0415  0.0217  0.0500  178 LEU A CD2   
1405 C CD2   B LEU A 181 ? 0.2081 0.2128 0.3255 0.0411  0.0309  0.0565  178 LEU A CD2   
1406 N N     . GLN A 182 ? 0.4990 0.4902 0.6217 0.0654  0.0464  0.0628  179 GLN A N     
1407 C CA    . GLN A 182 ? 0.6166 0.6054 0.7425 0.0746  0.0590  0.0657  179 GLN A CA    
1408 C C     . GLN A 182 ? 0.6456 0.6333 0.7648 0.0756  0.0681  0.0650  179 GLN A C     
1409 O O     . GLN A 182 ? 0.6692 0.6433 0.7656 0.0778  0.0727  0.0593  179 GLN A O     
1410 C CB    . GLN A 182 ? 0.7638 0.7363 0.8722 0.0799  0.0622  0.0615  179 GLN A CB    
1411 C CG    . GLN A 182 ? 0.9150 0.8827 1.0239 0.0907  0.0753  0.0638  179 GLN A CG    
1412 C CD    . GLN A 182 ? 1.0332 1.0152 1.1701 0.0962  0.0787  0.0729  179 GLN A CD    
1413 O OE1   . GLN A 182 ? 1.0757 1.0701 1.2294 0.0975  0.0845  0.0786  179 GLN A OE1   
1414 N NE2   . GLN A 182 ? 1.0450 1.0258 1.1881 0.0995  0.0752  0.0749  179 GLN A NE2   
1415 N N     . ILE A 183 ? 0.6186 0.6201 0.7578 0.0742  0.0703  0.0710  180 ILE A N     
1416 C CA    . ILE A 183 ? 0.6484 0.6500 0.7832 0.0749  0.0790  0.0720  180 ILE A CA    
1417 C C     . ILE A 183 ? 0.6909 0.6845 0.8166 0.0858  0.0940  0.0734  180 ILE A C     
1418 O O     . ILE A 183 ? 0.5951 0.5848 0.7100 0.0885  0.1025  0.0735  180 ILE A O     
1419 C CB    . ILE A 183 ? 0.5904 0.6088 0.7530 0.0711  0.0786  0.0794  180 ILE A CB    
1420 C CG1   . ILE A 183 ? 0.5986 0.6288 0.7891 0.0772  0.0843  0.0880  180 ILE A CG1   
1421 C CG2   . ILE A 183 ? 0.5972 0.6214 0.7659 0.0609  0.0632  0.0770  180 ILE A CG2   
1422 C CD1   . ILE A 183 ? 0.6112 0.6589 0.8337 0.0729  0.0830  0.0956  180 ILE A CD1   
1423 N N     . ASP A 184 ? 0.8502 0.8406 0.9789 0.0928  0.0973  0.0746  181 ASP A N     
1424 C CA    . ASP A 184 ? 1.0061 0.9882 1.1265 0.1045  0.1118  0.0759  181 ASP A CA    
1425 C C     . ASP A 184 ? 0.9451 0.9068 1.0302 0.1070  0.1138  0.0665  181 ASP A C     
1426 O O     . ASP A 184 ? 0.9782 0.9316 1.0498 0.1159  0.1259  0.0664  181 ASP A O     
1427 C CB    . ASP A 184 ? 1.1990 1.1821 1.3318 0.1111  0.1135  0.0792  181 ASP A CB    
1428 C CG    . ASP A 184 ? 1.3837 1.3651 1.5198 0.1241  0.1302  0.0844  181 ASP A CG    
1429 O OD1   . ASP A 184 ? 1.4615 1.4338 1.5789 0.1292  0.1404  0.0826  181 ASP A OD1   
1430 O OD2   . ASP A 184 ? 1.4316 1.4207 1.5883 0.1298  0.1333  0.0906  181 ASP A OD2   
1431 N N     . ASN A 185 ? 0.7875 0.7413 0.8582 0.0996  0.1019  0.0587  182 ASN A N     
1432 C CA    . ASN A 185 ? 0.6461 0.5805 0.6862 0.1011  0.1013  0.0491  182 ASN A CA    
1433 C C     . ASN A 185 ? 0.6008 0.5331 0.6259 0.0942  0.0961  0.0442  182 ASN A C     
1434 O O     . ASN A 185 ? 0.5596 0.4961 0.5872 0.0846  0.0850  0.0418  182 ASN A O     
1435 C CB    . ASN A 185 ? 0.5664 0.4915 0.6014 0.0985  0.0928  0.0440  182 ASN A CB    
1436 C CG    . ASN A 185 ? 0.6168 0.5218 0.6236 0.0995  0.0912  0.0339  182 ASN A CG    
1437 O OD1   . ASN A 185 ? 0.6425 0.5386 0.6314 0.1046  0.0974  0.0303  182 ASN A OD1   
1438 N ND2   . ASN A 185 ? 0.6558 0.5530 0.6585 0.0947  0.0825  0.0293  182 ASN A ND2   
1439 N N     . LEU A 186 ? 0.5492 0.4745 0.5578 0.1001  0.1045  0.0428  183 LEU A N     
1440 C CA    . LEU A 186 ? 0.6188 0.5421 0.6127 0.0952  0.1005  0.0389  183 LEU A CA    
1441 C C     . LEU A 186 ? 0.5702 0.4812 0.5443 0.0897  0.0895  0.0285  183 LEU A C     
1442 O O     . LEU A 186 ? 0.5785 0.4901 0.5442 0.0838  0.0834  0.0253  183 LEU A O     
1443 C CB    . LEU A 186 ? 0.7179 0.6357 0.6971 0.1044  0.1127  0.0406  183 LEU A CB    
1444 C CG    . LEU A 186 ? 0.8164 0.7488 0.8154 0.1064  0.1226  0.0516  183 LEU A CG    
1445 C CD1   . LEU A 186 ? 0.8569 0.8024 0.8862 0.1075  0.1262  0.0598  183 LEU A CD1   
1446 C CD2   . LEU A 186 ? 0.8312 0.7551 0.8119 0.1176  0.1366  0.0536  183 LEU A CD2   
1447 N N     . THR A 187 ? 0.5376 0.4377 0.5057 0.0915  0.0870  0.0237  184 THR A N     
1448 C CA    . THR A 187 ? 0.5634 0.4518 0.5161 0.0860  0.0768  0.0144  184 THR A CA    
1449 C C     . THR A 187 ? 0.5035 0.3984 0.4709 0.0767  0.0670  0.0152  184 THR A C     
1450 O O     . THR A 187 ? 0.5591 0.4457 0.5179 0.0715  0.0591  0.0089  184 THR A O     
1451 C CB    . THR A 187 ? 0.8631 0.7316 0.7969 0.0934  0.0795  0.0073  184 THR A CB    
1452 O OG1   . THR A 187 ? 0.8637 0.7311 0.8099 0.0967  0.0822  0.0104  184 THR A OG1   
1453 C CG2   . THR A 187 ? 0.8637 0.7241 0.7800 0.1044  0.0900  0.0065  184 THR A CG2   
1454 N N     . SER A 188 ? 0.3858 0.2952 0.3751 0.0750  0.0674  0.0231  185 SER A N     
1455 C CA    . SER A 188 ? 0.3217 0.2371 0.3230 0.0675  0.0583  0.0245  185 SER A CA    
1456 C C     . SER A 188 ? 0.2644 0.1840 0.2621 0.0583  0.0497  0.0217  185 SER A C     
1457 O O     . SER A 188 ? 0.2441 0.1729 0.2457 0.0560  0.0500  0.0241  185 SER A O     
1458 C CB    . SER A 188 ? 0.3838 0.3140 0.4086 0.0683  0.0595  0.0333  185 SER A CB    
1459 O OG    . SER A 188 ? 0.4813 0.4171 0.5144 0.0613  0.0499  0.0344  185 SER A OG    
1460 N N     . PRO A 189 ? 0.2601 0.1726 0.2509 0.0531  0.0426  0.0169  186 PRO A N     
1461 C CA    . PRO A 189 ? 0.2241 0.1408 0.2116 0.0451  0.0354  0.0144  186 PRO A CA    
1462 C C     . PRO A 189 ? 0.2168 0.1479 0.2188 0.0406  0.0317  0.0200  186 PRO A C     
1463 O O     . PRO A 189 ? 0.2064 0.1431 0.2069 0.0365  0.0290  0.0194  186 PRO A O     
1464 C CB    . PRO A 189 ? 0.2368 0.1443 0.2192 0.0409  0.0297  0.0102  186 PRO A CB    
1465 C CG    . PRO A 189 ? 0.2976 0.1910 0.2724 0.0472  0.0342  0.0069  186 PRO A CG    
1466 C CD    . PRO A 189 ? 0.2933 0.1919 0.2772 0.0547  0.0418  0.0129  186 PRO A CD    
1467 N N     . ASP A 190 ? 0.2242 0.1607 0.2395 0.0416  0.0309  0.0252  187 ASP A N     
1468 C CA    . ASP A 190 ? 0.1289 0.0780 0.1569 0.0376  0.0259  0.0296  187 ASP A CA    
1469 C C     . ASP A 190 ? 0.1885 0.1468 0.2249 0.0387  0.0296  0.0328  187 ASP A C     
1470 O O     . ASP A 190 ? 0.1873 0.1528 0.2277 0.0340  0.0253  0.0335  187 ASP A O     
1471 C CB    . ASP A 190 ? 0.1863 0.1390 0.2265 0.0396  0.0236  0.0345  187 ASP A CB    
1472 C CG    . ASP A 190 ? 0.2398 0.1849 0.2733 0.0373  0.0190  0.0331  187 ASP A CG    
1473 O OD1   . ASP A 190 ? 0.2206 0.1606 0.2434 0.0326  0.0162  0.0289  187 ASP A OD1   
1474 O OD2   . ASP A 190 ? 0.2763 0.2207 0.3163 0.0406  0.0185  0.0368  187 ASP A OD2   
1475 N N     . LEU A 191 ? 0.2023 0.1598 0.2418 0.0453  0.0381  0.0351  188 LEU A N     
1476 C CA    . LEU A 191 ? 0.2086 0.1739 0.2564 0.0470  0.0438  0.0391  188 LEU A CA    
1477 C C     . LEU A 191 ? 0.1934 0.1553 0.2270 0.0445  0.0441  0.0352  188 LEU A C     
1478 O O     . LEU A 191 ? 0.1772 0.1467 0.2178 0.0415  0.0436  0.0378  188 LEU A O     
1479 C CB    . LEU A 191 ? 0.2242 0.1877 0.2755 0.0559  0.0548  0.0425  188 LEU A CB    
1480 C CG    . LEU A 191 ? 0.2581 0.2290 0.3183 0.0586  0.0630  0.0478  188 LEU A CG    
1481 C CD1   . LEU A 191 ? 0.2382 0.2242 0.3226 0.0536  0.0585  0.0537  188 LEU A CD1   
1482 C CD2   . LEU A 191 ? 0.2446 0.2128 0.3067 0.0688  0.0754  0.0515  188 LEU A CD2   
1483 N N     . GLN A 192 ? 0.1976 0.1476 0.2119 0.0459  0.0445  0.0290  189 GLN A N     
1484 C CA    . GLN A 192 ? 0.2233 0.1696 0.2230 0.0442  0.0437  0.0249  189 GLN A CA    
1485 C C     . GLN A 192 ? 0.1824 0.1350 0.1854 0.0362  0.0353  0.0242  189 GLN A C     
1486 O O     . GLN A 192 ? 0.1881 0.1444 0.1900 0.0346  0.0356  0.0251  189 GLN A O     
1487 C CB    . GLN A 192 ? 0.2248 0.1572 0.2048 0.0465  0.0431  0.0176  189 GLN A CB    
1488 C CG    . GLN A 192 ? 0.2846 0.2087 0.2567 0.0559  0.0525  0.0176  189 GLN A CG    
1489 C CD    . GLN A 192 ? 0.4517 0.3602 0.4045 0.0584  0.0507  0.0094  189 GLN A CD    
1490 O OE1   . GLN A 192 ? 0.4902 0.3946 0.4407 0.0529  0.0428  0.0048  189 GLN A OE1   
1491 N NE2   . GLN A 192 ? 0.5265 0.4256 0.4653 0.0671  0.0581  0.0077  189 GLN A NE2   
1492 N N     . LEU A 193 ? 0.1625 0.1157 0.1689 0.0318  0.0284  0.0230  190 LEU A N     
1493 C CA    . LEU A 193 ? 0.1405 0.0993 0.1494 0.0253  0.0212  0.0226  190 LEU A CA    
1494 C C     . LEU A 193 ? 0.1523 0.1213 0.1757 0.0238  0.0205  0.0276  190 LEU A C     
1495 O O     . LEU A 193 ? 0.1763 0.1485 0.1992 0.0199  0.0171  0.0270  190 LEU A O     
1496 C CB    . LEU A 193 ? 0.1688 0.1261 0.1785 0.0221  0.0152  0.0216  190 LEU A CB    
1497 C CG    . LEU A 193 ? 0.1497 0.0973 0.1480 0.0213  0.0140  0.0168  190 LEU A CG    
1498 C CD1   . LEU A 193 ? 0.2179 0.1653 0.2193 0.0182  0.0092  0.0179  190 LEU A CD1   
1499 C CD2   . LEU A 193 ? 0.1604 0.1058 0.1480 0.0188  0.0123  0.0122  190 LEU A CD2   
1500 N N     . THR A 194 ? 0.1621 0.1359 0.1996 0.0266  0.0232  0.0324  191 THR A N     
1501 C CA    . THR A 194 ? 0.1370 0.1209 0.1918 0.0247  0.0215  0.0371  191 THR A CA    
1502 C C     . THR A 194 ? 0.1802 0.1660 0.2361 0.0253  0.0272  0.0391  191 THR A C     
1503 O O     . THR A 194 ? 0.1479 0.1382 0.2101 0.0211  0.0237  0.0401  191 THR A O     
1504 C CB    . THR A 194 ? 0.1540 0.1437 0.2259 0.0281  0.0233  0.0422  191 THR A CB    
1505 O OG1   . THR A 194 ? 0.1709 0.1577 0.2401 0.0281  0.0180  0.0408  191 THR A OG1   
1506 C CG2   . THR A 194 ? 0.1694 0.1699 0.2618 0.0251  0.0196  0.0468  191 THR A CG2   
1507 N N     . VAL A 195 ? 0.1583 0.1393 0.2068 0.0309  0.0364  0.0396  192 VAL A N     
1508 C CA    . VAL A 195 ? 0.1981 0.1792 0.2441 0.0328  0.0431  0.0419  192 VAL A CA    
1509 C C     . VAL A 195 ? 0.1933 0.1702 0.2243 0.0291  0.0384  0.0373  192 VAL A C     
1510 O O     . VAL A 195 ? 0.1916 0.1713 0.2260 0.0273  0.0394  0.0397  192 VAL A O     
1511 C CB    . VAL A 195 ? 0.1780 0.1530 0.2148 0.0412  0.0541  0.0431  192 VAL A CB    
1512 C CG1   . VAL A 195 ? 0.1932 0.1667 0.2235 0.0440  0.0614  0.0458  192 VAL A CG1   
1513 C CG2   . VAL A 195 ? 0.2104 0.1911 0.2651 0.0454  0.0600  0.0491  192 VAL A CG2   
1514 N N     . GLY A 196 ? 0.1698 0.1402 0.1859 0.0279  0.0335  0.0310  193 GLY A N     
1515 C CA    . GLY A 196 ? 0.1751 0.1433 0.1802 0.0242  0.0281  0.0269  193 GLY A CA    
1516 C C     . GLY A 196 ? 0.1805 0.1552 0.1961 0.0185  0.0221  0.0284  193 GLY A C     
1517 O O     . GLY A 196 ? 0.1764 0.1515 0.1890 0.0168  0.0213  0.0283  193 GLY A O     
1518 N N     . ALA A 197 ? 0.1838 0.1628 0.2108 0.0161  0.0175  0.0295  194 ALA A N     
1519 C CA    . ALA A 197 ? 0.1375 0.1212 0.1731 0.0113  0.0108  0.0302  194 ALA A CA    
1520 C C     . ALA A 197 ? 0.1588 0.1472 0.2075 0.0106  0.0136  0.0347  194 ALA A C     
1521 O O     . ALA A 197 ? 0.1421 0.1309 0.1916 0.0072  0.0096  0.0339  194 ALA A O     
1522 C CB    . ALA A 197 ? 0.1643 0.1509 0.2079 0.0100  0.0048  0.0306  194 ALA A CB    
1523 N N     . VAL A 198 ? 0.1385 0.1298 0.1978 0.0141  0.0209  0.0396  195 VAL A N     
1524 C CA    . VAL A 198 ? 0.1510 0.1468 0.2248 0.0135  0.0252  0.0451  195 VAL A CA    
1525 C C     . VAL A 198 ? 0.1994 0.1903 0.2609 0.0141  0.0290  0.0446  195 VAL A C     
1526 O O     . VAL A 198 ? 0.1770 0.1690 0.2453 0.0108  0.0273  0.0463  195 VAL A O     
1527 C CB    . VAL A 198 ? 0.1716 0.1715 0.2585 0.0183  0.0345  0.0513  195 VAL A CB    
1528 C CG1   . VAL A 198 ? 0.1841 0.1881 0.2859 0.0181  0.0412  0.0581  195 VAL A CG1   
1529 C CG2   . VAL A 198 ? 0.1707 0.1769 0.2734 0.0176  0.0297  0.0526  195 VAL A CG2   
1530 N N     . ILE A 199 ? 0.1588 0.1435 0.2016 0.0185  0.0334  0.0420  196 ILE A N     
1531 C CA    . ILE A 199 ? 0.1763 0.1560 0.2049 0.0201  0.0361  0.0413  196 ILE A CA    
1532 C C     . ILE A 199 ? 0.1462 0.1250 0.1699 0.0151  0.0275  0.0371  196 ILE A C     
1533 O O     . ILE A 199 ? 0.1741 0.1519 0.1971 0.0144  0.0283  0.0388  196 ILE A O     
1534 C CB    . ILE A 199 ? 0.1818 0.1544 0.1903 0.0260  0.0403  0.0382  196 ILE A CB    
1535 C CG1   . ILE A 199 ? 0.2002 0.1724 0.2118 0.0325  0.0512  0.0434  196 ILE A CG1   
1536 C CG2   . ILE A 199 ? 0.2264 0.1941 0.2189 0.0275  0.0404  0.0365  196 ILE A CG2   
1537 C CD1   . ILE A 199 ? 0.2396 0.2036 0.2322 0.0388  0.0544  0.0394  196 ILE A CD1   
1538 N N     . VAL A 200 ? 0.1625 0.1414 0.1829 0.0122  0.0200  0.0322  197 VAL A N     
1539 C CA    . VAL A 200 ? 0.1613 0.1393 0.1764 0.0084  0.0128  0.0285  197 VAL A CA    
1540 C C     . VAL A 200 ? 0.1818 0.1626 0.2102 0.0045  0.0090  0.0305  197 VAL A C     
1541 O O     . VAL A 200 ? 0.1581 0.1368 0.1824 0.0029  0.0065  0.0291  197 VAL A O     
1542 C CB    . VAL A 200 ? 0.1340 0.1111 0.1421 0.0070  0.0072  0.0237  197 VAL A CB    
1543 C CG1   . VAL A 200 ? 0.1735 0.1502 0.1771 0.0039  0.0011  0.0207  197 VAL A CG1   
1544 C CG2   . VAL A 200 ? 0.1773 0.1502 0.1722 0.0102  0.0100  0.0210  197 VAL A CG2   
1545 N N     . GLU A 201 ? 0.1427 0.1279 0.1874 0.0031  0.0083  0.0335  198 GLU A N     
1546 C CA    . GLU A 201 ? 0.1371 0.1243 0.1963 -0.0008 0.0040  0.0353  198 GLU A CA    
1547 C C     . GLU A 201 ? 0.1693 0.1546 0.2312 -0.0004 0.0100  0.0391  198 GLU A C     
1548 O O     . GLU A 201 ? 0.1610 0.1437 0.2252 -0.0033 0.0063  0.0383  198 GLU A O     
1549 C CB    . GLU A 201 ? 0.1342 0.1278 0.2140 -0.0021 0.0026  0.0389  198 GLU A CB    
1550 C CG    . GLU A 201 ? 0.1725 0.1682 0.2525 -0.0026 -0.0046 0.0361  198 GLU A CG    
1551 C CD    . GLU A 201 ? 0.1894 0.1840 0.2701 -0.0064 -0.0158 0.0323  198 GLU A CD    
1552 O OE1   . GLU A 201 ? 0.2350 0.2261 0.3142 -0.0089 -0.0186 0.0306  198 GLU A OE1   
1553 O OE2   . GLU A 201 ? 0.1731 0.1693 0.2545 -0.0063 -0.0220 0.0309  198 GLU A OE2   
1554 N N     . GLU A 202 ? 0.1527 0.1383 0.2135 0.0040  0.0197  0.0434  199 GLU A N     
1555 C CA    . GLU A 202 ? 0.1480 0.1312 0.2103 0.0057  0.0271  0.0485  199 GLU A CA    
1556 C C     . GLU A 202 ? 0.1889 0.1659 0.2327 0.0068  0.0257  0.0451  199 GLU A C     
1557 O O     . GLU A 202 ? 0.1519 0.1262 0.1987 0.0054  0.0262  0.0473  199 GLU A O     
1558 C CB    . GLU A 202 ? 0.2075 0.1916 0.2698 0.0115  0.0386  0.0540  199 GLU A CB    
1559 C CG    . GLU A 202 ? 0.1999 0.1913 0.2853 0.0108  0.0415  0.0592  199 GLU A CG    
1560 C CD    . GLU A 202 ? 0.2932 0.2852 0.3757 0.0178  0.0524  0.0633  199 GLU A CD    
1561 O OE1   . GLU A 202 ? 0.3393 0.3380 0.4414 0.0181  0.0560  0.0682  199 GLU A OE1   
1562 O OE2   . GLU A 202 ? 0.3416 0.3273 0.4025 0.0233  0.0572  0.0615  199 GLU A OE2   
1563 N N     . MET A 203 ? 0.1665 0.1415 0.1928 0.0091  0.0236  0.0400  200 MET A N     
1564 C CA    . MET A 203 ? 0.1538 0.1246 0.1642 0.0103  0.0214  0.0367  200 MET A CA    
1565 C C     . MET A 203 ? 0.1438 0.1139 0.1576 0.0058  0.0138  0.0338  200 MET A C     
1566 O O     . MET A 203 ? 0.1648 0.1315 0.1746 0.0062  0.0139  0.0343  200 MET A O     
1567 C CB    . MET A 203 ? 0.1910 0.1608 0.1861 0.0125  0.0191  0.0315  200 MET A CB    
1568 C CG    A MET A 203 ? 0.1904 0.1586 0.1786 0.0176  0.0255  0.0327  200 MET A CG    
1569 C CG    B MET A 203 ? 0.2002 0.1669 0.1804 0.0146  0.0174  0.0289  200 MET A CG    
1570 S SD    A MET A 203 ? 0.2896 0.2551 0.2611 0.0190  0.0209  0.0255  200 MET A SD    
1571 S SD    B MET A 203 ? 0.2902 0.2564 0.2570 0.0157  0.0132  0.0224  200 MET A SD    
1572 C CE    A MET A 203 ? 0.1153 0.0791 0.0755 0.0195  0.0170  0.0233  200 MET A CE    
1573 C CE    B MET A 203 ? 0.1932 0.1590 0.1629 0.0177  0.0178  0.0234  200 MET A CE    
1574 N N     . ARG A 204 ? 0.1463 0.1189 0.1661 0.0023  0.0074  0.0307  201 ARG A N     
1575 C CA    . ARG A 204 ? 0.1507 0.1213 0.1710 -0.0010 0.0001  0.0273  201 ARG A CA    
1576 C C     . ARG A 204 ? 0.1654 0.1338 0.1985 -0.0036 -0.0004 0.0302  201 ARG A C     
1577 O O     . ARG A 204 ? 0.1622 0.1258 0.1914 -0.0044 -0.0033 0.0283  201 ARG A O     
1578 C CB    . ARG A 204 ? 0.1505 0.1233 0.1720 -0.0032 -0.0064 0.0237  201 ARG A CB    
1579 C CG    . ARG A 204 ? 0.1545 0.1279 0.1629 -0.0012 -0.0065 0.0205  201 ARG A CG    
1580 C CD    . ARG A 204 ? 0.2112 0.1861 0.2199 -0.0026 -0.0117 0.0181  201 ARG A CD    
1581 N NE    . ARG A 204 ? 0.1878 0.1605 0.1976 -0.0046 -0.0181 0.0160  201 ARG A NE    
1582 C CZ    . ARG A 204 ? 0.1905 0.1639 0.2099 -0.0066 -0.0231 0.0163  201 ARG A CZ    
1583 N NH1   . ARG A 204 ? 0.1858 0.1554 0.2035 -0.0079 -0.0297 0.0135  201 ARG A NH1   
1584 N NH2   . ARG A 204 ? 0.2255 0.2032 0.2559 -0.0068 -0.0219 0.0192  201 ARG A NH2   
1585 N N     . ALA A 205 ? 0.1622 0.1336 0.2115 -0.0049 0.0030  0.0350  202 ALA A N     
1586 C CA    . ALA A 205 ? 0.1637 0.1330 0.2284 -0.0078 0.0034  0.0388  202 ALA A CA    
1587 C C     . ALA A 205 ? 0.1423 0.1064 0.2002 -0.0051 0.0102  0.0423  202 ALA A C     
1588 O O     . ALA A 205 ? 0.1697 0.1284 0.2313 -0.0072 0.0080  0.0424  202 ALA A O     
1589 C CB    . ALA A 205 ? 0.1759 0.1512 0.2618 -0.0092 0.0071  0.0446  202 ALA A CB    
1590 N N     . ALA A 206 ? 0.1588 0.1236 0.2055 0.0001  0.0179  0.0449  203 ALA A N     
1591 C CA    . ALA A 206 ? 0.2005 0.1602 0.2380 0.0040  0.0240  0.0485  203 ALA A CA    
1592 C C     . ALA A 206 ? 0.1461 0.1013 0.1702 0.0043  0.0182  0.0433  203 ALA A C     
1593 O O     . ALA A 206 ? 0.1634 0.1131 0.1871 0.0049  0.0196  0.0456  203 ALA A O     
1594 C CB    . ALA A 206 ? 0.2297 0.1901 0.2546 0.0103  0.0320  0.0513  203 ALA A CB    
1595 N N     . ILE A 207 ? 0.1551 0.1126 0.1690 0.0043  0.0124  0.0369  204 ILE A N     
1596 C CA    . ILE A 207 ? 0.1354 0.0898 0.1382 0.0051  0.0076  0.0325  204 ILE A CA    
1597 C C     . ILE A 207 ? 0.1665 0.1159 0.1774 0.0015  0.0029  0.0311  204 ILE A C     
1598 O O     . ILE A 207 ? 0.1654 0.1093 0.1720 0.0030  0.0030  0.0313  204 ILE A O     
1599 C CB    . ILE A 207 ? 0.1465 0.1047 0.1400 0.0052  0.0029  0.0267  204 ILE A CB    
1600 C CG1   . ILE A 207 ? 0.1784 0.1394 0.1621 0.0090  0.0065  0.0272  204 ILE A CG1   
1601 C CG2   . ILE A 207 ? 0.1726 0.1284 0.1582 0.0058  -0.0015 0.0229  204 ILE A CG2   
1602 C CD1   . ILE A 207 ? 0.1772 0.1420 0.1560 0.0082  0.0027  0.0224  204 ILE A CD1   
1603 N N     . GLU A 208 ? 0.1631 0.1137 0.1857 -0.0029 -0.0018 0.0295  205 GLU A N     
1604 C CA    . GLU A 208 ? 0.1647 0.1092 0.1936 -0.0063 -0.0080 0.0269  205 GLU A CA    
1605 C C     . GLU A 208 ? 0.1555 0.0946 0.1961 -0.0077 -0.0042 0.0321  205 GLU A C     
1606 O O     . GLU A 208 ? 0.1700 0.1011 0.2087 -0.0079 -0.0065 0.0305  205 GLU A O     
1607 C CB    . GLU A 208 ? 0.1872 0.1341 0.2249 -0.0103 -0.0154 0.0235  205 GLU A CB    
1608 C CG    . GLU A 208 ? 0.2206 0.1594 0.2600 -0.0130 -0.0238 0.0188  205 GLU A CG    
1609 C CD    . GLU A 208 ? 0.2549 0.1950 0.3000 -0.0161 -0.0328 0.0148  205 GLU A CD    
1610 O OE1   . GLU A 208 ? 0.3119 0.2443 0.3553 -0.0176 -0.0409 0.0097  205 GLU A OE1   
1611 O OE2   . GLU A 208 ? 0.2859 0.2340 0.3365 -0.0166 -0.0323 0.0165  205 GLU A OE2   
1612 N N     . ARG A 209 ? 0.1716 0.1144 0.2246 -0.0082 0.0024  0.0387  206 ARG A N     
1613 C CA    . ARG A 209 ? 0.1549 0.0928 0.2207 -0.0094 0.0075  0.0452  206 ARG A CA    
1614 C C     . ARG A 209 ? 0.1825 0.1138 0.2345 -0.0046 0.0124  0.0473  206 ARG A C     
1615 O O     . ARG A 209 ? 0.1939 0.1170 0.2509 -0.0059 0.0120  0.0486  206 ARG A O     
1616 C CB    . ARG A 209 ? 0.1625 0.1065 0.2427 -0.0093 0.0162  0.0533  206 ARG A CB    
1617 C CG    . ARG A 209 ? 0.2388 0.1779 0.3364 -0.0114 0.0222  0.0612  206 ARG A CG    
1618 C CD    . ARG A 209 ? 0.3676 0.3125 0.4776 -0.0096 0.0337  0.0708  206 ARG A CD    
1619 N NE    . ARG A 209 ? 0.3949 0.3387 0.4863 -0.0016 0.0440  0.0755  206 ARG A NE    
1620 C CZ    . ARG A 209 ? 0.3702 0.3070 0.4568 0.0020  0.0516  0.0819  206 ARG A CZ    
1621 N NH1   . ARG A 209 ? 0.3782 0.3141 0.4456 0.0100  0.0598  0.0855  206 ARG A NH1   
1622 N NH2   . ARG A 209 ? 0.3349 0.2647 0.4348 -0.0021 0.0507  0.0845  206 ARG A NH2   
1623 N N     . GLU A 210 ? 0.1515 0.0861 0.1865 0.0010  0.0161  0.0473  207 GLU A N     
1624 C CA    . GLU A 210 ? 0.1642 0.0940 0.1870 0.0066  0.0216  0.0509  207 GLU A CA    
1625 C C     . GLU A 210 ? 0.1614 0.0875 0.1706 0.0087  0.0160  0.0452  207 GLU A C     
1626 O O     . GLU A 210 ? 0.1878 0.1087 0.1894 0.0130  0.0190  0.0481  207 GLU A O     
1627 C CB    . GLU A 210 ? 0.2020 0.1364 0.2136 0.0122  0.0284  0.0545  207 GLU A CB    
1628 C CG    . GLU A 210 ? 0.1971 0.1338 0.2212 0.0118  0.0366  0.0618  207 GLU A CG    
1629 C CD    . GLU A 210 ? 0.2969 0.2368 0.3077 0.0181  0.0432  0.0643  207 GLU A CD    
1630 O OE1   . GLU A 210 ? 0.3144 0.2517 0.3065 0.0239  0.0438  0.0636  207 GLU A OE1   
1631 O OE2   . GLU A 210 ? 0.3716 0.3161 0.3907 0.0177  0.0474  0.0668  207 GLU A OE2   
1632 N N     . THR A 211 ? 0.1846 0.1133 0.1910 0.0064  0.0084  0.0378  208 THR A N     
1633 C CA    . THR A 211 ? 0.2074 0.1332 0.2019 0.0091  0.0042  0.0329  208 THR A CA    
1634 C C     . THR A 211 ? 0.2059 0.1263 0.2041 0.0056  -0.0029 0.0273  208 THR A C     
1635 O O     . THR A 211 ? 0.2145 0.1297 0.2047 0.0082  -0.0051 0.0241  208 THR A O     
1636 C CB    . THR A 211 ? 0.1822 0.1160 0.1647 0.0118  0.0025  0.0292  208 THR A CB    
1637 O OG1   . THR A 211 ? 0.1650 0.1032 0.1509 0.0080  -0.0020 0.0249  208 THR A OG1   
1638 C CG2   . THR A 211 ? 0.2152 0.1536 0.1919 0.0154  0.0077  0.0332  208 THR A CG2   
1639 N N     . GLY A 212 ? 0.1779 0.0993 0.1871 0.0004  -0.0067 0.0256  209 GLY A N     
1640 C CA    . GLY A 212 ? 0.2131 0.1295 0.2223 -0.0022 -0.0150 0.0190  209 GLY A CA    
1641 C C     . GLY A 212 ? 0.2283 0.1503 0.2275 -0.0013 -0.0191 0.0138  209 GLY A C     
1642 O O     . GLY A 212 ? 0.2950 0.2132 0.2931 -0.0030 -0.0259 0.0086  209 GLY A O     
1643 N N     . PHE A 213 ? 0.1948 0.1251 0.1867 0.0015  -0.0153 0.0150  210 PHE A N     
1644 C CA    . PHE A 213 ? 0.1687 0.1038 0.1516 0.0026  -0.0181 0.0109  210 PHE A CA    
1645 C C     . PHE A 213 ? 0.1787 0.1197 0.1674 -0.0004 -0.0199 0.0109  210 PHE A C     
1646 O O     . PHE A 213 ? 0.2178 0.1635 0.2138 -0.0014 -0.0161 0.0148  210 PHE A O     
1647 C CB    . PHE A 213 ? 0.1611 0.1019 0.1348 0.0067  -0.0140 0.0119  210 PHE A CB    
1648 C CG    . PHE A 213 ? 0.1456 0.0822 0.1136 0.0108  -0.0121 0.0126  210 PHE A CG    
1649 C CD1   . PHE A 213 ? 0.1994 0.1399 0.1638 0.0142  -0.0080 0.0159  210 PHE A CD1   
1650 C CD2   . PHE A 213 ? 0.1855 0.1135 0.1507 0.0118  -0.0146 0.0098  210 PHE A CD2   
1651 C CE1   . PHE A 213 ? 0.1908 0.1280 0.1503 0.0186  -0.0065 0.0170  210 PHE A CE1   
1652 C CE2   . PHE A 213 ? 0.2010 0.1250 0.1612 0.0163  -0.0124 0.0108  210 PHE A CE2   
1653 C CZ    . PHE A 213 ? 0.1879 0.1170 0.1460 0.0196  -0.0083 0.0147  210 PHE A CZ    
1654 N N     . GLN A 214 ? 0.1538 0.0944 0.1382 -0.0010 -0.0251 0.0067  211 GLN A N     
1655 C CA    . GLN A 214 ? 0.1648 0.1110 0.1526 -0.0029 -0.0271 0.0066  211 GLN A CA    
1656 C C     . GLN A 214 ? 0.1584 0.1107 0.1377 -0.0006 -0.0242 0.0064  211 GLN A C     
1657 O O     . GLN A 214 ? 0.1674 0.1195 0.1377 0.0022  -0.0226 0.0052  211 GLN A O     
1658 C CB    . GLN A 214 ? 0.1859 0.1274 0.1729 -0.0042 -0.0350 0.0025  211 GLN A CB    
1659 C CG    . GLN A 214 ? 0.1918 0.1286 0.1919 -0.0079 -0.0395 0.0026  211 GLN A CG    
1660 C CD    . GLN A 214 ? 0.2686 0.1999 0.2671 -0.0091 -0.0493 -0.0024 211 GLN A CD    
1661 O OE1   . GLN A 214 ? 0.2763 0.2057 0.2607 -0.0062 -0.0520 -0.0058 211 GLN A OE1   
1662 N NE2   . GLN A 214 ? 0.2898 0.2184 0.3030 -0.0132 -0.0547 -0.0025 211 GLN A NE2   
1663 N N     . CYS A 215 ? 0.1622 0.1197 0.1459 -0.0019 -0.0236 0.0078  212 CYS A N     
1664 C CA    . CYS A 215 ? 0.1408 0.1031 0.1183 -0.0005 -0.0213 0.0077  212 CYS A CA    
1665 C C     . CYS A 215 ? 0.1673 0.1322 0.1481 -0.0019 -0.0233 0.0079  212 CYS A C     
1666 O O     . CYS A 215 ? 0.1944 0.1587 0.1833 -0.0037 -0.0264 0.0086  212 CYS A O     
1667 C CB    . CYS A 215 ? 0.1826 0.1483 0.1602 0.0006  -0.0161 0.0099  212 CYS A CB    
1668 S SG    . CYS A 215 ? 0.2406 0.2079 0.2284 -0.0004 -0.0128 0.0137  212 CYS A SG    
1669 N N     . SER A 216 ? 0.1566 0.1242 0.1322 -0.0010 -0.0218 0.0077  213 SER A N     
1670 C CA    . SER A 216 ? 0.1381 0.1078 0.1163 -0.0017 -0.0226 0.0086  213 SER A CA    
1671 C C     . SER A 216 ? 0.1533 0.1261 0.1331 -0.0015 -0.0181 0.0098  213 SER A C     
1672 O O     . SER A 216 ? 0.1820 0.1556 0.1588 -0.0007 -0.0154 0.0095  213 SER A O     
1673 C CB    . SER A 216 ? 0.1781 0.1465 0.1483 -0.0005 -0.0245 0.0074  213 SER A CB    
1674 O OG    . SER A 216 ? 0.2313 0.1950 0.1971 0.0003  -0.0292 0.0055  213 SER A OG    
1675 N N     . ALA A 217 ? 0.1404 0.1145 0.1243 -0.0019 -0.0177 0.0111  214 ALA A N     
1676 C CA    . ALA A 217 ? 0.1273 0.1024 0.1110 -0.0013 -0.0139 0.0114  214 ALA A CA    
1677 C C     . ALA A 217 ? 0.1470 0.1219 0.1320 -0.0013 -0.0142 0.0121  214 ALA A C     
1678 O O     . ALA A 217 ? 0.1500 0.1249 0.1383 -0.0014 -0.0171 0.0133  214 ALA A O     
1679 C CB    . ALA A 217 ? 0.1421 0.1175 0.1306 -0.0003 -0.0105 0.0132  214 ALA A CB    
1680 N N     . GLY A 218 ? 0.1419 0.1160 0.1244 -0.0011 -0.0118 0.0112  215 GLY A N     
1681 C CA    . GLY A 218 ? 0.1245 0.0969 0.1086 -0.0009 -0.0111 0.0120  215 GLY A CA    
1682 C C     . GLY A 218 ? 0.1482 0.1189 0.1334 0.0007  -0.0077 0.0116  215 GLY A C     
1683 O O     . GLY A 218 ? 0.1473 0.1172 0.1282 0.0014  -0.0062 0.0098  215 GLY A O     
1684 N N     . ILE A 219 ? 0.1262 0.0957 0.1159 0.0021  -0.0064 0.0133  216 ILE A N     
1685 C CA    . ILE A 219 ? 0.1138 0.0803 0.1032 0.0047  -0.0024 0.0130  216 ILE A CA    
1686 C C     . ILE A 219 ? 0.1169 0.0790 0.1060 0.0051  -0.0021 0.0126  216 ILE A C     
1687 O O     . ILE A 219 ? 0.1527 0.1157 0.1467 0.0051  -0.0036 0.0152  216 ILE A O     
1688 C CB    . ILE A 219 ? 0.1539 0.1233 0.1516 0.0070  0.0004  0.0164  216 ILE A CB    
1689 C CG1   . ILE A 219 ? 0.1643 0.1373 0.1643 0.0062  0.0003  0.0175  216 ILE A CG1   
1690 C CG2   . ILE A 219 ? 0.1752 0.1407 0.1706 0.0111  0.0061  0.0162  216 ILE A CG2   
1691 C CD1   . ILE A 219 ? 0.2288 0.2055 0.2353 0.0035  -0.0049 0.0188  216 ILE A CD1   
1692 N N     . SER A 220 ? 0.1353 0.0920 0.1185 0.0056  -0.0009 0.0092  217 SER A N     
1693 C CA    . SER A 220 ? 0.1594 0.1100 0.1426 0.0059  -0.0004 0.0085  217 SER A CA    
1694 C C     . SER A 220 ? 0.1912 0.1345 0.1673 0.0079  0.0013  0.0041  217 SER A C     
1695 O O     . SER A 220 ? 0.1513 0.0946 0.1224 0.0107  0.0033  0.0029  217 SER A O     
1696 C CB    . SER A 220 ? 0.1662 0.1166 0.1503 0.0021  -0.0032 0.0087  217 SER A CB    
1697 O OG    . SER A 220 ? 0.1813 0.1256 0.1673 0.0025  -0.0023 0.0095  217 SER A OG    
1698 N N     . HIS A 221 ? 0.1696 0.1057 0.1444 0.0068  0.0003  0.0017  218 HIS A N     
1699 C CA    . HIS A 221 ? 0.1666 0.0935 0.1336 0.0090  0.0007  -0.0036 218 HIS A CA    
1700 C C     . HIS A 221 ? 0.1830 0.1081 0.1454 0.0056  -0.0041 -0.0087 218 HIS A C     
1701 O O     . HIS A 221 ? 0.2159 0.1328 0.1704 0.0073  -0.0056 -0.0141 218 HIS A O     
1702 C CB    . HIS A 221 ? 0.1884 0.1064 0.1571 0.0104  0.0023  -0.0038 218 HIS A CB    
1703 C CG    . HIS A 221 ? 0.2056 0.1239 0.1774 0.0156  0.0073  0.0002  218 HIS A CG    
1704 N ND1   . HIS A 221 ? 0.2136 0.1314 0.1808 0.0211  0.0118  0.0000  218 HIS A ND1   
1705 C CD2   . HIS A 221 ? 0.1967 0.1162 0.1766 0.0165  0.0088  0.0050  218 HIS A CD2   
1706 C CE1   . HIS A 221 ? 0.2221 0.1417 0.1965 0.0249  0.0160  0.0046  218 HIS A CE1   
1707 N NE2   . HIS A 221 ? 0.2177 0.1385 0.1998 0.0222  0.0136  0.0075  218 HIS A NE2   
1708 N N     . ASN A 222 ? 0.1506 0.0832 0.1181 0.0013  -0.0070 -0.0072 219 ASN A N     
1709 C CA    . ASN A 222 ? 0.1441 0.0772 0.1105 -0.0020 -0.0119 -0.0113 219 ASN A CA    
1710 C C     . ASN A 222 ? 0.1504 0.0938 0.1214 -0.0046 -0.0130 -0.0083 219 ASN A C     
1711 O O     . ASN A 222 ? 0.1634 0.1119 0.1372 -0.0041 -0.0105 -0.0037 219 ASN A O     
1712 C CB    . ASN A 222 ? 0.1785 0.1052 0.1504 -0.0060 -0.0145 -0.0136 219 ASN A CB    
1713 C CG    . ASN A 222 ? 0.2011 0.1300 0.1824 -0.0086 -0.0120 -0.0079 219 ASN A CG    
1714 O OD1   . ASN A 222 ? 0.1897 0.1268 0.1757 -0.0107 -0.0117 -0.0041 219 ASN A OD1   
1715 N ND2   . ASN A 222 ? 0.1852 0.1058 0.1680 -0.0078 -0.0100 -0.0072 219 ASN A ND2   
1716 N N     . LYS A 223 ? 0.1804 0.1267 0.1520 -0.0069 -0.0171 -0.0111 220 LYS A N     
1717 C CA    . LYS A 223 ? 0.1456 0.1012 0.1202 -0.0081 -0.0177 -0.0086 220 LYS A CA    
1718 C C     . LYS A 223 ? 0.1667 0.1266 0.1499 -0.0111 -0.0159 -0.0041 220 LYS A C     
1719 O O     . LYS A 223 ? 0.1602 0.1254 0.1434 -0.0102 -0.0141 -0.0008 220 LYS A O     
1720 C CB    . LYS A 223 ? 0.1730 0.1310 0.1473 -0.0093 -0.0230 -0.0127 220 LYS A CB    
1721 C CG    . LYS A 223 ? 0.1915 0.1453 0.1536 -0.0049 -0.0249 -0.0167 220 LYS A CG    
1722 C CD    . LYS A 223 ? 0.3182 0.2721 0.2792 -0.0058 -0.0321 -0.0218 220 LYS A CD    
1723 C CE    . LYS A 223 ? 0.3164 0.2807 0.2844 -0.0075 -0.0343 -0.0198 220 LYS A CE    
1724 N NZ    . LYS A 223 ? 0.2715 0.2366 0.2397 -0.0081 -0.0425 -0.0249 220 LYS A NZ    
1725 N N     . VAL A 224 ? 0.1628 0.1194 0.1528 -0.0143 -0.0161 -0.0039 221 VAL A N     
1726 C CA    . VAL A 224 ? 0.1661 0.1263 0.1631 -0.0164 -0.0133 0.0013  221 VAL A CA    
1727 C C     . VAL A 224 ? 0.1605 0.1198 0.1536 -0.0135 -0.0099 0.0055  221 VAL A C     
1728 O O     . VAL A 224 ? 0.1687 0.1326 0.1612 -0.0127 -0.0083 0.0091  221 VAL A O     
1729 C CB    . VAL A 224 ? 0.1711 0.1272 0.1774 -0.0204 -0.0134 0.0017  221 VAL A CB    
1730 C CG1   . VAL A 224 ? 0.2218 0.1797 0.2327 -0.0210 -0.0087 0.0084  221 VAL A CG1   
1731 C CG2   . VAL A 224 ? 0.2072 0.1672 0.2208 -0.0239 -0.0177 -0.0016 221 VAL A CG2   
1732 N N     . LEU A 225 ? 0.1512 0.1043 0.1414 -0.0115 -0.0091 0.0050  222 LEU A N     
1733 C CA    . LEU A 225 ? 0.1547 0.1080 0.1429 -0.0087 -0.0072 0.0088  222 LEU A CA    
1734 C C     . LEU A 225 ? 0.1639 0.1226 0.1484 -0.0065 -0.0079 0.0089  222 LEU A C     
1735 O O     . LEU A 225 ? 0.1503 0.1115 0.1342 -0.0053 -0.0079 0.0120  222 LEU A O     
1736 C CB    . LEU A 225 ? 0.1511 0.0975 0.1390 -0.0064 -0.0059 0.0087  222 LEU A CB    
1737 C CG    . LEU A 225 ? 0.1569 0.0963 0.1488 -0.0080 -0.0047 0.0099  222 LEU A CG    
1738 C CD1   . LEU A 225 ? 0.1888 0.1209 0.1797 -0.0047 -0.0032 0.0096  222 LEU A CD1   
1739 C CD2   . LEU A 225 ? 0.1973 0.1388 0.1916 -0.0087 -0.0031 0.0158  222 LEU A CD2   
1740 N N     . ALA A 226 ? 0.1401 0.0998 0.1217 -0.0058 -0.0087 0.0055  223 ALA A N     
1741 C CA    . ALA A 226 ? 0.1366 0.1006 0.1159 -0.0041 -0.0089 0.0061  223 ALA A CA    
1742 C C     . ALA A 226 ? 0.1372 0.1061 0.1164 -0.0052 -0.0100 0.0073  223 ALA A C     
1743 O O     . ALA A 226 ? 0.1513 0.1222 0.1296 -0.0041 -0.0104 0.0091  223 ALA A O     
1744 C CB    . ALA A 226 ? 0.1545 0.1175 0.1294 -0.0023 -0.0088 0.0031  223 ALA A CB    
1745 N N     . LYS A 227 ? 0.1536 0.1242 0.1343 -0.0073 -0.0106 0.0064  224 LYS A N     
1746 C CA    . LYS A 227 ? 0.1530 0.1283 0.1340 -0.0076 -0.0104 0.0079  224 LYS A CA    
1747 C C     . LYS A 227 ? 0.1552 0.1296 0.1353 -0.0069 -0.0089 0.0117  224 LYS A C     
1748 O O     . LYS A 227 ? 0.1794 0.1551 0.1554 -0.0051 -0.0092 0.0128  224 LYS A O     
1749 C CB    . LYS A 227 ? 0.1736 0.1519 0.1596 -0.0099 -0.0110 0.0068  224 LYS A CB    
1750 C CG    A LYS A 227 ? 0.2182 0.2020 0.2058 -0.0095 -0.0096 0.0090  224 LYS A CG    
