data_4ENM
# 
_entry.id   4ENM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ENM         
NDB   NA1752       
RCSB  RCSB071842   
WWPDB D_1000071842 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4ENJ unspecified . 
PDB 4ENK unspecified . 
PDB 4ENN unspecified . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ENM 
_pdbx_database_status.recvd_initial_deposition_date   2012-04-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tubbs, J.L.'  1 
'Arvai, A.S.'  2 
'Tainer, J.A.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Atl1 Regulates Choice between Global Genome and Transcription-Coupled Repair of O(6)-Alkylguanines.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            47 
_citation.page_first                50 
_citation.page_last                 60 
_citation.year                      2012 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22658721 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2012.04.028 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Latypov, V.F.'          1  
primary 'Tubbs, J.L.'            2  
primary 'Watson, A.J.'           3  
primary 'Marriott, A.S.'         4  
primary 'McGown, G.'             5  
primary 'Thorncroft, M.'         6  
primary 'Wilkinson, O.J.'        7  
primary 'Senthong, P.'           8  
primary 'Butt, A.'               9  
primary 'Arvai, A.S.'            10 
primary 'Millington, C.L.'       11 
primary 'Povey, A.C.'            12 
primary 'Williams, D.M.'         13 
primary 'Santibanez-Koref, M.F.' 14 
primary 'Tainer, J.A.'           15 
primary 'Margison, G.P.'         16 
# 
_cell.entry_id           4ENM 
_cell.length_a           59.900 
_cell.length_b           59.900 
_cell.length_c           237.051 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ENM 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Alkyltransferase-like protein 1'                           13662.412 1 ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*GP*CP*CP*AP*TP*GP*(BZG)P*CP*TP*AP*GP*TP*A)-3')
;
4081.733  1 ? ? ? ? 
3 polymer syn 
;DNA (5'-D(*CP*TP*AP*CP*TP*AP*GP*CP*CP*AP*TP*GP*G)-3')
;
3951.586  1 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKD
RLEEEGVEIYQTSLGEYKLNLPEYMWKPGSHHHHHH
;
;MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKD
RLEEEGVEIYQTSLGEYKLNLPEYMWKPGSHHHHHH
;
A ? 
2 polydeoxyribonucleotide no yes '(DG)(DC)(DC)(DA)(DT)(DG)(BZG)(DC)(DT)(DA)(DG)(DT)(DA)' GCCATGNCTAGTA B ? 
3 polydeoxyribonucleotide no no  '(DC)(DT)(DA)(DC)(DT)(DA)(DG)(DC)(DC)(DA)(DT)(DG)(DG)' CTACTAGCCATGG C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   MET n 
1 4   ASP n 
1 5   GLU n 
1 6   PHE n 
1 7   TYR n 
1 8   THR n 
1 9   LYS n 
1 10  VAL n 
1 11  TYR n 
1 12  ASP n 
1 13  ALA n 
1 14  VAL n 
1 15  CYS n 
1 16  GLU n 
1 17  ILE n 
1 18  PRO n 
1 19  TYR n 
1 20  GLY n 
1 21  LYS n 
1 22  VAL n 
1 23  SER n 
1 24  THR n 
1 25  TYR n 
1 26  GLY n 
1 27  GLU n 
1 28  ILE n 
1 29  ALA n 
1 30  ARG n 
1 31  TYR n 
1 32  VAL n 
1 33  GLY n 
1 34  MET n 
1 35  PRO n 
1 36  SER n 
1 37  TYR n 
1 38  ALA n 
1 39  ARG n 
1 40  GLN n 
1 41  VAL n 
1 42  GLY n 
1 43  GLN n 
1 44  ALA n 
1 45  MET n 
1 46  LYS n 
1 47  HIS n 
1 48  LEU n 
1 49  HIS n 
1 50  PRO n 
1 51  GLU n 
1 52  THR n 
1 53  HIS n 
1 54  VAL n 
1 55  PRO n 
1 56  TRP n 
1 57  HIS n 
1 58  ARG n 
1 59  VAL n 
1 60  ILE n 
1 61  ASN n 
1 62  SER n 
1 63  ARG n 
1 64  GLY n 
1 65  THR n 
1 66  ILE n 
1 67  SER n 
1 68  LYS n 
1 69  ARG n 
1 70  ASP n 
1 71  ILE n 
1 72  SER n 
1 73  ALA n 
1 74  GLY n 
1 75  GLU n 
1 76  GLN n 
1 77  ARG n 
1 78  GLN n 
1 79  LYS n 
1 80  ASP n 
1 81  ARG n 
1 82  LEU n 
1 83  GLU n 
1 84  GLU n 
1 85  GLU n 
1 86  GLY n 
1 87  VAL n 
1 88  GLU n 
1 89  ILE n 
1 90  TYR n 
1 91  GLN n 
1 92  THR n 
1 93  SER n 
1 94  LEU n 
1 95  GLY n 
1 96  GLU n 
1 97  TYR n 
1 98  LYS n 
1 99  LEU n 
1 100 ASN n 
1 101 LEU n 
1 102 PRO n 
1 103 GLU n 
1 104 TYR n 
1 105 MET n 
1 106 TRP n 
1 107 LYS n 
1 108 PRO n 
1 109 GLY n 
1 110 SER n 
1 111 HIS n 
1 112 HIS n 
1 113 HIS n 
1 114 HIS n 
1 115 HIS n 
1 116 HIS n 
2 1   DG  n 
2 2   DC  n 
2 3   DC  n 
2 4   DA  n 
2 5   DT  n 
2 6   DG  n 
2 7   BZG n 
2 8   DC  n 
2 9   DT  n 
2 10  DA  n 
2 11  DG  n 
2 12  DT  n 
2 13  DA  n 
3 1   DC  n 
3 2   DT  n 
3 3   DA  n 
3 4   DC  n 
3 5   DT  n 
3 6   DA  n 
3 7   DG  n 
3 8   DC  n 
3 9   DC  n 
3 10  DA  n 
3 11  DT  n 
3 12  DG  n 
3 13  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Fission yeast' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'atl1, SPAC1250.04c' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    '972 / ATCC 24843' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Schizosaccharomyces pombe' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     284812 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'synthetic construct' ? 32630 ? 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ATL1_SCHPO Q9UTN9 1 
;MRMDEFYTKVYDAVCEIPYGKVSTYGEIARYVGMPSYARQVGQAMKHLHPETHVPWHRVINSRGTISKRDISAGEQRQKD
RLEEEGVEIYQTSLGEYKLNLPEYMWKP
;
1 ? 
2 PDB 4ENM       4ENM   2 GCCATGNCTAGTA 1 ? 
3 PDB 4ENM       4ENM   3 CTACTAGCCATGG 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ENM A 1 ? 108 ? Q9UTN9 1 ? 108 ? 1  108 
2 2 4ENM B 1 ? 13  ? 4ENM   1 ? 13  ? 1  13  
3 3 4ENM C 1 ? 13  ? 4ENM   1 ? 13  ? 14 26  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ENM GLY A 109 ? UNP Q9UTN9 ? ? 'EXPRESSION TAG' 109 1 
1 4ENM SER A 110 ? UNP Q9UTN9 ? ? 'EXPRESSION TAG' 110 2 
1 4ENM HIS A 111 ? UNP Q9UTN9 ? ? 'EXPRESSION TAG' 111 3 
1 4ENM HIS A 112 ? UNP Q9UTN9 ? ? 'EXPRESSION TAG' 112 4 
1 4ENM HIS A 113 ? UNP Q9UTN9 ? ? 'EXPRESSION TAG' 113 5 
1 4ENM HIS A 114 ? UNP Q9UTN9 ? ? 'EXPRESSION TAG' 114 6 
1 4ENM HIS A 115 ? UNP Q9UTN9 ? ? 'EXPRESSION TAG' 115 7 
1 4ENM HIS A 116 ? UNP Q9UTN9 ? ? 'EXPRESSION TAG' 116 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                  ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                 ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                               ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                          ? 'C4 H7 N O4' 
133.103 
BZG 'DNA linking'       . '6-(BENZYLOXY)-9-(2-DEOXY-5-O-PHOSPHONO-BETA-D-ERYTHRO-PENTOFURANOSYL)-9H-PURIN-2-AMINE' 
"O6-BENZYL-2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" 'C17 H20 N5 O7 P' 437.344 
CYS 'L-peptide linking' y CYSTEINE                                                                                 ? 
'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                     ? 
'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                      ? 
'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                     ? 
'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                             ? 
'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                          ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                  ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                ? 
'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                               ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                  ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                   ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                               ? 
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                            ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                  ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                   ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                                ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                               ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                 ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                   ? 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          4ENM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.96 
_exptl_crystal.density_percent_sol   58.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            288 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.4 
_exptl_crystal_grow.pdbx_details    
'15% mPEG 2000, 0.2M imidazole-malate, 30% xylose, pH 5.4, VAPOR DIFFUSION, HANGING DROP, temperature 288K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-07-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Curved crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97945 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97945 
# 
_reflns.entry_id                     4ENM 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.84 
_reflns.number_obs                   6178 
_reflns.number_all                   6178 
_reflns.percent_possible_obs         93.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.84 
_reflns_shell.d_res_low              2.94 
_reflns_shell.percent_possible_all   61.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4ENM 
_refine.ls_number_reflns_obs                     5915 
_refine.ls_number_reflns_all                     5915 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.11 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.033 
_refine.ls_d_res_high                            2.8402 
_refine.ls_percent_reflns_obs                    89.99 
_refine.ls_R_factor_obs                          0.1812 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1732 
_refine.ls_R_factor_R_free                       0.2526 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.97 
_refine.ls_number_reflns_R_free                  590 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            15.0050 
_refine.aniso_B[2][2]                            15.0050 
_refine.aniso_B[3][3]                            -30.0101 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.314 
_refine.solvent_model_param_bsol                 67.163 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3GVA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.37 
_refine.pdbx_overall_phase_error                 26.54 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        890 
_refine_hist.pdbx_number_atoms_nucleic_acid   534 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1424 
_refine_hist.d_res_high                       2.8402 
_refine_hist.d_res_low                        39.033 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.008  ? ? 1512 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.275  ? ? 2151 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 25.572 ? ? 616  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.065  ? ? 226  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 187  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.8402 3.1259  929  0.2978 66.00 0.3752 . . 102 . . . . 'X-RAY DIFFRACTION' 
. 3.1259 3.5779  1365 0.1928 96.00 0.2411 . . 153 . . . . 'X-RAY DIFFRACTION' 
. 3.5779 4.5067  1464 0.1583 99.00 0.2348 . . 160 . . . . 'X-RAY DIFFRACTION' 
. 4.5067 39.0370 1567 0.1593 98.00 0.2434 . . 175 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4ENM 
_struct.title                     'Crystal structure of S. pombe Atl1 in complex with damaged DNA containing O6-benzylguanine' 
_struct.pdbx_descriptor           'Alkyltransferase-like protein 1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ENM 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            
;Alkyltransferase, DNA repair, nucleotide excision repair, NER, base repair, DNA, DNA Damage, Guanine, Alkylation, DNA BINDING PROTEIN-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 2   ? ILE A 17  ? ARG A 2   ILE A 17  1 ? 16 
HELX_P HELX_P2 2 TYR A 25  ? VAL A 32  ? TYR A 25  VAL A 32  1 ? 8  
HELX_P HELX_P3 3 TYR A 37  ? HIS A 47  ? TYR A 37  HIS A 47  1 ? 11 
HELX_P HELX_P4 4 PRO A 55  ? HIS A 57  ? PRO A 55  HIS A 57  5 ? 3  
HELX_P HELX_P5 5 GLU A 75  ? GLU A 85  ? GLU A 75  GLU A 85  1 ? 11 
HELX_P HELX_P6 6 ASN A 100 ? MET A 105 ? ASN A 100 MET A 105 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DC 2  N3 ? ? ? 1_555 C DG 13 N1 ? ? B DC 2  C DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DC 2  N4 ? ? ? 1_555 C DG 13 O6 ? ? B DC 2  C DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DC 2  O2 ? ? ? 1_555 C DG 13 N2 ? ? B DC 2  C DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DC 3  N4 ? ? ? 1_555 C DG 12 O6 ? ? B DC 3  C DG 25 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog5  hydrog ? ? B DA 4  N1 ? ? ? 1_555 C DT 11 N3 ? ? B DA 4  C DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DA 4  N6 ? ? ? 1_555 C DT 11 O4 ? ? B DA 4  C DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DT 5  N3 ? ? ? 1_555 C DA 10 N1 ? ? B DT 5  C DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DT 5  O4 ? ? ? 1_555 C DA 10 N6 ? ? B DT 5  C DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DG 6  N1 ? ? ? 1_555 C DC 9  N3 ? ? B DG 6  C DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DG 6  N2 ? ? ? 1_555 C DC 9  O2 ? ? B DG 6  C DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DG 6  O6 ? ? ? 1_555 C DC 9  N4 ? ? B DG 6  C DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DC 8  N3 ? ? ? 1_555 C DG 7  N1 ? ? B DC 8  C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DC 8  N4 ? ? ? 1_555 C DG 7  O6 ? ? B DC 8  C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DC 8  O2 ? ? ? 1_555 C DG 7  N2 ? ? B DC 8  C DG 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DT 9  O4 ? ? ? 1_555 C DA 6  N6 ? ? B DT 9  C DA 19 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog16 hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 5  N3 ? ? B DA 10 C DT 18 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog17 hydrog ? ? B DG 11 N1 ? ? ? 1_555 C DC 4  N3 ? ? B DG 11 C DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DG 11 N2 ? ? ? 1_555 C DC 4  O2 ? ? B DG 11 C DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DG 11 O6 ? ? ? 1_555 C DC 4  N4 ? ? B DG 11 C DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DT 12 N3 ? ? ? 1_555 C DA 3  N1 ? ? B DT 12 C DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DT 12 O4 ? ? ? 1_555 C DA 3  N6 ? ? B DT 12 C DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DA 13 N1 ? ? ? 1_555 C DT 2  N3 ? ? B DA 13 C DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DA 13 N6 ? ? ? 1_555 C DT 2  O4 ? ? B DA 13 C DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 23 ? THR A 24 ? SER A 23 THR A 24 
A 2 VAL A 59 ? ILE A 60 ? VAL A 59 ILE A 60 
B 1 TYR A 90 ? GLN A 91 ? TYR A 90 GLN A 91 
B 2 TYR A 97 ? LYS A 98 ? TYR A 97 LYS A 98 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 23 ? N SER A 23 O ILE A 60 ? O ILE A 60 
B 1 2 N TYR A 90 ? N TYR A 90 O LYS A 98 ? O LYS A 98 
# 
_database_PDB_matrix.entry_id          4ENM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ENM 
_atom_sites.fract_transf_matrix[1][1]   0.016694 
_atom_sites.fract_transf_matrix[1][2]   0.009639 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019277 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004219 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? 37.615 -26.703 21.414  1.00 101.38 ? 1   MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? 36.912 -25.492 21.002  1.00 95.82  ? 1   MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? 35.409 -25.644 21.116  1.00 94.64  ? 1   MET A C     1 
ATOM   4    O O     . MET A 1 1   ? 34.820 -26.548 20.533  1.00 107.59 ? 1   MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? 37.253 -25.126 19.563  1.00 93.87  ? 1   MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? 36.239 -24.174 18.955  1.00 93.27  ? 1   MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? 36.320 -24.028 17.159  1.00 134.85 ? 1   MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? 36.943 -22.365 16.994  1.00 57.36  ? 1   MET A CE    1 
ATOM   9    N N     . ARG A 1 2   ? 34.798 -24.732 21.856  1.00 89.54  ? 2   ARG A N     1 
ATOM   10   C CA    . ARG A 1 2   ? 33.370 -24.763 22.153  1.00 92.77  ? 2   ARG A CA    1 
ATOM   11   C C     . ARG A 1 2   ? 32.524 -24.666 20.874  1.00 85.03  ? 2   ARG A C     1 
ATOM   12   O O     . ARG A 1 2   ? 32.882 -23.929 19.944  1.00 70.89  ? 2   ARG A O     1 
ATOM   13   C CB    . ARG A 1 2   ? 33.059 -23.581 23.083  1.00 101.40 ? 2   ARG A CB    1 
ATOM   14   C CG    . ARG A 1 2   ? 32.273 -23.906 24.341  1.00 105.57 ? 2   ARG A CG    1 
ATOM   15   C CD    . ARG A 1 2   ? 32.933 -23.382 25.635  1.00 108.18 ? 2   ARG A CD    1 
ATOM   16   N NE    . ARG A 1 2   ? 33.604 -22.087 25.509  1.00 109.25 ? 2   ARG A NE    1 
ATOM   17   C CZ    . ARG A 1 2   ? 32.983 -20.928 25.301  1.00 106.10 ? 2   ARG A CZ    1 
ATOM   18   N NH1   . ARG A 1 2   ? 31.667 -20.895 25.169  1.00 103.50 ? 2   ARG A NH1   1 
ATOM   19   N NH2   . ARG A 1 2   ? 33.681 -19.804 25.203  1.00 103.69 ? 2   ARG A NH2   1 
ATOM   20   N N     . MET A 1 3   ? 31.403 -25.389 20.820  1.00 84.93  ? 3   MET A N     1 
ATOM   21   C CA    . MET A 1 3   ? 30.501 -25.293 19.657  1.00 89.18  ? 3   MET A CA    1 
ATOM   22   C C     . MET A 1 3   ? 30.071 -23.847 19.419  1.00 86.67  ? 3   MET A C     1 
ATOM   23   O O     . MET A 1 3   ? 30.138 -23.346 18.309  1.00 90.54  ? 3   MET A O     1 
ATOM   24   C CB    . MET A 1 3   ? 29.260 -26.221 19.767  1.00 71.55  ? 3   MET A CB    1 
ATOM   25   C CG    . MET A 1 3   ? 29.367 -27.602 19.017  1.00 78.40  ? 3   MET A CG    1 
ATOM   26   S SD    . MET A 1 3   ? 30.363 -27.638 17.469  1.00 110.26 ? 3   MET A SD    1 
ATOM   27   C CE    . MET A 1 3   ? 31.983 -28.074 18.108  1.00 82.99  ? 3   MET A CE    1 
ATOM   28   N N     . ASP A 1 4   ? 29.646 -23.169 20.473  1.00 90.99  ? 4   ASP A N     1 
ATOM   29   C CA    . ASP A 1 4   ? 29.219 -21.779 20.359  1.00 89.09  ? 4   ASP A CA    1 
ATOM   30   C C     . ASP A 1 4   ? 30.349 -20.872 19.878  1.00 86.88  ? 4   ASP A C     1 
ATOM   31   O O     . ASP A 1 4   ? 30.097 -19.777 19.373  1.00 85.59  ? 4   ASP A O     1 
ATOM   32   C CB    . ASP A 1 4   ? 28.698 -21.264 21.700  1.00 91.67  ? 4   ASP A CB    1 
ATOM   33   C CG    . ASP A 1 4   ? 29.794 -21.172 22.754  1.00 94.67  ? 4   ASP A CG    1 
ATOM   34   O OD1   . ASP A 1 4   ? 30.543 -20.166 22.773  1.00 89.14  ? 4   ASP A OD1   1 
ATOM   35   O OD2   . ASP A 1 4   ? 29.902 -22.111 23.570  1.00 97.64  ? 4   ASP A OD2   1 
ATOM   36   N N     . GLU A 1 5   ? 31.592 -21.314 20.052  1.00 85.11  ? 5   GLU A N     1 
ATOM   37   C CA    . GLU A 1 5   ? 32.736 -20.533 19.604  1.00 91.91  ? 5   GLU A CA    1 
ATOM   38   C C     . GLU A 1 5   ? 32.817 -20.668 18.102  1.00 87.28  ? 5   GLU A C     1 
ATOM   39   O O     . GLU A 1 5   ? 32.830 -19.686 17.368  1.00 79.67  ? 5   GLU A O     1 
ATOM   40   C CB    . GLU A 1 5   ? 34.024 -21.045 20.240  1.00 100.96 ? 5   GLU A CB    1 
ATOM   41   C CG    . GLU A 1 5   ? 34.376 -20.383 21.561  1.00 117.18 ? 5   GLU A CG    1 
ATOM   42   C CD    . GLU A 1 5   ? 35.682 -20.902 22.148  1.00 126.60 ? 5   GLU A CD    1 
ATOM   43   O OE1   . GLU A 1 5   ? 36.603 -20.083 22.371  1.00 128.43 ? 5   GLU A OE1   1 
ATOM   44   O OE2   . GLU A 1 5   ? 35.783 -22.127 22.390  1.00 125.91 ? 5   GLU A OE2   1 
ATOM   45   N N     . PHE A 1 6   ? 32.875 -21.917 17.669  1.00 91.52  ? 6   PHE A N     1 
ATOM   46   C CA    . PHE A 1 6   ? 32.787 -22.287 16.273  1.00 82.88  ? 6   PHE A CA    1 
ATOM   47   C C     . PHE A 1 6   ? 31.700 -21.494 15.578  1.00 82.24  ? 6   PHE A C     1 
ATOM   48   O O     . PHE A 1 6   ? 31.979 -20.642 14.728  1.00 78.14  ? 6   PHE A O     1 
ATOM   49   C CB    . PHE A 1 6   ? 32.425 -23.752 16.204  1.00 80.92  ? 6   PHE A CB    1 
ATOM   50   C CG    . PHE A 1 6   ? 32.289 -24.267 14.825  1.00 78.71  ? 6   PHE A CG    1 
ATOM   51   C CD1   . PHE A 1 6   ? 33.364 -24.231 13.959  1.00 72.79  ? 6   PHE A CD1   1 
ATOM   52   C CD2   . PHE A 1 6   ? 31.101 -24.829 14.397  1.00 83.86  ? 6   PHE A CD2   1 
ATOM   53   C CE1   . PHE A 1 6   ? 33.254 -24.717 12.682  1.00 71.65  ? 6   PHE A CE1   1 
ATOM   54   C CE2   . PHE A 1 6   ? 30.986 -25.331 13.107  1.00 82.02  ? 6   PHE A CE2   1 
ATOM   55   C CZ    . PHE A 1 6   ? 32.070 -25.272 12.253  1.00 77.79  ? 6   PHE A CZ    1 
ATOM   56   N N     . TYR A 1 7   ? 30.457 -21.793 15.940  1.00 87.31  ? 7   TYR A N     1 
ATOM   57   C CA    . TYR A 1 7   ? 29.309 -21.074 15.412  1.00 87.47  ? 7   TYR A CA    1 
ATOM   58   C C     . TYR A 1 7   ? 29.617 -19.594 15.277  1.00 78.71  ? 7   TYR A C     1 
ATOM   59   O O     . TYR A 1 7   ? 29.355 -19.001 14.241  1.00 69.00  ? 7   TYR A O     1 
ATOM   60   C CB    . TYR A 1 7   ? 28.075 -21.285 16.288  1.00 96.32  ? 7   TYR A CB    1 
ATOM   61   C CG    . TYR A 1 7   ? 27.396 -22.612 16.054  1.00 115.61 ? 7   TYR A CG    1 
ATOM   62   C CD1   . TYR A 1 7   ? 28.133 -23.748 15.743  1.00 120.11 ? 7   TYR A CD1   1 
ATOM   63   C CD2   . TYR A 1 7   ? 26.018 -22.734 16.150  1.00 123.02 ? 7   TYR A CD2   1 
ATOM   64   C CE1   . TYR A 1 7   ? 27.515 -24.967 15.537  1.00 116.74 ? 7   TYR A CE1   1 
ATOM   65   C CE2   . TYR A 1 7   ? 25.393 -23.948 15.940  1.00 123.38 ? 7   TYR A CE2   1 
ATOM   66   C CZ    . TYR A 1 7   ? 26.146 -25.059 15.636  1.00 118.86 ? 7   TYR A CZ    1 
ATOM   67   O OH    . TYR A 1 7   ? 25.523 -26.265 15.433  1.00 117.15 ? 7   TYR A OH    1 
ATOM   68   N N     . THR A 1 8   ? 30.198 -18.991 16.302  1.00 59.81  ? 8   THR A N     1 
ATOM   69   C CA    . THR A 1 8   ? 30.533 -17.577 16.188  1.00 81.21  ? 8   THR A CA    1 
ATOM   70   C C     . THR A 1 8   ? 31.560 -17.374 15.083  1.00 75.30  ? 8   THR A C     1 
ATOM   71   O O     . THR A 1 8   ? 31.312 -16.619 14.143  1.00 81.99  ? 8   THR A O     1 
ATOM   72   C CB    . THR A 1 8   ? 31.077 -16.973 17.491  1.00 91.81  ? 8   THR A CB    1 
ATOM   73   O OG1   . THR A 1 8   ? 30.207 -17.301 18.588  1.00 97.98  ? 8   THR A OG1   1 
ATOM   74   C CG2   . THR A 1 8   ? 31.180 -15.463 17.352  1.00 88.12  ? 8   THR A CG2   1 
ATOM   75   N N     . LYS A 1 9   ? 32.697 -18.064 15.193  1.00 66.92  ? 9   LYS A N     1 
ATOM   76   C CA    . LYS A 1 9   ? 33.776 -18.003 14.201  1.00 63.93  ? 9   LYS A CA    1 
ATOM   77   C C     . LYS A 1 9   ? 33.233 -18.064 12.785  1.00 73.37  ? 9   LYS A C     1 
ATOM   78   O O     . LYS A 1 9   ? 33.553 -17.230 11.932  1.00 79.33  ? 9   LYS A O     1 
ATOM   79   C CB    . LYS A 1 9   ? 34.744 -19.171 14.370  1.00 63.14  ? 9   LYS A CB    1 
ATOM   80   C CG    . LYS A 1 9   ? 35.190 -19.440 15.799  1.00 90.61  ? 9   LYS A CG    1 
ATOM   81   C CD    . LYS A 1 9   ? 36.102 -18.341 16.344  1.00 104.89 ? 9   LYS A CD    1 
ATOM   82   C CE    . LYS A 1 9   ? 37.507 -18.427 15.762  1.00 103.03 ? 9   LYS A CE    1 
ATOM   83   N NZ    . LYS A 1 9   ? 38.149 -19.734 16.075  1.00 102.03 ? 9   LYS A NZ    1 
ATOM   84   N N     . VAL A 1 10  ? 32.420 -19.072 12.530  1.00 68.37  ? 10  VAL A N     1 
ATOM   85   C CA    . VAL A 1 10  ? 31.844 -19.235 11.210  1.00 71.71  ? 10  VAL A CA    1 
ATOM   86   C C     . VAL A 1 10  ? 31.112 -17.986 10.723  1.00 78.63  ? 10  VAL A C     1 
ATOM   87   O O     . VAL A 1 10  ? 31.462 -17.402 9.699   1.00 82.46  ? 10  VAL A O     1 
ATOM   88   C CB    . VAL A 1 10  ? 30.901 -20.432 11.186  1.00 67.25  ? 10  VAL A CB    1 
ATOM   89   C CG1   . VAL A 1 10  ? 30.106 -20.450 9.913   1.00 63.57  ? 10  VAL A CG1   1 
ATOM   90   C CG2   . VAL A 1 10  ? 31.712 -21.717 11.350  1.00 69.24  ? 10  VAL A CG2   1 
ATOM   91   N N     . TYR A 1 11  ? 30.094 -17.575 11.456  1.00 83.82  ? 11  TYR A N     1 
ATOM   92   C CA    . TYR A 1 11  ? 29.374 -16.373 11.086  1.00 86.23  ? 11  TYR A CA    1 
ATOM   93   C C     . TYR A 1 11  ? 30.359 -15.251 10.786  1.00 84.91  ? 11  TYR A C     1 
ATOM   94   O O     . TYR A 1 11  ? 30.274 -14.605 9.747   1.00 91.67  ? 11  TYR A O     1 
ATOM   95   C CB    . TYR A 1 11  ? 28.420 -15.970 12.201  1.00 84.67  ? 11  TYR A CB    1 
ATOM   96   C CG    . TYR A 1 11  ? 27.369 -17.016 12.503  1.00 80.65  ? 11  TYR A CG    1 
ATOM   97   C CD1   . TYR A 1 11  ? 26.902 -17.201 13.789  1.00 83.36  ? 11  TYR A CD1   1 
ATOM   98   C CD2   . TYR A 1 11  ? 26.843 -17.817 11.498  1.00 78.89  ? 11  TYR A CD2   1 
ATOM   99   C CE1   . TYR A 1 11  ? 25.937 -18.152 14.070  1.00 85.65  ? 11  TYR A CE1   1 