1751 C CG    B LYS A 227 ? 0.2323 0.2156 0.2204 -0.0097 -0.0092 0.0095  224 LYS A CG    
1752 C CD    A LYS A 227 ? 0.2958 0.2819 0.2781 -0.0069 -0.0105 0.0080  224 LYS A CD    
1753 C CD    B LYS A 227 ? 0.3078 0.2935 0.2904 -0.0070 -0.0096 0.0091  224 LYS A CD    
1754 C CE    A LYS A 227 ? 0.3477 0.3388 0.3317 -0.0057 -0.0087 0.0098  224 LYS A CE    
1755 C CE    B LYS A 227 ? 0.3655 0.3558 0.3498 -0.0060 -0.0073 0.0113  224 LYS A CE    
1756 N NZ    A LYS A 227 ? 0.3159 0.3068 0.2933 -0.0026 -0.0089 0.0095  224 LYS A NZ    
1757 N NZ    B LYS A 227 ? 0.3824 0.3779 0.3764 -0.0083 -0.0076 0.0111  224 LYS A NZ    
1758 N N     . LEU A 228 ? 0.1494 0.1203 0.1321 -0.0078 -0.0076 0.0136  225 LEU A N     
1759 C CA    . LEU A 228 ? 0.1482 0.1171 0.1282 -0.0063 -0.0062 0.0176  225 LEU A CA    
1760 C C     . LEU A 228 ? 0.1901 0.1582 0.1656 -0.0036 -0.0087 0.0179  225 LEU A C     
1761 O O     . LEU A 228 ? 0.1801 0.1483 0.1500 -0.0015 -0.0097 0.0193  225 LEU A O     
1762 C CB    . LEU A 228 ? 0.1715 0.1358 0.1556 -0.0074 -0.0042 0.0199  225 LEU A CB    
1763 C CG    . LEU A 228 ? 0.2381 0.1997 0.2186 -0.0053 -0.0021 0.0252  225 LEU A CG    
1764 C CD1   . LEU A 228 ? 0.2684 0.2330 0.2466 -0.0046 0.0010  0.0280  225 LEU A CD1   
1765 C CD2   . LEU A 228 ? 0.2228 0.1788 0.2082 -0.0064 0.0001  0.0276  225 LEU A CD2   
1766 N N     . ALA A 229 ? 0.1808 0.1478 0.1590 -0.0035 -0.0098 0.0163  226 ALA A N     
1767 C CA    . ALA A 229 ? 0.1672 0.1346 0.1454 -0.0016 -0.0124 0.0168  226 ALA A CA    
1768 C C     . ALA A 229 ? 0.1739 0.1438 0.1492 -0.0012 -0.0147 0.0155  226 ALA A C     
1769 O O     . ALA A 229 ? 0.1749 0.1445 0.1483 0.0001  -0.0179 0.0163  226 ALA A O     
1770 C CB    . ALA A 229 ? 0.1685 0.1354 0.1517 -0.0012 -0.0115 0.0157  226 ALA A CB    
1771 N N     . CYS A 230 ? 0.1593 0.1313 0.1343 -0.0022 -0.0136 0.0133  227 CYS A N     
1772 C CA    . CYS A 230 ? 0.1664 0.1396 0.1392 -0.0017 -0.0154 0.0120  227 CYS A CA    
1773 C C     . CYS A 230 ? 0.1944 0.1663 0.1607 -0.0002 -0.0170 0.0126  227 CYS A C     
1774 O O     . CYS A 230 ? 0.2177 0.1881 0.1818 0.0007  -0.0204 0.0117  227 CYS A O     
1775 C CB    . CYS A 230 ? 0.1429 0.1182 0.1154 -0.0023 -0.0137 0.0101  227 CYS A CB    
1776 S SG    . CYS A 230 ? 0.1865 0.1622 0.1565 -0.0012 -0.0151 0.0089  227 CYS A SG    
1777 N N     . GLY A 231 ? 0.1791 0.1508 0.1424 0.0002  -0.0145 0.0142  228 GLY A N     
1778 C CA    . GLY A 231 ? 0.2266 0.1963 0.1814 0.0029  -0.0144 0.0152  228 GLY A CA    
1779 C C     . GLY A 231 ? 0.2296 0.1952 0.1786 0.0052  -0.0175 0.0168  228 GLY A C     
1780 O O     . GLY A 231 ? 0.2631 0.2254 0.2020 0.0085  -0.0184 0.0171  228 GLY A O     
1781 N N     . LEU A 232 ? 0.2008 0.1662 0.1553 0.0043  -0.0194 0.0178  229 LEU A N     
1782 C CA    . LEU A 232 ? 0.2032 0.1654 0.1530 0.0070  -0.0229 0.0198  229 LEU A CA    
1783 C C     . LEU A 232 ? 0.2152 0.1756 0.1612 0.0084  -0.0301 0.0173  229 LEU A C     
1784 O O     . LEU A 232 ? 0.2380 0.1944 0.1747 0.0118  -0.0340 0.0180  229 LEU A O     
1785 C CB    . LEU A 232 ? 0.1851 0.1479 0.1431 0.0062  -0.0228 0.0219  229 LEU A CB    
1786 C CG    . LEU A 232 ? 0.2126 0.1746 0.1732 0.0050  -0.0169 0.0243  229 LEU A CG    
1787 C CD1   . LEU A 232 ? 0.2217 0.1826 0.1895 0.0050  -0.0168 0.0260  229 LEU A CD1   
1788 C CD2   . LEU A 232 ? 0.2746 0.2336 0.2266 0.0073  -0.0139 0.0279  229 LEU A CD2   
1789 N N     . ASN A 233 ? 0.1791 0.1417 0.1321 0.0061  -0.0320 0.0144  230 ASN A N     
1790 C CA    . ASN A 233 ? 0.1975 0.1581 0.1503 0.0064  -0.0393 0.0118  230 ASN A CA    
1791 C C     . ASN A 233 ? 0.2713 0.2316 0.2250 0.0048  -0.0385 0.0088  230 ASN A C     
1792 O O     . ASN A 233 ? 0.4123 0.3758 0.3767 0.0021  -0.0376 0.0087  230 ASN A O     
1793 C CB    . ASN A 233 ? 0.1802 0.1441 0.1460 0.0048  -0.0434 0.0129  230 ASN A CB    
1794 C CG    . ASN A 233 ? 0.1747 0.1383 0.1392 0.0072  -0.0453 0.0160  230 ASN A CG    
1795 O OD1   . ASN A 233 ? 0.2542 0.2142 0.2107 0.0101  -0.0517 0.0156  230 ASN A OD1   
1796 N ND2   . ASN A 233 ? 0.1911 0.1573 0.1625 0.0066  -0.0402 0.0188  230 ASN A ND2   
1797 N N     . LYS A 234 ? 0.3671 0.3235 0.3090 0.0072  -0.0379 0.0071  231 LYS A N     
1798 C CA    . LYS A 234 ? 0.3016 0.2564 0.2428 0.0068  -0.0373 0.0044  231 LYS A CA    
1799 C C     . LYS A 234 ? 0.3423 0.2895 0.2737 0.0092  -0.0441 0.0008  231 LYS A C     
1800 O O     . LYS A 234 ? 0.4192 0.3623 0.3398 0.0125  -0.0473 0.0006  231 LYS A O     
1801 C CB    . LYS A 234 ? 0.3618 0.3184 0.2981 0.0082  -0.0301 0.0053  231 LYS A CB    
1802 C CG    . LYS A 234 ? 0.4421 0.4049 0.3884 0.0053  -0.0252 0.0067  231 LYS A CG    
1803 C CD    . LYS A 234 ? 0.4609 0.4254 0.4043 0.0067  -0.0206 0.0065  231 LYS A CD    
1804 C CE    . LYS A 234 ? 0.4509 0.4203 0.4026 0.0045  -0.0182 0.0066  231 LYS A CE    
1805 N NZ    . LYS A 234 ? 0.2620 0.2296 0.2138 0.0051  -0.0190 0.0050  231 LYS A NZ    
1806 N N     . PRO A 235 ? 0.2369 0.1810 0.1711 0.0079  -0.0467 -0.0023 232 PRO A N     
1807 C CA    . PRO A 235 ? 0.2201 0.1678 0.1656 0.0048  -0.0431 -0.0015 232 PRO A CA    
1808 C C     . PRO A 235 ? 0.2147 0.1646 0.1756 0.0008  -0.0470 -0.0009 232 PRO A C     
1809 O O     . PRO A 235 ? 0.2535 0.2023 0.2175 0.0002  -0.0538 -0.0016 232 PRO A O     
1810 C CB    . PRO A 235 ? 0.2984 0.2392 0.2363 0.0067  -0.0439 -0.0049 232 PRO A CB    
1811 C CG    . PRO A 235 ? 0.3445 0.2771 0.2734 0.0087  -0.0523 -0.0088 232 PRO A CG    
1812 C CD    . PRO A 235 ? 0.2979 0.2325 0.2205 0.0107  -0.0529 -0.0068 232 PRO A CD    
1813 N N     . ASN A 236 ? 0.1840 0.1371 0.1545 -0.0014 -0.0426 0.0008  233 ASN A N     
1814 C CA    . ASN A 236 ? 0.1824 0.1373 0.1686 -0.0048 -0.0443 0.0024  233 ASN A CA    
1815 C C     . ASN A 236 ? 0.1448 0.1054 0.1409 -0.0060 -0.0456 0.0051  233 ASN A C     
1816 O O     . ASN A 236 ? 0.1731 0.1347 0.1819 -0.0083 -0.0503 0.0057  233 ASN A O     
1817 C CB    . ASN A 236 ? 0.2156 0.1636 0.2043 -0.0062 -0.0517 -0.0008 233 ASN A CB    
1818 C CG    . ASN A 236 ? 0.2192 0.1689 0.2261 -0.0100 -0.0514 0.0017  233 ASN A CG    
1819 O OD1   . ASN A 236 ? 0.2646 0.2184 0.2774 -0.0104 -0.0437 0.0056  233 ASN A OD1   
1820 N ND2   . ASN A 236 ? 0.2657 0.2120 0.2818 -0.0127 -0.0598 -0.0003 233 ASN A ND2   
1821 N N     . ARG A 237 ? 0.1676 0.1319 0.1592 -0.0044 -0.0414 0.0068  234 ARG A N     
1822 C CA    . ARG A 237 ? 0.1787 0.1478 0.1790 -0.0047 -0.0415 0.0096  234 ARG A CA    
1823 C C     . ARG A 237 ? 0.1563 0.1286 0.1553 -0.0038 -0.0338 0.0118  234 ARG A C     
1824 O O     . ARG A 237 ? 0.1781 0.1493 0.1685 -0.0030 -0.0298 0.0108  234 ARG A O     
1825 C CB    . ARG A 237 ? 0.1941 0.1613 0.1876 -0.0028 -0.0476 0.0087  234 ARG A CB    
1826 C CG    . ARG A 237 ? 0.2050 0.1680 0.1982 -0.0031 -0.0576 0.0057  234 ARG A CG    
1827 C CD    . ARG A 237 ? 0.2262 0.1934 0.2392 -0.0062 -0.0619 0.0072  234 ARG A CD    
1828 N NE    . ARG A 237 ? 0.2585 0.2217 0.2731 -0.0070 -0.0734 0.0038  234 ARG A NE    
1829 C CZ    . ARG A 237 ? 0.3844 0.3427 0.4022 -0.0094 -0.0778 0.0006  234 ARG A CZ    
1830 N NH1   . ARG A 237 ? 0.3622 0.3194 0.3817 -0.0108 -0.0708 0.0011  234 ARG A NH1   
1831 N NH2   . ARG A 237 ? 0.3963 0.3501 0.4152 -0.0101 -0.0896 -0.0033 234 ARG A NH2   
1832 N N     . GLN A 238 ? 0.1486 0.1247 0.1566 -0.0037 -0.0319 0.0145  235 GLN A N     
1833 C CA    . GLN A 238 ? 0.1442 0.1215 0.1497 -0.0025 -0.0255 0.0157  235 GLN A CA    
1834 C C     . GLN A 238 ? 0.1303 0.1084 0.1372 -0.0012 -0.0265 0.0174  235 GLN A C     
1835 O O     . GLN A 238 ? 0.1625 0.1422 0.1765 -0.0010 -0.0313 0.0187  235 GLN A O     
1836 C CB    . GLN A 238 ? 0.1620 0.1413 0.1746 -0.0024 -0.0197 0.0176  235 GLN A CB    
1837 C CG    . GLN A 238 ? 0.1718 0.1548 0.1998 -0.0027 -0.0199 0.0208  235 GLN A CG    
1838 C CD    . GLN A 238 ? 0.1633 0.1477 0.1967 -0.0016 -0.0125 0.0236  235 GLN A CD    
1839 O OE1   . GLN A 238 ? 0.1882 0.1711 0.2201 -0.0022 -0.0105 0.0236  235 GLN A OE1   
1840 N NE2   . GLN A 238 ? 0.1519 0.1384 0.1910 0.0007  -0.0078 0.0262  235 GLN A NE2   
1841 N N     . THR A 239 ? 0.1318 0.1083 0.1326 -0.0002 -0.0224 0.0173  236 THR A N     
1842 C CA    . THR A 239 ? 0.1191 0.0947 0.1196 0.0013  -0.0227 0.0191  236 THR A CA    
1843 C C     . THR A 239 ? 0.1423 0.1169 0.1448 0.0022  -0.0170 0.0197  236 THR A C     
1844 O O     . THR A 239 ? 0.1622 0.1350 0.1596 0.0016  -0.0135 0.0177  236 THR A O     
1845 C CB    . THR A 239 ? 0.1572 0.1295 0.1467 0.0016  -0.0240 0.0186  236 THR A CB    
1846 O OG1   . THR A 239 ? 0.1587 0.1303 0.1437 0.0018  -0.0292 0.0174  236 THR A OG1   
1847 C CG2   . THR A 239 ? 0.2012 0.1715 0.1903 0.0036  -0.0243 0.0214  236 THR A CG2   
1848 N N     . LEU A 240 ? 0.1415 0.1169 0.1512 0.0041  -0.0167 0.0222  237 LEU A N     
1849 C CA    . LEU A 240 ? 0.1357 0.1085 0.1464 0.0060  -0.0114 0.0226  237 LEU A CA    
1850 C C     . LEU A 240 ? 0.1466 0.1149 0.1528 0.0067  -0.0118 0.0235  237 LEU A C     
1851 O O     . LEU A 240 ? 0.1577 0.1267 0.1661 0.0081  -0.0153 0.0262  237 LEU A O     
1852 C CB    . LEU A 240 ? 0.1463 0.1228 0.1691 0.0085  -0.0096 0.0256  237 LEU A CB    
1853 C CG    . LEU A 240 ? 0.1603 0.1338 0.1843 0.0118  -0.0031 0.0261  237 LEU A CG    
1854 C CD1   . LEU A 240 ? 0.1774 0.1562 0.2142 0.0144  0.0004  0.0295  237 LEU A CD1   
1855 C CD2   . LEU A 240 ? 0.1649 0.1338 0.1874 0.0137  -0.0033 0.0271  237 LEU A CD2   
1856 N N     . VAL A 241 ? 0.1359 0.0994 0.1360 0.0058  -0.0087 0.0213  238 VAL A N     
1857 C CA    . VAL A 241 ? 0.1426 0.1007 0.1401 0.0061  -0.0079 0.0224  238 VAL A CA    
1858 C C     . VAL A 241 ? 0.1767 0.1295 0.1760 0.0081  -0.0039 0.0215  238 VAL A C     
1859 O O     . VAL A 241 ? 0.1811 0.1307 0.1768 0.0073  -0.0018 0.0177  238 VAL A O     
1860 C CB    . VAL A 241 ? 0.1330 0.0892 0.1244 0.0030  -0.0078 0.0208  238 VAL A CB    
1861 C CG1   . VAL A 241 ? 0.1665 0.1159 0.1576 0.0025  -0.0056 0.0219  238 VAL A CG1   
1862 C CG2   . VAL A 241 ? 0.1708 0.1303 0.1586 0.0026  -0.0109 0.0225  238 VAL A CG2   
1863 N N     . SER A 242 ? 0.1467 0.0982 0.1509 0.0113  -0.0034 0.0247  239 SER A N     
1864 C CA    . SER A 242 ? 0.1307 0.0761 0.1363 0.0144  0.0008  0.0241  239 SER A CA    
1865 C C     . SER A 242 ? 0.1538 0.0899 0.1552 0.0131  0.0018  0.0230  239 SER A C     
1866 O O     . SER A 242 ? 0.1649 0.1003 0.1644 0.0106  0.0000  0.0248  239 SER A O     
1867 C CB    . SER A 242 ? 0.1800 0.1284 0.1945 0.0188  0.0011  0.0285  239 SER A CB    
1868 O OG    . SER A 242 ? 0.2210 0.1688 0.2360 0.0193  -0.0023 0.0323  239 SER A OG    
1869 N N     . HIS A 243 ? 0.1492 0.1194 0.1391 0.0196  -0.0153 0.0172  240 HIS A N     
1870 C CA    . HIS A 243 ? 0.1487 0.1150 0.1348 0.0204  -0.0120 0.0164  240 HIS A CA    
1871 C C     . HIS A 243 ? 0.1531 0.1220 0.1420 0.0242  -0.0108 0.0176  240 HIS A C     
1872 O O     . HIS A 243 ? 0.1651 0.1329 0.1521 0.0248  -0.0109 0.0169  240 HIS A O     
1873 C CB    . HIS A 243 ? 0.1726 0.1333 0.1539 0.0187  -0.0069 0.0162  240 HIS A CB    
1874 C CG    . HIS A 243 ? 0.1995 0.1547 0.1759 0.0187  -0.0037 0.0151  240 HIS A CG    
1875 N ND1   . HIS A 243 ? 0.2488 0.2012 0.2207 0.0157  -0.0056 0.0136  240 HIS A ND1   
1876 C CD2   . HIS A 243 ? 0.2904 0.2422 0.2659 0.0210  0.0012  0.0156  240 HIS A CD2   
1877 C CE1   . HIS A 243 ? 0.2720 0.2193 0.2398 0.0158  -0.0020 0.0130  240 HIS A CE1   
1878 N NE2   . HIS A 243 ? 0.2846 0.2308 0.2542 0.0191  0.0022  0.0142  240 HIS A NE2   
1879 N N     . GLY A 244 ? 0.1658 0.1387 0.1596 0.0265  -0.0098 0.0197  241 GLY A N     
1880 C CA    . GLY A 244 ? 0.1739 0.1497 0.1709 0.0300  -0.0091 0.0218  241 GLY A CA    
1881 C C     . GLY A 244 ? 0.1473 0.1273 0.1452 0.0304  -0.0138 0.0214  241 GLY A C     
1882 O O     . GLY A 244 ? 0.1797 0.1608 0.1776 0.0325  -0.0135 0.0227  241 GLY A O     
1883 N N     . SER A 245 ? 0.1306 0.1123 0.1286 0.0283  -0.0180 0.0196  242 SER A N     
1884 C CA    . SER A 245 ? 0.1365 0.1215 0.1348 0.0286  -0.0219 0.0183  242 SER A CA    
1885 C C     . SER A 245 ? 0.1476 0.1300 0.1418 0.0282  -0.0215 0.0162  242 SER A C     
1886 O O     . SER A 245 ? 0.1720 0.1570 0.1656 0.0287  -0.0235 0.0151  242 SER A O     
1887 C CB    . SER A 245 ? 0.1370 0.1235 0.1370 0.0267  -0.0263 0.0168  242 SER A CB    
1888 O OG    . SER A 245 ? 0.1742 0.1568 0.1719 0.0248  -0.0271 0.0145  242 SER A OG    
1889 N N     . VAL A 246 ? 0.1571 0.1346 0.1482 0.0270  -0.0188 0.0156  243 VAL A N     
1890 C CA    . VAL A 246 ? 0.1642 0.1402 0.1523 0.0260  -0.0188 0.0136  243 VAL A CA    
1891 C C     . VAL A 246 ? 0.1658 0.1428 0.1521 0.0273  -0.0173 0.0142  243 VAL A C     
1892 O O     . VAL A 246 ? 0.1718 0.1513 0.1576 0.0270  -0.0188 0.0124  243 VAL A O     
1893 C CB    . VAL A 246 ? 0.1496 0.1205 0.1344 0.0235  -0.0168 0.0129  243 VAL A CB    
1894 C CG1   . VAL A 246 ? 0.2150 0.1851 0.1973 0.0221  -0.0166 0.0114  243 VAL A CG1   
1895 C CG2   . VAL A 246 ? 0.1754 0.1459 0.1614 0.0215  -0.0196 0.0122  243 VAL A CG2   
1896 N N     . PRO A 247 ? 0.1590 0.1340 0.1445 0.0288  -0.0142 0.0169  244 PRO A N     
1897 C CA    . PRO A 247 ? 0.1543 0.1297 0.1375 0.0296  -0.0131 0.0180  244 PRO A CA    
1898 C C     . PRO A 247 ? 0.1698 0.1512 0.1539 0.0303  -0.0164 0.0176  244 PRO A C     
1899 O O     . PRO A 247 ? 0.1858 0.1686 0.1673 0.0294  -0.0165 0.0163  244 PRO A O     
1900 C CB    . PRO A 247 ? 0.1703 0.1424 0.1538 0.0317  -0.0099 0.0214  244 PRO A CB    
1901 C CG    . PRO A 247 ? 0.1562 0.1236 0.1397 0.0310  -0.0074 0.0207  244 PRO A CG    
1902 C CD    . PRO A 247 ? 0.1537 0.1249 0.1397 0.0297  -0.0109 0.0188  244 PRO A CD    
1903 N N     . GLN A 248 ? 0.1541 0.1393 0.1415 0.0314  -0.0188 0.0187  245 GLN A N     
1904 C CA    . GLN A 248 ? 0.1644 0.1547 0.1515 0.0314  -0.0220 0.0180  245 GLN A CA    
1905 C C     . GLN A 248 ? 0.1734 0.1648 0.1600 0.0300  -0.0240 0.0135  245 GLN A C     
1906 O O     . GLN A 248 ? 0.1599 0.1536 0.1439 0.0295  -0.0244 0.0117  245 GLN A O     
1907 C CB    . GLN A 248 ? 0.1764 0.1706 0.1671 0.0323  -0.0245 0.0203  245 GLN A CB    
1908 C CG    . GLN A 248 ? 0.2499 0.2447 0.2421 0.0344  -0.0230 0.0252  245 GLN A CG    
1909 C CD    . GLN A 248 ? 0.4506 0.4517 0.4452 0.0349  -0.0266 0.0280  245 GLN A CD    
1910 O OE1   . GLN A 248 ? 0.5352 0.5390 0.5263 0.0340  -0.0288 0.0279  245 GLN A OE1   
1911 N NE2   . GLN A 248 ? 0.3887 0.3924 0.3892 0.0360  -0.0271 0.0305  245 GLN A NE2   
1912 N N     . LEU A 249 ? 0.1390 0.1285 0.1279 0.0293  -0.0249 0.0118  246 LEU A N     
1913 C CA    . LEU A 249 ? 0.1407 0.1307 0.1303 0.0284  -0.0270 0.0080  246 LEU A CA    
1914 C C     . LEU A 249 ? 0.1113 0.1013 0.0991 0.0280  -0.0251 0.0061  246 LEU A C     
1915 O O     . LEU A 249 ? 0.1609 0.1534 0.1486 0.0281  -0.0259 0.0031  246 LEU A O     
1916 C CB    . LEU A 249 ? 0.1698 0.1570 0.1620 0.0275  -0.0283 0.0076  246 LEU A CB    
1917 C CG    . LEU A 249 ? 0.1912 0.1781 0.1854 0.0271  -0.0309 0.0043  246 LEU A CG    
1918 C CD1   . LEU A 249 ? 0.2029 0.1919 0.1978 0.0277  -0.0336 0.0021  246 LEU A CD1   
1919 C CD2   . LEU A 249 ? 0.2043 0.1879 0.2003 0.0257  -0.0323 0.0051  246 LEU A CD2   
1920 N N     . PHE A 250 ? 0.1397 0.1268 0.1260 0.0272  -0.0223 0.0077  247 PHE A N     
1921 C CA    . PHE A 250 ? 0.1297 0.1172 0.1146 0.0261  -0.0207 0.0063  247 PHE A CA    
1922 C C     . PHE A 250 ? 0.1532 0.1431 0.1350 0.0262  -0.0188 0.0068  247 PHE A C     
1923 O O     . PHE A 250 ? 0.1609 0.1529 0.1420 0.0251  -0.0175 0.0053  247 PHE A O     
1924 C CB    . PHE A 250 ? 0.1384 0.1214 0.1220 0.0243  -0.0186 0.0076  247 PHE A CB    
1925 C CG    . PHE A 250 ? 0.1317 0.1133 0.1176 0.0231  -0.0206 0.0064  247 PHE A CG    
1926 C CD1   . PHE A 250 ? 0.1699 0.1477 0.1537 0.0206  -0.0193 0.0071  247 PHE A CD1   
1927 C CD2   . PHE A 250 ? 0.1835 0.1670 0.1732 0.0239  -0.0240 0.0048  247 PHE A CD2   
1928 C CE1   . PHE A 250 ? 0.1587 0.1354 0.1439 0.0189  -0.0215 0.0066  247 PHE A CE1   
1929 C CE2   . PHE A 250 ? 0.1582 0.1400 0.1498 0.0226  -0.0262 0.0045  247 PHE A CE2   
1930 C CZ    . PHE A 250 ? 0.1580 0.1367 0.1472 0.0200  -0.0251 0.0055  247 PHE A CZ    
1931 N N     . SER A 251 ? 0.1470 0.1371 0.1269 0.0272  -0.0188 0.0094  248 SER A N     
1932 C CA    . SER A 251 ? 0.1598 0.1515 0.1357 0.0269  -0.0172 0.0109  248 SER A CA    
1933 C C     . SER A 251 ? 0.1639 0.1607 0.1385 0.0264  -0.0178 0.0077  248 SER A C     
1934 O O     . SER A 251 ? 0.1754 0.1739 0.1465 0.0252  -0.0158 0.0081  248 SER A O     
1935 C CB    . SER A 251 ? 0.1446 0.1358 0.1195 0.0282  -0.0176 0.0150  248 SER A CB    
1936 O OG    . SER A 251 ? 0.1741 0.1693 0.1501 0.0289  -0.0209 0.0143  248 SER A OG    
1937 N N     . GLN A 252 ? 0.1685 0.1673 0.1456 0.0271  -0.0203 0.0044  249 GLN A N     
1938 C CA    . GLN A 252 ? 0.1773 0.1801 0.1533 0.0269  -0.0204 0.0005  249 GLN A CA    
1939 C C     . GLN A 252 ? 0.1884 0.1917 0.1693 0.0276  -0.0211 -0.0037 249 GLN A C     
1940 O O     . GLN A 252 ? 0.2154 0.2211 0.1967 0.0283  -0.0216 -0.0077 249 GLN A O     
1941 C CB    . GLN A 252 ? 0.2410 0.2454 0.2145 0.0271  -0.0229 0.0001  249 GLN A CB    
1942 C CG    . GLN A 252 ? 0.2356 0.2409 0.2046 0.0265  -0.0229 0.0044  249 GLN A CG    
1943 C CD    . GLN A 252 ? 0.2778 0.2856 0.2435 0.0258  -0.0257 0.0036  249 GLN A CD    
1944 O OE1   . GLN A 252 ? 0.3427 0.3533 0.3033 0.0244  -0.0250 0.0014  249 GLN A OE1   
1945 N NE2   . GLN A 252 ? 0.2681 0.2754 0.2364 0.0263  -0.0289 0.0052  249 GLN A NE2   
1946 N N     . MET A 253 ? 0.1602 0.1610 0.1447 0.0275  -0.0212 -0.0028 250 MET A N     
1947 C CA    . MET A 253 ? 0.1606 0.1616 0.1505 0.0283  -0.0228 -0.0057 250 MET A CA    
1948 C C     . MET A 253 ? 0.1433 0.1479 0.1353 0.0278  -0.0205 -0.0073 250 MET A C     
1949 O O     . MET A 253 ? 0.1392 0.1432 0.1306 0.0260  -0.0190 -0.0049 250 MET A O     
1950 C CB    . MET A 253 ? 0.1708 0.1674 0.1629 0.0278  -0.0245 -0.0034 250 MET A CB    
1951 C CG    . MET A 253 ? 0.1843 0.1804 0.1820 0.0283  -0.0271 -0.0054 250 MET A CG    
1952 S SD    . MET A 253 ? 0.2287 0.2244 0.2290 0.0304  -0.0301 -0.0089 250 MET A SD    
1953 C CE    . MET A 253 ? 0.2283 0.2205 0.2260 0.0296  -0.0322 -0.0061 250 MET A CE    
1954 N N     . PRO A 254 ? 0.1685 0.1770 0.1634 0.0292  -0.0201 -0.0113 251 PRO A N     
1955 C CA    . PRO A 254 ? 0.1595 0.1728 0.1581 0.0288  -0.0179 -0.0127 251 PRO A CA    
1956 C C     . PRO A 254 ? 0.1732 0.1855 0.1769 0.0281  -0.0196 -0.0109 251 PRO A C     
1957 O O     . PRO A 254 ? 0.1601 0.1690 0.1667 0.0290  -0.0228 -0.0107 251 PRO A O     
1958 C CB    . PRO A 254 ? 0.1799 0.1966 0.1821 0.0314  -0.0175 -0.0177 251 PRO A CB    
1959 C CG    . PRO A 254 ? 0.1753 0.1892 0.1720 0.0318  -0.0185 -0.0189 251 PRO A CG    
1960 C CD    . PRO A 254 ? 0.1635 0.1720 0.1585 0.0310  -0.0215 -0.0150 251 PRO A CD    
1961 N N     . ILE A 255 ? 0.1494 0.1645 0.1534 0.0258  -0.0176 -0.0094 252 ILE A N     
1962 C CA    . ILE A 255 ? 0.1372 0.1516 0.1448 0.0241  -0.0193 -0.0074 252 ILE A CA    
1963 C C     . ILE A 255 ? 0.1562 0.1728 0.1722 0.0264  -0.0224 -0.0092 252 ILE A C     
1964 O O     . ILE A 255 ? 0.1559 0.1692 0.1737 0.0256  -0.0257 -0.0073 252 ILE A O     
1965 C CB    . ILE A 255 ? 0.1404 0.1587 0.1473 0.0210  -0.0166 -0.0061 252 ILE A CB    
1966 C CG1   . ILE A 255 ? 0.2206 0.2334 0.2189 0.0184  -0.0146 -0.0032 252 ILE A CG1   
1967 C CG2   . ILE A 255 ? 0.1764 0.1967 0.1888 0.0190  -0.0188 -0.0048 252 ILE A CG2   
1968 C CD1   . ILE A 255 ? 0.2715 0.2874 0.2674 0.0153  -0.0113 -0.0021 252 ILE A CD1   
1969 N N     . ARG A 256 ? 0.1383 0.1599 0.1592 0.0293  -0.0214 -0.0128 253 ARG A N     
1970 C CA    . ARG A 256 ? 0.1129 0.1366 0.1430 0.0322  -0.0240 -0.0145 253 ARG A CA    
1971 C C     . ARG A 256 ? 0.1595 0.1761 0.1897 0.0337  -0.0281 -0.0143 253 ARG A C     
1972 O O     . ARG A 256 ? 0.1762 0.1928 0.2136 0.0356  -0.0312 -0.0144 253 ARG A O     
1973 C CB    . ARG A 256 ? 0.1416 0.1715 0.1767 0.0354  -0.0211 -0.0191 253 ARG A CB    
1974 C CG    . ARG A 256 ? 0.1623 0.1887 0.1922 0.0374  -0.0199 -0.0226 253 ARG A CG    
1975 C CD    . ARG A 256 ? 0.2062 0.2382 0.2400 0.0403  -0.0163 -0.0277 253 ARG A CD    
1976 N NE    . ARG A 256 ? 0.2216 0.2498 0.2482 0.0411  -0.0152 -0.0311 253 ARG A NE    
1977 C CZ    . ARG A 256 ? 0.2336 0.2629 0.2514 0.0388  -0.0122 -0.0313 253 ARG A CZ    
1978 N NH1   . ARG A 256 ? 0.2467 0.2802 0.2619 0.0358  -0.0098 -0.0284 253 ARG A NH1   
1979 N NH2   . ARG A 256 ? 0.2411 0.2670 0.2525 0.0391  -0.0120 -0.0342 253 ARG A NH2   
1980 N N     . LYS A 257 ? 0.1702 0.1813 0.1931 0.0329  -0.0283 -0.0137 254 LYS A N     
1981 C CA    . LYS A 257 ? 0.1673 0.1722 0.1902 0.0339  -0.0320 -0.0134 254 LYS A CA    
1982 C C     . LYS A 257 ? 0.2106 0.2117 0.2335 0.0315  -0.0351 -0.0095 254 LYS A C     
1983 O O     . LYS A 257 ? 0.2188 0.2155 0.2431 0.0320  -0.0385 -0.0088 254 LYS A O     
1984 C CB    . LYS A 257 ? 0.1766 0.1781 0.1926 0.0336  -0.0313 -0.0139 254 LYS A CB    
1985 C CG    . LYS A 257 ? 0.2265 0.2308 0.2405 0.0352  -0.0287 -0.0178 254 LYS A CG    
1986 C CD    . LYS A 257 ? 0.2553 0.2601 0.2752 0.0384  -0.0294 -0.0222 254 LYS A CD    
1987 C CE    . LYS A 257 ? 0.3455 0.3525 0.3618 0.0395  -0.0263 -0.0267 254 LYS A CE    
1988 N NZ    . LYS A 257 ? 0.3915 0.3975 0.4130 0.0429  -0.0264 -0.0318 254 LYS A NZ    
1989 N N     . ILE A 258 ? 0.1522 0.1545 0.1727 0.0286  -0.0338 -0.0068 255 ILE A N     
1990 C CA    . ILE A 258 ? 0.1633 0.1617 0.1819 0.0256  -0.0362 -0.0033 255 ILE A CA    
1991 C C     . ILE A 258 ? 0.1847 0.1857 0.2103 0.0254  -0.0395 -0.0024 255 ILE A C     
1992 O O     . ILE A 258 ? 0.1773 0.1846 0.2080 0.0259  -0.0386 -0.0032 255 ILE A O     
1993 C CB    . ILE A 258 ? 0.1754 0.1725 0.1873 0.0221  -0.0332 -0.0012 255 ILE A CB    
1994 C CG1   . ILE A 258 ? 0.2484 0.2415 0.2539 0.0223  -0.0310 -0.0008 255 ILE A CG1   
1995 C CG2   . ILE A 258 ? 0.1972 0.1914 0.2075 0.0185  -0.0353 0.0017  255 ILE A CG2   
1996 C CD1   . ILE A 258 ? 0.3395 0.3349 0.3450 0.0251  -0.0296 -0.0032 255 ILE A CD1   
1997 N N     . ARG A 259 ? 0.1758 0.1725 0.2019 0.0245  -0.0435 -0.0002 256 ARG A N     
1998 C CA    . ARG A 259 ? 0.1937 0.1926 0.2268 0.0244  -0.0476 0.0014  256 ARG A CA    
1999 C C     . ARG A 259 ? 0.2220 0.2257 0.2555 0.0210  -0.0472 0.0033  256 ARG A C     
2000 O O     . ARG A 259 ? 0.1950 0.1957 0.2209 0.0168  -0.0460 0.0051  256 ARG A O     
2001 C CB    . ARG A 259 ? 0.2171 0.2098 0.2484 0.0226  -0.0520 0.0043  256 ARG A CB    
2002 C CG    . ARG A 259 ? 0.2716 0.2661 0.3107 0.0230  -0.0572 0.0066  256 ARG A CG    
2003 C CD    . ARG A 259 ? 0.3418 0.3298 0.3778 0.0204  -0.0616 0.0101  256 ARG A CD    
2004 N NE    . ARG A 259 ? 0.4721 0.4605 0.5167 0.0224  -0.0670 0.0119  256 ARG A NE    
2005 C CZ    . ARG A 259 ? 0.7190 0.7092 0.7660 0.0198  -0.0714 0.0159  256 ARG A CZ    
2006 N NH1   . ARG A 259 ? 0.7678 0.7592 0.8083 0.0144  -0.0709 0.0181  256 ARG A NH1   
2007 N NH2   . ARG A 259 ? 0.8052 0.7957 0.8611 0.0223  -0.0765 0.0179  256 ARG A NH2   
2008 N N     . SER A 260 ? 0.1857 0.1966 0.2285 0.0230  -0.0482 0.0028  257 SER A N     
2009 C CA    . SER A 260 ? 0.1569 0.1744 0.2027 0.0200  -0.0484 0.0046  257 SER A CA    
2010 C C     . SER A 260 ? 0.1681 0.1916 0.2140 0.0202  -0.0432 0.0021  257 SER A C     
2011 O O     . SER A 260 ? 0.1686 0.1994 0.2190 0.0183  -0.0429 0.0031  257 SER A O     
2012 C CB    . SER A 260 ? 0.2174 0.2310 0.2556 0.0137  -0.0504 0.0082  257 SER A CB    
2013 O OG    . SER A 260 ? 0.2258 0.2358 0.2542 0.0108  -0.0459 0.0075  257 SER A OG    
2014 N N     . LEU A 261 ? 0.1347 0.1556 0.1757 0.0223  -0.0392 -0.0007 258 LEU A N     
2015 C CA    . LEU A 261 ? 0.1281 0.1540 0.1678 0.0222  -0.0342 -0.0027 258 LEU A CA    
2016 C C     . LEU A 261 ? 0.1646 0.1955 0.2108 0.0273  -0.0320 -0.0067 258 LEU A C     
2017 O O     . LEU A 261 ? 0.1409 0.1754 0.1851 0.0275  -0.0276 -0.0088 258 LEU A O     
2018 C CB    . LEU A 261 ? 0.1302 0.1498 0.1587 0.0201  -0.0310 -0.0025 258 LEU A CB    
2019 C CG    . LEU A 261 ? 0.1504 0.1643 0.1716 0.0151  -0.0317 0.0007  258 LEU A CG    
2020 C CD1   . LEU A 261 ? 0.1486 0.1567 0.1605 0.0143  -0.0281 0.0008  258 LEU A CD1   
2021 C CD2   . LEU A 261 ? 0.1715 0.1905 0.1947 0.0110  -0.0318 0.0024  258 LEU A CD2   
2022 N N     . GLY A 262 ? 0.1559 0.1867 0.2096 0.0312  -0.0350 -0.0078 259 GLY A N     
2023 C CA    . GLY A 262 ? 0.1582 0.1925 0.2179 0.0362  -0.0328 -0.0122 259 GLY A CA    
2024 C C     . GLY A 262 ? 0.1457 0.1909 0.2159 0.0380  -0.0308 -0.0135 259 GLY A C     
2025 O O     . GLY A 262 ? 0.1693 0.2179 0.2450 0.0425  -0.0281 -0.0177 259 GLY A O     
2026 N N     . GLY A 263 ? 0.1356 0.1864 0.2087 0.0344  -0.0318 -0.0101 260 GLY A N     
2027 C CA    . GLY A 263 ? 0.1705 0.2330 0.2552 0.0356  -0.0306 -0.0104 260 GLY A CA    
2028 C C     . GLY A 263 ? 0.1527 0.2221 0.2345 0.0310  -0.0268 -0.0094 260 GLY A C     
2029 O O     . GLY A 263 ? 0.1590 0.2253 0.2309 0.0290  -0.0228 -0.0108 260 GLY A O     
2030 N N     . LYS A 264 ? 0.1548 0.2332 0.2453 0.0289  -0.0283 -0.0068 261 LYS A N     
2031 C CA    . LYS A 264 ? 0.1449 0.2308 0.2340 0.0240  -0.0249 -0.0057 261 LYS A CA    
2032 C C     . LYS A 264 ? 0.1769 0.2546 0.2519 0.0175  -0.0249 -0.0032 261 LYS A C     
2033 O O     . LYS A 264 ? 0.1828 0.2615 0.2515 0.0145  -0.0204 -0.0037 261 LYS A O     
2034 C CB    . LYS A 264 ? 0.1579 0.2558 0.2602 0.0227  -0.0275 -0.0029 261 LYS A CB    
2035 C CG    . LYS A 264 ? 0.1945 0.3026 0.3127 0.0294  -0.0263 -0.0054 261 LYS A CG    
2036 C CD    . LYS A 264 ? 0.2625 0.3835 0.3947 0.0279  -0.0293 -0.0018 261 LYS A CD    
2037 C CE    . LYS A 264 ? 0.3564 0.4887 0.5057 0.0352  -0.0271 -0.0045 261 LYS A CE    
2038 N NZ    . LYS A 264 ? 0.3897 0.5367 0.5541 0.0337  -0.0297 -0.0006 261 LYS A NZ    
2039 N N     . LEU A 265 ? 0.1449 0.2141 0.2147 0.0152  -0.0296 -0.0004 262 LEU A N     
2040 C CA    . LEU A 265 ? 0.1408 0.2014 0.1974 0.0096  -0.0289 0.0015  262 LEU A CA    
2041 C C     . LEU A 265 ? 0.1312 0.1848 0.1781 0.0112  -0.0246 -0.0009 262 LEU A C     
2042 O O     . LEU A 265 ? 0.1877 0.2393 0.2269 0.0077  -0.0212 -0.0004 262 LEU A O     
2043 C CB    . LEU A 265 ? 0.1645 0.2168 0.2165 0.0071  -0.0341 0.0044  262 LEU A CB    
2044 C CG    . LEU A 265 ? 0.2061 0.2479 0.2442 0.0022  -0.0328 0.0057  262 LEU A CG    
2045 C CD1   . LEU A 265 ? 0.2195 0.2640 0.2541 -0.0040 -0.0307 0.0070  262 LEU A CD1   
2046 C CD2   . LEU A 265 ? 0.2046 0.2386 0.2381 0.0000  -0.0374 0.0079  262 LEU A CD2   
2047 N N     . GLY A 266 ? 0.1372 0.1868 0.1844 0.0163  -0.0250 -0.0032 263 GLY A N     
2048 C CA    . GLY A 266 ? 0.1255 0.1696 0.1644 0.0178  -0.0216 -0.0052 263 GLY A CA    
2049 C C     . GLY A 266 ? 0.1198 0.1707 0.1587 0.0178  -0.0165 -0.0072 263 GLY A C     
2050 O O     . GLY A 266 ? 0.1438 0.1908 0.1736 0.0159  -0.0135 -0.0069 263 GLY A O     
2051 N N     . ALA A 267 ? 0.1455 0.2064 0.1946 0.0201  -0.0153 -0.0092 264 ALA A N     
2052 C CA    . ALA A 267 ? 0.1900 0.2584 0.2392 0.0198  -0.0099 -0.0113 264 ALA A CA    
2053 C C     . ALA A 267 ? 0.1528 0.2228 0.1971 0.0134  -0.0080 -0.0081 264 ALA A C     
2054 O O     . ALA A 267 ? 0.1812 0.2515 0.2188 0.0115  -0.0039 -0.0085 264 ALA A O     
2055 C CB    . ALA A 267 ? 0.1951 0.2748 0.2576 0.0236  -0.0085 -0.0141 264 ALA A CB    
2056 N N     . SER A 268 ? 0.1440 0.2142 0.1907 0.0097  -0.0114 -0.0049 265 SER A N     
2057 C CA    . SER A 268 ? 0.1634 0.2338 0.2050 0.0030  -0.0101 -0.0019 265 SER A CA    
2058 C C     . SER A 268 ? 0.1701 0.2281 0.1979 0.0004  -0.0092 -0.0004 265 SER A C     
2059 O O     . SER A 268 ? 0.1708 0.2278 0.1923 -0.0035 -0.0060 0.0008  265 SER A O     
2060 C CB    . SER A 268 ? 0.1771 0.2515 0.2250 -0.0008 -0.0143 0.0009  265 SER A CB    
2061 O OG    B SER A 268 ? 0.1564 0.2208 0.1988 -0.0021 -0.0186 0.0028  265 SER A OG    
2062 O OG    C SER A 268 ? 0.1654 0.2388 0.2074 -0.0079 -0.0134 0.0036  265 SER A OG    
2063 N N     . VAL A 269 ? 0.1418 0.1904 0.1653 0.0026  -0.0119 -0.0003 266 VAL A N     
2064 C CA    . VAL A 269 ? 0.1497 0.1870 0.1618 0.0014  -0.0108 0.0010  266 VAL A CA    
2065 C C     . VAL A 269 ? 0.1964 0.2343 0.2039 0.0029  -0.0066 -0.0002 266 VAL A C     
2066 O O     . VAL A 269 ? 0.1608 0.1943 0.1605 -0.0002 -0.0041 0.0017  266 VAL A O     
2067 C CB    . VAL A 269 ? 0.1511 0.1802 0.1610 0.0043  -0.0139 0.0009  266 VAL A CB    
2068 C CG1   . VAL A 269 ? 0.1712 0.1905 0.1711 0.0044  -0.0122 0.0019  266 VAL A CG1   
2069 C CG2   . VAL A 269 ? 0.1792 0.2063 0.1909 0.0016  -0.0180 0.0027  266 VAL A CG2   
2070 N N     . ILE A 270 ? 0.1654 0.2083 0.1774 0.0076  -0.0060 -0.0033 267 ILE A N     
2071 C CA    . ILE A 270 ? 0.1623 0.2064 0.1695 0.0089  -0.0024 -0.0047 267 ILE A CA    
2072 C C     . ILE A 270 ? 0.1596 0.2102 0.1657 0.0050  0.0016  -0.0039 267 ILE A C     
2073 O O     . ILE A 270 ? 0.2069 0.2539 0.2046 0.0028  0.0040  -0.0022 267 ILE A O     
2074 C CB    . ILE A 270 ? 0.1858 0.2343 0.1982 0.0141  -0.0024 -0.0089 267 ILE A CB    
2075 C CG1   . ILE A 270 ? 0.1870 0.2276 0.1980 0.0173  -0.0061 -0.0092 267 ILE A CG1   
2076 C CG2   . ILE A 270 ? 0.2523 0.3042 0.2599 0.0144  0.0018  -0.0108 267 ILE A CG2   
2077 C CD1   . ILE A 270 ? 0.2845 0.3279 0.3019 0.0222  -0.0071 -0.0133 267 ILE A CD1   
2078 N N     . GLU A 271 ? 0.1539 0.2142 0.1688 0.0038  0.0022  -0.0047 268 GLU A N     
2079 C CA    . GLU A 271 ? 0.1752 0.2436 0.1905 -0.0001 0.0063  -0.0041 268 GLU A CA    
2080 C C     . GLU A 271 ? 0.2066 0.2698 0.2152 -0.0065 0.0065  0.0000  268 GLU A C     
2081 O O     . GLU A 271 ? 0.2642 0.3267 0.2659 -0.0097 0.0098  0.0015  268 GLU A O     
2082 C CB    . GLU A 271 ? 0.3227 0.4044 0.3512 0.0007  0.0068  -0.0060 268 GLU A CB    
2083 C CG    . GLU A 271 ? 0.5396 0.6307 0.5694 -0.0042 0.0110  -0.0049 268 GLU A CG    
2084 C CD    . GLU A 271 ? 0.7294 0.8356 0.7730 -0.0020 0.0130  -0.0075 268 GLU A CD    
2085 O OE1   . GLU A 271 ? 0.8276 0.9360 0.8787 0.0041  0.0118  -0.0108 268 GLU A OE1   
2086 O OE2   . GLU A 271 ? 0.7841 0.8998 0.8314 -0.0064 0.0159  -0.0063 268 GLU A OE2   
2087 N N     . ILE A 272 ? 0.1964 0.2553 0.2062 -0.0087 0.0029  0.0020  269 ILE A N     
2088 C CA    . ILE A 272 ? 0.1808 0.2338 0.1842 -0.0153 0.0030  0.0054  269 ILE A CA    
2089 C C     . ILE A 272 ? 0.1888 0.2286 0.1800 -0.0158 0.0041  0.0073  269 ILE A C     
2090 O O     . ILE A 272 ? 0.2165 0.2527 0.2012 -0.0205 0.0064  0.0097  269 ILE A O     
2091 C CB    . ILE A 272 ? 0.1796 0.2308 0.1864 -0.0179 -0.0013 0.0066  269 ILE A CB    
2092 C CG1   . ILE A 272 ? 0.2440 0.3095 0.2634 -0.0186 -0.0025 0.0060  269 ILE A CG1   
2093 C CG2   . ILE A 272 ? 0.2596 0.3013 0.2572 -0.0245 -0.0012 0.0095  269 ILE A CG2   
2094 C CD1   . ILE A 272 ? 0.2788 0.3439 0.3019 -0.0216 -0.0074 0.0076  269 ILE A CD1   
2095 N N     . LEU A 273 ? 0.2149 0.2477 0.2037 -0.0110 0.0023  0.0064  270 LEU A N     
2096 C CA    . LEU A 273 ? 0.1985 0.2193 0.1775 -0.0109 0.0030  0.0086  270 LEU A CA    
2097 C C     . LEU A 273 ? 0.1943 0.2160 0.1692 -0.0084 0.0054  0.0086  270 LEU A C     
2098 O O     . LEU A 273 ? 0.2278 0.2411 0.1949 -0.0089 0.0064  0.0112  270 LEU A O     
2099 C CB    . LEU A 273 ? 0.1981 0.2109 0.1764 -0.0078 0.0000  0.0082  270 LEU A CB    
2100 C CG    . LEU A 273 ? 0.1959 0.2064 0.1761 -0.0108 -0.0026 0.0085  270 LEU A CG    
2101 C CD1   . LEU A 273 ? 0.2246 0.2276 0.2034 -0.0077 -0.0051 0.0082  270 LEU A CD1   
2102 C CD2   . LEU A 273 ? 0.2422 0.2462 0.2157 -0.0172 -0.0010 0.0109  270 LEU A CD2   
2103 N N     . GLY A 274 ? 0.1987 0.2303 0.1787 -0.0059 0.0064  0.0057  271 GLY A N     
2104 C CA    . GLY A 274 ? 0.2257 0.2588 0.2012 -0.0041 0.0085  0.0053  271 GLY A CA    
2105 C C     . GLY A 274 ? 0.2574 0.2832 0.2292 0.0002  0.0063  0.0054  271 GLY A C     
2106 O O     . GLY A 274 ? 0.2898 0.3114 0.2544 0.0002  0.0070  0.0077  271 GLY A O     
2107 N N     . ILE A 275 ? 0.1663 0.1910 0.1432 0.0036  0.0033  0.0034  272 ILE A N     
2108 C CA    . ILE A 275 ? 0.1798 0.1986 0.1544 0.0074  0.0009  0.0034  272 ILE A CA    
2109 C C     . ILE A 275 ? 0.1735 0.1973 0.1539 0.0113  -0.0007 -0.0007 272 ILE A C     
2110 O O     . ILE A 275 ? 0.2002 0.2313 0.1873 0.0117  -0.0002 -0.0035 272 ILE A O     
2111 C CB    . ILE A 275 ? 0.1677 0.1777 0.1416 0.0073  -0.0012 0.0055  272 ILE A CB    
2112 C CG1   . ILE A 275 ? 0.2139 0.2261 0.1945 0.0069  -0.0033 0.0038  272 ILE A CG1   
2113 C CG2   . ILE A 275 ? 0.1965 0.1993 0.1639 0.0038  0.0006  0.0094  272 ILE A CG2   
2114 C CD1   . ILE A 275 ? 0.1947 0.1981 0.1735 0.0065  -0.0053 0.0054  272 ILE A CD1   
2115 N N     . GLU A 276 ? 0.1672 0.1873 0.1457 0.0143  -0.0027 -0.0011 273 GLU A N     
2116 C CA    . GLU A 276 ? 0.1798 0.2028 0.1628 0.0179  -0.0045 -0.0051 273 GLU A CA    
2117 C C     . GLU A 276 ? 0.1564 0.1737 0.1416 0.0200  -0.0082 -0.0047 273 GLU A C     
2118 O O     . GLU A 276 ? 0.1831 0.2019 0.1740 0.0223  -0.0102 -0.0075 273 GLU A O     
2119 C CB    . GLU A 276 ? 0.1962 0.2211 0.1742 0.0188  -0.0035 -0.0066 273 GLU A CB    
2120 C CG    . GLU A 276 ? 0.2835 0.3156 0.2598 0.0170  0.0005  -0.0084 273 GLU A CG    
2121 C CD    . GLU A 276 ? 0.5431 0.5756 0.5113 0.0166  0.0015  -0.0086 273 GLU A CD    
2122 O OE1   . GLU A 276 ? 0.6784 0.7151 0.6422 0.0139  0.0049  -0.0082 273 GLU A OE1   
2123 O OE2   . GLU A 276 ? 0.5519 0.5809 0.5178 0.0184  -0.0013 -0.0090 273 GLU A OE2   
2124 N N     . TYR A 277 ? 0.1422 0.1529 0.1230 0.0195  -0.0090 -0.0012 274 TYR A N     
2125 C CA    . TYR A 277 ? 0.1534 0.1594 0.1356 0.0214  -0.0121 -0.0008 274 TYR A CA    
2126 C C     . TYR A 277 ? 0.1548 0.1556 0.1375 0.0200  -0.0126 0.0015  274 TYR A C     
2127 O O     . TYR A 277 ? 0.1701 0.1685 0.1497 0.0174  -0.0105 0.0037  274 TYR A O     
2128 C CB    . TYR A 277 ? 0.1734 0.1768 0.1510 0.0225  -0.0126 0.0013  274 TYR A CB    
2129 C CG    . TYR A 277 ? 0.1599 0.1678 0.1350 0.0231  -0.0123 -0.0008 274 TYR A CG    
2130 C CD1   . TYR A 277 ? 0.1926 0.2012 0.1617 0.0218  -0.0106 0.0015  274 TYR A CD1   
2131 C CD2   . TYR A 277 ? 0.1724 0.1834 0.1507 0.0247  -0.0135 -0.0052 274 TYR A CD2   
2132 C CE1   . TYR A 277 ? 0.2546 0.2673 0.2200 0.0216  -0.0102 -0.0005 274 TYR A CE1   
2133 C CE2   . TYR A 277 ? 0.2081 0.2226 0.1830 0.0249  -0.0128 -0.0078 274 TYR A CE2   
2134 C CZ    . TYR A 277 ? 0.2503 0.2659 0.2184 0.0231  -0.0112 -0.0055 274 TYR A CZ    
2135 O OH    . TYR A 277 ? 0.2618 0.2809 0.2252 0.0226  -0.0104 -0.0081 274 TYR A OH    
2136 N N     . MET A 278 ? 0.1418 0.1402 0.1276 0.0212  -0.0153 0.0010  275 MET A N     
2137 C CA    . MET A 278 ? 0.1384 0.1320 0.1240 0.0194  -0.0158 0.0027  275 MET A CA    
2138 C C     . MET A 278 ? 0.1527 0.1402 0.1328 0.0183  -0.0135 0.0058  275 MET A C     
2139 O O     . MET A 278 ? 0.1982 0.1818 0.1758 0.0157  -0.0122 0.0069  275 MET A O     
2140 C CB    . MET A 278 ? 0.1829 0.1747 0.1717 0.0209  -0.0191 0.0021  275 MET A CB    
2141 C CG    A MET A 278 ? 0.1278 0.1162 0.1170 0.0185  -0.0203 0.0030  275 MET A CG    
2142 C CG    B MET A 278 ? 0.2566 0.2522 0.2513 0.0214  -0.0216 -0.0002 275 MET A CG    
2143 S SD    A MET A 278 ? 0.1817 0.1749 0.1751 0.0162  -0.0214 0.0021  275 MET A SD    
2144 S SD    B MET A 278 ? 0.2268 0.2230 0.2232 0.0180  -0.0220 0.0007  275 MET A SD    
2145 C CE    A MET A 278 ? 0.1737 0.1611 0.1644 0.0124  -0.0229 0.0041  275 MET A CE    
2146 C CE    B MET A 278 ? 0.1929 0.1808 0.1840 0.0157  -0.0224 0.0033  275 MET A CE    
2147 N N     . GLY A 279 ? 0.1489 0.1353 0.1269 0.0204  -0.0131 0.0072  276 GLY A N     
2148 C CA    . GLY A 279 ? 0.1767 0.1572 0.1508 0.0203  -0.0110 0.0103  276 GLY A CA    
2149 C C     . GLY A 279 ? 0.1906 0.1687 0.1606 0.0179  -0.0080 0.0118  276 GLY A C     
2150 O O     . GLY A 279 ? 0.1869 0.1581 0.1536 0.0168  -0.0059 0.0138  276 GLY A O     
2151 N N     . GLU A 280 ? 0.1688 0.1523 0.1387 0.0168  -0.0076 0.0107  277 GLU A N     
2152 C CA    . GLU A 280 ? 0.1317 0.1136 0.0976 0.0139  -0.0049 0.0124  277 GLU A CA    
2153 C C     . GLU A 280 ? 0.1596 0.1375 0.1246 0.0104  -0.0040 0.0122  277 GLU A C     
2154 O O     . GLU A 280 ? 0.1708 0.1444 0.1316 0.0076  -0.0016 0.0140  277 GLU A O     
2155 C CB    . GLU A 280 ? 0.1520 0.1417 0.1184 0.0130  -0.0044 0.0109  277 GLU A CB    
2156 C CG    . GLU A 280 ? 0.1627 0.1555 0.1274 0.0153  -0.0049 0.0114  277 GLU A CG    
2157 C CD    . GLU A 280 ? 0.2111 0.2115 0.1754 0.0140  -0.0036 0.0094  277 GLU A CD    
2158 O OE1   . GLU A 280 ? 0.2062 0.2123 0.1745 0.0154  -0.0046 0.0056  277 GLU A OE1   
2159 O OE2   . GLU A 280 ? 0.2415 0.2418 0.2014 0.0114  -0.0013 0.0116  277 GLU A OE2   
2160 N N     . LEU A 281 ? 0.1666 0.1459 0.1353 0.0101  -0.0061 0.0102  278 LEU A N     
2161 C CA    . LEU A 281 ? 0.1589 0.1344 0.1261 0.0062  -0.0058 0.0101  278 LEU A CA    
2162 C C     . LEU A 281 ? 0.1599 0.1247 0.1212 0.0051  -0.0036 0.0119  278 LEU A C     
2163 O O     . LEU A 281 ? 0.1700 0.1301 0.1277 0.0009  -0.0025 0.0120  278 LEU A O     
2164 C CB    . LEU A 281 ? 0.1589 0.1377 0.1310 0.0061  -0.0091 0.0082  278 LEU A CB    
2165 C CG    . LEU A 281 ? 0.1725 0.1610 0.1509 0.0059  -0.0109 0.0064  278 LEU A CG    
2166 C CD1   . LEU A 281 ? 0.1839 0.1748 0.1678 0.0076  -0.0146 0.0051  278 LEU A CD1   
2167 C CD2   . LEU A 281 ? 0.2124 0.2031 0.1905 0.0012  -0.0100 0.0069  278 LEU A CD2   
2168 N N     . THR A 282 ? 0.1518 0.1127 0.1123 0.0087  -0.0028 0.0131  279 THR A N     
2169 C CA    . THR A 282 ? 0.1744 0.1251 0.1303 0.0083  -0.0002 0.0144  279 THR A CA    
2170 C C     . THR A 282 ? 0.1739 0.1182 0.1244 0.0058  0.0029  0.0161  279 THR A C     
2171 O O     . THR A 282 ? 0.2234 0.1582 0.1694 0.0044  0.0055  0.0164  279 THR A O     
2172 C CB    . THR A 282 ? 0.2039 0.1526 0.1613 0.0130  0.0004  0.0159  279 THR A CB    
2173 O OG1   . THR A 282 ? 0.2090 0.1604 0.1670 0.0155  0.0006  0.0181  279 THR A OG1   
2174 C CG2   . THR A 282 ? 0.1796 0.1336 0.1418 0.0150  -0.0025 0.0144  279 THR A CG2   
2175 N N     . GLN A 283 ? 0.1917 0.1407 0.1424 0.0050  0.0029  0.0171  280 GLN A N     
2176 C CA    . GLN A 283 ? 0.2272 0.1700 0.1727 0.0024  0.0057  0.0194  280 GLN A CA    
2177 C C     . GLN A 283 ? 0.2680 0.2081 0.2100 -0.0037 0.0064  0.0185  280 GLN A C     
2178 O O     . GLN A 283 ? 0.3517 0.2865 0.2892 -0.0067 0.0086  0.0203  280 GLN A O     
2179 C CB    . GLN A 283 ? 0.2359 0.1844 0.1818 0.0037  0.0055  0.0215  280 GLN A CB    
2180 C CG    . GLN A 283 ? 0.2979 0.2463 0.2455 0.0091  0.0049  0.0235  280 GLN A CG    
2181 C CD    . GLN A 283 ? 0.3593 0.2970 0.3050 0.0112  0.0071  0.0253  280 GLN A CD    
2182 O OE1   . GLN A 283 ? 0.3681 0.2975 0.3096 0.0101  0.0095  0.0278  280 GLN A OE1   
2183 N NE2   . GLN A 283 ? 0.3483 0.2859 0.2973 0.0141  0.0064  0.0240  280 GLN A NE2   
2184 N N     . PHE A 284 ? 0.1909 0.1347 0.1352 -0.0060 0.0044  0.0159  281 PHE A N     
2185 C CA    . PHE A 284 ? 0.2038 0.1464 0.1454 -0.0124 0.0044  0.0152  281 PHE A CA    
2186 C C     . PHE A 284 ? 0.2172 0.1506 0.1542 -0.0148 0.0048  0.0139  281 PHE A C     
2187 O O     . PHE A 284 ? 0.2497 0.1823 0.1881 -0.0117 0.0039  0.0128  281 PHE A O     
2188 C CB    . PHE A 284 ? 0.1932 0.1486 0.1415 -0.0137 0.0013  0.0137  281 PHE A CB    
2189 C CG    . PHE A 284 ? 0.2051 0.1696 0.1573 -0.0117 0.0016  0.0143  281 PHE A CG    
2190 C CD1   . PHE A 284 ? 0.2457 0.2123 0.1961 -0.0157 0.0034  0.0156  281 PHE A CD1   
2191 C CD2   . PHE A 284 ? 0.1880 0.1584 0.1448 -0.0062 0.0004  0.0135  281 PHE A CD2   
2192 C CE1   . PHE A 284 ? 0.2845 0.2594 0.2374 -0.0142 0.0042  0.0160  281 PHE A CE1   
2193 C CE2   . PHE A 284 ? 0.1941 0.1723 0.1531 -0.0047 0.0010  0.0136  281 PHE A CE2   
2194 C CZ    . PHE A 284 ? 0.2512 0.2318 0.2081 -0.0087 0.0030  0.0149  281 PHE A CZ    
2195 N N     . THR A 285 ? 0.2163 0.1424 0.1471 -0.0207 0.0062  0.0138  282 THR A N     
2196 C CA    . THR A 285 ? 0.2281 0.1454 0.1532 -0.0239 0.0066  0.0120  282 THR A CA    
2197 C C     . THR A 285 ? 0.1909 0.1167 0.1197 -0.0268 0.0023  0.0106  282 THR A C     
2198 O O     . THR A 285 ? 0.1976 0.1350 0.1329 -0.0273 -0.0005 0.0110  282 THR A O     
2199 C CB    . THR A 285 ? 0.2337 0.1395 0.1499 -0.0302 0.0092  0.0120  282 THR A CB    
2200 O OG1   . THR A 285 ? 0.2467 0.1595 0.1641 -0.0363 0.0070  0.0124  282 THR A OG1   
2201 C CG2   . THR A 285 ? 0.2676 0.1648 0.1808 -0.0275 0.0132  0.0141  282 THR A CG2   
2202 N N     . GLU A 286 ? 0.2200 0.1400 0.1444 -0.0286 0.0019  0.0091  283 GLU A N     
2203 C CA    . GLU A 286 ? 0.2270 0.1539 0.1540 -0.0319 -0.0026 0.0084  283 GLU A CA    
2204 C C     . GLU A 286 ? 0.2164 0.1479 0.1434 -0.0388 -0.0048 0.0090  283 GLU A C     
2205 O O     . GLU A 286 ? 0.2103 0.1537 0.1450 -0.0394 -0.0090 0.0096  283 GLU A O     
2206 C CB    . GLU A 286 ? 0.2028 0.1209 0.1226 -0.0340 -0.0021 0.0069  283 GLU A CB    
2207 C CG    . GLU A 286 ? 0.2355 0.1608 0.1581 -0.0366 -0.0074 0.0069  283 GLU A CG    
2208 C CD    . GLU A 286 ? 0.3915 0.3088 0.3067 -0.0384 -0.0068 0.0056  283 GLU A CD    
2209 O OE1   . GLU A 286 ? 0.3964 0.3023 0.3042 -0.0377 -0.0016 0.0042  283 GLU A OE1   
2210 O OE2   . GLU A 286 ? 0.3768 0.2991 0.2935 -0.0406 -0.0112 0.0060  283 GLU A OE2   
2211 N N     . SER A 287 ? 0.2279 0.1503 0.1470 -0.0439 -0.0020 0.0090  284 SER A N     
2212 C CA    . SER A 287 ? 0.2186 0.1453 0.1376 -0.0512 -0.0040 0.0097  284 SER A CA    
2213 C C     . SER A 287 ? 0.2142 0.1539 0.1427 -0.0491 -0.0048 0.0114  284 SER A C     
2214 O O     . SER A 287 ? 0.2290 0.1797 0.1634 -0.0527 -0.0081 0.0121  284 SER A O     
2215 C CB    . SER A 287 ? 0.2617 0.1744 0.1694 -0.0576 -0.0007 0.0092  284 SER A CB    
2216 O OG    A SER A 287 ? 0.3018 0.2020 0.2001 -0.0595 0.0008  0.0071  284 SER A OG    
2217 O OG    B SER A 287 ? 0.2926 0.1969 0.1976 -0.0535 0.0041  0.0098  284 SER A OG    
2218 N N     . GLN A 288 ? 0.1889 0.1280 0.1191 -0.0433 -0.0017 0.0120  285 GLN A N     
2219 C CA    . GLN A 288 ? 0.1960 0.1476 0.1344 -0.0412 -0.0020 0.0132  285 GLN A CA    
2220 C C     . GLN A 288 ? 0.2004 0.1658 0.1493 -0.0378 -0.0059 0.0125  285 GLN A C     
2221 O O     . GLN A 288 ? 0.2093 0.1867 0.1656 -0.0395 -0.0076 0.0129  285 GLN A O     
2222 C CB    . GLN A 288 ? 0.2092 0.1576 0.1468 -0.0355 0.0013  0.0142  285 GLN A CB    
2223 C CG    . GLN A 288 ? 0.2595 0.1968 0.1889 -0.0388 0.0050  0.0158  285 GLN A CG    
2224 C CD    . GLN A 288 ? 0.3085 0.2436 0.2378 -0.0330 0.0076  0.0175  285 GLN A CD    
2225 O OE1   . GLN A 288 ? 0.2681 0.2002 0.1980 -0.0270 0.0079  0.0172  285 GLN A OE1   
2226 N NE2   . GLN A 288 ? 0.3491 0.2863 0.2775 -0.0351 0.0092  0.0196  285 GLN A NE2   
2227 N N     . LEU A 289 ? 0.1856 0.1493 0.1357 -0.0329 -0.0072 0.0115  286 LEU A N     
2228 C CA    . LEU A 289 ? 0.1593 0.1344 0.1192 -0.0293 -0.0110 0.0109  286 LEU A CA    
2229 C C     . LEU A 289 ? 0.1887 0.1696 0.1517 -0.0346 -0.0152 0.0113  286 LEU A C     
2230 O O     . LEU A 289 ? 0.1982 0.1914 0.1711 -0.0334 -0.0179 0.0116  286 LEU A O     
2231 C CB    . LEU A 289 ? 0.1647 0.1359 0.1245 -0.0237 -0.0116 0.0100  286 LEU A CB    
2232 C CG    . LEU A 289 ? 0.1818 0.1500 0.1406 -0.0181 -0.0083 0.0100  286 LEU A CG    
2233 C CD1   . LEU A 289 ? 0.1911 0.1560 0.1502 -0.0134 -0.0091 0.0094  286 LEU A CD1   
2234 C CD2   . LEU A 289 ? 0.2009 0.1798 0.1667 -0.0152 -0.0081 0.0099  286 LEU A CD2   
2235 N N     . GLN A 290 ? 0.2016 0.1737 0.1563 -0.0405 -0.0158 0.0114  287 GLN A N     
2236 C CA    . GLN A 290 ? 0.2026 0.1798 0.1591 -0.0464 -0.0203 0.0123  287 GLN A CA    
2237 C C     . GLN A 290 ? 0.2454 0.2320 0.2069 -0.0510 -0.0208 0.0136  287 GLN A C     
2238 O O     . GLN A 290 ? 0.2220 0.2197 0.1915 -0.0533 -0.0251 0.0148  287 GLN A O     
2239 C CB    . GLN A 290 ? 0.2253 0.1897 0.1695 -0.0526 -0.0203 0.0118  287 GLN A CB    
2240 C CG    . GLN A 290 ? 0.2160 0.1732 0.1560 -0.0495 -0.0205 0.0108  287 GLN A CG    
2241 C CD    . GLN A 290 ? 0.2438 0.1875 0.1704 -0.0557 -0.0192 0.0097  287 GLN A CD    
2242 O OE1   . GLN A 290 ? 0.2988 0.2336 0.2175 -0.0595 -0.0156 0.0089  287 GLN A OE1   
2243 N NE2   . GLN A 290 ? 0.3009 0.2426 0.2245 -0.0569 -0.0220 0.0095  287 GLN A NE2   
2244 N N     . SER A 291 ? 0.1798 0.1622 0.1370 -0.0523 -0.0164 0.0136  288 SER A N     
2245 C CA    . SER A 291 ? 0.2013 0.1924 0.1626 -0.0574 -0.0163 0.0150  288 SER A CA    
2246 C C     . SER A 291 ? 0.2540 0.2620 0.2292 -0.0528 -0.0172 0.0152  288 SER A C     
2247 O O     . SER A 291 ? 0.3237 0.3430 0.3061 -0.0567 -0.0190 0.0165  288 SER A O     
2248 C CB    . SER A 291 ? 0.2926 0.2745 0.2455 -0.0600 -0.0113 0.0153  288 SER A CB    
2249 O OG    . SER A 291 ? 0.3130 0.2971 0.2687 -0.0534 -0.0080 0.0152  288 SER A OG    
2250 N N     . HIS A 292 ? 0.2355 0.2451 0.2147 -0.0446 -0.0160 0.0140  289 HIS A N     
2251 C CA    . HIS A 292 ? 0.2299 0.2542 0.2216 -0.0397 -0.0162 0.0134  289 HIS A CA    
2252 C C     . HIS A 292 ? 0.2361 0.2679 0.2373 -0.0363 -0.0210 0.0132  289 HIS A C     
2253 O O     . HIS A 292 ? 0.3142 0.3595 0.3272 -0.0349 -0.0225 0.0134  289 HIS A O     
2254 C CB    . HIS A 292 ? 0.2400 0.2625 0.2306 -0.0331 -0.0123 0.0120  289 HIS A CB    
2255 C CG    . HIS A 292 ? 0.2325 0.2500 0.2159 -0.0357 -0.0078 0.0128  289 HIS A CG    
2256 N ND1   . HIS A 292 ? 0.2959 0.3217 0.2821 -0.0398 -0.0058 0.0138  289 HIS A ND1   
2257 C CD2   . HIS A 292 ? 0.2857 0.2910 0.2594 -0.0347 -0.0049 0.0132  289 HIS A CD2   
2258 C CE1   . HIS A 292 ? 0.3251 0.3432 0.3029 -0.0415 -0.0021 0.0149  289 HIS A CE1   
2259 N NE2   . HIS A 292 ? 0.3155 0.3210 0.2858 -0.0382 -0.0016 0.0146  289 HIS A NE2   
2260 N N     . PHE A 293 ? 0.1714 0.1945 0.1679 -0.0347 -0.0233 0.0129  290 PHE A N     
2261 C CA    . PHE A 293 ? 0.1814 0.2098 0.1863 -0.0301 -0.0275 0.0128  290 PHE A CA    
2262 C C     . PHE A 293 ? 0.2227 0.2487 0.2256 -0.0349 -0.0328 0.0146  290 PHE A C     
2263 O O     . PHE A 293 ? 0.2538 0.2829 0.2625 -0.0320 -0.0370 0.0152  290 PHE A O     
2264 C CB    . PHE A 293 ? 0.1739 0.1961 0.1766 -0.0231 -0.0259 0.0109  290 PHE A CB    
2265 C CG    . PHE A 293 ? 0.1784 0.2018 0.1809 -0.0193 -0.0210 0.0094  290 PHE A CG    
2266 C CD1   . PHE A 293 ? 0.1688 0.2043 0.1811 -0.0165 -0.0199 0.0083  290 PHE A CD1   
2267 C CD2   . PHE A 293 ? 0.1747 0.1876 0.1673 -0.0188 -0.0174 0.0090  290 PHE A CD2   
2268 C CE1   . PHE A 293 ? 0.1662 0.2029 0.1769 -0.0138 -0.0154 0.0070  290 PHE A CE1   
2269 C CE2   . PHE A 293 ? 0.2050 0.2193 0.1969 -0.0159 -0.0135 0.0083  290 PHE A CE2   
2270 C CZ    . PHE A 293 ? 0.1758 0.2019 0.1761 -0.0137 -0.0125 0.0072  290 PHE A CZ    
2271 N N     . GLY A 294 ? 0.1953 0.2154 0.1893 -0.0427 -0.0327 0.0156  291 GLY A N     
2272 C CA    . GLY A 294 ? 0.2063 0.2234 0.1962 -0.0485 -0.0376 0.0173  291 GLY A CA    
2273 C C     . GLY A 294 ? 0.2364 0.2382 0.2131 -0.0493 -0.0363 0.0161  291 GLY A C     
2274 O O     . GLY A 294 ? 0.2156 0.2109 0.1894 -0.0437 -0.0327 0.0144  291 GLY A O     
2275 N N     . GLU A 295 ? 0.2168 0.2131 0.1855 -0.0565 -0.0392 0.0171  292 GLU A N     
2276 C CA    . GLU A 295 ? 0.2187 0.2007 0.1742 -0.0583 -0.0376 0.0158  292 GLU A CA    
2277 C C     . GLU A 295 ? 0.2282 0.2086 0.1860 -0.0514 -0.0383 0.0154  292 GLU A C     
2278 O O     . GLU A 295 ? 0.2295 0.2007 0.1813 -0.0479 -0.0339 0.0135  292 GLU A O     
2279 C CB    . GLU A 295 ? 0.2213 0.2002 0.1691 -0.0676 -0.0418 0.0171  292 GLU A CB    
2280 C CG    . GLU A 295 ? 0.2843 0.2485 0.2176 -0.0704 -0.0398 0.0154  292 GLU A CG    
2281 C CD    . GLU A 295 ? 0.4187 0.3802 0.3434 -0.0803 -0.0443 0.0165  292 GLU A CD    
2282 O OE1   . GLU A 295 ? 0.5293 0.4863 0.4481 -0.0817 -0.0465 0.0168  292 GLU A OE1   
2283 O OE2   . GLU A 295 ? 0.4105 0.3749 0.3342 -0.0872 -0.0458 0.0174  292 GLU A OE2   
2284 N N     . LYS A 296 ? 0.1986 0.1880 0.1656 -0.0496 -0.0439 0.0174  293 LYS A N     
2285 C CA    . LYS A 296 ? 0.1890 0.1767 0.1581 -0.0442 -0.0454 0.0175  293 LYS A CA    
2286 C C     . LYS A 296 ? 0.2109 0.2000 0.1860 -0.0356 -0.0416 0.0156  293 LYS A C     
2287 O O     . LYS A 296 ? 0.2250 0.2066 0.1951 -0.0323 -0.0388 0.0143  293 LYS A O     
2288 C CB    . LYS A 296 ? 0.2500 0.2468 0.2282 -0.0445 -0.0528 0.0206  293 LYS A CB    
2289 C CG    . LYS A 296 ? 0.3104 0.3040 0.2889 -0.0406 -0.0552 0.0213  293 LYS A CG    
2290 C CD    . LYS A 296 ? 0.3586 0.3603 0.3459 -0.0413 -0.0630 0.0250  293 LYS A CD    
2291 C CE    . LYS A 296 ? 0.4832 0.4819 0.4723 -0.0367 -0.0653 0.0258  293 LYS A CE    
2292 N NZ    . LYS A 296 ? 0.6038 0.6095 0.6017 -0.0370 -0.0732 0.0300  293 LYS A NZ    
2293 N N     . ASN A 297 ? 0.1919 0.1910 0.1774 -0.0322 -0.0413 0.0154  294 ASN A N     
2294 C CA    . ASN A 297 ? 0.1923 0.1933 0.1829 -0.0246 -0.0380 0.0135  294 ASN A CA    
2295 C C     . ASN A 297 ? 0.1776 0.1697 0.1592 -0.0242 -0.0320 0.0118  294 ASN A C     
2296 O O     . ASN A 297 ? 0.1799 0.1689 0.1612 -0.0189 -0.0297 0.0106  294 ASN A O     
2297 C CB    . ASN A 297 ? 0.2237 0.2369 0.2259 -0.0219 -0.0379 0.0132  294 ASN A CB    
2298 C CG    . ASN A 297 ? 0.2797 0.3024 0.2940 -0.0192 -0.0431 0.0145  294 ASN A CG    
2299 O OD1   . ASN A 297 ? 0.2955 0.3153 0.3106 -0.0171 -0.0464 0.0153  294 ASN A OD1   
2300 N ND2   . ASN A 297 ? 0.2561 0.2903 0.2805 -0.0191 -0.0436 0.0150  294 ASN A ND2   
2301 N N     . GLY A 298 ? 0.2045 0.1928 0.1793 -0.0297 -0.0297 0.0119  295 GLY A N     
2302 C CA    . GLY A 298 ? 0.2094 0.1890 0.1763 -0.0293 -0.0241 0.0108  295 GLY A CA    
2303 C C     . GLY A 298 ? 0.2102 0.1785 0.1688 -0.0282 -0.0223 0.0101  295 GLY A C     
2304 O O     . GLY A 298 ? 0.1995 0.1634 0.1565 -0.0236 -0.0187 0.0093  295 GLY A O     
2305 N N     . SER A 299 ? 0.1864 0.1501 0.1395 -0.0327 -0.0247 0.0104  296 SER A N     
2306 C CA    . SER A 299 ? 0.1978 0.1516 0.1433 -0.0319 -0.0227 0.0096  296 SER A CA    
2307 C C     . SER A 299 ? 0.1826 0.1400 0.1345 -0.0253 -0.0239 0.0097  296 SER A C     
2308 O O     . SER A 299 ? 0.1996 0.1514 0.1487 -0.0217 -0.0205 0.0089  296 SER A O     
2309 C CB    . SER A 299 ? 0.2590 0.2082 0.1968 -0.0389 -0.0253 0.0100  296 SER A CB    
2310 O OG    . SER A 299 ? 0.2663 0.2089 0.1954 -0.0454 -0.0232 0.0093  296 SER A OG    
2311 N N     . TRP A 300 ? 0.1937 0.1606 0.1549 -0.0234 -0.0287 0.0107  297 TRP A N     
2312 C CA    . TRP A 300 ? 0.1709 0.1405 0.1381 -0.0176 -0.0302 0.0107  297 TRP A CA    
2313 C C     . TRP A 300 ? 0.1760 0.1467 0.1463 -0.0117 -0.0265 0.0094  297 TRP A C     
2314 O O     . TRP A 300 ? 0.1866 0.1541 0.1561 -0.0082 -0.0252 0.0090  297 TRP A O     
2315 C CB    . TRP A 300 ? 0.1935 0.1722 0.1704 -0.0167 -0.0360 0.0119  297 TRP A CB    
2316 C CG    . TRP A 300 ? 0.1946 0.1749 0.1772 -0.0113 -0.0380 0.0119  297 TRP A CG    
2317 C CD1   . TRP A 300 ? 0.2640 0.2406 0.2446 -0.0119 -0.0408 0.0131  297 TRP A CD1   
2318 C CD2   . TRP A 300 ? 0.1743 0.1598 0.1649 -0.0052 -0.0374 0.0105  297 TRP A CD2   
2319 N NE1   . TRP A 300 ? 0.3104 0.2895 0.2977 -0.0065 -0.0422 0.0126  297 TRP A NE1   
2320 C CE2   . TRP A 300 ? 0.2243 0.2085 0.2174 -0.0023 -0.0401 0.0108  297 TRP A CE2   
2321 C CE3   . TRP A 300 ? 0.1946 0.1855 0.1896 -0.0023 -0.0348 0.0089  297 TRP A CE3   
2322 C CZ2   . TRP A 300 ? 0.2058 0.1933 0.2057 0.0034  -0.0403 0.0093  297 TRP A CZ2   
2323 C CZ3   . TRP A 300 ? 0.2614 0.2559 0.2627 0.0034  -0.0348 0.0073  297 TRP A CZ3   
2324 C CH2   . TRP A 300 ? 0.2264 0.2188 0.2299 0.0061  -0.0376 0.0073  297 TRP A CH2   
2325 N N     . LEU A 301 ? 0.1705 0.1461 0.1440 -0.0113 -0.0251 0.0089  298 LEU A N     
2326 C CA    . LEU A 301 ? 0.1707 0.1475 0.1460 -0.0066 -0.0218 0.0080  298 LEU A CA    
2327 C C     . LEU A 301 ? 0.1771 0.1447 0.1445 -0.0062 -0.0174 0.0081  298 LEU A C     
2328 O O     . LEU A 301 ? 0.1706 0.1375 0.1389 -0.0017 -0.0159 0.0079  298 LEU A O     
2329 C CB    . LEU A 301 ? 0.1495 0.1333 0.1287 -0.0072 -0.0207 0.0078  298 LEU A CB    
2330 C CG    . LEU A 301 ? 0.1675 0.1623 0.1570 -0.0055 -0.0240 0.0073  298 LEU A CG    
2331 C CD1   . LEU A 301 ? 0.1939 0.1956 0.1863 -0.0080 -0.0226 0.0074  298 LEU A CD1   
2332 C CD2   . LEU A 301 ? 0.1865 0.1845 0.1814 0.0008  -0.0243 0.0058  298 LEU A CD2   
2333 N N     . TYR A 302 ? 0.1659 0.1263 0.1258 -0.0109 -0.0153 0.0084  299 TYR A N     
2334 C CA    . TYR A 302 ? 0.1779 0.1287 0.1307 -0.0103 -0.0107 0.0084  299 TYR A CA    
2335 C C     . TYR A 302 ? 0.1906 0.1379 0.1428 -0.0070 -0.0102 0.0082  299 TYR A C     
2336 O O     . TYR A 302 ? 0.1842 0.1292 0.1366 -0.0029 -0.0075 0.0086  299 TYR A O     
2337 C CB    . TYR A 302 ? 0.1720 0.1146 0.1162 -0.0165 -0.0087 0.0081  299 TYR A CB    
2338 C CG    . TYR A 302 ? 0.1889 0.1207 0.1264 -0.0154 -0.0035 0.0080  299 TYR A CG    
2339 C CD1   . TYR A 302 ? 0.2043 0.1335 0.1407 -0.0144 -0.0005 0.0088  299 TYR A CD1   
2340 C CD2   . TYR A 302 ? 0.2747 0.1989 0.2073 -0.0151 -0.0015 0.0071  299 TYR A CD2   
2341 C CE1   . TYR A 302 ? 0.2342 0.1531 0.1653 -0.0129 0.0042  0.0090  299 TYR A CE1   
2342 C CE2   . TYR A 302 ? 0.2873 0.2018 0.2150 -0.0133 0.0038  0.0069  299 TYR A CE2   
2343 C CZ    . TYR A 302 ? 0.3126 0.2243 0.2399 -0.0120 0.0064  0.0080  299 TYR A CZ    
2344 O OH    . TYR A 302 ? 0.3793 0.2810 0.3026 -0.0097 0.0114  0.0081  299 TYR A OH    
2345 N N     . ALA A 303 ? 0.1758 0.1232 0.1276 -0.0091 -0.0131 0.0081  300 ALA A N     
2346 C CA    . ALA A 303 ? 0.1716 0.1166 0.1231 -0.0067 -0.0128 0.0082  300 ALA A CA    
2347 C C     . ALA A 303 ? 0.1617 0.1140 0.1215 -0.0014 -0.0152 0.0085  300 ALA A C     
2348 O O     . ALA A 303 ? 0.1727 0.1237 0.1333 0.0021  -0.0135 0.0087  300 ALA A O     
2349 C CB    . ALA A 303 ? 0.2227 0.1656 0.1703 -0.0113 -0.0154 0.0082  300 ALA A CB    
2350 N N     . MET A 304 ? 0.1627 0.1224 0.1286 -0.0010 -0.0191 0.0084  301 MET A N     
2351 C CA    . MET A 304 ? 0.1699 0.1351 0.1429 0.0034  -0.0217 0.0081  301 MET A CA    
2352 C C     . MET A 304 ? 0.1681 0.1347 0.1426 0.0076  -0.0192 0.0078  301 MET A C     
2353 O O     . MET A 304 ? 0.1634 0.1313 0.1407 0.0108  -0.0200 0.0078  301 MET A O     
2354 C CB    . MET A 304 ? 0.1934 0.1659 0.1732 0.0035  -0.0258 0.0077  301 MET A CB    
2355 C CG    . MET A 304 ? 0.1871 0.1634 0.1734 0.0076  -0.0288 0.0071  301 MET A CG    
2356 S SD    . MET A 304 ? 0.2210 0.1933 0.2060 0.0061  -0.0321 0.0086  301 MET A SD    
2357 C CE    . MET A 304 ? 0.2048 0.1746 0.1888 0.0094  -0.0297 0.0084  301 MET A CE    
2358 N N     . CYS A 305 ? 0.1537 0.1201 0.1263 0.0072  -0.0164 0.0079  302 CYS A N     
2359 C CA    . CYS A 305 ? 0.1728 0.1407 0.1463 0.0108  -0.0144 0.0081  302 CYS A CA    
2360 C C     . CYS A 305 ? 0.1688 0.1313 0.1395 0.0127  -0.0118 0.0095  302 CYS A C     
2361 O O     . CYS A 305 ? 0.1921 0.1562 0.1643 0.0159  -0.0111 0.0103  302 CYS A O     
2362 C CB    . CYS A 305 ? 0.1684 0.1374 0.1401 0.0096  -0.0122 0.0084  302 CYS A CB    
2363 S SG    . CYS A 305 ? 0.1759 0.1356 0.1399 0.0062  -0.0081 0.0096  302 CYS A SG    
2364 N N     . ARG A 306 ? 0.1561 0.1126 0.1230 0.0106  -0.0106 0.0097  303 ARG A N     
2365 C CA    . ARG A 306 ? 0.1675 0.1194 0.1327 0.0124  -0.0077 0.0107  303 ARG A CA    
2366 C C     . ARG A 306 ? 0.1674 0.1211 0.1353 0.0130  -0.0099 0.0106  303 ARG A C     
2367 O O     . ARG A 306 ? 0.2290 0.1799 0.1962 0.0142  -0.0075 0.0114  303 ARG A O     
2368 C CB    . ARG A 306 ? 0.1834 0.1265 0.1418 0.0097  -0.0035 0.0105  303 ARG A CB    
2369 C CG    . ARG A 306 ? 0.1678 0.1075 0.1232 0.0092  -0.0009 0.0111  303 ARG A CG    
2370 C CD    . ARG A 306 ? 0.2188 0.1490 0.1665 0.0051  0.0025  0.0102  303 ARG A CD    
2371 N NE    . ARG A 306 ? 0.2438 0.1698 0.1891 0.0055  0.0054  0.0113  303 ARG A NE    
2372 C CZ    . ARG A 306 ? 0.2028 0.1318 0.1481 0.0034  0.0041  0.0116  303 ARG A CZ    
2373 N NH1   . ARG A 306 ? 0.2165 0.1411 0.1593 0.0036  0.0067  0.0131  303 ARG A NH1   
2374 N NH2   . ARG A 306 ? 0.1854 0.1218 0.1335 0.0010  0.0003  0.0107  303 ARG A NH2   
2375 N N     . GLY A 307 ? 0.1647 0.1230 0.1359 0.0122  -0.0143 0.0099  304 GLY A N     
2376 C CA    . GLY A 307 ? 0.1693 0.1291 0.1432 0.0125  -0.0171 0.0101  304 GLY A CA    
2377 C C     . GLY A 307 ? 0.1900 0.1459 0.1598 0.0084  -0.0178 0.0102  304 GLY A C     
2378 O O     . GLY A 307 ? 0.1934 0.1493 0.1640 0.0079  -0.0193 0.0109  304 GLY A O     
2379 N N     . ILE A 308 ? 0.1739 0.1266 0.1390 0.0049  -0.0168 0.0098  305 ILE A N     
2380 C CA    . ILE A 308 ? 0.1857 0.1337 0.1447 0.0001  -0.0169 0.0099  305 ILE A CA    
2381 C C     . ILE A 308 ? 0.1983 0.1491 0.1583 -0.0032 -0.0218 0.0101  305 ILE A C     
2382 O O     . ILE A 308 ? 0.2048 0.1581 0.1663 -0.0035 -0.0224 0.0097  305 ILE A O     
2383 C CB    . ILE A 308 ? 0.2448 0.1855 0.1962 -0.0022 -0.0116 0.0091  305 ILE A CB    
2384 C CG1   . ILE A 308 ? 0.2285 0.1666 0.1801 0.0017  -0.0067 0.0092  305 ILE A CG1   
2385 C CG2   . ILE A 308 ? 0.2299 0.1654 0.1735 -0.0080 -0.0118 0.0088  305 ILE A CG2   
2386 C CD1   . ILE A 308 ? 0.2802 0.2103 0.2255 0.0009  -0.0009 0.0083  305 ILE A CD1   
2387 N N     . GLU A 309 ? 0.1615 0.1124 0.1212 -0.0055 -0.0254 0.0112  306 GLU A N     
2388 C CA    . GLU A 309 ? 0.2352 0.1887 0.1961 -0.0088 -0.0305 0.0122  306 GLU A CA    
2389 C C     . GLU A 309 ? 0.2523 0.2020 0.2076 -0.0133 -0.0325 0.0137  306 GLU A C     
2390 O O     . GLU A 309 ? 0.2496 0.1972 0.2037 -0.0125 -0.0313 0.0141  306 GLU A O     
2391 C CB    . GLU A 309 ? 0.3474 0.3076 0.3182 -0.0050 -0.0351 0.0125  306 GLU A CB    
2392 C CG    . GLU A 309 ? 0.4885 0.4520 0.4621 -0.0078 -0.0404 0.0140  306 GLU A CG    
2393 C CD    . GLU A 309 ? 0.4259 0.3939 0.4085 -0.0044 -0.0453 0.0147  306 GLU A CD    
2394 O OE1   . GLU A 309 ? 0.2754 0.2417 0.2592 -0.0024 -0.0461 0.0151  306 GLU A OE1   
2395 O OE2   . GLU A 309 ? 0.4746 0.4480 0.4636 -0.0037 -0.0482 0.0150  306 GLU A OE2   
2396 N N     . HIS A 310 ? 0.5781 0.1681 0.2204 0.0909  -0.1623 -0.0695 307 HIS A N     
2397 C CA    . HIS A 310 ? 0.5221 0.1466 0.1932 0.0977  -0.1487 -0.0702 307 HIS A CA    
2398 C C     . HIS A 310 ? 0.4504 0.1108 0.1475 0.0848  -0.1276 -0.0607 307 HIS A C     
2399 O O     . HIS A 310 ? 0.5468 0.2321 0.2628 0.0885  -0.1155 -0.0601 307 HIS A O     
2400 C CB    . HIS A 310 ? 0.6493 0.2501 0.2880 0.1006  -0.1533 -0.0714 307 HIS A CB    
2401 C CG    . HIS A 310 ? 0.8158 0.3826 0.4308 0.1166  -0.1743 -0.0820 307 HIS A CG    
2402 N ND1   . HIS A 310 ? 0.8175 0.3972 0.4605 0.1365  -0.1825 -0.0937 307 HIS A ND1   
2403 C CD2   . HIS A 310 ? 0.8973 0.4169 0.4631 0.1161  -0.1897 -0.0833 307 HIS A CD2   
2404 C CE1   . HIS A 310 ? 0.8387 0.3806 0.4512 0.1491  -0.2031 -0.1022 307 HIS A CE1   
2405 N NE2   . HIS A 310 ? 0.8996 0.4027 0.4629 0.1368  -0.2079 -0.0956 307 HIS A NE2   
2406 N N     . ASP A 311 ? 0.4538 0.1153 0.1502 0.0702  -0.1233 -0.0539 308 ASP A N     
2407 C CA    . ASP A 311 ? 0.4705 0.1629 0.1885 0.0586  -0.1052 -0.0453 308 ASP A CA    
2408 C C     . ASP A 311 ? 0.4289 0.1602 0.1912 0.0682  -0.0942 -0.0476 308 ASP A C     
2409 O O     . ASP A 311 ? 0.3914 0.1329 0.1767 0.0752  -0.0974 -0.0525 308 ASP A O     
2410 C CB    . ASP A 311 ? 0.5088 0.1972 0.2223 0.0438  -0.1032 -0.0398 308 ASP A CB    
2411 C CG    . ASP A 311 ? 0.5763 0.2946 0.3107 0.0327  -0.0863 -0.0319 308 ASP A CG    
2412 O OD1   . ASP A 311 ? 0.5589 0.2915 0.3116 0.0278  -0.0812 -0.0294 308 ASP A OD1   
2413 O OD2   . ASP A 311 ? 0.6653 0.3911 0.3963 0.0295  -0.0793 -0.0286 308 ASP A OD2   
2414 N N     . PRO A 312 ? 0.3710 0.1224 0.1440 0.0680  -0.0811 -0.0443 309 PRO A N     
2415 C CA    . PRO A 312 ? 0.4043 0.1887 0.2151 0.0761  -0.0696 -0.0470 309 PRO A CA    
2416 C C     . PRO A 312 ? 0.3135 0.1217 0.1512 0.0683  -0.0596 -0.0418 309 PRO A C     
2417 O O     . PRO A 312 ? 0.3269 0.1322 0.1560 0.0558  -0.0573 -0.0343 309 PRO A O     
2418 C CB    . PRO A 312 ? 0.3939 0.1850 0.1987 0.0761  -0.0591 -0.0440 309 PRO A CB    
2419 C CG    . PRO A 312 ? 0.4422 0.2141 0.2162 0.0634  -0.0620 -0.0367 309 PRO A CG    
2420 C CD    . PRO A 312 ? 0.4036 0.1454 0.1527 0.0615  -0.0777 -0.0395 309 PRO A CD    
2421 N N     . VAL A 313 ? 0.3143 0.1464 0.1855 0.0757  -0.0536 -0.0465 310 VAL A N     
2422 C CA    . VAL A 313 ? 0.2824 0.1386 0.1798 0.0690  -0.0417 -0.0415 310 VAL A CA    
2423 C C     . VAL A 313 ? 0.2579 0.1257 0.1540 0.0639  -0.0269 -0.0346 310 VAL A C     
2424 O O     . VAL A 313 ? 0.3018 0.1781 0.2035 0.0704  -0.0194 -0.0379 310 VAL A O     
2425 C CB    . VAL A 313 ? 0.2890 0.1669 0.2222 0.0777  -0.0389 -0.0497 310 VAL A CB    
2426 C CG1   . VAL A 313 ? 0.2489 0.1497 0.2069 0.0700  -0.0258 -0.0442 310 VAL A CG1   
2427 C CG2   . VAL A 313 ? 0.2826 0.1470 0.2166 0.0848  -0.0566 -0.0578 310 VAL A CG2   
2428 N N     . LYS A 314 ? 0.2840 0.1501 0.1703 0.0526  -0.0238 -0.0258 311 LYS A N     
2429 C CA    . LYS A 314 ? 0.3168 0.1898 0.1979 0.0480  -0.0131 -0.0193 311 LYS A CA    
2430 C C     . LYS A 314 ? 0.2604 0.1557 0.1671 0.0480  0.0005  -0.0173 311 LYS A C     
2431 O O     . LYS A 314 ? 0.2985 0.2040 0.2237 0.0450  0.0019  -0.0165 311 LYS A O     
2432 C CB    . LYS A 314 ? 0.3392 0.2052 0.2054 0.0367  -0.0155 -0.0123 311 LYS A CB    
2433 C CG    . LYS A 314 ? 0.4999 0.3432 0.3420 0.0324  -0.0279 -0.0139 311 LYS A CG    
2434 C CD    . LYS A 314 ? 0.5718 0.3977 0.3891 0.0358  -0.0331 -0.0162 311 LYS A CD    
2435 C CE    . LYS A 314 ? 0.5946 0.3950 0.3837 0.0284  -0.0443 -0.0167 311 LYS A CE    
2436 N NZ    . LYS A 314 ? 0.5811 0.3682 0.3679 0.0305  -0.0537 -0.0212 311 LYS A NZ    
2437 N N     . PRO A 315 ? 0.2390 0.1393 0.1438 0.0507  0.0107  -0.0165 312 PRO A N     
2438 C CA    . PRO A 315 ? 0.2430 0.1597 0.1659 0.0487  0.0248  -0.0139 312 PRO A CA    
2439 C C     . PRO A 315 ? 0.2983 0.2153 0.2163 0.0401  0.0270  -0.0048 312 PRO A C     
2440 O O     . PRO A 315 ? 0.3272 0.2391 0.2298 0.0382  0.0311  0.0000  312 PRO A O     
2441 C CB    . PRO A 315 ? 0.3125 0.2274 0.2257 0.0536  0.0340  -0.0158 312 PRO A CB    
2442 C CG    . PRO A 315 ? 0.3445 0.2404 0.2288 0.0547  0.0243  -0.0147 312 PRO A CG    
2443 C CD    . PRO A 315 ? 0.3120 0.1997 0.1944 0.0550  0.0098  -0.0179 312 PRO A CD    