ATOM   100  C CE2   . TYR A 1 11  ? 25.880 -18.779 11.770  1.00 78.49  ? 11  TYR A CE2   1 
ATOM   101  C CZ    . TYR A 1 11  ? 25.431 -18.935 13.061  1.00 85.25  ? 11  TYR A CZ    1 
ATOM   102  O OH    . TYR A 1 11  ? 24.472 -19.876 13.357  1.00 100.51 ? 11  TYR A OH    1 
ATOM   103  N N     . ASP A 1 12  ? 31.312 -15.034 11.683  1.00 77.15  ? 12  ASP A N     1 
ATOM   104  C CA    . ASP A 1 12  ? 32.318 -14.012 11.447  1.00 87.22  ? 12  ASP A CA    1 
ATOM   105  C C     . ASP A 1 12  ? 32.893 -14.130 10.043  1.00 89.08  ? 12  ASP A C     1 
ATOM   106  O O     . ASP A 1 12  ? 32.993 -13.137 9.326   1.00 97.15  ? 12  ASP A O     1 
ATOM   107  C CB    . ASP A 1 12  ? 33.442 -14.100 12.476  1.00 98.72  ? 12  ASP A CB    1 
ATOM   108  C CG    . ASP A 1 12  ? 33.029 -13.584 13.842  1.00 111.18 ? 12  ASP A CG    1 
ATOM   109  O OD1   . ASP A 1 12  ? 33.464 -14.177 14.853  1.00 116.27 ? 12  ASP A OD1   1 
ATOM   110  O OD2   . ASP A 1 12  ? 32.279 -12.586 13.911  1.00 117.04 ? 12  ASP A OD2   1 
ATOM   111  N N     . ALA A 1 13  ? 33.265 -15.346 9.655   1.00 81.97  ? 13  ALA A N     1 
ATOM   112  C CA    . ALA A 1 13  ? 33.880 -15.589 8.346   1.00 75.56  ? 13  ALA A CA    1 
ATOM   113  C C     . ALA A 1 13  ? 32.931 -15.294 7.195   1.00 71.82  ? 13  ALA A C     1 
ATOM   114  O O     . ALA A 1 13  ? 33.265 -14.552 6.281   1.00 66.07  ? 13  ALA A O     1 
ATOM   115  C CB    . ALA A 1 13  ? 34.365 -17.018 8.247   1.00 63.05  ? 13  ALA A CB    1 
ATOM   116  N N     . VAL A 1 14  ? 31.751 -15.900 7.243   1.00 75.47  ? 14  VAL A N     1 
ATOM   117  C CA    . VAL A 1 14  ? 30.751 -15.707 6.206   1.00 74.62  ? 14  VAL A CA    1 
ATOM   118  C C     . VAL A 1 14  ? 30.561 -14.231 5.906   1.00 81.69  ? 14  VAL A C     1 
ATOM   119  O O     . VAL A 1 14  ? 30.629 -13.807 4.749   1.00 85.05  ? 14  VAL A O     1 
ATOM   120  C CB    . VAL A 1 14  ? 29.402 -16.273 6.633   1.00 76.67  ? 14  VAL A CB    1 
ATOM   121  C CG1   . VAL A 1 14  ? 28.468 -16.304 5.453   1.00 73.50  ? 14  VAL A CG1   1 
ATOM   122  C CG2   . VAL A 1 14  ? 29.580 -17.656 7.185   1.00 78.09  ? 14  VAL A CG2   1 
ATOM   123  N N     . CYS A 1 15  ? 30.320 -13.451 6.952   1.00 74.44  ? 15  CYS A N     1 
ATOM   124  C CA    . CYS A 1 15  ? 30.099 -12.026 6.796   1.00 76.12  ? 15  CYS A CA    1 
ATOM   125  C C     . CYS A 1 15  ? 31.241 -11.325 6.058   1.00 93.53  ? 15  CYS A C     1 
ATOM   126  O O     . CYS A 1 15  ? 31.062 -10.239 5.507   1.00 107.59 ? 15  CYS A O     1 
ATOM   127  C CB    . CYS A 1 15  ? 29.876 -11.389 8.155   1.00 79.96  ? 15  CYS A CB    1 
ATOM   128  S SG    . CYS A 1 15  ? 28.336 -11.925 8.957   1.00 114.61 ? 15  CYS A SG    1 
ATOM   129  N N     . GLU A 1 16  ? 32.409 -11.951 6.025   1.00 93.18  ? 16  GLU A N     1 
ATOM   130  C CA    . GLU A 1 16  ? 33.537 -11.391 5.291   1.00 106.23 ? 16  GLU A CA    1 
ATOM   131  C C     . GLU A 1 16  ? 33.430 -11.601 3.769   1.00 106.23 ? 16  GLU A C     1 
ATOM   132  O O     . GLU A 1 16  ? 34.118 -10.931 2.985   1.00 108.43 ? 16  GLU A O     1 
ATOM   133  C CB    . GLU A 1 16  ? 34.853 -11.956 5.833   1.00 111.58 ? 16  GLU A CB    1 
ATOM   134  C CG    . GLU A 1 16  ? 35.110 -11.601 7.289   1.00 129.83 ? 16  GLU A CG    1 
ATOM   135  C CD    . GLU A 1 16  ? 36.246 -12.398 7.908   1.00 136.42 ? 16  GLU A CD    1 
ATOM   136  O OE1   . GLU A 1 16  ? 36.136 -12.755 9.107   1.00 137.07 ? 16  GLU A OE1   1 
ATOM   137  O OE2   . GLU A 1 16  ? 37.246 -12.662 7.201   1.00 133.17 ? 16  GLU A OE2   1 
ATOM   138  N N     . ILE A 1 17  ? 32.564 -12.524 3.356   1.00 97.06  ? 17  ILE A N     1 
ATOM   139  C CA    . ILE A 1 17  ? 32.393 -12.823 1.936   1.00 88.34  ? 17  ILE A CA    1 
ATOM   140  C C     . ILE A 1 17  ? 31.805 -11.631 1.207   1.00 81.77  ? 17  ILE A C     1 
ATOM   141  O O     . ILE A 1 17  ? 30.669 -11.231 1.457   1.00 87.52  ? 17  ILE A O     1 
ATOM   142  C CB    . ILE A 1 17  ? 31.458 -14.012 1.714   1.00 86.02  ? 17  ILE A CB    1 
ATOM   143  C CG1   . ILE A 1 17  ? 31.819 -15.149 2.661   1.00 83.48  ? 17  ILE A CG1   1 
ATOM   144  C CG2   . ILE A 1 17  ? 31.511 -14.466 0.276   1.00 85.51  ? 17  ILE A CG2   1 
ATOM   145  C CD1   . ILE A 1 17  ? 31.423 -16.510 2.152   1.00 77.19  ? 17  ILE A CD1   1 
ATOM   146  N N     . PRO A 1 18  ? 32.573 -11.062 0.286   1.00 75.75  ? 18  PRO A N     1 
ATOM   147  C CA    . PRO A 1 18  ? 32.136 -9.819  -0.351  1.00 90.91  ? 18  PRO A CA    1 
ATOM   148  C C     . PRO A 1 18  ? 30.844 -10.003 -1.145  1.00 92.46  ? 18  PRO A C     1 
ATOM   149  O O     . PRO A 1 18  ? 30.587 -11.081 -1.690  1.00 91.35  ? 18  PRO A O     1 
ATOM   150  C CB    . PRO A 1 18  ? 33.304 -9.467  -1.284  1.00 85.62  ? 18  PRO A CB    1 
ATOM   151  C CG    . PRO A 1 18  ? 33.969 -10.763 -1.558  1.00 81.66  ? 18  PRO A CG    1 
ATOM   152  C CD    . PRO A 1 18  ? 33.782 -11.617 -0.333  1.00 80.39  ? 18  PRO A CD    1 
ATOM   153  N N     . TYR A 1 19  ? 30.035 -8.952  -1.189  1.00 121.31 ? 19  TYR A N     1 
ATOM   154  C CA    . TYR A 1 19  ? 28.883 -8.923  -2.067  1.00 121.63 ? 19  TYR A CA    1 
ATOM   155  C C     . TYR A 1 19  ? 29.293 -9.461  -3.431  1.00 118.39 ? 19  TYR A C     1 
ATOM   156  O O     . TYR A 1 19  ? 30.387 -9.177  -3.920  1.00 120.06 ? 19  TYR A O     1 
ATOM   157  C CB    . TYR A 1 19  ? 28.379 -7.488  -2.199  1.00 134.92 ? 19  TYR A CB    1 
ATOM   158  C CG    . TYR A 1 19  ? 27.160 -7.321  -3.079  1.00 141.77 ? 19  TYR A CG    1 
ATOM   159  C CD1   . TYR A 1 19  ? 27.214 -7.603  -4.440  1.00 141.63 ? 19  TYR A CD1   1 
ATOM   160  C CD2   . TYR A 1 19  ? 25.960 -6.855  -2.553  1.00 146.83 ? 19  TYR A CD2   1 
ATOM   161  C CE1   . TYR A 1 19  ? 26.101 -7.444  -5.248  1.00 145.81 ? 19  TYR A CE1   1 
ATOM   162  C CE2   . TYR A 1 19  ? 24.844 -6.691  -3.354  1.00 149.17 ? 19  TYR A CE2   1 
ATOM   163  C CZ    . TYR A 1 19  ? 24.920 -6.987  -4.700  1.00 149.44 ? 19  TYR A CZ    1 
ATOM   164  O OH    . TYR A 1 19  ? 23.811 -6.823  -5.498  1.00 151.78 ? 19  TYR A OH    1 
ATOM   165  N N     . GLY A 1 20  ? 28.422 -10.256 -4.037  1.00 111.03 ? 20  GLY A N     1 
ATOM   166  C CA    . GLY A 1 20  ? 28.662 -10.747 -5.377  1.00 99.14  ? 20  GLY A CA    1 
ATOM   167  C C     . GLY A 1 20  ? 29.608 -11.927 -5.467  1.00 99.08  ? 20  GLY A C     1 
ATOM   168  O O     . GLY A 1 20  ? 29.681 -12.575 -6.513  1.00 102.44 ? 20  GLY A O     1 
ATOM   169  N N     . LYS A 1 21  ? 30.338 -12.205 -4.387  1.00 100.56 ? 21  LYS A N     1 
ATOM   170  C CA    . LYS A 1 21  ? 31.234 -13.371 -4.332  1.00 96.15  ? 21  LYS A CA    1 
ATOM   171  C C     . LYS A 1 21  ? 30.581 -14.529 -3.573  1.00 92.03  ? 21  LYS A C     1 
ATOM   172  O O     . LYS A 1 21  ? 29.449 -14.389 -3.115  1.00 86.94  ? 21  LYS A O     1 
ATOM   173  C CB    . LYS A 1 21  ? 32.572 -12.996 -3.694  1.00 102.33 ? 21  LYS A CB    1 
ATOM   174  C CG    . LYS A 1 21  ? 33.535 -12.327 -4.657  1.00 109.45 ? 21  LYS A CG    1 
ATOM   175  C CD    . LYS A 1 21  ? 33.940 -13.297 -5.749  1.00 110.91 ? 21  LYS A CD    1 
ATOM   176  C CE    . LYS A 1 21  ? 34.705 -12.607 -6.874  1.00 111.51 ? 21  LYS A CE    1 
ATOM   177  N NZ    . LYS A 1 21  ? 35.063 -13.575 -7.950  1.00 104.04 ? 21  LYS A NZ    1 
ATOM   178  N N     . VAL A 1 22  ? 31.265 -15.671 -3.464  1.00 70.94  ? 22  VAL A N     1 
ATOM   179  C CA    . VAL A 1 22  ? 30.746 -16.791 -2.669  1.00 78.48  ? 22  VAL A CA    1 
ATOM   180  C C     . VAL A 1 22  ? 31.818 -17.681 -2.060  1.00 79.72  ? 22  VAL A C     1 
ATOM   181  O O     . VAL A 1 22  ? 32.996 -17.582 -2.409  1.00 88.64  ? 22  VAL A O     1 
ATOM   182  C CB    . VAL A 1 22  ? 29.827 -17.734 -3.475  1.00 71.39  ? 22  VAL A CB    1 
ATOM   183  C CG1   . VAL A 1 22  ? 28.939 -16.964 -4.410  1.00 68.27  ? 22  VAL A CG1   1 
ATOM   184  C CG2   . VAL A 1 22  ? 30.639 -18.794 -4.216  1.00 65.56  ? 22  VAL A CG2   1 
ATOM   185  N N     . SER A 1 23  ? 31.395 -18.565 -1.156  1.00 72.79  ? 23  SER A N     1 
ATOM   186  C CA    . SER A 1 23  ? 32.303 -19.561 -0.602  1.00 65.90  ? 23  SER A CA    1 
ATOM   187  C C     . SER A 1 23  ? 31.624 -20.907 -0.382  1.00 68.63  ? 23  SER A C     1 
ATOM   188  O O     . SER A 1 23  ? 30.509 -21.136 -0.848  1.00 77.31  ? 23  SER A O     1 
ATOM   189  C CB    . SER A 1 23  ? 32.924 -19.064 0.697   1.00 61.69  ? 23  SER A CB    1 
ATOM   190  O OG    . SER A 1 23  ? 34.171 -19.701 0.915   1.00 68.12  ? 23  SER A OG    1 
ATOM   191  N N     . THR A 1 24  ? 32.298 -21.798 0.334   1.00 68.04  ? 24  THR A N     1 
ATOM   192  C CA    . THR A 1 24  ? 31.740 -23.117 0.610   1.00 71.32  ? 24  THR A CA    1 
ATOM   193  C C     . THR A 1 24  ? 32.022 -23.658 2.002   1.00 69.67  ? 24  THR A C     1 
ATOM   194  O O     . THR A 1 24  ? 33.159 -23.637 2.474   1.00 82.62  ? 24  THR A O     1 
ATOM   195  C CB    . THR A 1 24  ? 32.299 -24.174 -0.354  1.00 71.26  ? 24  THR A CB    1 
ATOM   196  O OG1   . THR A 1 24  ? 33.702 -24.374 -0.088  1.00 71.97  ? 24  THR A OG1   1 
ATOM   197  C CG2   . THR A 1 24  ? 32.049 -23.772 -1.794  1.00 57.19  ? 24  THR A CG2   1 
ATOM   198  N N     . TYR A 1 25  ? 30.975 -24.177 2.629   1.00 79.77  ? 25  TYR A N     1 
ATOM   199  C CA    . TYR A 1 25  ? 31.079 -24.997 3.833   1.00 77.50  ? 25  TYR A CA    1 
ATOM   200  C C     . TYR A 1 25  ? 32.517 -25.373 4.148   1.00 79.47  ? 25  TYR A C     1 
ATOM   201  O O     . TYR A 1 25  ? 33.124 -24.831 5.072   1.00 87.64  ? 25  TYR A O     1 
ATOM   202  C CB    . TYR A 1 25  ? 30.252 -26.263 3.637   1.00 86.93  ? 25  TYR A CB    1 
ATOM   203  C CG    . TYR A 1 25  ? 28.839 -25.957 3.205   1.00 90.45  ? 25  TYR A CG    1 
ATOM   204  C CD1   . TYR A 1 25  ? 28.103 -26.869 2.478   1.00 96.96  ? 25  TYR A CD1   1 
ATOM   205  C CD2   . TYR A 1 25  ? 28.246 -24.737 3.519   1.00 86.28  ? 25  TYR A CD2   1 
ATOM   206  C CE1   . TYR A 1 25  ? 26.814 -26.589 2.086   1.00 101.09 ? 25  TYR A CE1   1 
ATOM   207  C CE2   . TYR A 1 25  ? 26.954 -24.447 3.127   1.00 87.23  ? 25  TYR A CE2   1 
ATOM   208  C CZ    . TYR A 1 25  ? 26.248 -25.379 2.412   1.00 100.94 ? 25  TYR A CZ    1 
ATOM   209  O OH    . TYR A 1 25  ? 24.964 -25.101 2.022   1.00 113.51 ? 25  TYR A OH    1 
ATOM   210  N N     . GLY A 1 26  ? 33.060 -26.292 3.358   1.00 79.66  ? 26  GLY A N     1 
ATOM   211  C CA    . GLY A 1 26  ? 34.437 -26.726 3.505   1.00 75.92  ? 26  GLY A CA    1 
ATOM   212  C C     . GLY A 1 26  ? 35.409 -25.577 3.658   1.00 77.73  ? 26  GLY A C     1 
ATOM   213  O O     . GLY A 1 26  ? 36.156 -25.520 4.635   1.00 80.87  ? 26  GLY A O     1 
ATOM   214  N N     . GLU A 1 27  ? 35.402 -24.651 2.703   1.00 77.22  ? 27  GLU A N     1 
ATOM   215  C CA    . GLU A 1 27  ? 36.368 -23.573 2.764   1.00 75.98  ? 27  GLU A CA    1 
ATOM   216  C C     . GLU A 1 27  ? 36.226 -22.837 4.070   1.00 61.93  ? 27  GLU A C     1 
ATOM   217  O O     . GLU A 1 27  ? 37.214 -22.589 4.751   1.00 69.97  ? 27  GLU A O     1 
ATOM   218  C CB    . GLU A 1 27  ? 36.279 -22.623 1.570   1.00 85.81  ? 27  GLU A CB    1 
ATOM   219  C CG    . GLU A 1 27  ? 37.290 -22.947 0.453   1.00 108.66 ? 27  GLU A CG    1 
ATOM   220  C CD    . GLU A 1 27  ? 38.731 -23.159 0.949   1.00 121.10 ? 27  GLU A CD    1 
ATOM   221  O OE1   . GLU A 1 27  ? 39.042 -22.800 2.111   1.00 125.67 ? 27  GLU A OE1   1 
ATOM   222  O OE2   . GLU A 1 27  ? 39.558 -23.691 0.167   1.00 120.23 ? 27  GLU A OE2   1 
ATOM   223  N N     . ILE A 1 28  ? 34.997 -22.521 4.440   1.00 56.47  ? 28  ILE A N     1 
ATOM   224  C CA    . ILE A 1 28  ? 34.774 -21.817 5.699   1.00 76.66  ? 28  ILE A CA    1 
ATOM   225  C C     . ILE A 1 28  ? 35.306 -22.619 6.869   1.00 75.65  ? 28  ILE A C     1 
ATOM   226  O O     . ILE A 1 28  ? 36.048 -22.098 7.702   1.00 74.43  ? 28  ILE A O     1 
ATOM   227  C CB    . ILE A 1 28  ? 33.299 -21.541 5.978   1.00 80.79  ? 28  ILE A CB    1 
ATOM   228  C CG1   . ILE A 1 28  ? 32.698 -20.668 4.872   1.00 76.41  ? 28  ILE A CG1   1 
ATOM   229  C CG2   . ILE A 1 28  ? 33.174 -20.861 7.323   1.00 75.37  ? 28  ILE A CG2   1 
ATOM   230  C CD1   . ILE A 1 28  ? 33.543 -19.439 4.576   1.00 75.05  ? 28  ILE A CD1   1 
ATOM   231  N N     . ALA A 1 29  ? 34.920 -23.890 6.917   1.00 69.48  ? 29  ALA A N     1 
ATOM   232  C CA    . ALA A 1 29  ? 35.438 -24.805 7.920   1.00 71.48  ? 29  ALA A CA    1 
ATOM   233  C C     . ALA A 1 29  ? 36.944 -24.644 8.064   1.00 77.31  ? 29  ALA A C     1 
ATOM   234  O O     . ALA A 1 29  ? 37.460 -24.366 9.147   1.00 75.30  ? 29  ALA A O     1 
ATOM   235  C CB    . ALA A 1 29  ? 35.109 -26.217 7.544   1.00 75.86  ? 29  ALA A CB    1 
ATOM   236  N N     . ARG A 1 30  ? 37.655 -24.824 6.962   1.00 80.29  ? 30  ARG A N     1 
ATOM   237  C CA    . ARG A 1 30  ? 39.098 -24.644 6.987   1.00 85.44  ? 30  ARG A CA    1 
ATOM   238  C C     . ARG A 1 30  ? 39.469 -23.236 7.437   1.00 79.75  ? 30  ARG A C     1 
ATOM   239  O O     . ARG A 1 30  ? 40.383 -23.057 8.228   1.00 78.01  ? 30  ARG A O     1 
ATOM   240  C CB    . ARG A 1 30  ? 39.714 -24.967 5.631   1.00 65.75  ? 30  ARG A CB    1 
ATOM   241  C CG    . ARG A 1 30  ? 39.863 -26.458 5.415   1.00 93.46  ? 30  ARG A CG    1 
ATOM   242  C CD    . ARG A 1 30  ? 40.617 -26.751 4.128   1.00 96.66  ? 30  ARG A CD    1 
ATOM   243  N NE    . ARG A 1 30  ? 39.892 -26.236 2.976   1.00 99.16  ? 30  ARG A NE    1 
ATOM   244  C CZ    . ARG A 1 30  ? 39.103 -26.975 2.208   1.00 102.50 ? 30  ARG A CZ    1 
ATOM   245  N NH1   . ARG A 1 30  ? 38.958 -28.269 2.469   1.00 97.41  ? 30  ARG A NH1   1 
ATOM   246  N NH2   . ARG A 1 30  ? 38.474 -26.424 1.175   1.00 104.34 ? 30  ARG A NH2   1 
ATOM   247  N N     . TYR A 1 31  ? 38.752 -22.238 6.944   1.00 74.33  ? 31  TYR A N     1 
ATOM   248  C CA    . TYR A 1 31  ? 39.097 -20.873 7.267   1.00 75.39  ? 31  TYR A CA    1 
ATOM   249  C C     . TYR A 1 31  ? 39.266 -20.739 8.759   1.00 85.02  ? 31  TYR A C     1 
ATOM   250  O O     . TYR A 1 31  ? 40.221 -20.137 9.226   1.00 102.20 ? 31  TYR A O     1 
ATOM   251  C CB    . TYR A 1 31  ? 38.004 -19.922 6.815   1.00 72.29  ? 31  TYR A CB    1 
ATOM   252  C CG    . TYR A 1 31  ? 38.406 -18.472 6.917   1.00 80.11  ? 31  TYR A CG    1 
ATOM   253  C CD1   . TYR A 1 31  ? 39.635 -18.033 6.428   1.00 93.11  ? 31  TYR A CD1   1 
ATOM   254  C CD2   . TYR A 1 31  ? 37.560 -17.542 7.487   1.00 69.56  ? 31  TYR A CD2   1 
ATOM   255  C CE1   . TYR A 1 31  ? 40.003 -16.703 6.512   1.00 94.52  ? 31  TYR A CE1   1 
ATOM   256  C CE2   . TYR A 1 31  ? 37.914 -16.213 7.572   1.00 80.16  ? 31  TYR A CE2   1 
ATOM   257  C CZ    . TYR A 1 31  ? 39.133 -15.800 7.087   1.00 96.01  ? 31  TYR A CZ    1 
ATOM   258  O OH    . TYR A 1 31  ? 39.473 -14.475 7.181   1.00 107.81 ? 31  TYR A OH    1 
ATOM   259  N N     . VAL A 1 32  ? 38.335 -21.319 9.505   1.00 86.73  ? 32  VAL A N     1 
ATOM   260  C CA    . VAL A 1 32  ? 38.279 -21.130 10.948  1.00 81.14  ? 32  VAL A CA    1 
ATOM   261  C C     . VAL A 1 32  ? 38.880 -22.301 11.722  1.00 84.84  ? 32  VAL A C     1 
ATOM   262  O O     . VAL A 1 32  ? 38.426 -22.626 12.821  1.00 88.75  ? 32  VAL A O     1 
ATOM   263  C CB    . VAL A 1 32  ? 36.814 -20.866 11.447  1.00 75.02  ? 32  VAL A CB    1 
ATOM   264  C CG1   . VAL A 1 32  ? 36.181 -19.708 10.691  1.00 77.30  ? 32  VAL A CG1   1 
ATOM   265  C CG2   . VAL A 1 32  ? 35.939 -22.096 11.311  1.00 44.54  ? 32  VAL A CG2   1 
ATOM   266  N N     . GLY A 1 33  ? 39.876 -22.953 11.135  1.00 84.86  ? 33  GLY A N     1 
ATOM   267  C CA    . GLY A 1 33  ? 40.669 -23.945 11.847  1.00 89.32  ? 33  GLY A CA    1 
ATOM   268  C C     . GLY A 1 33  ? 39.974 -25.229 12.269  1.00 87.14  ? 33  GLY A C     1 
ATOM   269  O O     . GLY A 1 33  ? 40.421 -25.897 13.194  1.00 91.06  ? 33  GLY A O     1 
ATOM   270  N N     . MET A 1 34  ? 38.889 -25.582 11.592  1.00 85.74  ? 34  MET A N     1 
ATOM   271  C CA    . MET A 1 34  ? 38.159 -26.809 11.898  1.00 81.84  ? 34  MET A CA    1 
ATOM   272  C C     . MET A 1 34  ? 37.830 -27.603 10.628  1.00 82.04  ? 34  MET A C     1 
ATOM   273  O O     . MET A 1 34  ? 36.668 -27.780 10.270  1.00 82.65  ? 34  MET A O     1 
ATOM   274  C CB    . MET A 1 34  ? 36.903 -26.468 12.691  1.00 76.67  ? 34  MET A CB    1 
ATOM   275  C CG    . MET A 1 34  ? 37.207 -26.053 14.128  1.00 86.92  ? 34  MET A CG    1 
ATOM   276  S SD    . MET A 1 34  ? 37.542 -27.488 15.162  1.00 94.21  ? 34  MET A SD    1 
ATOM   277  C CE    . MET A 1 34  ? 38.576 -26.788 16.449  1.00 177.54 ? 34  MET A CE    1 
ATOM   278  N N     . PRO A 1 35  ? 38.871 -28.105 9.960   1.00 80.44  ? 35  PRO A N     1 
ATOM   279  C CA    . PRO A 1 35  ? 38.800 -28.656 8.604   1.00 86.55  ? 35  PRO A CA    1 
ATOM   280  C C     . PRO A 1 35  ? 37.736 -29.738 8.401   1.00 83.67  ? 35  PRO A C     1 
ATOM   281  O O     . PRO A 1 35  ? 37.147 -29.820 7.318   1.00 81.73  ? 35  PRO A O     1 
ATOM   282  C CB    . PRO A 1 35  ? 40.207 -29.237 8.394   1.00 90.92  ? 35  PRO A CB    1 
ATOM   283  C CG    . PRO A 1 35  ? 41.075 -28.493 9.364   1.00 90.67  ? 35  PRO A CG    1 
ATOM   284  C CD    . PRO A 1 35  ? 40.208 -28.275 10.557  1.00 82.27  ? 35  PRO A CD    1 
ATOM   285  N N     . SER A 1 36  ? 37.500 -30.559 9.416   1.00 83.86  ? 36  SER A N     1 
ATOM   286  C CA    . SER A 1 36  ? 36.590 -31.688 9.274   1.00 84.90  ? 36  SER A CA    1 
ATOM   287  C C     . SER A 1 36  ? 35.122 -31.305 9.484   1.00 85.25  ? 36  SER A C     1 
ATOM   288  O O     . SER A 1 36  ? 34.227 -32.121 9.255   1.00 90.18  ? 36  SER A O     1 
ATOM   289  C CB    . SER A 1 36  ? 36.975 -32.797 10.248  1.00 88.71  ? 36  SER A CB    1 
ATOM   290  O OG    . SER A 1 36  ? 36.841 -32.354 11.588  1.00 87.63  ? 36  SER A OG    1 
ATOM   291  N N     . TYR A 1 37  ? 34.871 -30.065 9.898   1.00 83.39  ? 37  TYR A N     1 
ATOM   292  C CA    . TYR A 1 37  ? 33.532 -29.668 10.340  1.00 72.05  ? 37  TYR A CA    1 
ATOM   293  C C     . TYR A 1 37  ? 32.670 -29.016 9.290   1.00 68.06  ? 37  TYR A C     1 
ATOM   294  O O     . TYR A 1 37  ? 31.827 -28.181 9.629   1.00 75.12  ? 37  TYR A O     1 
ATOM   295  C CB    . TYR A 1 37  ? 33.621 -28.706 11.529  1.00 64.41  ? 37  TYR A CB    1 
ATOM   296  C CG    . TYR A 1 37  ? 33.855 -29.395 12.847  1.00 70.62  ? 37  TYR A CG    1 
ATOM   297  C CD1   . TYR A 1 37  ? 34.813 -30.382 12.971  1.00 81.56  ? 37  TYR A CD1   1 
ATOM   298  C CD2   . TYR A 1 37  ? 33.128 -29.050 13.968  1.00 72.37  ? 37  TYR A CD2   1 
ATOM   299  C CE1   . TYR A 1 37  ? 35.035 -31.002 14.174  1.00 87.67  ? 37  TYR A CE1   1 
ATOM   300  C CE2   . TYR A 1 37  ? 33.345 -29.664 15.173  1.00 79.57  ? 37  TYR A CE2   1 
ATOM   301  C CZ    . TYR A 1 37  ? 34.298 -30.638 15.269  1.00 88.26  ? 37  TYR A CZ    1 
ATOM   302  O OH    . TYR A 1 37  ? 34.515 -31.254 16.473  1.00 98.73  ? 37  TYR A OH    1 
ATOM   303  N N     . ALA A 1 38  ? 32.861 -29.368 8.025   1.00 79.73  ? 38  ALA A N     1 
ATOM   304  C CA    . ALA A 1 38  ? 32.043 -28.754 6.979   1.00 65.75  ? 38  ALA A CA    1 
ATOM   305  C C     . ALA A 1 38  ? 30.558 -28.982 7.242   1.00 64.96  ? 38  ALA A C     1 
ATOM   306  O O     . ALA A 1 38  ? 29.749 -28.063 7.142   1.00 60.89  ? 38  ALA A O     1 
ATOM   307  C CB    . ALA A 1 38  ? 32.417 -29.283 5.633   1.00 69.46  ? 38  ALA A CB    1 
ATOM   308  N N     . ARG A 1 39  ? 30.195 -30.203 7.615   1.00 67.93  ? 39  ARG A N     1 
ATOM   309  C CA    . ARG A 1 39  ? 28.787 -30.487 7.840   1.00 63.33  ? 39  ARG A CA    1 
ATOM   310  C C     . ARG A 1 39  ? 28.279 -29.457 8.822   1.00 70.89  ? 39  ARG A C     1 
ATOM   311  O O     . ARG A 1 39  ? 27.182 -28.927 8.651   1.00 73.82  ? 39  ARG A O     1 
ATOM   312  C CB    . ARG A 1 39  ? 28.556 -31.915 8.341   1.00 59.30  ? 39  ARG A CB    1 
ATOM   313  C CG    . ARG A 1 39  ? 29.321 -32.952 7.537   1.00 82.45  ? 39  ARG A CG    1 
ATOM   314  C CD    . ARG A 1 39  ? 28.764 -34.367 7.683   1.00 98.27  ? 39  ARG A CD    1 
ATOM   315  N NE    . ARG A 1 39  ? 27.441 -34.527 7.079   1.00 103.73 ? 39  ARG A NE    1 
ATOM   316  C CZ    . ARG A 1 39  ? 26.920 -35.696 6.700   1.00 99.88  ? 39  ARG A CZ    1 
ATOM   317  N NH1   . ARG A 1 39  ? 25.706 -35.731 6.174   1.00 103.33 ? 39  ARG A NH1   1 
ATOM   318  N NH2   . ARG A 1 39  ? 27.603 -36.833 6.830   1.00 87.11  ? 39  ARG A NH2   1 
ATOM   319  N N     . GLN A 1 40  ? 29.100 -29.127 9.818   1.00 79.33  ? 40  GLN A N     1 
ATOM   320  C CA    . GLN A 1 40  ? 28.643 -28.243 10.897  1.00 81.33  ? 40  GLN A CA    1 
ATOM   321  C C     . GLN A 1 40  ? 28.497 -26.814 10.419  1.00 69.62  ? 40  GLN A C     1 
ATOM   322  O O     . GLN A 1 40  ? 27.697 -26.047 10.959  1.00 61.99  ? 40  GLN A O     1 
ATOM   323  C CB    . GLN A 1 40  ? 29.546 -28.312 12.134  1.00 72.06  ? 40  GLN A CB    1 
ATOM   324  C CG    . GLN A 1 40  ? 30.469 -29.495 12.126  1.00 80.91  ? 40  GLN A CG    1 
ATOM   325  C CD    . GLN A 1 40  ? 29.721 -30.799 12.168  1.00 80.93  ? 40  GLN A CD    1 
ATOM   326  O OE1   . GLN A 1 40  ? 28.731 -30.923 12.879  1.00 85.62  ? 40  GLN A OE1   1 
ATOM   327  N NE2   . GLN A 1 40  ? 30.187 -31.781 11.408  1.00 76.22  ? 40  GLN A NE2   1 
ATOM   328  N N     . VAL A 1 41  ? 29.262 -26.450 9.398   1.00 58.42  ? 41  VAL A N     1 
ATOM   329  C CA    . VAL A 1 41  ? 29.037 -25.140 8.802   1.00 63.68  ? 41  VAL A CA    1 
ATOM   330  C C     . VAL A 1 41  ? 27.652 -25.112 8.177   1.00 69.13  ? 41  VAL A C     1 
ATOM   331  O O     . VAL A 1 41  ? 26.961 -24.085 8.181   1.00 69.54  ? 41  VAL A O     1 
ATOM   332  C CB    . VAL A 1 41  ? 30.056 -24.810 7.758   1.00 55.12  ? 41  VAL A CB    1 
ATOM   333  C CG1   . VAL A 1 41  ? 30.018 -23.326 7.482   1.00 50.78  ? 41  VAL A CG1   1 
ATOM   334  C CG2   . VAL A 1 41  ? 31.442 -25.246 8.249   1.00 51.06  ? 41  VAL A CG2   1 
ATOM   335  N N     . GLY A 1 42  ? 27.242 -26.265 7.664   1.00 68.37  ? 42  GLY A N     1 
ATOM   336  C CA    . GLY A 1 42  ? 25.871 -26.452 7.252   1.00 60.81  ? 42  GLY A CA    1 
ATOM   337  C C     . GLY A 1 42  ? 25.045 -26.045 8.432   1.00 74.30  ? 42  GLY A C     1 
ATOM   338  O O     . GLY A 1 42  ? 24.357 -25.024 8.387   1.00 80.73  ? 42  GLY A O     1 
ATOM   339  N N     . GLN A 1 43  ? 25.157 -26.838 9.499   1.00 87.86  ? 43  GLN A N     1 
ATOM   340  C CA    . GLN A 1 43  ? 24.417 -26.631 10.743  1.00 82.28  ? 43  GLN A CA    1 
ATOM   341  C C     . GLN A 1 43  ? 24.305 -25.153 11.091  1.00 71.89  ? 43  GLN A C     1 
ATOM   342  O O     . GLN A 1 43  ? 23.208 -24.619 11.173  1.00 73.57  ? 43  GLN A O     1 
ATOM   343  C CB    . GLN A 1 43  ? 25.095 -27.372 11.898  1.00 94.96  ? 43  GLN A CB    1 
ATOM   344  C CG    . GLN A 1 43  ? 25.024 -28.899 11.853  1.00 108.50 ? 43  GLN A CG    1 
ATOM   345  C CD    . GLN A 1 43  ? 25.381 -29.552 13.207  1.00 122.22 ? 43  GLN A CD    1 
ATOM   346  O OE1   . GLN A 1 43  ? 25.465 -30.782 13.321  1.00 126.51 ? 43  GLN A OE1   1 
ATOM   347  N NE2   . GLN A 1 43  ? 25.581 -28.725 14.235  1.00 121.46 ? 43  GLN A NE2   1 
ATOM   348  N N     . ALA A 1 44  ? 25.447 -24.498 11.283  1.00 64.47  ? 44  ALA A N     1 
ATOM   349  C CA    . ALA A 1 44  ? 25.481 -23.063 11.592  1.00 64.46  ? 44  ALA A CA    1 
ATOM   350  C C     . ALA A 1 44  ? 24.468 -22.261 10.782  1.00 68.36  ? 44  ALA A C     1 
ATOM   351  O O     . ALA A 1 44  ? 23.578 -21.614 11.339  1.00 69.40  ? 44  ALA A O     1 
ATOM   352  C CB    . ALA A 1 44  ? 26.877 -22.497 11.382  1.00 52.63  ? 44  ALA A CB    1 
ATOM   353  N N     . MET A 1 45  ? 24.624 -22.309 9.463   1.00 66.63  ? 45  MET A N     1 
ATOM   354  C CA    . MET A 1 45  ? 23.716 -21.647 8.538   1.00 63.98  ? 45  MET A CA    1 
ATOM   355  C C     . MET A 1 45  ? 22.267 -21.947 8.875   1.00 68.97  ? 45  MET A C     1 
ATOM   356  O O     . MET A 1 45  ? 21.475 -21.051 9.157   1.00 72.91  ? 45  MET A O     1 
ATOM   357  C CB    . MET A 1 45  ? 23.995 -22.114 7.107   1.00 64.18  ? 45  MET A CB    1 
ATOM   358  C CG    . MET A 1 45  ? 25.397 -21.824 6.593   1.00 58.22  ? 45  MET A CG    1 
ATOM   359  S SD    . MET A 1 45  ? 25.902 -20.122 6.896   1.00 78.13  ? 45  MET A SD    1 
ATOM   360  C CE    . MET A 1 45  ? 27.095 -20.378 8.202   1.00 125.84 ? 45  MET A CE    1 
ATOM   361  N N     . LYS A 1 46  ? 21.937 -23.230 8.845   1.00 63.74  ? 46  LYS A N     1 
ATOM   362  C CA    . LYS A 1 46  ? 20.578 -23.696 9.056   1.00 67.00  ? 46  LYS A CA    1 
ATOM   363  C C     . LYS A 1 46  ? 19.966 -23.170 10.353  1.00 90.22  ? 46  LYS A C     1 
ATOM   364  O O     . LYS A 1 46  ? 18.751 -23.203 10.522  1.00 103.37 ? 46  LYS A O     1 
ATOM   365  C CB    . LYS A 1 46  ? 20.578 -25.227 9.037   1.00 66.74  ? 46  LYS A CB    1 
ATOM   366  C CG    . LYS A 1 46  ? 19.240 -25.926 9.312   1.00 73.33  ? 46  LYS A CG    1 
ATOM   367  C CD    . LYS A 1 46  ? 19.447 -27.449 9.304   1.00 83.61  ? 46  LYS A CD    1 
ATOM   368  C CE    . LYS A 1 46  ? 18.146 -28.206 9.424   1.00 107.38 ? 46  LYS A CE    1 
ATOM   369  N NZ    . LYS A 1 46  ? 18.347 -29.683 9.382   1.00 120.40 ? 46  LYS A NZ    1 
ATOM   370  N N     . HIS A 1 47  ? 20.799 -22.661 11.257  1.00 97.19  ? 47  HIS A N     1 
ATOM   371  C CA    . HIS A 1 47  ? 20.318 -22.250 12.574  1.00 105.82 ? 47  HIS A CA    1 
ATOM   372  C C     . HIS A 1 47  ? 20.141 -20.746 12.737  1.00 102.77 ? 47  HIS A C     1 
ATOM   373  O O     . HIS A 1 47  ? 19.678 -20.280 13.780  1.00 116.06 ? 47  HIS A O     1 
ATOM   374  C CB    . HIS A 1 47  ? 21.223 -22.801 13.680  1.00 120.17 ? 47  HIS A CB    1 
ATOM   375  C CG    . HIS A 1 47  ? 21.012 -24.250 13.962  1.00 136.13 ? 47  HIS A CG    1 
ATOM   376  N ND1   . HIS A 1 47  ? 21.985 -25.056 14.530  1.00 141.68 ? 47  HIS A ND1   1 
ATOM   377  C CD2   . HIS A 1 47  ? 19.941 -25.062 13.764  1.00 141.63 ? 47  HIS A CD2   1 
ATOM   378  C CE1   . HIS A 1 47  ? 21.528 -26.279 14.662  1.00 144.94 ? 47  HIS A CE1   1 
ATOM   379  N NE2   . HIS A 1 47  ? 20.282 -26.313 14.202  1.00 146.07 ? 47  HIS A NE2   1 
ATOM   380  N N     . LEU A 1 48  ? 20.511 -19.985 11.716  1.00 84.68  ? 48  LEU A N     1 
ATOM   381  C CA    . LEU A 1 48  ? 20.300 -18.547 11.750  1.00 77.40  ? 48  LEU A CA    1 
ATOM   382  C C     . LEU A 1 48  ? 18.821 -18.232 11.725  1.00 94.68  ? 48  LEU A C     1 
ATOM   383  O O     . LEU A 1 48  ? 17.988 -19.110 11.485  1.00 100.19 ? 48  LEU A O     1 
ATOM   384  C CB    . LEU A 1 48  ? 20.947 -17.894 10.557  1.00 73.97  ? 48  LEU A CB    1 
ATOM   385  C CG    . LEU A 1 48  ? 22.454 -17.997 10.550  1.00 78.99  ? 48  LEU A CG    1 
ATOM   386  C CD1   . LEU A 1 48  ? 22.942 -18.032 9.135   1.00 77.22  ? 48  LEU A CD1   1 
ATOM   387  C CD2   . LEU A 1 48  ? 23.009 -16.799 11.283  1.00 87.08  ? 48  LEU A CD2   1 
ATOM   388  N N     . HIS A 1 49  ? 18.492 -16.972 11.976  1.00 104.94 ? 49  HIS A N     1 
ATOM   389  C CA    . HIS A 1 49  ? 17.102 -16.560 11.978  1.00 119.95 ? 49  HIS A CA    1 
ATOM   390  C C     . HIS A 1 49  ? 16.789 -15.749 10.740  1.00 121.35 ? 49  HIS A C     1 
ATOM   391  O O     . HIS A 1 49  ? 17.517 -14.812 10.408  1.00 123.59 ? 49  HIS A O     1 
ATOM   392  C CB    . HIS A 1 49  ? 16.769 -15.799 13.252  1.00 131.86 ? 49  HIS A CB    1 
ATOM   393  C CG    . HIS A 1 49  ? 16.564 -16.690 14.431  1.00 145.15 ? 49  HIS A CG    1 
ATOM   394  N ND1   . HIS A 1 49  ? 17.285 -16.564 15.598  1.00 152.22 ? 49  HIS A ND1   1 
ATOM   395  C CD2   . HIS A 1 49  ? 15.728 -17.741 14.617  1.00 152.90 ? 49  HIS A CD2   1 
ATOM   396  C CE1   . HIS A 1 49  ? 16.894 -17.487 16.457  1.00 161.22 ? 49  HIS A CE1   1 
ATOM   397  N NE2   . HIS A 1 49  ? 15.950 -18.216 15.885  1.00 162.31 ? 49  HIS A NE2   1 
ATOM   398  N N     . PRO A 1 50  ? 15.703 -16.126 10.045  1.00 113.61 ? 50  PRO A N     1 
ATOM   399  C CA    . PRO A 1 50  ? 15.315 -15.632 8.720   1.00 110.40 ? 50  PRO A CA    1 
ATOM   400  C C     . PRO A 1 50  ? 15.551 -14.134 8.496   1.00 111.70 ? 50  PRO A C     1 
ATOM   401  O O     . PRO A 1 50  ? 15.781 -13.717 7.357   1.00 122.77 ? 50  PRO A O     1 
ATOM   402  C CB    . PRO A 1 50  ? 13.825 -16.001 8.623   1.00 109.67 ? 50  PRO A CB    1 
ATOM   403  C CG    . PRO A 1 50  ? 13.483 -16.689 9.928   1.00 114.08 ? 50  PRO A CG    1 
ATOM   404  C CD    . PRO A 1 50  ? 14.761 -17.142 10.529  1.00 109.28 ? 50  PRO A CD    1 
ATOM   405  N N     . GLU A 1 51  ? 15.526 -13.346 9.560   1.00 129.79 ? 51  GLU A N     1 
ATOM   406  C CA    . GLU A 1 51  ? 15.734 -11.911 9.444   1.00 128.86 ? 51  GLU A CA    1 
ATOM   407  C C     . GLU A 1 51  ? 17.128 -11.518 9.907   1.00 118.13 ? 51  GLU A C     1 
ATOM   408  O O     . GLU A 1 51  ? 17.284 -10.670 10.787  1.00 120.15 ? 51  GLU A O     1 
ATOM   409  C CB    . GLU A 1 51  ? 14.683 -11.165 10.266  1.00 143.10 ? 51  GLU A CB    1 
ATOM   410  C CG    . GLU A 1 51  ? 13.714 -12.078 11.006  1.00 156.23 ? 51  GLU A CG    1 
ATOM   411  C CD    . GLU A 1 51  ? 14.406 -12.986 12.008  1.00 164.84 ? 51  GLU A CD    1 
ATOM   412  O OE1   . GLU A 1 51  ? 14.896 -12.479 13.040  1.00 167.03 ? 51  GLU A OE1   1 
ATOM   413  O OE2   . GLU A 1 51  ? 14.464 -14.209 11.756  1.00 167.79 ? 51  GLU A OE2   1 
ATOM   414  N N     . THR A 1 52  ? 18.143 -12.140 9.324   1.00 105.69 ? 52  THR A N     1 
ATOM   415  C CA    . THR A 1 52  ? 19.512 -11.904 9.768   1.00 108.90 ? 52  THR A CA    1 
ATOM   416  C C     . THR A 1 52  ? 20.401 -11.174 8.755   1.00 115.37 ? 52  THR A C     1 
ATOM   417  O O     . THR A 1 52  ? 20.295 -11.363 7.532   1.00 109.73 ? 52  THR A O     1 
ATOM   418  C CB    . THR A 1 52  ? 20.225 -13.208 10.148  1.00 105.45 ? 52  THR A CB    1 
ATOM   419  O OG1   . THR A 1 52  ? 21.631 -12.954 10.227  1.00 103.93 ? 52  THR A OG1   1 
ATOM   420  C CG2   . THR A 1 52  ? 19.993 -14.269 9.084   1.00 106.52 ? 52  THR A CG2   1 
ATOM   421  N N     . HIS A 1 53  ? 21.297 -10.358 9.295   1.00 117.71 ? 53  HIS A N     1 
ATOM   422  C CA    . HIS A 1 53  ? 22.230 -9.588  8.495   1.00 119.73 ? 53  HIS A CA    1 
ATOM   423  C C     . HIS A 1 53  ? 23.354 -10.448 7.938   1.00 108.59 ? 53  HIS A C     1 
ATOM   424  O O     . HIS A 1 53  ? 24.259 -9.939  7.276   1.00 111.13 ? 53  HIS A O     1 
ATOM   425  C CB    . HIS A 1 53  ? 22.818 -8.450  9.332   1.00 133.96 ? 53  HIS A CB    1 
ATOM   426  C CG    . HIS A 1 53  ? 22.048 -7.176  9.267   1.00 143.22 ? 53  HIS A CG    1 
ATOM   427  N ND1   . HIS A 1 53  ? 22.250 -6.119  10.125  1.00 142.82 ? 53  HIS A ND1   1 
ATOM   428  C CD2   . HIS A 1 53  ? 21.057 -6.768  8.414   1.00 144.80 ? 53  HIS A CD2   1 
ATOM   429  C CE1   . HIS A 1 53  ? 21.434 -5.131  9.827   1.00 144.96 ? 53  HIS A CE1   1 
ATOM   430  N NE2   . HIS A 1 53  ? 20.700 -5.502  8.790   1.00 146.50 ? 53  HIS A NE2   1 
ATOM   431  N N     . VAL A 1 54  ? 23.302 -11.749 8.199   1.00 99.36  ? 54  VAL A N     1 
ATOM   432  C CA    . VAL A 1 54  ? 24.366 -12.648 7.743   1.00 95.98  ? 54  VAL A CA    1 
ATOM   433  C C     . VAL A 1 54  ? 24.189 -13.150 6.296   1.00 102.25 ? 54  VAL A C     1 
ATOM   434  O O     . VAL A 1 54  ? 23.111 -13.603 5.913   1.00 105.79 ? 54  VAL A O     1 
ATOM   435  C CB    . VAL A 1 54  ? 24.530 -13.849 8.708   1.00 91.19  ? 54  VAL A CB    1 
ATOM   436  C CG1   . VAL A 1 54  ? 25.472 -14.886 8.107   1.00 83.68  ? 54  VAL A CG1   1 
ATOM   437  C CG2   . VAL A 1 54  ? 25.030 -13.384 10.050  1.00 84.89  ? 54  VAL A CG2   1 
ATOM   438  N N     . PRO A 1 55  ? 25.255 -13.072 5.488   1.00 100.76 ? 55  PRO A N     1 
ATOM   439  C CA    . PRO A 1 55  ? 25.152 -13.469 4.074   1.00 102.44 ? 55  PRO A CA    1 
ATOM   440  C C     . PRO A 1 55  ? 25.172 -14.985 3.880   1.00 105.38 ? 55  PRO A C     1 
ATOM   441  O O     . PRO A 1 55  ? 25.991 -15.514 3.129   1.00 101.85 ? 55  PRO A O     1 
ATOM   442  C CB    . PRO A 1 55  ? 26.395 -12.843 3.445   1.00 96.40  ? 55  PRO A CB    1 
ATOM   443  C CG    . PRO A 1 55  ? 27.392 -12.848 4.546   1.00 98.39  ? 55  PRO A CG    1 
ATOM   444  C CD    . PRO A 1 55  ? 26.602 -12.583 5.830   1.00 99.12  ? 55  PRO A CD    1 
ATOM   445  N N     . TRP A 1 56  ? 24.260 -15.675 4.552   1.00 74.18  ? 56  TRP A N     1 
ATOM   446  C CA    . TRP A 1 56  ? 24.168 -17.118 4.427   1.00 78.27  ? 56  TRP A CA    1 
ATOM   447  C C     . TRP A 1 56  ? 23.963 -17.558 2.982   1.00 81.11  ? 56  TRP A C     1 
ATOM   448  O O     . TRP A 1 56  ? 24.244 -18.709 2.648   1.00 84.61  ? 56  TRP A O     1 
ATOM   449  C CB    . TRP A 1 56  ? 23.032 -17.654 5.295   1.00 84.73  ? 56  TRP A CB    1 
ATOM   450  C CG    . TRP A 1 56  ? 21.730 -16.993 5.006   1.00 95.62  ? 56  TRP A CG    1 
ATOM   451  C CD1   . TRP A 1 56  ? 21.215 -15.895 5.627   1.00 104.68 ? 56  TRP A CD1   1 
ATOM   452  C CD2   . TRP A 1 56  ? 20.777 -17.374 4.008   1.00 94.32  ? 56  TRP A CD2   1 
ATOM   453  N NE1   . TRP A 1 56  ? 19.995 -15.576 5.085   1.00 106.88 ? 56  TRP A NE1   1 
ATOM   454  C CE2   . TRP A 1 56  ? 19.708 -16.465 4.089   1.00 96.29  ? 56  TRP A CE2   1 
ATOM   455  C CE3   . TRP A 1 56  ? 20.731 -18.394 3.057   1.00 94.36  ? 56  TRP A CE3   1 
ATOM   456  C CZ2   . TRP A 1 56  ? 18.602 -16.547 3.258   1.00 95.78  ? 56  TRP A CZ2   1 
ATOM   457  C CZ3   . TRP A 1 56  ? 19.627 -18.478 2.238   1.00 96.48  ? 56  TRP A CZ3   1 
ATOM   458  C CH2   . TRP A 1 56  ? 18.579 -17.558 2.339   1.00 97.18  ? 56  TRP A CH2   1 
ATOM   459  N N     . HIS A 1 57  ? 23.468 -16.658 2.130   1.00 76.60  ? 57  HIS A N     1 
ATOM   460  C CA    . HIS A 1 57  ? 23.255 -17.009 0.725   1.00 79.23  ? 57  HIS A CA    1 
ATOM   461  C C     . HIS A 1 57  ? 24.566 -17.126 -0.040  1.00 86.35  ? 57  HIS A C     1 
ATOM   462  O O     . HIS A 1 57  ? 24.611 -17.758 -1.091  1.00 85.21  ? 57  HIS A O     1 
ATOM   463  C CB    . HIS A 1 57  ? 22.345 -16.019 0.019   1.00 78.23  ? 57  HIS A CB    1 
ATOM   464  C CG    . HIS A 1 57  ? 22.816 -14.599 0.111   1.00 86.36  ? 57  HIS A CG    1 
ATOM   465  N ND1   . HIS A 1 57  ? 22.662 -13.849 1.251   1.00 92.04  ? 57  HIS A ND1   1 
ATOM   466  C CD2   . HIS A 1 57  ? 23.418 -13.809 -0.799  1.00 89.02  ? 57  HIS A CD2   1 
ATOM   467  C CE1   . HIS A 1 57  ? 23.160 -12.638 1.039   1.00 95.29  ? 57  HIS A CE1   1 
ATOM   468  N NE2   . HIS A 1 57  ? 23.622 -12.587 -0.190  1.00 93.83  ? 57  HIS A NE2   1 
ATOM   469  N N     . ARG A 1 58  ? 25.636 -16.541 0.489   1.00 82.09  ? 58  ARG A N     1 
ATOM   470  C CA    . ARG A 1 58  ? 26.915 -16.605 -0.200  1.00 71.90  ? 58  ARG A CA    1 
ATOM   471  C C     . ARG A 1 58  ? 27.663 -17.908 0.063   1.00 73.71  ? 58  ARG A C     1 
ATOM   472  O O     . ARG A 1 58  ? 28.866 -17.988 -0.169  1.00 80.24  ? 58  ARG A O     1 
ATOM   473  C CB    . ARG A 1 58  ? 27.774 -15.389 0.144   1.00 59.19  ? 58  ARG A CB    1 
ATOM   474  C CG    . ARG A 1 58  ? 26.979 -14.082 0.086   1.00 81.78  ? 58  ARG A CG    1 
ATOM   475  C CD    . ARG A 1 58  ? 27.805 -12.930 -0.463  1.00 85.26  ? 58  ARG A CD    1 
ATOM   476  N NE    . ARG A 1 58  ? 27.968 -11.822 0.478   1.00 89.54  ? 58  ARG A NE    1 
ATOM   477  C CZ    . ARG A 1 58  ? 27.054 -10.880 0.689   1.00 92.08  ? 58  ARG A CZ    1 
ATOM   478  N NH1   . ARG A 1 58  ? 25.902 -10.922 0.044   1.00 82.70  ? 58  ARG A NH1   1 
ATOM   479  N NH2   . ARG A 1 58  ? 27.287 -9.900  1.554   1.00 99.91  ? 58  ARG A NH2   1 
ATOM   480  N N     . VAL A 1 59  ? 26.958 -18.939 0.524   1.00 68.45  ? 59  VAL A N     1 
ATOM   481  C CA    . VAL A 1 59  ? 27.622 -20.193 0.878   1.00 67.76  ? 59  VAL A CA    1 
ATOM   482  C C     . VAL A 1 59  ? 27.011 -21.411 0.201   1.00 75.07  ? 59  VAL A C     1 
ATOM   483  O O     . VAL A 1 59  ? 25.850 -21.744 0.435   1.00 81.41  ? 59  VAL A O     1 
ATOM   484  C CB    . VAL A 1 59  ? 27.580 -20.427 2.388   1.00 69.75  ? 59  VAL A CB    1 
ATOM   485  C CG1   . VAL A 1 59  ? 28.486 -21.576 2.770   1.00 66.30  ? 59  VAL A CG1   1 
ATOM   486  C CG2   . VAL A 1 59  ? 28.004 -19.179 3.112   1.00 78.31  ? 59  VAL A CG2   1 
ATOM   487  N N     . ILE A 1 60  ? 27.802 -22.084 -0.629  1.00 78.25  ? 60  ILE A N     1 
ATOM   488  C CA    . ILE A 1 60  ? 27.332 -23.256 -1.372  1.00 69.59  ? 60  ILE A CA    1 
ATOM   489  C C     . ILE A 1 60  ? 28.325 -24.385 -1.234  1.00 60.23  ? 60  ILE A C     1 
ATOM   490  O O     . ILE A 1 60  ? 29.262 -24.284 -0.462  1.00 76.11  ? 60  ILE A O     1 
ATOM   491  C CB    . ILE A 1 60  ? 27.159 -22.963 -2.871  1.00 69.50  ? 60  ILE A CB    1 
ATOM   492  C CG1   . ILE A 1 60  ? 28.518 -22.800 -3.548  1.00 82.99  ? 60  ILE A CG1   1 
ATOM   493  C CG2   . ILE A 1 60  ? 26.299 -21.730 -3.083  1.00 65.56  ? 60  ILE A CG2   1 
ATOM   494  C CD1   . ILE A 1 60  ? 28.426 -22.727 -5.063  1.00 93.50  ? 60  ILE A CD1   1 
ATOM   495  N N     . ASN A 1 61  ? 28.133 -25.453 -1.998  1.00 77.42  ? 61  ASN A N     1 
ATOM   496  C CA    . ASN A 1 61  ? 28.982 -26.635 -1.886  1.00 79.48  ? 61  ASN A CA    1 
ATOM   497  C C     . ASN A 1 61  ? 30.229 -26.665 -2.787  1.00 80.63  ? 61  ASN A C     1 
ATOM   498  O O     . ASN A 1 61  ? 30.381 -25.883 -3.728  1.00 69.10  ? 61  ASN A O     1 
ATOM   499  C CB    . ASN A 1 61  ? 28.155 -27.891 -2.128  1.00 86.57  ? 61  ASN A CB    1 
ATOM   500  C CG    . ASN A 1 61  ? 27.598 -27.950 -3.533  1.00 90.88  ? 61  ASN A CG    1 
ATOM   501  O OD1   . ASN A 1 61  ? 28.286 -27.592 -4.499  1.00 80.04  ? 61  ASN A OD1   1 
ATOM   502  N ND2   . ASN A 1 61  ? 26.342 -28.386 -3.659  1.00 91.40  ? 61  ASN A ND2   1 
ATOM   503  N N     . SER A 1 62  ? 31.109 -27.605 -2.466  1.00 89.21  ? 62  SER A N     1 
ATOM   504  C CA    . SER A 1 62  ? 32.386 -27.775 -3.127  1.00 90.56  ? 62  SER A CA    1 
ATOM   505  C C     . SER A 1 62  ? 32.199 -27.886 -4.621  1.00 87.98  ? 62  SER A C     1 
ATOM   506  O O     . SER A 1 62  ? 33.019 -27.395 -5.388  1.00 89.14  ? 62  SER A O     1 
ATOM   507  C CB    . SER A 1 62  ? 33.029 -29.066 -2.633  1.00 104.29 ? 62  SER A CB    1 
ATOM   508  O OG    . SER A 1 62  ? 32.309 -30.194 -3.116  1.00 113.20 ? 62  SER A OG    1 
ATOM   509  N N     . ARG A 1 63  ? 31.125 -28.558 -5.025  1.00 80.94  ? 63  ARG A N     1 
ATOM   510  C CA    . ARG A 1 63  ? 30.858 -28.813 -6.433  1.00 81.38  ? 63  ARG A CA    1 
ATOM   511  C C     . ARG A 1 63  ? 30.340 -27.588 -7.189  1.00 80.53  ? 63  ARG A C     1 
ATOM   512  O O     . ARG A 1 63  ? 30.059 -27.665 -8.381  1.00 86.72  ? 63  ARG A O     1 
ATOM   513  C CB    . ARG A 1 63  ? 29.871 -29.966 -6.570  1.00 78.81  ? 63  ARG A CB    1 
ATOM   514  C CG    . ARG A 1 63  ? 30.477 -31.307 -6.253  1.00 113.20 ? 63  ARG A CG    1 
ATOM   515  C CD    . ARG A 1 63  ? 29.389 -32.331 -5.940  1.00 128.03 ? 63  ARG A CD    1 
ATOM   516  N NE    . ARG A 1 63  ? 28.235 -32.200 -6.824  1.00 135.28 ? 63  ARG A NE    1 
ATOM   517  C CZ    . ARG A 1 63  ? 27.056 -31.710 -6.450  1.00 139.85 ? 63  ARG A CZ    1 
ATOM   518  N NH1   . ARG A 1 63  ? 26.863 -31.310 -5.197  1.00 136.92 ? 63  ARG A NH1   1 
ATOM   519  N NH2   . ARG A 1 63  ? 26.067 -31.627 -7.332  1.00 142.06 ? 63  ARG A NH2   1 
ATOM   520  N N     . GLY A 1 64  ? 30.218 -26.464 -6.495  1.00 80.79  ? 64  GLY A N     1 
ATOM   521  C CA    . GLY A 1 64  ? 29.736 -25.236 -7.100  1.00 75.90  ? 64  GLY A CA    1 
ATOM   522  C C     . GLY A 1 64  ? 28.232 -25.202 -7.310  1.00 87.76  ? 64  GLY A C     1 
ATOM   523  O O     . GLY A 1 64  ? 27.728 -24.360 -8.047  1.00 101.34 ? 64  GLY A O     1 
ATOM   524  N N     . THR A 1 65  ? 27.501 -26.109 -6.674  1.00 86.29  ? 65  THR A N     1 
ATOM   525  C CA    . THR A 1 65  ? 26.048 -26.116 -6.826  1.00 89.15  ? 65  THR A CA    1 
ATOM   526  C C     . THR A 1 65  ? 25.325 -25.596 -5.571  1.00 88.20  ? 65  THR A C     1 
ATOM   527  O O     . THR A 1 65  ? 25.957 -25.240 -4.586  1.00 90.86  ? 65  THR A O     1 
ATOM   528  C CB    . THR A 1 65  ? 25.510 -27.516 -7.220  1.00 95.01  ? 65  THR A CB    1 
ATOM   529  O OG1   . THR A 1 65  ? 24.846 -28.118 -6.102  1.00 103.95 ? 65  THR A OG1   1 
ATOM   530  C CG2   . THR A 1 65  ? 26.638 -28.414 -7.686  1.00 92.94  ? 65  THR A CG2   1 
ATOM   531  N N     . ILE A 1 66  ? 24.001 -25.517 -5.629  1.00 87.30  ? 66  ILE A N     1 
ATOM   532  C CA    . ILE A 1 66  ? 23.202 -25.183 -4.458  1.00 94.36  ? 66  ILE A CA    1 
ATOM   533  C C     . ILE A 1 66  ? 22.543 -26.463 -3.947  1.00 109.09 ? 66  ILE A C     1 
ATOM   534  O O     . ILE A 1 66  ? 21.932 -27.220 -4.711  1.00 111.11 ? 66  ILE A O     1 
ATOM   535  C CB    . ILE A 1 66  ? 22.152 -24.087 -4.756  1.00 95.34  ? 66  ILE A CB    1 
ATOM   536  C CG1   . ILE A 1 66  ? 22.849 -22.760 -5.070  1.00 91.00  ? 66  ILE A CG1   1 
ATOM   537  C CG2   . ILE A 1 66  ? 21.186 -23.916 -3.579  1.00 86.61  ? 66  ILE A CG2   1 
ATOM   538  C CD1   . ILE A 1 66  ? 21.889 -21.575 -5.180  1.00 97.43  ? 66  ILE A CD1   1 
ATOM   539  N N     . SER A 1 67  ? 22.674 -26.696 -2.647  1.00 117.39 ? 67  SER A N     1 
ATOM   540  C CA    . SER A 1 67  ? 22.414 -28.005 -2.066  1.00 114.52 ? 67  SER A CA    1 
ATOM   541  C C     . SER A 1 67  ? 20.965 -28.221 -1.692  1.00 112.21 ? 67  SER A C     1 
ATOM   542  O O     . SER A 1 67  ? 20.360 -27.374 -1.053  1.00 101.98 ? 67  SER A O     1 
ATOM   543  C CB    . SER A 1 67  ? 23.281 -28.159 -0.834  1.00 105.47 ? 67  SER A CB    1 
ATOM   544  O OG    . SER A 1 67  ? 24.003 -26.959 -0.646  1.00 99.10  ? 67  SER A OG    1 
ATOM   545  N N     . LYS A 1 68  ? 20.419 -29.367 -2.087  1.00 128.25 ? 68  LYS A N     1 
ATOM   546  C CA    . LYS A 1 68  ? 19.048 -29.733 -1.743  1.00 135.88 ? 68  LYS A CA    1 
ATOM   547  C C     . LYS A 1 68  ? 18.873 -29.813 -0.225  1.00 132.55 ? 68  LYS A C     1 
ATOM   548  O O     . LYS A 1 68  ? 19.733 -30.338 0.485   1.00 129.53 ? 68  LYS A O     1 
ATOM   549  C CB    . LYS A 1 68  ? 18.668 -31.073 -2.388  1.00 148.96 ? 68  LYS A CB    1 
ATOM   550  C CG    . LYS A 1 68  ? 18.390 -31.021 -3.891  1.00 165.04 ? 68  LYS A CG    1 
ATOM   551  C CD    . LYS A 1 68  ? 19.616 -30.600 -4.700  1.00 171.56 ? 68  LYS A CD    1 
ATOM   552  C CE    . LYS A 1 68  ? 20.794 -31.548 -4.490  1.00 175.15 ? 68  LYS A CE    1 
ATOM   553  N NZ    . LYS A 1 68  ? 22.082 -30.950 -4.949  1.00 171.12 ? 68  LYS A NZ    1 
ATOM   554  N N     . ARG A 1 69  ? 17.757 -29.286 0.268   1.00 130.87 ? 69  ARG A N     1 
ATOM   555  C CA    . ARG A 1 69  ? 17.459 -29.320 1.692   1.00 127.16 ? 69  ARG A CA    1 
ATOM   556  C C     . ARG A 1 69  ? 16.536 -30.482 2.004   1.00 150.22 ? 69  ARG A C     1 
ATOM   557  O O     . ARG A 1 69  ? 15.441 -30.574 1.445   1.00 155.40 ? 69  ARG A O     1 
ATOM   558  C CB    . ARG A 1 69  ? 16.754 -28.037 2.119   1.00 109.22 ? 69  ARG A CB    1 
ATOM   559  C CG    . ARG A 1 69  ? 17.347 -26.769 1.563   1.00 98.06  ? 69  ARG A CG    1 
ATOM   560  C CD    . ARG A 1 69  ? 18.736 -26.537 2.088   1.00 94.03  ? 69  ARG A CD    1 
ATOM   561  N NE    . ARG A 1 69  ? 19.068 -25.115 2.095   1.00 98.30  ? 69  ARG A NE    1 
ATOM   562  C CZ    . ARG A 1 69  ? 19.758 -24.489 1.141   1.00 106.97 ? 69  ARG A CZ    1 
ATOM   563  N NH1   . ARG A 1 69  ? 20.202 -25.153 0.080   1.00 118.64 ? 69  ARG A NH1   1 
ATOM   564  N NH2   . ARG A 1 69  ? 20.014 -23.190 1.252   1.00 96.98  ? 69  ARG A NH2   1 
ATOM   565  N N     . ASP A 1 70  ? 16.966 -31.359 2.906   1.00 165.55 ? 70  ASP A N     1 
ATOM   566  C CA    . ASP A 1 70  ? 16.105 -32.446 3.370   1.00 179.45 ? 70  ASP A CA    1 
ATOM   567  C C     . ASP A 1 70  ? 14.884 -31.885 4.121   1.00 168.42 ? 70  ASP A C     1 
ATOM   568  O O     . ASP A 1 70  ? 13.853 -32.553 4.245   1.00 172.26 ? 70  ASP A O     1 
ATOM   569  C CB    . ASP A 1 70  ? 16.887 -33.462 4.220   1.00 186.08 ? 70  ASP A CB    1 
ATOM   570  C CG    . ASP A 1 70  ? 17.929 -34.237 3.409   1.00 192.59 ? 70  ASP A CG    1 
ATOM   571  O OD1   . ASP A 1 70  ? 18.820 -34.862 4.027   1.00 192.51 ? 70  ASP A OD1   1 
ATOM   572  O OD2   . ASP A 1 70  ? 17.861 -34.224 2.158   1.00 195.37 ? 70  ASP A OD2   1 
ATOM   573  N N     . ILE A 1 71  ? 15.016 -30.656 4.619   1.00 151.71 ? 71  ILE A N     1 
ATOM   574  C CA    . ILE A 1 71  ? 13.870 -29.873 5.078   1.00 141.67 ? 71  ILE A CA    1 
ATOM   575  C C     . ILE A 1 71  ? 13.975 -28.463 4.487   1.00 130.05 ? 71  ILE A C     1 
ATOM   576  O O     . ILE A 1 71  ? 15.052 -27.866 4.484   1.00 121.02 ? 71  ILE A O     1 
ATOM   577  C CB    . ILE A 1 71  ? 13.790 -29.740 6.632   1.00 159.27 ? 71  ILE A CB    1 
ATOM   578  C CG1   . ILE A 1 71  ? 14.466 -30.916 7.351   1.00 161.86 ? 71  ILE A CG1   1 
ATOM   579  C CG2   . ILE A 1 71  ? 12.338 -29.559 7.088   1.00 152.82 ? 71  ILE A CG2   1 
ATOM   580  C CD1   . ILE A 1 71  ? 14.608 -30.713 8.863   1.00 149.58 ? 71  ILE A CD1   1 
ATOM   581  N N     . SER A 1 72  ? 12.863 -27.947 3.971   1.00 128.16 ? 72  SER A N     1 
ATOM   582  C CA    . SER A 1 72  ? 12.757 -26.530 3.620   1.00 117.85 ? 72  SER A CA    1 
ATOM   583  C C     . SER A 1 72  ? 13.342 -26.143 2.254   1.00 113.81 ? 72  SER A C     1 
ATOM   584  O O     . SER A 1 72  ? 14.480 -25.697 2.156   1.00 103.44 ? 72  SER A O     1 
ATOM   585  C CB    . SER A 1 72  ? 13.368 -25.669 4.733   1.00 112.59 ? 72  SER A CB    1 
ATOM   586  O OG    . SER A 1 72  ? 13.557 -24.330 4.314   1.00 115.20 ? 72  SER A OG    1 
ATOM   587  N N     . ALA A 1 73  ? 12.545 -26.288 1.202   1.00 120.25 ? 73  ALA A N     1 
ATOM   588  C CA    . ALA A 1 73  ? 12.981 -25.866 -0.121  1.00 114.49 ? 73  ALA A CA    1 
ATOM   589  C C     . ALA A 1 73  ? 12.975 -24.341 -0.223  1.00 104.18 ? 73  ALA A C     1 
ATOM   590  O O     . ALA A 1 73  ? 12.132 -23.742 -0.869  1.00 95.93  ? 73  ALA A O     1 
ATOM   591  C CB    . ALA A 1 73  ? 12.117 -26.490 -1.190  1.00 122.20 ? 73  ALA A CB    1 
ATOM   592  N N     . GLY A 1 74  ? 13.910 -23.713 0.465   1.00 112.83 ? 74  GLY A N     1 
ATOM   593  C CA    . GLY A 1 74  ? 14.168 -22.306 0.257   1.00 121.50 ? 74  GLY A CA    1 
ATOM   594  C C     . GLY A 1 74  ? 15.551 -22.240 -0.353  1.00 133.60 ? 74  GLY A C     1 
ATOM   595  O O     . GLY A 1 74  ? 16.302 -21.288 -0.143  1.00 128.39 ? 74  GLY A O     1 
ATOM   596  N N     . GLU A 1 75  ? 15.908 -23.295 -1.079  1.00 139.05 ? 75  GLU A N     1 
ATOM   597  C CA    . GLU A 1 75  ? 17.135 -23.301 -1.861  1.00 128.76 ? 75  GLU A CA    1 
ATOM   598  C C     . GLU A 1 75  ? 16.844 -22.388 -3.021  1.00 118.31 ? 75  GLU A C     1 
ATOM   599  O O     . GLU A 1 75  ? 17.739 -21.824 -3.643  1.00 114.68 ? 75  GLU A O     1 
ATOM   600  C CB    . GLU A 1 75  ? 17.458 -24.705 -2.366  1.00 125.44 ? 75  GLU A CB    1 
ATOM   601  C CG    . GLU A 1 75  ? 16.590 -25.181 -3.517  1.00 128.98 ? 75  GLU A CG    1 
ATOM   602  C CD    . GLU A 1 75  ? 16.870 -26.624 -3.889  1.00 137.82 ? 75  GLU A CD    1 
ATOM   603  O OE1   . GLU A 1 75  ? 17.066 -27.435 -2.961  1.00 145.16 ? 75  GLU A OE1   1 
ATOM   604  O OE2   . GLU A 1 75  ? 16.901 -26.947 -5.101  1.00 132.85 ? 75  GLU A OE2   1 
ATOM   605  N N     . GLN A 1 76  ? 15.554 -22.253 -3.294  1.00 115.90 ? 76  GLN A N     1 
ATOM   606  C CA    . GLN A 1 76  ? 15.071 -21.299 -4.266  1.00 113.35 ? 76  GLN A CA    1 
ATOM   607  C C     . GLN A 1 76  ? 15.422 -19.912 -3.761  1.00 116.04 ? 76  GLN A C     1 
ATOM   608  O O     . GLN A 1 76  ? 15.965 -19.078 -4.490  1.00 115.92 ? 76  GLN A O     1 
ATOM   609  C CB    . GLN A 1 76  ? 13.557 -21.426 -4.411  1.00 106.68 ? 76  GLN A CB    1 
ATOM   610  C CG    . GLN A 1 76  ? 13.077 -21.186 -5.816  1.00 104.43 ? 76  GLN A CG    1 
ATOM   611  C CD    . GLN A 1 76  ? 13.698 -22.162 -6.791  1.00 106.01 ? 76  GLN A CD    1 
ATOM   612  O OE1   . GLN A 1 76  ? 14.075 -21.796 -7.906  1.00 102.89 ? 76  GLN A OE1   1 
ATOM   613  N NE2   . GLN A 1 76  ? 13.816 -23.417 -6.371  1.00 108.59 ? 76  GLN A NE2   1 
ATOM   614  N N     . ARG A 1 77  ? 15.114 -19.684 -2.492  1.00 115.66 ? 77  ARG A N     1 
ATOM   615  C CA    . ARG A 1 77  ? 15.339 -18.395 -1.870  1.00 117.48 ? 77  ARG A CA    1 
ATOM   616  C C     . ARG A 1 77  ? 16.840 -18.077 -1.885  1.00 116.52 ? 77  ARG A C     1 
ATOM   617  O O     . ARG A 1 77  ? 17.235 -16.917 -1.758  1.00 127.47 ? 77  ARG A O     1 
ATOM   618  C CB    . ARG A 1 77  ? 14.754 -18.414 -0.450  1.00 126.82 ? 77  ARG A CB    1 
ATOM   619  C CG    . ARG A 1 77  ? 14.872 -17.134 0.379   1.00 135.07 ? 77  ARG A CG    1 
ATOM   620  C CD    . ARG A 1 77  ? 14.695 -17.482 1.865   1.00 140.08 ? 77  ARG A CD    1 
ATOM   621  N NE    . ARG A 1 77  ? 14.633 -16.320 2.751   1.00 145.92 ? 77  ARG A NE    1 
ATOM   622  C CZ    . ARG A 1 77  ? 14.915 -16.349 4.054   1.00 152.42 ? 77  ARG A CZ    1 
ATOM   623  N NH1   . ARG A 1 77  ? 15.299 -17.480 4.635   1.00 147.58 ? 77  ARG A NH1   1 
ATOM   624  N NH2   . ARG A 1 77  ? 14.833 -15.240 4.780   1.00 157.35 ? 77  ARG A NH2   1 