2444 N N     . ARG A 316 ? 0.2406 0.1626 0.1708 0.0356  0.0232  -0.0032 313 ARG A N     
2445 C CA    . ARG A 316 ? 0.2300 0.1537 0.1583 0.0285  0.0244  0.0039  313 ARG A CA    
2446 C C     . ARG A 316 ? 0.2683 0.2019 0.2176 0.0257  0.0259  0.0043  313 ARG A C     
2447 O O     . ARG A 316 ? 0.3063 0.2380 0.2604 0.0248  0.0181  0.0016  313 ARG A O     
2448 C CB    . ARG A 316 ? 0.2990 0.2123 0.2099 0.0241  0.0147  0.0057  313 ARG A CB    
2449 C CG    . ARG A 316 ? 0.3156 0.2333 0.2274 0.0180  0.0155  0.0111  313 ARG A CG    
2450 C CD    . ARG A 316 ? 0.3611 0.2718 0.2593 0.0124  0.0073  0.0110  313 ARG A CD    
2451 N NE    . ARG A 316 ? 0.4018 0.3065 0.2996 0.0097  0.0011  0.0074  313 ARG A NE    
2452 C CZ    . ARG A 316 ? 0.4265 0.3355 0.3361 0.0066  0.0009  0.0073  313 ARG A CZ    
2453 N NH1   . ARG A 316 ? 0.3639 0.2848 0.2885 0.0060  0.0065  0.0105  313 ARG A NH1   
2454 N NH2   . ARG A 316 ? 0.4789 0.3772 0.3822 0.0042  -0.0057 0.0038  313 ARG A NH2   
2455 N N     . GLN A 317 ? 0.2400 0.1813 0.1987 0.0238  0.0356  0.0079  314 GLN A N     
2456 C CA    . GLN A 317 ? 0.2801 0.2300 0.2581 0.0208  0.0379  0.0085  314 GLN A CA    
2457 C C     . GLN A 317 ? 0.3078 0.2558 0.2814 0.0159  0.0357  0.0144  314 GLN A C     
2458 O O     . GLN A 317 ? 0.2808 0.2327 0.2665 0.0133  0.0344  0.0148  314 GLN A O     
2459 C CB    . GLN A 317 ? 0.4014 0.3593 0.3919 0.0208  0.0506  0.0079  314 GLN A CB    
2460 C CG    . GLN A 317 ? 0.4828 0.4492 0.4939 0.0171  0.0534  0.0079  314 GLN A CG    
2461 C CD    . GLN A 317 ? 0.3961 0.3703 0.4194 0.0151  0.0672  0.0064  314 GLN A CD    
2462 O OE1   . GLN A 317 ? 0.5140 0.4884 0.5321 0.0172  0.0753  0.0040  314 GLN A OE1   
2463 N NE2   . GLN A 317 ? 0.4128 0.3924 0.4514 0.0102  0.0708  0.0073  314 GLN A NE2   
2464 N N     . LEU A 318 ? 0.2349 0.1769 0.1915 0.0153  0.0346  0.0182  315 LEU A N     
2465 C CA    . LEU A 318 ? 0.2429 0.1850 0.1973 0.0122  0.0322  0.0223  315 LEU A CA    
2466 C C     . LEU A 318 ? 0.2177 0.1577 0.1643 0.0096  0.0234  0.0207  315 LEU A C     
2467 O O     . LEU A 318 ? 0.2356 0.1700 0.1703 0.0101  0.0196  0.0187  315 LEU A O     
2468 C CB    . LEU A 318 ? 0.2156 0.1524 0.1573 0.0136  0.0361  0.0268  315 LEU A CB    
2469 C CG    . LEU A 318 ? 0.2625 0.1967 0.2047 0.0142  0.0468  0.0290  315 LEU A CG    
2470 C CD1   . LEU A 318 ? 0.3345 0.2568 0.2557 0.0157  0.0483  0.0335  315 LEU A CD1   
2471 C CD2   . LEU A 318 ? 0.2710 0.2101 0.2289 0.0113  0.0506  0.0303  315 LEU A CD2   
2472 N N     . PRO A 319 ? 0.2236 0.1676 0.1762 0.0063  0.0207  0.0213  316 PRO A N     
2473 C CA    . PRO A 319 ? 0.2101 0.1536 0.1559 0.0021  0.0146  0.0190  316 PRO A CA    
2474 C C     . PRO A 319 ? 0.2398 0.1822 0.1738 0.0025  0.0122  0.0198  316 PRO A C     
2475 O O     . PRO A 319 ? 0.2660 0.2081 0.1978 0.0064  0.0142  0.0230  316 PRO A O     
2476 C CB    . PRO A 319 ? 0.2437 0.1936 0.2004 -0.0007 0.0147  0.0189  316 PRO A CB    
2477 C CG    . PRO A 319 ? 0.2822 0.2342 0.2478 0.0029  0.0194  0.0224  316 PRO A CG    
2478 C CD    . PRO A 319 ? 0.2225 0.1711 0.1878 0.0058  0.0238  0.0233  316 PRO A CD    
2479 N N     . LYS A 320 ? 0.2413 0.1809 0.1661 -0.0018 0.0073  0.0168  317 LYS A N     
2480 C CA    . LYS A 320 ? 0.2621 0.2005 0.1760 -0.0023 0.0034  0.0164  317 LYS A CA    
2481 C C     . LYS A 320 ? 0.2698 0.2192 0.1921 -0.0052 0.0006  0.0146  317 LYS A C     
2482 O O     . LYS A 320 ? 0.2705 0.2215 0.1879 -0.0049 -0.0039 0.0136  317 LYS A O     
2483 C CB    . LYS A 320 ? 0.3458 0.2753 0.2455 -0.0072 -0.0009 0.0132  317 LYS A CB    
2484 C CG    . LYS A 320 ? 0.4476 0.3651 0.3368 -0.0031 -0.0006 0.0131  317 LYS A CG    
2485 C CD    . LYS A 320 ? 0.5389 0.4443 0.4101 -0.0081 -0.0066 0.0099  317 LYS A CD    
2486 C CE    . LYS A 320 ? 0.6813 0.5736 0.5403 -0.0021 -0.0079 0.0089  317 LYS A CE    
2487 N NZ    . LYS A 320 ? 0.7112 0.5882 0.5489 -0.0069 -0.0147 0.0061  317 LYS A NZ    
2488 N N     . THR A 321 ? 0.2507 0.2078 0.1861 -0.0079 0.0027  0.0131  318 THR A N     
2489 C CA    . THR A 321 ? 0.2476 0.2176 0.1945 -0.0100 0.0009  0.0096  318 THR A CA    
2490 C C     . THR A 321 ? 0.2163 0.1913 0.1765 -0.0067 0.0042  0.0109  318 THR A C     
2491 O O     . THR A 321 ? 0.2660 0.2354 0.2274 -0.0063 0.0079  0.0133  318 THR A O     
2492 C CB    . THR A 321 ? 0.3169 0.2915 0.2641 -0.0204 0.0006  0.0036  318 THR A CB    
2493 O OG1   . THR A 321 ? 0.2916 0.2588 0.2360 -0.0250 0.0041  0.0033  318 THR A OG1   
2494 C CG2   . THR A 321 ? 0.2689 0.2377 0.2021 -0.0247 -0.0035 0.0019  318 THR A CG2   
2495 N N     . ILE A 322 ? 0.1898 0.1750 0.1601 -0.0036 0.0017  0.0088  319 ILE A N     
2496 C CA    . ILE A 322 ? 0.1889 0.1779 0.1705 0.0001  0.0036  0.0093  319 ILE A CA    
2497 C C     . ILE A 322 ? 0.1833 0.1878 0.1786 -0.0026 0.0022  0.0018  319 ILE A C     
2498 O O     . ILE A 322 ? 0.1975 0.2112 0.1978 -0.0001 -0.0033 -0.0022 319 ILE A O     
2499 C CB    . ILE A 322 ? 0.1624 0.1447 0.1404 0.0091  0.0013  0.0141  319 ILE A CB    
2500 C CG1   . ILE A 322 ? 0.2277 0.1962 0.1936 0.0103  0.0056  0.0204  319 ILE A CG1   
2501 C CG2   . ILE A 322 ? 0.2271 0.2120 0.2154 0.0131  0.0017  0.0138  319 ILE A CG2   
2502 C CD1   . ILE A 322 ? 0.2385 0.1959 0.1958 0.0170  0.0056  0.0256  319 ILE A CD1   
2503 N N     . GLY A 323 ? 0.1556 0.1632 0.1572 -0.0080 0.0071  -0.0011 320 GLY A N     
2504 C CA    . GLY A 323 ? 0.1632 0.1861 0.1771 -0.0128 0.0084  -0.0096 320 GLY A CA    
2505 C C     . GLY A 323 ? 0.1535 0.1799 0.1773 -0.0116 0.0124  -0.0119 320 GLY A C     
2506 O O     . GLY A 323 ? 0.1866 0.2013 0.2058 -0.0095 0.0144  -0.0067 320 GLY A O     
2507 N N     . CYS A 324 ? 0.1616 0.2048 0.2000 -0.0132 0.0137  -0.0207 321 CYS A N     
2508 C CA    B CYS A 324 ? 0.2056 0.2541 0.2547 -0.0111 0.0174  -0.0247 321 CYS A CA    
2509 C CA    C CYS A 324 ? 0.2062 0.2524 0.2526 -0.0131 0.0185  -0.0242 321 CYS A CA    
2510 C C     . CYS A 324 ? 0.1730 0.2374 0.2320 -0.0208 0.0239  -0.0356 321 CYS A C     
2511 O O     . CYS A 324 ? 0.1799 0.2602 0.2488 -0.0230 0.0219  -0.0422 321 CYS A O     
2512 C CB    B CYS A 324 ? 0.2394 0.2954 0.3008 0.0021  0.0107  -0.0262 321 CYS A CB    
2513 C CB    C CYS A 324 ? 0.2370 0.2831 0.2910 -0.0003 0.0136  -0.0221 321 CYS A CB    
2514 S SG    B CYS A 324 ? 0.2290 0.2666 0.2781 0.0137  0.0030  -0.0150 321 CYS A SG    
2515 S SG    C CYS A 324 ? 0.2660 0.3293 0.3349 0.0096  0.0044  -0.0287 321 CYS A SG    
2516 N N     . SER A 325 ? 0.1719 0.2328 0.2293 -0.0262 0.0316  -0.0383 322 SER A N     
2517 C CA    A SER A 325 ? 0.1684 0.2435 0.2336 -0.0369 0.0401  -0.0494 322 SER A CA    
2518 C CA    B SER A 325 ? 0.1826 0.2545 0.2446 -0.0380 0.0405  -0.0484 322 SER A CA    
2519 C C     . SER A 325 ? 0.1328 0.2076 0.2015 -0.0370 0.0473  -0.0539 322 SER A C     
2520 O O     . SER A 325 ? 0.1703 0.2294 0.2311 -0.0312 0.0457  -0.0474 322 SER A O     
2521 C CB    A SER A 325 ? 0.2074 0.2707 0.2536 -0.0522 0.0452  -0.0488 322 SER A CB    
2522 C CB    B SER A 325 ? 0.2229 0.2776 0.2624 -0.0521 0.0452  -0.0458 322 SER A CB    
2523 O OG    A SER A 325 ? 0.2040 0.2423 0.2289 -0.0561 0.0478  -0.0426 322 SER A OG    
2524 O OG    B SER A 325 ? 0.2065 0.2690 0.2469 -0.0657 0.0554  -0.0557 322 SER A OG    
2525 N N     . LYS A 326 ? 0.1438 0.2374 0.2261 -0.0438 0.0554  -0.0660 323 LYS A N     
2526 C CA    . LYS A 326 ? 0.1500 0.2451 0.2359 -0.0449 0.0641  -0.0725 323 LYS A CA    
2527 C C     . LYS A 326 ? 0.1506 0.2548 0.2363 -0.0617 0.0777  -0.0834 323 LYS A C     
2528 O O     . LYS A 326 ? 0.1692 0.2966 0.2720 -0.0667 0.0796  -0.0923 323 LYS A O     
2529 C CB    . LYS A 326 ? 0.1707 0.2855 0.2818 -0.0298 0.0595  -0.0789 323 LYS A CB    
2530 C CG    . LYS A 326 ? 0.1586 0.2748 0.2736 -0.0292 0.0683  -0.0862 323 LYS A CG    
2531 C CD    . LYS A 326 ? 0.2185 0.3071 0.3147 -0.0235 0.0650  -0.0755 323 LYS A CD    
2532 C CE    . LYS A 326 ? 0.2406 0.3223 0.3308 -0.0276 0.0754  -0.0814 323 LYS A CE    
2533 N NZ    . LYS A 326 ? 0.1864 0.2515 0.2533 -0.0453 0.0859  -0.0812 323 LYS A NZ    
2534 N N     . ASN A 327 ? 0.1635 0.2483 0.2289 -0.0712 0.0871  -0.0832 324 ASN A N     
2535 C CA    . ASN A 327 ? 0.2069 0.2971 0.2690 -0.0879 0.1026  -0.0945 324 ASN A CA    
2536 C C     . ASN A 327 ? 0.2570 0.3684 0.3412 -0.0834 0.1110  -0.1068 324 ASN A C     
2537 O O     . ASN A 327 ? 0.2186 0.3279 0.3092 -0.0687 0.1052  -0.1042 324 ASN A O     
2538 C CB    . ASN A 327 ? 0.3354 0.3895 0.3599 -0.1002 0.1086  -0.0890 324 ASN A CB    
2539 C CG    . ASN A 327 ? 0.3776 0.4100 0.3777 -0.1081 0.1031  -0.0804 324 ASN A CG    
2540 O OD1   . ASN A 327 ? 0.4321 0.4776 0.4421 -0.1083 0.0979  -0.0799 324 ASN A OD1   
2541 N ND2   . ASN A 327 ? 0.4425 0.4397 0.4088 -0.1145 0.1033  -0.0742 324 ASN A ND2   
2542 N N     . PHE A 328 ? 0.2708 0.4009 0.3651 -0.0969 0.1254  -0.1207 325 PHE A N     
2543 C CA    . PHE A 328 ? 0.2965 0.4487 0.4125 -0.0948 0.1364  -0.1351 325 PHE A CA    
2544 C C     . PHE A 328 ? 0.3618 0.5036 0.4580 -0.1161 0.1566  -0.1431 325 PHE A C     
2545 O O     . PHE A 328 ? 0.4103 0.5729 0.5186 -0.1308 0.1688  -0.1552 325 PHE A O     
2546 C CB    . PHE A 328 ? 0.2951 0.4910 0.4544 -0.0872 0.1333  -0.1482 325 PHE A CB    
2547 C CG    . PHE A 328 ? 0.2710 0.4718 0.4436 -0.0673 0.1128  -0.1401 325 PHE A CG    
2548 C CD1   . PHE A 328 ? 0.2263 0.4274 0.3975 -0.0688 0.1029  -0.1336 325 PHE A CD1   
2549 C CD2   . PHE A 328 ? 0.2390 0.4395 0.4210 -0.0476 0.1037  -0.1383 325 PHE A CD2   
2550 C CE1   . PHE A 328 ? 0.2300 0.4312 0.4084 -0.0512 0.0850  -0.1258 325 PHE A CE1   
2551 C CE2   . PHE A 328 ? 0.2235 0.4232 0.4121 -0.0306 0.0856  -0.1304 325 PHE A CE2   
2552 C CZ    . PHE A 328 ? 0.2417 0.4416 0.4281 -0.0326 0.0766  -0.1241 325 PHE A CZ    
2553 N N     . PRO A 329 ? 0.3621 0.4695 0.4261 -0.1185 0.1603  -0.1365 326 PRO A N     
2554 C CA    . PRO A 329 ? 0.4858 0.5692 0.5175 -0.1391 0.1775  -0.1405 326 PRO A CA    
2555 C C     . PRO A 329 ? 0.5655 0.6708 0.6134 -0.1455 0.1971  -0.1582 326 PRO A C     
2556 O O     . PRO A 329 ? 0.5187 0.6442 0.5926 -0.1298 0.1955  -0.1644 326 PRO A O     
2557 C CB    . PRO A 329 ? 0.4887 0.5294 0.4850 -0.1336 0.1698  -0.1272 326 PRO A CB    
2558 C CG    . PRO A 329 ? 0.4376 0.4908 0.4578 -0.1104 0.1561  -0.1230 326 PRO A CG    
2559 C CD    . PRO A 329 ? 0.3715 0.4574 0.4253 -0.1016 0.1464  -0.1239 326 PRO A CD    
2560 N N     . GLY A 330 ? 0.6101 0.7092 0.6406 -0.1688 0.2157  -0.1664 327 GLY A N     
2561 C CA    . GLY A 330 ? 0.6367 0.7521 0.6763 -0.1792 0.2382  -0.1839 327 GLY A CA    
2562 C C     . GLY A 330 ? 0.6629 0.8309 0.7580 -0.1651 0.2395  -0.1993 327 GLY A C     
2563 O O     . GLY A 330 ? 0.6244 0.8294 0.7543 -0.1667 0.2388  -0.2081 327 GLY A O     
2564 N N     . LYS A 331 ? 0.7579 0.9275 0.8605 -0.1503 0.2399  -0.2029 328 LYS A N     
2565 C CA    . LYS A 331 ? 0.8280 1.0436 0.9795 -0.1364 0.2428  -0.2200 328 LYS A CA    
2566 C C     . LYS A 331 ? 0.6291 0.8722 0.8177 -0.1143 0.2201  -0.2172 328 LYS A C     
2567 O O     . LYS A 331 ? 0.5922 0.8789 0.8259 -0.1055 0.2203  -0.2331 328 LYS A O     
2568 C CB    . LYS A 331 ? 1.0389 1.2412 1.1814 -0.1259 0.2479  -0.2231 328 LYS A CB    
2569 C CG    . LYS A 331 ? 1.1869 1.4325 1.3768 -0.1090 0.2498  -0.2412 328 LYS A CG    
2570 C CD    . LYS A 331 ? 1.3132 1.5401 1.4875 -0.1010 0.2567  -0.2442 328 LYS A CD    
2571 C CE    . LYS A 331 ? 1.3694 1.6366 1.5899 -0.0805 0.2552  -0.2615 328 LYS A CE    
2572 N NZ    . LYS A 331 ? 1.3748 1.6539 1.6196 -0.0561 0.2279  -0.2539 328 LYS A NZ    
2573 N N     . THR A 332 ? 0.4556 0.6727 0.6250 -0.1054 0.2004  -0.1978 329 THR A N     
2574 C CA    . THR A 332 ? 0.3923 0.6268 0.5887 -0.0835 0.1785  -0.1931 329 THR A CA    
2575 C C     . THR A 332 ? 0.2772 0.5349 0.4935 -0.0883 0.1719  -0.1948 329 THR A C     
2576 O O     . THR A 332 ? 0.3296 0.5988 0.5645 -0.0716 0.1533  -0.1907 329 THR A O     
2577 C CB    . THR A 332 ? 0.4349 0.6327 0.6041 -0.0705 0.1606  -0.1724 329 THR A CB    
2578 O OG1   . THR A 332 ? 0.4333 0.6045 0.5727 -0.0828 0.1570  -0.1583 329 THR A OG1   
2579 C CG2   . THR A 332 ? 0.4510 0.6220 0.5972 -0.0673 0.1661  -0.1700 329 THR A CG2   
2580 N N     . ALA A 333 ? 0.3389 0.6010 0.5489 -0.1115 0.1868  -0.2009 330 ALA A N     
2581 C CA    . ALA A 333 ? 0.2858 0.5684 0.5129 -0.1177 0.1808  -0.2028 330 ALA A CA    
2582 C C     . ALA A 333 ? 0.2525 0.5815 0.5315 -0.1011 0.1710  -0.2170 330 ALA A C     
2583 O O     . ALA A 333 ? 0.2777 0.6371 0.5871 -0.0979 0.1809  -0.2351 330 ALA A O     
2584 C CB    . ALA A 333 ? 0.3398 0.6233 0.5556 -0.1466 0.2009  -0.2108 330 ALA A CB    
2585 N N     . LEU A 334 ? 0.2561 0.5892 0.5440 -0.0899 0.1510  -0.2093 331 LEU A N     
2586 C CA    . LEU A 334 ? 0.2563 0.6259 0.5877 -0.0708 0.1365  -0.2205 331 LEU A CA    
2587 C C     . LEU A 334 ? 0.2528 0.6683 0.6248 -0.0821 0.1465  -0.2427 331 LEU A C     
2588 O O     . LEU A 334 ? 0.3097 0.7308 0.6815 -0.0973 0.1475  -0.2429 331 LEU A O     
2589 C CB    . LEU A 334 ? 0.1777 0.5337 0.5014 -0.0575 0.1129  -0.2055 331 LEU A CB    
2590 C CG    . LEU A 334 ? 0.1568 0.4687 0.4414 -0.0489 0.1040  -0.1836 331 LEU A CG    
2591 C CD1   . LEU A 334 ? 0.1458 0.4468 0.4245 -0.0366 0.0829  -0.1709 331 LEU A CD1   
2592 C CD2   . LEU A 334 ? 0.2256 0.5311 0.5114 -0.0332 0.1034  -0.1847 331 LEU A CD2   
2593 N N     . ALA A 335 ? 0.2532 0.7020 0.6610 -0.0745 0.1535  -0.2622 332 ALA A N     
2594 C CA    . ALA A 335 ? 0.2534 0.7500 0.7042 -0.0863 0.1662  -0.2865 332 ALA A CA    
2595 C C     . ALA A 335 ? 0.2367 0.7755 0.7394 -0.0636 0.1481  -0.3025 332 ALA A C     
2596 O O     . ALA A 335 ? 0.2447 0.8294 0.7918 -0.0692 0.1568  -0.3258 332 ALA A O     
2597 C CB    . ALA A 335 ? 0.2950 0.8001 0.7476 -0.1003 0.1939  -0.3005 332 ALA A CB    
2598 N N     . THR A 336 ? 0.1671 0.6897 0.6639 -0.0384 0.1228  -0.2907 333 THR A N     
2599 C CA    . THR A 336 ? 0.2736 0.8282 0.8126 -0.0152 0.1013  -0.3038 333 THR A CA    
2600 C C     . THR A 336 ? 0.2610 0.7930 0.7823 -0.0042 0.0757  -0.2867 333 THR A C     
2601 O O     . THR A 336 ? 0.2431 0.7317 0.7200 -0.0055 0.0719  -0.2637 333 THR A O     
2602 C CB    . THR A 336 ? 0.2778 0.8364 0.8307 0.0103  0.0941  -0.3111 333 THR A CB    
2603 O OG1   . THR A 336 ? 0.2133 0.7234 0.7221 0.0214  0.0842  -0.2879 333 THR A OG1   
2604 C CG2   . THR A 336 ? 0.2748 0.8548 0.8440 0.0004  0.1203  -0.3287 333 THR A CG2   
2605 N N     . ARG A 337 ? 0.2716 0.8332 0.8280 0.0065  0.0581  -0.2989 334 ARG A N     
2606 C CA    . ARG A 337 ? 0.2899 0.8305 0.8299 0.0178  0.0333  -0.2846 334 ARG A CA    
2607 C C     . ARG A 337 ? 0.2562 0.7594 0.7676 0.0413  0.0163  -0.2683 334 ARG A C     
2608 O O     . ARG A 337 ? 0.2217 0.6871 0.6950 0.0423  0.0070  -0.2470 334 ARG A O     
2609 C CB    . ARG A 337 ? 0.3697 0.9496 0.9547 0.0273  0.0158  -0.3033 334 ARG A CB    
2610 C CG    . ARG A 337 ? 0.4588 1.0157 1.0255 0.0395  -0.0107 -0.2899 334 ARG A CG    
2611 C CD    . ARG A 337 ? 0.5567 1.1522 1.1679 0.0479  -0.0286 -0.3097 334 ARG A CD    
2612 N NE    . ARG A 337 ? 0.6765 1.3083 1.3334 0.0668  -0.0348 -0.3331 334 ARG A NE    
2613 C CZ    . ARG A 337 ? 0.7579 1.3758 1.4123 0.0955  -0.0554 -0.3324 334 ARG A CZ    
2614 N NH1   . ARG A 337 ? 0.7580 1.3265 1.3658 0.1070  -0.0703 -0.3092 334 ARG A NH1   
2615 N NH2   . ARG A 337 ? 0.7848 1.4375 1.4827 0.1125  -0.0607 -0.3556 334 ARG A NH2   
2616 N N     . GLU A 338 ? 0.2647 0.7782 0.7943 0.0598  0.0127  -0.2791 335 GLU A N     
2617 C CA    . GLU A 338 ? 0.2364 0.7140 0.7390 0.0814  -0.0023 -0.2653 335 GLU A CA    
2618 C C     . GLU A 338 ? 0.1693 0.6026 0.6228 0.0701  0.0093  -0.2417 335 GLU A C     
2619 O O     . GLU A 338 ? 0.1653 0.5615 0.5866 0.0804  -0.0040 -0.2235 335 GLU A O     
2620 C CB    . GLU A 338 ? 0.1977 0.6935 0.7265 0.0997  -0.0033 -0.2822 335 GLU A CB    
2621 C CG    . GLU A 338 ? 0.4082 0.9421 0.9840 0.1190  -0.0220 -0.3050 335 GLU A CG    
2622 C CD    . GLU A 338 ? 0.5436 1.0525 1.1041 0.1408  -0.0533 -0.2955 335 GLU A CD    
2623 O OE1   . GLU A 338 ? 0.5583 1.0203 1.0732 0.1445  -0.0593 -0.2726 335 GLU A OE1   
2624 O OE2   . GLU A 338 ? 0.6116 1.1470 1.2051 0.1539  -0.0719 -0.3114 335 GLU A OE2   
2625 N N     . GLN A 339 ? 0.2098 0.6462 0.6575 0.0490  0.0341  -0.2430 336 GLN A N     
2626 C CA    . GLN A 339 ? 0.2364 0.6325 0.6396 0.0376  0.0451  -0.2228 336 GLN A CA    
2627 C C     . GLN A 339 ? 0.2070 0.5784 0.5811 0.0272  0.0398  -0.2046 336 GLN A C     
2628 O O     . GLN A 339 ? 0.2050 0.5390 0.5442 0.0307  0.0339  -0.1852 336 GLN A O     
2629 C CB    . GLN A 339 ? 0.3439 0.7480 0.7459 0.0162  0.0720  -0.2300 336 GLN A CB    
2630 C CG    . GLN A 339 ? 0.3979 0.8046 0.8058 0.0237  0.0816  -0.2389 336 GLN A CG    
2631 C CD    . GLN A 339 ? 0.4249 0.8240 0.8153 0.0007  0.1079  -0.2398 336 GLN A CD    
2632 O OE1   . GLN A 339 ? 0.4669 0.8955 0.8791 -0.0148 0.1251  -0.2564 336 GLN A OE1   
2633 N NE2   . GLN A 339 ? 0.2427 0.6006 0.5922 -0.0026 0.1109  -0.2223 336 GLN A NE2   
2634 N N     . VAL A 340 ? 0.2361 0.6291 0.6251 0.0134  0.0429  -0.2118 337 VAL A N     
2635 C CA    . VAL A 340 ? 0.2334 0.6059 0.5972 0.0036  0.0377  -0.1969 337 VAL A CA    
2636 C C     . VAL A 340 ? 0.2159 0.5684 0.5678 0.0240  0.0140  -0.1853 337 VAL A C     
2637 O O     . VAL A 340 ? 0.1968 0.5157 0.5144 0.0224  0.0102  -0.1666 337 VAL A O     
2638 C CB    . VAL A 340 ? 0.1766 0.5787 0.5630 -0.0122 0.0420  -0.2092 337 VAL A CB    
2639 C CG1   . VAL A 340 ? 0.1274 0.5067 0.4872 -0.0195 0.0339  -0.1941 337 VAL A CG1   
2640 C CG2   . VAL A 340 ? 0.1948 0.6108 0.5862 -0.0353 0.0677  -0.2194 337 VAL A CG2   
2641 N N     . GLN A 341 ? 0.1881 0.5601 0.5676 0.0435  -0.0018 -0.1973 338 GLN A N     
2642 C CA    . GLN A 341 ? 0.2720 0.6224 0.6377 0.0632  -0.0251 -0.1877 338 GLN A CA    
2643 C C     . GLN A 341 ? 0.2491 0.5619 0.5832 0.0742  -0.0282 -0.1719 338 GLN A C     
2644 O O     . GLN A 341 ? 0.2457 0.5271 0.5504 0.0794  -0.0388 -0.1557 338 GLN A O     
2645 C CB    . GLN A 341 ? 0.3092 0.6880 0.7111 0.0820  -0.0435 -0.2058 338 GLN A CB    
2646 C CG    . GLN A 341 ? 0.3045 0.7162 0.7351 0.0728  -0.0463 -0.2192 338 GLN A CG    
2647 C CD    . GLN A 341 ? 0.3410 0.7816 0.8097 0.0927  -0.0669 -0.2386 338 GLN A CD    
2648 O OE1   . GLN A 341 ? 0.3657 0.8126 0.8493 0.1111  -0.0740 -0.2478 338 GLN A OE1   
2649 N NE2   . GLN A 341 ? 0.3234 0.7807 0.8077 0.0896  -0.0779 -0.2454 338 GLN A NE2   
2650 N N     . TRP A 342 ? 0.1667 0.4820 0.5061 0.0769  -0.0184 -0.1769 339 TRP A N     
2651 C CA    . TRP A 342 ? 0.2171 0.4973 0.5276 0.0859  -0.0207 -0.1629 339 TRP A CA    
2652 C C     . TRP A 342 ? 0.2271 0.4756 0.5010 0.0713  -0.0118 -0.1428 339 TRP A C     
2653 O O     . TRP A 342 ? 0.1854 0.4024 0.4323 0.0781  -0.0208 -0.1275 339 TRP A O     
2654 C CB    . TRP A 342 ? 0.1955 0.4847 0.5182 0.0896  -0.0102 -0.1730 339 TRP A CB    
2655 C CG    . TRP A 342 ? 0.2262 0.4799 0.5214 0.1003  -0.0148 -0.1602 339 TRP A CG    
2656 C CD1   . TRP A 342 ? 0.3315 0.5717 0.6237 0.1218  -0.0323 -0.1604 339 TRP A CD1   
2657 C CD2   . TRP A 342 ? 0.2062 0.4323 0.4725 0.0895  -0.0025 -0.1462 339 TRP A CD2   
2658 N NE1   . TRP A 342 ? 0.3173 0.5238 0.5809 0.1238  -0.0305 -0.1472 339 TRP A NE1   
2659 C CE2   . TRP A 342 ? 0.2557 0.4545 0.5047 0.1045  -0.0127 -0.1386 339 TRP A CE2   
2660 C CE3   . TRP A 342 ? 0.2209 0.4409 0.4730 0.0690  0.0148  -0.1398 339 TRP A CE3   
2661 C CZ2   . TRP A 342 ? 0.2226 0.3917 0.4443 0.0990  -0.0057 -0.1253 339 TRP A CZ2   
2662 C CZ3   . TRP A 342 ? 0.2488 0.4383 0.4732 0.0650  0.0204  -0.1268 339 TRP A CZ3   
2663 C CH2   . TRP A 342 ? 0.2900 0.4560 0.5012 0.0797  0.0103  -0.1199 339 TRP A CH2   
2664 N N     . TRP A 343 ? 0.1661 0.4222 0.4386 0.0510  0.0057  -0.1436 340 TRP A N     
2665 C CA    . TRP A 343 ? 0.1236 0.3508 0.3630 0.0376  0.0133  -0.1264 340 TRP A CA    
2666 C C     . TRP A 343 ? 0.1360 0.3507 0.3607 0.0364  0.0031  -0.1157 340 TRP A C     
2667 O O     . TRP A 343 ? 0.1379 0.3234 0.3350 0.0364  0.0008  -0.0998 340 TRP A O     
2668 C CB    . TRP A 343 ? 0.1714 0.4053 0.4089 0.0168  0.0331  -0.1306 340 TRP A CB    
2669 C CG    . TRP A 343 ? 0.1563 0.3833 0.3892 0.0158  0.0447  -0.1330 340 TRP A CG    
2670 C CD1   . TRP A 343 ? 0.2450 0.4952 0.4987 0.0122  0.0568  -0.1491 340 TRP A CD1   
2671 C CD2   . TRP A 343 ? 0.1801 0.3747 0.3858 0.0180  0.0453  -0.1194 340 TRP A CD2   
2672 N NE1   . TRP A 343 ? 0.2060 0.4376 0.4441 0.0126  0.0646  -0.1457 340 TRP A NE1   
2673 C CE2   . TRP A 343 ? 0.2357 0.4333 0.4449 0.0161  0.0569  -0.1275 340 TRP A CE2   
2674 C CE3   . TRP A 343 ? 0.1794 0.3435 0.3590 0.0209  0.0375  -0.1019 340 TRP A CE3   
2675 C CZ2   . TRP A 343 ? 0.2628 0.4324 0.4493 0.0174  0.0593  -0.1183 340 TRP A CZ2   
2676 C CZ3   . TRP A 343 ? 0.2659 0.4053 0.4263 0.0217  0.0405  -0.0935 340 TRP A CZ3   
2677 C CH2   . TRP A 343 ? 0.3108 0.4524 0.4743 0.0201  0.0505  -0.1014 340 TRP A CH2   
2678 N N     . LEU A 344 ? 0.1326 0.3698 0.3762 0.0355  -0.0030 -0.1249 341 LEU A N     
2679 C CA    . LEU A 344 ? 0.1471 0.3714 0.3754 0.0352  -0.0133 -0.1153 341 LEU A CA    
2680 C C     . LEU A 344 ? 0.1185 0.3174 0.3294 0.0529  -0.0285 -0.1048 341 LEU A C     
2681 O O     . LEU A 344 ? 0.1254 0.2988 0.3098 0.0516  -0.0316 -0.0905 341 LEU A O     
2682 C CB    . LEU A 344 ? 0.1104 0.3628 0.3632 0.0333  -0.0200 -0.1282 341 LEU A CB    
2683 C CG    . LEU A 344 ? 0.1906 0.4609 0.4517 0.0117  -0.0064 -0.1350 341 LEU A CG    
2684 C CD1   . LEU A 344 ? 0.1339 0.4342 0.4237 0.0122  -0.0158 -0.1494 341 LEU A CD1   
2685 C CD2   . LEU A 344 ? 0.1895 0.4319 0.4165 -0.0015 -0.0008 -0.1193 341 LEU A CD2   
2686 N N     . LEU A 345 ? 0.1468 0.3511 0.3711 0.0692  -0.0374 -0.1123 342 LEU A N     
2687 C CA    . LEU A 345 ? 0.1553 0.3310 0.3590 0.0852  -0.0514 -0.1024 342 LEU A CA    
2688 C C     . LEU A 345 ? 0.2208 0.3656 0.3961 0.0814  -0.0432 -0.0868 342 LEU A C     
2689 O O     . LEU A 345 ? 0.1875 0.3044 0.3369 0.0845  -0.0490 -0.0735 342 LEU A O     
2690 C CB    . LEU A 345 ? 0.1934 0.3793 0.4161 0.1043  -0.0642 -0.1149 342 LEU A CB    
2691 C CG    . LEU A 345 ? 0.2608 0.4127 0.4583 0.1209  -0.0795 -0.1054 342 LEU A CG    
2692 C CD1   . LEU A 345 ? 0.2652 0.3969 0.4404 0.1226  -0.0911 -0.0958 342 LEU A CD1   
2693 C CD2   . LEU A 345 ? 0.2659 0.4281 0.4828 0.1407  -0.0937 -0.1197 342 LEU A CD2   
2694 N N     . GLN A 346 ? 0.1523 0.3016 0.3320 0.0741  -0.0296 -0.0887 343 GLN A N     
2695 C CA    . GLN A 346 ? 0.1319 0.2534 0.2869 0.0699  -0.0228 -0.0750 343 GLN A CA    
2696 C C     . GLN A 346 ? 0.1573 0.2638 0.2918 0.0578  -0.0181 -0.0623 343 GLN A C     
2697 O O     . GLN A 346 ? 0.1539 0.2347 0.2664 0.0595  -0.0203 -0.0496 343 GLN A O     
2698 C CB    . GLN A 346 ? 0.1409 0.2689 0.3026 0.0628  -0.0090 -0.0800 343 GLN A CB    
2699 C CG    . GLN A 346 ? 0.1376 0.2847 0.3227 0.0736  -0.0107 -0.0950 343 GLN A CG    
2700 C CD    . GLN A 346 ? 0.2006 0.3343 0.3823 0.0935  -0.0270 -0.0944 343 GLN A CD    
2701 O OE1   . GLN A 346 ? 0.2236 0.3280 0.3825 0.0976  -0.0301 -0.0827 343 GLN A OE1   
2702 N NE2   . GLN A 346 ? 0.2364 0.3907 0.4403 0.1057  -0.0381 -0.1076 343 GLN A NE2   
2703 N N     . LEU A 347 ? 0.1563 0.2786 0.2981 0.0452  -0.0113 -0.0666 344 LEU A N     
2704 C CA    . LEU A 347 ? 0.1494 0.2582 0.2723 0.0343  -0.0074 -0.0563 344 LEU A CA    
2705 C C     . LEU A 347 ? 0.1579 0.2537 0.2682 0.0423  -0.0193 -0.0490 344 LEU A C     
2706 O O     . LEU A 347 ? 0.1492 0.2234 0.2384 0.0401  -0.0183 -0.0371 344 LEU A O     
2707 C CB    . LEU A 347 ? 0.1325 0.2592 0.2639 0.0196  0.0005  -0.0635 344 LEU A CB    
2708 C CG    . LEU A 347 ? 0.2443 0.3783 0.3804 0.0077  0.0148  -0.0695 344 LEU A CG    
2709 C CD1   . LEU A 347 ? 0.2220 0.3738 0.3665 -0.0069 0.0219  -0.0783 344 LEU A CD1   
2710 C CD2   . LEU A 347 ? 0.2285 0.3367 0.3411 0.0018  0.0210  -0.0581 344 LEU A CD2   
2711 N N     . ALA A 348 ? 0.1622 0.2703 0.2852 0.0519  -0.0308 -0.0570 345 ALA A N     
2712 C CA    . ALA A 348 ? 0.1714 0.2648 0.2794 0.0592  -0.0429 -0.0509 345 ALA A CA    
2713 C C     . ALA A 348 ? 0.1574 0.2213 0.2432 0.0690  -0.0478 -0.0402 345 ALA A C     
2714 O O     . ALA A 348 ? 0.1909 0.2335 0.2542 0.0694  -0.0505 -0.0302 345 ALA A O     
2715 C CB    . ALA A 348 ? 0.1688 0.2810 0.2956 0.0682  -0.0563 -0.0631 345 ALA A CB    
2716 N N     . GLN A 349 ? 0.1603 0.2219 0.2514 0.0763  -0.0482 -0.0427 346 GLN A N     
2717 C CA    . GLN A 349 ? 0.1824 0.2143 0.2514 0.0837  -0.0517 -0.0327 346 GLN A CA    
2718 C C     . GLN A 349 ? 0.2062 0.2213 0.2580 0.0725  -0.0396 -0.0204 346 GLN A C     
2719 O O     . GLN A 349 ? 0.2057 0.1963 0.2351 0.0736  -0.0409 -0.0101 346 GLN A O     
2720 C CB    . GLN A 349 ? 0.1773 0.2104 0.2559 0.0940  -0.0555 -0.0392 346 GLN A CB    
2721 C CG    . GLN A 349 ? 0.2242 0.2664 0.3150 0.1097  -0.0719 -0.0505 346 GLN A CG    
2722 C CD    . GLN A 349 ? 0.3241 0.3668 0.4243 0.1218  -0.0768 -0.0581 346 GLN A CD    
2723 O OE1   . GLN A 349 ? 0.3611 0.4086 0.4680 0.1168  -0.0659 -0.0590 346 GLN A OE1   
2724 N NE2   . GLN A 349 ? 0.3630 0.3987 0.4620 0.1386  -0.0943 -0.0641 346 GLN A NE2   
2725 N N     . GLU A 350 ? 0.1670 0.1943 0.2288 0.0616  -0.0279 -0.0219 347 GLU A N     
2726 C CA    . GLU A 350 ? 0.1739 0.1869 0.2218 0.0520  -0.0186 -0.0118 347 GLU A CA    
2727 C C     . GLU A 350 ? 0.1704 0.1776 0.2059 0.0472  -0.0185 -0.0059 347 GLU A C     
2728 O O     . GLU A 350 ? 0.1846 0.1736 0.2038 0.0454  -0.0158 0.0034  347 GLU A O     
2729 C CB    . GLU A 350 ? 0.1718 0.1954 0.2291 0.0416  -0.0080 -0.0150 347 GLU A CB    
2730 C CG    . GLU A 350 ? 0.2130 0.2217 0.2569 0.0331  -0.0010 -0.0056 347 GLU A CG    
2731 C CD    . GLU A 350 ? 0.2383 0.2517 0.2861 0.0231  0.0074  -0.0082 347 GLU A CD    
2732 O OE1   . GLU A 350 ? 0.2378 0.2608 0.2959 0.0230  0.0099  -0.0156 347 GLU A OE1   
2733 O OE2   . GLU A 350 ? 0.2374 0.2435 0.2766 0.0158  0.0112  -0.0033 347 GLU A OE2   
2734 N N     . LEU A 351 ? 0.1675 0.1908 0.2114 0.0448  -0.0210 -0.0122 348 LEU A N     
2735 C CA    . LEU A 351 ? 0.1998 0.2175 0.2315 0.0407  -0.0217 -0.0077 348 LEU A CA    
2736 C C     . LEU A 351 ? 0.2218 0.2191 0.2345 0.0495  -0.0296 -0.0012 348 LEU A C     
2737 O O     . LEU A 351 ? 0.1993 0.1810 0.1945 0.0462  -0.0258 0.0070  348 LEU A O     
2738 C CB    . LEU A 351 ? 0.2043 0.2428 0.2490 0.0365  -0.0243 -0.0167 348 LEU A CB    
2739 C CG    . LEU A 351 ? 0.2312 0.2651 0.2637 0.0305  -0.0245 -0.0132 348 LEU A CG    
2740 C CD1   . LEU A 351 ? 0.2630 0.2868 0.2846 0.0213  -0.0143 -0.0064 348 LEU A CD1   
2741 C CD2   . LEU A 351 ? 0.2710 0.3262 0.3183 0.0253  -0.0272 -0.0234 348 LEU A CD2   
2742 N N     . GLU A 352 ? 0.2342 0.2301 0.2490 0.0608  -0.0407 -0.0055 349 GLU A N     
2743 C CA    . GLU A 352 ? 0.2781 0.2493 0.2698 0.0694  -0.0493 0.0004  349 GLU A CA    
2744 C C     . GLU A 352 ? 0.2658 0.2126 0.2382 0.0669  -0.0415 0.0111  349 GLU A C     
2745 O O     . GLU A 352 ? 0.2672 0.1937 0.2170 0.0658  -0.0400 0.0187  349 GLU A O     
2746 C CB    . GLU A 352 ? 0.2769 0.2470 0.2727 0.0834  -0.0641 -0.0066 349 GLU A CB    
2747 C CG    . GLU A 352 ? 0.3971 0.3342 0.3621 0.0922  -0.0738 0.0002  349 GLU A CG    
2748 C CD    . GLU A 352 ? 0.6110 0.5412 0.5760 0.1077  -0.0906 -0.0065 349 GLU A CD    
2749 O OE1   . GLU A 352 ? 0.7194 0.6164 0.6548 0.1150  -0.0983 -0.0005 349 GLU A OE1   
2750 O OE2   . GLU A 352 ? 0.5822 0.5387 0.5756 0.1128  -0.0960 -0.0184 349 GLU A OE2   
2751 N N     . GLU A 353 ? 0.2295 0.1785 0.2109 0.0654  -0.0359 0.0111  350 GLU A N     
2752 C CA    . GLU A 353 ? 0.2586 0.1863 0.2246 0.0621  -0.0287 0.0202  350 GLU A CA    
2753 C C     . GLU A 353 ? 0.2262 0.1530 0.1874 0.0513  -0.0174 0.0261  350 GLU A C     
2754 O O     . GLU A 353 ? 0.2824 0.1900 0.2253 0.0490  -0.0129 0.0335  350 GLU A O     
2755 C CB    . GLU A 353 ? 0.2595 0.1911 0.2377 0.0619  -0.0255 0.0182  350 GLU A CB    
2756 C CG    . GLU A 353 ? 0.4209 0.3331 0.3867 0.0566  -0.0177 0.0266  350 GLU A CG    
2757 C CD    . GLU A 353 ? 0.5846 0.4969 0.5594 0.0576  -0.0167 0.0246  350 GLU A CD    
2758 O OE1   . GLU A 353 ? 0.5936 0.5086 0.5737 0.0669  -0.0250 0.0185  350 GLU A OE1   
2759 O OE2   . GLU A 353 ? 0.6786 0.5884 0.6557 0.0495  -0.0082 0.0284  350 GLU A OE2   
2760 N N     . ARG A 354 ? 0.1966 0.1433 0.1736 0.0447  -0.0127 0.0221  351 ARG A N     
2761 C CA    . ARG A 354 ? 0.1919 0.1381 0.1655 0.0360  -0.0039 0.0263  351 ARG A CA    
2762 C C     . ARG A 354 ? 0.2285 0.1669 0.1866 0.0366  -0.0054 0.0291  351 ARG A C     
2763 O O     . ARG A 354 ? 0.2463 0.1745 0.1939 0.0327  0.0017  0.0344  351 ARG A O     
2764 C CB    . ARG A 354 ? 0.2199 0.1841 0.2094 0.0291  0.0000  0.0213  351 ARG A CB    
2765 C CG    . ARG A 354 ? 0.2011 0.1672 0.2007 0.0272  0.0036  0.0202  351 ARG A CG    
2766 C CD    . ARG A 354 ? 0.2110 0.1921 0.2228 0.0213  0.0060  0.0138  351 ARG A CD    
2767 N NE    . ARG A 354 ? 0.2061 0.1882 0.2140 0.0141  0.0095  0.0146  351 ARG A NE    
2768 C CZ    . ARG A 354 ? 0.2096 0.2005 0.2217 0.0076  0.0111  0.0094  351 ARG A CZ    
2769 N NH1   . ARG A 354 ? 0.2150 0.2166 0.2372 0.0066  0.0114  0.0028  351 ARG A NH1   
2770 N NH2   . ARG A 354 ? 0.2111 0.1986 0.2160 0.0019  0.0128  0.0104  351 ARG A NH2   
2771 N N     . LEU A 355 ? 0.2443 0.1877 0.2017 0.0415  -0.0146 0.0247  352 LEU A N     
2772 C CA    . LEU A 355 ? 0.2475 0.1818 0.1883 0.0427  -0.0177 0.0267  352 LEU A CA    
2773 C C     . LEU A 355 ? 0.2657 0.1730 0.1812 0.0471  -0.0181 0.0337  352 LEU A C     
2774 O O     . LEU A 355 ? 0.2843 0.1792 0.1829 0.0444  -0.0129 0.0382  352 LEU A O     
2775 C CB    . LEU A 355 ? 0.2328 0.1787 0.1801 0.0473  -0.0294 0.0195  352 LEU A CB    
2776 C CG    . LEU A 355 ? 0.1997 0.1689 0.1652 0.0401  -0.0278 0.0127  352 LEU A CG    
2777 C CD1   . LEU A 355 ? 0.2179 0.2007 0.1939 0.0445  -0.0395 0.0041  352 LEU A CD1   
2778 C CD2   . LEU A 355 ? 0.2622 0.2265 0.2168 0.0330  -0.0216 0.0164  352 LEU A CD2   
2779 N N     . THR A 356 ? 0.2682 0.1646 0.1790 0.0539  -0.0242 0.0340  353 THR A N     
2780 C CA    . THR A 356 ? 0.2981 0.1639 0.1802 0.0573  -0.0250 0.0405  353 THR A CA    
2781 C C     . THR A 356 ? 0.3375 0.1934 0.2123 0.0484  -0.0097 0.0473  353 THR A C     
2782 O O     . THR A 356 ? 0.3492 0.1858 0.2011 0.0460  -0.0041 0.0524  353 THR A O     
2783 C CB    . THR A 356 ? 0.3685 0.2223 0.2459 0.0665  -0.0355 0.0391  353 THR A CB    
2784 O OG1   . THR A 356 ? 0.3913 0.2555 0.2769 0.0758  -0.0507 0.0312  353 THR A OG1   
2785 C CG2   . THR A 356 ? 0.4012 0.2177 0.2433 0.0684  -0.0357 0.0465  353 THR A CG2   
2786 N N     . LYS A 357 ? 0.3295 0.1990 0.2243 0.0433  -0.0027 0.0466  354 LYS A N     
2787 C CA    . LYS A 357 ? 0.2883 0.1538 0.1826 0.0346  0.0110  0.0511  354 LYS A CA    
2788 C C     . LYS A 357 ? 0.3021 0.1752 0.1968 0.0297  0.0182  0.0510  354 LYS A C     
2789 O O     . LYS A 357 ? 0.3317 0.1932 0.2142 0.0252  0.0281  0.0548  354 LYS A O     
2790 C CB    . LYS A 357 ? 0.3198 0.1999 0.2372 0.0307  0.0147  0.0490  354 LYS A CB    