ATOM   625  N N     . GLN A 1 78  ? 17.680 -19.096 -2.067  1.00 101.64 ? 78  GLN A N     1 
ATOM   626  C CA    . GLN A 1 78  ? 19.122 -18.857 -2.082  1.00 102.64 ? 78  GLN A CA    1 
ATOM   627  C C     . GLN A 1 78  ? 19.599 -18.422 -3.465  1.00 109.33 ? 78  GLN A C     1 
ATOM   628  O O     . GLN A 1 78  ? 20.429 -17.513 -3.586  1.00 104.57 ? 78  GLN A O     1 
ATOM   629  C CB    . GLN A 1 78  ? 19.912 -20.080 -1.609  1.00 93.53  ? 78  GLN A CB    1 
ATOM   630  C CG    . GLN A 1 78  ? 21.410 -19.828 -1.571  1.00 87.01  ? 78  GLN A CG    1 
ATOM   631  C CD    . GLN A 1 78  ? 22.216 -20.978 -0.977  1.00 94.74  ? 78  GLN A CD    1 
ATOM   632  O OE1   . GLN A 1 78  ? 21.742 -22.112 -0.890  1.00 93.86  ? 78  GLN A OE1   1 
ATOM   633  N NE2   . GLN A 1 78  ? 23.454 -20.686 -0.575  1.00 86.23  ? 78  GLN A NE2   1 
ATOM   634  N N     . LYS A 1 79  ? 19.081 -19.082 -4.501  1.00 115.92 ? 79  LYS A N     1 
ATOM   635  C CA    . LYS A 1 79  ? 19.345 -18.681 -5.882  1.00 115.27 ? 79  LYS A CA    1 
ATOM   636  C C     . LYS A 1 79  ? 18.977 -17.218 -6.094  1.00 112.46 ? 79  LYS A C     1 
ATOM   637  O O     . LYS A 1 79  ? 19.799 -16.421 -6.541  1.00 120.68 ? 79  LYS A O     1 
ATOM   638  C CB    . LYS A 1 79  ? 18.545 -19.535 -6.862  1.00 115.44 ? 79  LYS A CB    1 
ATOM   639  C CG    . LYS A 1 79  ? 18.627 -19.043 -8.304  1.00 119.60 ? 79  LYS A CG    1 
ATOM   640  C CD    . LYS A 1 79  ? 17.283 -19.170 -9.030  1.00 125.08 ? 79  LYS A CD    1 
ATOM   641  C CE    . LYS A 1 79  ? 17.371 -18.681 -10.483 1.00 125.19 ? 79  LYS A CE    1 
ATOM   642  N NZ    . LYS A 1 79  ? 16.038 -18.505 -11.148 1.00 121.36 ? 79  LYS A NZ    1 
ATOM   643  N N     . ASP A 1 80  ? 17.737 -16.872 -5.764  1.00 132.36 ? 80  ASP A N     1 
ATOM   644  C CA    . ASP A 1 80  ? 17.259 -15.507 -5.928  1.00 128.02 ? 80  ASP A CA    1 
ATOM   645  C C     . ASP A 1 80  ? 18.245 -14.514 -5.322  1.00 119.65 ? 80  ASP A C     1 
ATOM   646  O O     . ASP A 1 80  ? 18.724 -13.608 -6.001  1.00 117.31 ? 80  ASP A O     1 
ATOM   647  C CB    . ASP A 1 80  ? 15.878 -15.339 -5.287  1.00 139.80 ? 80  ASP A CB    1 
ATOM   648  C CG    . ASP A 1 80  ? 14.935 -14.488 -6.134  1.00 154.21 ? 80  ASP A CG    1 
ATOM   649  O OD1   . ASP A 1 80  ? 13.716 -14.475 -5.845  1.00 157.17 ? 80  ASP A OD1   1 
ATOM   650  O OD2   . ASP A 1 80  ? 15.409 -13.841 -7.096  1.00 159.07 ? 80  ASP A OD2   1 
ATOM   651  N N     . ARG A 1 81  ? 18.558 -14.701 -4.045  1.00 119.79 ? 81  ARG A N     1 
ATOM   652  C CA    . ARG A 1 81  ? 19.467 -13.809 -3.331  1.00 115.46 ? 81  ARG A CA    1 
ATOM   653  C C     . ARG A 1 81  ? 20.773 -13.597 -4.093  1.00 107.77 ? 81  ARG A C     1 
ATOM   654  O O     . ARG A 1 81  ? 21.361 -12.516 -4.058  1.00 107.22 ? 81  ARG A O     1 
ATOM   655  C CB    . ARG A 1 81  ? 19.730 -14.344 -1.919  1.00 111.27 ? 81  ARG A CB    1 
ATOM   656  C CG    . ARG A 1 81  ? 18.487 -14.340 -1.032  1.00 119.01 ? 81  ARG A CG    1 
ATOM   657  C CD    . ARG A 1 81  ? 18.259 -12.984 -0.361  1.00 125.54 ? 81  ARG A CD    1 
ATOM   658  N NE    . ARG A 1 81  ? 19.107 -12.846 0.819   1.00 132.32 ? 81  ARG A NE    1 
ATOM   659  C CZ    . ARG A 1 81  ? 18.698 -13.058 2.066   1.00 132.33 ? 81  ARG A CZ    1 
ATOM   660  N NH1   . ARG A 1 81  ? 17.435 -13.390 2.306   1.00 134.36 ? 81  ARG A NH1   1 
ATOM   661  N NH2   . ARG A 1 81  ? 19.551 -12.925 3.074   1.00 126.44 ? 81  ARG A NH2   1 
ATOM   662  N N     . LEU A 1 82  ? 21.213 -14.629 -4.798  1.00 100.11 ? 82  LEU A N     1 
ATOM   663  C CA    . LEU A 1 82  ? 22.456 -14.556 -5.544  1.00 96.93  ? 82  LEU A CA    1 
ATOM   664  C C     . LEU A 1 82  ? 22.281 -13.783 -6.834  1.00 110.52 ? 82  LEU A C     1 
ATOM   665  O O     . LEU A 1 82  ? 23.098 -12.923 -7.169  1.00 114.47 ? 82  LEU A O     1 
ATOM   666  C CB    . LEU A 1 82  ? 22.972 -15.959 -5.841  1.00 94.75  ? 82  LEU A CB    1 
ATOM   667  C CG    . LEU A 1 82  ? 23.732 -16.603 -4.679  1.00 94.79  ? 82  LEU A CG    1 
ATOM   668  C CD1   . LEU A 1 82  ? 23.621 -18.124 -4.705  1.00 88.17  ? 82  LEU A CD1   1 
ATOM   669  C CD2   . LEU A 1 82  ? 25.198 -16.157 -4.697  1.00 88.91  ? 82  LEU A CD2   1 
ATOM   670  N N     . GLU A 1 83  ? 21.209 -14.094 -7.556  1.00 118.21 ? 83  GLU A N     1 
ATOM   671  C CA    . GLU A 1 83  ? 20.966 -13.476 -8.853  1.00 112.29 ? 83  GLU A CA    1 
ATOM   672  C C     . GLU A 1 83  ? 20.939 -11.960 -8.712  1.00 116.54 ? 83  GLU A C     1 
ATOM   673  O O     . GLU A 1 83  ? 21.382 -11.243 -9.598  1.00 125.37 ? 83  GLU A O     1 
ATOM   674  C CB    . GLU A 1 83  ? 19.682 -14.016 -9.507  1.00 112.19 ? 83  GLU A CB    1 
ATOM   675  C CG    . GLU A 1 83  ? 19.806 -15.445 -10.075 1.00 116.09 ? 83  GLU A CG    1 
ATOM   676  C CD    . GLU A 1 83  ? 19.102 -15.629 -11.428 1.00 135.02 ? 83  GLU A CD    1 
ATOM   677  O OE1   . GLU A 1 83  ? 17.889 -15.330 -11.528 1.00 140.52 ? 83  GLU A OE1   1 
ATOM   678  O OE2   . GLU A 1 83  ? 19.767 -16.071 -12.398 1.00 139.14 ? 83  GLU A OE2   1 
ATOM   679  N N     . GLU A 1 84  ? 20.445 -11.472 -7.583  1.00 121.04 ? 84  GLU A N     1 
ATOM   680  C CA    . GLU A 1 84  ? 20.444 -10.036 -7.333  1.00 129.76 ? 84  GLU A CA    1 
ATOM   681  C C     . GLU A 1 84  ? 21.858 -9.495  -7.195  1.00 126.38 ? 84  GLU A C     1 
ATOM   682  O O     . GLU A 1 84  ? 22.130 -8.346  -7.538  1.00 125.74 ? 84  GLU A O     1 
ATOM   683  C CB    . GLU A 1 84  ? 19.631 -9.711  -6.086  1.00 139.32 ? 84  GLU A CB    1 
ATOM   684  C CG    . GLU A 1 84  ? 18.139 -9.885  -6.282  1.00 155.84 ? 84  GLU A CG    1 
ATOM   685  C CD    . GLU A 1 84  ? 17.463 -10.490 -5.069  1.00 163.54 ? 84  GLU A CD    1 
ATOM   686  O OE1   . GLU A 1 84  ? 16.434 -9.935  -4.619  1.00 168.91 ? 84  GLU A OE1   1 
ATOM   687  O OE2   . GLU A 1 84  ? 17.960 -11.525 -4.573  1.00 160.66 ? 84  GLU A OE2   1 
ATOM   688  N N     . GLU A 1 85  ? 22.757 -10.325 -6.683  1.00 125.03 ? 85  GLU A N     1 
ATOM   689  C CA    . GLU A 1 85  ? 24.147 -9.933  -6.548  1.00 123.08 ? 85  GLU A CA    1 
ATOM   690  C C     . GLU A 1 85  ? 24.820 -10.152 -7.881  1.00 124.17 ? 85  GLU A C     1 
ATOM   691  O O     . GLU A 1 85  ? 26.003 -9.875  -8.049  1.00 126.81 ? 85  GLU A O     1 
ATOM   692  C CB    . GLU A 1 85  ? 24.833 -10.741 -5.453  1.00 124.42 ? 85  GLU A CB    1 
ATOM   693  C CG    . GLU A 1 85  ? 24.011 -10.789 -4.184  1.00 134.47 ? 85  GLU A CG    1 
ATOM   694  C CD    . GLU A 1 85  ? 24.852 -10.835 -2.926  1.00 137.72 ? 85  GLU A CD    1 
ATOM   695  O OE1   . GLU A 1 85  ? 26.084 -11.023 -3.025  1.00 137.87 ? 85  GLU A OE1   1 
ATOM   696  O OE2   . GLU A 1 85  ? 24.271 -10.677 -1.833  1.00 139.80 ? 85  GLU A OE2   1 
ATOM   697  N N     . GLY A 1 86  ? 24.049 -10.654 -8.836  1.00 124.49 ? 86  GLY A N     1 
ATOM   698  C CA    . GLY A 1 86  ? 24.537 -10.809 -10.194 1.00 133.02 ? 86  GLY A CA    1 
ATOM   699  C C     . GLY A 1 86  ? 25.392 -12.044 -10.356 1.00 125.80 ? 86  GLY A C     1 
ATOM   700  O O     . GLY A 1 86  ? 26.616 -11.963 -10.478 1.00 123.67 ? 86  GLY A O     1 
ATOM   701  N N     . VAL A 1 87  ? 24.735 -13.195 -10.370 1.00 118.51 ? 87  VAL A N     1 
ATOM   702  C CA    . VAL A 1 87  ? 25.448 -14.457 -10.392 1.00 116.45 ? 87  VAL A CA    1 
ATOM   703  C C     . VAL A 1 87  ? 24.848 -15.452 -11.388 1.00 121.94 ? 87  VAL A C     1 
ATOM   704  O O     . VAL A 1 87  ? 23.764 -16.002 -11.173 1.00 119.31 ? 87  VAL A O     1 
ATOM   705  C CB    . VAL A 1 87  ? 25.551 -15.040 -8.969  1.00 102.60 ? 87  VAL A CB    1 
ATOM   706  C CG1   . VAL A 1 87  ? 25.551 -16.554 -8.996  1.00 95.34  ? 87  VAL A CG1   1 
ATOM   707  C CG2   . VAL A 1 87  ? 26.800 -14.487 -8.279  1.00 91.48  ? 87  VAL A CG2   1 
ATOM   708  N N     . GLU A 1 88  ? 25.558 -15.656 -12.494 1.00 125.94 ? 88  GLU A N     1 
ATOM   709  C CA    . GLU A 1 88  ? 25.084 -16.546 -13.541 1.00 129.47 ? 88  GLU A CA    1 
ATOM   710  C C     . GLU A 1 88  ? 24.903 -17.920 -12.943 1.00 116.37 ? 88  GLU A C     1 
ATOM   711  O O     . GLU A 1 88  ? 25.872 -18.556 -12.517 1.00 111.24 ? 88  GLU A O     1 
ATOM   712  C CB    . GLU A 1 88  ? 26.081 -16.605 -14.701 1.00 145.61 ? 88  GLU A CB    1 
ATOM   713  C CG    . GLU A 1 88  ? 25.544 -17.263 -15.963 1.00 154.16 ? 88  GLU A CG    1 
ATOM   714  C CD    . GLU A 1 88  ? 24.480 -16.427 -16.647 1.00 161.37 ? 88  GLU A CD    1 
ATOM   715  O OE1   . GLU A 1 88  ? 23.359 -16.329 -16.106 1.00 160.42 ? 88  GLU A OE1   1 
ATOM   716  O OE2   . GLU A 1 88  ? 24.763 -15.867 -17.727 1.00 169.70 ? 88  GLU A OE2   1 
ATOM   717  N N     . ILE A 1 89  ? 23.655 -18.369 -12.903 1.00 111.73 ? 89  ILE A N     1 
ATOM   718  C CA    . ILE A 1 89  ? 23.336 -19.657 -12.313 1.00 111.89 ? 89  ILE A CA    1 
ATOM   719  C C     . ILE A 1 89  ? 22.571 -20.516 -13.291 1.00 114.27 ? 89  ILE A C     1 
ATOM   720  O O     . ILE A 1 89  ? 21.507 -20.126 -13.768 1.00 116.68 ? 89  ILE A O     1 
ATOM   721  C CB    . ILE A 1 89  ? 22.510 -19.492 -11.024 1.00 108.28 ? 89  ILE A CB    1 
ATOM   722  C CG1   . ILE A 1 89  ? 23.420 -19.115 -9.869  1.00 99.00  ? 89  ILE A CG1   1 
ATOM   723  C CG2   . ILE A 1 89  ? 21.801 -20.777 -10.652 1.00 105.58 ? 89  ILE A CG2   1 
ATOM   724  C CD1   . ILE A 1 89  ? 22.657 -18.792 -8.660  1.00 96.40  ? 89  ILE A CD1   1 
ATOM   725  N N     . TYR A 1 90  ? 23.113 -21.688 -13.592 1.00 117.73 ? 90  TYR A N     1 
ATOM   726  C CA    . TYR A 1 90  ? 22.433 -22.590 -14.509 1.00 124.76 ? 90  TYR A CA    1 
ATOM   727  C C     . TYR A 1 90  ? 21.958 -23.868 -13.853 1.00 126.00 ? 90  TYR A C     1 
ATOM   728  O O     . TYR A 1 90  ? 22.709 -24.533 -13.139 1.00 126.89 ? 90  TYR A O     1 
ATOM   729  C CB    . TYR A 1 90  ? 23.292 -22.918 -15.734 1.00 125.30 ? 90  TYR A CB    1 
ATOM   730  C CG    . TYR A 1 90  ? 24.698 -23.432 -15.470 1.00 124.48 ? 90  TYR A CG    1 
ATOM   731  C CD1   . TYR A 1 90  ? 25.725 -22.558 -15.106 1.00 123.65 ? 90  TYR A CD1   1 
ATOM   732  C CD2   . TYR A 1 90  ? 25.014 -24.780 -15.649 1.00 126.35 ? 90  TYR A CD2   1 
ATOM   733  C CE1   . TYR A 1 90  ? 27.028 -23.020 -14.891 1.00 129.60 ? 90  TYR A CE1   1 
ATOM   734  C CE2   . TYR A 1 90  ? 26.311 -25.253 -15.439 1.00 131.71 ? 90  TYR A CE2   1 
ATOM   735  C CZ    . TYR A 1 90  ? 27.315 -24.368 -15.060 1.00 134.49 ? 90  TYR A CZ    1 
ATOM   736  O OH    . TYR A 1 90  ? 28.606 -24.825 -14.851 1.00 133.15 ? 90  TYR A OH    1 
ATOM   737  N N     . GLN A 1 91  ? 20.691 -24.190 -14.090 1.00 123.76 ? 91  GLN A N     1 
ATOM   738  C CA    . GLN A 1 91  ? 20.187 -25.508 -13.776 1.00 120.34 ? 91  GLN A CA    1 
ATOM   739  C C     . GLN A 1 91  ? 21.040 -26.455 -14.593 1.00 122.02 ? 91  GLN A C     1 
ATOM   740  O O     . GLN A 1 91  ? 21.252 -26.230 -15.783 1.00 122.62 ? 91  GLN A O     1 
ATOM   741  C CB    . GLN A 1 91  ? 18.712 -25.659 -14.169 1.00 128.70 ? 91  GLN A CB    1 
ATOM   742  C CG    . GLN A 1 91  ? 17.793 -24.534 -13.696 1.00 132.18 ? 91  GLN A CG    1 
ATOM   743  C CD    . GLN A 1 91  ? 17.826 -23.309 -14.611 1.00 146.75 ? 91  GLN A CD    1 
ATOM   744  O OE1   . GLN A 1 91  ? 18.042 -23.418 -15.835 1.00 147.36 ? 91  GLN A OE1   1 
ATOM   745  N NE2   . GLN A 1 91  ? 17.616 -22.128 -14.016 1.00 145.34 ? 91  GLN A NE2   1 
ATOM   746  N N     . THR A 1 92  ? 21.560 -27.489 -13.941 1.00 124.01 ? 92  THR A N     1 
ATOM   747  C CA    . THR A 1 92  ? 22.323 -28.519 -14.626 1.00 133.34 ? 92  THR A CA    1 
ATOM   748  C C     . THR A 1 92  ? 21.348 -29.283 -15.515 1.00 143.98 ? 92  THR A C     1 
ATOM   749  O O     . THR A 1 92  ? 20.183 -28.892 -15.626 1.00 148.23 ? 92  THR A O     1 
ATOM   750  C CB    . THR A 1 92  ? 23.010 -29.477 -13.627 1.00 131.36 ? 92  THR A CB    1 
ATOM   751  O OG1   . THR A 1 92  ? 23.971 -30.290 -14.316 1.00 137.96 ? 92  THR A OG1   1 
ATOM   752  C CG2   . THR A 1 92  ? 21.986 -30.370 -12.941 1.00 128.61 ? 92  THR A CG2   1 
ATOM   753  N N     . SER A 1 93  ? 21.809 -30.351 -16.161 1.00 145.68 ? 93  SER A N     1 
ATOM   754  C CA    . SER A 1 93  ? 20.897 -31.186 -16.936 1.00 150.25 ? 93  SER A CA    1 
ATOM   755  C C     . SER A 1 93  ? 19.725 -31.589 -16.045 1.00 147.31 ? 93  SER A C     1 
ATOM   756  O O     . SER A 1 93  ? 18.570 -31.528 -16.461 1.00 142.57 ? 93  SER A O     1 
ATOM   757  C CB    . SER A 1 93  ? 21.613 -32.410 -17.520 1.00 158.39 ? 93  SER A CB    1 
ATOM   758  O OG    . SER A 1 93  ? 22.218 -33.188 -16.500 1.00 165.08 ? 93  SER A OG    1 
ATOM   759  N N     . LEU A 1 94  ? 20.028 -31.979 -14.810 1.00 150.18 ? 94  LEU A N     1 
ATOM   760  C CA    . LEU A 1 94  ? 18.991 -32.124 -13.792 1.00 156.27 ? 94  LEU A CA    1 
ATOM   761  C C     . LEU A 1 94  ? 18.667 -30.738 -13.216 1.00 153.10 ? 94  LEU A C     1 
ATOM   762  O O     . LEU A 1 94  ? 19.236 -29.737 -13.646 1.00 149.49 ? 94  LEU A O     1 
ATOM   763  C CB    . LEU A 1 94  ? 19.426 -33.105 -12.695 1.00 158.29 ? 94  LEU A CB    1 
ATOM   764  C CG    . LEU A 1 94  ? 18.369 -33.488 -11.646 1.00 165.90 ? 94  LEU A CG    1 
ATOM   765  C CD1   . LEU A 1 94  ? 18.229 -35.000 -11.487 1.00 168.44 ? 94  LEU A CD1   1 
ATOM   766  C CD2   . LEU A 1 94  ? 18.657 -32.827 -10.302 1.00 164.17 ? 94  LEU A CD2   1 
ATOM   767  N N     . GLY A 1 95  ? 17.757 -30.675 -12.250 1.00 154.30 ? 95  GLY A N     1 
ATOM   768  C CA    . GLY A 1 95  ? 17.284 -29.399 -11.736 1.00 152.26 ? 95  GLY A CA    1 
ATOM   769  C C     . GLY A 1 95  ? 18.189 -28.710 -10.730 1.00 147.16 ? 95  GLY A C     1 
ATOM   770  O O     . GLY A 1 95  ? 17.737 -27.861 -9.962  1.00 147.40 ? 95  GLY A O     1 
ATOM   771  N N     . GLU A 1 96  ? 19.468 -29.066 -10.735 1.00 142.18 ? 96  GLU A N     1 
ATOM   772  C CA    . GLU A 1 96  ? 20.430 -28.486 -9.807  1.00 137.17 ? 96  GLU A CA    1 
ATOM   773  C C     . GLU A 1 96  ? 20.778 -27.084 -10.252 1.00 128.54 ? 96  GLU A C     1 
ATOM   774  O O     . GLU A 1 96  ? 20.889 -26.840 -11.445 1.00 142.01 ? 96  GLU A O     1 
ATOM   775  C CB    . GLU A 1 96  ? 21.701 -29.320 -9.824  1.00 142.82 ? 96  GLU A CB    1 
ATOM   776  C CG    . GLU A 1 96  ? 22.320 -29.541 -8.475  1.00 152.54 ? 96  GLU A CG    1 
ATOM   777  C CD    . GLU A 1 96  ? 22.907 -30.924 -8.370  1.00 160.84 ? 96  GLU A CD    1 
ATOM   778  O OE1   . GLU A 1 96  ? 23.432 -31.272 -7.292  1.00 166.70 ? 96  GLU A OE1   1 
ATOM   779  O OE2   . GLU A 1 96  ? 22.832 -31.666 -9.373  1.00 159.65 ? 96  GLU A OE2   1 
ATOM   780  N N     . TYR A 1 97  ? 20.965 -26.157 -9.319  1.00 109.50 ? 97  TYR A N     1 
ATOM   781  C CA    . TYR A 1 97  ? 21.481 -24.850 -9.714  1.00 103.55 ? 97  TYR A CA    1 
ATOM   782  C C     . TYR A 1 97  ? 22.983 -24.832 -9.523  1.00 100.64 ? 97  TYR A C     1 
ATOM   783  O O     . TYR A 1 97  ? 23.462 -24.956 -8.412  1.00 95.78  ? 97  TYR A O     1 
ATOM   784  C CB    . TYR A 1 97  ? 20.834 -23.707 -8.943  1.00 93.94  ? 97  TYR A CB    1 
ATOM   785  C CG    . TYR A 1 97  ? 19.326 -23.717 -8.994  1.00 114.56 ? 97  TYR A CG    1 
ATOM   786  C CD1   . TYR A 1 97  ? 18.578 -22.843 -8.208  1.00 118.61 ? 97  TYR A CD1   1 
ATOM   787  C CD2   . TYR A 1 97  ? 18.644 -24.614 -9.806  1.00 115.09 ? 97  TYR A CD2   1 
ATOM   788  C CE1   . TYR A 1 97  ? 17.193 -22.856 -8.234  1.00 122.21 ? 97  TYR A CE1   1 
ATOM   789  C CE2   . TYR A 1 97  ? 17.255 -24.635 -9.840  1.00 123.56 ? 97  TYR A CE2   1 
ATOM   790  C CZ    . TYR A 1 97  ? 16.537 -23.753 -9.052  1.00 126.15 ? 97  TYR A CZ    1 
ATOM   791  O OH    . TYR A 1 97  ? 15.160 -23.772 -9.086  1.00 131.79 ? 97  TYR A OH    1 
ATOM   792  N N     . LYS A 1 98  ? 23.719 -24.687 -10.617 1.00 108.94 ? 98  LYS A N     1 
ATOM   793  C CA    . LYS A 1 98  ? 25.171 -24.737 -10.586 1.00 107.91 ? 98  LYS A CA    1 
ATOM   794  C C     . LYS A 1 98  ? 25.699 -23.333 -10.820 1.00 106.81 ? 98  LYS A C     1 
ATOM   795  O O     . LYS A 1 98  ? 24.929 -22.402 -11.062 1.00 111.59 ? 98  LYS A O     1 
ATOM   796  C CB    . LYS A 1 98  ? 25.673 -25.686 -11.689 1.00 107.86 ? 98  LYS A CB    1 
ATOM   797  C CG    . LYS A 1 98  ? 27.139 -26.129 -11.600 1.00 102.30 ? 98  LYS A CG    1 
ATOM   798  C CD    . LYS A 1 98  ? 27.356 -27.390 -12.421 1.00 108.29 ? 98  LYS A CD    1 
ATOM   799  C CE    . LYS A 1 98  ? 28.833 -27.633 -12.737 1.00 115.35 ? 98  LYS A CE    1 
ATOM   800  N NZ    . LYS A 1 98  ? 29.076 -28.173 -14.144 1.00 106.61 ? 98  LYS A NZ    1 
ATOM   801  N N     . LEU A 1 99  ? 27.013 -23.179 -10.742 1.00 118.29 ? 99  LEU A N     1 
ATOM   802  C CA    . LEU A 1 99  ? 27.647 -21.952 -11.184 1.00 115.82 ? 99  LEU A CA    1 
ATOM   803  C C     . LEU A 1 99  ? 29.133 -22.173 -11.342 1.00 115.02 ? 99  LEU A C     1 
ATOM   804  O O     . LEU A 1 99  ? 29.676 -23.162 -10.834 1.00 91.38  ? 99  LEU A O     1 
ATOM   805  C CB    . LEU A 1 99  ? 27.358 -20.803 -10.220 1.00 108.83 ? 99  LEU A CB    1 
ATOM   806  C CG    . LEU A 1 99  ? 27.915 -20.851 -8.796  1.00 103.90 ? 99  LEU A CG    1 
ATOM   807  C CD1   . LEU A 1 99  ? 29.432 -20.755 -8.758  1.00 104.82 ? 99  LEU A CD1   1 
ATOM   808  C CD2   . LEU A 1 99  ? 27.308 -19.719 -7.997  1.00 98.09  ? 99  LEU A CD2   1 
ATOM   809  N N     . ASN A 1 100 ? 29.782 -21.257 -12.056 1.00 105.26 ? 100 ASN A N     1 
ATOM   810  C CA    . ASN A 1 100 ? 31.201 -21.395 -12.335 1.00 109.37 ? 100 ASN A CA    1 
ATOM   811  C C     . ASN A 1 100 ? 32.008 -21.076 -11.090 1.00 111.83 ? 100 ASN A C     1 
ATOM   812  O O     . ASN A 1 100 ? 32.436 -19.940 -10.885 1.00 115.90 ? 100 ASN A O     1 
ATOM   813  C CB    . ASN A 1 100 ? 31.623 -20.499 -13.498 1.00 120.98 ? 100 ASN A CB    1 
ATOM   814  C CG    . ASN A 1 100 ? 32.868 -20.996 -14.183 1.00 124.84 ? 100 ASN A CG    1 
ATOM   815  O OD1   . ASN A 1 100 ? 33.972 -20.518 -13.918 1.00 126.82 ? 100 ASN A OD1   1 
ATOM   816  N ND2   . ASN A 1 100 ? 32.700 -21.972 -15.069 1.00 125.18 ? 100 ASN A ND2   1 
ATOM   817  N N     . LEU A 1 101 ? 32.202 -22.093 -10.259 1.00 107.33 ? 101 LEU A N     1 
ATOM   818  C CA    . LEU A 1 101 ? 32.891 -21.939 -8.989  1.00 98.42  ? 101 LEU A CA    1 
ATOM   819  C C     . LEU A 1 101 ? 34.194 -21.148 -9.103  1.00 106.71 ? 101 LEU A C     1 
ATOM   820  O O     . LEU A 1 101 ? 34.350 -20.132 -8.430  1.00 106.33 ? 101 LEU A O     1 
ATOM   821  C CB    . LEU A 1 101 ? 33.143 -23.310 -8.367  1.00 100.69 ? 101 LEU A CB    1 
ATOM   822  C CG    . LEU A 1 101 ? 33.368 -23.407 -6.854  1.00 96.80  ? 101 LEU A CG    1 
ATOM   823  C CD1   . LEU A 1 101 ? 32.414 -22.520 -6.076  1.00 94.40  ? 101 LEU A CD1   1 
ATOM   824  C CD2   . LEU A 1 101 ? 33.222 -24.853 -6.419  1.00 91.50  ? 101 LEU A CD2   1 
ATOM   825  N N     . PRO A 1 102 ? 35.128 -21.597 -9.965  1.00 115.87 ? 102 PRO A N     1 
ATOM   826  C CA    . PRO A 1 102 ? 36.424 -20.918 -10.095 1.00 115.98 ? 102 PRO A CA    1 
ATOM   827  C C     . PRO A 1 102 ? 36.286 -19.404 -10.252 1.00 120.23 ? 102 PRO A C     1 
ATOM   828  O O     . PRO A 1 102 ? 37.097 -18.646 -9.723  1.00 121.58 ? 102 PRO A O     1 
ATOM   829  C CB    . PRO A 1 102 ? 36.997 -21.513 -11.382 1.00 113.65 ? 102 PRO A CB    1 
ATOM   830  C CG    . PRO A 1 102 ? 36.371 -22.842 -11.493 1.00 116.63 ? 102 PRO A CG    1 
ATOM   831  C CD    . PRO A 1 102 ? 34.988 -22.689 -10.945 1.00 120.33 ? 102 PRO A CD    1 
ATOM   832  N N     . GLU A 1 103 ? 35.264 -18.974 -10.980 1.00 121.64 ? 103 GLU A N     1 
ATOM   833  C CA    . GLU A 1 103 ? 35.050 -17.556 -11.228 1.00 124.95 ? 103 GLU A CA    1 
ATOM   834  C C     . GLU A 1 103 ? 34.504 -16.822 -10.011 1.00 126.29 ? 103 GLU A C     1 
ATOM   835  O O     . GLU A 1 103 ? 34.845 -15.669 -9.767  1.00 132.40 ? 103 GLU A O     1 
ATOM   836  C CB    . GLU A 1 103 ? 34.074 -17.385 -12.384 1.00 132.64 ? 103 GLU A CB    1 
ATOM   837  C CG    . GLU A 1 103 ? 33.478 -15.997 -12.482 1.00 140.72 ? 103 GLU A CG    1 
ATOM   838  C CD    . GLU A 1 103 ? 32.436 -15.893 -13.577 1.00 151.45 ? 103 GLU A CD    1 
ATOM   839  O OE1   . GLU A 1 103 ? 31.725 -14.869 -13.620 1.00 154.74 ? 103 GLU A OE1   1 
ATOM   840  O OE2   . GLU A 1 103 ? 32.328 -16.836 -14.393 1.00 154.65 ? 103 GLU A OE2   1 
ATOM   841  N N     . TYR A 1 104 ? 33.646 -17.493 -9.254  1.00 132.63 ? 104 TYR A N     1 
ATOM   842  C CA    . TYR A 1 104 ? 32.918 -16.843 -8.174  1.00 124.06 ? 104 TYR A CA    1 
ATOM   843  C C     . TYR A 1 104 ? 33.552 -17.029 -6.791  1.00 117.03 ? 104 TYR A C     1 
ATOM   844  O O     . TYR A 1 104 ? 33.422 -16.167 -5.925  1.00 116.09 ? 104 TYR A O     1 
ATOM   845  C CB    . TYR A 1 104 ? 31.469 -17.333 -8.153  1.00 125.30 ? 104 TYR A CB    1 
ATOM   846  C CG    . TYR A 1 104 ? 30.572 -16.733 -9.218  1.00 127.88 ? 104 TYR A CG    1 
ATOM   847  C CD1   . TYR A 1 104 ? 29.905 -17.541 -10.133 1.00 127.72 ? 104 TYR A CD1   1 
ATOM   848  C CD2   . TYR A 1 104 ? 30.378 -15.363 -9.298  1.00 130.00 ? 104 TYR A CD2   1 
ATOM   849  C CE1   . TYR A 1 104 ? 29.072 -16.995 -11.098 1.00 124.17 ? 104 TYR A CE1   1 
ATOM   850  C CE2   . TYR A 1 104 ? 29.551 -14.812 -10.259 1.00 129.71 ? 104 TYR A CE2   1 
ATOM   851  C CZ    . TYR A 1 104 ? 28.904 -15.632 -11.154 1.00 125.89 ? 104 TYR A CZ    1 
ATOM   852  O OH    . TYR A 1 104 ? 28.083 -15.076 -12.105 1.00 127.05 ? 104 TYR A OH    1 
ATOM   853  N N     . MET A 1 105 ? 34.226 -18.154 -6.580  1.00 111.59 ? 105 MET A N     1 
ATOM   854  C CA    . MET A 1 105 ? 34.844 -18.450 -5.289  1.00 109.05 ? 105 MET A CA    1 
ATOM   855  C C     . MET A 1 105 ? 35.665 -17.282 -4.743  1.00 111.58 ? 105 MET A C     1 
ATOM   856  O O     . MET A 1 105 ? 36.277 -16.527 -5.496  1.00 113.37 ? 105 MET A O     1 
ATOM   857  C CB    . MET A 1 105 ? 35.720 -19.696 -5.394  1.00 111.53 ? 105 MET A CB    1 
ATOM   858  C CG    . MET A 1 105 ? 36.575 -19.976 -4.161  1.00 118.30 ? 105 MET A CG    1 
ATOM   859  S SD    . MET A 1 105 ? 35.712 -20.831 -2.813  1.00 116.26 ? 105 MET A SD    1 
ATOM   860  C CE    . MET A 1 105 ? 34.814 -22.073 -3.731  1.00 106.78 ? 105 MET A CE    1 
ATOM   861  N N     . TRP A 1 106 ? 35.673 -17.145 -3.424  1.00 115.45 ? 106 TRP A N     1 
ATOM   862  C CA    . TRP A 1 106 ? 36.362 -16.042 -2.775  1.00 120.09 ? 106 TRP A CA    1 
ATOM   863  C C     . TRP A 1 106 ? 37.522 -16.510 -1.906  1.00 124.28 ? 106 TRP A C     1 
ATOM   864  O O     . TRP A 1 106 ? 37.481 -17.591 -1.323  1.00 120.89 ? 106 TRP A O     1 
ATOM   865  C CB    . TRP A 1 106 ? 35.380 -15.247 -1.926  1.00 119.66 ? 106 TRP A CB    1 
ATOM   866  C CG    . TRP A 1 106 ? 36.043 -14.257 -1.032  1.00 126.00 ? 106 TRP A CG    1 
ATOM   867  C CD1   . TRP A 1 106 ? 36.633 -13.087 -1.405  1.00 129.29 ? 106 TRP A CD1   1 
ATOM   868  C CD2   . TRP A 1 106 ? 36.181 -14.343 0.392   1.00 130.61 ? 106 TRP A CD2   1 
ATOM   869  N NE1   . TRP A 1 106 ? 37.132 -12.437 -0.302  1.00 132.78 ? 106 TRP A NE1   1 
ATOM   870  C CE2   . TRP A 1 106 ? 36.867 -13.187 0.813   1.00 134.66 ? 106 TRP A CE2   1 
ATOM   871  C CE3   . TRP A 1 106 ? 35.791 -15.282 1.351   1.00 134.10 ? 106 TRP A CE3   1 
ATOM   872  C CZ2   . TRP A 1 106 ? 37.172 -12.949 2.153   1.00 139.11 ? 106 TRP A CZ2   1 
ATOM   873  C CZ3   . TRP A 1 106 ? 36.096 -15.044 2.680   1.00 134.12 ? 106 TRP A CZ3   1 
ATOM   874  C CH2   . TRP A 1 106 ? 36.778 -13.888 3.068   1.00 137.90 ? 106 TRP A CH2   1 
ATOM   875  N N     . LYS A 1 107 ? 38.555 -15.683 -1.821  1.00 129.55 ? 107 LYS A N     1 
ATOM   876  C CA    . LYS A 1 107 ? 39.687 -15.979 -0.959  1.00 136.77 ? 107 LYS A CA    1 
ATOM   877  C C     . LYS A 1 107 ? 40.357 -14.709 -0.456  1.00 136.34 ? 107 LYS A C     1 
ATOM   878  O O     . LYS A 1 107 ? 40.662 -13.808 -1.238  1.00 125.76 ? 107 LYS A O     1 
ATOM   879  C CB    . LYS A 1 107 ? 40.707 -16.868 -1.675  1.00 144.20 ? 107 LYS A CB    1 
ATOM   880  C CG    . LYS A 1 107 ? 40.744 -16.712 -3.189  1.00 147.75 ? 107 LYS A CG    1 
ATOM   881  C CD    . LYS A 1 107 ? 40.050 -17.890 -3.864  1.00 150.42 ? 107 LYS A CD    1 
ATOM   882  C CE    . LYS A 1 107 ? 40.611 -18.160 -5.256  1.00 151.46 ? 107 LYS A CE    1 
ATOM   883  N NZ    . LYS A 1 107 ? 40.200 -19.500 -5.775  1.00 149.91 ? 107 LYS A NZ    1 
ATOM   884  N N     . PRO A 1 108 ? 40.577 -14.638 0.866   1.00 143.01 ? 108 PRO A N     1 
ATOM   885  C CA    . PRO A 1 108 ? 41.283 -13.524 1.513   1.00 146.11 ? 108 PRO A CA    1 
ATOM   886  C C     . PRO A 1 108 ? 42.729 -13.369 1.021   1.00 145.95 ? 108 PRO A C     1 
ATOM   887  O O     . PRO A 1 108 ? 43.619 -14.147 1.377   1.00 142.53 ? 108 PRO A O     1 
ATOM   888  C CB    . PRO A 1 108 ? 41.255 -13.905 3.003   1.00 146.95 ? 108 PRO A CB    1 
ATOM   889  C CG    . PRO A 1 108 ? 40.901 -15.381 3.040   1.00 142.95 ? 108 PRO A CG    1 
ATOM   890  C CD    . PRO A 1 108 ? 40.052 -15.616 1.838   1.00 139.34 ? 108 PRO A CD    1 
ATOM   891  O "O5'" . DG  B 2 1   ? 28.979 -45.222 24.042  1.00 117.33 ? 1   DG  B "O5'" 1 
ATOM   892  C "C5'" . DG  B 2 1   ? 29.249 -46.602 24.271  1.00 128.70 ? 1   DG  B "C5'" 1 
ATOM   893  C "C4'" . DG  B 2 1   ? 27.953 -47.381 24.197  1.00 139.75 ? 1   DG  B "C4'" 1 
ATOM   894  O "O4'" . DG  B 2 1   ? 27.079 -46.913 25.258  1.00 138.35 ? 1   DG  B "O4'" 1 
ATOM   895  C "C3'" . DG  B 2 1   ? 27.157 -47.171 22.915  1.00 143.11 ? 1   DG  B "C3'" 1 
ATOM   896  O "O3'" . DG  B 2 1   ? 27.561 -48.084 21.895  1.00 144.83 ? 1   DG  B "O3'" 1 
ATOM   897  C "C2'" . DG  B 2 1   ? 25.741 -47.463 23.393  1.00 147.80 ? 1   DG  B "C2'" 1 
ATOM   898  C "C1'" . DG  B 2 1   ? 25.756 -46.809 24.771  1.00 139.54 ? 1   DG  B "C1'" 1 
ATOM   899  N N9    . DG  B 2 1   ? 25.390 -45.404 24.726  1.00 132.86 ? 1   DG  B N9    1 
ATOM   900  C C8    . DG  B 2 1   ? 26.193 -44.308 24.927  1.00 129.59 ? 1   DG  B C8    1 
ATOM   901  N N7    . DG  B 2 1   ? 25.558 -43.173 24.814  1.00 122.50 ? 1   DG  B N7    1 
ATOM   902  C C5    . DG  B 2 1   ? 24.256 -43.550 24.518  1.00 119.93 ? 1   DG  B C5    1 
ATOM   903  C C6    . DG  B 2 1   ? 23.108 -42.763 24.285  1.00 112.47 ? 1   DG  B C6    1 
ATOM   904  O O6    . DG  B 2 1   ? 23.010 -41.531 24.296  1.00 107.49 ? 1   DG  B O6    1 
ATOM   905  N N1    . DG  B 2 1   ? 21.983 -43.538 24.019  1.00 115.27 ? 1   DG  B N1    1 
ATOM   906  C C2    . DG  B 2 1   ? 21.970 -44.911 23.985  1.00 128.88 ? 1   DG  B C2    1 
ATOM   907  N N2    . DG  B 2 1   ? 20.789 -45.484 23.713  1.00 138.05 ? 1   DG  B N2    1 
ATOM   908  N N3    . DG  B 2 1   ? 23.039 -45.668 24.204  1.00 132.35 ? 1   DG  B N3    1 
ATOM   909  C C4    . DG  B 2 1   ? 24.138 -44.918 24.461  1.00 128.86 ? 1   DG  B C4    1 
ATOM   910  P P     . DC  B 2 2   ? 27.754 -47.569 20.383  1.00 156.60 ? 2   DC  B P     1 
ATOM   911  O OP1   . DC  B 2 2   ? 29.188 -47.694 20.034  1.00 154.07 ? 2   DC  B OP1   1 
ATOM   912  O OP2   . DC  B 2 2   ? 27.091 -46.255 20.259  1.00 153.21 ? 2   DC  B OP2   1 
ATOM   913  O "O5'" . DC  B 2 2   ? 26.900 -48.608 19.518  1.00 159.37 ? 2   DC  B "O5'" 1 
ATOM   914  C "C5'" . DC  B 2 2   ? 26.018 -49.564 20.114  1.00 154.72 ? 2   DC  B "C5'" 1 
ATOM   915  C "C4'" . DC  B 2 2   ? 24.577 -49.310 19.706  1.00 148.38 ? 2   DC  B "C4'" 1 
ATOM   916  O "O4'" . DC  B 2 2   ? 24.083 -48.271 20.573  1.00 131.29 ? 2   DC  B "O4'" 1 
ATOM   917  C "C3'" . DC  B 2 2   ? 24.356 -48.774 18.292  1.00 159.71 ? 2   DC  B "C3'" 1 
ATOM   918  O "O3'" . DC  B 2 2   ? 24.123 -49.828 17.335  1.00 179.67 ? 2   DC  B "O3'" 1 
ATOM   919  C "C2'" . DC  B 2 2   ? 23.125 -47.881 18.435  1.00 148.65 ? 2   DC  B "C2'" 1 
ATOM   920  C "C1'" . DC  B 2 2   ? 23.070 -47.540 19.918  1.00 134.47 ? 2   DC  B "C1'" 1 
ATOM   921  N N1    . DC  B 2 2   ? 23.250 -46.087 20.203  1.00 126.63 ? 2   DC  B N1    1 
ATOM   922  C C2    . DC  B 2 2   ? 22.187 -45.214 19.961  1.00 125.69 ? 2   DC  B C2    1 
ATOM   923  O O2    . DC  B 2 2   ? 21.135 -45.669 19.509  1.00 135.26 ? 2   DC  B O2    1 
ATOM   924  N N3    . DC  B 2 2   ? 22.326 -43.894 20.218  1.00 118.38 ? 2   DC  B N3    1 
ATOM   925  C C4    . DC  B 2 2   ? 23.477 -43.440 20.704  1.00 118.58 ? 2   DC  B C4    1 
ATOM   926  N N4    . DC  B 2 2   ? 23.568 -42.125 20.942  1.00 112.18 ? 2   DC  B N4    1 
ATOM   927  C C5    . DC  B 2 2   ? 24.576 -44.313 20.967  1.00 121.78 ? 2   DC  B C5    1 
ATOM   928  C C6    . DC  B 2 2   ? 24.422 -45.615 20.703  1.00 125.14 ? 2   DC  B C6    1 
ATOM   929  P P     . DC  B 2 3   ? 23.319 -49.526 15.969  1.00 158.66 ? 3   DC  B P     1 
ATOM   930  O OP1   . DC  B 2 3   ? 23.325 -50.764 15.153  1.00 160.75 ? 3   DC  B OP1   1 
ATOM   931  O OP2   . DC  B 2 3   ? 23.868 -48.281 15.383  1.00 148.23 ? 3   DC  B OP2   1 
ATOM   932  O "O5'" . DC  B 2 3   ? 21.821 -49.231 16.475  1.00 167.43 ? 3   DC  B "O5'" 1 
ATOM   933  C "C5'" . DC  B 2 3   ? 20.698 -49.212 15.597  1.00 168.47 ? 3   DC  B "C5'" 1 
ATOM   934  C "C4'" . DC  B 2 3   ? 20.269 -47.801 15.215  1.00 158.63 ? 3   DC  B "C4'" 1 
ATOM   935  O "O4'" . DC  B 2 3   ? 20.775 -46.821 16.167  1.00 143.62 ? 3   DC  B "O4'" 1 
ATOM   936  C "C3'" . DC  B 2 3   ? 20.734 -47.326 13.831  1.00 159.58 ? 3   DC  B "C3'" 1 
ATOM   937  O "O3'" . DC  B 2 3   ? 19.673 -46.729 13.102  1.00 148.81 ? 3   DC  B "O3'" 1 
ATOM   938  C "C2'" . DC  B 2 3   ? 21.746 -46.247 14.170  1.00 150.74 ? 3   DC  B "C2'" 1 
ATOM   939  C "C1'" . DC  B 2 3   ? 21.016 -45.677 15.375  1.00 144.23 ? 3   DC  B "C1'" 1 
ATOM   940  N N1    . DC  B 2 3   ? 21.796 -44.637 16.083  1.00 138.91 ? 3   DC  B N1    1 
ATOM   941  C C2    . DC  B 2 3   ? 21.199 -43.393 16.299  1.00 134.51 ? 3   DC  B C2    1 
ATOM   942  O O2    . DC  B 2 3   ? 20.037 -43.210 15.916  1.00 137.75 ? 3   DC  B O2    1 
ATOM   943  N N3    . DC  B 2 3   ? 21.904 -42.423 16.925  1.00 125.97 ? 3   DC  B N3    1 
ATOM   944  C C4    . DC  B 2 3   ? 23.154 -42.666 17.318  1.00 126.77 ? 3   DC  B C4    1 
ATOM   945  N N4    . DC  B 2 3   ? 23.809 -41.679 17.937  1.00 123.48 ? 3   DC  B N4    1 
ATOM   946  C C5    . DC  B 2 3   ? 23.785 -43.928 17.099  1.00 129.89 ? 3   DC  B C5    1 
ATOM   947  C C6    . DC  B 2 3   ? 23.077 -44.878 16.480  1.00 136.42 ? 3   DC  B C6    1 
ATOM   948  P P     . DA  B 2 4   ? 19.714 -46.701 11.492  1.00 169.61 ? 4   DA  B P     1 
ATOM   949  O OP1   . DA  B 2 4   ? 18.894 -47.836 11.002  1.00 163.27 ? 4   DA  B OP1   1 
ATOM   950  O OP2   . DA  B 2 4   ? 21.128 -46.543 11.068  1.00 154.20 ? 4   DA  B OP2   1 
ATOM   951  O "O5'" . DA  B 2 4   ? 19.003 -45.313 11.118  1.00 156.35 ? 4   DA  B "O5'" 1 
ATOM   952  C "C5'" . DA  B 2 4   ? 17.759 -45.008 11.746  1.00 154.65 ? 4   DA  B "C5'" 1 
ATOM   953  C "C4'" . DA  B 2 4   ? 17.334 -43.558 11.570  1.00 147.15 ? 4   DA  B "C4'" 1 
ATOM   954  O "O4'" . DA  B 2 4   ? 18.034 -42.687 12.497  1.00 138.31 ? 4   DA  B "O4'" 1 
ATOM   955  C "C3'" . DA  B 2 4   ? 17.590 -42.940 10.216  1.00 142.21 ? 4   DA  B "C3'" 1 
ATOM   956  O "O3'" . DA  B 2 4   ? 16.616 -41.916 10.068  1.00 178.67 ? 4   DA  B "O3'" 1 
ATOM   957  C "C2'" . DA  B 2 4   ? 19.003 -42.398 10.408  1.00 137.25 ? 4   DA  B "C2'" 1 
ATOM   958  C "C1'" . DA  B 2 4   ? 18.866 -41.782 11.794  1.00 131.33 ? 4   DA  B "C1'" 1 
ATOM   959  N N9    . DA  B 2 4   ? 20.093 -41.676 12.591  1.00 130.06 ? 4   DA  B N9    1 
ATOM   960  C C8    . DA  B 2 4   ? 21.001 -42.672 12.814  1.00 134.36 ? 4   DA  B C8    1 
ATOM   961  N N7    . DA  B 2 4   ? 22.006 -42.315 13.574  1.00 130.32 ? 4   DA  B N7    1 
ATOM   962  C C5    . DA  B 2 4   ? 21.741 -40.992 13.903  1.00 124.57 ? 4   DA  B C5    1 
ATOM   963  C C6    . DA  B 2 4   ? 22.424 -40.032 14.701  1.00 112.81 ? 4   DA  B C6    1 
ATOM   964  N N6    . DA  B 2 4   ? 23.573 -40.268 15.347  1.00 104.65 ? 4   DA  B N6    1 
ATOM   965  N N1    . DA  B 2 4   ? 21.883 -38.800 14.815  1.00 105.03 ? 4   DA  B N1    1 
ATOM   966  C C2    . DA  B 2 4   ? 20.734 -38.551 14.181  1.00 110.08 ? 4   DA  B C2    1 
ATOM   967  N N3    . DA  B 2 4   ? 20.007 -39.365 13.413  1.00 123.27 ? 4   DA  B N3    1 
ATOM   968  C C4    . DA  B 2 4   ? 20.562 -40.585 13.306  1.00 125.70 ? 4   DA  B C4    1 
ATOM   969  P P     . DT  B 2 5   ? 16.277 -41.318 8.606   1.00 141.11 ? 5   DT  B P     1 
ATOM   970  O OP1   . DT  B 2 5   ? 14.807 -41.373 8.415   1.00 138.72 ? 5   DT  B OP1   1 
ATOM   971  O OP2   . DT  B 2 5   ? 17.148 -42.000 7.618   1.00 138.24 ? 5   DT  B OP2   1 
ATOM   972  O "O5'" . DT  B 2 5   ? 16.749 -39.783 8.711   1.00 129.82 ? 5   DT  B "O5'" 1 
ATOM   973  C "C5'" . DT  B 2 5   ? 16.387 -39.013 9.867   1.00 127.03 ? 5   DT  B "C5'" 1 
ATOM   974  C "C4'" . DT  B 2 5   ? 17.221 -37.753 10.015  1.00 118.57 ? 5   DT  B "C4'" 1 
ATOM   975  O "O4'" . DT  B 2 5   ? 18.480 -38.041 10.660  1.00 106.39 ? 5   DT  B "O4'" 1 
ATOM   976  C "C3'" . DT  B 2 5   ? 17.612 -37.046 8.726   1.00 125.42 ? 5   DT  B "C3'" 1 
ATOM   977  O "O3'" . DT  B 2 5   ? 17.128 -35.726 8.810   1.00 132.27 ? 5   DT  B "O3'" 1 
ATOM   978  C "C2'" . DT  B 2 5   ? 19.143 -37.064 8.735   1.00 118.42 ? 5   DT  B "C2'" 1 
ATOM   979  C "C1'" . DT  B 2 5   ? 19.401 -37.072 10.230  1.00 104.87 ? 5   DT  B "C1'" 1 
ATOM   980  N N1    . DT  B 2 5   ? 20.717 -37.570 10.652  1.00 105.31 ? 5   DT  B N1    1 
ATOM   981  C C2    . DT  B 2 5   ? 21.502 -36.828 11.510  1.00 108.23 ? 5   DT  B C2    1 
ATOM   982  O O2    . DT  B 2 5   ? 21.189 -35.736 11.948  1.00 111.79 ? 5   DT  B O2    1 
ATOM   983  N N3    . DT  B 2 5   ? 22.694 -37.416 11.840  1.00 103.82 ? 5   DT  B N3    1 
ATOM   984  C C4    . DT  B 2 5   ? 23.161 -38.640 11.409  1.00 101.44 ? 5   DT  B C4    1 
ATOM   985  O O4    . DT  B 2 5   ? 24.244 -39.097 11.748  1.00 95.85  ? 5   DT  B O4    1 
ATOM   986  C C5    . DT  B 2 5   ? 22.289 -39.355 10.523  1.00 108.17 ? 5   DT  B C5    1 
ATOM   987  C C7    . DT  B 2 5   ? 22.712 -40.693 10.004  1.00 109.76 ? 5   DT  B C7    1 
ATOM   988  C C6    . DT  B 2 5   ? 21.119 -38.800 10.191  1.00 107.90 ? 5   DT  B C6    1 
ATOM   989  P P     . DG  B 2 6   ? 16.699 -34.938 7.479   1.00 136.54 ? 6   DG  B P     1 
ATOM   990  O OP1   . DG  B 2 6   ? 15.349 -34.374 7.706   1.00 138.77 ? 6   DG  B OP1   1 
ATOM   991  O OP2   . DG  B 2 6   ? 17.006 -35.807 6.313   1.00 123.11 ? 6   DG  B OP2   1 
ATOM   992  O "O5'" . DG  B 2 6   ? 17.733 -33.731 7.416   1.00 105.21 ? 6   DG  B "O5'" 1 
ATOM   993  C "C5'" . DG  B 2 6   ? 18.204 -33.190 8.623   1.00 106.46 ? 6   DG  B "C5'" 1 
ATOM   994  C "C4'" . DG  B 2 6   ? 19.555 -32.604 8.314   1.00 105.95 ? 6   DG  B "C4'" 1 
ATOM   995  O "O4'" . DG  B 2 6   ? 20.614 -33.518 8.699   1.00 110.77 ? 6   DG  B "O4'" 1 
ATOM   996  C "C3'" . DG  B 2 6   ? 19.734 -32.375 6.826   1.00 100.06 ? 6   DG  B "C3'" 1 
ATOM   997  O "O3'" . DG  B 2 6   ? 20.469 -31.188 6.637   1.00 91.56  ? 6   DG  B "O3'" 1 
ATOM   998  C "C2'" . DG  B 2 6   ? 20.515 -33.617 6.415   1.00 101.79 ? 6   DG  B "C2'" 1 
ATOM   999  C "C1'" . DG  B 2 6   ? 21.470 -33.659 7.589   1.00 99.76  ? 6   DG  B "C1'" 1 
ATOM   1000 N N9    . DG  B 2 6   ? 22.169 -34.911 7.769   1.00 93.27  ? 6   DG  B N9    1 
ATOM   1001 C C8    . DG  B 2 6   ? 21.897 -36.144 7.234   1.00 95.86  ? 6   DG  B C8    1 
ATOM   1002 N N7    . DG  B 2 6   ? 22.734 -37.059 7.631   1.00 96.88  ? 6   DG  B N7    1 
ATOM   1003 C C5    . DG  B 2 6   ? 23.599 -36.383 8.477   1.00 90.46  ? 6   DG  B C5    1 
ATOM   1004 C C6    . DG  B 2 6   ? 24.714 -36.835 9.205   1.00 85.02  ? 6   DG  B C6    1 
ATOM   1005 O O6    . DG  B 2 6   ? 25.185 -37.973 9.267   1.00 85.58  ? 6   DG  B O6    1 
ATOM   1006 N N1    . DG  B 2 6   ? 25.308 -35.810 9.928   1.00 84.12  ? 6   DG  B N1    1 
ATOM   1007 C C2    . DG  B 2 6   ? 24.874 -34.506 9.957   1.00 87.00  ? 6   DG  B C2    1 
ATOM   1008 N N2    . DG  B 2 6   ? 25.579 -33.660 10.729  1.00 83.56  ? 6   DG  B N2    1 
ATOM   1009 N N3    . DG  B 2 6   ? 23.826 -34.066 9.275   1.00 87.54  ? 6   DG  B N3    1 
ATOM   1010 C C4    . DG  B 2 6   ? 23.258 -35.061 8.568   1.00 88.71  ? 6   DG  B C4    1 
HETATM 1011 P P     . BZG B 2 7   ? 19.834 -29.975 5.793   1.00 103.07 ? 7   BZG B P     1 
HETATM 1012 O O1P   . BZG B 2 7   ? 20.124 -28.651 6.547   1.00 130.07 ? 7   BZG B O1P   1 
HETATM 1013 O O2P   . BZG B 2 7   ? 18.315 -30.222 5.630   1.00 96.35  ? 7   BZG B O2P   1 
HETATM 1014 O "O5'" . BZG B 2 7   ? 20.586 -30.019 4.435   1.00 103.35 ? 7   BZG B "O5'" 1 
HETATM 1015 C CZ1   . BZG B 2 7   ? 18.518 -18.602 6.497   1.00 112.02 ? 7   BZG B CZ1   1 
HETATM 1016 C CT1   . BZG B 2 7   ? 17.330 -18.226 7.146   1.00 115.18 ? 7   BZG B CT1   1 
HETATM 1017 C CI    . BZG B 2 7   ? 16.493 -19.197 7.717   1.00 116.07 ? 7   BZG B CI    1 
HETATM 1018 C CT2   . BZG B 2 7   ? 16.840 -20.543 7.643   1.00 110.96 ? 7   BZG B CT2   1 
HETATM 1019 C CZ2   . BZG B 2 7   ? 18.029 -20.915 6.993   1.00 107.07 ? 7   BZG B CZ2   1 
HETATM 1020 C CE    . BZG B 2 7   ? 18.863 -19.953 6.423   1.00 108.09 ? 7   BZG B CE    1 
HETATM 1021 C CW    . BZG B 2 7   ? 20.149 -20.391 5.737   1.00 101.87 ? 7   BZG B CW    1 
HETATM 1022 O OL    . BZG B 2 7   ? 20.274 -21.764 5.561   1.00 91.59  ? 7   BZG B OL    1 
HETATM 1023 C CK    . BZG B 2 7   ? 21.263 -22.372 4.830   1.00 76.69  ? 7   BZG B CK    1 
HETATM 1024 N NJ    . BZG B 2 7   ? 22.253 -21.683 4.207   1.00 70.76  ? 7   BZG B NJ    1 
HETATM 1025 C CH    . BZG B 2 7   ? 23.165 -22.358 3.515   1.00 65.45  ? 7   BZG B CH    1 
HETATM 1026 N NI    . BZG B 2 7   ? 24.244 -21.658 2.874   1.00 69.71  ? 7   BZG B NI    1 
HETATM 1027 N NG    . BZG B 2 7   ? 23.118 -23.705 3.422   1.00 77.99  ? 7   BZG B NG    1 
HETATM 1028 C CF    . BZG B 2 7   ? 22.151 -24.460 4.019   1.00 67.87  ? 7   BZG B CF    1 
HETATM 1029 C CM    . BZG B 2 7   ? 21.204 -23.795 4.734   1.00 73.88  ? 7   BZG B CM    1 
HETATM 1030 N NN    . BZG B 2 7   ? 20.317 -24.736 5.240   1.00 74.31  ? 7   BZG B NN    1 
HETATM 1031 C CO    . BZG B 2 7   ? 20.734 -25.973 4.841   1.00 76.14  ? 7   BZG B CO    1 
HETATM 1032 N NE    . BZG B 2 7   ? 21.847 -25.814 4.104   1.00 79.39  ? 7   BZG B NE    1 
HETATM 1033 C "CT'" . BZG B 2 7   ? 22.578 -26.875 3.448   1.00 83.83  ? 7   BZG B "CT'" 1 
HETATM 1034 O "OS'" . BZG B 2 7   ? 21.704 -27.950 3.265   1.00 84.24  ? 7   BZG B "OS'" 1 
HETATM 1035 C "CP'" . BZG B 2 7   ? 23.705 -27.397 4.243   1.00 87.66  ? 7   BZG B "CP'" 1 
HETATM 1036 C "C5'" . BZG B 2 7   ? 21.963 -29.996 4.351   1.00 91.63  ? 7   BZG B "C5'" 1 
HETATM 1037 C "C4'" . BZG B 2 7   ? 22.497 -29.164 3.329   1.00 84.04  ? 7   BZG B "C4'" 1 
HETATM 1038 C "C3'" . BZG B 2 7   ? 23.841 -28.757 3.737   1.00 86.49  ? 7   BZG B "C3'" 1 
HETATM 1039 O "O3'" . BZG B 2 7   ? 24.692 -28.751 2.669   1.00 76.81  ? 7   BZG B "O3'" 1 
ATOM   1040 P P     . DC  B 2 8   ? 25.241 -30.132 2.073   1.00 96.73  ? 8   DC  B P     1 
ATOM   1041 O OP1   . DC  B 2 8   ? 25.809 -29.853 0.732   1.00 97.93  ? 8   DC  B OP1   1 
ATOM   1042 O OP2   . DC  B 2 8   ? 24.180 -31.148 2.250   1.00 88.23  ? 8   DC  B OP2   1 
ATOM   1043 O "O5'" . DC  B 2 8   ? 26.459 -30.514 3.043   1.00 64.49  ? 8   DC  B "O5'" 1 
ATOM   1044 C "C5'" . DC  B 2 8   ? 27.187 -29.501 3.717   1.00 67.83  ? 8   DC  B "C5'" 1 
ATOM   1045 C "C4'" . DC  B 2 8   ? 28.649 -29.863 3.708   1.00 72.69  ? 8   DC  B "C4'" 1 
ATOM   1046 O "O4'" . DC  B 2 8   ? 28.767 -31.236 4.138   1.00 73.77  ? 8   DC  B "O4'" 1 
ATOM   1047 C "C3'" . DC  B 2 8   ? 29.251 -29.832 2.315   1.00 74.06  ? 8   DC  B "C3'" 1 
ATOM   1048 O "O3'" . DC  B 2 8   ? 30.551 -29.284 2.315   1.00 73.93  ? 8   DC  B "O3'" 1 
ATOM   1049 C "C2'" . DC  B 2 8   ? 29.297 -31.297 1.917   1.00 69.11  ? 8   DC  B "C2'" 1 
ATOM   1050 C "C1'" . DC  B 2 8   ? 29.607 -31.922 3.253   1.00 65.60  ? 8   DC  B "C1'" 1 
ATOM   1051 N N1    . DC  B 2 8   ? 29.205 -33.311 3.317   1.00 69.58  ? 8   DC  B N1    1 
ATOM   1052 C C2    . DC  B 2 8   ? 30.137 -34.279 3.699   1.00 84.06  ? 8   DC  B C2    1 
ATOM   1053 O O2    . DC  B 2 8   ? 31.299 -33.920 3.974   1.00 87.88  ? 8   DC  B O2    1 
ATOM   1054 N N3    . DC  B 2 8   ? 29.725 -35.576 3.752   1.00 85.05  ? 8   DC  B N3    1 
ATOM   1055 C C4    . DC  B 2 8   ? 28.461 -35.902 3.460   1.00 82.29  ? 8   DC  B C4    1 
ATOM   1056 N N4    . DC  B 2 8   ? 28.093 -37.189 3.533   1.00 69.37  ? 8   DC  B N4    1 
ATOM   1057 C C5    . DC  B 2 8   ? 27.512 -34.913 3.071   1.00 75.90  ? 8   DC  B C5    1 
ATOM   1058 C C6    . DC  B 2 8   ? 27.924 -33.640 3.013   1.00 67.59  ? 8   DC  B C6    1 
ATOM   1059 P P     . DT  B 2 9   ? 31.366 -29.173 0.938   1.00 65.14  ? 9   DT  B P     1 
ATOM   1060 O OP1   . DT  B 2 9   ? 32.279 -28.010 1.047   1.00 60.65  ? 9   DT  B OP1   1 
ATOM   1061 O OP2   . DT  B 2 9   ? 30.399 -29.340 -0.181  1.00 65.54  ? 9   DT  B OP2   1 
ATOM   1062 O "O5'" . DT  B 2 9   ? 32.244 -30.499 0.912   1.00 72.25  ? 9   DT  B "O5'" 1 
ATOM   1063 C "C5'" . DT  B 2 9   ? 33.295 -30.645 1.863   1.00 82.14  ? 9   DT  B "C5'" 1 
ATOM   1064 C "C4'" . DT  B 2 9   ? 34.217 -31.765 1.418   1.00 86.52  ? 9   DT  B "C4'" 1 
ATOM   1065 O "O4'" . DT  B 2 9   ? 33.634 -33.067 1.726   1.00 89.44  ? 9   DT  B "O4'" 1 
ATOM   1066 C "C3'" . DT  B 2 9   ? 34.385 -31.788 -0.088  1.00 89.11  ? 9   DT  B "C3'" 1 
ATOM   1067 O "O3'" . DT  B 2 9   ? 35.574 -32.456 -0.427  1.00 98.90  ? 9   DT  B "O3'" 1 
ATOM   1068 C "C2'" . DT  B 2 9   ? 33.207 -32.659 -0.469  1.00 80.28  ? 9   DT  B "C2'" 1 
ATOM   1069 C "C1'" . DT  B 2 9   ? 33.522 -33.768 0.509   1.00 75.81  ? 9   DT  B "C1'" 1 
ATOM   1070 N N1    . DT  B 2 9   ? 32.447 -34.760 0.491   1.00 79.49  ? 9   DT  B N1    1 
ATOM   1071 C C2    . DT  B 2 9   ? 32.712 -36.075 0.818   1.00 89.20  ? 9   DT  B C2    1 
ATOM   1072 O O2    . DT  B 2 9   ? 33.813 -36.463 1.166   1.00 99.76  ? 9   DT  B O2    1 
ATOM   1073 N N3    . DT  B 2 9   ? 31.630 -36.915 0.733   1.00 82.72  ? 9   DT  B N3    1 
ATOM   1074 C C4    . DT  B 2 9   ? 30.348 -36.559 0.343   1.00 80.85  ? 9   DT  B C4    1 
ATOM   1075 O O4    . DT  B 2 9   ? 29.421 -37.358 0.278   1.00 83.10  ? 9   DT  B O4    1 
ATOM   1076 C C5    . DT  B 2 9   ? 30.149 -35.176 0.006   1.00 81.57  ? 9   DT  B C5    1 
ATOM   1077 C C7    . DT  B 2 9   ? 28.792 -34.707 -0.427  1.00 67.51  ? 9   DT  B C7    1 
ATOM   1078 C C6    . DT  B 2 9   ? 31.197 -34.345 0.086   1.00 78.27  ? 9   DT  B C6    1 
ATOM   1079 P P     . DA  B 2 10  ? 36.829 -31.627 -0.974  1.00 109.34 ? 10  DA  B P     1 
ATOM   1080 O OP1   . DA  B 2 10  ? 37.178 -30.618 0.057   1.00 106.61 ? 10  DA  B OP1   1 
ATOM   1081 O OP2   . DA  B 2 10  ? 36.524 -31.199 -2.362  1.00 103.15 ? 10  DA  B OP2   1 
ATOM   1082 O "O5'" . DA  B 2 10  ? 37.989 -32.723 -1.042  1.00 101.11 ? 10  DA  B "O5'" 1 
ATOM   1083 C "C5'" . DA  B 2 10  ? 38.203 -33.565 0.084   1.00 102.18 ? 10  DA  B "C5'" 1 
ATOM   1084 C "C4'" . DA  B 2 10  ? 38.518 -34.979 -0.366  1.00 107.24 ? 10  DA  B "C4'" 1 
ATOM   1085 O "O4'" . DA  B 2 10  ? 37.299 -35.752 -0.500  1.00 111.12 ? 10  DA  B "O4'" 1 
ATOM   1086 C "C3'" . DA  B 2 10  ? 39.221 -35.102 -1.708  1.00 104.94 ? 10  DA  B "C3'" 1 
ATOM   1087 O "O3'" . DA  B 2 10  ? 40.061 -36.210 -1.608  1.00 103.61 ? 10  DA  B "O3'" 1 
ATOM   1088 C "C2'" . DA  B 2 10  ? 38.079 -35.396 -2.674  1.00 104.35 ? 10  DA  B "C2'" 1 
ATOM   1089 C "C1'" . DA  B 2 10  ? 37.220 -36.296 -1.803  1.00 108.00 ? 10  DA  B "C1'" 1 
ATOM   1090 N N9    . DA  B 2 10  ? 35.822 -36.218 -2.160  1.00 104.60 ? 10  DA  B N9    1 
ATOM   1091 C C8    . DA  B 2 10  ? 35.184 -35.117 -2.648  1.00 105.03 ? 10  DA  B C8    1 
ATOM   1092 N N7    . DA  B 2 10  ? 33.906 -35.305 -2.874  1.00 101.18 ? 10  DA  B N7    1 
ATOM   1093 C C5    . DA  B 2 10  ? 33.703 -36.619 -2.505  1.00 96.33  ? 10  DA  B C5    1 
ATOM   1094 C C6    . DA  B 2 10  ? 32.554 -37.415 -2.521  1.00 93.87  ? 10  DA  B C6    1 
ATOM   1095 N N6    . DA  B 2 10  ? 31.378 -36.939 -2.940  1.00 81.44  ? 10  DA  B N6    1 
ATOM   1096 N N1    . DA  B 2 10  ? 32.666 -38.691 -2.097  1.00 94.46  ? 10  DA  B N1    1 
ATOM   1097 C C2    . DA  B 2 10  ? 33.863 -39.121 -1.680  1.00 97.12  ? 10  DA  B C2    1 
ATOM   1098 N N3    . DA  B 2 10  ? 35.020 -38.461 -1.621  1.00 99.84  ? 10  DA  B N3    1 
ATOM   1099 C C4    . DA  B 2 10  ? 34.868 -37.202 -2.055  1.00 100.08 ? 10  DA  B C4    1 
ATOM   1100 P P     . DG  B 2 11  ? 41.100 -36.539 -2.783  1.00 127.30 ? 11  DG  B P     1 
ATOM   1101 O OP1   . DG  B 2 11  ? 42.464 -36.347 -2.250  1.00 122.82 ? 11  DG  B OP1   1 
ATOM   1102 O OP2   . DG  B 2 11  ? 40.651 -35.833 -4.006  1.00 120.69 ? 11  DG  B OP2   1 
ATOM   1103 O "O5'" . DG  B 2 11  ? 40.874 -38.090 -3.044  1.00 116.74 ? 11  DG  B "O5'" 1 
ATOM   1104 C "C5'" . DG  B 2 11  ? 40.313 -38.894 -2.011  1.00 112.36 ? 11  DG  B "C5'" 1 
ATOM   1105 C "C4'" . DG  B 2 11  ? 39.690 -40.118 -2.650  1.00 111.00 ? 11  DG  B "C4'" 1 
ATOM   1106 O "O4'" . DG  B 2 11  ? 38.272 -39.894 -2.860  1.00 107.14 ? 11  DG  B "O4'" 1 
ATOM   1107 C "C3'" . DG  B 2 11  ? 40.272 -40.454 -4.014  1.00 110.09 ? 11  DG  B "C3'" 1 
ATOM   1108 O "O3'" . DG  B 2 11  ? 40.407 -41.850 -4.128  1.00 104.78 ? 11  DG  B "O3'" 1 
ATOM   1109 C "C2'" . DG  B 2 11  ? 39.208 -39.925 -4.964  1.00 99.59  ? 11  DG  B "C2'" 1 
ATOM   1110 C "C1'" . DG  B 2 11  ? 37.958 -40.264 -4.172  1.00 98.04  ? 11  DG  B "C1'" 1 
ATOM   1111 N N9    . DG  B 2 11  ? 36.824 -39.473 -4.604  1.00 94.95  ? 11  DG  B N9    1 
ATOM   1112 C C8    . DG  B 2 11  ? 36.825 -38.137 -4.905  1.00 93.45  ? 11  DG  B C8    1 
ATOM   1113 N N7    . DG  B 2 11  ? 35.659 -37.693 -5.280  1.00 93.82  ? 11  DG  B N7    1 
ATOM   1114 C C5    . DG  B 2 11  ? 34.838 -38.813 -5.227  1.00 100.04 ? 11  DG  B C5    1 
ATOM   1115 C C6    . DG  B 2 11  ? 33.461 -38.946 -5.525  1.00 103.15 ? 11  DG  B C6    1 
ATOM   1116 O O6    . DG  B 2 11  ? 32.678 -38.060 -5.911  1.00 98.66  ? 11  DG  B O6    1 
ATOM   1117 N N1    . DG  B 2 11  ? 33.021 -40.259 -5.335  1.00 104.56 ? 11  DG  B N1    1 
ATOM   1118 C C2    . DG  B 2 11  ? 33.814 -41.300 -4.907  1.00 106.81 ? 11  DG  B C2    1 
ATOM   1119 N N2    . DG  B 2 11  ? 33.219 -42.493 -4.778  1.00 110.15 ? 11  DG  B N2    1 
ATOM   1120 N N3    . DG  B 2 11  ? 35.103 -41.184 -4.621  1.00 106.07 ? 11  DG  B N3    1 
ATOM   1121 C C4    . DG  B 2 11  ? 35.543 -39.918 -4.807  1.00 100.80 ? 11  DG  B C4    1 
ATOM   1122 P P     . DT  B 2 12  ? 41.316 -42.481 -5.297  1.00 145.80 ? 12  DT  B P     1 
ATOM   1123 O OP1   . DT  B 2 12  ? 42.502 -43.107 -4.668  1.00 145.62 ? 12  DT  B OP1   1 
ATOM   1124 O OP2   . DT  B 2 12  ? 41.496 -41.448 -6.350  1.00 136.66 ? 12  DT  B OP2   1 
ATOM   1125 O "O5'" . DT  B 2 12  ? 40.390 -43.631 -5.899  1.00 139.66 ? 12  DT  B "O5'" 1 
ATOM   1126 C "C5'" . DT  B 2 12  ? 39.588 -44.413 -5.015  1.00 133.64 ? 12  DT  B "C5'" 1 
ATOM   1127 C "C4'" . DT  B 2 12  ? 38.377 -44.951 -5.755  1.00 125.94 ? 12  DT  B "C4'" 1 
ATOM   1128 O "O4'" . DT  B 2 12  ? 37.395 -43.892 -5.912  1.00 118.28 ? 12  DT  B "O4'" 1 
ATOM   1129 C "C3'" . DT  B 2 12  ? 38.686 -45.458 -7.158  1.00 122.30 ? 12  DT  B "C3'" 1 
ATOM   1130 O "O3'" . DT  B 2 12  ? 37.957 -46.650 -7.410  1.00 127.48 ? 12  DT  B "O3'" 1 
ATOM   1131 C "C2'" . DT  B 2 12  ? 38.206 -44.305 -8.035  1.00 115.38 ? 12  DT  B "C2'" 1 
ATOM   1132 C "C1'" . DT  B 2 12  ? 36.974 -43.869 -7.254  1.00 112.95 ? 12  DT  B "C1'" 1 
ATOM   1133 N N1    . DT  B 2 12  ? 36.504 -42.510 -7.623  1.00 109.74 ? 12  DT  B N1    1 
ATOM   1134 C C2    . DT  B 2 12  ? 35.155 -42.309 -7.821  1.00 108.47 ? 12  DT  B C2    1 
ATOM   1135 O O2    . DT  B 2 12  ? 34.339 -43.201 -7.685  1.00 111.55 ? 12  DT  B O2    1 
ATOM   1136 N N3    . DT  B 2 12  ? 34.798 -41.030 -8.176  1.00 102.33 ? 12  DT  B N3    1 
ATOM   1137 C C4    . DT  B 2 12  ? 35.655 -39.957 -8.350  1.00 102.98 ? 12  DT  B C4    1 
ATOM   1138 O O4    . DT  B 2 12  ? 35.259 -38.840 -8.673  1.00 92.69  ? 12  DT  B O4    1 
ATOM   1139 C C5    . DT  B 2 12  ? 37.053 -40.243 -8.134  1.00 105.96 ? 12  DT  B C5    1 
ATOM   1140 C C7    . DT  B 2 12  ? 38.064 -39.151 -8.298  1.00 107.80 ? 12  DT  B C7    1 
ATOM   1141 C C6    . DT  B 2 12  ? 37.412 -41.488 -7.792  1.00 107.69 ? 12  DT  B C6    1 
ATOM   1142 P P     . DA  B 2 13  ? 38.502 -47.723 -8.479  1.00 149.05 ? 13  DA  B P     1 
ATOM   1143 O OP1   . DA  B 2 13  ? 38.938 -48.927 -7.736  1.00 152.59 ? 13  DA  B OP1   1 
ATOM   1144 O OP2   . DA  B 2 13  ? 39.433 -47.028 -9.401  1.00 139.36 ? 13  DA  B OP2   1 
ATOM   1145 O "O5'" . DA  B 2 13  ? 37.204 -48.091 -9.328  1.00 150.80 ? 13  DA  B "O5'" 1 
ATOM   1146 C "C5'" . DA  B 2 13  ? 35.959 -48.317 -8.682  1.00 142.32 ? 13  DA  B "C5'" 1 
ATOM   1147 C "C4'" . DA  B 2 13  ? 34.888 -48.073 -9.720  1.00 135.45 ? 13  DA  B "C4'" 1 
ATOM   1148 O "O4'" . DA  B 2 13  ? 34.594 -46.653 -9.796  1.00 130.62 ? 13  DA  B "O4'" 1 
ATOM   1149 C "C3'" . DA  B 2 13  ? 35.330 -48.469 -11.127 1.00 130.24 ? 13  DA  B "C3'" 1 