2791 C CG    . LYS A 357 ? 0.4496 0.3276 0.3705 0.0221  0.0273  0.0522  354 LYS A CG    
2792 C CD    . LYS A 357 ? 0.5872 0.4694 0.5230 0.0195  0.0285  0.0515  354 LYS A CD    
2793 C CE    . LYS A 357 ? 0.6303 0.5001 0.5613 0.0121  0.0388  0.0558  354 LYS A CE    
2794 N NZ    . LYS A 357 ? 0.5477 0.4234 0.4814 0.0062  0.0490  0.0558  354 LYS A NZ    
2795 N N     . ASP A 358 ? 0.2559 0.1475 0.1637 0.0304  0.0136  0.0462  355 ASP A N     
2796 C CA    . ASP A 358 ? 0.2607 0.1580 0.1676 0.0267  0.0185  0.0455  355 ASP A CA    
2797 C C     . ASP A 358 ? 0.3168 0.1953 0.1976 0.0290  0.0190  0.0488  355 ASP A C     
2798 O O     . ASP A 358 ? 0.3131 0.1874 0.1869 0.0254  0.0283  0.0503  355 ASP A O     
2799 C CB    . ASP A 358 ? 0.2419 0.1579 0.1627 0.0264  0.0122  0.0397  355 ASP A CB    
2800 C CG    . ASP A 358 ? 0.2934 0.2121 0.2108 0.0231  0.0161  0.0389  355 ASP A CG    
2801 O OD1   . ASP A 358 ? 0.2768 0.2012 0.2036 0.0189  0.0229  0.0383  355 ASP A OD1   
2802 O OD2   . ASP A 358 ? 0.2828 0.1968 0.1873 0.0254  0.0111  0.0383  355 ASP A OD2   
2803 N N     . ARG A 359 ? 0.2724 0.1389 0.1383 0.0355  0.0085  0.0491  356 ARG A N     
2804 C CA    . ARG A 359 ? 0.3487 0.1937 0.1858 0.0384  0.0066  0.0519  356 ARG A CA    
2805 C C     . ARG A 359 ? 0.3485 0.1698 0.1640 0.0347  0.0184  0.0580  356 ARG A C     
2806 O O     . ARG A 359 ? 0.3619 0.1708 0.1587 0.0323  0.0260  0.0601  356 ARG A O     
2807 C CB    . ARG A 359 ? 0.3586 0.1945 0.1854 0.0473  -0.0097 0.0500  356 ARG A CB    
2808 C CG    . ARG A 359 ? 0.4232 0.2352 0.2182 0.0513  -0.0152 0.0521  356 ARG A CG    
2809 C CD    . ARG A 359 ? 0.4651 0.2696 0.2531 0.0615  -0.0344 0.0487  356 ARG A CD    
2810 N NE    . ARG A 359 ? 0.5487 0.3382 0.3299 0.0664  -0.0390 0.0504  356 ARG A NE    
2811 C CZ    . ARG A 359 ? 0.6300 0.4219 0.4180 0.0760  -0.0554 0.0452  356 ARG A CZ    
2812 N NH1   . ARG A 359 ? 0.6315 0.4429 0.4362 0.0807  -0.0678 0.0376  356 ARG A NH1   
2813 N NH2   . ARG A 359 ? 0.6688 0.4436 0.4476 0.0808  -0.0593 0.0470  356 ARG A NH2   
2814 N N     . ASN A 360 ? 0.3088 0.1234 0.1261 0.0335  0.0207  0.0603  357 ASN A N     
2815 C CA    . ASN A 360 ? 0.3462 0.1382 0.1438 0.0277  0.0330  0.0657  357 ASN A CA    
2816 C C     . ASN A 360 ? 0.3882 0.1937 0.2005 0.0185  0.0500  0.0651  357 ASN A C     
2817 O O     . ASN A 360 ? 0.4641 0.2545 0.2583 0.0132  0.0624  0.0676  357 ASN A O     
2818 C CB    . ASN A 360 ? 0.3430 0.1249 0.1403 0.0283  0.0300  0.0677  357 ASN A CB    
2819 C CG    . ASN A 360 ? 0.4175 0.1743 0.1890 0.0375  0.0151  0.0690  357 ASN A CG    
2820 O OD1   . ASN A 360 ? 0.5246 0.2566 0.2647 0.0399  0.0127  0.0716  357 ASN A OD1   
2821 N ND2   . ASN A 360 ? 0.4834 0.2449 0.2667 0.0434  0.0044  0.0667  357 ASN A ND2   
2822 N N     . ASP A 361 ? 0.3345 0.1675 0.1791 0.0169  0.0503  0.0610  358 ASP A N     
2823 C CA    . ASP A 361 ? 0.3540 0.2021 0.2170 0.0100  0.0632  0.0588  358 ASP A CA    
2824 C C     . ASP A 361 ? 0.3505 0.2048 0.2112 0.0105  0.0670  0.0561  358 ASP A C     
2825 O O     . ASP A 361 ? 0.3408 0.1957 0.2021 0.0058  0.0801  0.0551  358 ASP A O     
2826 C CB    . ASP A 361 ? 0.3200 0.1914 0.2146 0.0091  0.0595  0.0550  358 ASP A CB    
2827 C CG    . ASP A 361 ? 0.4496 0.3162 0.3496 0.0070  0.0592  0.0571  358 ASP A CG    
2828 O OD1   . ASP A 361 ? 0.4616 0.3065 0.3417 0.0048  0.0634  0.0615  358 ASP A OD1   
2829 O OD2   . ASP A 361 ? 0.4711 0.3530 0.3928 0.0070  0.0548  0.0542  358 ASP A OD2   
2830 N N     . ASN A 362 ? 0.3170 0.1761 0.1756 0.0162  0.0557  0.0542  359 ASN A N     
2831 C CA    . ASN A 362 ? 0.3206 0.1892 0.1822 0.0169  0.0568  0.0505  359 ASN A CA    
2832 C C     . ASN A 362 ? 0.3275 0.1806 0.1624 0.0209  0.0525  0.0516  359 ASN A C     
2833 O O     . ASN A 362 ? 0.3392 0.1975 0.1735 0.0220  0.0523  0.0487  359 ASN A O     
2834 C CB    . ASN A 362 ? 0.2777 0.1675 0.1628 0.0176  0.0486  0.0460  359 ASN A CB    
2835 C CG    . ASN A 362 ? 0.2985 0.2017 0.2081 0.0138  0.0528  0.0443  359 ASN A CG    
2836 O OD1   . ASN A 362 ? 0.3178 0.2224 0.2339 0.0103  0.0633  0.0438  359 ASN A OD1   
2837 N ND2   . ASN A 362 ? 0.2592 0.1722 0.1824 0.0142  0.0446  0.0427  359 ASN A ND2   
2838 N N     . ASP A 363 ? 0.3424 0.1743 0.1534 0.0237  0.0478  0.0556  360 ASP A N     
2839 C CA    . ASP A 363 ? 0.3802 0.1924 0.1615 0.0275  0.0437  0.0570  360 ASP A CA    
2840 C C     . ASP A 363 ? 0.3783 0.2022 0.1655 0.0314  0.0314  0.0530  360 ASP A C     
2841 O O     . ASP A 363 ? 0.4185 0.2376 0.1934 0.0320  0.0328  0.0518  360 ASP A O     
2842 C CB    . ASP A 363 ? 0.4595 0.2611 0.2254 0.0238  0.0594  0.0576  360 ASP A CB    
2843 C CG    . ASP A 363 ? 0.5898 0.3756 0.3440 0.0181  0.0730  0.0613  360 ASP A CG    
2844 O OD1   . ASP A 363 ? 0.5174 0.2803 0.2495 0.0195  0.0676  0.0657  360 ASP A OD1   
2845 O OD2   . ASP A 363 ? 0.6659 0.4617 0.4333 0.0121  0.0884  0.0592  360 ASP A OD2   
2846 N N     . ARG A 364 ? 0.3635 0.2026 0.1695 0.0333  0.0198  0.0505  361 ARG A N     
2847 C CA    . ARG A 364 ? 0.3571 0.2080 0.1700 0.0350  0.0085  0.0460  361 ARG A CA    
2848 C C     . ARG A 364 ? 0.3632 0.2225 0.1878 0.0385  -0.0046 0.0435  361 ARG A C     
2849 O O     . ARG A 364 ? 0.3361 0.1960 0.1685 0.0395  -0.0043 0.0447  361 ARG A O     
2850 C CB    . ARG A 364 ? 0.3246 0.1957 0.1589 0.0303  0.0131  0.0423  361 ARG A CB    
2851 C CG    . ARG A 364 ? 0.2585 0.1467 0.1190 0.0272  0.0155  0.0410  361 ARG A CG    
2852 C CD    . ARG A 364 ? 0.2502 0.1523 0.1260 0.0231  0.0191  0.0375  361 ARG A CD    
2853 N NE    . ARG A 364 ? 0.2640 0.1796 0.1617 0.0203  0.0195  0.0359  361 ARG A NE    
2854 C CZ    . ARG A 364 ? 0.2919 0.2183 0.2028 0.0167  0.0194  0.0324  361 ARG A CZ    
2855 N NH1   . ARG A 364 ? 0.2672 0.2026 0.1946 0.0143  0.0196  0.0312  361 ARG A NH1   
2856 N NH2   . ARG A 364 ? 0.2851 0.2103 0.1900 0.0156  0.0185  0.0300  361 ARG A NH2   
2857 N N     . VAL A 365 ? 0.3574 0.2234 0.1837 0.0402  -0.0162 0.0391  362 VAL A N     
2858 C CA    . VAL A 365 ? 0.3419 0.2195 0.1825 0.0438  -0.0291 0.0344  362 VAL A CA    
2859 C C     . VAL A 365 ? 0.3581 0.2581 0.2181 0.0390  -0.0334 0.0278  362 VAL A C     
2860 O O     . VAL A 365 ? 0.3512 0.2485 0.2019 0.0362  -0.0339 0.0271  362 VAL A O     
2861 C CB    . VAL A 365 ? 0.3827 0.2410 0.2017 0.0521  -0.0424 0.0346  362 VAL A CB    
2862 C CG1   . VAL A 365 ? 0.4924 0.3237 0.2876 0.0557  -0.0380 0.0412  362 VAL A CG1   
2863 C CG2   . VAL A 365 ? 0.4365 0.2846 0.2365 0.0522  -0.0470 0.0341  362 VAL A CG2   
2864 N N     . ALA A 366 ? 0.2702 0.1908 0.1553 0.0373  -0.0358 0.0228  363 ALA A N     
2865 C CA    . ALA A 366 ? 0.2815 0.2227 0.1842 0.0310  -0.0389 0.0158  363 ALA A CA    
2866 C C     . ALA A 366 ? 0.2886 0.2327 0.1906 0.0349  -0.0531 0.0102  363 ALA A C     
2867 O O     . ALA A 366 ? 0.3547 0.2921 0.2530 0.0437  -0.0624 0.0096  363 ALA A O     
2868 C CB    . ALA A 366 ? 0.2685 0.2293 0.1966 0.0277  -0.0352 0.0117  363 ALA A CB    
2869 N N     . THR A 367 ? 0.2772 0.2298 0.1821 0.0283  -0.0561 0.0056  364 THR A N     
2870 C CA    . THR A 367 ? 0.2830 0.2392 0.1885 0.0312  -0.0704 -0.0006 364 THR A CA    
2871 C C     . THR A 367 ? 0.2860 0.2706 0.2198 0.0236  -0.0736 -0.0111 364 THR A C     
2872 O O     . THR A 367 ? 0.3070 0.3008 0.2492 0.0255  -0.0860 -0.0185 364 THR A O     
2873 C CB    . THR A 367 ? 0.3383 0.2750 0.2169 0.0307  -0.0739 0.0027  364 THR A CB    
2874 O OG1   . THR A 367 ? 0.3695 0.3115 0.2490 0.0201  -0.0671 0.0017  364 THR A OG1   
2875 C CG2   . THR A 367 ? 0.4105 0.3196 0.2610 0.0371  -0.0681 0.0121  364 THR A CG2   
2876 N N     . GLN A 368 ? 0.2541 0.2520 0.2021 0.0145  -0.0625 -0.0125 365 GLN A N     
2877 C CA    . GLN A 368 ? 0.2685 0.2914 0.2405 0.0049  -0.0623 -0.0225 365 GLN A CA    
2878 C C     . GLN A 368 ? 0.2116 0.2497 0.2042 0.0033  -0.0539 -0.0252 365 GLN A C     
2879 O O     . GLN A 368 ? 0.2379 0.2661 0.2233 0.0033  -0.0446 -0.0184 365 GLN A O     
2880 C CB    . GLN A 368 ? 0.2924 0.3117 0.2545 -0.0083 -0.0567 -0.0226 365 GLN A CB    
2881 C CG    . GLN A 368 ? 0.3220 0.3644 0.3052 -0.0212 -0.0548 -0.0332 365 GLN A CG    
2882 C CD    . GLN A 368 ? 0.4102 0.4432 0.3776 -0.0346 -0.0512 -0.0330 365 GLN A CD    
2883 O OE1   . GLN A 368 ? 0.4799 0.4997 0.4335 -0.0396 -0.0423 -0.0277 365 GLN A OE1   
2884 N NE2   . GLN A 368 ? 0.4692 0.5076 0.4379 -0.0402 -0.0592 -0.0392 365 GLN A NE2   
2885 N N     . LEU A 369 ? 0.1878 0.2505 0.2069 0.0020  -0.0573 -0.0361 366 LEU A N     
2886 C CA    . LEU A 369 ? 0.2566 0.3353 0.2958 -0.0007 -0.0486 -0.0404 366 LEU A CA    
2887 C C     . LEU A 369 ? 0.2453 0.3415 0.2973 -0.0170 -0.0407 -0.0488 366 LEU A C     
2888 O O     . LEU A 369 ? 0.2331 0.3450 0.2976 -0.0223 -0.0460 -0.0579 366 LEU A O     
2889 C CB    . LEU A 369 ? 0.2464 0.3402 0.3069 0.0112  -0.0575 -0.0478 366 LEU A CB    
2890 C CG    . LEU A 369 ? 0.2314 0.3423 0.3135 0.0101  -0.0491 -0.0536 366 LEU A CG    
2891 C CD1   . LEU A 369 ? 0.2339 0.3245 0.3001 0.0141  -0.0418 -0.0425 366 LEU A CD1   
2892 C CD2   . LEU A 369 ? 0.2623 0.3926 0.3694 0.0218  -0.0601 -0.0646 366 LEU A CD2   
2893 N N     . VAL A 370 ? 0.2075 0.2990 0.2547 -0.0255 -0.0281 -0.0460 367 VAL A N     
2894 C CA    . VAL A 370 ? 0.2170 0.3190 0.2699 -0.0424 -0.0190 -0.0532 367 VAL A CA    
2895 C C     . VAL A 370 ? 0.1991 0.3195 0.2738 -0.0444 -0.0107 -0.0607 367 VAL A C     
2896 O O     . VAL A 370 ? 0.2321 0.3440 0.3033 -0.0384 -0.0064 -0.0554 367 VAL A O     
2897 C CB    . VAL A 370 ? 0.2385 0.3163 0.2641 -0.0516 -0.0117 -0.0452 367 VAL A CB    
2898 C CG1   . VAL A 370 ? 0.3290 0.4126 0.3558 -0.0698 -0.0016 -0.0524 367 VAL A CG1   
2899 C CG2   . VAL A 370 ? 0.2401 0.3005 0.2443 -0.0501 -0.0192 -0.0392 367 VAL A CG2   
2900 N N     . VAL A 371 ? 0.2197 0.3657 0.3173 -0.0531 -0.0082 -0.0739 368 VAL A N     
2901 C CA    . VAL A 371 ? 0.2494 0.4151 0.3689 -0.0562 0.0013  -0.0832 368 VAL A CA    
2902 C C     . VAL A 371 ? 0.2256 0.3926 0.3398 -0.0774 0.0156  -0.0886 368 VAL A C     
2903 O O     . VAL A 371 ? 0.2509 0.4240 0.3654 -0.0903 0.0163  -0.0942 368 VAL A O     
2904 C CB    . VAL A 371 ? 0.2882 0.4863 0.4431 -0.0485 -0.0060 -0.0970 368 VAL A CB    
2905 C CG1   . VAL A 371 ? 0.3011 0.5175 0.4777 -0.0473 0.0033  -0.1059 368 VAL A CG1   
2906 C CG2   . VAL A 371 ? 0.2592 0.4507 0.4130 -0.0287 -0.0231 -0.0920 368 VAL A CG2   
2907 N N     . SER A 372 ? 0.2369 0.3951 0.3434 -0.0815 0.0269  -0.0867 369 SER A N     
2908 C CA    . SER A 372 ? 0.2104 0.3633 0.3056 -0.1017 0.0411  -0.0910 369 SER A CA    
2909 C C     . SER A 372 ? 0.1885 0.3585 0.3021 -0.1044 0.0528  -0.1007 369 SER A C     
2910 O O     . SER A 372 ? 0.2188 0.3905 0.3408 -0.0903 0.0508  -0.0985 369 SER A O     
2911 C CB    . SER A 372 ? 0.3260 0.4416 0.3835 -0.1055 0.0430  -0.0781 369 SER A CB    
2912 O OG    . SER A 372 ? 0.4711 0.5752 0.5121 -0.1239 0.0560  -0.0817 369 SER A OG    
2913 N N     . ILE A 373 ? 0.1940 0.3756 0.3128 -0.1231 0.0658  -0.1118 370 ILE A N     
2914 C CA    . ILE A 373 ? 0.2266 0.4227 0.3599 -0.1278 0.0796  -0.1219 370 ILE A CA    
2915 C C     . ILE A 373 ? 0.3091 0.4862 0.4160 -0.1507 0.0962  -0.1237 370 ILE A C     
2916 O O     . ILE A 373 ? 0.3045 0.4630 0.3872 -0.1646 0.0967  -0.1200 370 ILE A O     
2917 C CB    . ILE A 373 ? 0.2509 0.4915 0.4289 -0.1259 0.0807  -0.1396 370 ILE A CB    
2918 C CG1   . ILE A 373 ? 0.2706 0.5269 0.4569 -0.1453 0.0856  -0.1499 370 ILE A CG1   
2919 C CG2   . ILE A 373 ? 0.2379 0.4925 0.4381 -0.1019 0.0623  -0.1382 370 ILE A CG2   
2920 C CD1   . ILE A 373 ? 0.3582 0.6616 0.5929 -0.1438 0.0858  -0.1692 370 ILE A CD1   
2921 N N     . ARG A 374 ? 0.3069 0.4853 0.4151 -0.1544 0.1092  -0.1292 371 ARG A N     
2922 C CA    . ARG A 374 ? 0.3505 0.5139 0.4359 -0.1774 0.1271  -0.1341 371 ARG A CA    
2923 C C     . ARG A 374 ? 0.3584 0.5589 0.4782 -0.1840 0.1418  -0.1527 371 ARG A C     
2924 O O     . ARG A 374 ? 0.3313 0.5538 0.4790 -0.1677 0.1394  -0.1576 371 ARG A O     
2925 C CB    . ARG A 374 ? 0.4466 0.5712 0.4959 -0.1759 0.1297  -0.1233 371 ARG A CB    
2926 C CG    . ARG A 374 ? 0.6399 0.7349 0.6518 -0.1995 0.1448  -0.1249 371 ARG A CG    
2927 C CD    . ARG A 374 ? 0.8382 0.8934 0.8148 -0.1944 0.1428  -0.1137 371 ARG A CD    
2928 N NE    . ARG A 374 ? 1.0208 1.0398 0.9545 -0.2157 0.1546  -0.1141 371 ARG A NE    
2929 C CZ    . ARG A 374 ? 1.1158 1.0963 1.0141 -0.2149 0.1541  -0.1066 371 ARG A CZ    
2930 N NH1   . ARG A 374 ? 1.1101 1.0865 1.0142 -0.1948 0.1431  -0.0985 371 ARG A NH1   
2931 N NH2   . ARG A 374 ? 1.1728 1.1171 1.0286 -0.2347 0.1640  -0.1075 371 ARG A NH2   
2932 N N     . VAL A 375 ? 0.3433 0.5511 0.4615 -0.2078 0.1569  -0.1637 372 VAL A N     
2933 C CA    . VAL A 375 ? 0.4065 0.6512 0.5582 -0.2169 0.1738  -0.1833 372 VAL A CA    
2934 C C     . VAL A 375 ? 0.4334 0.6538 0.5547 -0.2340 0.1948  -0.1857 372 VAL A C     
2935 O O     . VAL A 375 ? 0.4792 0.6564 0.5530 -0.2476 0.1981  -0.1756 372 VAL A O     
2936 C CB    . VAL A 375 ? 0.5624 0.8380 0.7393 -0.2336 0.1787  -0.1972 372 VAL A CB    
2937 C CG1   . VAL A 375 ? 0.5596 0.8624 0.7706 -0.2147 0.1572  -0.1975 372 VAL A CG1   
2938 C CG2   . VAL A 375 ? 0.6822 0.9228 0.8159 -0.2582 0.1849  -0.1909 372 VAL A CG2   
2939 N N     . GLN A 376 ? 0.3964 0.6421 0.5431 -0.2324 0.2080  -0.1993 373 GLN A N     
2940 C CA    . GLN A 376 ? 0.5733 0.7949 0.6903 -0.2468 0.2282  -0.2019 373 GLN A CA    
2941 C C     . GLN A 376 ? 0.7451 0.9496 0.8333 -0.2794 0.2469  -0.2073 373 GLN A C     
2942 O O     . GLN A 376 ? 0.7489 0.9869 0.8653 -0.2943 0.2569  -0.2223 373 GLN A O     
2943 C CB    . GLN A 376 ? 0.6197 0.8773 0.7741 -0.2396 0.2403  -0.2184 373 GLN A CB    
2944 C CG    . GLN A 376 ? 0.6958 0.9245 0.8176 -0.2482 0.2578  -0.2189 373 GLN A CG    
2945 C CD    . GLN A 376 ? 0.7482 1.0111 0.9068 -0.2366 0.2671  -0.2341 373 GLN A CD    
2946 O OE1   . GLN A 376 ? 0.7493 1.0618 0.9569 -0.2363 0.2731  -0.2524 373 GLN A OE1   
2947 N NE2   . GLN A 376 ? 0.7893 1.0258 0.9254 -0.2262 0.2673  -0.2274 373 GLN A NE2   
2948 N N     . GLY A 377 ? 0.9276 1.0784 0.9586 -0.2906 0.2507  -0.1956 374 GLY A N     
2949 C CA    . GLY A 377 ? 1.1153 1.2391 1.1084 -0.3220 0.2679  -0.1991 374 GLY A CA    
2950 C C     . GLY A 377 ? 1.1963 1.2795 1.1483 -0.3277 0.2538  -0.1840 374 GLY A C     
2951 O O     . GLY A 377 ? 1.2783 1.3195 1.1811 -0.3501 0.2635  -0.1814 374 GLY A O     
2952 N N     . ASP A 378 ? 1.1206 1.2143 1.0908 -0.3071 0.2308  -0.1744 375 ASP A N     
2953 C CA    . ASP A 378 ? 1.0590 1.1179 0.9949 -0.3091 0.2158  -0.1607 375 ASP A CA    
2954 C C     . ASP A 378 ? 1.1324 1.1398 1.0218 -0.2988 0.2051  -0.1442 375 ASP A C     
2955 O O     . ASP A 378 ? 1.1225 1.1343 1.0251 -0.2754 0.1936  -0.1372 375 ASP A O     
2956 C CB    . ASP A 378 ? 0.8821 0.9720 0.8549 -0.2908 0.1962  -0.1576 375 ASP A CB    
2957 C CG    . ASP A 378 ? 0.7747 0.8352 0.7168 -0.2963 0.1837  -0.1472 375 ASP A CG    
2958 O OD1   . ASP A 378 ? 0.7749 0.7870 0.6651 -0.3093 0.1862  -0.1399 375 ASP A OD1   
2959 O OD2   . ASP A 378 ? 0.6819 0.7659 0.6501 -0.2870 0.1704  -0.1467 375 ASP A OD2   
2960 N N     . LYS A 379 ? 1.2106 1.1683 1.0454 -0.3163 0.2082  -0.1386 376 LYS A N     
2961 C CA    . LYS A 379 ? 1.2618 1.1685 1.0509 -0.3075 0.1970  -0.1247 376 LYS A CA    
2962 C C     . LYS A 379 ? 1.1721 1.0729 0.9640 -0.2860 0.1725  -0.1113 376 LYS A C     
2963 O O     . LYS A 379 ? 1.1775 1.0505 0.9492 -0.2712 0.1599  -0.1005 376 LYS A O     
2964 C CB    . LYS A 379 ? 1.4043 1.2558 1.1309 -0.3320 0.2056  -0.1234 376 LYS A CB    
2965 C CG    . LYS A 379 ? 1.4828 1.2829 1.1632 -0.3252 0.1989  -0.1137 376 LYS A CG    
2966 C CD    . LYS A 379 ? 1.5527 1.2904 1.1665 -0.3431 0.1972  -0.1086 376 LYS A CD    
2967 C CE    . LYS A 379 ? 1.5459 1.2688 1.1499 -0.3329 0.1753  -0.0983 376 LYS A CE    
2968 N NZ    . LYS A 379 ? 1.5913 1.2482 1.1272 -0.3465 0.1700  -0.0929 376 LYS A NZ    
2969 N N     . ARG A 380 ? 1.0607 0.9881 0.8780 -0.2848 0.1659  -0.1127 377 ARG A N     
2970 C CA    . ARG A 380 ? 0.9978 0.9226 0.8196 -0.2652 0.1445  -0.1013 377 ARG A CA    
2971 C C     . ARG A 380 ? 0.9566 0.9081 0.8144 -0.2388 0.1350  -0.0974 377 ARG A C     
2972 O O     . ARG A 380 ? 0.9292 0.9192 0.8259 -0.2343 0.1422  -0.1061 377 ARG A O     
2973 C CB    . ARG A 380 ? 0.9200 0.8673 0.7602 -0.2711 0.1406  -0.1051 377 ARG A CB    
2974 C CG    . ARG A 380 ? 0.9013 0.8223 0.7061 -0.2984 0.1493  -0.1090 377 ARG A CG    
2975 C CD    . ARG A 380 ? 0.8707 0.8189 0.6995 -0.3035 0.1452  -0.1139 377 ARG A CD    
2976 N NE    . ARG A 380 ? 0.8100 0.8142 0.6939 -0.3033 0.1536  -0.1272 377 ARG A NE    
2977 C CZ    . ARG A 380 ? 0.7011 0.7399 0.6197 -0.3004 0.1467  -0.1325 377 ARG A CZ    
2978 N NH1   . ARG A 380 ? 0.6966 0.7192 0.5994 -0.2980 0.1323  -0.1249 377 ARG A NH1   
2979 N NH2   . ARG A 380 ? 0.5818 0.6709 0.5510 -0.2990 0.1532  -0.1460 377 ARG A NH2   
2980 N N     . LEU A 381 ? 0.9495 0.8799 0.7942 -0.2215 0.1189  -0.0849 378 LEU A N     
2981 C CA    . LEU A 381 ? 0.9252 0.8754 0.7990 -0.1977 0.1096  -0.0800 378 LEU A CA    
2982 C C     . LEU A 381 ? 0.8373 0.8315 0.7555 -0.1877 0.1051  -0.0840 378 LEU A C     
2983 O O     . LEU A 381 ? 0.8276 0.8473 0.7767 -0.1729 0.1032  -0.0855 378 LEU A O     
2984 C CB    . LEU A 381 ? 0.9934 0.9135 0.8451 -0.1835 0.0938  -0.0669 378 LEU A CB    
2985 C CG    . LEU A 381 ? 1.0404 0.9248 0.8616 -0.1825 0.0933  -0.0624 378 LEU A CG    
2986 C CD1   . LEU A 381 ? 1.0644 0.9253 0.8545 -0.2043 0.1078  -0.0691 378 LEU A CD1   
2987 C CD2   . LEU A 381 ? 1.0641 0.9162 0.8594 -0.1734 0.0777  -0.0521 378 LEU A CD2   
2988 N N     . SER A 382 ? 0.7636 0.7637 0.6825 -0.1957 0.1022  -0.0860 379 SER A N     
2989 C CA    . SER A 382 ? 0.6802 0.7193 0.6382 -0.1879 0.0968  -0.0911 379 SER A CA    
2990 C C     . SER A 382 ? 0.6338 0.6917 0.6020 -0.2083 0.1070  -0.1037 379 SER A C     
2991 O O     . SER A 382 ? 0.6686 0.7024 0.6067 -0.2261 0.1106  -0.1033 379 SER A O     
2992 C CB    . SER A 382 ? 0.6526 0.6832 0.6056 -0.1743 0.0800  -0.0808 379 SER A CB    
2993 O OG    . SER A 382 ? 0.6486 0.7107 0.6318 -0.1704 0.0743  -0.0863 379 SER A OG    
2994 N N     . SER A 383 ? 0.5623 0.6630 0.5733 -0.2059 0.1111  -0.1156 380 SER A N     
2995 C CA    . SER A 383 ? 0.5119 0.6375 0.5408 -0.2250 0.1212  -0.1299 380 SER A CA    
2996 C C     . SER A 383 ? 0.4112 0.5558 0.4596 -0.2201 0.1076  -0.1311 380 SER A C     
2997 O O     . SER A 383 ? 0.4470 0.5959 0.4938 -0.2383 0.1115  -0.1379 380 SER A O     
2998 C CB    . SER A 383 ? 0.5398 0.7042 0.6075 -0.2262 0.1342  -0.1453 380 SER A CB    
2999 O OG    . SER A 383 ? 0.5317 0.6774 0.5779 -0.2364 0.1502  -0.1468 380 SER A OG    
3000 N N     . LEU A 384 ? 0.3776 0.5315 0.4424 -0.1962 0.0915  -0.1245 381 LEU A N     
3001 C CA    . LEU A 384 ? 0.3298 0.5022 0.4143 -0.1890 0.0774  -0.1263 381 LEU A CA    
3002 C C     . LEU A 384 ? 0.3099 0.4734 0.3925 -0.1638 0.0604  -0.1139 381 LEU A C     
3003 O O     . LEU A 384 ? 0.3062 0.4717 0.3967 -0.1486 0.0593  -0.1104 381 LEU A O     
3004 C CB    . LEU A 384 ? 0.3663 0.5867 0.4994 -0.1899 0.0801  -0.1440 381 LEU A CB    
3005 C CG    . LEU A 384 ? 0.4375 0.6808 0.5973 -0.1767 0.0621  -0.1472 381 LEU A CG    
3006 C CD1   . LEU A 384 ? 0.4634 0.7466 0.6608 -0.1898 0.0665  -0.1665 381 LEU A CD1   
3007 C CD2   . LEU A 384 ? 0.4341 0.6869 0.6122 -0.1493 0.0495  -0.1433 381 LEU A CD2   
3008 N N     . ARG A 385 ? 0.3392 0.4913 0.4097 -0.1603 0.0477  -0.1075 382 ARG A N     
3009 C CA    . ARG A 385 ? 0.3310 0.4740 0.3980 -0.1383 0.0327  -0.0966 382 ARG A CA    
3010 C C     . ARG A 385 ? 0.3340 0.4954 0.4195 -0.1325 0.0192  -0.1013 382 ARG A C     
3011 O O     . ARG A 385 ? 0.3512 0.5141 0.4332 -0.1464 0.0185  -0.1063 382 ARG A O     
3012 C CB    . ARG A 385 ? 0.4556 0.5584 0.4817 -0.1376 0.0298  -0.0822 382 ARG A CB    
3013 C CG    . ARG A 385 ? 0.5843 0.6755 0.6049 -0.1161 0.0196  -0.0707 382 ARG A CG    
3014 C CD    . ARG A 385 ? 0.6823 0.7427 0.6706 -0.1144 0.0129  -0.0601 382 ARG A CD    
3015 N NE    . ARG A 385 ? 0.7468 0.8119 0.7365 -0.1135 0.0027  -0.0617 382 ARG A NE    
3016 C CZ    . ARG A 385 ? 0.7183 0.7664 0.6916 -0.1027 -0.0070 -0.0531 382 ARG A CZ    
3017 N NH1   . ARG A 385 ? 0.7055 0.7570 0.6790 -0.1026 -0.0163 -0.0554 382 ARG A NH1   
3018 N NH2   . ARG A 385 ? 0.6816 0.7096 0.6385 -0.0922 -0.0072 -0.0430 382 ARG A NH2   
3019 N N     . ARG A 386 ? 0.2522 0.4253 0.3556 -0.1123 0.0080  -0.1001 383 ARG A N     
3020 C CA    . ARG A 386 ? 0.2588 0.4454 0.3769 -0.1040 -0.0073 -0.1042 383 ARG A CA    
3021 C C     . ARG A 386 ? 0.2308 0.4004 0.3371 -0.0823 -0.0197 -0.0924 383 ARG A C     
3022 O O     . ARG A 386 ? 0.2444 0.4059 0.3468 -0.0725 -0.0163 -0.0860 383 ARG A O     
3023 C CB    . ARG A 386 ? 0.2699 0.4975 0.4320 -0.1030 -0.0086 -0.1213 383 ARG A CB    
3024 C CG    . ARG A 386 ? 0.2712 0.5209 0.4500 -0.1261 0.0039  -0.1356 383 ARG A CG    
3025 C CD    . ARG A 386 ? 0.2531 0.5006 0.4252 -0.1381 -0.0029 -0.1383 383 ARG A CD    
3026 N NE    . ARG A 386 ? 0.2961 0.5664 0.4863 -0.1617 0.0095  -0.1532 383 ARG A NE    
3027 C CZ    . ARG A 386 ? 0.3505 0.6039 0.5170 -0.1837 0.0258  -0.1519 383 ARG A CZ    
3028 N NH1   . ARG A 386 ? 0.4303 0.6443 0.5554 -0.1833 0.0297  -0.1366 383 ARG A NH1   
3029 N NH2   . ARG A 386 ? 0.3745 0.6494 0.5581 -0.2063 0.0379  -0.1665 383 ARG A NH2   
3030 N N     . CYS A 387 ? 0.3142 0.4768 0.4129 -0.0754 -0.0336 -0.0897 384 CYS A N     
3031 C CA    . CYS A 387 ? 0.2852 0.4283 0.3684 -0.0564 -0.0440 -0.0786 384 CYS A CA    
3032 C C     . CYS A 387 ? 0.3305 0.4857 0.4294 -0.0430 -0.0611 -0.0844 384 CYS A C     
3033 O O     . CYS A 387 ? 0.3308 0.5062 0.4487 -0.0491 -0.0674 -0.0959 384 CYS A O     
3034 C CB    . CYS A 387 ? 0.2838 0.3938 0.3296 -0.0584 -0.0441 -0.0660 384 CYS A CB    
3035 S SG    . CYS A 387 ? 0.6439 0.7486 0.6777 -0.0698 -0.0518 -0.0694 384 CYS A SG    
3036 N N     . CYS A 388 ? 0.3249 0.4661 0.4147 -0.0251 -0.0691 -0.0769 385 CYS A N     
3037 C CA    . CYS A 388 ? 0.3884 0.5303 0.4823 -0.0109 -0.0876 -0.0800 385 CYS A CA    
3038 C C     . CYS A 388 ? 0.3468 0.4551 0.4084 0.0027  -0.0927 -0.0658 385 CYS A C     
3039 O O     . CYS A 388 ? 0.3204 0.4109 0.3634 0.0015  -0.0815 -0.0551 385 CYS A O     
3040 C CB    . CYS A 388 ? 0.3819 0.5518 0.5110 -0.0014 -0.0940 -0.0926 385 CYS A CB    
3041 S SG    . CYS A 388 ? 0.3368 0.5016 0.4674 0.0100  -0.0865 -0.0872 385 CYS A SG    
3042 N N     . ALA A 389 ? 0.3541 0.4531 0.4085 0.0152  -0.1095 -0.0663 386 ALA A N     
3043 C CA    . ALA A 389 ? 0.3395 0.4048 0.3608 0.0273  -0.1139 -0.0536 386 ALA A CA    
3044 C C     . ALA A 389 ? 0.3105 0.3704 0.3330 0.0375  -0.1100 -0.0492 386 ALA A C     
3045 O O     . ALA A 389 ? 0.3376 0.4165 0.3852 0.0440  -0.1151 -0.0580 386 ALA A O     
3046 C CB    . ALA A 389 ? 0.3356 0.3895 0.3463 0.0380  -0.1340 -0.0562 386 ALA A CB    
3047 N N     . LEU A 390 ? 0.2887 0.3229 0.2844 0.0388  -0.1010 -0.0363 387 LEU A N     
3048 C CA    . LEU A 390 ? 0.3182 0.3409 0.3087 0.0482  -0.0982 -0.0305 387 LEU A CA    
3049 C C     . LEU A 390 ? 0.3334 0.3239 0.2918 0.0594  -0.1081 -0.0230 387 LEU A C     
3050 O O     . LEU A 390 ? 0.3700 0.3374 0.3010 0.0567  -0.1011 -0.0131 387 LEU A O     
3051 C CB    . LEU A 390 ? 0.2835 0.3005 0.2678 0.0402  -0.0802 -0.0222 387 LEU A CB    
3052 C CG    . LEU A 390 ? 0.3046 0.3214 0.2961 0.0453  -0.0745 -0.0199 387 LEU A CG    
3053 C CD1   . LEU A 390 ? 0.3048 0.3196 0.2937 0.0357  -0.0581 -0.0137 387 LEU A CD1   
3054 C CD2   . LEU A 390 ? 0.3864 0.3769 0.3558 0.0580  -0.0817 -0.0131 387 LEU A CD2   
3055 N N     . THR A 391 ? 0.3604 0.3482 0.3213 0.0720  -0.1245 -0.0284 388 THR A N     
3056 C CA    . THR A 391 ? 0.4632 0.4170 0.3897 0.0823  -0.1364 -0.0225 388 THR A CA    
3057 C C     . THR A 391 ? 0.4828 0.4131 0.3923 0.0927  -0.1375 -0.0163 388 THR A C     
3058 O O     . THR A 391 ? 0.5342 0.4292 0.4075 0.0987  -0.1419 -0.0085 388 THR A O     
3059 C CB    . THR A 391 ? 0.5087 0.4677 0.4418 0.0903  -0.1584 -0.0328 388 THR A CB    
3060 O OG1   . THR A 391 ? 0.5126 0.4949 0.4773 0.0986  -0.1683 -0.0443 388 THR A OG1   
3061 C CG2   . THR A 391 ? 0.4076 0.3863 0.3539 0.0788  -0.1580 -0.0386 388 THR A CG2   
3062 N N     . ARG A 392 ? 0.4303 0.3780 0.3637 0.0942  -0.1332 -0.0200 389 ARG A N     
3063 C CA    . ARG A 392 ? 0.4635 0.3891 0.3817 0.1032  -0.1341 -0.0147 389 ARG A CA    
3064 C C     . ARG A 392 ? 0.3797 0.3211 0.3175 0.0971  -0.1184 -0.0134 389 ARG A C     
3065 O O     . ARG A 392 ? 0.3812 0.3556 0.3528 0.0927  -0.1149 -0.0223 389 ARG A O     
3066 C CB    . ARG A 392 ? 0.5327 0.4549 0.4552 0.1193  -0.1562 -0.0236 389 ARG A CB    
3067 C CG    . ARG A 392 ? 0.7047 0.5964 0.5951 0.1284  -0.1740 -0.0222 389 ARG A CG    
3068 C CD    . ARG A 392 ? 0.9234 0.8092 0.8171 0.1461  -0.1981 -0.0317 389 ARG A CD    
3069 N NE    . ARG A 392 ? 1.1104 0.9830 0.9989 0.1535  -0.1970 -0.0292 389 ARG A NE    
3070 C CZ    . ARG A 392 ? 1.2288 1.1286 1.1521 0.1595  -0.2004 -0.0396 389 ARG A CZ    
3071 N NH1   . ARG A 392 ? 1.2583 1.2018 1.2254 0.1583  -0.2041 -0.0538 389 ARG A NH1   
3072 N NH2   . ARG A 392 ? 1.2700 1.1530 1.1837 0.1662  -0.1997 -0.0363 389 ARG A NH2   
3073 N N     . TYR A 393 ? 0.3683 0.2854 0.2838 0.0961  -0.1085 -0.0028 390 TYR A N     
3074 C CA    . TYR A 393 ? 0.3221 0.2493 0.2527 0.0916  -0.0958 -0.0012 390 TYR A CA    
3075 C C     . TYR A 393 ? 0.4233 0.3522 0.3647 0.1037  -0.1070 -0.0077 390 TYR A C     
3076 O O     . TYR A 393 ? 0.4543 0.3561 0.3743 0.1099  -0.1090 -0.0018 390 TYR A O     
3077 C CB    . TYR A 393 ? 0.3657 0.2672 0.2706 0.0859  -0.0821 0.0115  390 TYR A CB    
3078 C CG    . TYR A 393 ? 0.3584 0.2646 0.2608 0.0737  -0.0680 0.0164  390 TYR A CG    
3079 C CD1   . TYR A 393 ? 0.3141 0.2035 0.2000 0.0677  -0.0543 0.0257  390 TYR A CD1   
3080 C CD2   . TYR A 393 ? 0.3921 0.3192 0.3088 0.0682  -0.0688 0.0108  390 TYR A CD2   
3081 C CE1   . TYR A 393 ? 0.3058 0.1999 0.1908 0.0584  -0.0428 0.0287  390 TYR A CE1   
3082 C CE2   . TYR A 393 ? 0.3774 0.3057 0.2895 0.0584  -0.0575 0.0149  390 TYR A CE2   
3083 C CZ    . TYR A 393 ? 0.3101 0.2224 0.2070 0.0544  -0.0451 0.0235  390 TYR A CZ    
3084 O OH    . TYR A 393 ? 0.3293 0.2436 0.2232 0.0463  -0.0351 0.0261  390 TYR A OH    
3085 N N     . ASP A 394 ? 0.3556 0.3159 0.3297 0.1069  -0.1142 -0.0206 391 ASP A N     
3086 C CA    . ASP A 394 ? 0.3115 0.2783 0.3010 0.1197  -0.1255 -0.0295 391 ASP A CA    
3087 C C     . ASP A 394 ? 0.2691 0.2764 0.2992 0.1139  -0.1174 -0.0405 391 ASP A C     
3088 O O     . ASP A 394 ? 0.3219 0.3565 0.3742 0.1081  -0.1176 -0.0492 391 ASP A O     
3089 C CB    . ASP A 394 ? 0.4037 0.3644 0.3896 0.1340  -0.1485 -0.0375 391 ASP A CB    
3090 C CG    . ASP A 394 ? 0.5098 0.4777 0.5129 0.1495  -0.1624 -0.0485 391 ASP A CG    
3091 O OD1   . ASP A 394 ? 0.4603 0.4666 0.5031 0.1499  -0.1630 -0.0623 391 ASP A OD1   
3092 O OD2   . ASP A 394 ? 0.7326 0.6666 0.7084 0.1610  -0.1725 -0.0437 391 ASP A OD2   
3093 N N     . ALA A 395 ? 0.2585 0.2679 0.2962 0.1143  -0.1095 -0.0401 392 ALA A N     
3094 C CA    . ALA A 395 ? 0.2860 0.3292 0.3569 0.1072  -0.0988 -0.0494 392 ALA A CA    
3095 C C     . ALA A 395 ? 0.2367 0.3127 0.3417 0.1141  -0.1092 -0.0672 392 ALA A C     
3096 O O     . ALA A 395 ? 0.2930 0.3997 0.4237 0.1035  -0.1004 -0.0757 392 ALA A O     
3097 C CB    . ALA A 395 ? 0.2501 0.2847 0.3192 0.1087  -0.0909 -0.0459 392 ALA A CB    
3098 N N     . HIS A 396 ? 0.2935 0.3624 0.3987 0.1316  -0.1279 -0.0736 393 HIS A N     
3099 C CA    . HIS A 396 ? 0.3478 0.4497 0.4888 0.1399  -0.1396 -0.0924 393 HIS A CA    
3100 C C     . HIS A 396 ? 0.2977 0.4189 0.4508 0.1322  -0.1429 -0.0980 393 HIS A C     
3101 O O     . HIS A 396 ? 0.3049 0.4643 0.4942 0.1266  -0.1395 -0.1123 393 HIS A O     
3102 C CB    . HIS A 396 ? 0.3678 0.4537 0.5032 0.1623  -0.1623 -0.0982 393 HIS A CB    
3103 C CG    . HIS A 396 ? 0.5752 0.6541 0.7117 0.1711  -0.1605 -0.0993 393 HIS A CG    
3104 N ND1   . HIS A 396 ? 0.7021 0.7404 0.8018 0.1734  -0.1586 -0.0845 393 HIS A ND1   
3105 C CD2   . HIS A 396 ? 0.6468 0.7537 0.8164 0.1774  -0.1594 -0.1139 393 HIS A CD2   
3106 C CE1   . HIS A 396 ? 0.7368 0.7769 0.8456 0.1812  -0.1578 -0.0895 393 HIS A CE1   
3107 N NE2   . HIS A 396 ? 0.6990 0.7802 0.8498 0.1843  -0.1582 -0.1073 393 HIS A NE2   
3108 N N     . LYS A 397 ? 0.2851 0.3792 0.4072 0.1311  -0.1489 -0.0871 394 LYS A N     
3109 C CA    . LYS A 397 ? 0.2972 0.4046 0.4258 0.1232  -0.1524 -0.0909 394 LYS A CA    
3110 C C     . LYS A 397 ? 0.2871 0.4144 0.4265 0.1020  -0.1313 -0.0892 394 LYS A C     
3111 O O     . LYS A 397 ? 0.3019 0.4579 0.4660 0.0935  -0.1307 -0.1000 394 LYS A O     
3112 C CB    . LYS A 397 ? 0.3969 0.4664 0.4851 0.1271  -0.1628 -0.0790 394 LYS A CB    
3113 C CG    . LYS A 397 ? 0.4477 0.5265 0.5372 0.1172  -0.1645 -0.0808 394 LYS A CG    
3114 C CD    . LYS A 397 ? 0.5371 0.5770 0.5855 0.1229  -0.1761 -0.0704 394 LYS A CD    
3115 C CE    . LYS A 397 ? 0.5415 0.5877 0.5877 0.1116  -0.1755 -0.0706 394 LYS A CE    
3116 N NZ    . LYS A 397 ? 0.5408 0.6253 0.6267 0.1107  -0.1855 -0.0883 394 LYS A NZ    
3117 N N     . MET A 398 ? 0.2497 0.3602 0.3697 0.0931  -0.1149 -0.0762 395 MET A N     
3118 C CA    . MET A 398 ? 0.2242 0.3471 0.3488 0.0741  -0.0965 -0.0739 395 MET A CA    
3119 C C     . MET A 398 ? 0.2556 0.4145 0.4164 0.0672  -0.0872 -0.0879 395 MET A C     
3120 O O     . MET A 398 ? 0.2102 0.3894 0.3848 0.0531  -0.0794 -0.0940 395 MET A O     
3121 C CB    . MET A 398 ? 0.2359 0.3325 0.3331 0.0680  -0.0830 -0.0581 395 MET A CB    
3122 C CG    . MET A 398 ? 0.2337 0.2992 0.2964 0.0686  -0.0863 -0.0451 395 MET A CG    
3123 S SD    . MET A 398 ? 0.3361 0.3785 0.3739 0.0591  -0.0690 -0.0295 395 MET A SD    
3124 C CE    . MET A 398 ? 0.3787 0.4046 0.4101 0.0705  -0.0704 -0.0252 395 MET A CE    
3125 N N     . SER A 399 ? 0.2450 0.4102 0.4191 0.0767  -0.0875 -0.0932 396 SER A N     
3126 C CA    . SER A 399 ? 0.2360 0.4348 0.4439 0.0711  -0.0776 -0.1075 396 SER A CA    
3127 C C     . SER A 399 ? 0.2028 0.4365 0.4451 0.0721  -0.0863 -0.1257 396 SER A C     
3128 O O     . SER A 399 ? 0.2175 0.4801 0.4839 0.0582  -0.0742 -0.1365 396 SER A O     
3129 C CB    . SER A 399 ? 0.2361 0.4322 0.4496 0.0830  -0.0774 -0.1098 396 SER A CB    
3130 O OG    . SER A 399 ? 0.2803 0.4731 0.4988 0.1033  -0.0972 -0.1158 396 SER A OG    
3131 N N     . HIS A 400 ? 0.2041 0.4339 0.4478 0.0878  -0.1075 -0.1297 397 HIS A N     
3132 C CA    . HIS A 400 ? 0.2482 0.5113 0.5264 0.0904  -0.1189 -0.1479 397 HIS A CA    
3133 C C     . HIS A 400 ? 0.2560 0.5257 0.5317 0.0725  -0.1139 -0.1467 397 HIS A C     
3134 O O     . HIS A 400 ? 0.2392 0.5436 0.5466 0.0613  -0.1084 -0.1613 397 HIS A O     
3135 C CB    . HIS A 400 ? 0.3402 0.5910 0.6149 0.1129  -0.1456 -0.1514 397 HIS A CB    
3136 C CG    . HIS A 400 ? 0.5005 0.7873 0.8150 0.1187  -0.1603 -0.1723 397 HIS A CG    
3137 N ND1   . HIS A 400 ? 0.5907 0.8842 0.9079 0.1119  -0.1686 -0.1754 397 HIS A ND1   