ATOM   1150 O "O3'" . DA  B 2 13  ? 34.224 -48.985 -11.847 1.00 128.84 ? 13  DA  B "O3'" 1 
ATOM   1151 C "C2'" . DA  B 2 13  ? 35.788 -47.137 -11.710 1.00 125.68 ? 13  DA  B "C2'" 1 
ATOM   1152 C "C1'" . DA  B 2 13  ? 34.650 -46.294 -11.161 1.00 126.68 ? 13  DA  B "C1'" 1 
ATOM   1153 N N9    . DA  B 2 13  ? 34.823 -44.857 -11.304 1.00 123.78 ? 13  DA  B N9    1 
ATOM   1154 C C8    . DA  B 2 13  ? 35.984 -44.141 -11.285 1.00 123.94 ? 13  DA  B C8    1 
ATOM   1155 N N7    . DA  B 2 13  ? 35.809 -42.847 -11.442 1.00 117.87 ? 13  DA  B N7    1 
ATOM   1156 C C5    . DA  B 2 13  ? 34.442 -42.717 -11.574 1.00 114.68 ? 13  DA  B C5    1 
ATOM   1157 C C6    . DA  B 2 13  ? 33.618 -41.599 -11.765 1.00 109.76 ? 13  DA  B C6    1 
ATOM   1158 N N6    . DA  B 2 13  ? 34.090 -40.359 -11.866 1.00 103.09 ? 13  DA  B N6    1 
ATOM   1159 N N1    . DA  B 2 13  ? 32.291 -41.808 -11.847 1.00 115.04 ? 13  DA  B N1    1 
ATOM   1160 C C2    . DA  B 2 13  ? 31.832 -43.063 -11.750 1.00 122.49 ? 13  DA  B C2    1 
ATOM   1161 N N3    . DA  B 2 13  ? 32.510 -44.196 -11.570 1.00 123.67 ? 13  DA  B N3    1 
ATOM   1162 C C4    . DA  B 2 13  ? 33.821 -43.945 -11.490 1.00 120.50 ? 13  DA  B C4    1 
ATOM   1163 O "O5'" . DC  C 3 1   ? 30.203 -31.777 -15.311 1.00 129.26 ? 14  DC  C "O5'" 1 
ATOM   1164 C "C5'" . DC  C 3 1   ? 30.035 -31.958 -16.724 1.00 123.67 ? 14  DC  C "C5'" 1 
ATOM   1165 C "C4'" . DC  C 3 1   ? 29.286 -33.245 -17.024 1.00 120.38 ? 14  DC  C "C4'" 1 
ATOM   1166 O "O4'" . DC  C 3 1   ? 30.210 -34.248 -17.513 1.00 124.69 ? 14  DC  C "O4'" 1 
ATOM   1167 C "C3'" . DC  C 3 1   ? 28.663 -33.875 -15.795 1.00 114.24 ? 14  DC  C "C3'" 1 
ATOM   1168 O "O3'" . DC  C 3 1   ? 27.355 -33.375 -15.600 1.00 107.68 ? 14  DC  C "O3'" 1 
ATOM   1169 C "C2'" . DC  C 3 1   ? 28.671 -35.374 -16.096 1.00 115.74 ? 14  DC  C "C2'" 1 
ATOM   1170 C "C1'" . DC  C 3 1   ? 29.874 -35.538 -17.018 1.00 121.99 ? 14  DC  C "C1'" 1 
ATOM   1171 N N1    . DC  C 3 1   ? 31.091 -36.163 -16.403 1.00 119.44 ? 14  DC  C N1    1 
ATOM   1172 C C2    . DC  C 3 1   ? 32.177 -35.363 -16.028 1.00 125.47 ? 14  DC  C C2    1 
ATOM   1173 O O2    . DC  C 3 1   ? 32.113 -34.140 -16.186 1.00 136.26 ? 14  DC  C O2    1 
ATOM   1174 N N3    . DC  C 3 1   ? 33.282 -35.941 -15.490 1.00 116.01 ? 14  DC  C N3    1 
ATOM   1175 C C4    . DC  C 3 1   ? 33.333 -37.256 -15.322 1.00 111.51 ? 14  DC  C C4    1 
ATOM   1176 N N4    . DC  C 3 1   ? 34.447 -37.759 -14.782 1.00 103.05 ? 14  DC  C N4    1 
ATOM   1177 C C5    . DC  C 3 1   ? 32.241 -38.093 -15.705 1.00 116.29 ? 14  DC  C C5    1 
ATOM   1178 C C6    . DC  C 3 1   ? 31.156 -37.516 -16.240 1.00 117.97 ? 14  DC  C C6    1 
ATOM   1179 P P     . DT  C 3 2   ? 26.645 -33.547 -14.177 1.00 167.20 ? 15  DT  C P     1 
ATOM   1180 O OP1   . DT  C 3 2   ? 25.341 -32.847 -14.231 1.00 172.92 ? 15  DT  C OP1   1 
ATOM   1181 O OP2   . DT  C 3 2   ? 27.641 -33.203 -13.131 1.00 153.96 ? 15  DT  C OP2   1 
ATOM   1182 O "O5'" . DT  C 3 2   ? 26.361 -35.120 -14.091 1.00 127.43 ? 15  DT  C "O5'" 1 
ATOM   1183 C "C5'" . DT  C 3 2   ? 25.501 -35.778 -15.019 1.00 132.15 ? 15  DT  C "C5'" 1 
ATOM   1184 C "C4'" . DT  C 3 2   ? 25.476 -37.266 -14.714 1.00 135.04 ? 15  DT  C "C4'" 1 
ATOM   1185 O "O4'" . DT  C 3 2   ? 26.846 -37.734 -14.675 1.00 128.50 ? 15  DT  C "O4'" 1 
ATOM   1186 C "C3'" . DT  C 3 2   ? 24.852 -37.646 -13.366 1.00 140.80 ? 15  DT  C "C3'" 1 
ATOM   1187 O "O3'" . DT  C 3 2   ? 23.661 -38.495 -13.532 1.00 151.02 ? 15  DT  C "O3'" 1 
ATOM   1188 C "C2'" . DT  C 3 2   ? 26.014 -38.227 -12.556 1.00 132.07 ? 15  DT  C "C2'" 1 
ATOM   1189 C "C1'" . DT  C 3 2   ? 27.004 -38.658 -13.624 1.00 126.79 ? 15  DT  C "C1'" 1 
ATOM   1190 N N1    . DT  C 3 2   ? 28.424 -38.640 -13.187 1.00 121.72 ? 15  DT  C N1    1 
ATOM   1191 C C2    . DT  C 3 2   ? 29.034 -39.819 -12.815 1.00 127.62 ? 15  DT  C C2    1 
ATOM   1192 O O2    . DT  C 3 2   ? 28.468 -40.897 -12.813 1.00 139.12 ? 15  DT  C O2    1 
ATOM   1193 N N3    . DT  C 3 2   ? 30.344 -39.696 -12.429 1.00 118.80 ? 15  DT  C N3    1 
ATOM   1194 C C4    . DT  C 3 2   ? 31.091 -38.536 -12.389 1.00 109.32 ? 15  DT  C C4    1 
ATOM   1195 O O4    . DT  C 3 2   ? 32.267 -38.511 -12.040 1.00 94.70  ? 15  DT  C O4    1 
ATOM   1196 C C5    . DT  C 3 2   ? 30.391 -37.348 -12.792 1.00 114.31 ? 15  DT  C C5    1 
ATOM   1197 C C7    . DT  C 3 2   ? 31.118 -36.042 -12.782 1.00 116.08 ? 15  DT  C C7    1 
ATOM   1198 C C6    . DT  C 3 2   ? 29.111 -37.448 -13.167 1.00 116.16 ? 15  DT  C C6    1 
ATOM   1199 P P     . DA  C 3 3   ? 23.636 -40.020 -13.001 1.00 210.19 ? 16  DA  C P     1 
ATOM   1200 O OP1   . DA  C 3 3   ? 24.900 -40.668 -13.403 1.00 208.77 ? 16  DA  C OP1   1 
ATOM   1201 O OP2   . DA  C 3 3   ? 22.361 -40.629 -13.433 1.00 215.25 ? 16  DA  C OP2   1 
ATOM   1202 O "O5'" . DA  C 3 3   ? 23.572 -39.877 -11.402 1.00 131.05 ? 16  DA  C "O5'" 1 
ATOM   1203 C "C5'" . DA  C 3 3   ? 24.719 -40.216 -10.625 1.00 129.75 ? 16  DA  C "C5'" 1 
ATOM   1204 C "C4'" . DA  C 3 3   ? 24.994 -41.707 -10.634 1.00 136.80 ? 16  DA  C "C4'" 1 
ATOM   1205 O "O4'" . DA  C 3 3   ? 26.406 -41.955 -10.849 1.00 132.19 ? 16  DA  C "O4'" 1 
ATOM   1206 C "C3'" . DA  C 3 3   ? 24.689 -42.365 -9.305  1.00 146.91 ? 16  DA  C "C3'" 1 
ATOM   1207 O "O3'" . DA  C 3 3   ? 24.386 -43.728 -9.501  1.00 154.62 ? 16  DA  C "O3'" 1 
ATOM   1208 C "C2'" . DA  C 3 3   ? 25.985 -42.163 -8.517  1.00 140.64 ? 16  DA  C "C2'" 1 
ATOM   1209 C "C1'" . DA  C 3 3   ? 27.060 -42.125 -9.604  1.00 134.75 ? 16  DA  C "C1'" 1 
ATOM   1210 N N9    . DA  C 3 3   ? 28.043 -41.051 -9.452  1.00 124.24 ? 16  DA  C N9    1 
ATOM   1211 C C8    . DA  C 3 3   ? 27.833 -39.701 -9.528  1.00 115.09 ? 16  DA  C C8    1 
ATOM   1212 N N7    . DA  C 3 3   ? 28.921 -38.986 -9.361  1.00 105.27 ? 16  DA  C N7    1 
ATOM   1213 C C5    . DA  C 3 3   ? 29.912 -39.932 -9.167  1.00 104.20 ? 16  DA  C C5    1 
ATOM   1214 C C6    . DA  C 3 3   ? 31.295 -39.823 -8.928  1.00 99.22  ? 16  DA  C C6    1 
ATOM   1215 N N6    . DA  C 3 3   ? 31.939 -38.658 -8.847  1.00 86.65  ? 16  DA  C N6    1 
ATOM   1216 N N1    . DA  C 3 3   ? 31.998 -40.962 -8.775  1.00 106.67 ? 16  DA  C N1    1 
ATOM   1217 C C2    . DA  C 3 3   ? 31.345 -42.128 -8.855  1.00 115.44 ? 16  DA  C C2    1 
ATOM   1218 N N3    . DA  C 3 3   ? 30.052 -42.360 -9.075  1.00 117.91 ? 16  DA  C N3    1 
ATOM   1219 C C4    . DA  C 3 3   ? 29.387 -41.207 -9.222  1.00 114.86 ? 16  DA  C C4    1 
ATOM   1220 P P     . DC  C 3 4   ? 23.740 -44.583 -8.306  1.00 156.42 ? 17  DC  C P     1 
ATOM   1221 O OP1   . DC  C 3 4   ? 23.161 -45.811 -8.891  1.00 163.52 ? 17  DC  C OP1   1 
ATOM   1222 O OP2   . DC  C 3 4   ? 22.904 -43.674 -7.491  1.00 147.85 ? 17  DC  C OP2   1 
ATOM   1223 O "O5'" . DC  C 3 4   ? 24.999 -44.962 -7.405  1.00 146.64 ? 17  DC  C "O5'" 1 
ATOM   1224 C "C5'" . DC  C 3 4   ? 26.114 -45.566 -8.043  1.00 147.05 ? 17  DC  C "C5'" 1 
ATOM   1225 C "C4'" . DC  C 3 4   ? 27.191 -45.792 -7.007  1.00 137.86 ? 17  DC  C "C4'" 1 
ATOM   1226 O "O4'" . DC  C 3 4   ? 28.119 -44.679 -7.020  1.00 131.27 ? 17  DC  C "O4'" 1 
ATOM   1227 C "C3'" . DC  C 3 4   ? 26.664 -45.852 -5.584  1.00 126.50 ? 17  DC  C "C3'" 1 
ATOM   1228 O "O3'" . DC  C 3 4   ? 27.516 -46.691 -4.826  1.00 117.36 ? 17  DC  C "O3'" 1 
ATOM   1229 C "C2'" . DC  C 3 4   ? 26.807 -44.394 -5.171  1.00 120.97 ? 17  DC  C "C2'" 1 
ATOM   1230 C "C1'" . DC  C 3 4   ? 28.214 -44.198 -5.704  1.00 122.75 ? 17  DC  C "C1'" 1 
ATOM   1231 N N1    . DC  C 3 4   ? 28.653 -42.797 -5.774  1.00 121.58 ? 17  DC  C N1    1 
ATOM   1232 C C2    . DC  C 3 4   ? 30.011 -42.502 -5.614  1.00 115.99 ? 17  DC  C C2    1 
ATOM   1233 O O2    . DC  C 3 4   ? 30.806 -43.433 -5.420  1.00 117.83 ? 17  DC  C O2    1 
ATOM   1234 N N3    . DC  C 3 4   ? 30.402 -41.204 -5.678  1.00 101.69 ? 17  DC  C N3    1 
ATOM   1235 C C4    . DC  C 3 4   ? 29.492 -40.252 -5.896  1.00 96.30  ? 17  DC  C C4    1 
ATOM   1236 N N4    . DC  C 3 4   ? 29.911 -38.989 -5.954  1.00 85.28  ? 17  DC  C N4    1 
ATOM   1237 C C5    . DC  C 3 4   ? 28.110 -40.541 -6.064  1.00 101.84 ? 17  DC  C C5    1 
ATOM   1238 C C6    . DC  C 3 4   ? 27.737 -41.818 -5.993  1.00 115.10 ? 17  DC  C C6    1 
ATOM   1239 P P     . DT  C 3 5   ? 27.374 -46.749 -3.225  1.00 165.02 ? 18  DT  C P     1 
ATOM   1240 O OP1   . DT  C 3 5   ? 25.996 -47.182 -2.903  1.00 164.30 ? 18  DT  C OP1   1 
ATOM   1241 O OP2   . DT  C 3 5   ? 27.870 -45.473 -2.674  1.00 161.79 ? 18  DT  C OP2   1 
ATOM   1242 O "O5'" . DT  C 3 5   ? 28.412 -47.888 -2.796  1.00 141.84 ? 18  DT  C "O5'" 1 
ATOM   1243 C "C5'" . DT  C 3 5   ? 29.773 -47.837 -3.236  1.00 136.81 ? 18  DT  C "C5'" 1 
ATOM   1244 C "C4'" . DT  C 3 5   ? 30.681 -47.159 -2.219  1.00 127.42 ? 18  DT  C "C4'" 1 
ATOM   1245 O "O4'" . DT  C 3 5   ? 30.988 -45.811 -2.644  1.00 114.48 ? 18  DT  C "O4'" 1 
ATOM   1246 C "C3'" . DT  C 3 5   ? 30.093 -47.025 -0.817  1.00 131.80 ? 18  DT  C "C3'" 1 
ATOM   1247 O "O3'" . DT  C 3 5   ? 30.481 -48.154 -0.017  1.00 135.82 ? 18  DT  C "O3'" 1 
ATOM   1248 C "C2'" . DT  C 3 5   ? 30.623 -45.683 -0.301  1.00 121.75 ? 18  DT  C "C2'" 1 
ATOM   1249 C "C1'" . DT  C 3 5   ? 31.292 -45.031 -1.508  1.00 109.58 ? 18  DT  C "C1'" 1 
ATOM   1250 N N1    . DT  C 3 5   ? 30.792 -43.661 -1.752  1.00 101.70 ? 18  DT  C N1    1 
ATOM   1251 C C2    . DT  C 3 5   ? 31.673 -42.610 -1.771  1.00 104.89 ? 18  DT  C C2    1 
ATOM   1252 O O2    . DT  C 3 5   ? 32.869 -42.752 -1.598  1.00 109.04 ? 18  DT  C O2    1 
ATOM   1253 N N3    . DT  C 3 5   ? 31.097 -41.387 -2.007  1.00 102.71 ? 18  DT  C N3    1 
ATOM   1254 C C4    . DT  C 3 5   ? 29.755 -41.122 -2.212  1.00 99.64  ? 18  DT  C C4    1 
ATOM   1255 O O4    . DT  C 3 5   ? 29.319 -39.990 -2.412  1.00 92.45  ? 18  DT  C O4    1 
ATOM   1256 C C5    . DT  C 3 5   ? 28.897 -42.276 -2.172  1.00 101.98 ? 18  DT  C C5    1 
ATOM   1257 C C7    . DT  C 3 5   ? 27.421 -42.131 -2.381  1.00 107.75 ? 18  DT  C C7    1 
ATOM   1258 C C6    . DT  C 3 5   ? 29.449 -43.468 -1.945  1.00 101.62 ? 18  DT  C C6    1 
ATOM   1259 P P     . DA  C 3 6   ? 31.611 -48.009 1.121   1.00 169.90 ? 19  DA  C P     1 
ATOM   1260 O OP1   . DA  C 3 6   ? 32.149 -49.360 1.394   1.00 168.53 ? 19  DA  C OP1   1 
ATOM   1261 O OP2   . DA  C 3 6   ? 31.046 -47.200 2.227   1.00 165.81 ? 19  DA  C OP2   1 
ATOM   1262 O "O5'" . DA  C 3 6   ? 32.775 -47.162 0.408   1.00 145.15 ? 19  DA  C "O5'" 1 
ATOM   1263 C "C5'" . DA  C 3 6   ? 34.136 -47.292 0.842   1.00 137.20 ? 19  DA  C "C5'" 1 
ATOM   1264 C "C4'" . DA  C 3 6   ? 34.665 -46.134 1.684   1.00 127.67 ? 19  DA  C "C4'" 1 
ATOM   1265 O "O4'" . DA  C 3 6   ? 34.111 -44.858 1.252   1.00 125.48 ? 19  DA  C "O4'" 1 
ATOM   1266 C "C3'" . DA  C 3 6   ? 34.438 -46.187 3.200   1.00 127.03 ? 19  DA  C "C3'" 1 
ATOM   1267 O "O3'" . DA  C 3 6   ? 35.733 -46.027 3.826   1.00 126.59 ? 19  DA  C "O3'" 1 
ATOM   1268 C "C2'" . DA  C 3 6   ? 33.487 -45.003 3.441   1.00 119.79 ? 19  DA  C "C2'" 1 
ATOM   1269 C "C1'" . DA  C 3 6   ? 34.061 -44.038 2.413   1.00 116.22 ? 19  DA  C "C1'" 1 
ATOM   1270 N N9    . DA  C 3 6   ? 33.342 -42.790 2.115   1.00 112.50 ? 19  DA  C N9    1 
ATOM   1271 C C8    . DA  C 3 6   ? 33.914 -41.558 1.898   1.00 105.58 ? 19  DA  C C8    1 
ATOM   1272 N N7    . DA  C 3 6   ? 33.071 -40.588 1.625   1.00 94.90  ? 19  DA  C N7    1 
ATOM   1273 C C5    . DA  C 3 6   ? 31.857 -41.236 1.663   1.00 98.65  ? 19  DA  C C5    1 
ATOM   1274 C C6    . DA  C 3 6   ? 30.566 -40.753 1.458   1.00 96.00  ? 19  DA  C C6    1 
ATOM   1275 N N6    . DA  C 3 6   ? 30.334 -39.475 1.175   1.00 84.20  ? 19  DA  C N6    1 
ATOM   1276 N N1    . DA  C 3 6   ? 29.548 -41.634 1.568   1.00 109.97 ? 19  DA  C N1    1 
ATOM   1277 C C2    . DA  C 3 6   ? 29.823 -42.917 1.858   1.00 113.40 ? 19  DA  C C2    1 
ATOM   1278 N N3    . DA  C 3 6   ? 31.007 -43.493 2.073   1.00 110.63 ? 19  DA  C N3    1 
ATOM   1279 C C4    . DA  C 3 6   ? 31.990 -42.585 1.962   1.00 109.00 ? 19  DA  C C4    1 
ATOM   1280 P P     . DG  C 3 7   ? 35.885 -46.043 5.435   1.00 177.20 ? 20  DG  C P     1 
ATOM   1281 O OP1   . DG  C 3 7   ? 37.258 -46.487 5.762   1.00 175.10 ? 20  DG  C OP1   1 
ATOM   1282 O OP2   . DG  C 3 7   ? 34.718 -46.759 6.007   1.00 178.59 ? 20  DG  C OP2   1 
ATOM   1283 O "O5'" . DG  C 3 7   ? 35.777 -44.501 5.839   1.00 141.56 ? 20  DG  C "O5'" 1 
ATOM   1284 C "C5'" . DG  C 3 7   ? 36.830 -43.597 5.514   1.00 135.79 ? 20  DG  C "C5'" 1 
ATOM   1285 C "C4'" . DG  C 3 7   ? 36.462 -42.178 5.916   1.00 126.83 ? 20  DG  C "C4'" 1 
ATOM   1286 O "O4'" . DG  C 3 7   ? 35.280 -41.766 5.182   1.00 129.42 ? 20  DG  C "O4'" 1 
ATOM   1287 C "C3'" . DG  C 3 7   ? 36.102 -42.027 7.384   1.00 117.65 ? 20  DG  C "C3'" 1 
ATOM   1288 O "O3'" . DG  C 3 7   ? 37.086 -41.298 8.104   1.00 112.59 ? 20  DG  C "O3'" 1 
ATOM   1289 C "C2'" . DG  C 3 7   ? 34.758 -41.297 7.409   1.00 118.34 ? 20  DG  C "C2'" 1 
ATOM   1290 C "C1'" . DG  C 3 7   ? 34.536 -40.859 5.967   1.00 119.02 ? 20  DG  C "C1'" 1 
ATOM   1291 N N9    . DG  C 3 7   ? 33.127 -40.894 5.566   1.00 110.16 ? 20  DG  C N9    1 
ATOM   1292 C C8    . DG  C 3 7   ? 32.273 -41.967 5.618   1.00 112.18 ? 20  DG  C C8    1 
ATOM   1293 N N7    . DG  C 3 7   ? 31.068 -41.699 5.196   1.00 111.67 ? 20  DG  C N7    1 
ATOM   1294 C C5    . DG  C 3 7   ? 31.117 -40.360 4.843   1.00 104.98 ? 20  DG  C C5    1 
ATOM   1295 C C6    . DG  C 3 7   ? 30.104 -39.516 4.325   1.00 102.67 ? 20  DG  C C6    1 
ATOM   1296 O O6    . DG  C 3 7   ? 28.922 -39.789 4.060   1.00 108.27 ? 20  DG  C O6    1 
ATOM   1297 N N1    . DG  C 3 7   ? 30.585 -38.229 4.114   1.00 90.78  ? 20  DG  C N1    1 
ATOM   1298 C C2    . DG  C 3 7   ? 31.869 -37.816 4.371   1.00 86.81  ? 20  DG  C C2    1 
ATOM   1299 N N2    . DG  C 3 7   ? 32.144 -36.537 4.090   1.00 85.65  ? 20  DG  C N2    1 
ATOM   1300 N N3    . DG  C 3 7   ? 32.825 -38.590 4.860   1.00 88.09  ? 20  DG  C N3    1 
ATOM   1301 C C4    . DG  C 3 7   ? 32.378 -39.850 5.068   1.00 100.38 ? 20  DG  C C4    1 
ATOM   1302 P P     . DC  C 3 8   ? 36.960 -41.152 9.708   1.00 137.24 ? 21  DC  C P     1 
ATOM   1303 O OP1   . DC  C 3 8   ? 38.319 -40.955 10.264  1.00 130.38 ? 21  DC  C OP1   1 
ATOM   1304 O OP2   . DC  C 3 8   ? 36.135 -42.277 10.209  1.00 130.77 ? 21  DC  C OP2   1 
ATOM   1305 O "O5'" . DC  C 3 8   ? 36.134 -39.793 9.891   1.00 122.79 ? 21  DC  C "O5'" 1 
ATOM   1306 C "C5'" . DC  C 3 8   ? 36.631 -38.642 9.211   1.00 114.16 ? 21  DC  C "C5'" 1 
ATOM   1307 C "C4'" . DC  C 3 8   ? 35.568 -37.586 8.989   1.00 103.55 ? 21  DC  C "C4'" 1 
ATOM   1308 O "O4'" . DC  C 3 8   ? 34.473 -38.121 8.216   1.00 106.18 ? 21  DC  C "O4'" 1 
ATOM   1309 C "C3'" . DC  C 3 8   ? 34.868 -37.107 10.237  1.00 94.03  ? 21  DC  C "C3'" 1 
ATOM   1310 O "O3'" . DC  C 3 8   ? 35.697 -36.171 10.903  1.00 86.24  ? 21  DC  C "O3'" 1 
ATOM   1311 C "C2'" . DC  C 3 8   ? 33.602 -36.469 9.658   1.00 94.83  ? 21  DC  C "C2'" 1 
ATOM   1312 C "C1'" . DC  C 3 8   ? 33.370 -37.241 8.363   1.00 96.53  ? 21  DC  C "C1'" 1 
ATOM   1313 N N1    . DC  C 3 8   ? 32.110 -38.052 8.237   1.00 92.97  ? 21  DC  C N1    1 
ATOM   1314 C C2    . DC  C 3 8   ? 30.967 -37.463 7.685   1.00 93.76  ? 21  DC  C C2    1 
ATOM   1315 O O2    . DC  C 3 8   ? 31.020 -36.277 7.344   1.00 89.91  ? 21  DC  C O2    1 
ATOM   1316 N N3    . DC  C 3 8   ? 29.839 -38.207 7.545   1.00 98.25  ? 21  DC  C N3    1 
ATOM   1317 C C4    . DC  C 3 8   ? 29.830 -39.485 7.923   1.00 101.40 ? 21  DC  C C4    1 
ATOM   1318 N N4    . DC  C 3 8   ? 28.697 -40.169 7.761   1.00 92.15  ? 21  DC  C N4    1 
ATOM   1319 C C5    . DC  C 3 8   ? 30.986 -40.111 8.477   1.00 89.27  ? 21  DC  C C5    1 
ATOM   1320 C C6    . DC  C 3 8   ? 32.094 -39.367 8.611   1.00 94.63  ? 21  DC  C C6    1 
ATOM   1321 P P     . DC  C 3 9   ? 35.564 -35.965 12.492  1.00 98.85  ? 22  DC  C P     1 
ATOM   1322 O OP1   . DC  C 3 9   ? 36.483 -34.879 12.892  1.00 96.47  ? 22  DC  C OP1   1 
ATOM   1323 O OP2   . DC  C 3 9   ? 35.631 -37.297 13.132  1.00 103.40 ? 22  DC  C OP2   1 
ATOM   1324 O "O5'" . DC  C 3 9   ? 34.072 -35.426 12.683  1.00 80.99  ? 22  DC  C "O5'" 1 
ATOM   1325 C "C5'" . DC  C 3 9   ? 33.745 -34.110 12.285  1.00 68.69  ? 22  DC  C "C5'" 1 
ATOM   1326 C "C4'" . DC  C 3 9   ? 32.405 -33.808 12.896  1.00 85.52  ? 22  DC  C "C4'" 1 
ATOM   1327 O "O4'" . DC  C 3 9   ? 31.405 -34.483 12.103  1.00 72.34  ? 22  DC  C "O4'" 1 
ATOM   1328 C "C3'" . DC  C 3 9   ? 32.255 -34.345 14.317  1.00 84.86  ? 22  DC  C "C3'" 1 
ATOM   1329 O "O3'" . DC  C 3 9   ? 31.443 -33.452 15.081  1.00 91.08  ? 22  DC  C "O3'" 1 
ATOM   1330 C "C2'" . DC  C 3 9   ? 31.541 -35.666 14.058  1.00 79.88  ? 22  DC  C "C2'" 1 
ATOM   1331 C "C1'" . DC  C 3 9   ? 30.574 -35.152 13.007  1.00 79.18  ? 22  DC  C "C1'" 1 
ATOM   1332 N N1    . DC  C 3 9   ? 29.820 -36.179 12.291  1.00 85.40  ? 22  DC  C N1    1 
ATOM   1333 C C2    . DC  C 3 9   ? 28.577 -35.834 11.748  1.00 98.39  ? 22  DC  C C2    1 
ATOM   1334 O O2    . DC  C 3 9   ? 28.155 -34.676 11.879  1.00 98.12  ? 22  DC  C O2    1 
ATOM   1335 N N3    . DC  C 3 9   ? 27.865 -36.782 11.091  1.00 105.75 ? 22  DC  C N3    1 
ATOM   1336 C C4    . DC  C 3 9   ? 28.360 -38.017 10.978  1.00 104.32 ? 22  DC  C C4    1 
ATOM   1337 N N4    . DC  C 3 9   ? 27.622 -38.918 10.323  1.00 101.26 ? 22  DC  C N4    1 
ATOM   1338 C C5    . DC  C 3 9   ? 29.626 -38.381 11.535  1.00 100.28 ? 22  DC  C C5    1 
ATOM   1339 C C6    . DC  C 3 9   ? 30.322 -37.437 12.179  1.00 88.27  ? 22  DC  C C6    1 
ATOM   1340 P P     . DA  C 3 10  ? 31.610 -33.365 16.677  1.00 85.55  ? 23  DA  C P     1 
ATOM   1341 O OP1   . DA  C 3 10  ? 32.692 -32.408 16.966  1.00 79.38  ? 23  DA  C OP1   1 
ATOM   1342 O OP2   . DA  C 3 10  ? 31.659 -34.741 17.214  1.00 79.26  ? 23  DA  C OP2   1 
ATOM   1343 O "O5'" . DA  C 3 10  ? 30.270 -32.666 17.148  1.00 69.44  ? 23  DA  C "O5'" 1 
ATOM   1344 C "C5'" . DA  C 3 10  ? 30.253 -31.291 16.859  1.00 71.86  ? 23  DA  C "C5'" 1 
ATOM   1345 C "C4'" . DA  C 3 10  ? 28.860 -30.909 16.439  1.00 72.40  ? 23  DA  C "C4'" 1 
ATOM   1346 O "O4'" . DA  C 3 10  ? 28.407 -31.870 15.457  1.00 72.82  ? 23  DA  C "O4'" 1 
ATOM   1347 C "C3'" . DA  C 3 10  ? 27.862 -30.970 17.581  1.00 76.63  ? 23  DA  C "C3'" 1 
ATOM   1348 O "O3'" . DA  C 3 10  ? 26.908 -29.966 17.414  1.00 76.03  ? 23  DA  C "O3'" 1 
ATOM   1349 C "C2'" . DA  C 3 10  ? 27.213 -32.329 17.409  1.00 74.02  ? 23  DA  C "C2'" 1 
ATOM   1350 C "C1'" . DA  C 3 10  ? 27.199 -32.453 15.898  1.00 76.57  ? 23  DA  C "C1'" 1 
ATOM   1351 N N9    . DA  C 3 10  ? 27.167 -33.853 15.503  1.00 84.40  ? 23  DA  C N9    1 
ATOM   1352 C C8    . DA  C 3 10  ? 28.120 -34.796 15.776  1.00 84.39  ? 23  DA  C C8    1 
ATOM   1353 N N7    . DA  C 3 10  ? 27.819 -35.991 15.313  1.00 91.61  ? 23  DA  C N7    1 
ATOM   1354 C C5    . DA  C 3 10  ? 26.584 -35.815 14.693  1.00 97.25  ? 23  DA  C C5    1 
ATOM   1355 C C6    . DA  C 3 10  ? 25.721 -36.698 14.003  1.00 100.01 ? 23  DA  C C6    1 
ATOM   1356 N N6    . DA  C 3 10  ? 25.988 -37.998 13.813  1.00 103.87 ? 23  DA  C N6    1 
ATOM   1357 N N1    . DA  C 3 10  ? 24.567 -36.195 13.515  1.00 92.28  ? 23  DA  C N1    1 
ATOM   1358 C C2    . DA  C 3 10  ? 24.297 -34.902 13.705  1.00 88.95  ? 23  DA  C C2    1 
ATOM   1359 N N3    . DA  C 3 10  ? 25.029 -33.980 14.326  1.00 92.25  ? 23  DA  C N3    1 
ATOM   1360 C C4    . DA  C 3 10  ? 26.170 -34.502 14.803  1.00 92.40  ? 23  DA  C C4    1 
ATOM   1361 P P     . DT  C 3 11  ? 26.089 -29.427 18.677  1.00 93.83  ? 24  DT  C P     1 
ATOM   1362 O OP1   . DT  C 3 11  ? 25.807 -27.991 18.455  1.00 90.39  ? 24  DT  C OP1   1 
ATOM   1363 O OP2   . DT  C 3 11  ? 26.775 -29.915 19.901  1.00 92.98  ? 24  DT  C OP2   1 
ATOM   1364 O "O5'" . DT  C 3 11  ? 24.670 -30.143 18.538  1.00 78.56  ? 24  DT  C "O5'" 1 
ATOM   1365 C "C5'" . DT  C 3 11  ? 23.932 -29.856 17.364  1.00 83.44  ? 24  DT  C "C5'" 1 
ATOM   1366 C "C4'" . DT  C 3 11  ? 22.757 -30.799 17.247  1.00 86.59  ? 24  DT  C "C4'" 1 
ATOM   1367 O "O4'" . DT  C 3 11  ? 23.203 -32.076 16.711  1.00 93.36  ? 24  DT  C "O4'" 1 
ATOM   1368 C "C3'" . DT  C 3 11  ? 22.120 -31.095 18.592  1.00 86.55  ? 24  DT  C "C3'" 1 
ATOM   1369 O "O3'" . DT  C 3 11  ? 20.696 -30.892 18.608  1.00 92.45  ? 24  DT  C "O3'" 1 
ATOM   1370 C "C2'" . DT  C 3 11  ? 22.468 -32.562 18.822  1.00 90.76  ? 24  DT  C "C2'" 1 
ATOM   1371 C "C1'" . DT  C 3 11  ? 22.532 -33.098 17.406  1.00 95.62  ? 24  DT  C "C1'" 1 
ATOM   1372 N N1    . DT  C 3 11  ? 23.257 -34.401 17.343  1.00 98.16  ? 24  DT  C N1    1 
ATOM   1373 C C2    . DT  C 3 11  ? 22.616 -35.493 16.798  1.00 100.42 ? 24  DT  C C2    1 
ATOM   1374 O O2    . DT  C 3 11  ? 21.488 -35.447 16.345  1.00 104.08 ? 24  DT  C O2    1 
ATOM   1375 N N3    . DT  C 3 11  ? 23.351 -36.651 16.796  1.00 99.91  ? 24  DT  C N3    1 
ATOM   1376 C C4    . DT  C 3 11  ? 24.636 -36.826 17.279  1.00 98.89  ? 24  DT  C C4    1 
ATOM   1377 O O4    . DT  C 3 11  ? 25.203 -37.917 17.231  1.00 93.42  ? 24  DT  C O4    1 
ATOM   1378 C C5    . DT  C 3 11  ? 25.250 -35.643 17.846  1.00 99.55  ? 24  DT  C C5    1 
ATOM   1379 C C7    . DT  C 3 11  ? 26.642 -35.702 18.413  1.00 82.69  ? 24  DT  C C7    1 
ATOM   1380 C C6    . DT  C 3 11  ? 24.537 -34.506 17.852  1.00 96.72  ? 24  DT  C C6    1 
ATOM   1381 P P     . DG  C 3 12  ? 19.951 -30.518 19.990  1.00 126.65 ? 25  DG  C P     1 
ATOM   1382 O OP1   . DG  C 3 12  ? 19.898 -29.044 20.092  1.00 128.03 ? 25  DG  C OP1   1 
ATOM   1383 O OP2   . DG  C 3 12  ? 20.565 -31.317 21.085  1.00 113.78 ? 25  DG  C OP2   1 
ATOM   1384 O "O5'" . DG  C 3 12  ? 18.470 -31.084 19.793  1.00 98.41  ? 25  DG  C "O5'" 1 
ATOM   1385 C "C5'" . DG  C 3 12  ? 18.025 -31.734 18.600  1.00 98.66  ? 25  DG  C "C5'" 1 
ATOM   1386 C "C4'" . DG  C 3 12  ? 17.673 -33.212 18.784  1.00 98.66  ? 25  DG  C "C4'" 1 
ATOM   1387 O "O4'" . DG  C 3 12  ? 18.889 -33.987 18.737  1.00 101.01 ? 25  DG  C "O4'" 1 
ATOM   1388 C "C3'" . DG  C 3 12  ? 16.973 -33.679 20.067  1.00 105.88 ? 25  DG  C "C3'" 1 
ATOM   1389 O "O3'" . DG  C 3 12  ? 15.747 -34.320 19.775  1.00 105.65 ? 25  DG  C "O3'" 1 
ATOM   1390 C "C2'" . DG  C 3 12  ? 17.933 -34.695 20.683  1.00 101.30 ? 25  DG  C "C2'" 1 
ATOM   1391 C "C1'" . DG  C 3 12  ? 18.597 -35.181 19.419  1.00 111.59 ? 25  DG  C "C1'" 1 
ATOM   1392 N N9    . DG  C 3 12  ? 19.856 -35.889 19.555  1.00 117.71 ? 25  DG  C N9    1 
ATOM   1393 C C8    . DG  C 3 12  ? 21.020 -35.469 20.147  1.00 116.28 ? 25  DG  C C8    1 
ATOM   1394 N N7    . DG  C 3 12  ? 21.981 -36.349 20.067  1.00 115.27 ? 25  DG  C N7    1 
ATOM   1395 C C5    . DG  C 3 12  ? 21.415 -37.406 19.366  1.00 120.19 ? 25  DG  C C5    1 
ATOM   1396 C C6    . DG  C 3 12  ? 21.958 -38.647 18.963  1.00 122.03 ? 25  DG  C C6    1 
ATOM   1397 O O6    . DG  C 3 12  ? 23.094 -39.088 19.153  1.00 129.93 ? 25  DG  C O6    1 
ATOM   1398 N N1    . DG  C 3 12  ? 21.035 -39.422 18.269  1.00 117.34 ? 25  DG  C N1    1 
ATOM   1399 C C2    . DG  C 3 12  ? 19.744 -39.045 17.997  1.00 117.66 ? 25  DG  C C2    1 
ATOM   1400 N N2    . DG  C 3 12  ? 19.000 -39.925 17.318  1.00 120.20 ? 25  DG  C N2    1 
ATOM   1401 N N3    . DG  C 3 12  ? 19.217 -37.891 18.364  1.00 120.70 ? 25  DG  C N3    1 
ATOM   1402 C C4    . DG  C 3 12  ? 20.110 -37.131 19.040  1.00 121.45 ? 25  DG  C C4    1 
ATOM   1403 P P     . DG  C 3 13  ? 14.575 -34.360 20.880  1.00 147.20 ? 26  DG  C P     1 
ATOM   1404 O OP1   . DG  C 3 13  ? 13.523 -33.407 20.464  1.00 152.74 ? 26  DG  C OP1   1 
ATOM   1405 O OP2   . DG  C 3 13  ? 15.200 -34.227 22.217  1.00 135.92 ? 26  DG  C OP2   1 
ATOM   1406 O "O5'" . DG  C 3 13  ? 14.001 -35.855 20.771  1.00 129.07 ? 26  DG  C "O5'" 1 
ATOM   1407 C "C5'" . DG  C 3 13  ? 13.828 -36.448 19.483  1.00 126.93 ? 26  DG  C "C5'" 1 
ATOM   1408 C "C4'" . DG  C 3 13  ? 14.012 -37.957 19.509  1.00 126.32 ? 26  DG  C "C4'" 1 
ATOM   1409 O "O4'" . DG  C 3 13  ? 15.422 -38.312 19.454  1.00 126.93 ? 26  DG  C "O4'" 1 
ATOM   1410 C "C3'" . DG  C 3 13  ? 13.460 -38.651 20.745  1.00 130.94 ? 26  DG  C "C3'" 1 
ATOM   1411 O "O3'" . DG  C 3 13  ? 12.928 -39.902 20.358  1.00 137.14 ? 26  DG  C "O3'" 1 
ATOM   1412 C "C2'" . DG  C 3 13  ? 14.706 -38.838 21.598  1.00 128.17 ? 26  DG  C "C2'" 1 
ATOM   1413 C "C1'" . DG  C 3 13  ? 15.692 -39.219 20.506  1.00 130.49 ? 26  DG  C "C1'" 1 
ATOM   1414 N N9    . DG  C 3 13  ? 17.090 -39.133 20.926  1.00 132.95 ? 26  DG  C N9    1 
ATOM   1415 C C8    . DG  C 3 13  ? 17.737 -38.068 21.508  1.00 129.83 ? 26  DG  C C8    1 
ATOM   1416 N N7    . DG  C 3 13  ? 18.995 -38.295 21.773  1.00 126.24 ? 26  DG  C N7    1 
ATOM   1417 C C5    . DG  C 3 13  ? 19.195 -39.601 21.339  1.00 129.12 ? 26  DG  C C5    1 
ATOM   1418 C C6    . DG  C 3 13  ? 20.361 -40.406 21.361  1.00 126.92 ? 26  DG  C C6    1 
ATOM   1419 O O6    . DG  C 3 13  ? 21.487 -40.111 21.792  1.00 119.77 ? 26  DG  C O6    1 
ATOM   1420 N N1    . DG  C 3 13  ? 20.127 -41.670 20.817  1.00 132.46 ? 26  DG  C N1    1 
ATOM   1421 C C2    . DG  C 3 13  ? 18.919 -42.102 20.318  1.00 138.00 ? 26  DG  C C2    1 
ATOM   1422 N N2    . DG  C 3 13  ? 18.881 -43.352 19.837  1.00 141.61 ? 26  DG  C N2    1 
ATOM   1423 N N3    . DG  C 3 13  ? 17.819 -41.360 20.292  1.00 139.50 ? 26  DG  C N3    1 
ATOM   1424 C C4    . DG  C 3 13  ? 18.032 -40.128 20.817  1.00 134.94 ? 26  DG  C C4    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.9610 1.3435 1.5475 -0.1820 0.4255  0.2692  1   MET A N     
2    C CA    . MET A 1   ? 0.9123 1.2822 1.4461 -0.1672 0.3777  0.2074  1   MET A CA    
3    C C     . MET A 1   ? 0.8890 1.3103 1.3967 -0.1552 0.4026  0.1693  1   MET A C     
4    O O     . MET A 1   ? 1.0359 1.4684 1.5837 -0.1769 0.4587  0.1720  1   MET A O     
5    C CB    . MET A 1   ? 0.9000 1.2055 1.4609 -0.1923 0.3704  0.1900  1   MET A CB    
6    C CG    . MET A 1   ? 0.9089 1.2086 1.4261 -0.1827 0.3414  0.1243  1   MET A CG    
7    S SD    . MET A 1   ? 1.4455 1.6791 1.9992 -0.2144 0.3519  0.1014  1   MET A SD    
8    C CE    . MET A 1   ? 0.4939 0.6815 1.0038 -0.1985 0.2646  0.0727  1   MET A CE    
9    N N     . ARG A 2   ? 0.8375 1.2879 1.2768 -0.1201 0.3586  0.1344  2   ARG A N     
10   C CA    . ARG A 2   ? 0.8699 1.3775 1.2775 -0.1012 0.3766  0.1010  2   ARG A CA    
11   C C     . ARG A 2   ? 0.7723 1.2629 1.1955 -0.1212 0.3933  0.0597  2   ARG A C     
12   O O     . ARG A 2   ? 0.6129 1.0471 1.0337 -0.1323 0.3610  0.0346  2   ARG A O     
13   C CB    . ARG A 2   ? 1.0012 1.5273 1.3242 -0.0564 0.3154  0.0689  2   ARG A CB    
14   C CG    . ARG A 2   ? 1.0410 1.6418 1.3286 -0.0231 0.3328  0.0759  2   ARG A CG    
15   C CD    . ARG A 2   ? 1.0908 1.6967 1.3227 0.0116  0.2858  0.0920  2   ARG A CD    
16   N NE    . ARG A 2   ? 1.1398 1.6869 1.3244 0.0230  0.2102  0.0663  2   ARG A NE    
17   C CZ    . ARG A 2   ? 1.1250 1.6583 1.2480 0.0459  0.1639  0.0117  2   ARG A CZ    
18   N NH1   . ARG A 2   ? 1.0846 1.6608 1.1871 0.0601  0.1866  -0.0230 2   ARG A NH1   
19   N NH2   . ARG A 2   ? 1.1264 1.6028 1.2106 0.0537  0.0946  -0.0070 2   ARG A NH2   
20   N N     . MET A 3   ? 0.7494 1.2887 1.1889 -0.1258 0.4418  0.0533  3   MET A N     
21   C CA    . MET A 3   ? 0.8033 1.3307 1.2544 -0.1438 0.4557  0.0129  3   MET A CA    
22   C C     . MET A 3   ? 0.7974 1.3096 1.1861 -0.1199 0.3958  -0.0440 3   MET A C     
23   O O     . MET A 3   ? 0.8610 1.3233 1.2558 -0.1367 0.3793  -0.0726 3   MET A O     
24   C CB    . MET A 3   ? 0.5514 1.1415 1.0257 -0.1495 0.5112  0.0148  3   MET A CB    
25   C CG    . MET A 3   ? 0.6185 1.1920 1.1684 -0.1930 0.5752  0.0475  3   MET A CG    
26   S SD    . MET A 3   ? 1.0528 1.5075 1.6290 -0.2258 0.5626  0.0436  3   MET A SD    
27   C CE    . MET A 3   ? 0.7095 1.1360 1.3079 -0.2254 0.5616  0.1035  3   MET A CE    
28   N N     . ASP A 4   ? 0.8592 1.4126 1.1854 -0.0790 0.3630  -0.0596 4   ASP A N     
29   C CA    . ASP A 4   ? 0.8618 1.4014 1.1219 -0.0518 0.3047  -0.1132 4   ASP A CA    
30   C C     . ASP A 4   ? 0.8627 1.3272 1.1112 -0.0578 0.2493  -0.1211 4   ASP A C     
31   O O     . ASP A 4   ? 0.8689 1.3046 1.0785 -0.0475 0.2047  -0.1664 4   ASP A O     
32   C CB    . ASP A 4   ? 0.9002 1.4929 1.0900 -0.0027 0.2793  -0.1224 4   ASP A CB    
33   C CG    . ASP A 4   ? 0.9492 1.5308 1.1168 0.0142  0.2507  -0.0876 4   ASP A CG    
34   O OD1   . ASP A 4   ? 0.9090 1.4396 1.0384 0.0248  0.1895  -0.1018 4   ASP A OD1   
35   O OD2   . ASP A 4   ? 0.9654 1.5897 1.1547 0.0165  0.2883  -0.0450 4   ASP A OD2   
36   N N     . GLU A 5   ? 0.8385 1.2732 1.1218 -0.0738 0.2515  -0.0751 5   GLU A N     
37   C CA    . GLU A 5   ? 0.9480 1.3143 1.2299 -0.0819 0.2013  -0.0741 5   GLU A CA    
38   C C     . GLU A 5   ? 0.8888 1.2082 1.2193 -0.1177 0.2207  -0.0857 5   GLU A C     
39   O O     . GLU A 5   ? 0.8131 1.0913 1.1227 -0.1173 0.1797  -0.1224 5   GLU A O     
40   C CB    . GLU A 5   ? 1.0571 1.4110 1.3678 -0.0891 0.2020  -0.0163 5   GLU A CB    
41   C CG    . GLU A 5   ? 1.2786 1.6462 1.5277 -0.0527 0.1500  -0.0112 5   GLU A CG    
42   C CD    . GLU A 5   ? 1.3913 1.7460 1.6731 -0.0623 0.1498  0.0482  5   GLU A CD    
43   O OE1   . GLU A 5   ? 1.4355 1.7494 1.6951 -0.0555 0.0899  0.0536  5   GLU A OE1   
44   O OE2   . GLU A 5   ? 1.3560 1.7414 1.6867 -0.0771 0.2085  0.0906  5   GLU A OE2   
45   N N     . PHE A 6   ? 0.9196 1.2443 1.3135 -0.1475 0.2842  -0.0531 6   PHE A N     
46   C CA    . PHE A 6   ? 0.8080 1.0936 1.2476 -0.1810 0.3152  -0.0621 6   PHE A CA    
47   C C     . PHE A 6   ? 0.8112 1.0967 1.2169 -0.1743 0.2960  -0.1228 6   PHE A C     
48   O O     . PHE A 6   ? 0.7791 1.0144 1.1756 -0.1792 0.2603  -0.1498 6   PHE A O     
49   C CB    . PHE A 6   ? 0.7564 1.0704 1.2479 -0.2035 0.3884  -0.0311 6   PHE A CB    
50   C CG    . PHE A 6   ? 0.7276 1.0003 1.2628 -0.2373 0.4243  -0.0382 6   PHE A CG    
51   C CD1   . PHE A 6   ? 0.6643 0.8703 1.2310 -0.2575 0.4202  -0.0205 6   PHE A CD1   
52   C CD2   . PHE A 6   ? 0.7801 1.0802 1.3260 -0.2488 0.4633  -0.0595 6   PHE A CD2   
53   C CE1   . PHE A 6   ? 0.6642 0.8108 1.2473 -0.2737 0.4432  -0.0326 6   PHE A CE1   
54   C CE2   . PHE A 6   ? 0.7720 1.0079 1.3366 -0.2707 0.4831  -0.0712 6   PHE A CE2   
55   C CZ    . PHE A 6   ? 0.7428 0.8959 1.3170 -0.2767 0.4701  -0.0609 6   PHE A CZ    
56   N N     . TYR A 7   ? 1.1684 1.1833 0.9657 0.0606  0.0493  -0.2824 7   TYR A N     
57   C CA    . TYR A 7   ? 1.1309 1.2534 0.9391 0.0810  0.0398  -0.3174 7   TYR A CA    
58   C C     . TYR A 7   ? 1.0000 1.1101 0.8805 0.1291  -0.0424 -0.2822 7   TYR A C     
59   O O     . TYR A 7   ? 0.8336 1.0227 0.7653 0.1425  -0.0530 -0.2672 7   TYR A O     
60   C CB    . TYR A 7   ? 1.2592 1.4108 0.9897 0.0793  0.0596  -0.3952 7   TYR A CB    
61   C CG    . TYR A 7   ? 1.5051 1.7157 1.1717 0.0337  0.1461  -0.4387 7   TYR A CG    
62   C CD1   . TYR A 7   ? 1.5762 1.7559 1.2315 -0.0058 0.1980  -0.4118 7   TYR A CD1   
63   C CD2   . TYR A 7   ? 1.5867 1.8832 1.2044 0.0300  0.1758  -0.5068 7   TYR A CD2   
64   C CE1   . TYR A 7   ? 1.5359 1.7680 1.1319 -0.0478 0.2770  -0.4517 7   TYR A CE1   
65   C CE2   . TYR A 7   ? 1.5918 1.9425 1.1537 -0.0125 0.2540  -0.5458 7   TYR A CE2   
66   C CZ    . TYR A 7   ? 1.5444 1.8631 1.1086 -0.0537 0.2985  -0.5111 7   TYR A CZ    
67   O OH    . TYR A 7   ? 1.5025 1.8746 1.0740 -0.1080 0.3461  -0.5197 7   TYR A OH    
68   N N     . THR A 8   ? 0.7923 0.8023 0.6780 0.1552  -0.1013 -0.2676 8   THR A N     
69   C CA    . THR A 8   ? 1.0453 1.0394 1.0007 0.2011  -0.1809 -0.2324 8   THR A CA    
70   C C     . THR A 8   ? 0.9439 0.9368 0.9803 0.2006  -0.1921 -0.1597 8   THR A C     
71   O O     . THR A 8   ? 0.9867 1.0514 1.0773 0.2199  -0.2124 -0.1437 8   THR A O     
72   C CB    . THR A 8   ? 1.2203 1.0989 1.1691 0.2290  -0.2444 -0.2250 8   THR A CB    
73   O OG1   . THR A 8   ? 1.3289 1.1978 1.1961 0.2255  -0.2285 -0.2915 8   THR A OG1   
74   C CG2   . THR A 8   ? 1.1512 1.0301 1.1667 0.2777  -0.3247 -0.1991 8   THR A CG2   
75   N N     . LYS A 9   ? 0.8623 0.7744 0.9059 0.1784  -0.1773 -0.1165 9   LYS A N     
76   C CA    . LYS A 9   ? 0.8036 0.7043 0.9211 0.1742  -0.1827 -0.0451 9   LYS A CA    
77   C C     . LYS A 9   ? 0.8742 0.8939 1.0197 0.1641  -0.1460 -0.0435 9   LYS A C     
78   O O     . LYS A 9   ? 0.9160 0.9641 1.1340 0.1864  -0.1812 -0.0012 9   LYS A O     
79   C CB    . LYS A 9   ? 0.8240 0.6521 0.9229 0.1369  -0.1404 -0.0169 9   LYS A CB    
80   C CG    . LYS A 9   ? 1.2254 0.9389 1.2784 0.1367  -0.1587 -0.0275 9   LYS A CG    
81   C CD    . LYS A 9   ? 1.4184 1.0395 1.5274 0.1755  -0.2435 0.0182  9   LYS A CD    
82   C CE    . LYS A 9   ? 1.3908 0.9562 1.5678 0.1689  -0.2537 0.0953  9   LYS A CE    
83   N NZ    . LYS A 9   ? 1.4113 0.9170 1.5484 0.1286  -0.2011 0.1035  9   LYS A NZ    
84   N N     . VAL A 10  ? 0.8075 0.8956 0.8948 0.1298  -0.0743 -0.0894 10  VAL A N     
85   C CA    . VAL A 10  ? 0.8053 1.0079 0.9115 0.1171  -0.0341 -0.0927 10  VAL A CA    
86   C C     . VAL A 10  ? 0.8540 1.1323 1.0011 0.1555  -0.0802 -0.1026 10  VAL A C     
87   O O     . VAL A 10  ? 0.8683 1.1819 1.0831 0.1691  -0.1001 -0.0586 10  VAL A O     
88   C CB    . VAL A 10  ? 0.7533 1.0192 0.7825 0.0776  0.0454  -0.1516 10  VAL A CB    
89   C CG1   . VAL A 10  ? 0.6598 1.0510 0.7046 0.0700  0.0798  -0.1646 10  VAL A CG1   
90   C CG2   . VAL A 10  ? 0.8096 1.0124 0.8089 0.0364  0.0974  -0.1320 10  VAL A CG2   
91   N N     . TYR A 11  ? 0.9253 1.2282 1.0311 0.1733  -0.0970 -0.1603 11  TYR A N     
92   C CA    . TYR A 11  ? 0.9213 1.2924 1.0627 0.2112  -0.1428 -0.1725 11  TYR A CA    
93   C C     . TYR A 11  ? 0.8925 1.2149 1.1188 0.2461  -0.2138 -0.1061 11  TYR A C     
94   O O     . TYR A 11  ? 0.9379 1.3248 1.2202 0.2618  -0.2297 -0.0818 11  TYR A O     
95   C CB    . TYR A 11  ? 0.9195 1.2887 1.0088 0.2312  -0.1659 -0.2346 11  TYR A CB    
96   C CG    . TYR A 11  ? 0.8786 1.3008 0.8850 0.1985  -0.0972 -0.3030 11  TYR A CG    
97   C CD1   . TYR A 11  ? 0.9495 1.3274 0.8904 0.2000  -0.0989 -0.3523 11  TYR A CD1   
98   C CD2   . TYR A 11  ? 0.8292 1.3453 0.8228 0.1663  -0.0306 -0.3181 11  TYR A CD2   
99   C CE1   . TYR A 11  ? 0.9874 1.4135 0.8532 0.1702  -0.0358 -0.4148 11  TYR A CE1   
100  C CE2   . TYR A 11  ? 0.8329 1.3978 0.7517 0.1359  0.0325  -0.3807 11  TYR A CE2   
101  C CZ    . TYR A 11  ? 0.9545 1.4742 0.8103 0.1382  0.0294  -0.4287 11  TYR A CZ    
102  O OH    . TYR A 11  ? 1.1568 1.7235 0.9386 0.1085  0.0915  -0.4911 11  TYR A OH    
103  N N     . ASP A 12  ? 0.9067 1.2644 0.7601 -0.1074 0.0916  -0.1992 12  ASP A N     
104  C CA    . ASP A 12  ? 1.0490 1.2984 0.9664 -0.1491 0.0854  -0.1892 12  ASP A CA    
105  C C     . ASP A 12  ? 1.0384 1.2987 1.0474 -0.1350 0.1051  -0.1002 12  ASP A C     
106  O O     . ASP A 12  ? 1.1601 1.3197 1.2113 -0.1156 0.1311  -0.0820 12  ASP A O     
107  C CB    . ASP A 12  ? 1.1916 1.4435 1.1159 -0.2387 0.0334  -0.2191 12  ASP A CB    
108  C CG    . ASP A 12  ? 1.3945 1.5929 1.2370 -0.2592 0.0152  -0.3118 12  ASP A CG    
109  O OD1   . ASP A 12  ? 1.4498 1.7047 1.2634 -0.3145 -0.0262 -0.3433 12  ASP A OD1   
110  O OD2   . ASP A 12  ? 1.5135 1.6130 1.3205 -0.2208 0.0421  -0.3531 12  ASP A OD2   
111  N N     . ALA A 13  ? 0.8977 1.2803 0.9366 -0.1444 0.0931  -0.0449 13  ALA A N     
112  C CA    . ALA A 13  ? 0.7798 1.1847 0.9063 -0.1354 0.1090  0.0425  13  ALA A CA    
113  C C     . ALA A 13  ? 0.7391 1.1182 0.8713 -0.0511 0.1613  0.0779  13  ALA A C     
114  O O     . ALA A 13  ? 0.6719 0.9742 0.8644 -0.0380 0.1843  0.1168  13  ALA A O     
115  C CB    . ALA A 13  ? 0.5667 1.1143 0.7146 -0.1600 0.0855  0.0894  13  ALA A CB    
116  N N     . VAL A 14  ? 0.7842 1.2297 0.8538 0.0058  0.1795  0.0650  14  VAL A N     
117  C CA    . VAL A 14  ? 0.7791 1.2091 0.8468 0.0886  0.2284  0.0959  14  VAL A CA    
118  C C     . VAL A 14  ? 0.9142 1.1958 0.9940 0.1107  0.2557  0.0756  14  VAL A C     
119  O O     . VAL A 14  ? 0.9528 1.1905 1.0882 0.1438  0.2865  0.1292  14  VAL A O     
120  C CB    . VAL A 14  ? 0.8126 1.3061 0.7944 0.1423  0.2413  0.0591  14  VAL A CB    
121  C CG1   . VAL A 14  ? 0.7680 1.2680 0.7566 0.2255  0.2891  0.1043  14  VAL A CG1   
122  C CG2   . VAL A 14  ? 0.7919 1.4246 0.7507 0.1133  0.2092  0.0637  14  VAL A CG2   
123  N N     . CYS A 15  ? 0.8659 1.0700 0.8925 0.0926  0.2446  -0.0022 15  CYS A N     
124  C CA    . CYS A 15  ? 0.9335 0.9944 0.9644 0.1118  0.2687  -0.0297 15  CYS A CA    
125  C C     . CYS A 15  ? 1.1490 1.1339 1.2709 0.0782  0.2687  0.0169  15  CYS A C     
126  O O     . CYS A 15  ? 1.3562 1.2319 1.4999 0.1066  0.2976  0.0188  15  CYS A O     
127  C CB    . CYS A 15  ? 1.0261 1.0228 0.9892 0.0828  0.2485  -0.1208 15  CYS A CB    
128  S SG    . CYS A 15  ? 1.4817 1.5394 1.3334 0.1352  0.2585  -0.1820 15  CYS A SG    
129  N N     . GLU A 16  ? 1.1072 1.1502 1.2832 0.0188  0.2371  0.0558  16  GLU A N     
130  C CA    . GLU A 16  ? 1.2629 1.2442 1.5293 -0.0143 0.2362  0.1054  16  GLU A CA    
131  C C     . GLU A 16  ? 1.2360 1.2382 1.5620 0.0375  0.2735  0.1891  16  GLU A C     
132  O O     . GLU A 16  ? 1.2639 1.1949 1.6612 0.0285  0.2850  0.2301  16  GLU A O     
133  C CB    . GLU A 16  ? 1.3008 1.3337 1.6050 -0.0989 0.1880  0.1158  16  GLU A CB    
134  C CG    . GLU A 16  ? 1.5609 1.5567 1.8154 -0.1563 0.1500  0.0357  16  GLU A CG    
135  C CD    . GLU A 16  ? 1.6108 1.6824 1.8902 -0.2350 0.1008  0.0438  16  GLU A CD    
136  O OE1   . GLU A 16  ? 1.6274 1.7349 1.8456 -0.2676 0.0695  -0.0143 16  GLU A OE1   
137  O OE2   . GLU A 16  ? 1.5352 1.6295 1.8951 -0.2640 0.0936  0.1081  16  GLU A OE2   
138  N N     . ILE A 17  ? 1.0978 1.1963 1.3938 0.0918  0.2923  0.2138  17  ILE A N     
139  C CA    . ILE A 17  ? 0.9610 1.0885 1.3071 0.1433  0.3272  0.2926  17  ILE A CA    
140  C C     . ILE A 17  ? 0.9139 0.9231 1.2697 0.1978  0.3699  0.2938  17  ILE A C     
141  O O     . ILE A 17  ? 1.0192 0.9937 1.3126 0.2481  0.3921  0.2493  17  ILE A O     
142  C CB    . ILE A 17  ? 0.9050 1.1555 1.2079 0.1944  0.3395  0.3118  17  ILE A CB    
143  C CG1   . ILE A 17  ? 0.8445 1.2093 1.1183 0.1448  0.2970  0.2934  17  ILE A CG1   
144  C CG2   . ILE A 17  ? 0.8647 1.1574 1.2268 0.2346  0.3682  0.3993  17  ILE A CG2   
145  C CD1   . ILE A 17  ? 0.7210 1.2231 0.9887 0.1772  0.3030  0.3423  17  ILE A CD1   
146  N N     . PRO A 18  ? 0.8321 0.7791 1.2671 0.1886  0.3821  0.3459  18  PRO A N     
147  C CA    . PRO A 18  ? 1.0608 0.8840 1.5094 0.2327  0.4198  0.3442  18  PRO A CA    
148  C C     . PRO A 18  ? 1.0830 0.9288 1.5012 0.3211  0.4636  0.3651  18  PRO A C     
149  O O     . PRO A 18  ? 1.0321 0.9857 1.4531 0.3480  0.4703  0.4125  18  PRO A O     
150  C CB    . PRO A 18  ? 0.9753 0.7563 1.5216 0.2035  0.4219  0.4097  18  PRO A CB    
151  C CG    . PRO A 18  ? 0.8714 0.7786 1.4526 0.1757  0.4014  0.4658  18  PRO A CG    
152  C CD    . PRO A 18  ? 0.8473 0.8436 1.3634 0.1457  0.3663  0.4152  18  PRO A CD    
153  N N     . TYR A 19  ? 1.7028 1.1270 1.7793 0.4740  0.1698  0.0270  19  TYR A N     
154  C CA    . TYR A 19  ? 1.7078 1.1404 1.7731 0.5002  0.1836  0.1107  19  TYR A CA    
155  C C     . TYR A 19  ? 1.6521 1.1100 1.7361 0.4461  0.1844  0.1568  19  TYR A C     
156  O O     . TYR A 19  ? 1.6802 1.0927 1.7889 0.3921  0.1880  0.1304  19  TYR A O     
157  C CB    . TYR A 19  ? 1.9135 1.2362 1.9767 0.5293  0.2113  0.1236  19  TYR A CB    
158  C CG    . TYR A 19  ? 2.0042 1.3261 2.0561 0.5593  0.2276  0.2096  19  TYR A CG    
159  C CD1   . TYR A 19  ? 1.9942 1.3277 2.0593 0.5218  0.2341  0.2682  19  TYR A CD1   
160  C CD2   . TYR A 19  ? 2.0808 1.3889 2.1093 0.6247  0.2370  0.2321  19  TYR A CD2   
161  C CE1   . TYR A 19  ? 2.0506 1.3841 2.1054 0.5487  0.2491  0.3472  19  TYR A CE1   
162  C CE2   . TYR A 19  ? 2.1140 1.4212 2.1325 0.6523  0.2521  0.3111  19  TYR A CE2   
163  C CZ    . TYR A 19  ? 2.1087 1.4290 2.1404 0.6141  0.2580  0.3685  19  TYR A CZ    
164  O OH    . TYR A 19  ? 2.1416 1.4621 2.1634 0.6411  0.2729  0.4475  19  TYR A OH    
165  N N     . GLY A 20  ? 1.5380 1.0702 1.6104 0.4601  0.1809  0.2249  20  GLY A N     
166  C CA    . GLY A 20  ? 1.3737 0.9313 1.4617 0.4133  0.1835  0.2759  20  GLY A CA    
167  C C     . GLY A 20  ? 1.3419 0.9785 1.4443 0.3626  0.1610  0.2515  20  GLY A C     
168  O O     . GLY A 20  ? 1.3668 1.0467 1.4789 0.3282  0.1597  0.2977  20  GLY A O     
169  N N     . LYS A 21  ? 1.3536 1.0093 1.4581 0.3573  0.1436  0.1793  21  LYS A N     
170  C CA    . LYS A 21  ? 1.2665 1.0024 1.3843 0.3124  0.1205  0.1515  21  LYS A CA    
171  C C     . LYS A 21  ? 1.1838 1.0315 1.2813 0.3480  0.0988  0.1570  21  LYS A C     
172  O O     . LYS A 21  ? 1.1237 0.9829 1.1966 0.4065  0.1022  0.1822  21  LYS A O     
173  C CB    . LYS A 21  ? 1.3544 1.0432 1.4907 0.2769  0.1143  0.0679  21  LYS A CB    
174  C CG    . LYS A 21  ? 1.4618 1.0714 1.6255 0.2197  0.1288  0.0628  21  LYS A CG    
175  C CD    . LYS A 21  ? 1.4541 1.1261 1.6340 0.1681  0.1217  0.1005  21  LYS A CD    
176  C CE    . LYS A 21  ? 1.4795 1.0728 1.6847 0.1151  0.1388  0.1100  21  LYS A CE    
177  N NZ    . LYS A 21  ? 1.3587 1.0153 1.5791 0.0654  0.1320  0.1484  21  LYS A NZ    
178  N N     . VAL A 22  ? 0.8858 0.8159 0.9937 0.3135  0.0772  0.1356  22  VAL A N     
179  C CA    . VAL A 22  ? 0.9514 0.9885 1.0421 0.3450  0.0554  0.1343  22  VAL A CA    
180  C C     . VAL A 22  ? 0.9421 1.0400 1.0469 0.3092  0.0315  0.0754  22  VAL A C     
181  O O     . VAL A 22  ? 1.0570 1.1241 1.1869 0.2535  0.0308  0.0419  22  VAL A O     
182  C CB    . VAL A 22  ? 0.8366 0.9582 0.9177 0.3545  0.0530  0.2125  22  VAL A CB    
183  C CG1   . VAL A 22  ? 0.8182 0.8839 0.8918 0.3735  0.0771  0.2791  22  VAL A CG1   
184  C CG2   . VAL A 22  ? 0.7334 0.9208 0.8367 0.2940  0.0405  0.2197  22  VAL A CG2   
185  N N     . SER A 23  ? 0.8302 1.0160 0.9193 0.3416  0.0119  0.0642  23  SER A N     
186  C CA    . SER A 23  ? 0.7147 0.9727 0.8167 0.3104  -0.0120 0.0159  23  SER A CA    
187  C C     . SER A 23  ? 0.7125 1.0934 0.8017 0.3327  -0.0305 0.0472  23  SER A C     
188  O O     . SER A 23  ? 0.8174 1.2299 0.8901 0.3646  -0.0244 0.1118  23  SER A O     
189  C CB    . SER A 23  ? 0.6736 0.8955 0.7747 0.3210  -0.0198 -0.0656 23  SER A CB    
190  O OG    . SER A 23  ? 0.7360 0.9928 0.8594 0.2705  -0.0370 -0.1166 23  SER A OG    
191  N N     . THR A 24  ? 0.6791 1.1296 0.7763 0.3159  -0.0532 0.0012  24  THR A N     
192  C CA    . THR A 24  ? 0.6843 1.2540 0.7714 0.3350  -0.0719 0.0255  24  THR A CA    
193  C C     . THR A 24  ? 0.6467 1.2722 0.7283 0.3539  -0.0942 -0.0347 24  THR A C     
194  O O     . THR A 24  ? 0.8093 1.4212 0.9085 0.3194  -0.1036 -0.0975 24  THR A O     
195  C CB    . THR A 24  ? 0.6540 1.2900 0.7635 0.2798  -0.0798 0.0522  24  THR A CB    
196  O OG1   . THR A 24  ? 0.6555 1.2884 0.7905 0.2278  -0.0914 -0.0106 24  THR A OG1   
197  C CG2   . THR A 24  ? 0.4883 1.0801 0.6046 0.2569  -0.0592 0.1144  24  THR A CG2   
198  N N     . TYR A 25  ? 0.9681 0.8979 1.1648 -0.2644 0.1174  -0.2397 25  TYR A N     
199  C CA    . TYR A 25  ? 0.9713 0.8776 1.0958 -0.2806 0.1072  -0.2392 25  TYR A CA    
200  C C     . TYR A 25  ? 1.0099 0.8915 1.1180 -0.1829 0.1389  -0.2094 25  TYR A C     
201  O O     . TYR A 25  ? 1.0141 1.0461 1.2698 -0.1605 0.1439  -0.2141 25  TYR A O     
202  C CB    . TYR A 25  ? 1.2362 0.9430 1.1238 -0.3378 0.0854  -0.2340 25  TYR A CB    
203  C CG    . TYR A 25  ? 1.2737 0.9994 1.1636 -0.4329 0.0554  -0.2587 25  TYR A CG    
204  C CD1   . TYR A 25  ? 1.4879 1.0228 1.1734 -0.4776 0.0386  -0.2491 25  TYR A CD1   
205  C CD2   . TYR A 25  ? 1.0829 1.0180 1.1772 -0.4757 0.0410  -0.2918 25  TYR A CD2   
206  C CE1   . TYR A 25  ? 1.5297 1.0916 1.2195 -0.5657 0.0109  -0.2699 25  TYR A CE1   
207  C CE2   . TYR A 25  ? 1.0850 1.0479 1.1816 -0.5576 0.0136  -0.3151 25  TYR A CE2   
208  C CZ    . TYR A 25  ? 1.3856 1.1667 1.2830 -0.6036 0.0000  -0.3030 25  TYR A CZ    
209  O OH    . TYR A 25  ? 1.5329 1.3595 1.4204 -0.6635 -0.0173 -0.3116 25  TYR A OH    
210  N N     . GLY A 26  ? 1.1364 0.8288 1.0616 -0.1215 0.1589  -0.1790 26  GLY A N     
211  C CA    . GLY A 26  ? 1.1134 0.7708 1.0004 -0.0180 0.1908  -0.1484 26  GLY A CA    
212  C C     . GLY A 26  ? 0.9941 0.8526 1.1067 0.0394  0.2157  -0.1408 26  GLY A C     
213  O O     . GLY A 26  ? 0.9782 0.9285 1.1658 0.0712  0.2231  -0.1361 26  GLY A O     
214  N N     . GLU A 27  ? 0.9288 0.8558 1.1493 0.0498  0.2260  -0.1381 27  GLU A N     
215  C CA    . GLU A 27  ? 0.7853 0.8923 1.2092 0.1017  0.2462  -0.1244 27  GLU A CA    
216  C C     . GLU A 27  ? 0.4883 0.7750 1.0898 0.0553  0.2233  -0.1513 27  GLU A C     
217  O O     . GLU A 27  ? 0.5239 0.9131 1.2214 0.1036  0.2365  -0.1369 27  GLU A O     
218  C CB    . GLU A 27  ? 0.8620 1.0189 1.3795 0.1071  0.2543  -0.1182 27  GLU A CB    
219  C CG    . GLU A 27  ? 1.2046 1.2835 1.6404 0.2051  0.2945  -0.0736 27  GLU A CG    
220  C CD    . GLU A 27  ? 1.3337 1.4720 1.7956 0.2963  0.3246  -0.0392 27  GLU A CD    
221  O OE1   . GLU A 27  ? 1.3074 1.5749 1.8926 0.2832  0.3152  -0.0484 27  GLU A OE1   
222  O OE2   . GLU A 27  ? 1.3844 1.4433 1.7406 0.3844  0.3575  -0.0028 27  GLU A OE2   
223  N N     . ILE A 28  ? 0.3936 0.7196 1.0324 -0.0361 0.1880  -0.1901 28  ILE A N     
224  C CA    . ILE A 28  ? 0.5380 1.0359 1.3387 -0.0786 0.1626  -0.2198 28  ILE A CA    
225  C C     . ILE A 28  ? 0.5493 1.0323 1.2928 -0.0590 0.1663  -0.2133 28  ILE A C     
226  O O     . ILE A 28  ? 0.4435 1.0608 1.3236 -0.0299 0.1689  -0.2119 28  ILE A O     
227  C CB    . ILE A 28  ? 0.5713 1.1075 1.3908 -0.1772 0.1234  -0.2630 28  ILE A CB    
228  C CG1   . ILE A 28  ? 0.4857 1.0466 1.3708 -0.1995 0.1156  -0.2743 28  ILE A CG1   
229  C CG2   . ILE A 28  ? 0.4174 1.0929 1.3533 -0.1961 0.0974  -0.2930 28  ILE A CG2   
230  C CD1   . ILE A 28  ? 0.4067 1.0338 1.4111 -0.1380 0.1204  -0.2644 28  ILE A CD1   
231  N N     . ALA A 29  ? 0.5968 0.9100 1.1332 -0.0767 0.1636  -0.2084 29  ALA A N     
232  C CA    . ALA A 29  ? 0.6679 0.9325 1.1155 -0.0541 0.1672  -0.1985 29  ALA A CA    
233  C C     . ALA A 29  ? 0.6998 1.0218 1.2157 0.0460  0.2003  -0.1685 29  ALA A C     
234  O O     . ALA A 29  ? 0.5982 1.0409 1.2219 0.0579  0.1982  -0.1731 29  ALA A O     
235  C CB    . ALA A 29  ? 0.8871 0.9197 1.0756 -0.0611 0.1649  -0.1845 29  ALA A CB    
236  N N     . ARG A 30  ? 0.7863 1.0268 1.2376 0.1195  0.2309  -0.1363 30  ARG A N     
237  C CA    . ARG A 30  ? 0.8065 1.1160 1.3239 0.2168  0.2641  -0.1029 30  ARG A CA    
238  C C     . ARG A 30  ? 0.5711 1.1110 1.3480 0.2094  0.2591  -0.1095 30  ARG A C     
239  O O     . ARG A 30  ? 0.4853 1.1277 1.3509 0.2509  0.2682  -0.0974 30  ARG A O     
240  C CB    . ARG A 30  ? 0.6267 0.8305 1.0408 0.2952  0.2969  -0.0671 30  ARG A CB    
241  C CG    . ARG A 30  ? 1.1395 1.1196 1.2917 0.3404  0.3056  -0.0521 30  ARG A CG    
242  C CD    . ARG A 30  ? 1.2422 1.1338 1.2968 0.4354  0.3399  -0.0159 30  ARG A CD    
243  N NE    . ARG A 30  ? 1.2766 1.1448 1.3462 0.3986  0.3358  -0.0217 30  ARG A NE    
244  C CZ    . ARG A 30  ? 1.4462 1.1212 1.3272 0.3750  0.3238  -0.0284 30  ARG A CZ    
245  N NH1   . ARG A 30  ? 1.5205 1.0022 1.1784 0.3839  0.3122  -0.0285 30  ARG A NH1   
246  N NH2   . ARG A 30  ? 1.4613 1.1309 1.3721 0.3423  0.3208  -0.0338 30  ARG A NH2   
247  N N     . TYR A 31  ? 0.4383 1.0542 1.3317 0.1561  0.2409  -0.1292 31  TYR A N     
248  C CA    . TYR A 31  ? 0.3451 1.1038 1.4155 0.1383  0.2174  -0.1320 31  TYR A CA    
249  C C     . TYR A 31  ? 0.4406 1.2486 1.5413 0.1140  0.1893  -0.1500 31  TYR A C     
250  O O     . TYR A 31  ? 0.6293 1.4773 1.7768 0.1357  0.1813  -0.1312 31  TYR A O     
251  C CB    . TYR A 31  ? 0.2960 1.0490 1.4017 0.0648  0.1797  -0.1645 31  TYR A CB    
252  C CG    . TYR A 31  ? 0.3616 1.1423 1.5397 0.0533  0.1483  -0.1647 31  TYR A CG    
253  C CD1   . TYR A 31  ? 0.5053 1.3104 1.7220 0.1013  0.1656  -0.1178 31  TYR A CD1   
254  C CD2   . TYR A 31  ? 0.2215 1.0020 1.4194 0.0027  0.1073  -0.2108 31  TYR A CD2   
255  C CE1   . TYR A 31  ? 0.4914 1.3231 1.7767 0.0866  0.1396  -0.1155 31  TYR A CE1   
256  C CE2   . TYR A 31  ? 0.3314 1.1264 1.5881 0.0024  0.0855  -0.2131 31  TYR A CE2   
257  C CZ    . TYR A 31  ? 0.5077 1.3279 1.8123 0.0383  0.0997  -0.1649 31  TYR A CZ    
258  O OH    . TYR A 31  ? 0.6308 1.4676 1.9978 0.0317  0.0769  -0.1648 31  TYR A OH    
259  N N     . VAL A 32  ? 0.6816 1.0852 1.5286 -0.1543 0.2059  0.2039  32  VAL A N     