3138 C CD2   . HIS A 400 ? 0.5589 0.8781 0.9138 0.1308  -0.1688 -0.1923 397 HIS A CD2   
3139 C CE1   . HIS A 400 ? 0.5652 0.8946 0.9241 0.1190  -0.1818 -0.1964 397 HIS A CE1   
3140 N NE2   . HIS A 400 ? 0.5676 0.9142 0.9511 0.1309  -0.1821 -0.2075 397 HIS A NE2   
3141 N N     . ASP A 401 ? 0.2508 0.4867 0.4882 0.0693  -0.1151 -0.1299 398 ASP A N     
3142 C CA    . ASP A 401 ? 0.2389 0.4753 0.4682 0.0531  -0.1106 -0.1271 398 ASP A CA    
3143 C C     . ASP A 401 ? 0.2286 0.4798 0.4655 0.0315  -0.0877 -0.1284 398 ASP A C     
3144 O O     . ASP A 401 ? 0.2535 0.5234 0.5036 0.0168  -0.0836 -0.1363 398 ASP A O     
3145 C CB    . ASP A 401 ? 0.2787 0.4741 0.4637 0.0548  -0.1145 -0.1087 398 ASP A CB    
3146 C CG    . ASP A 401 ? 0.3437 0.5219 0.5163 0.0722  -0.1377 -0.1083 398 ASP A CG    
3147 O OD1   . ASP A 401 ? 0.3140 0.5140 0.5143 0.0820  -0.1529 -0.1233 398 ASP A OD1   
3148 O OD2   . ASP A 401 ? 0.3938 0.5359 0.5284 0.0760  -0.1407 -0.0937 398 ASP A OD2   
3149 N N     . ALA A 402 ? 0.2343 0.4745 0.4603 0.0290  -0.0735 -0.1207 399 ALA A N     
3150 C CA    . ALA A 402 ? 0.2210 0.4694 0.4488 0.0093  -0.0527 -0.1215 399 ALA A CA    
3151 C C     . ALA A 402 ? 0.2169 0.5060 0.4850 0.0017  -0.0463 -0.1414 399 ALA A C     
3152 O O     . ALA A 402 ? 0.2337 0.5357 0.5077 -0.0176 -0.0344 -0.1469 399 ALA A O     
3153 C CB    . ALA A 402 ? 0.2033 0.4314 0.4128 0.0103  -0.0412 -0.1106 399 ALA A CB    
3154 N N     . PHE A 403 ? 0.1749 0.4835 0.4702 0.0168  -0.0538 -0.1528 400 PHE A N     
3155 C CA    . PHE A 403 ? 0.1551 0.5062 0.4933 0.0114  -0.0476 -0.1740 400 PHE A CA    
3156 C C     . PHE A 403 ? 0.2293 0.6037 0.5878 0.0026  -0.0545 -0.1854 400 PHE A C     
3157 O O     . PHE A 403 ? 0.2470 0.6461 0.6244 -0.0166 -0.0402 -0.1965 400 PHE A O     
3158 C CB    . PHE A 403 ? 0.1969 0.5641 0.5613 0.0328  -0.0584 -0.1853 400 PHE A CB    
3159 C CG    . PHE A 403 ? 0.2564 0.6698 0.6678 0.0283  -0.0506 -0.2087 400 PHE A CG    
3160 C CD1   . PHE A 403 ? 0.2586 0.7051 0.7074 0.0344  -0.0649 -0.2268 400 PHE A CD1   
3161 C CD2   . PHE A 403 ? 0.2639 0.6880 0.6828 0.0176  -0.0288 -0.2136 400 PHE A CD2   
3162 C CE1   . PHE A 403 ? 0.2870 0.7797 0.7830 0.0297  -0.0566 -0.2501 400 PHE A CE1   
3163 C CE2   . PHE A 403 ? 0.3195 0.7873 0.7821 0.0125  -0.0194 -0.2363 400 PHE A CE2   
3164 C CZ    . PHE A 403 ? 0.3027 0.8065 0.8056 0.0184  -0.0327 -0.2549 400 PHE A CZ    
3165 N N     . THR A 404 ? 0.2283 0.5927 0.5808 0.0159  -0.0762 -0.1827 401 THR A N     
3166 C CA    . THR A 404 ? 0.2459 0.6305 0.6171 0.0098  -0.0865 -0.1936 401 THR A CA    
3167 C C     . THR A 404 ? 0.2141 0.5941 0.5701 -0.0162 -0.0710 -0.1890 401 THR A C     
3168 O O     . THR A 404 ? 0.3046 0.7135 0.6867 -0.0308 -0.0674 -0.2032 401 THR A O     
3169 C CB    . THR A 404 ? 0.2676 0.6293 0.6206 0.0274  -0.1121 -0.1868 401 THR A CB    
3170 O OG1   . THR A 404 ? 0.2656 0.6306 0.6326 0.0517  -0.1287 -0.1932 401 THR A OG1   
3171 C CG2   . THR A 404 ? 0.2441 0.6246 0.6146 0.0201  -0.1234 -0.1977 401 THR A CG2   
3172 N N     . VAL A 405 ? 0.1777 0.5208 0.4916 -0.0219 -0.0621 -0.1697 402 VAL A N     
3173 C CA    . VAL A 405 ? 0.2795 0.6098 0.5712 -0.0442 -0.0496 -0.1632 402 VAL A CA    
3174 C C     . VAL A 405 ? 0.2781 0.6265 0.5825 -0.0655 -0.0265 -0.1719 402 VAL A C     
3175 O O     . VAL A 405 ? 0.3081 0.6576 0.6065 -0.0864 -0.0174 -0.1743 402 VAL A O     
3176 C CB    . VAL A 405 ? 0.4600 0.7453 0.7039 -0.0417 -0.0485 -0.1411 402 VAL A CB    
3177 C CG1   . VAL A 405 ? 0.5032 0.7733 0.7231 -0.0628 -0.0377 -0.1353 402 VAL A CG1   
3178 C CG2   . VAL A 405 ? 0.4973 0.7626 0.7252 -0.0233 -0.0692 -0.1329 402 VAL A CG2   
3179 N N     . ILE A 406 ? 0.2469 0.6070 0.5662 -0.0606 -0.0168 -0.1769 403 ILE A N     
3180 C CA    . ILE A 406 ? 0.2872 0.6606 0.6141 -0.0805 0.0064  -0.1849 403 ILE A CA    
3181 C C     . ILE A 406 ? 0.3140 0.7347 0.6909 -0.0820 0.0121  -0.2083 403 ILE A C     
3182 O O     . ILE A 406 ? 0.3324 0.7669 0.7177 -0.1004 0.0329  -0.2174 403 ILE A O     
3183 C CB    . ILE A 406 ? 0.3456 0.6922 0.6454 -0.0788 0.0185  -0.1724 403 ILE A CB    
3184 C CG1   . ILE A 406 ? 0.2925 0.6492 0.6113 -0.0570 0.0124  -0.1761 403 ILE A CG1   
3185 C CG2   . ILE A 406 ? 0.3396 0.6428 0.5943 -0.0771 0.0138  -0.1511 403 ILE A CG2   
3186 C CD1   . ILE A 406 ? 0.3526 0.6901 0.6524 -0.0574 0.0260  -0.1681 403 ILE A CD1   
3187 N N     . LYS A 407 ? 0.2671 0.7115 0.6760 -0.0627 -0.0062 -0.2189 404 LYS A N     
3188 C CA    . LYS A 407 ? 0.3058 0.7963 0.7652 -0.0595 -0.0027 -0.2422 404 LYS A CA    
3189 C C     . LYS A 407 ? 0.3782 0.9021 0.8646 -0.0850 0.0118  -0.2596 404 LYS A C     
3190 O O     . LYS A 407 ? 0.3396 0.8991 0.8615 -0.0917 0.0261  -0.2782 404 LYS A O     
3191 C CB    . LYS A 407 ? 0.3284 0.8352 0.8154 -0.0327 -0.0289 -0.2509 404 LYS A CB    
3192 C CG    . LYS A 407 ? 0.3271 0.8439 0.8256 -0.0328 -0.0474 -0.2562 404 LYS A CG    
3193 C CD    . LYS A 407 ? 0.3707 0.8957 0.8894 -0.0040 -0.0755 -0.2633 404 LYS A CD    
3194 C CE    . LYS A 407 ? 0.4656 0.9988 0.9946 -0.0035 -0.0958 -0.2692 404 LYS A CE    
3195 N NZ    . LYS A 407 ? 0.5287 1.0197 1.0084 -0.0121 -0.0979 -0.2478 404 LYS A NZ    
3196 N N     . ASN A 408 ? 0.4600 0.9712 0.9284 -0.0998 0.0090  -0.2536 405 ASN A N     
3197 C CA    . ASN A 408 ? 0.5321 1.0702 1.0212 -0.1263 0.0220  -0.2687 405 ASN A CA    
3198 C C     . ASN A 408 ? 0.4682 0.9965 0.9375 -0.1524 0.0517  -0.2674 405 ASN A C     
3199 O O     . ASN A 408 ? 0.4834 1.0335 0.9687 -0.1771 0.0674  -0.2811 405 ASN A O     
3200 C CB    . ASN A 408 ? 0.6496 1.1720 1.1205 -0.1340 0.0088  -0.2616 405 ASN A CB    
3201 C CG    . ASN A 408 ? 0.7247 1.2530 1.2109 -0.1094 -0.0211 -0.2631 405 ASN A CG    
3202 O OD1   . ASN A 408 ? 0.7443 1.2389 1.1964 -0.1024 -0.0360 -0.2470 405 ASN A OD1   
3203 N ND2   . ASN A 408 ? 0.7335 1.3033 1.2699 -0.0956 -0.0305 -0.2830 405 ASN A ND2   
3204 N N     . CYS A 409 ? 0.4011 0.8948 0.8342 -0.1473 0.0592  -0.2512 406 CYS A N     
3205 C CA    . CYS A 409 ? 0.3596 0.8360 0.7665 -0.1698 0.0850  -0.2483 406 CYS A CA    
3206 C C     . CYS A 409 ? 0.3618 0.8727 0.8033 -0.1737 0.1034  -0.2672 406 CYS A C     
3207 O O     . CYS A 409 ? 0.3867 0.8919 0.8144 -0.1961 0.1273  -0.2706 406 CYS A O     
3208 C CB    . CYS A 409 ? 0.3699 0.7962 0.7260 -0.1620 0.0844  -0.2247 406 CYS A CB    
3209 S SG    . CYS A 409 ? 0.5628 0.9446 0.8722 -0.1624 0.0691  -0.2029 406 CYS A SG    
3210 N N     . ASN A 410 ? 0.3214 0.8660 0.8057 -0.1515 0.0917  -0.2797 407 ASN A N     
3211 C CA    . ASN A 410 ? 0.2407 0.8214 0.7623 -0.1512 0.1071  -0.2994 407 ASN A CA    
3212 C C     . ASN A 410 ? 0.3161 0.9430 0.8799 -0.1736 0.1215  -0.3242 407 ASN A C     
3213 O O     . ASN A 410 ? 0.3666 1.0243 0.9661 -0.1696 0.1066  -0.3361 407 ASN A O     
3214 C CB    . ASN A 410 ? 0.2291 0.8282 0.7813 -0.1181 0.0872  -0.3051 407 ASN A CB    
3215 C CG    . ASN A 410 ? 0.2722 0.9037 0.8588 -0.1141 0.1021  -0.3240 407 ASN A CG    
3216 O OD1   . ASN A 410 ? 0.3490 0.9858 0.9325 -0.1361 0.1290  -0.3313 407 ASN A OD1   
3217 N ND2   . ASN A 410 ? 0.3200 0.9710 0.9373 -0.0857 0.0846  -0.3325 407 ASN A ND2   
3218 N N     . THR A 411 ? 0.3238 0.9543 0.8823 -0.1977 0.1508  -0.3321 408 THR A N     
3219 C CA    . THR A 411 ? 0.3955 1.0682 0.9910 -0.2233 0.1695  -0.3560 408 THR A CA    
3220 C C     . THR A 411 ? 0.3862 1.1153 1.0444 -0.2113 0.1741  -0.3826 408 THR A C     
3221 O O     . THR A 411 ? 0.4252 1.2027 1.1316 -0.2245 0.1824  -0.4067 408 THR A O     
3222 C CB    . THR A 411 ? 0.4989 1.1463 1.0557 -0.2575 0.2009  -0.3531 408 THR A CB    
3223 O OG1   . THR A 411 ? 0.6100 1.2059 1.1100 -0.2684 0.1952  -0.3302 408 THR A OG1   
3224 C CG2   . THR A 411 ? 0.5981 1.2898 1.1936 -0.2860 0.2224  -0.3788 408 THR A CG2   
3225 N N     . SER A 412 ? 0.3985 1.1213 1.0566 -0.1858 0.1682  -0.3789 409 SER A N     
3226 C CA    . SER A 412 ? 0.4371 1.2081 1.1499 -0.1712 0.1719  -0.4032 409 SER A CA    
3227 C C     . SER A 412 ? 0.5604 1.3875 1.3382 -0.1624 0.1558  -0.4269 409 SER A C     
3228 O O     . SER A 412 ? 0.6115 1.4333 1.3910 -0.1479 0.1278  -0.4197 409 SER A O     
3229 C CB    . SER A 412 ? 0.4171 1.1671 1.1174 -0.1387 0.1571  -0.3922 409 SER A CB    
3230 O OG    . SER A 412 ? 0.4119 1.2075 1.1654 -0.1215 0.1573  -0.4163 409 SER A OG    
3231 N N     . GLY A 413 ? 0.6050 1.4859 1.4363 -0.1712 0.1737  -0.4561 410 GLY A N     
3232 C CA    . GLY A 413 ? 0.6463 1.5866 1.5472 -0.1603 0.1584  -0.4826 410 GLY A CA    
3233 C C     . GLY A 413 ? 0.6855 1.6360 1.6111 -0.1190 0.1312  -0.4868 410 GLY A C     
3234 O O     . GLY A 413 ? 0.6781 1.6452 1.6316 -0.0985 0.1010  -0.4924 410 GLY A O     
3235 N N     . ILE A 414 ? 0.7260 1.6632 1.6382 -0.1069 0.1413  -0.4839 411 ILE A N     
3236 C CA    . ILE A 414 ? 0.7729 1.7101 1.6984 -0.0681 0.1167  -0.4851 411 ILE A CA    
3237 C C     . ILE A 414 ? 0.8522 1.7353 1.7282 -0.0497 0.0877  -0.4553 411 ILE A C     
3238 O O     . ILE A 414 ? 0.8579 1.6911 1.6756 -0.0628 0.0952  -0.4292 411 ILE A O     
3239 C CB    . ILE A 414 ? 0.7571 1.6847 1.6706 -0.0624 0.1361  -0.4861 411 ILE A CB    
3240 C CG1   . ILE A 414 ? 0.7698 1.7379 1.7144 -0.0895 0.1733  -0.5103 411 ILE A CG1   
3241 C CG2   . ILE A 414 ? 0.7333 1.6722 1.6730 -0.0229 0.1118  -0.4948 411 ILE A CG2   
3242 C CD1   . ILE A 414 ? 0.7739 1.7246 1.6957 -0.0900 0.1968  -0.5086 411 ILE A CD1   
3243 N N     . GLN A 415 ? 0.9102 1.8024 1.8091 -0.0193 0.0545  -0.4599 412 GLN A N     
3244 C CA    . GLN A 415 ? 0.9468 1.7904 1.8015 -0.0027 0.0265  -0.4340 412 GLN A CA    
3245 C C     . GLN A 415 ? 0.8590 1.6520 1.6639 0.0125  0.0249  -0.4110 412 GLN A C     
3246 O O     . GLN A 415 ? 0.9009 1.6465 1.6587 0.0192  0.0100  -0.3858 412 GLN A O     
3247 C CB    . GLN A 415 ? 1.0560 1.9212 1.9469 0.0245  -0.0092 -0.4467 412 GLN A CB    
3248 C CG    . GLN A 415 ? 1.1398 1.9603 1.9884 0.0340  -0.0360 -0.4231 412 GLN A CG    
3249 C CD    . GLN A 415 ? 1.2119 2.0569 2.0974 0.0534  -0.0688 -0.4383 412 GLN A CD    
3250 O OE1   . GLN A 415 ? 1.2410 2.1357 2.1851 0.0650  -0.0754 -0.4667 412 GLN A OE1   
3251 N NE2   . GLN A 415 ? 1.2307 2.0406 2.0818 0.0573  -0.0901 -0.4203 412 GLN A NE2   
3252 N N     . THR A 416 ? 0.6990 1.5023 1.5144 0.0170  0.0410  -0.4205 413 THR A N     
3253 C CA    . THR A 416 ? 0.5495 1.3086 1.3227 0.0322  0.0392  -0.4016 413 THR A CA    
3254 C C     . THR A 416 ? 0.4280 1.1489 1.1502 0.0076  0.0653  -0.3814 413 THR A C     
3255 O O     . THR A 416 ? 0.4102 1.0824 1.0841 0.0145  0.0593  -0.3572 413 THR A O     
3256 C CB    . THR A 416 ? 0.5000 1.2847 1.3068 0.0527  0.0408  -0.4215 413 THR A CB    
3257 O OG1   . THR A 416 ? 0.4816 1.2915 1.3278 0.0812  0.0107  -0.4374 413 THR A OG1   
3258 C CG2   . THR A 416 ? 0.4971 1.2345 1.2579 0.0644  0.0420  -0.4019 413 THR A CG2   
3259 N N     . GLU A 417 ? 0.3890 1.1313 1.1216 -0.0215 0.0938  -0.3920 414 GLU A N     
3260 C CA    . GLU A 417 ? 0.3716 1.0786 1.0570 -0.0452 0.1194  -0.3762 414 GLU A CA    
3261 C C     . GLU A 417 ? 0.3890 1.0619 1.0326 -0.0648 0.1186  -0.3551 414 GLU A C     
3262 O O     . GLU A 417 ? 0.3921 1.0784 1.0505 -0.0673 0.1051  -0.3574 414 GLU A O     
3263 C CB    . GLU A 417 ? 0.4341 1.1746 1.1442 -0.0682 0.1522  -0.3977 414 GLU A CB    
3264 C CG    . GLU A 417 ? 0.4487 1.2313 1.2080 -0.0503 0.1549  -0.4233 414 GLU A CG    
3265 C CD    . GLU A 417 ? 0.4717 1.2229 1.2059 -0.0265 0.1476  -0.4122 414 GLU A CD    
3266 O OE1   . GLU A 417 ? 0.4958 1.2144 1.1900 -0.0386 0.1670  -0.4006 414 GLU A OE1   
3267 O OE2   . GLU A 417 ? 0.5000 1.2568 1.2526 0.0041  0.1216  -0.4152 414 GLU A OE2   
3268 N N     . TRP A 418 ? 0.2920 0.9200 0.8832 -0.0779 0.1322  -0.3352 415 TRP A N     
3269 C CA    . TRP A 418 ? 0.3005 0.8935 0.8492 -0.0966 0.1330  -0.3157 415 TRP A CA    
3270 C C     . TRP A 418 ? 0.3248 0.9062 0.8491 -0.1289 0.1632  -0.3163 415 TRP A C     
3271 O O     . TRP A 418 ? 0.3541 0.9162 0.8558 -0.1325 0.1790  -0.3129 415 TRP A O     
3272 C CB    . TRP A 418 ? 0.2190 0.7606 0.7204 -0.0817 0.1169  -0.2882 415 TRP A CB    
3273 C CG    . TRP A 418 ? 0.2429 0.7551 0.7101 -0.0937 0.1102  -0.2706 415 TRP A CG    
3274 C CD1   . TRP A 418 ? 0.2927 0.7783 0.7231 -0.1190 0.1263  -0.2610 415 TRP A CD1   
3275 C CD2   . TRP A 418 ? 0.2497 0.7545 0.7147 -0.0805 0.0854  -0.2614 415 TRP A CD2   
3276 N NE1   . TRP A 418 ? 0.3339 0.7976 0.7413 -0.1216 0.1129  -0.2467 415 TRP A NE1   
3277 C CE2   . TRP A 418 ? 0.3104 0.7858 0.7384 -0.0987 0.0884  -0.2466 415 TRP A CE2   
3278 C CE3   . TRP A 418 ? 0.2681 0.7855 0.7560 -0.0549 0.0603  -0.2644 415 TRP A CE3   
3279 C CZ2   . TRP A 418 ? 0.3261 0.7862 0.7409 -0.0921 0.0686  -0.2350 415 TRP A CZ2   
3280 C CZ3   . TRP A 418 ? 0.2652 0.7651 0.7374 -0.0491 0.0406  -0.2524 415 TRP A CZ3   
3281 C CH2   . TRP A 418 ? 0.2934 0.7662 0.7303 -0.0678 0.0456  -0.2380 415 TRP A CH2   
3282 N N     . SER A 419 ? 0.3070 0.8971 0.8327 -0.1526 0.1705  -0.3204 416 SER A N     
3283 C CA    . SER A 419 ? 0.4068 0.9790 0.9020 -0.1851 0.1977  -0.3195 416 SER A CA    
3284 C C     . SER A 419 ? 0.4575 1.0050 0.9223 -0.2033 0.1933  -0.3068 416 SER A C     
3285 O O     . SER A 419 ? 0.4472 1.0130 0.9342 -0.1983 0.1761  -0.3095 416 SER A O     
3286 C CB    . SER A 419 ? 0.4831 1.1021 1.0200 -0.2028 0.2224  -0.3475 416 SER A CB    
3287 O OG    . SER A 419 ? 0.4457 1.1127 1.0343 -0.2031 0.2136  -0.3654 416 SER A OG    
3288 N N     . PRO A 420 ? 0.5310 1.0334 0.9421 -0.2233 0.2072  -0.2926 417 PRO A N     
3289 C CA    . PRO A 420 ? 0.5837 1.0575 0.9631 -0.2254 0.2230  -0.2869 417 PRO A CA    
3290 C C     . PRO A 420 ? 0.4362 0.8797 0.7940 -0.1977 0.2030  -0.2674 417 PRO A C     
3291 O O     . PRO A 420 ? 0.4180 0.8490 0.7685 -0.1846 0.1810  -0.2540 417 PRO A O     
3292 C CB    . PRO A 420 ? 0.6798 1.1113 1.0060 -0.2549 0.2383  -0.2769 417 PRO A CB    
3293 C CG    . PRO A 420 ? 0.6591 1.0798 0.9752 -0.2565 0.2204  -0.2662 417 PRO A CG    
3294 C CD    . PRO A 420 ? 0.5986 1.0726 0.9743 -0.2449 0.2078  -0.2820 417 PRO A CD    
3295 N N     . PRO A 421 ? 0.3910 0.8226 0.7386 -0.1896 0.2111  -0.2664 418 PRO A N     
3296 C CA    . PRO A 421 ? 0.3228 0.7272 0.6521 -0.1643 0.1937  -0.2495 418 PRO A CA    
3297 C C     . PRO A 421 ? 0.3000 0.6582 0.5832 -0.1649 0.1806  -0.2255 418 PRO A C     
3298 O O     . PRO A 421 ? 0.3145 0.6480 0.5650 -0.1868 0.1898  -0.2199 418 PRO A O     
3299 C CB    . PRO A 421 ? 0.3438 0.7330 0.6557 -0.1674 0.2115  -0.2519 418 PRO A CB    
3300 C CG    . PRO A 421 ? 0.4075 0.8372 0.7536 -0.1825 0.2337  -0.2768 418 PRO A CG    
3301 C CD    . PRO A 421 ? 0.3977 0.8412 0.7506 -0.2044 0.2382  -0.2823 418 PRO A CD    
3302 N N     . LEU A 422 ? 0.2519 0.5978 0.5322 -0.1409 0.1593  -0.2123 419 LEU A N     
3303 C CA    . LEU A 422 ? 0.2738 0.5793 0.5150 -0.1383 0.1462  -0.1906 419 LEU A CA    
3304 C C     . LEU A 422 ? 0.2968 0.5619 0.4995 -0.1360 0.1496  -0.1770 419 LEU A C     
3305 O O     . LEU A 422 ? 0.3292 0.5960 0.5397 -0.1216 0.1487  -0.1782 419 LEU A O     
3306 C CB    . LEU A 422 ? 0.2889 0.6015 0.5459 -0.1152 0.1220  -0.1837 419 LEU A CB    
3307 C CG    . LEU A 422 ? 0.2474 0.5959 0.5404 -0.1137 0.1130  -0.1954 419 LEU A CG    
3308 C CD1   . LEU A 422 ? 0.2165 0.5597 0.5125 -0.0908 0.0884  -0.1853 419 LEU A CD1   
3309 C CD2   . LEU A 422 ? 0.3245 0.6699 0.6051 -0.1383 0.1210  -0.1967 419 LEU A CD2   
3310 N N     . THR A 423 ? 0.2823 0.5097 0.4430 -0.1495 0.1519  -0.1645 420 THR A N     
3311 C CA    . THR A 423 ? 0.3129 0.5003 0.4362 -0.1479 0.1532  -0.1521 420 THR A CA    
3312 C C     . THR A 423 ? 0.2866 0.4495 0.3931 -0.1320 0.1336  -0.1337 420 THR A C     
3313 O O     . THR A 423 ? 0.2945 0.4270 0.3751 -0.1274 0.1313  -0.1232 420 THR A O     
3314 C CB    . THR A 423 ? 0.3391 0.4958 0.4228 -0.1726 0.1689  -0.1514 420 THR A CB    
3315 O OG1   . THR A 423 ? 0.4235 0.5709 0.4927 -0.1851 0.1652  -0.1471 420 THR A OG1   
3316 C CG2   . THR A 423 ? 0.3601 0.5380 0.4573 -0.1885 0.1916  -0.1697 420 THR A CG2   
3317 N N     . MET A 424 ? 0.2604 0.4366 0.3820 -0.1239 0.1199  -0.1307 421 MET A N     
3318 C CA    . MET A 424 ? 0.2343 0.3901 0.3423 -0.1092 0.1029  -0.1148 421 MET A CA    
3319 C C     . MET A 424 ? 0.1986 0.3764 0.3312 -0.0969 0.0885  -0.1153 421 MET A C     
3320 O O     . MET A 424 ? 0.1966 0.3972 0.3469 -0.1047 0.0899  -0.1250 421 MET A O     
3321 C CB    . MET A 424 ? 0.2914 0.4107 0.3596 -0.1208 0.1025  -0.1033 421 MET A CB    
3322 C CG    . MET A 424 ? 0.2883 0.3860 0.3418 -0.1071 0.0873  -0.0878 421 MET A CG    
3323 S SD    . MET A 424 ? 0.3724 0.4804 0.4344 -0.1024 0.0741  -0.0843 421 MET A SD    
3324 C CE    . MET A 424 ? 0.3419 0.4397 0.3829 -0.1269 0.0829  -0.0886 421 MET A CE    
3325 N N     . LEU A 425 ? 0.1937 0.3632 0.3261 -0.0782 0.0749  -0.1054 422 LEU A N     
3326 C CA    . LEU A 425 ? 0.1785 0.3572 0.3228 -0.0658 0.0596  -0.1023 422 LEU A CA    
3327 C C     . LEU A 425 ? 0.1640 0.3119 0.2811 -0.0593 0.0506  -0.0853 422 LEU A C     
3328 O O     . LEU A 425 ? 0.1798 0.3077 0.2820 -0.0551 0.0518  -0.0773 422 LEU A O     
3329 C CB    . LEU A 425 ? 0.1552 0.3551 0.3279 -0.0473 0.0513  -0.1088 422 LEU A CB    
3330 C CG    . LEU A 425 ? 0.2555 0.4923 0.4636 -0.0485 0.0568  -0.1279 422 LEU A CG    
3331 C CD1   . LEU A 425 ? 0.2350 0.4838 0.4642 -0.0272 0.0471  -0.1324 422 LEU A CD1   
3332 C CD2   . LEU A 425 ? 0.2316 0.4912 0.4572 -0.0558 0.0532  -0.1367 422 LEU A CD2   
3333 N N     . PHE A 426 ? 0.1974 0.3426 0.3094 -0.0585 0.0417  -0.0808 423 PHE A N     
3334 C CA    . PHE A 426 ? 0.1773 0.2956 0.2645 -0.0539 0.0347  -0.0664 423 PHE A CA    
3335 C C     . PHE A 426 ? 0.1962 0.3202 0.2897 -0.0434 0.0217  -0.0641 423 PHE A C     
3336 O O     . PHE A 426 ? 0.1914 0.3293 0.2935 -0.0489 0.0190  -0.0707 423 PHE A O     
3337 C CB    . PHE A 426 ? 0.2383 0.3378 0.3004 -0.0700 0.0405  -0.0631 423 PHE A CB    
3338 C CG    . PHE A 426 ? 0.3341 0.4067 0.3717 -0.0657 0.0343  -0.0501 423 PHE A CG    
3339 C CD1   . PHE A 426 ? 0.5037 0.5585 0.5184 -0.0768 0.0354  -0.0472 423 PHE A CD1   
3340 C CD2   . PHE A 426 ? 0.2735 0.3382 0.3107 -0.0510 0.0277  -0.0417 423 PHE A CD2   
3341 C CE1   . PHE A 426 ? 0.5210 0.5531 0.5156 -0.0718 0.0296  -0.0370 423 PHE A CE1   
3342 C CE2   . PHE A 426 ? 0.3465 0.3899 0.3645 -0.0478 0.0236  -0.0315 423 PHE A CE2   
3343 C CZ    . PHE A 426 ? 0.4659 0.4942 0.4639 -0.0574 0.0243  -0.0296 423 PHE A CZ    
3344 N N     . LEU A 427 ? 0.1531 0.2652 0.2410 -0.0290 0.0137  -0.0553 424 LEU A N     
3345 C CA    . LEU A 427 ? 0.1676 0.2766 0.2527 -0.0193 0.0016  -0.0511 424 LEU A CA    
3346 C C     . LEU A 427 ? 0.1718 0.2543 0.2308 -0.0185 0.0007  -0.0380 424 LEU A C     
3347 O O     . LEU A 427 ? 0.2029 0.2713 0.2530 -0.0160 0.0044  -0.0312 424 LEU A O     
3348 C CB    . LEU A 427 ? 0.2102 0.3247 0.3078 -0.0028 -0.0073 -0.0523 424 LEU A CB    
3349 C CG    . LEU A 427 ? 0.2493 0.3915 0.3761 0.0018  -0.0105 -0.0664 424 LEU A CG    
3350 C CD1   . LEU A 427 ? 0.2439 0.3815 0.3741 0.0203  -0.0224 -0.0650 424 LEU A CD1   
3351 C CD2   . LEU A 427 ? 0.2119 0.3734 0.3519 -0.0045 -0.0146 -0.0758 424 LEU A CD2   
3352 N N     . CYS A 428 ? 0.1852 0.2616 0.2330 -0.0206 -0.0043 -0.0354 425 CYS A N     
3353 C CA    . CYS A 428 ? 0.2058 0.2590 0.2304 -0.0196 -0.0046 -0.0247 425 CYS A CA    
3354 C C     . CYS A 428 ? 0.2501 0.2969 0.2661 -0.0118 -0.0140 -0.0210 425 CYS A C     
3355 O O     . CYS A 428 ? 0.2837 0.3391 0.3031 -0.0146 -0.0195 -0.0264 425 CYS A O     
3356 C CB    . CYS A 428 ? 0.2411 0.2852 0.2516 -0.0330 0.0014  -0.0246 425 CYS A CB    
3357 S SG    . CYS A 428 ? 0.3665 0.3835 0.3516 -0.0310 0.0017  -0.0136 425 CYS A SG    
3358 N N     . ALA A 429 ? 0.1779 0.2087 0.1819 -0.0028 -0.0155 -0.0124 426 ALA A N     
3359 C CA    . ALA A 429 ? 0.1772 0.1961 0.1667 0.0039  -0.0227 -0.0078 426 ALA A CA    
3360 C C     . ALA A 429 ? 0.1996 0.2035 0.1699 -0.0013 -0.0191 -0.0026 426 ALA A C     
3361 O O     . ALA A 429 ? 0.2337 0.2295 0.1989 -0.0041 -0.0120 0.0014  426 ALA A O     
3362 C CB    . ALA A 429 ? 0.2264 0.2335 0.2101 0.0152  -0.0248 -0.0017 426 ALA A CB    
3363 N N     . THR A 430 ? 0.2254 0.2251 0.1852 -0.0017 -0.0252 -0.0033 427 THR A N     
3364 C CA    . THR A 430 ? 0.2742 0.2602 0.2157 -0.0067 -0.0230 -0.0002 427 THR A CA    
3365 C C     . THR A 430 ? 0.2957 0.2695 0.2202 -0.0011 -0.0299 0.0025  427 THR A C     
3366 O O     . THR A 430 ? 0.2604 0.2355 0.1865 0.0062  -0.0372 0.0017  427 THR A O     
3367 C CB    . THR A 430 ? 0.3640 0.3570 0.3077 -0.0193 -0.0220 -0.0064 427 THR A CB    
3368 O OG1   . THR A 430 ? 0.4219 0.4267 0.3731 -0.0214 -0.0297 -0.0129 427 THR A OG1   
3369 C CG2   . THR A 430 ? 0.4130 0.4165 0.3710 -0.0260 -0.0150 -0.0101 427 THR A CG2   
3370 N N     . LYS A 431 ? 0.3244 0.2846 0.2309 -0.0039 -0.0285 0.0050  428 LYS A N     
3371 C CA    . LYS A 431 ? 0.2942 0.2403 0.1811 0.0007  -0.0343 0.0072  428 LYS A CA    
3372 C C     . LYS A 431 ? 0.2736 0.2077 0.1507 0.0112  -0.0337 0.0131  428 LYS A C     
3373 O O     . LYS A 431 ? 0.2970 0.2272 0.1689 0.0171  -0.0419 0.0128  428 LYS A O     
3374 C CB    . LYS A 431 ? 0.3153 0.2696 0.2060 -0.0021 -0.0449 0.0010  428 LYS A CB    
3375 C CG    . LYS A 431 ? 0.4739 0.4365 0.3696 -0.0150 -0.0444 -0.0049 428 LYS A CG    
3376 C CD    . LYS A 431 ? 0.5833 0.5483 0.4760 -0.0185 -0.0549 -0.0103 428 LYS A CD    
3377 C CE    . LYS A 431 ? 0.6725 0.6431 0.5672 -0.0336 -0.0531 -0.0161 428 LYS A CE    
3378 N NZ    . LYS A 431 ? 0.7098 0.6620 0.5849 -0.0379 -0.0461 -0.0116 428 LYS A NZ    
3379 N N     . PHE A 432 ? 0.3420 0.2689 0.2157 0.0131  -0.0241 0.0179  429 PHE A N     
3380 C CA    . PHE A 432 ? 0.3304 0.2443 0.1932 0.0205  -0.0203 0.0236  429 PHE A CA    
3381 C C     . PHE A 432 ? 0.4007 0.2953 0.2374 0.0242  -0.0213 0.0262  429 PHE A C     
3382 O O     . PHE A 432 ? 0.4397 0.3296 0.2673 0.0215  -0.0200 0.0252  429 PHE A O     
3383 C CB    . PHE A 432 ? 0.3254 0.2403 0.1958 0.0197  -0.0089 0.0266  429 PHE A CB    
3384 C CG    . PHE A 432 ? 0.3226 0.2507 0.2137 0.0185  -0.0078 0.0256  429 PHE A CG    
3385 C CD1   . PHE A 432 ? 0.2765 0.2009 0.1683 0.0235  -0.0085 0.0281  429 PHE A CD1   
3386 C CD2   . PHE A 432 ? 0.3682 0.3090 0.2747 0.0123  -0.0063 0.0219  429 PHE A CD2   
3387 C CE1   . PHE A 432 ? 0.2871 0.2223 0.1967 0.0231  -0.0078 0.0268  429 PHE A CE1   
3388 C CE2   . PHE A 432 ? 0.3878 0.3393 0.3115 0.0114  -0.0049 0.0206  429 PHE A CE2   
3389 C CZ    . PHE A 432 ? 0.3331 0.2826 0.2593 0.0172  -0.0057 0.0230  429 PHE A CZ    
3390 N N     . SER A 433 ? 0.3759 0.2568 0.1982 0.0304  -0.0242 0.0294  430 SER A N     
3391 C CA    . SER A 433 ? 0.3627 0.2208 0.1558 0.0343  -0.0235 0.0326  430 SER A CA    
3392 C C     . SER A 433 ? 0.4595 0.3028 0.2407 0.0376  -0.0138 0.0381  430 SER A C     
3393 O O     . SER A 433 ? 0.3961 0.2437 0.1881 0.0385  -0.0131 0.0395  430 SER A O     
3394 C CB    . SER A 433 ? 0.5051 0.3544 0.2848 0.0382  -0.0385 0.0306  430 SER A CB    
3395 O OG    . SER A 433 ? 0.6714 0.5330 0.4601 0.0335  -0.0464 0.0250  430 SER A OG    
3396 N N     . ALA A 434 ? 0.5004 0.3256 0.2586 0.0387  -0.0057 0.0409  431 ALA A N     
3397 C CA    . ALA A 434 ? 0.5155 0.3252 0.2600 0.0395  0.0062  0.0456  431 ALA A CA    
3398 C C     . ALA A 434 ? 0.5622 0.3532 0.2885 0.0440  -0.0022 0.0487  431 ALA A C     
3399 O O     . ALA A 434 ? 0.6481 0.4316 0.3632 0.0482  -0.0169 0.0471  431 ALA A O     
3400 C CB    . ALA A 434 ? 0.5700 0.3638 0.2919 0.0395  0.0170  0.0465  431 ALA A CB    
3401 N N     . SER A 435 ? 0.5315 0.3137 0.2542 0.0431  0.0062  0.0526  432 SER A N     
3402 C CA    . SER A 435 ? 0.6503 0.4081 0.3498 0.0477  -0.0014 0.0560  432 SER A CA    
3403 C C     . SER A 435 ? 0.7645 0.5005 0.4435 0.0439  0.0144  0.0614  432 SER A C     
3404 O O     . SER A 435 ? 0.7421 0.4518 0.3962 0.0464  0.0106  0.0651  432 SER A O     
3405 C CB    . SER A 435 ? 0.6972 0.4701 0.4196 0.0508  -0.0135 0.0537  432 SER A CB    
3406 O OG    . SER A 435 ? 0.7902 0.5818 0.5390 0.0459  -0.0033 0.0539  432 SER A OG    
3407 O OXT   . SER A 435 ? 0.8566 0.6003 0.5433 0.0380  0.0313  0.0614  432 SER A OXT   
3408 P P     . DA  B 2   ? 1.7203 1.7300 1.6047 -0.1752 0.0968  -0.0200 2   DA  T P     
3409 O OP1   . DA  B 2   ? 1.6958 1.7249 1.6020 -0.1681 0.1113  -0.0329 2   DA  T OP1   
3410 O OP2   . DA  B 2   ? 1.7078 1.7245 1.6056 -0.1752 0.0932  -0.0248 2   DA  T OP2   
3411 O "O5'" . DA  B 2   ? 0.9454 0.9442 0.8246 -0.1560 0.0778  -0.0033 2   DA  T "O5'" 
3412 C "C5'" . DA  B 2   ? 0.8676 0.8774 0.7697 -0.1319 0.0678  -0.0022 2   DA  T "C5'" 
3413 C "C4'" . DA  B 2   ? 0.7971 0.8101 0.7075 -0.1112 0.0656  0.0012  2   DA  T "C4'" 
3414 O "O4'" . DA  B 2   ? 0.7974 0.7901 0.6917 -0.1099 0.0540  0.0158  2   DA  T "O4'" 
3415 C "C3'" . DA  B 2   ? 0.7406 0.7660 0.6739 -0.0871 0.0603  -0.0027 2   DA  T "C3'" 
3416 O "O3'" . DA  B 2   ? 0.6282 0.6725 0.5811 -0.0818 0.0704  -0.0161 2   DA  T "O3'" 
3417 C "C2'" . DA  B 2   ? 0.7592 0.7734 0.6875 -0.0718 0.0537  0.0074  2   DA  T "C2'" 
3418 C "C1'" . DA  B 2   ? 0.8106 0.8050 0.7180 -0.0868 0.0480  0.0190  2   DA  T "C1'" 
3419 N N9    . DA  B 2   ? 0.8653 0.8463 0.7711 -0.0835 0.0345  0.0281  2   DA  T N9    
3420 C C8    . DA  B 2   ? 0.8835 0.8582 0.7838 -0.0954 0.0276  0.0308  2   DA  T C8    
3421 N N7    . DA  B 2   ? 0.8911 0.8541 0.7948 -0.0886 0.0158  0.0387  2   DA  T N7    
3422 C C5    . DA  B 2   ? 0.8729 0.8339 0.7845 -0.0720 0.0165  0.0406  2   DA  T C5    
3423 C C6    . DA  B 2   ? 0.8837 0.8332 0.8040 -0.0594 0.0097  0.0460  2   DA  T C6    
3424 N N6    . DA  B 2   ? 0.9384 0.8773 0.8634 -0.0611 -0.0005 0.0511  2   DA  T N6    
3425 N N1    . DA  B 2   ? 0.8193 0.7682 0.7448 -0.0456 0.0153  0.0451  2   DA  T N1    
3426 C C2    . DA  B 2   ? 0.7621 0.7215 0.6843 -0.0437 0.0252  0.0400  2   DA  T C2    
3427 N N3    . DA  B 2   ? 0.7867 0.7585 0.7033 -0.0541 0.0317  0.0345  2   DA  T N3    
3428 C C4    . DA  B 2   ? 0.8503 0.8219 0.7618 -0.0685 0.0275  0.0347  2   DA  T C4    
3429 P P     . DT  B 3   ? 0.3674 0.4278 0.3468 -0.0688 0.0666  -0.0271 3   DT  T P     
3430 O OP1   . DT  B 3   ? 0.4459 0.5248 0.4473 -0.0745 0.0793  -0.0431 3   DT  T OP1   
3431 O OP2   . DT  B 3   ? 0.3707 0.4255 0.3463 -0.0729 0.0576  -0.0234 3   DT  T OP2   
3432 O "O5'" . DT  B 3   ? 0.2312 0.2877 0.2139 -0.0437 0.0580  -0.0228 3   DT  T "O5'" 
3433 C "C5'" . DT  B 3   ? 0.2524 0.3114 0.2379 -0.0348 0.0638  -0.0244 3   DT  T "C5'" 
3434 C "C4'" . DT  B 3   ? 0.2404 0.2892 0.2222 -0.0132 0.0546  -0.0191 3   DT  T "C4'" 
3435 O "O4'" . DT  B 3   ? 0.2329 0.2635 0.1959 -0.0133 0.0494  -0.0066 3   DT  T "O4'" 
3436 C "C3'" . DT  B 3   ? 0.1914 0.2426 0.1848 -0.0001 0.0440  -0.0249 3   DT  T "C3'" 
3437 O "O3'" . DT  B 3   ? 0.1907 0.2344 0.1816 0.0175  0.0407  -0.0245 3   DT  T "O3'" 
3438 C "C2'" . DT  B 3   ? 0.2197 0.2576 0.1996 -0.0016 0.0357  -0.0164 3   DT  T "C2'" 
3439 C "C1'" . DT  B 3   ? 0.2371 0.2599 0.1991 -0.0030 0.0392  -0.0050 3   DT  T "C1'" 
3440 N N1    . DT  B 3   ? 0.1986 0.2101 0.1505 -0.0125 0.0350  0.0039  3   DT  T N1    
3441 C C2    . DT  B 3   ? 0.1985 0.1927 0.1408 -0.0058 0.0330  0.0125  3   DT  T C2    
3442 O O2    . DT  B 3   ? 0.1984 0.1855 0.1373 0.0067  0.0360  0.0129  3   DT  T O2    
3443 N N3    . DT  B 3   ? 0.2432 0.2273 0.1815 -0.0147 0.0276  0.0198  3   DT  T N3    
3444 C C4    . DT  B 3   ? 0.2263 0.2140 0.1648 -0.0295 0.0236  0.0207  3   DT  T C4    
3445 O O4    . DT  B 3   ? 0.2651 0.2411 0.2004 -0.0362 0.0171  0.0281  3   DT  T O4    
3446 C C5    . DT  B 3   ? 0.2547 0.2598 0.1997 -0.0368 0.0279  0.0114  3   DT  T C5    
3447 C C7    . DT  B 3   ? 0.2739 0.2820 0.2176 -0.0543 0.0262  0.0106  3   DT  T C7    
3448 C C6    . DT  B 3   ? 0.2177 0.2347 0.1714 -0.0281 0.0336  0.0030  3   DT  T C6    
3449 P P     . DT  B 4   ? 0.1976 0.2362 0.1938 0.0340  0.0271  -0.0294 4   DT  T P     
3450 O OP1   . DT  B 4   ? 0.2096 0.2503 0.2144 0.0453  0.0271  -0.0349 4   DT  T OP1   
3451 O OP2   . DT  B 4   ? 0.2006 0.2506 0.2130 0.0278  0.0207  -0.0365 4   DT  T OP2   
3452 O "O5'" . DT  B 4   ? 0.2053 0.2181 0.1742 0.0422  0.0218  -0.0185 4   DT  T "O5'" 
3453 C "C5'" . DT  B 4   ? 0.2060 0.2035 0.1580 0.0485  0.0281  -0.0116 4   DT  T "C5'" 
3454 C "C4'" . DT  B 4   ? 0.2157 0.1891 0.1467 0.0534  0.0252  -0.0043 4   DT  T "C4'" 
3455 O "O4'" . DT  B 4   ? 0.2258 0.2011 0.1582 0.0411  0.0270  0.0011  4   DT  T "O4'" 
3456 C "C3'" . DT  B 4   ? 0.2308 0.1913 0.1532 0.0622  0.0130  -0.0072 4   DT  T "C3'" 
3457 O "O3'" . DT  B 4   ? 0.2550 0.1870 0.1522 0.0710  0.0148  -0.0027 4   DT  T "O3'" 
3458 C "C2'" . DT  B 4   ? 0.2277 0.1944 0.1561 0.0521  0.0092  -0.0061 4   DT  T "C2'" 
3459 C "C1'" . DT  B 4   ? 0.2529 0.2171 0.1786 0.0432  0.0191  0.0018  4   DT  T "C1'" 
3460 N N1    . DT  B 4   ? 0.2173 0.1901 0.1510 0.0296  0.0175  0.0044  4   DT  T N1    
3461 C C2    . DT  B 4   ? 0.2422 0.2021 0.1705 0.0251  0.0194  0.0119  4   DT  T C2    
3462 O O2    . DT  B 4   ? 0.2829 0.2261 0.2030 0.0313  0.0238  0.0155  4   DT  T O2    
3463 N N3    . DT  B 4   ? 0.2524 0.2184 0.1873 0.0124  0.0158  0.0146  4   DT  T N3    
3464 C C4    . DT  B 4   ? 0.2711 0.2537 0.2149 0.0028  0.0129  0.0103  4   DT  T C4    
3465 O O4    . DT  B 4   ? 0.3023 0.2857 0.2479 -0.0093 0.0101  0.0138  4   DT  T O4    
3466 C C5    . DT  B 4   ? 0.2409 0.2379 0.1930 0.0075  0.0133  0.0010  4   DT  T C5    
3467 C C7    . DT  B 4   ? 0.2618 0.2776 0.2287 -0.0033 0.0125  -0.0066 4   DT  T C7    
3468 C C6    . DT  B 4   ? 0.2285 0.2203 0.1765 0.0210  0.0144  -0.0013 4   DT  T C6    
3469 P P     . DA  B 5   ? 0.2715 0.1790 0.1474 0.0815  0.0031  -0.0051 5   DA  T P     
3470 O OP1   . DA  B 5   ? 0.3546 0.2310 0.2023 0.0867  0.0112  -0.0009 5   DA  T OP1   
3471 O OP2   . DA  B 5   ? 0.2761 0.1927 0.1629 0.0882  -0.0084 -0.0120 5   DA  T OP2   
3472 O "O5'" . DA  B 5   ? 0.3012 0.2110 0.1805 0.0749  -0.0040 -0.0053 5   DA  T "O5'" 
3473 C "C5'" . DA  B 5   ? 0.3331 0.2187 0.1918 0.0744  -0.0028 -0.0020 5   DA  T "C5'" 
3474 C "C4'" . DA  B 5   ? 0.3099 0.1950 0.1734 0.0666  0.0101  0.0036  5   DA  T "C4'" 
3475 O "O4'" . DA  B 5   ? 0.3589 0.2705 0.2468 0.0557  0.0095  0.0049  5   DA  T "O4'" 
3476 C "C3'" . DA  B 5   ? 0.3155 0.1780 0.1646 0.0649  0.0116  0.0049  5   DA  T "C3'" 
3477 O "O3'" . DA  B 5   ? 0.3620 0.1960 0.1882 0.0707  0.0212  0.0052  5   DA  T "O3'" 
3478 C "C2'" . DA  B 5   ? 0.3995 0.2748 0.2693 0.0542  0.0159  0.0090  5   DA  T "C2'" 
3479 C "C1'" . DA  B 5   ? 0.3954 0.3000 0.2856 0.0486  0.0139  0.0096  5   DA  T "C1'" 
3480 N N9    . DA  B 5   ? 0.3187 0.2415 0.2245 0.0384  0.0075  0.0098  5   DA  T N9    
3481 C C8    . DA  B 5   ? 0.3187 0.2617 0.2357 0.0354  0.0008  0.0049  5   DA  T C8    
3482 N N7    . DA  B 5   ? 0.3415 0.2958 0.2697 0.0243  -0.0021 0.0059  5   DA  T N7    
3483 C C5    . DA  B 5   ? 0.2305 0.1712 0.1556 0.0204  0.0011  0.0126  5   DA  T C5    
3484 C C6    . DA  B 5   ? 0.3639 0.3053 0.2969 0.0094  -0.0015 0.0171  5   DA  T C6    
3485 N N6    . DA  B 5   ? 0.4064 0.3624 0.3477 -0.0008 -0.0065 0.0158  5   DA  T N6    
3486 N N1    . DA  B 5   ? 0.3554 0.2808 0.2890 0.0088  0.0013  0.0223  5   DA  T N1    
3487 C C2    . DA  B 5   ? 0.3891 0.2991 0.3151 0.0181  0.0086  0.0220  5   DA  T C2    
3488 N N3    . DA  B 5   ? 0.3683 0.2746 0.2822 0.0281  0.0129  0.0184  5   DA  T N3    
3489 C C4    . DA  B 5   ? 0.2942 0.2164 0.2081 0.0290  0.0076  0.0143  5   DA  T C4    
3490 P P     . DT  B 6   ? 0.3934 0.1914 0.1895 0.0725  0.0227  0.0029  6   DT  T P     
3491 O OP1   . DT  B 6   ? 0.4659 0.2361 0.2419 0.0757  0.0378  0.0025  6   DT  T OP1   
3492 O OP2   . DT  B 6   ? 0.4085 0.2004 0.1886 0.0771  0.0063  -0.0002 6   DT  T OP2   
3493 O "O5'" . DT  B 6   ? 0.4120 0.2155 0.2258 0.0632  0.0265  0.0043  6   DT  T "O5'" 
3494 C "C5'" . DT  B 6   ? 0.4217 0.2096 0.2239 0.0605  0.0238  0.0021  6   DT  T "C5'" 
3495 C "C4'" . DT  B 6   ? 0.3668 0.1595 0.1924 0.0523  0.0320  0.0039  6   DT  T "C4'" 
3496 O "O4'" . DT  B 6   ? 0.3665 0.1920 0.2221 0.0467  0.0246  0.0080  6   DT  T "O4'" 
3497 C "C3'" . DT  B 6   ? 0.4173 0.1936 0.2328 0.0486  0.0306  0.0008  6   DT  T "C3'" 
3498 O "O3'" . DT  B 6   ? 0.4524 0.2085 0.2708 0.0450  0.0463  -0.0014 6   DT  T "O3'" 
3499 C "C2'" . DT  B 6   ? 0.4244 0.2292 0.2655 0.0425  0.0188  0.0034  6   DT  T "C2'" 
3500 C "C1'" . DT  B 6   ? 0.3772 0.2072 0.2443 0.0397  0.0195  0.0083  6   DT  T "C1'" 
3501 N N1    . DT  B 6   ? 0.3278 0.1860 0.2093 0.0355  0.0073  0.0098  6   DT  T N1    
3502 C C2    . DT  B 6   ? 0.3489 0.2201 0.2511 0.0259  0.0038  0.0132  6   DT  T C2    
3503 O O2    . DT  B 6   ? 0.3721 0.2338 0.2847 0.0216  0.0085  0.0152  6   DT  T O2    
3504 N N3    . DT  B 6   ? 0.3153 0.2097 0.2271 0.0209  -0.0052 0.0132  6   DT  T N3    
3505 C C4    . DT  B 6   ? 0.3539 0.2616 0.2625 0.0247  -0.0106 0.0091  6   DT  T C4    
3506 O O4    . DT  B 6   ? 0.4025 0.3306 0.3238 0.0184  -0.0161 0.0075  6   DT  T O4    
3507 C C5    . DT  B 6   ? 0.3335 0.2279 0.2243 0.0359  -0.0089 0.0060  6   DT  T C5    
3508 C C7    . DT  B 6   ? 0.3570 0.2639 0.2484 0.0415  -0.0167 0.0008  6   DT  T C7    
3509 C C6    . DT  B 6   ? 0.3628 0.2322 0.2381 0.0405  -0.0004 0.0071  6   DT  T C6    
3510 P P     . DG  B 7   ? 0.5544 0.2796 0.3524 0.0413  0.0529  -0.0073 7   DG  T P     
3511 O OP1   . DG  B 7   ? 0.6196 0.3194 0.4172 0.0390  0.0741  -0.0121 7   DG  T OP1   
3512 O OP2   . DG  B 7   ? 0.5690 0.2811 0.3317 0.0452  0.0411  -0.0089 7   DG  T OP2   
3513 O "O5'" . DG  B 7   ? 0.4702 0.2160 0.2990 0.0340  0.0454  -0.0054 7   DG  T "O5'" 
3514 C "C5'" . DG  B 7   ? 0.4674 0.2257 0.3334 0.0287  0.0503  -0.0032 7   DG  T "C5'" 
3515 C "C4'" . DG  B 7   ? 0.4103 0.1824 0.2954 0.0221  0.0404  -0.0016 7   DG  T "C4'" 
3516 O "O4'" . DG  B 7   ? 0.4296 0.2310 0.3216 0.0218  0.0246  0.0039  7   DG  T "O4'" 
3517 C "C3'" . DG  B 7   ? 0.4778 0.2310 0.3410 0.0204  0.0404  -0.0070 7   DG  T "C3'" 
3518 O "O3'" . DG  B 7   ? 0.4467 0.1964 0.3354 0.0133  0.0458  -0.0091 7   DG  T "O3'" 
3519 C "C2'" . DG  B 7   ? 0.4636 0.2377 0.3205 0.0217  0.0220  -0.0041 7   DG  T "C2'" 
3520 C "C1'" . DG  B 7   ? 0.4143 0.2198 0.3020 0.0189  0.0150  0.0026  7   DG  T "C1'" 
3521 N N9    . DG  B 7   ? 0.3643 0.1928 0.2499 0.0207  0.0020  0.0046  7   DG  T N9    
3522 C C8    . DG  B 7   ? 0.3623 0.1901 0.2276 0.0283  -0.0025 0.0024  7   DG  T C8    
3523 N N7    . DG  B 7   ? 0.3513 0.2040 0.2271 0.0275  -0.0132 0.0030  7   DG  T N7    
3524 C C5    . DG  B 7   ? 0.3106 0.1794 0.2100 0.0180  -0.0152 0.0064  7   DG  T C5    
3525 C C6    . DG  B 7   ? 0.2855 0.1800 0.2018 0.0111  -0.0230 0.0075  7   DG  T C6    
3526 O O6    . DG  B 7   ? 0.3192 0.2301 0.2376 0.0124  -0.0288 0.0043  7   DG  T O6    
3527 N N1    . DG  B 7   ? 0.2832 0.1821 0.2160 0.0012  -0.0234 0.0119  7   DG  T N1    
3528 C C2    . DG  B 7   ? 0.2675 0.1500 0.2059 -0.0008 -0.0180 0.0143  7   DG  T C2    
3529 N N2    . DG  B 7   ? 0.3062 0.1942 0.2629 -0.0106 -0.0221 0.0188  7   DG  T N2    
3530 N N3    . DG  B 7   ? 0.3290 0.1895 0.2569 0.0055  -0.0089 0.0117  7   DG  T N3    
3531 C C4    . DG  B 7   ? 0.3140 0.1681 0.2199 0.0143  -0.0075 0.0080  7   DG  T C4    
3532 P P     . DA  B 8   ? 0.5069 0.2373 0.3817 0.0087  0.0485  -0.0154 8   DA  T P     
3533 O OP1   . DA  B 8   ? 0.6282 0.3362 0.5175 0.0039  0.0675  -0.0226 8   DA  T OP1   
3534 O OP2   . DA  B 8   ? 0.6776 0.3932 0.5082 0.0132  0.0430  -0.0176 8   DA  T OP2   
3535 O "O5'" . DA  B 8   ? 0.4163 0.1742 0.3172 0.0038  0.0327  -0.0104 8   DA  T "O5'" 
3536 C "C5'" . DA  B 8   ? 0.4198 0.1948 0.3603 -0.0006 0.0300  -0.0055 8   DA  T "C5'" 
3537 C "C4'" . DA  B 8   ? 0.4180 0.2149 0.3754 -0.0063 0.0147  -0.0005 8   DA  T "C4'" 
3538 O "O4'" . DA  B 8   ? 0.4912 0.3095 0.4373 -0.0041 0.0025  0.0041  8   DA  T "O4'" 
3539 C "C3'" . DA  B 8   ? 0.4636 0.2517 0.4137 -0.0097 0.0139  -0.0054 8   DA  T "C3'" 
3540 O "O3'" . DA  B 8   ? 0.4828 0.2803 0.4656 -0.0171 0.0085  -0.0025 8   DA  T "O3'" 
3541 C "C2'" . DA  B 8   ? 0.4601 0.2611 0.3870 -0.0068 0.0012  -0.0044 8   DA  T "C2'" 
3542 C "C1'" . DA  B 8   ? 0.4306 0.2565 0.3695 -0.0064 -0.0069 0.0027  8   DA  T "C1'" 
3543 N N9    . DA  B 8   ? 0.3977 0.2332 0.3163 -0.0006 -0.0137 0.0019  8   DA  T N9    
3544 C C8    . DA  B 8   ? 0.4051 0.2253 0.2963 0.0075  -0.0103 -0.0018 8   DA  T C8    
3545 N N7    . DA  B 8   ? 0.4763 0.3104 0.3594 0.0118  -0.0201 -0.0021 8   DA  T N7    
3546 C C5    . DA  B 8   ? 0.3189 0.1793 0.2251 0.0052  -0.0280 0.0007  8   DA  T C5    
3547 C C6    . DA  B 8   ? 0.4095 0.2937 0.3232 0.0045  -0.0375 -0.0001 8   DA  T C6    
3548 N N6    . DA  B 8   ? 0.4199 0.3066 0.3223 0.0121  -0.0428 -0.0041 8   DA  T N6    
3549 N N1    . DA  B 8   ? 0.4507 0.3540 0.3847 -0.0052 -0.0412 0.0025  8   DA  T N1    
3550 C C2    . DA  B 8   ? 0.4575 0.3557 0.4032 -0.0125 -0.0384 0.0069  8   DA  T C2    
3551 N N3    . DA  B 8   ? 0.3745 0.2528 0.3200 -0.0115 -0.0312 0.0079  8   DA  T N3    
3552 C C4    . DA  B 8   ? 0.3837 0.2441 0.3090 -0.0027 -0.0249 0.0041  8   DA  T C4    
3553 P P     . DC  B 9   ? 0.5503 0.3386 0.5379 -0.0225 0.0096  -0.0077 9   DC  T P     
3554 O OP1   . DC  B 9   ? 0.6521 0.4393 0.6801 -0.0286 0.0108  -0.0067 9   DC  T OP1   
3555 O OP2   . DC  B 9   ? 0.5992 0.3628 0.5533 -0.0194 0.0208  -0.0163 9   DC  T OP2   
3556 O "O5'" . DC  B 9   ? 0.4404 0.2511 0.4222 -0.0248 -0.0071 -0.0033 9   DC  T "O5'" 
3557 C "C5'" . DC  B 9   ? 0.4000 0.2328 0.4001 -0.0290 -0.0186 0.0051  9   DC  T "C5'" 
3558 C "C4'" . DC  B 9   ? 0.3400 0.1906 0.3303 -0.0312 -0.0300 0.0059  9   DC  T "C4'" 
3559 O "O4'" . DC  B 9   ? 0.3567 0.2134 0.3241 -0.0242 -0.0314 0.0041  9   DC  T "O4'" 
3560 C "C3'" . DC  B 9   ? 0.3558 0.2000 0.3406 -0.0330 -0.0309 0.0001  9   DC  T "C3'" 
3561 O "O3'" . DC  B 9   ? 0.3800 0.2396 0.3843 -0.0416 -0.0405 0.0047  9   DC  T "O3'" 
3562 C "C2'" . DC  B 9   ? 0.4208 0.2655 0.3761 -0.0261 -0.0344 -0.0048 9   DC  T "C2'" 
3563 C "C1'" . DC  B 9   ? 0.3927 0.2549 0.3479 -0.0235 -0.0385 -0.0005 9   DC  T "C1'" 
3564 N N1    . DC  B 9   ? 0.4074 0.2664 0.3384 -0.0143 -0.0396 -0.0042 9   DC  T N1    
3565 C C2    . DC  B 9   ? 0.3855 0.2656 0.3177 -0.0130 -0.0487 -0.0049 9   DC  T C2    
3566 O O2    . DC  B 9   ? 0.4189 0.3188 0.3690 -0.0206 -0.0535 -0.0028 9   DC  T O2    
3567 N N3    . DC  B 9   ? 0.3675 0.2441 0.2818 -0.0042 -0.0517 -0.0085 9   DC  T N3    
3568 C C4    . DC  B 9   ? 0.4035 0.2544 0.2938 0.0024  -0.0462 -0.0104 9   DC  T C4    
3569 N N4    . DC  B 9   ? 0.4033 0.2488 0.2749 0.0107  -0.0517 -0.0132 9   DC  T N4    
3570 C C5    . DC  B 9   ? 0.3487 0.1764 0.2340 -0.0002 -0.0344 -0.0102 9   DC  T C5    
3571 C C6    . DC  B 9   ? 0.4039 0.2378 0.3127 -0.0081 -0.0314 -0.0077 9   DC  T C6    
3572 P P     . DG  B 10  ? 0.3942 0.2550 0.4005 -0.0461 -0.0449 0.0007  10  DG  T P     
3573 O OP1   . DG  B 10  ? 0.4127 0.2763 0.4463 -0.0554 -0.0494 0.0060  10  DG  T OP1   
3574 O OP2   . DG  B 10  ? 0.4453 0.2859 0.4324 -0.0410 -0.0371 -0.0076 10  DG  T OP2   
3575 O "O5'" . DG  B 10  ? 0.4341 0.3157 0.4302 -0.0463 -0.0546 -0.0001 10  DG  T "O5'" 
3576 C "C5'" . DG  B 10  ? 0.3556 0.2551 0.3605 -0.0521 -0.0600 0.0058  10  DG  T "C5'" 
3577 C "C4'" . DG  B 10  ? 0.3407 0.2581 0.3412 -0.0536 -0.0665 0.0011  10  DG  T "C4'" 
3578 O "O4'" . DG  B 10  ? 0.3192 0.2386 0.3040 -0.0437 -0.0666 -0.0044 10  DG  T "O4'" 
3579 C "C3'" . DG  B 10  ? 0.2888 0.2060 0.2914 -0.0557 -0.0705 -0.0043 10  DG  T "C3'" 
3580 O "O3'" . DG  B 10  ? 0.2824 0.2193 0.2937 -0.0636 -0.0759 -0.0052 10  DG  T "O3'" 
3581 C "C2'" . DG  B 10  ? 0.3025 0.2101 0.2850 -0.0449 -0.0710 -0.0121 10  DG  T "C2'" 
3582 C "C1'" . DG  B 10  ? 0.2978 0.2150 0.2739 -0.0393 -0.0719 -0.0122 10  DG  T "C1'" 
3583 N N9    . DG  B 10  ? 0.3109 0.2120 0.2653 -0.0285 -0.0700 -0.0151 10  DG  T N9    
3584 C C8    . DG  B 10  ? 0.4150 0.2914 0.3554 -0.0249 -0.0615 -0.0142 10  DG  T C8    
3585 N N7    . DG  B 10  ? 0.3755 0.2383 0.2928 -0.0162 -0.0613 -0.0171 10  DG  T N7    
3586 C C5    . DG  B 10  ? 0.3327 0.2139 0.2526 -0.0128 -0.0719 -0.0199 10  DG  T C5    
3587 C C6    . DG  B 10  ? 0.4045 0.2816 0.3083 -0.0036 -0.0785 -0.0236 10  DG  T C6    
3588 O O6    . DG  B 10  ? 0.4445 0.2977 0.3222 0.0032  -0.0764 -0.0241 10  DG  T O6    
3589 N N1    . DG  B 10  ? 0.3825 0.2845 0.3037 -0.0033 -0.0885 -0.0276 10  DG  T N1    
3590 C C2    . DG  B 10  ? 0.4009 0.3273 0.3483 -0.0121 -0.0894 -0.0283 10  DG  T C2    
3591 N N2    . DG  B 10  ? 0.4070 0.3545 0.3710 -0.0116 -0.0967 -0.0346 10  DG  T N2    
3592 N N3    . DG  B 10  ? 0.3242 0.2523 0.2814 -0.0215 -0.0834 -0.0237 10  DG  T N3    
3593 C C4    . DG  B 10  ? 0.3158 0.2214 0.2600 -0.0207 -0.0759 -0.0195 10  DG  T C4    
3594 P P     . DC  B 11  ? 0.2854 0.2285 0.3052 -0.0697 -0.0808 -0.0098 11  DC  T P     
3595 O OP1   . DC  B 11  ? 0.2810 0.2381 0.3117 -0.0824 -0.0823 -0.0068 11  DC  T OP1   
3596 O OP2   . DC  B 11  ? 0.3412 0.2669 0.3622 -0.0690 -0.0790 -0.0092 11  DC  T OP2   
3597 O "O5'" . DC  B 11  ? 0.2914 0.2423 0.3038 -0.0614 -0.0859 -0.0202 11  DC  T "O5'" 
3598 C "C5'" . DC  B 11  ? 0.2849 0.2552 0.3039 -0.0629 -0.0875 -0.0241 11  DC  T "C5'" 
3599 C "C4'" . DC  B 11  ? 0.2926 0.2676 0.3096 -0.0540 -0.0955 -0.0348 11  DC  T "C4'" 
3600 O "O4'" . DC  B 11  ? 0.3124 0.2713 0.3099 -0.0420 -0.0964 -0.0343 11  DC  T "O4'" 
3601 C "C3'" . DC  B 11  ? 0.3077 0.2780 0.3255 -0.0541 -0.1019 -0.0401 11  DC  T "C3'" 
3602 O "O3'" . DC  B 11  ? 0.3621 0.3481 0.3928 -0.0526 -0.1107 -0.0510 11  DC  T "O3'" 
3603 C "C2'" . DC  B 11  ? 0.3186 0.2634 0.3118 -0.0440 -0.1034 -0.0397 11  DC  T "C2'" 
3604 C "C1'" . DC  B 11  ? 0.3190 0.2650 0.3045 -0.0355 -0.1048 -0.0404 11  DC  T "C1'" 
3605 N N1    . DC  B 11  ? 0.4031 0.3234 0.3615 -0.0268 -0.1025 -0.0379 11  DC  T N1    
3606 C C2    . DC  B 11  ? 0.4358 0.3520 0.3821 -0.0169 -0.1100 -0.0417 11  DC  T C2    
3607 O O2    . DC  B 11  ? 0.3713 0.3069 0.3343 -0.0152 -0.1186 -0.0478 11  DC  T O2    
3608 N N3    . DC  B 11  ? 0.3775 0.2672 0.2953 -0.0101 -0.1073 -0.0395 11  DC  T N3    
3609 C C4    . DC  B 11  ? 0.3691 0.2383 0.2735 -0.0131 -0.0958 -0.0352 11  DC  T C4    
3610 N N4    . DC  B 11  ? 0.3900 0.2313 0.2647 -0.0073 -0.0915 -0.0346 11  DC  T N4    
3611 C C5    . DC  B 11  ? 0.3569 0.2319 0.2788 -0.0224 -0.0883 -0.0321 11  DC  T C5    
3612 C C6    . DC  B 11  ? 0.3402 0.2402 0.2873 -0.0289 -0.0930 -0.0329 11  DC  T C6    
3613 P P     . DG  B 12  ? 0.3160 0.3277 0.3730 -0.0641 -0.1074 -0.0560 12  DG  T P     
3614 O OP1   . DG  B 12  ? 0.3509 0.3608 0.4090 -0.0772 -0.0987 -0.0468 12  DG  T OP1   
3615 O OP2   . DG  B 12  ? 0.2969 0.3194 0.3696 -0.0619 -0.1172 -0.0686 12  DG  T OP2   
3616 O "O5'" . DG  B 12  ? 0.3754 0.3975 0.4363 -0.0620 -0.1033 -0.0570 12  DG  T "O5'" 
3617 C "C5'" . DG  B 12  ? 0.3814 0.4242 0.4632 -0.0717 -0.0976 -0.0637 12  DG  T "C5'" 
3618 C "C4'" . DG  B 12  ? 0.3629 0.4069 0.4387 -0.0739 -0.0887 -0.0581 12  DG  T "C4'" 
3619 O "O4'" . DG  B 12  ? 0.4798 0.5436 0.5763 -0.0828 -0.0820 -0.0681 12  DG  T "O4'" 
3620 C "C3'" . DG  B 12  ? 0.3889 0.4212 0.4501 -0.0839 -0.0810 -0.0444 12  DG  T "C3'" 
3621 O "O3'" . DG  B 12  ? 0.4341 0.4608 0.4839 -0.0797 -0.0768 -0.0380 12  DG  T "O3'" 
3622 C "C2'" . DG  B 12  ? 0.5739 0.6178 0.6463 -0.1017 -0.0734 -0.0478 12  DG  T "C2'" 
3623 C "C1'" . DG  B 12  ? 0.5967 0.6596 0.6878 -0.1000 -0.0706 -0.0618 12  DG  T "C1'" 
3624 N N9    . DG  B 12  ? 0.6708 0.7490 0.7830 -0.1126 -0.0651 -0.0739 12  DG  T N9    
3625 C C8    . DG  B 12  ? 0.7165 0.8099 0.8459 -0.1209 -0.0549 -0.0855 12  DG  T C8    
3626 N N7    . DG  B 12  ? 0.7423 0.8466 0.8907 -0.1326 -0.0493 -0.0968 12  DG  T N7    
3627 C C5    . DG  B 12  ? 0.6939 0.7903 0.8364 -0.1312 -0.0577 -0.0915 12  DG  T C5    
3628 C C6    . DG  B 12  ? 0.6856 0.7877 0.8420 -0.1408 -0.0563 -0.0991 12  DG  T C6    
3629 O O6    . DG  B 12  ? 0.7262 0.8414 0.9038 -0.1531 -0.0464 -0.1129 12  DG  T O6    
3630 N N1    . DG  B 12  ? 0.6201 0.7106 0.7651 -0.1358 -0.0663 -0.0903 12  DG  T N1    
3631 C C2    . DG  B 12  ? 0.5711 0.6457 0.6951 -0.1238 -0.0749 -0.0771 12  DG  T C2    
3632 N N2    . DG  B 12  ? 0.5115 0.5762 0.6295 -0.1218 -0.0818 -0.0719 12  DG  T N2    
3633 N N3    . DG  B 12  ? 0.5630 0.6314 0.6741 -0.1152 -0.0753 -0.0705 12  DG  T N3    
3634 C C4    . DG  B 12  ? 0.6536 0.7339 0.7744 -0.1191 -0.0672 -0.0777 12  DG  T C4    
3635 O "O5'" . DT  C 1   ? 1.8076 0.8067 0.6627 -0.0531 -0.2552 -0.0088 1   DT  P "O5'" 
3636 C "C5'" . DT  C 1   ? 1.6938 0.7318 0.6332 -0.0239 -0.2905 -0.0133 1   DT  P "C5'" 
3637 C "C4'" . DT  C 1   ? 1.5063 0.6366 0.5496 -0.0075 -0.2571 -0.0239 1   DT  P "C4'" 
3638 O "O4'" . DT  C 1   ? 1.4942 0.6438 0.5368 -0.0113 -0.2255 -0.0355 1   DT  P "O4'" 
3639 C "C3'" . DT  C 1   ? 1.3778 0.5468 0.4549 -0.0138 -0.2203 -0.0191 1   DT  P "C3'" 
3640 O "O3'" . DT  C 1   ? 1.2065 0.4522 0.3857 0.0076  -0.2166 -0.0255 1   DT  P "O3'" 
3641 C "C2'" . DT  C 1   ? 1.4191 0.5913 0.4641 -0.0330 -0.1694 -0.0245 1   DT  P "C2'" 
3642 C "C1'" . DT  C 1   ? 1.3969 0.5900 0.4679 -0.0201 -0.1739 -0.0384 1   DT  P "C1'" 
3643 N N1    . DT  C 1   ? 1.4018 0.5777 0.4238 -0.0359 -0.1407 -0.0492 1   DT  P N1    
3644 C C2    . DT  C 1   ? 1.2924 0.5249 0.3776 -0.0286 -0.1103 -0.0634 1   DT  P C2    
3645 O O2    . DT  C 1   ? 1.1575 0.4517 0.3323 -0.0119 -0.1096 -0.0644 1   DT  P O2    
3646 N N3    . DT  C 1   ? 1.3399 0.5531 0.3783 -0.0425 -0.0817 -0.0771 1   DT  P N3    
3647 C C4    . DT  C 1   ? 1.4142 0.5598 0.3450 -0.0646 -0.0775 -0.0777 1   DT  P C4    
3648 O O4    . DT  C 1   ? 1.3882 0.5248 0.2839 -0.0761 -0.0482 -0.0942 1   DT  P O4    
3649 C C5    . DT  C 1   ? 1.5259 0.6118 0.3885 -0.0741 -0.1111 -0.0588 1   DT  P C5    
3650 C C7    . DT  C 1   ? 1.6547 0.6607 0.3914 -0.1019 -0.1121 -0.0546 1   DT  P C7    
3651 C C6    . DT  C 1   ? 1.4861 0.5892 0.4001 -0.0584 -0.1421 -0.0459 1   DT  P C6    
3652 P P     . DG  C 2   ? 1.2262 0.4973 0.4556 0.0189  -0.2323 -0.0208 2   DG  P P     
3653 O OP1   . DG  C 2   ? 1.3004 0.5036 0.4754 0.0166  -0.2772 -0.0130 2   DG  P OP1   
3654 O OP2   . DG  C 2   ? 1.2220 0.5287 0.4763 0.0096  -0.1896 -0.0179 2   DG  P OP2   
3655 O "O5'" . DG  C 2   ? 0.9513 0.2913 0.2740 0.0443  -0.2466 -0.0317 2   DG  P "O5'" 
3656 C "C5'" . DG  C 2   ? 0.9444 0.2762 0.2740 0.0566  -0.2804 -0.0381 2   DG  P "C5'" 
3657 C "C4'" . DG  C 2   ? 0.8730 0.2818 0.2986 0.0766  -0.2852 -0.0470 2   DG  P "C4'" 
3658 O "O4'" . DG  C 2   ? 0.8449 0.3065 0.3105 0.0741  -0.2497 -0.0491 2   DG  P "O4'" 
3659 C "C3'" . DG  C 2   ? 0.8378 0.2850 0.3123 0.0850  -0.2848 -0.0483 2   DG  P "C3'" 
3660 O "O3'" . DG  C 2   ? 0.8208 0.3112 0.3602 0.1042  -0.3106 -0.0592 2   DG  P "O3'" 
3661 C "C2'" . DG  C 2   ? 0.7533 0.2534 0.2620 0.0780  -0.2387 -0.0459 2   DG  P "C2'" 
3662 C "C1'" . DG  C 2   ? 0.7470 0.2681 0.2700 0.0767  -0.2257 -0.0485 2   DG  P "C1'" 
3663 N N9    . DG  C 2   ? 0.7735 0.3075 0.2928 0.0633  -0.1841 -0.0455 2   DG  P N9    
3664 C C8    . DG  C 2   ? 0.8927 0.3863 0.3559 0.0466  -0.1604 -0.0411 2   DG  P C8    
3665 N N7    . DG  C 2   ? 0.8566 0.3780 0.3407 0.0387  -0.1245 -0.0427 2   DG  P N7    
3666 C C5    . DG  C 2   ? 0.7065 0.2864 0.2613 0.0501  -0.1273 -0.0461 2   DG  P C5    
3667 C C6    . DG  C 2   ? 0.7148 0.3414 0.3213 0.0481  -0.1027 -0.0480 2   DG  P C6    
3668 O O6    . DG  C 2   ? 0.6758 0.3036 0.2815 0.0376  -0.0719 -0.0501 2   DG  P O6    
3669 N N1    . DG  C 2   ? 0.6507 0.3265 0.3174 0.0587  -0.1183 -0.0478 2   DG  P N1    
3670 C C2    . DG  C 2   ? 0.5665 0.2510 0.2463 0.0704  -0.1497 -0.0484 2   DG  P C2    
3671 N N2    . DG  C 2   ? 0.5315 0.2697 0.2720 0.0762  -0.1573 -0.0478 2   DG  P N2    
3672 N N3    . DG  C 2   ? 0.6574 0.3006 0.2959 0.0749  -0.1731 -0.0498 2   DG  P N3    
3673 C C4    . DG  C 2   ? 0.7161 0.3061 0.2916 0.0641  -0.1619 -0.0473 2   DG  P C4    
3674 P P     . DC  C 3   ? 0.8776 0.4035 0.4688 0.1177  -0.3231 -0.0675 3   DC  P P     
3675 O OP1   . DC  C 3   ? 0.8227 0.3641 0.4573 0.1357  -0.3612 -0.0813 3   DC  P OP1   
3676 O OP2   . DC  C 3   ? 1.0259 0.5001 0.5670 0.1087  -0.3254 -0.0594 3   DC  P OP2   
3677 O "O5'" . DC  C 3   ? 0.7663 0.3730 0.4182 0.1173  -0.2839 -0.0686 3   DC  P "O5'" 
3678 C "C5'" . DC  C 3   ? 0.7556 0.4226 0.4640 0.1233  -0.2787 -0.0741 3   DC  P "C5'" 
3679 C "C4'" . DC  C 3   ? 0.6336 0.3603 0.3802 0.1165  -0.2410 -0.0696 3   DC  P "C4'" 
3680 O "O4'" . DC  C 3   ? 0.6376 0.3365 0.3444 0.1011  -0.2132 -0.0584 3   DC  P "O4'" 
3681 C "C3'" . DC  C 3   ? 0.6165 0.3791 0.3935 0.1205  -0.2322 -0.0740 3   DC  P "C3'" 
3682 O "O3'" . DC  C 3   ? 0.6201 0.4556 0.4612 0.1269  -0.2296 -0.0818 3   DC  P "O3'" 
3683 C "C2'" . DC  C 3   ? 0.6110 0.3682 0.3687 0.1058  -0.1980 -0.0621 3   DC  P "C2'" 
3684 C "C1'" . DC  C 3   ? 0.5589 0.3023 0.2985 0.0961  -0.1851 -0.0550 3   DC  P "C1'" 
3685 N N1    . DC  C 3   ? 0.6321 0.3425 0.3326 0.0812  -0.1578 -0.0465 3   DC  P N1    
3686 C C2    . DC  C 3   ? 0.5752 0.3176 0.3032 0.0733  -0.1315 -0.0427 3   DC  P C2    
3687 O O2    . DC  C 3   ? 0.5707 0.3641 0.3492 0.0772  -0.1333 -0.0431 3   DC  P O2    
3688 N N3    . DC  C 3   ? 0.5932 0.3107 0.2943 0.0605  -0.1053 -0.0390 3   DC  P N3    
3689 C C4    . DC  C 3   ? 0.6430 0.3065 0.2866 0.0530  -0.1025 -0.0371 3   DC  P C4    
3690 N N4    . DC  C 3   ? 0.6283 0.2742 0.2503 0.0388  -0.0727 -0.0354 3   DC  P N4    
3691 C C5    . DC  C 3   ? 0.6907 0.3165 0.2992 0.0587  -0.1312 -0.0373 3   DC  P C5    
3692 C C6    . DC  C 3   ? 0.7151 0.3652 0.3560 0.0740  -0.1594 -0.0430 3   DC  P C6    
3693 P P     . DG  C 4   ? 0.5765 0.4675 0.4617 0.1331  -0.2226 -0.0918 4   DG  P P     
3694 O OP1   . DG  C 4   ? 0.6509 0.5866 0.5844 0.1461  -0.2419 -0.1091 4   DG  P OP1   
3695 O OP2   . DG  C 4   ? 0.6253 0.4749 0.4778 0.1333  -0.2241 -0.0911 4   DG  P OP2   
3696 O "O5'" . DG  C 4   ? 0.4783 0.4195 0.3884 0.1198  -0.1894 -0.0805 4   DG  P "O5'" 
3697 C "C5'" . DG  C 4   ? 0.4684 0.4301 0.3940 0.1124  -0.1830 -0.0724 4   DG  P "C5'" 
3698 C "C4'" . DG  C 4   ? 0.4048 0.3979 0.3467 0.0987  -0.1555 -0.0597 4   DG  P "C4'" 
3699 O "O4'" . DG  C 4   ? 0.4663 0.4100 0.3696 0.0906  -0.1416 -0.0505 4   DG  P "O4'" 
3700 C "C3'" . DG  C 4   ? 0.4123 0.4475 0.3780 0.0980  -0.1444 -0.0630 4   DG  P "C3'" 
3701 O "O3'" . DG  C 4   ? 0.3405 0.4299 0.3417 0.0868  -0.1314 -0.0543 4   DG  P "O3'" 
3702 C "C2'" . DG  C 4   ? 0.4296 0.4222 0.3626 0.0933  -0.1314 -0.0568 4   DG  P "C2'" 
3703 C "C1'" . DG  C 4   ? 0.4471 0.4037 0.3571 0.0845  -0.1227 -0.0461 4   DG  P "C1'" 
3704 N N9    . DG  C 4   ? 0.5017 0.4003 0.3662 0.0807  -0.1151 -0.0433 4   DG  P N9    
3705 C C8    . DG  C 4   ? 0.5275 0.3803 0.3537 0.0864  -0.1289 -0.0483 4   DG  P C8    
3706 N N7    . DG  C 4   ? 0.5663 0.3725 0.3524 0.0769  -0.1159 -0.0422 4   DG  P N7    
3707 C C5    . DG  C 4   ? 0.4915 0.3163 0.2956 0.0666  -0.0912 -0.0358 4   DG  P C5    
3708 C C6    . DG  C 4   ? 0.5192 0.3170 0.3027 0.0538  -0.0668 -0.0311 4   DG  P C6    
3709 O O6    . DG  C 4   ? 0.5842 0.3354 0.3230 0.0466  -0.0597 -0.0296 4   DG  P O6    
3710 N N1    . DG  C 4   ? 0.4312 0.2624 0.2537 0.0482  -0.0504 -0.0284 4   DG  P N1    
3711 C C2    . DG  C 4   ? 0.4653 0.3458 0.3345 0.0518  -0.0581 -0.0267 4   DG  P C2    
3712 N N2    . DG  C 4   ? 0.4100 0.3119 0.3127 0.0442  -0.0447 -0.0225 4   DG  P N2    
3713 N N3    . DG  C 4   ? 0.4213 0.3287 0.3051 0.0609  -0.0782 -0.0293 4   DG  P N3    
3714 C C4    . DG  C 4   ? 0.4529 0.3317 0.3049 0.0690  -0.0930 -0.0355 4   DG  P C4    
3715 P P     . DT  C 5   ? 0.4012 0.5423 0.4274 0.0821  -0.1199 -0.0560 5   DT  P P     
3716 O OP1   . DT  C 5   ? 0.4494 0.6520 0.5117 0.0735  -0.1187 -0.0529 5   DT  P OP1   
3717 O OP2   . DT  C 5   ? 0.4777 0.6080 0.4938 0.0953  -0.1278 -0.0723 5   DT  P OP2   
3718 O "O5'" . DT  C 5   ? 0.3793 0.5029 0.3972 0.0697  -0.1021 -0.0403 5   DT  P "O5'" 
3719 C "C5'" . DT  C 5   ? 0.3391 0.4629 0.3674 0.0581  -0.0960 -0.0258 5   DT  P "C5'" 
3720 C "C4'" . DT  C 5   ? 0.3883 0.4908 0.4124 0.0499  -0.0807 -0.0167 5   DT  P "C4'" 
3721 O "O4'" . DT  C 5   ? 0.4275 0.4742 0.4152 0.0560  -0.0771 -0.0220 5   DT  P "O4'" 
3722 C "C3'" . DT  C 5   ? 0.3666 0.4975 0.4043 0.0456  -0.0744 -0.0156 5   DT  P "C3'" 
3723 O "O3'" . DT  C 5   ? 0.3835 0.5382 0.4484 0.0310  -0.0695 -0.0010 5   DT  P "O3'" 
3724 C "C2'" . DT  C 5   ? 0.3784 0.4650 0.3914 0.0501  -0.0668 -0.0196 5   DT  P "C2'" 
3725 C "C1'" . DT  C 5   ? 0.3806 0.4193 0.3692 0.0508  -0.0635 -0.0186 5   DT  P "C1'" 
3726 N N1    . DT  C 5   ? 0.3668 0.3543 0.3157 0.0561  -0.0619 -0.0246 5   DT  P N1    
3727 C C2    . DT  C 5   ? 0.3180 0.2703 0.2523 0.0481  -0.0451 -0.0204 5   DT  P C2    
3728 O O2    . DT  C 5   ? 0.3505 0.3122 0.3081 0.0395  -0.0323 -0.0147 5   DT  P O2    
3729 N N3    . DT  C 5   ? 0.4524 0.3582 0.3455 0.0497  -0.0446 -0.0239 5   DT  P N3    
3730 C C4    . DT  C 5   ? 0.4822 0.3689 0.3496 0.0594  -0.0631 -0.0303 5   DT  P C4    
3731 O O4    . DT  C 5   ? 0.6079 0.4477 0.4364 0.0575  -0.0642 -0.0303 5   DT  P O4    
3732 C C5    . DT  C 5   ? 0.5015 0.4275 0.3925 0.0705  -0.0816 -0.0376 5   DT  P C5    
3733 C C7    . DT  C 5   ? 0.5894 0.5008 0.4652 0.0836  -0.1051 -0.0490 5   DT  P C7    
3734 C C6    . DT  C 5   ? 0.3877 0.3633 0.3167 0.0675  -0.0779 -0.0346 5   DT  P C6    
3735 P P     . DC  C 6   ? 0.3543 0.5423 0.4366 0.0213  -0.0663 0.0050  6   DC  P P     
3736 O OP1   . DC  C 6   ? 0.2993 0.5228 0.4077 0.0056  -0.0712 0.0201  6   DC  P OP1   
3737 O OP2   . DC  C 6   ? 0.3458 0.5475 0.4154 0.0311  -0.0686 -0.0096 6   DC  P OP2   
3738 O "O5'" . DC  C 6   ? 0.2955 0.4468 0.3788 0.0185  -0.0556 0.0096  6   DC  P "O5'" 
3739 C "C5'" . DC  C 6   ? 0.2342 0.3604 0.3276 0.0138  -0.0502 0.0157  6   DC  P "C5'" 
3740 C "C4'" . DC  C 6   ? 0.1727 0.2658 0.2650 0.0135  -0.0366 0.0135  6   DC  P "C4'" 
3741 O "O4'" . DC  C 6   ? 0.2086 0.2658 0.2630 0.0235  -0.0309 0.0026  6   DC  P "O4'" 
3742 C "C3'" . DC  C 6   ? 0.1490 0.2578 0.2575 0.0083  -0.0364 0.0173  6   DC  P "C3'" 
3743 O "O3'" . DC  C 6   ? 0.1264 0.2294 0.2685 -0.0012 -0.0315 0.0247  6   DC  P "O3'" 
3744 C "C2'" . DC  C 6   ? 0.1806 0.2615 0.2613 0.0170  -0.0297 0.0071  6   DC  P "C2'" 
3745 C "C1'" . DC  C 6   ? 0.1878 0.2298 0.2412 0.0220  -0.0220 0.0013  6   DC  P "C1'" 
3746 N N1    . DC  C 6   ? 0.2416 0.2554 0.2553 0.0317  -0.0247 -0.0078 6   DC  P N1    
3747 C C2    . DC  C 6   ? 0.2277 0.1973 0.2171 0.0295  -0.0123 -0.0099 6   DC  P C2    
3748 O O2    . DC  C 6   ? 0.2510 0.2110 0.2561 0.0205  0.0043  -0.0069 6   DC  P O2    
3749 N N3    . DC  C 6   ? 0.2671 0.2062 0.2182 0.0362  -0.0194 -0.0155 6   DC  P N3    
3750 C C4    . DC  C 6   ? 0.2581 0.2105 0.2015 0.0474  -0.0387 -0.0221 6   DC  P C4    
3751 N N4    . DC  C 6   ? 0.3066 0.2241 0.2161 0.0541  -0.0498 -0.0279 6   DC  P N4    
3752 C C5    . DC  C 6   ? 0.2739 0.2766 0.2456 0.0508  -0.0480 -0.0235 6   DC  P C5    
3753 C C6    . DC  C 6   ? 0.2181 0.2490 0.2209 0.0413  -0.0402 -0.0147 6   DC  P C6    
3754 P P     . DA  C 7   ? 0.1282 0.2460 0.2993 -0.0100 -0.0357 0.0323  7   DA  P P     
3755 O OP1   . DA  C 7   ? 0.1483 0.2690 0.3626 -0.0204 -0.0403 0.0417  7   DA  P OP1   
3756 O OP2   . DA  C 7   ? 0.1562 0.3058 0.3138 -0.0107 -0.0473 0.0340  7   DA  P OP2   
3757 O "O5'" . DA  C 7   ? 0.1076 0.1942 0.2710 -0.0054 -0.0211 0.0236  7   DA  P "O5'" 
3758 C "C5'" . DA  C 7   ? 0.1120 0.1708 0.2896 -0.0073 -0.0048 0.0194  7   DA  P "C5'" 
3759 C "C4'" . DA  C 7   ? 0.1751 0.2094 0.3387 -0.0054 0.0078  0.0131  7   DA  P "C4'" 
3760 O "O4'" . DA  C 7   ? 0.1800 0.1963 0.2932 0.0034  0.0080  0.0069  7   DA  P "O4'" 
3761 C "C3'" . DA  C 7   ? 0.1377 0.1858 0.3171 -0.0078 -0.0020 0.0172  7   DA  P "C3'" 
3762 O "O3'" . DA  C 7   ? 0.1325 0.1707 0.3517 -0.0152 0.0079  0.0176  7   DA  P "O3'" 
3763 C "C2'" . DA  C 7   ? 0.1557 0.1887 0.2928 0.0009  -0.0031 0.0103  7   DA  P "C2'" 
3764 C "C1'" . DA  C 7   ? 0.1897 0.1930 0.2923 0.0047  0.0088  0.0046  7   DA  P "C1'" 
3765 N N9    . DA  C 7   ? 0.1826 0.1752 0.2421 0.0149  -0.0010 -0.0013 7   DA  P N9    
3766 C C8    . DA  C 7   ? 0.2070 0.2255 0.2571 0.0232  -0.0179 -0.0046 7   DA  P C8    
3767 N N7    . DA  C 7   ? 0.2443 0.2440 0.2609 0.0330  -0.0259 -0.0128 7   DA  P N7    
3768 C C5    . DA  C 7   ? 0.2178 0.1731 0.2143 0.0288  -0.0143 -0.0117 7   DA  P C5    
3769 C C6    . DA  C 7   ? 0.3315 0.2451 0.2879 0.0324  -0.0186 -0.0154 7   DA  P C6    
3770 N N6    . DA  C 7   ? 0.3573 0.2669 0.2922 0.0447  -0.0389 -0.0235 7   DA  P N6    
3771 N N1    . DA  C 7   ? 0.3665 0.2427 0.3076 0.0216  -0.0022 -0.0108 7   DA  P N1    
3772 C C2    . DA  C 7   ? 0.3117 0.1957 0.2824 0.0103  0.0187  -0.0064 7   DA  P C2    
3773 N N3    . DA  C 7   ? 0.2355 0.1564 0.2511 0.0083  0.0220  -0.0043 7   DA  P N3    
3774 C C4    . DA  C 7   ? 0.2111 0.1642 0.2337 0.0172  0.0037  -0.0055 7   DA  P C4    
3775 P P     . DT  C 8   ? 0.1325 0.1772 0.3768 -0.0192 -0.0014 0.0213  8   DT  P P     
3776 O OP1   . DT  C 8   ? 0.1561 0.2033 0.4587 -0.0279 0.0007  0.0240  8   DT  P OP1   
3777 O OP2   . DT  C 8   ? 0.1378 0.2072 0.3635 -0.0166 -0.0221 0.0255  8   DT  P OP2   
3778 O "O5'" . DT  C 8   ? 0.1660 0.1815 0.3838 -0.0160 0.0118  0.0143  8   DT  P "O5'" 
3779 C "C5'" A DT  C 8   ? 0.2111 0.2004 0.4304 -0.0205 0.0360  0.0091  8   DT  P "C5'" 
3780 C "C5'" B DT  C 8   ? 0.2331 0.2224 0.4551 -0.0210 0.0356  0.0093  8   DT  P "C5'" 
3781 C "C4'" A DT  C 8   ? 0.2597 0.2203 0.4381 -0.0188 0.0413  0.0063  8   DT  P "C4'" 
3782 C "C4'" B DT  C 8   ? 0.2777 0.2388 0.4581 -0.0189 0.0403  0.0066  8   DT  P "C4'" 
3783 O "O4'" A DT  C 8   ? 0.2964 0.2501 0.4231 -0.0092 0.0321  0.0041  8   DT  P "O4'" 
3784 O "O4'" B DT  C 8   ? 0.3046 0.2568 0.4325 -0.0099 0.0334  0.0041  8   DT  P "O4'" 
3785 C "C3'" A DT  C 8   ? 0.3237 0.2866 0.5098 -0.0173 0.0260  0.0084  8   DT  P "C3'" 
3786 C "C3'" B DT  C 8   ? 0.3301 0.2945 0.5117 -0.0156 0.0225  0.0083  8   DT  P "C3'" 
3787 O "O3'" A DT  C 8   ? 0.3577 0.3084 0.5769 -0.0268 0.0376  0.0092  8   DT  P "O3'" 
3788 O "O3'" B DT  C 8   ? 0.3622 0.3274 0.5903 -0.0239 0.0252  0.0108  8   DT  P "O3'" 
3789 C "C2'" A DT  C 8   ? 0.3555 0.2963 0.4885 -0.0094 0.0184  0.0050  8   DT  P "C2'" 
3790 C "C2'" B DT  C 8   ? 0.3811 0.3142 0.5114 -0.0112 0.0227  0.0051  8   DT  P "C2'" 
3791 C "C1'" A DT  C 8   ? 0.3331 0.2649 0.4303 -0.0059 0.0250  0.0026  8   DT  P "C1'" 
3792 C "C1'" B DT  C 8   ? 0.3343 0.2643 0.4304 -0.0062 0.0259  0.0026  8   DT  P "C1'" 
3793 N N1    . DT  C 8   ? 0.2847 0.2252 0.3514 0.0071  0.0042  -0.0017 8   DT  P N1    
3794 C C2    . DT  C 8   ? 0.3035 0.2127 0.3275 0.0125  -0.0022 -0.0055 8   DT  P C2    
3795 O O2    . DT  C 8   ? 0.3679 0.2405 0.3720 0.0046  0.0089  -0.0027 8   DT  P O2    
3796 N N3    . DT  C 8   ? 0.2846 0.2072 0.2916 0.0258  -0.0226 -0.0130 8   DT  P N3    
3797 C C4    . DT  C 8   ? 0.2480 0.2144 0.2726 0.0322  -0.0332 -0.0169 8   DT  P C4    
3798 O O4    . DT  C 8   ? 0.3427 0.3218 0.3530 0.0439  -0.0487 -0.0267 8   DT  P O4    
3799 C C5    . DT  C 8   ? 0.2204 0.2154 0.2820 0.0231  -0.0257 -0.0092 8   DT  P C5    
3800 C C7    . DT  C 8   ? 0.3785 0.4196 0.4551 0.0246  -0.0369 -0.0095 8   DT  P C7    
3801 C C6    . DT  C 8   ? 0.2292 0.2089 0.3122 0.0121  -0.0096 -0.0022 8   DT  P C6    
3802 P P     A DA  C 9   ? 0.3127 0.2584 0.5407 -0.0263 0.0219  0.0109  9   DA  P P     
3803 P P     B DA  C 9   ? 0.4361 0.3723 0.6725 -0.0343 0.0474  0.0095  9   DA  P P     
3804 O OP1   A DA  C 9   ? 0.3491 0.2937 0.6319 -0.0375 0.0327  0.0126  9   DA  P OP1   
3805 O OP1   B DA  C 9   ? 0.3446 0.2701 0.5731 -0.0405 0.0740  0.0054  9   DA  P OP1   
3806 O OP2   A DA  C 9   ? 0.2826 0.2523 0.5016 -0.0166 -0.0043 0.0107  9   DA  P OP2   
3807 O OP2   B DA  C 9   ? 0.4397 0.3845 0.7304 -0.0403 0.0419  0.0117  9   DA  P OP2   
3808 O "O5'" A DA  C 9   ? 0.3283 0.2377 0.5063 -0.0253 0.0259  0.0094  9   DA  P "O5'" 
3809 O "O5'" B DA  C 9   ? 0.4032 0.3115 0.5859 -0.0296 0.0388  0.0095  9   DA  P "O5'" 
3810 C "C5'" A DA  C 9   ? 0.3704 0.2511 0.5366 -0.0373 0.0513  0.0106  9   DA  P "C5'" 
3811 C "C5'" B DA  C 9   ? 0.3872 0.2625 0.5519 -0.0406 0.0583  0.0108  9   DA  P "C5'" 
3812 C "C4'" . DA  C 9   ? 0.3187 0.1641 0.4399 -0.0370 0.0423  0.0128  9   DA  P "C4'" 
3813 O "O4'" . DA  C 9   ? 0.3118 0.1561 0.3893 -0.0229 0.0247  0.0089  9   DA  P "O4'" 
3814 C "C3'" . DA  C 9   ? 0.4018 0.2489 0.5464 -0.0340 0.0215  0.0135  9   DA  P "C3'" 
3815 O "O3'" . DA  C 9   ? 0.3862 0.2024 0.5309 -0.0477 0.0308  0.0192  9   DA  P "O3'" 
3816 C "C2'" . DA  C 9   ? 0.4597 0.3054 0.5677 -0.0172 -0.0071 0.0077  9   DA  P "C2'" 
3817 C "C1'" . DA  C 9   ? 0.3777 0.2122 0.4404 -0.0133 -0.0015 0.0062  9   DA  P "C1'" 
3818 N N9    . DA  C 9   ? 0.2885 0.1485 0.3393 0.0034  -0.0207 -0.0023 9   DA  P N9    
3819 C C8    . DA  C 9   ? 0.2519 0.1529 0.3253 0.0078  -0.0214 -0.0044 9   DA  P C8    
3820 N N7    . DA  C 9   ? 0.2575 0.1772 0.3132 0.0211  -0.0379 -0.0128 9   DA  P N7    
3821 C C5    . DA  C 9   ? 0.2975 0.1856 0.3205 0.0282  -0.0510 -0.0183 9   DA  P C5    
3822 C C6    . DA  C 9   ? 0.4229 0.3122 0.4225 0.0436  -0.0720 -0.0308 9   DA  P C6    
3823 N N6    . DA  C 9   ? 0.3594 0.2888 0.3639 0.0540  -0.0796 -0.0406 9   DA  P N6    
3824 N N1    . DA  C 9   ? 0.4885 0.3360 0.4621 0.0470  -0.0858 -0.0331 9   DA  P N1    
3825 C C2    . DA  C 9   ? 0.4991 0.3073 0.4657 0.0331  -0.0771 -0.0213 9   DA  P C2    
3826 N N3    . DA  C 9   ? 0.3642 0.1715 0.3509 0.0167  -0.0534 -0.0097 9   DA  P N3    
3827 C C4    . DA  C 9   ? 0.3051 0.1538 0.3221 0.0166  -0.0420 -0.0101 9   DA  P C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   ?   ?   ?   T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DG  12  12  12  DG  DG  T . n 
C 3 1   DT  1   1   1   DT  DT  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   502  501 MG  MG  A . 
E 5 CA  1   503  502 CA  CA  A . 
F 4 MG  1   504  502 MG  MG  A . 
G 6 GOL 1   505  436 GOL GOL A . 
H 6 GOL 1   506  438 GOL GOL A . 
I 7 DTP 1   501  10  DTP DTP P . 
J 8 HOH 1   601  1   HOH HOH A . 
J 8 HOH 2   602  2   HOH HOH A . 
J 8 HOH 3   603  3   HOH HOH A . 
J 8 HOH 4   604  4   HOH HOH A . 
J 8 HOH 5   605  5   HOH HOH A . 
J 8 HOH 6   606  6   HOH HOH A . 
J 8 HOH 7   607  7   HOH HOH A . 
J 8 HOH 8   608  8   HOH HOH A . 
J 8 HOH 9   609  9   HOH HOH A . 
J 8 HOH 10  610  10  HOH HOH A . 
J 8 HOH 11  611  11  HOH HOH A . 
J 8 HOH 12  612  12  HOH HOH A . 
J 8 HOH 13  613  13  HOH HOH A . 
J 8 HOH 14  614  14  HOH HOH A . 
J 8 HOH 15  615  15  HOH HOH A . 
J 8 HOH 16  616  16  HOH HOH A . 
J 8 HOH 17  617  17  HOH HOH A . 
J 8 HOH 18  618  19  HOH HOH A . 
J 8 HOH 19  619  21  HOH HOH A . 
J 8 HOH 20  620  22  HOH HOH A . 
J 8 HOH 21  621  23  HOH HOH A . 
J 8 HOH 22  622  24  HOH HOH A . 
J 8 HOH 23  623  25  HOH HOH A . 
J 8 HOH 24  624  26  HOH HOH A . 
J 8 HOH 25  625  27  HOH HOH A . 
J 8 HOH 26  626  28  HOH HOH A . 
J 8 HOH 27  627  29  HOH HOH A . 
J 8 HOH 28  628  30  HOH HOH A . 
J 8 HOH 29  629  31  HOH HOH A . 
J 8 HOH 30  630  32  HOH HOH A . 
J 8 HOH 31  631  33  HOH HOH A . 
J 8 HOH 32  632  34  HOH HOH A . 
J 8 HOH 33  633  35  HOH HOH A . 
J 8 HOH 34  634  36  HOH HOH A . 
J 8 HOH 35  635  37  HOH HOH A . 
J 8 HOH 36  636  38  HOH HOH A . 
J 8 HOH 37  637  39  HOH HOH A . 
J 8 HOH 38  638  40  HOH HOH A . 
J 8 HOH 39  639  41  HOH HOH A . 
J 8 HOH 40  640  42  HOH HOH A . 
J 8 HOH 41  641  43  HOH HOH A . 
J 8 HOH 42  642  44  HOH HOH A . 
J 8 HOH 43  643  45  HOH HOH A . 
J 8 HOH 44  644  46  HOH HOH A . 
J 8 HOH 45  645  47  HOH HOH A . 
J 8 HOH 46  646  48  HOH HOH A . 
J 8 HOH 47  647  49  HOH HOH A . 
J 8 HOH 48  648  50  HOH HOH A . 
J 8 HOH 49  649  51  HOH HOH A . 
J 8 HOH 50  650  52  HOH HOH A . 
J 8 HOH 51  651  53  HOH HOH A . 
J 8 HOH 52  652  55  HOH HOH A . 
J 8 HOH 53  653  56  HOH HOH A . 
J 8 HOH 54  654  57  HOH HOH A . 
J 8 HOH 55  655  58  HOH HOH A . 
J 8 HOH 56  656  59  HOH HOH A . 
J 8 HOH 57  657  60  HOH HOH A . 
J 8 HOH 58  658  61  HOH HOH A . 
J 8 HOH 59  659  62  HOH HOH A . 
J 8 HOH 60  660  65  HOH HOH A . 
J 8 HOH 61  661  66  HOH HOH A . 
J 8 HOH 62  662  67  HOH HOH A . 
J 8 HOH 63  663  70  HOH HOH A . 
J 8 HOH 64  664  71  HOH HOH A . 
J 8 HOH 65  665  72  HOH HOH A . 
J 8 HOH 66  666  73  HOH HOH A . 
J 8 HOH 67  667  74  HOH HOH A . 
J 8 HOH 68  668  75  HOH HOH A . 
J 8 HOH 69  669  76  HOH HOH A . 
J 8 HOH 70  670  77  HOH HOH A . 
J 8 HOH 71  671  79  HOH HOH A . 
J 8 HOH 72  672  80  HOH HOH A . 
J 8 HOH 73  673  82  HOH HOH A . 
J 8 HOH 74  674  83  HOH HOH A . 
J 8 HOH 75  675  84  HOH HOH A . 
J 8 HOH 76  676  85  HOH HOH A . 
J 8 HOH 77  677  87  HOH HOH A . 
J 8 HOH 78  678  88  HOH HOH A . 
J 8 HOH 79  679  89  HOH HOH A . 
J 8 HOH 80  680  90  HOH HOH A . 
J 8 HOH 81  681  91  HOH HOH A . 
J 8 HOH 82  682  92  HOH HOH A . 
J 8 HOH 83  683  93  HOH HOH A . 
J 8 HOH 84  684  94  HOH HOH A . 
J 8 HOH 85  685  95  HOH HOH A . 
J 8 HOH 86  686  96  HOH HOH A . 
J 8 HOH 87  687  97  HOH HOH A . 
J 8 HOH 88  688  99  HOH HOH A . 
J 8 HOH 89  689  100 HOH HOH A . 
J 8 HOH 90  690  102 HOH HOH A . 
J 8 HOH 91  691  103 HOH HOH A . 
J 8 HOH 92  692  105 HOH HOH A . 
J 8 HOH 93  693  106 HOH HOH A . 
J 8 HOH 94  694  107 HOH HOH A . 
J 8 HOH 95  695  108 HOH HOH A . 
J 8 HOH 96  696  110 HOH HOH A . 
J 8 HOH 97  697  112 HOH HOH A . 
J 8 HOH 98  698  113 HOH HOH A . 
J 8 HOH 99  699  114 HOH HOH A . 
J 8 HOH 100 700  115 HOH HOH A . 
J 8 HOH 101 701  116 HOH HOH A . 
J 8 HOH 102 702  118 HOH HOH A . 
J 8 HOH 103 703  119 HOH HOH A . 
J 8 HOH 104 704  120 HOH HOH A . 
J 8 HOH 105 705  121 HOH HOH A . 
J 8 HOH 106 706  122 HOH HOH A . 
J 8 HOH 107 707  123 HOH HOH A . 
J 8 HOH 108 708  124 HOH HOH A . 
J 8 HOH 109 709  125 HOH HOH A . 
J 8 HOH 110 710  126 HOH HOH A . 
J 8 HOH 111 711  128 HOH HOH A . 
J 8 HOH 112 712  129 HOH HOH A . 
J 8 HOH 113 713  130 HOH HOH A . 
J 8 HOH 114 714  131 HOH HOH A . 
J 8 HOH 115 715  132 HOH HOH A . 
J 8 HOH 116 716  133 HOH HOH A . 
J 8 HOH 117 717  134 HOH HOH A . 
J 8 HOH 118 718  135 HOH HOH A . 
J 8 HOH 119 719  136 HOH HOH A . 
J 8 HOH 120 720  137 HOH HOH A . 
J 8 HOH 121 721  139 HOH HOH A . 
J 8 HOH 122 722  140 HOH HOH A . 
J 8 HOH 123 723  141 HOH HOH A . 
J 8 HOH 124 724  143 HOH HOH A . 
J 8 HOH 125 725  144 HOH HOH A . 
J 8 HOH 126 726  145 HOH HOH A . 
J 8 HOH 127 727  147 HOH HOH A . 
J 8 HOH 128 728  148 HOH HOH A . 
J 8 HOH 129 729  149 HOH HOH A . 
J 8 HOH 130 730  150 HOH HOH A . 
J 8 HOH 131 731  152 HOH HOH A . 
J 8 HOH 132 732  153 HOH HOH A . 
J 8 HOH 133 733  154 HOH HOH A . 
J 8 HOH 134 734  155 HOH HOH A . 
J 8 HOH 135 735  156 HOH HOH A . 
J 8 HOH 136 736  157 HOH HOH A . 
J 8 HOH 137 737  158 HOH HOH A . 
J 8 HOH 138 738  159 HOH HOH A . 
J 8 HOH 139 739  160 HOH HOH A . 
J 8 HOH 140 740  161 HOH HOH A . 
J 8 HOH 141 741  162 HOH HOH A . 
J 8 HOH 142 742  163 HOH HOH A . 
J 8 HOH 143 743  164 HOH HOH A . 
J 8 HOH 144 744  165 HOH HOH A . 
J 8 HOH 145 745  166 HOH HOH A . 
J 8 HOH 146 746  167 HOH HOH A . 
J 8 HOH 147 747  168 HOH HOH A . 
J 8 HOH 148 748  169 HOH HOH A . 
J 8 HOH 149 749  170 HOH HOH A . 
J 8 HOH 150 750  171 HOH HOH A . 
J 8 HOH 151 751  172 HOH HOH A . 
J 8 HOH 152 752  173 HOH HOH A . 
J 8 HOH 153 753  174 HOH HOH A . 
J 8 HOH 154 754  176 HOH HOH A . 
J 8 HOH 155 755  177 HOH HOH A . 
J 8 HOH 156 756  178 HOH HOH A . 
J 8 HOH 157 757  179 HOH HOH A . 
J 8 HOH 158 758  180 HOH HOH A . 
J 8 HOH 159 759  181 HOH HOH A . 
J 8 HOH 160 760  182 HOH HOH A . 
J 8 HOH 161 761  183 HOH HOH A . 
J 8 HOH 162 762  184 HOH HOH A . 
J 8 HOH 163 763  186 HOH HOH A . 
J 8 HOH 164 764  187 HOH HOH A . 
J 8 HOH 165 765  188 HOH HOH A . 
J 8 HOH 166 766  189 HOH HOH A . 
J 8 HOH 167 767  190 HOH HOH A . 
J 8 HOH 168 768  191 HOH HOH A . 
J 8 HOH 169 769  193 HOH HOH A . 
J 8 HOH 170 770  196 HOH HOH A . 
J 8 HOH 171 771  197 HOH HOH A . 
J 8 HOH 172 772  198 HOH HOH A . 
J 8 HOH 173 773  199 HOH HOH A . 
J 8 HOH 174 774  200 HOH HOH A . 
J 8 HOH 175 775  201 HOH HOH A . 
J 8 HOH 176 776  202 HOH HOH A . 
J 8 HOH 177 777  203 HOH HOH A . 
J 8 HOH 178 778  204 HOH HOH A . 
J 8 HOH 179 779  205 HOH HOH A . 
J 8 HOH 180 780  206 HOH HOH A . 
J 8 HOH 181 781  208 HOH HOH A . 
J 8 HOH 182 782  209 HOH HOH A . 
J 8 HOH 183 783  211 HOH HOH A . 
J 8 HOH 184 784  212 HOH HOH A . 
J 8 HOH 185 785  213 HOH HOH A . 
J 8 HOH 186 786  215 HOH HOH A . 
J 8 HOH 187 787  216 HOH HOH A . 
J 8 HOH 188 788  217 HOH HOH A . 
J 8 HOH 189 789  218 HOH HOH A . 
J 8 HOH 190 790  219 HOH HOH A . 
J 8 HOH 191 791  220 HOH HOH A . 
J 8 HOH 192 792  221 HOH HOH A . 
J 8 HOH 193 793  222 HOH HOH A . 
J 8 HOH 194 794  223 HOH HOH A . 
J 8 HOH 195 795  224 HOH HOH A . 
J 8 HOH 196 796  225 HOH HOH A . 
J 8 HOH 197 797  226 HOH HOH A . 
J 8 HOH 198 798  227 HOH HOH A . 
J 8 HOH 199 799  228 HOH HOH A . 
J 8 HOH 200 800  229 HOH HOH A . 
J 8 HOH 201 801  230 HOH HOH A . 
J 8 HOH 202 802  231 HOH HOH A . 
J 8 HOH 203 803  232 HOH HOH A . 
J 8 HOH 204 804  233 HOH HOH A . 
J 8 HOH 205 805  234 HOH HOH A . 
J 8 HOH 206 806  235 HOH HOH A . 
J 8 HOH 207 807  236 HOH HOH A . 
J 8 HOH 208 808  237 HOH HOH A . 
J 8 HOH 209 809  238 HOH HOH A . 
J 8 HOH 210 810  239 HOH HOH A . 
J 8 HOH 211 811  240 HOH HOH A . 
J 8 HOH 212 812  241 HOH HOH A . 
J 8 HOH 213 813  243 HOH HOH A . 
J 8 HOH 214 814  244 HOH HOH A . 
J 8 HOH 215 815  245 HOH HOH A . 
J 8 HOH 216 816  246 HOH HOH A . 
J 8 HOH 217 817  247 HOH HOH A . 
J 8 HOH 218 818  248 HOH HOH A . 
J 8 HOH 219 819  249 HOH HOH A . 
J 8 HOH 220 820  250 HOH HOH A . 
J 8 HOH 221 821  252 HOH HOH A . 
J 8 HOH 222 822  254 HOH HOH A . 
J 8 HOH 223 823  255 HOH HOH A . 
J 8 HOH 224 824  257 HOH HOH A . 
J 8 HOH 225 825  258 HOH HOH A . 
J 8 HOH 226 826  259 HOH HOH A . 
J 8 HOH 227 827  260 HOH HOH A . 
J 8 HOH 228 828  261 HOH HOH A . 
J 8 HOH 229 829  263 HOH HOH A . 
J 8 HOH 230 830  264 HOH HOH A . 
J 8 HOH 231 831  265 HOH HOH A . 
J 8 HOH 232 832  266 HOH HOH A . 
J 8 HOH 233 833  267 HOH HOH A . 
J 8 HOH 234 834  268 HOH HOH A . 
J 8 HOH 235 835  271 HOH HOH A . 
J 8 HOH 236 836  272 HOH HOH A . 
J 8 HOH 237 837  273 HOH HOH A . 
J 8 HOH 238 838  275 HOH HOH A . 
J 8 HOH 239 839  277 HOH HOH A . 
J 8 HOH 240 840  278 HOH HOH A . 
J 8 HOH 241 841  279 HOH HOH A . 
J 8 HOH 242 842  280 HOH HOH A . 
J 8 HOH 243 843  283 HOH HOH A . 
J 8 HOH 244 844  284 HOH HOH A . 
J 8 HOH 245 845  285 HOH HOH A . 
J 8 HOH 246 846  286 HOH HOH A . 
J 8 HOH 247 847  287 HOH HOH A . 
J 8 HOH 248 848  288 HOH HOH A . 
J 8 HOH 249 849  290 HOH HOH A . 
J 8 HOH 250 850  291 HOH HOH A . 
J 8 HOH 251 851  293 HOH HOH A . 
J 8 HOH 252 852  294 HOH HOH A . 
J 8 HOH 253 853  296 HOH HOH A . 
J 8 HOH 254 854  297 HOH HOH A . 
J 8 HOH 255 855  300 HOH HOH A . 
J 8 HOH 256 856  301 HOH HOH A . 
J 8 HOH 257 857  302 HOH HOH A . 
J 8 HOH 258 858  303 HOH HOH A . 
J 8 HOH 259 859  304 HOH HOH A . 
J 8 HOH 260 860  306 HOH HOH A . 
J 8 HOH 261 861  307 HOH HOH A . 
J 8 HOH 262 862  308 HOH HOH A . 
J 8 HOH 263 863  309 HOH HOH A . 
J 8 HOH 264 864  310 HOH HOH A . 
J 8 HOH 265 865  311 HOH HOH A . 
J 8 HOH 266 866  312 HOH HOH A . 
J 8 HOH 267 867  313 HOH HOH A . 
J 8 HOH 268 868  314 HOH HOH A . 
J 8 HOH 269 869  316 HOH HOH A . 
J 8 HOH 270 870  317 HOH HOH A . 
J 8 HOH 271 871  318 HOH HOH A . 
J 8 HOH 272 872  319 HOH HOH A . 
J 8 HOH 273 873  320 HOH HOH A . 
J 8 HOH 274 874  321 HOH HOH A . 
J 8 HOH 275 875  323 HOH HOH A . 
J 8 HOH 276 876  324 HOH HOH A . 
J 8 HOH 277 877  325 HOH HOH A . 
J 8 HOH 278 878  326 HOH HOH A . 
J 8 HOH 279 879  327 HOH HOH A . 
J 8 HOH 280 880  328 HOH HOH A . 
J 8 HOH 281 881  329 HOH HOH A . 
J 8 HOH 282 882  330 HOH HOH A . 
J 8 HOH 283 883  331 HOH HOH A . 
J 8 HOH 284 884  332 HOH HOH A . 
J 8 HOH 285 885  333 HOH HOH A . 
J 8 HOH 286 886  334 HOH HOH A . 
J 8 HOH 287 887  335 HOH HOH A . 
J 8 HOH 288 888  336 HOH HOH A . 
J 8 HOH 289 889  337 HOH HOH A . 
J 8 HOH 290 890  338 HOH HOH A . 
J 8 HOH 291 891  339 HOH HOH A . 
J 8 HOH 292 892  341 HOH HOH A . 
J 8 HOH 293 893  344 HOH HOH A . 
J 8 HOH 294 894  347 HOH HOH A . 
J 8 HOH 295 895  348 HOH HOH A . 
J 8 HOH 296 896  351 HOH HOH A . 
J 8 HOH 297 897  352 HOH HOH A . 
J 8 HOH 298 898  354 HOH HOH A . 
J 8 HOH 299 899  355 HOH HOH A . 
J 8 HOH 300 900  356 HOH HOH A . 
J 8 HOH 301 901  357 HOH HOH A . 
J 8 HOH 302 902  358 HOH HOH A . 
J 8 HOH 303 903  359 HOH HOH A . 
J 8 HOH 304 904  360 HOH HOH A . 
J 8 HOH 305 905  361 HOH HOH A . 
J 8 HOH 306 906  362 HOH HOH A . 
J 8 HOH 307 907  364 HOH HOH A . 
J 8 HOH 308 908  365 HOH HOH A . 
J 8 HOH 309 909  366 HOH HOH A . 
J 8 HOH 310 910  368 HOH HOH A . 
J 8 HOH 311 911  369 HOH HOH A . 
J 8 HOH 312 912  371 HOH HOH A . 
J 8 HOH 313 913  372 HOH HOH A . 
J 8 HOH 314 914  374 HOH HOH A . 
J 8 HOH 315 915  375 HOH HOH A . 
J 8 HOH 316 916  376 HOH HOH A . 
J 8 HOH 317 917  377 HOH HOH A . 
J 8 HOH 318 918  378 HOH HOH A . 
J 8 HOH 319 919  380 HOH HOH A . 
J 8 HOH 320 920  381 HOH HOH A . 
J 8 HOH 321 921  382 HOH HOH A . 
J 8 HOH 322 922  383 HOH HOH A . 
J 8 HOH 323 923  384 HOH HOH A . 
J 8 HOH 324 924  385 HOH HOH A . 
J 8 HOH 325 925  386 HOH HOH A . 
J 8 HOH 326 926  387 HOH HOH A . 
J 8 HOH 327 927  388 HOH HOH A . 
J 8 HOH 328 928  389 HOH HOH A . 
J 8 HOH 329 929  390 HOH HOH A . 
J 8 HOH 330 930  391 HOH HOH A . 
J 8 HOH 331 931  392 HOH HOH A . 
J 8 HOH 332 932  395 HOH HOH A . 
J 8 HOH 333 933  396 HOH HOH A . 
J 8 HOH 334 934  397 HOH HOH A . 
J 8 HOH 335 935  398 HOH HOH A . 
J 8 HOH 336 936  399 HOH HOH A . 
J 8 HOH 337 937  401 HOH HOH A . 
J 8 HOH 338 938  402 HOH HOH A . 
J 8 HOH 339 939  403 HOH HOH A . 
J 8 HOH 340 940  404 HOH HOH A . 
J 8 HOH 341 941  406 HOH HOH A . 
J 8 HOH 342 942  407 HOH HOH A . 
J 8 HOH 343 943  408 HOH HOH A . 
J 8 HOH 344 944  409 HOH HOH A . 
J 8 HOH 345 945  411 HOH HOH A . 
J 8 HOH 346 946  412 HOH HOH A . 
J 8 HOH 347 947  413 HOH HOH A . 
J 8 HOH 348 948  415 HOH HOH A . 
J 8 HOH 349 949  416 HOH HOH A . 
J 8 HOH 350 950  417 HOH HOH A . 
J 8 HOH 351 951  418 HOH HOH A . 
J 8 HOH 352 952  421 HOH HOH A . 
J 8 HOH 353 953  422 HOH HOH A . 
J 8 HOH 354 954  423 HOH HOH A . 
J 8 HOH 355 955  425 HOH HOH A . 
J 8 HOH 356 956  426 HOH HOH A . 
J 8 HOH 357 957  428 HOH HOH A . 
J 8 HOH 358 958  429 HOH HOH A . 
J 8 HOH 359 959  433 HOH HOH A . 
J 8 HOH 360 960  434 HOH HOH A . 
J 8 HOH 361 961  435 HOH HOH A . 
J 8 HOH 362 962  436 HOH HOH A . 
J 8 HOH 363 963  437 HOH HOH A . 
J 8 HOH 364 964  438 HOH HOH A . 
J 8 HOH 365 965  441 HOH HOH A . 
J 8 HOH 366 966  442 HOH HOH A . 
J 8 HOH 367 967  443 HOH HOH A . 
J 8 HOH 368 968  444 HOH HOH A . 
J 8 HOH 369 969  446 HOH HOH A . 
J 8 HOH 370 970  447 HOH HOH A . 
J 8 HOH 371 971  448 HOH HOH A . 
J 8 HOH 372 972  449 HOH HOH A . 
J 8 HOH 373 973  451 HOH HOH A . 
J 8 HOH 374 974  453 HOH HOH A . 
J 8 HOH 375 975  454 HOH HOH A . 
J 8 HOH 376 976  455 HOH HOH A . 
J 8 HOH 377 977  456 HOH HOH A . 
J 8 HOH 378 978  457 HOH HOH A . 
J 8 HOH 379 979  458 HOH HOH A . 
J 8 HOH 380 980  459 HOH HOH A . 
J 8 HOH 381 981  460 HOH HOH A . 
J 8 HOH 382 982  461 HOH HOH A . 
J 8 HOH 383 983  464 HOH HOH A . 
J 8 HOH 384 984  465 HOH HOH A . 
J 8 HOH 385 985  466 HOH HOH A . 
J 8 HOH 386 986  467 HOH HOH A . 
J 8 HOH 387 987  468 HOH HOH A . 
J 8 HOH 388 988  471 HOH HOH A . 
J 8 HOH 389 989  474 HOH HOH A . 
J 8 HOH 390 990  475 HOH HOH A . 
J 8 HOH 391 991  477 HOH HOH A . 
J 8 HOH 392 992  478 HOH HOH A . 
J 8 HOH 393 993  480 HOH HOH A . 
J 8 HOH 394 994  481 HOH HOH A . 
J 8 HOH 395 995  482 HOH HOH A . 
J 8 HOH 396 996  483 HOH HOH A . 
J 8 HOH 397 997  484 HOH HOH A . 
J 8 HOH 398 998  485 HOH HOH A . 
J 8 HOH 399 999  486 HOH HOH A . 
J 8 HOH 400 1000 489 HOH HOH A . 
J 8 HOH 401 1001 490 HOH HOH A . 
J 8 HOH 402 1002 491 HOH HOH A . 
J 8 HOH 403 1003 492 HOH HOH A . 
J 8 HOH 404 1004 493 HOH HOH A . 
J 8 HOH 405 1005 494 HOH HOH A . 
J 8 HOH 406 1006 495 HOH HOH A . 
J 8 HOH 407 1007 496 HOH HOH A . 
J 8 HOH 408 1008 497 HOH HOH A . 
J 8 HOH 409 1009 498 HOH HOH A . 
J 8 HOH 410 1010 502 HOH HOH A . 
J 8 HOH 411 1011 503 HOH HOH A . 
J 8 HOH 412 1012 504 HOH HOH A . 
J 8 HOH 413 1013 506 HOH HOH A . 
J 8 HOH 414 1014 508 HOH HOH A . 
J 8 HOH 415 1015 510 HOH HOH A . 
J 8 HOH 416 1016 511 HOH HOH A . 
J 8 HOH 417 1017 512 HOH HOH A . 
J 8 HOH 418 1018 513 HOH HOH A . 
J 8 HOH 419 1019 514 HOH HOH A . 
J 8 HOH 420 1020 515 HOH HOH A . 
K 8 HOH 1   101  20  HOH HOH T . 
K 8 HOH 2   102  68  HOH HOH T . 
K 8 HOH 3   103  69  HOH HOH T . 
K 8 HOH 4   104  86  HOH HOH T . 
K 8 HOH 5   105  109 HOH HOH T . 
K 8 HOH 6   106  127 HOH HOH T . 
K 8 HOH 7   107  142 HOH HOH T . 
K 8 HOH 8   108  146 HOH HOH T . 
K 8 HOH 9   109  175 HOH HOH T . 
K 8 HOH 10  110  185 HOH HOH T . 
K 8 HOH 11  111  192 HOH HOH T . 
K 8 HOH 12  112  194 HOH HOH T . 
K 8 HOH 13  113  207 HOH HOH T . 
K 8 HOH 14  114  214 HOH HOH T . 
K 8 HOH 15  115  242 HOH HOH T . 
K 8 HOH 16  116  251 HOH HOH T . 
K 8 HOH 17  117  253 HOH HOH T . 
K 8 HOH 18  118  256 HOH HOH T . 
K 8 HOH 19  119  269 HOH HOH T . 
K 8 HOH 20  120  281 HOH HOH T . 
K 8 HOH 21  121  282 HOH HOH T . 
K 8 HOH 22  122  289 HOH HOH T . 
K 8 HOH 23  123  292 HOH HOH T . 
K 8 HOH 24  124  298 HOH HOH T . 
K 8 HOH 25  125  315 HOH HOH T . 
K 8 HOH 26  126  367 HOH HOH T . 
K 8 HOH 27  127  379 HOH HOH T . 
K 8 HOH 28  128  394 HOH HOH T . 
K 8 HOH 29  129  432 HOH HOH T . 
K 8 HOH 30  130  479 HOH HOH T . 
K 8 HOH 31  131  507 HOH HOH T . 
K 8 HOH 32  132  509 HOH HOH T . 
L 8 HOH 1   101  63  HOH HOH P . 
L 8 HOH 2   102  78  HOH HOH P . 
L 8 HOH 3   103  81  HOH HOH P . 
L 8 HOH 4   104  98  HOH HOH P . 
L 8 HOH 5   105  101 HOH HOH P . 
L 8 HOH 6   106  104 HOH HOH P . 
L 8 HOH 7   107  111 HOH HOH P . 
L 8 HOH 8   108  151 HOH HOH P . 
L 8 HOH 9   109  195 HOH HOH P . 
L 8 HOH 10  110  270 HOH HOH P . 
L 8 HOH 11  111  276 HOH HOH P . 
L 8 HOH 12  112  299 HOH HOH P . 
L 8 HOH 13  113  345 HOH HOH P . 
L 8 HOH 14  114  349 HOH HOH P . 
L 8 HOH 15  115  350 HOH HOH P . 
L 8 HOH 16  116  363 HOH HOH P . 
L 8 HOH 17  117  370 HOH HOH P . 
L 8 HOH 18  118  393 HOH HOH P . 
L 8 HOH 19  119  400 HOH HOH P . 
L 8 HOH 20  120  410 HOH HOH P . 
L 8 HOH 21  121  419 HOH HOH P . 
L 8 HOH 22  122  430 HOH HOH P . 
L 8 HOH 23  123  431 HOH HOH P . 
L 8 HOH 24  124  462 HOH HOH P . 
L 8 HOH 25  125  472 HOH HOH P . 
L 8 HOH 26  126  473 HOH HOH P . 
L 8 HOH 27  127  501 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5430  ? 
1 MORE         -59   ? 
1 'SSA (A^2)'  22640 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 102.8 ? 
2  OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 157.5 ? 
3  OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 96.0  ? 
4  OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 "O3'" ? C DA  9   ? P DA  9   ? 1_555 82.6  ? 
5  OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 "O3'" ? C DA  9   ? P DA  9   ? 1_555 173.4 ? 
6  O2A   ? I DTP .   ? P DTP 501 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 "O3'" ? C DA  9   ? P DA  9   ? 1_555 79.5  ? 
7  OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 102.0 ? 
8  OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 97.8  ? 
9  O2A   ? I DTP .   ? P DTP 501 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 87.4  ? 
10 "O3'" ? C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 77.3  ? 
11 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O     ? J HOH .   ? A HOH 601 ? 1_555 95.2  ? 
12 OD2   A A ASP 16  ? A ASP 13  ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O     ? J HOH .   ? A HOH 601 ? 1_555 79.7  ? 
13 O2A   ? I DTP .   ? P DTP 501 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O     ? J HOH .   ? A HOH 601 ? 1_555 75.9  ? 
14 "O3'" ? C DA  9   ? P DA  9   ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O     ? J HOH .   ? A HOH 601 ? 1_555 103.6 ? 
15 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? D MG . ? A MG 502 ? 1_555 O     ? J HOH .   ? A HOH 601 ? 1_555 162.7 ? 
16 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O3G   ? I DTP .   ? P DTP 501 ? 1_555 102.9 ? 
17 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 504 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 92.2  ? 
18 O3G   ? I DTP .   ? P DTP 501 ? 1_555 MG B F MG . ? A MG 504 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 164.9 ? 
19 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 83.9  ? 
20 O3G   ? I DTP .   ? P DTP 501 ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 98.0  ? 
21 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 82.9  ? 
22 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O1B   ? I DTP .   ? P DTP 501 ? 1_555 173.3 ? 
23 O3G   ? I DTP .   ? P DTP 501 ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O1B   ? I DTP .   ? P DTP 501 ? 1_555 79.8  ? 
24 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O1B   ? I DTP .   ? P DTP 501 ? 1_555 85.1  ? 
25 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O1B   ? I DTP .   ? P DTP 501 ? 1_555 89.7  ? 
26 OD1   B A ASP 16  ? A ASP 13  ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 103.1 ? 
27 O3G   ? I DTP .   ? P DTP 501 ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 86.8  ? 
28 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 90.4  ? 
29 O     ? A MET 17  ? A MET 14  ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 170.5 ? 
30 O1B   ? I DTP .   ? P DTP 501 ? 1_555 MG B F MG . ? A MG 504 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 83.0  ? 
31 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O3G   ? I DTP .   ? P DTP 501 ? 1_555 166.3 ? 
32 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O1B   ? I DTP .   ? P DTP 501 ? 1_555 86.3  ? 
33 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O1B   ? I DTP .   ? P DTP 501 ? 1_555 80.2  ? 
34 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 83.8  ? 
35 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 98.3  ? 
36 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 91.0  ? 
37 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 90.4  ? 
38 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 86.1  ? 
39 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 83.3  ? 
40 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 503 ? 1_555 O2A   ? I DTP .   ? P DTP 501 ? 1_555 172.1 ? 
41 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 115.5 ? 
42 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 78.0  ? 
43 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 152.5 ? 
44 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 75.9  ? 
45 O2A   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD1   A A ASP 16  ? A ASP 13  ? 1_555 111.5 ? 
46 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 88.2  ? 
47 O3G   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 103.7 ? 
48 O1B   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 158.6 ? 
49 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 109.0 ? 
50 O2A   ? I DTP .   ? P DTP 501 ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 76.1  ? 
51 OD1   A A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 503 ? 1_555 OD2   A A ASP 16  ? A ASP 13  ? 1_555 45.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 67.1441 -4.7428  -1.6629 0.0807 0.0571 0.0864 0.0052  0.0003  0.0197  0.9302 1.5677 0.7600 -0.5991 
-0.0271 -0.2931 0.0260  -0.0893 0.0698  0.0413  0.0155  -0.2398 -0.0806 0.0420  0.0585  
'X-RAY DIFFRACTION' 2 ? refined 48.7041 13.4468  11.4125 0.1164 0.0807 0.0620 0.0087  0.0087  -0.0006 0.5874 0.6168 0.6304 0.0253  
0.1548  -0.1665 0.0230  -0.0696 0.0350  -0.1051 0.0274  0.0533  0.0644  -0.1343 -0.0108 
'X-RAY DIFFRACTION' 3 ? refined 51.5573 -22.0455 6.3147  0.1185 0.1094 0.1045 0.0071  -0.0168 0.0049  0.6124 0.6645 0.6956 0.3305  
-0.0034 -0.1600 -0.0781 0.0291  0.0281  -0.0597 0.0368  0.0797  -0.0276 0.0939  -0.1263 
'X-RAY DIFFRACTION' 4 ? refined 30.5922 5.7223   -7.5675 0.1115 0.2456 0.2207 -0.0179 -0.0015 -0.0630 0.1939 2.2139 1.7752 0.1263  
0.4191  0.9425  0.0839  -0.3226 0.2362  -0.0130 0.1557  0.5256  -0.0746 0.0581  -0.5674 
'X-RAY DIFFRACTION' 5 ? refined 37.8078 -5.9506  -1.6874 0.2535 0.1889 0.1928 -0.0004 -0.0316 0.0064  0.6145 3.3597 0.2608 1.0857  
0.1220  0.9650  0.1818  -0.2216 -0.0066 -0.0618 -0.1480 0.0852  -0.2722 0.0036  -0.3246 
'X-RAY DIFFRACTION' 6 ? refined 36.5835 -8.2310  -3.3064 0.3100 0.1757 0.1758 0.0434  -0.0328 -0.0224 3.0800 3.9728 1.5121 1.2940  
2.0749  0.9937  -0.1762 -0.0135 0.1487  -0.0856 -0.0104 -0.1686 -0.9156 -0.4671 -0.1474 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A -2  A 15  '( CHAIN A AND  ( RESID -2:15 OR RESID 88:239 )  )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 A 88  A 239 '( CHAIN A AND  ( RESID -2:15 OR RESID 88:239 )  )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 A 16  A 87  '( CHAIN A AND RESID 16:87 )'                       ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 3 A 240 A 306 '( CHAIN A AND RESID 240:306 )'                     ? ? ? ? ? 
'X-RAY DIFFRACTION' 5 4 A 307 A 432 '( CHAIN A AND RESID 307:432 )'                     ? ? ? ? ? 
'X-RAY DIFFRACTION' 6 5 T 2   T 12  '( CHAIN T AND RESID 2:12 )'                        ? ? ? ? ? 
'X-RAY DIFFRACTION' 7 6 P 1   P 9   '( CHAIN P AND RESID 1:9 )'                         ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 2 
HKL-2000 'data reduction'  .                            ? 3 
HKL-2000 'data scaling'    .                            ? 4 
# 
_pdbx_entry_details.entry_id             4ED8 
_pdbx_entry_details.nonpolymer_details   'CA A 503 AND MG A 504 ARE IN ALTERNATE CONFORMATIONS OF EACH OTHER.' 
_pdbx_entry_details.sequence_details     ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DG 10 ? ? "C1'" T DG 10 ? ? N9    T DG 10 ? ? 102.62 108.00 -5.38 0.70 N 
2 1 "O4'" P DT 8  ? B "C4'" P DT 8  ? B "C3'" P DT 8  ? B 101.04 104.50 -3.46 0.40 N 
3 1 "O4'" P DT 8  ? A "C1'" P DT 8  ? A N1    P DT 8  ? ? 111.11 108.30 2.81  0.30 N 
4 1 "O4'" P DT 8  ? B "C1'" P DT 8  ? B N1    P DT 8  ? ? 112.04 108.30 3.74  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 24.43   66.49   
2 1 TYR A 39  ? ? 68.97   -176.50 
3 1 LYS A 40  ? ? -155.07 -27.18  
4 1 SER A 62  ? ? 83.74   -14.22  
5 1 SER A 217 ? ? -157.51 -158.43 
6 1 SER A 257 ? ? 97.30   -11.58  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
6 1 Y 1 T DC  1   ? B DC  1   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ED8 'double helix'        
4ED8 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 4  1_555 C DA 9 1_555 0.086  -0.122 -0.119 2.697   -5.093  4.837  1 T_DT4:DA9_P  T 4  ? P 9 ? 20 1 
1 B DA 5  1_555 C DT 8 1_555 -0.233 -0.078 -0.049 -12.558 -20.303 1.942  2 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 0.064  -0.121 -0.093 -8.890  -3.208  -2.250 3 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.135 -0.118 -0.113 0.682   -3.557  1.056  4 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 -0.129 -0.197 0.001  -0.016  -6.548  -0.193 5 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.163  -0.051 -0.187 3.478   -6.284  1.746  6 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.159 -0.109 0.061  0.700   -0.707  -0.081 7 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.170  -0.157 0.102  10.423  -3.949  -4.416 8 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 4  1_555 C DA 9 1_555 B DA 5  1_555 C DT 8 1_555 0.789  -1.279 3.611 1.724  7.130 27.057 -4.434 -1.197 3.217 14.896 -3.601 
28.016 1 TT_DT4DA5:DT8DA9_PP   T 4  ? P 9 ? T 5  ? P 8 ? 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 -0.552 -1.038 3.306 2.558  4.734 34.041 -2.477 1.322  3.089 8.023  -4.335 
34.451 2 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.060 -0.693 3.209 0.952  5.532 28.848 -2.510 0.315  3.023 10.974 -1.889 
29.378 3 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.406 -0.496 3.413 -1.131 1.233 35.590 -0.998 0.492  3.405 2.015  1.849  
35.628 4 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.064  -0.668 3.363 0.994  1.729 30.791 -1.600 0.077  3.321 3.252  -1.869 
30.854 5 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.343 -0.006 3.480 -3.620 3.740 36.717 -0.546 0.021  3.480 5.900  5.711  
37.072 6 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.543 -0.278 3.232 -1.482 4.104 28.170 -1.489 0.768  3.183 8.369  3.023  
28.499 7 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 water                               HOH 
#