260  C CA    . VAL A 32  ? 0.5516 1.0296 1.5015 -0.2045 0.1223  0.1760  32  VAL A CA    
261  C C     . VAL A 32  ? 0.5348 1.1261 1.5626 -0.1577 0.0957  0.1675  32  VAL A C     
262  O O     . VAL A 32  ? 0.5797 1.1758 1.6164 -0.1694 0.0166  0.1327  32  VAL A O     
263  C CB    . VAL A 32  ? 0.5615 0.8979 1.3909 -0.2323 0.0437  0.1307  32  VAL A CB    
264  C CG1   . VAL A 32  ? 0.6567 0.8754 1.4049 -0.2760 0.0654  0.1373  32  VAL A CG1   
265  C CG2   . VAL A 32  ? 0.2619 0.4927 0.9378 -0.1580 0.0187  0.1013  32  VAL A CG2   
266  N N     . GLY A 33  ? 0.4900 1.1666 1.5677 -0.1032 0.1618  0.1983  33  GLY A N     
267  C CA    . GLY A 33  ? 0.4692 1.2761 1.6486 -0.0627 0.1437  0.1964  33  GLY A CA    
268  C C     . GLY A 33  ? 0.4988 1.2405 1.5714 0.0009  0.0918  0.1627  33  GLY A C     
269  O O     . GLY A 33  ? 0.4889 1.3264 1.6447 0.0167  0.0495  0.1512  33  GLY A O     
270  N N     . MET A 34  ? 0.5978 1.1754 1.4845 0.0377  0.0946  0.1466  34  MET A N     
271  C CA    . MET A 34  ? 0.6130 1.1145 1.3821 0.0988  0.0500  0.1137  34  MET A CA    
272  C C     . MET A 34  ? 0.7034 1.0972 1.3166 0.1788  0.1104  0.1238  34  MET A C     
273  O O     . MET A 34  ? 0.8167 1.0576 1.2660 0.1951  0.0922  0.0994  34  MET A O     
274  C CB    . MET A 34  ? 0.6076 1.0061 1.2995 0.0529  -0.0347 0.0686  34  MET A CB    
275  C CG    . MET A 34  ? 0.6538 1.1597 1.4891 -0.0107 -0.1057 0.0519  34  MET A CG    
276  S SD    . MET A 34  ? 0.7097 1.2906 1.5792 0.0435  -0.1580 0.0309  34  MET A SD    
277  C CE    . MET A 34  ? 1.6773 2.3670 2.7012 -0.0269 -0.1863 0.0383  34  MET A CE    
278  N N     . PRO A 35  ? 0.6374 1.1145 1.3044 0.2296  0.1823  0.1587  35  PRO A N     
279  C CA    . PRO A 35  ? 0.7838 1.1777 1.3269 0.2979  0.2577  0.1785  35  PRO A CA    
280  C C     . PRO A 35  ? 0.8565 1.1085 1.2142 0.3624  0.2312  0.1479  35  PRO A C     
281  O O     . PRO A 35  ? 0.9224 1.0482 1.1348 0.3941  0.2731  0.1529  35  PRO A O     
282  C CB    . PRO A 35  ? 0.7472 1.2917 1.4157 0.3424  0.3164  0.2117  35  PRO A CB    
283  C CG    . PRO A 35  ? 0.6235 1.3278 1.4937 0.2757  0.2900  0.2193  35  PRO A CG    
284  C CD    . PRO A 35  ? 0.5353 1.1995 1.3910 0.2283  0.1910  0.1785  35  PRO A CD    
285  N N     . SER A 36  ? 0.8520 1.1222 1.2120 0.3811  0.1634  0.1167  36  SER A N     
286  C CA    . SER A 36  ? 0.9621 1.1094 1.1544 0.4450  0.1400  0.0876  36  SER A CA    
287  C C     . SER A 36  ? 1.0613 1.0574 1.1202 0.4097  0.0810  0.0474  36  SER A C     
288  O O     . SER A 36  ? 1.2224 1.1071 1.0968 0.4224  0.0613  0.0244  36  SER A O     
289  C CB    . SER A 36  ? 0.9671 1.1929 1.2105 0.4838  0.0948  0.0712  36  SER A CB    
290  O OG    . SER A 36  ? 0.9054 1.1852 1.2390 0.4202  0.0146  0.0457  36  SER A OG    
291  N N     . TYR A 37  ? 1.0166 1.0177 1.1342 0.3274  0.0510  0.0417  37  TYR A N     
292  C CA    . TYR A 37  ? 0.9471 0.8257 0.9649 0.2866  -0.0166 -0.0013 37  TYR A CA    
293  C C     . TYR A 37  ? 0.9871 0.7302 0.8686 0.2706  0.0120  -0.0003 37  TYR A C     
294  O O     . TYR A 37  ? 1.1032 0.7997 0.9513 0.2014  -0.0347 -0.0246 37  TYR A O     
295  C CB    . TYR A 37  ? 0.7804 0.7364 0.9303 0.1996  -0.0779 -0.0148 37  TYR A CB    
296  C CG    . TYR A 37  ? 0.8066 0.8453 1.0312 0.2001  -0.1431 -0.0387 37  TYR A CG    
297  C CD1   . TYR A 37  ? 0.8926 1.0299 1.1763 0.2527  -0.1208 -0.0221 37  TYR A CD1   
298  C CD2   . TYR A 37  ? 0.8524 0.8427 1.0546 0.1242  -0.2104 -0.0878 37  TYR A CD2   
299  C CE1   . TYR A 37  ? 0.9461 1.1276 1.2574 0.2304  -0.1703 -0.0502 37  TYR A CE1   
300  C CE2   . TYR A 37  ? 0.9330 0.9330 1.1574 0.1117  -0.2362 -0.1165 37  TYR A CE2   
301  C CZ    . TYR A 37  ? 0.9901 1.0966 1.2667 0.1591  -0.2261 -0.0987 37  TYR A CZ    
302  O OH    . TYR A 37  ? 1.1171 1.2263 1.4081 0.1489  -0.2543 -0.1265 37  TYR A OH    
303  N N     . ALA A 38  ? 0.9245 1.0637 1.0412 0.0841  0.2801  0.0732  38  ALA A N     
304  C CA    . ALA A 38  ? 0.7551 0.8370 0.9062 0.0491  0.2680  0.0668  38  ALA A CA    
305  C C     . ALA A 38  ? 0.7369 0.8564 0.8748 0.0082  0.2574  0.0845  38  ALA A C     
306  O O     . ALA A 38  ? 0.6413 0.8172 0.8550 -0.0092 0.2433  0.0530  38  ALA A O     
307  C CB    . ALA A 38  ? 0.8822 0.7911 0.9659 0.0350  0.2748  0.1035  38  ALA A CB    
308  N N     . ARG A 39  ? 0.8155 0.9078 0.8577 -0.0067 0.2639  0.1344  39  ARG A N     
309  C CA    . ARG A 39  ? 0.7534 0.8757 0.7771 -0.0467 0.2543  0.1547  39  ARG A CA    
310  C C     . ARG A 39  ? 0.7583 1.0496 0.8854 -0.0375 0.2428  0.1023  39  ARG A C     
311  O O     . ARG A 39  ? 0.7704 1.0942 0.9403 -0.0674 0.2295  0.0905  39  ARG A O     
312  C CB    . ARG A 39  ? 0.7490 0.8426 0.6614 -0.0581 0.2631  0.2111  39  ARG A CB    
313  C CG    . ARG A 39  ? 1.1283 1.0655 0.9388 -0.0565 0.2765  0.2592  39  ARG A CG    
314  C CD    . ARG A 39  ? 1.3874 1.2648 1.0814 -0.0829 0.2816  0.3222  39  ARG A CD    
315  N NE    . ARG A 39  ? 1.4802 1.3090 1.1520 -0.1328 0.2709  0.3476  39  ARG A NE    
316  C CZ    . ARG A 39  ? 1.4998 1.2287 1.0666 -0.1642 0.2739  0.4067  39  ARG A CZ    
317  N NH1   . ARG A 39  ? 1.5585 1.2525 1.1149 -0.2089 0.2632  0.4251  39  ARG A NH1   
318  N NH2   . ARG A 39  ? 1.3921 1.0541 0.8635 -0.1516 0.2871  0.4478  39  ARG A NH2   
319  N N     . GLN A 40  ? 0.8153 1.2132 0.9855 0.0047  0.2477  0.0691  40  GLN A N     
320  C CA    . GLN A 40  ? 0.7536 1.3206 1.0160 0.0160  0.2377  0.0210  40  GLN A CA    
321  C C     . GLN A 40  ? 0.5562 1.1591 0.9297 0.0169  0.2248  -0.0328 40  GLN A C     
322  O O     . GLN A 40  ? 0.3974 1.1136 0.8444 0.0093  0.2123  -0.0665 40  GLN A O     
323  C CB    . GLN A 40  ? 0.5964 1.2695 0.8721 0.0607  0.2463  0.0012  40  GLN A CB    
324  C CG    . GLN A 40  ? 0.7701 1.3579 0.9462 0.0769  0.2630  0.0446  40  GLN A CG    
325  C CD    . GLN A 40  ? 0.8257 1.3551 0.8943 0.0444  0.2668  0.1057  40  GLN A CD    
326  O OE1   . GLN A 40  ? 0.8567 1.4689 0.9277 0.0254  0.2600  0.1098  40  GLN A OE1   
327  N NE2   . GLN A 40  ? 0.8455 1.2318 0.8187 0.0379  0.2774  0.1535  40  GLN A NE2   
328  N N     . VAL A 41  ? 0.4423 0.9488 0.8284 0.0258  0.2275  -0.0410 41  VAL A N     
329  C CA    . VAL A 41  ? 0.4699 0.9944 0.9551 0.0212  0.2144  -0.0874 41  VAL A CA    
330  C C     . VAL A 41  ? 0.5537 1.0402 1.0327 -0.0279 0.2024  -0.0701 41  VAL A C     
331  O O     . VAL A 41  ? 0.5067 1.0639 1.0716 -0.0384 0.1880  -0.1089 41  VAL A O     
332  C CB    . VAL A 41  ? 0.3934 0.8134 0.8876 0.0364  0.2195  -0.0955 41  VAL A CB    
333  C CG1   . VAL A 41  ? 0.2800 0.7568 0.8926 0.0433  0.2062  -0.1547 41  VAL A CG1   
334  C CG2   . VAL A 41  ? 0.3510 0.7730 0.8159 0.0801  0.2349  -0.0935 41  VAL A CG2   
335  N N     . GLY A 42  ? 0.6157 0.9910 0.9909 -0.0578 0.2082  -0.0111 42  GLY A N     
336  C CA    . GLY A 42  ? 0.5363 0.8830 0.8911 -0.1053 0.1980  0.0128  42  GLY A CA    
337  C C     . GLY A 42  ? 0.6360 1.1417 1.0454 -0.1065 0.1888  -0.0135 42  GLY A C     
338  O O     . GLY A 42  ? 0.6669 1.2389 1.1614 -0.1175 0.1746  -0.0515 42  GLY A O     
339  N N     . GLN A 43  ? 0.8033 1.3709 1.1643 -0.0936 0.1969  0.0059  43  GLN A N     
340  C CA    . GLN A 43  ? 0.6686 1.3894 1.0684 -0.0931 0.1902  -0.0132 43  GLN A CA    
341  C C     . GLN A 43  ? 0.4535 1.2963 0.9816 -0.0769 0.1775  -0.0806 43  GLN A C     
342  O O     . GLN A 43  ? 0.4391 1.3416 1.0145 -0.1015 0.1642  -0.0963 43  GLN A O     
343  C CB    . GLN A 43  ? 0.8227 1.6068 1.1787 -0.0624 0.2025  -0.0015 43  GLN A CB    
344  C CG    . GLN A 43  ? 1.0672 1.7601 1.2954 -0.0795 0.2138  0.0656  43  GLN A CG    
345  C CD    . GLN A 43  ? 1.2204 2.0077 1.4157 -0.0542 0.2227  0.0736  43  GLN A CD    
346  O OE1   . GLN A 43  ? 1.3288 2.0548 1.4231 -0.0617 0.2325  0.1246  43  GLN A OE1   
347  N NE2   . GLN A 43  ? 1.1325 2.0692 1.4131 -0.0245 0.2188  0.0231  43  GLN A NE2   
348  N N     . ALA A 44  ? 0.6216 0.9340 0.8940 -0.0696 0.2480  0.0672  44  ALA A N     
349  C CA    . ALA A 44  ? 0.5784 0.9530 0.9180 -0.0214 0.2710  0.0242  44  ALA A CA    
350  C C     . ALA A 44  ? 0.5736 1.0124 1.0112 -0.0214 0.2750  0.0291  44  ALA A C     
351  O O     . ALA A 44  ? 0.5346 1.0729 1.0295 -0.0113 0.3025  0.0243  44  ALA A O     
352  C CB    . ALA A 44  ? 0.4594 0.7615 0.7786 0.0193  0.2593  -0.0201 44  ALA A CB    
353  N N     . MET A 45  ? 0.5654 0.9459 1.0204 -0.0318 0.2466  0.0376  45  MET A N     
354  C CA    . MET A 45  ? 0.4875 0.9148 1.0286 -0.0336 0.2440  0.0451  45  MET A CA    
355  C C     . MET A 45  ? 0.5053 1.0302 1.0850 -0.0642 0.2610  0.0782  45  MET A C     
356  O O     . MET A 45  ? 0.5004 1.1179 1.1517 -0.0447 0.2834  0.0657  45  MET A O     
357  C CB    . MET A 45  ? 0.5211 0.8634 1.0541 -0.0567 0.2075  0.0637  45  MET A CB    
358  C CG    . MET A 45  ? 0.4894 0.7333 0.9892 -0.0303 0.1885  0.0311  45  MET A CG    
359  S SD    . MET A 45  ? 0.7137 0.9882 1.2669 0.0328  0.2104  -0.0278 45  MET A SD    
360  C CE    . MET A 45  ? 1.3546 1.5983 1.8285 0.0554  0.2228  -0.0579 45  MET A CE    
361  N N     . LYS A 46  ? 0.4630 0.9656 0.9933 -0.1130 0.2500  0.1197  46  LYS A N     
362  C CA    . LYS A 46  ? 0.4666 1.0529 1.0262 -0.1511 0.2632  0.1548  46  LYS A CA    
363  C C     . LYS A 46  ? 0.7163 1.4090 1.3025 -0.1346 0.3023  0.1404  46  LYS A C     
364  O O     . LYS A 46  ? 0.8368 1.6204 1.4704 -0.1565 0.3182  0.1595  46  LYS A O     
365  C CB    . LYS A 46  ? 0.5084 1.0382 0.9893 -0.2041 0.2476  0.1970  46  LYS A CB    
366  C CG    . LYS A 46  ? 0.5618 1.1677 1.0568 -0.2522 0.2612  0.2364  46  LYS A CG    
367  C CD    . LYS A 46  ? 0.7475 1.2779 1.1513 -0.3021 0.2441  0.2751  46  LYS A CD    
368  C CE    . LYS A 46  ? 1.0229 1.6189 1.4383 -0.3554 0.2550  0.3156  46  LYS A CE    
369  N NZ    . LYS A 46  ? 1.2447 1.7612 1.5689 -0.4047 0.2379  0.3535  46  LYS A NZ    
370  N N     . HIS A 47  ? 0.8165 1.5013 1.3749 -0.0957 0.3180  0.1050  47  HIS A N     
371  C CA    . HIS A 47  ? 0.8897 1.6688 1.4621 -0.0810 0.3552  0.0911  47  HIS A CA    
372  C C     . HIS A 47  ? 0.7998 1.6503 1.4545 -0.0306 0.3754  0.0502  47  HIS A C     
373  O O     . HIS A 47  ? 0.9317 1.8687 1.6091 -0.0154 0.4071  0.0357  47  HIS A O     
374  C CB    . HIS A 47  ? 1.1169 1.8515 1.5975 -0.0756 0.3631  0.0824  47  HIS A CB    
375  C CG    . HIS A 47  ? 1.3556 2.0575 1.7593 -0.1275 0.3564  0.1251  47  HIS A CG    
376  N ND1   . HIS A 47  ? 1.4861 2.1071 1.7900 -0.1309 0.3478  0.1267  47  HIS A ND1   
377  C CD2   . HIS A 47  ? 1.4121 2.1487 1.8205 -0.1788 0.3569  0.1678  47  HIS A CD2   
378  C CE1   . HIS A 47  ? 1.5512 2.1551 1.8007 -0.1812 0.3432  0.1689  47  HIS A CE1   
379  N NE2   . HIS A 47  ? 1.5215 2.1954 1.8332 -0.2125 0.3494  0.1947  47  HIS A NE2   
380  N N     . LEU A 48  ? 0.5692 1.3819 1.2664 -0.0049 0.3573  0.0313  48  LEU A N     
381  C CA    . LEU A 48  ? 0.4303 1.3042 1.2063 0.0419  0.3740  -0.0058 48  LEU A CA    
382  C C     . LEU A 48  ? 0.5848 1.5717 1.4409 0.0305  0.3894  0.0093  48  LEU A C     
383  O O     . LEU A 48  ? 0.6469 1.6579 1.5017 -0.0154 0.3837  0.0486  48  LEU A O     
384  C CB    . LEU A 48  ? 0.4030 1.2051 1.2025 0.0655  0.3493  -0.0243 48  LEU A CB    
385  C CG    . LEU A 48  ? 0.5243 1.2214 1.2555 0.0836  0.3357  -0.0483 48  LEU A CG    
386  C CD1   . LEU A 48  ? 0.5311 1.1396 1.2631 0.0778  0.3021  -0.0438 48  LEU A CD1   
387  C CD2   . LEU A 48  ? 0.6113 1.3343 1.3630 0.1370  0.3592  -0.0985 48  LEU A CD2   
388  N N     . HIS A 49  ? 0.6678 1.7251 1.5943 0.0725  0.4091  -0.0234 49  HIS A N     
389  C CA    . HIS A 49  ? 0.7929 1.9635 1.8012 0.0680  0.4241  -0.0149 49  HIS A CA    
390  C C     . HIS A 49  ? 0.7887 1.9541 1.8678 0.0869  0.4049  -0.0214 49  HIS A C     
391  O O     . HIS A 49  ? 0.8275 1.9486 1.9198 0.1287  0.3998  -0.0545 49  HIS A O     
392  C CB    . HIS A 49  ? 0.9013 2.1691 1.9397 0.0987  0.4621  -0.0440 49  HIS A CB    
393  C CG    . HIS A 49  ? 1.0753 2.3799 2.0599 0.0686  0.4836  -0.0271 49  HIS A CG    
394  N ND1   . HIS A 49  ? 1.1822 2.4827 2.1188 0.0905  0.5046  -0.0516 49  HIS A ND1   
395  C CD2   . HIS A 49  ? 1.1666 2.5089 2.1340 0.0169  0.4872  0.0123  49  HIS A CD2   
396  C CE1   . HIS A 49  ? 1.3004 2.6338 2.1913 0.0545  0.5201  -0.0275 49  HIS A CE1   
397  N NE2   . HIS A 49  ? 1.3002 2.6586 2.2082 0.0085  0.5105  0.0115  49  HIS A NE2   
398  N N     . PRO A 50  ? 0.6619 1.8706 1.7841 0.0550  0.3939  0.0102  50  PRO A N     
399  C CA    . PRO A 50  ? 0.6061 1.8018 1.7868 0.0620  0.3694  0.0143  50  PRO A CA    
400  C C     . PRO A 50  ? 0.6017 1.8041 1.8381 0.1206  0.3737  -0.0276 50  PRO A C     
401  O O     . PRO A 50  ? 0.7549 1.8992 2.0106 0.1326  0.3489  -0.0304 50  PRO A O     
402  C CB    . PRO A 50  ? 0.5442 1.8424 1.7805 0.0293  0.3745  0.0433  50  PRO A CB    
403  C CG    . PRO A 50  ? 0.5900 1.9513 1.7933 0.0037  0.4035  0.0535  50  PRO A CG    
404  C CD    . PRO A 50  ? 0.5888 1.8622 1.7013 0.0060  0.4048  0.0456  50  PRO A CD    
405  N N     . GLU A 51  ? 1.6356 1.9622 1.3337 0.0620  0.3815  -0.2527 51  GLU A N     
406  C CA    . GLU A 51  ? 1.5079 1.9464 1.4419 0.0917  0.3629  -0.2474 51  GLU A CA    
407  C C     . GLU A 51  ? 1.3895 1.8040 1.2948 0.1614  0.3588  -0.2768 51  GLU A C     
408  O O     . GLU A 51  ? 1.3620 1.8191 1.3842 0.1947  0.3764  -0.3171 51  GLU A O     
409  C CB    . GLU A 51  ? 1.6044 2.1179 1.7147 0.0738  0.3935  -0.2774 51  GLU A CB    
410  C CG    . GLU A 51  ? 1.8279 2.2812 1.8269 0.0313  0.4359  -0.3056 51  GLU A CG    
411  C CD    . GLU A 51  ? 2.0513 2.3844 1.8275 0.0600  0.4680  -0.3564 51  GLU A CD    
412  O OE1   . GLU A 51  ? 2.0690 2.4009 1.8766 0.1039  0.4903  -0.4060 51  GLU A OE1   
413  O OE2   . GLU A 51  ? 2.1892 2.4281 1.7578 0.0387  0.4701  -0.3463 51  GLU A OE2   
414  N N     . THR A 52  ? 1.3072 1.6522 1.0564 0.1836  0.3359  -0.2571 52  THR A N     
415  C CA    . THR A 52  ? 1.3765 1.6863 1.0751 0.2494  0.3324  -0.2854 52  THR A CA    
416  C C     . THR A 52  ? 1.4089 1.7722 1.2022 0.2818  0.2868  -0.2439 52  THR A C     
417  O O     . THR A 52  ? 1.3332 1.7115 1.1247 0.2564  0.2538  -0.1876 52  THR A O     
418  C CB    . THR A 52  ? 1.4700 1.6426 0.8941 0.2629  0.3477  -0.3083 52  THR A CB    
419  O OG1   . THR A 52  ? 1.4728 1.6188 0.8572 0.3249  0.3324  -0.3201 52  THR A OG1   
420  C CG2   . THR A 52  ? 1.5502 1.6691 0.8279 0.2204  0.3284  -0.2593 52  THR A CG2   
421  N N     . HIS A 53  ? 1.4046 1.7926 1.2751 0.3393  0.2857  -0.2731 53  HIS A N     
422  C CA    . HIS A 53  ? 1.3813 1.8198 1.3480 0.3774  0.2461  -0.2412 53  HIS A CA    
423  C C     . HIS A 53  ? 1.3381 1.6833 1.1046 0.4008  0.2269  -0.2229 53  HIS A C     
424  O O     . HIS A 53  ? 1.3445 1.7161 1.1617 0.4359  0.1950  -0.1972 53  HIS A O     
425  C CB    . HIS A 53  ? 1.4950 1.9875 1.6072 0.4320  0.2532  -0.2818 53  HIS A CB    
426  C CG    . HIS A 53  ? 1.4812 2.1029 1.8575 0.4204  0.2478  -0.2731 53  HIS A CG    
427  N ND1   . HIS A 53  ? 1.4060 2.0862 1.9344 0.4585  0.2601  -0.3125 53  HIS A ND1   
428  C CD2   . HIS A 53  ? 1.4248 2.1309 1.9459 0.3742  0.2302  -0.2280 53  HIS A CD2   
429  C CE1   . HIS A 53  ? 1.3211 2.1145 2.0724 0.4370  0.2516  -0.2932 53  HIS A CE1   
430  N NE2   . HIS A 53  ? 1.3345 2.1458 2.0862 0.3858  0.2332  -0.2419 53  HIS A NE2   
431  N N     . VAL A 54  ? 1.3332 1.5691 0.8730 0.3816  0.2465  -0.2358 54  VAL A N     
432  C CA    . VAL A 54  ? 1.3911 1.5299 0.7257 0.4035  0.2314  -0.2218 54  VAL A CA    
433  C C     . VAL A 54  ? 1.4885 1.6228 0.7739 0.3671  0.1977  -0.1550 54  VAL A C     
434  O O     . VAL A 54  ? 1.5351 1.6750 0.8093 0.3106  0.2009  -0.1318 54  VAL A O     
435  C CB    . VAL A 54  ? 1.4502 1.4654 0.5492 0.4050  0.2672  -0.2681 54  VAL A CB    
436  C CG1   . VAL A 54  ? 1.4615 1.3758 0.3421 0.4176  0.2508  -0.2469 54  VAL A CG1   
437  C CG2   . VAL A 54  ? 1.3653 1.3712 0.4889 0.4525  0.2946  -0.3321 54  VAL A CG2   
438  N N     . PRO A 55  ? 1.4837 1.6062 0.7385 0.3998  0.1652  -0.1237 55  PRO A N     
439  C CA    . PRO A 55  ? 1.5186 1.6391 0.7346 0.3690  0.1311  -0.0587 55  PRO A CA    
440  C C     . PRO A 55  ? 1.6825 1.6829 0.6385 0.3427  0.1392  -0.0514 55  PRO A C     
441  O O     . PRO A 55  ? 1.6978 1.6424 0.5298 0.3568  0.1169  -0.0218 55  PRO A O     
442  C CB    . PRO A 55  ? 1.4174 1.5604 0.6849 0.4205  0.0984  -0.0358 55  PRO A CB    
443  C CG    . PRO A 55  ? 1.4841 1.5744 0.6799 0.4766  0.1194  -0.0917 55  PRO A CG    
444  C CD    . PRO A 55  ? 1.4644 1.5765 0.7252 0.4672  0.1579  -0.1462 55  PRO A CD    
445  N N     . TRP A 56  ? 0.7642 0.9913 1.0628 0.0882  -0.0584 -0.1654 56  TRP A N     
446  C CA    . TRP A 56  ? 0.8014 1.0687 1.1038 0.0942  -0.0491 -0.1474 56  TRP A CA    
447  C C     . TRP A 56  ? 0.8881 1.0695 1.1243 0.1305  -0.0243 -0.1294 56  TRP A C     
448  O O     . TRP A 56  ? 0.9246 1.1228 1.1672 0.1345  -0.0050 -0.1022 56  TRP A O     
449  C CB    . TRP A 56  ? 0.8578 1.2009 1.1606 0.0946  -0.0860 -0.1839 56  TRP A CB    
450  C CG    . TRP A 56  ? 1.0325 1.3305 1.2700 0.1224  -0.1129 -0.2266 56  TRP A CG    
451  C CD1   . TRP A 56  ? 1.1461 1.4490 1.3824 0.1160  -0.1423 -0.2640 56  TRP A CD1   
452  C CD2   . TRP A 56  ? 1.0602 1.2997 1.2238 0.1616  -0.1131 -0.2366 56  TRP A CD2   
453  N NE1   . TRP A 56  ? 1.2142 1.4660 1.3807 0.1487  -0.1610 -0.2969 56  TRP A NE1   
454  C CE2   . TRP A 56  ? 1.1085 1.3206 1.2295 0.1771  -0.1436 -0.2809 56  TRP A CE2   
455  C CE3   . TRP A 56  ? 1.0823 1.2905 1.2124 0.1849  -0.0905 -0.2127 56  TRP A CE3   
456  C CZ2   . TRP A 56  ? 1.1460 1.3009 1.1925 0.2150  -0.1524 -0.3019 56  TRP A CZ2   
457  C CZ3   . TRP A 56  ? 1.1527 1.3046 1.2086 0.2225  -0.0993 -0.2336 56  TRP A CZ3   
458  C CH2   . TRP A 56  ? 1.1841 1.3094 1.1989 0.2373  -0.1299 -0.2777 56  TRP A CH2   
459  N N     . HIS A 57  ? 0.8826 0.9726 1.0553 0.1571  -0.0252 -0.1445 57  HIS A N     
460  C CA    . HIS A 57  ? 0.9667 0.9704 1.0732 0.1927  -0.0020 -0.1284 57  HIS A CA    
461  C C     . HIS A 57  ? 1.0673 1.0247 1.1890 0.1872  0.0417  -0.0797 57  HIS A C     
462  O O     . HIS A 57  ? 1.0829 0.9890 1.1657 0.2106  0.0660  -0.0572 57  HIS A O     
463  C CB    . HIS A 57  ? 1.0072 0.9250 1.0400 0.2232  -0.0156 -0.1584 57  HIS A CB    
464  C CG    . HIS A 57  ? 1.1216 0.9974 1.1623 0.2113  -0.0159 -0.1641 57  HIS A CG    
465  N ND1   . HIS A 57  ? 1.1628 1.0922 1.2419 0.1875  -0.0448 -0.1928 57  HIS A ND1   
466  C CD2   . HIS A 57  ? 1.1943 0.9796 1.2086 0.2202  0.0092  -0.1452 57  HIS A CD2   
467  C CE1   . HIS A 57  ? 1.2234 1.0968 1.3002 0.1822  -0.0376 -0.1914 57  HIS A CE1   
468  N NE2   . HIS A 57  ? 1.2471 1.0330 1.2851 0.2015  -0.0051 -0.1627 57  HIS A NE2   
469  N N     . ARG A 58  ? 0.9877 0.9644 1.1669 0.1561  0.0521  -0.0634 58  ARG A N     
470  C CA    . ARG A 58  ? 0.8670 0.8011 1.0639 0.1492  0.0936  -0.0178 58  ARG A CA    
471  C C     . ARG A 58  ? 0.8506 0.8503 1.0997 0.1321  0.1130  0.0164  58  ARG A C     
472  O O     . ARG A 58  ? 0.9247 0.9144 1.2098 0.1165  0.1445  0.0539  58  ARG A O     
473  C CB    . ARG A 58  ? 0.6993 0.6174 0.9323 0.1250  0.0990  -0.0136 58  ARG A CB    
474  C CG    . ARG A 58  ? 1.0176 0.8838 1.2059 0.1384  0.0745  -0.0518 58  ARG A CG    
475  C CD    . ARG A 58  ? 1.0887 0.8780 1.2727 0.1345  0.0964  -0.0362 58  ARG A CD    
476  N NE    . ARG A 58  ? 1.1208 0.9381 1.3433 0.1094  0.0757  -0.0580 58  ARG A NE    
477  C CZ    . ARG A 58  ? 1.1709 0.9676 1.3602 0.1195  0.0454  -0.0984 58  ARG A CZ    
478  N NH1   . ARG A 58  ? 1.0918 0.8412 1.2092 0.1541  0.0316  -0.1220 58  ARG A NH1   
479  N NH2   . ARG A 58  ? 1.2478 1.0719 1.4763 0.0951  0.0284  -0.1159 58  ARG A NH2   
480  N N     . VAL A 59  ? 0.7609 0.8263 1.0136 0.1355  0.0950  0.0041  59  VAL A N     
481  C CA    . VAL A 59  ? 0.7114 0.8464 1.0167 0.1179  0.1102  0.0343  59  VAL A CA    
482  C C     . VAL A 59  ? 0.8197 0.9481 1.0845 0.1450  0.1167  0.0411  59  VAL A C     
483  O O     . VAL A 59  ? 0.9018 1.0547 1.1367 0.1602  0.0891  0.0098  59  VAL A O     
484  C CB    . VAL A 59  ? 0.6772 0.9243 1.0486 0.0856  0.0823  0.0176  59  VAL A CB    
485  C CG1   . VAL A 59  ? 0.5904 0.9054 1.0233 0.0633  0.1012  0.0530  59  VAL A CG1   
486  C CG2   . VAL A 59  ? 0.7709 1.0267 1.1778 0.0607  0.0705  0.0043  59  VAL A CG2   
487  N N     . ILE A 60  ? 0.8706 0.9670 1.1357 0.1507  0.1535  0.0819  60  ILE A N     
488  C CA    . ILE A 60  ? 0.7776 0.8619 1.0046 0.1769  0.1640  0.0926  60  ILE A CA    
489  C C     . ILE A 60  ? 0.6236 0.7590 0.9057 0.1583  0.1894  0.1328  60  ILE A C     
490  O O     . ILE A 60  ? 0.7848 0.9722 1.1348 0.1251  0.1945  0.1483  60  ILE A O     
491  C CB    . ILE A 60  ? 0.8395 0.8098 0.9912 0.2127  0.1866  0.1022  60  ILE A CB    
492  C CG1   . ILE A 60  ? 1.0201 0.9417 1.1913 0.2038  0.2285  0.1462  60  ILE A CG1   
493  C CG2   . ILE A 60  ? 0.8278 0.7381 0.9249 0.2307  0.1643  0.0652  60  ILE A CG2   
494  C CD1   . ILE A 60  ? 1.2130 1.0270 1.3125 0.2388  0.2547  0.1611  60  ILE A CD1   
495  N N     . ASN A 61  ? 0.9648 1.1510 0.8257 -0.2886 0.2200  0.0433  61  ASN A N     
496  C CA    . ASN A 61  ? 1.0520 1.0827 0.8854 -0.3087 0.1994  0.0528  61  ASN A CA    
497  C C     . ASN A 61  ? 1.0898 1.0394 0.9344 -0.2689 0.1610  0.0176  61  ASN A C     
498  O O     . ASN A 61  ? 0.9078 0.9251 0.7928 -0.2328 0.1487  -0.0206 61  ASN A O     
499  C CB    . ASN A 61  ? 1.1361 1.1567 0.9964 -0.3902 0.2120  0.0587  61  ASN A CB    
500  C CG    . ASN A 61  ? 1.1380 1.2411 1.0737 -0.4148 0.2080  0.0151  61  ASN A CG    
501  O OD1   . ASN A 61  ? 0.9934 1.0908 0.9571 -0.3782 0.1824  -0.0230 61  ASN A OD1   
502  N ND2   . ASN A 61  ? 1.1072 1.2893 1.0764 -0.4766 0.2335  0.0200  61  ASN A ND2   
503  N N     . SER A 62  ? 1.2598 1.0622 1.0676 -0.2773 0.1429  0.0321  62  SER A N     
504  C CA    . SER A 62  ? 1.3102 1.0128 1.1176 -0.2419 0.1064  0.0060  62  SER A CA    
505  C C     . SER A 62  ? 1.2374 0.9900 1.1155 -0.2561 0.0931  -0.0419 62  SER A C     
506  O O     . SER A 62  ? 1.2510 0.9903 1.1454 -0.2089 0.0671  -0.0750 62  SER A O     
507  C CB    . SER A 62  ? 1.5496 1.0958 1.3172 -0.2727 0.0949  0.0304  62  SER A CB    
508  O OG    . SER A 62  ? 1.6520 1.1941 1.4552 -0.3457 0.1029  0.0267  62  SER A OG    
509  N N     . ARG A 63  ? 1.1162 0.9239 1.0354 -0.3221 0.1108  -0.0452 63  ARG A N     
510  C CA    . ARG A 63  ? 1.0841 0.9365 1.0715 -0.3450 0.1000  -0.0888 63  ARG A CA    
511  C C     . ARG A 63  ? 1.0073 1.0092 1.0434 -0.3131 0.1055  -0.1215 63  ARG A C     
512  O O     . ARG A 63  ? 1.0484 1.1028 1.1438 -0.3286 0.0978  -0.1592 63  ARG A O     
513  C CB    . ARG A 63  ? 1.0404 0.9001 1.0539 -0.4278 0.1178  -0.0798 63  ARG A CB    
514  C CG    . ARG A 63  ? 1.5372 1.2444 1.5196 -0.4624 0.1053  -0.0611 63  ARG A CG    
515  C CD    . ARG A 63  ? 1.7182 1.4370 1.7092 -0.5423 0.1310  -0.0378 63  ARG A CD    
516  N NE    . ARG A 63  ? 1.7442 1.5944 1.8014 -0.5788 0.1467  -0.0634 63  ARG A NE    
517  C CZ    . ARG A 63  ? 1.7574 1.7299 1.8262 -0.5981 0.1782  -0.0497 63  ARG A CZ    
518  N NH1   . ARG A 63  ? 1.7344 1.7150 1.7529 -0.5850 0.1977  -0.0102 63  ARG A NH1   
519  N NH2   . ARG A 63  ? 1.7265 1.8135 1.8575 -0.6309 0.1902  -0.0754 63  ARG A NH2   
520  N N     . GLY A 64  ? 0.9964 1.0661 1.0071 -0.2685 0.1189  -0.1069 64  GLY A N     
521  C CA    . GLY A 64  ? 0.8733 1.0852 0.9253 -0.2348 0.1256  -0.1345 64  GLY A CA    
522  C C     . GLY A 64  ? 0.9637 1.3107 1.0600 -0.2854 0.1568  -0.1348 64  GLY A C     
523  O O     . GLY A 64  ? 1.0796 1.5482 1.2228 -0.2689 0.1617  -0.1634 64  GLY A O     
524  N N     . THR A 65  ? 0.9561 1.2839 1.0387 -0.3474 0.1782  -0.1033 65  THR A N     
525  C CA    . THR A 65  ? 0.9367 1.3908 1.0597 -0.3980 0.2089  -0.1015 65  THR A CA    
526  C C     . THR A 65  ? 0.9172 1.4317 1.0023 -0.3983 0.2409  -0.0607 65  THR A C     
527  O O     . THR A 65  ? 0.9892 1.4465 1.0166 -0.3595 0.2391  -0.0340 65  THR A O     
528  C CB    . THR A 65  ? 1.0154 1.4299 1.1647 -0.4765 0.2129  -0.1011 65  THR A CB    
529  O OG1   . THR A 65  ? 1.1465 1.5432 1.2598 -0.5222 0.2392  -0.0563 65  THR A OG1   
530  C CG2   . THR A 65  ? 1.0396 1.3105 1.1812 -0.4765 0.1803  -0.1148 65  THR A CG2   
531  N N     . ILE A 66  ? 0.8551 1.4883 0.9737 -0.4406 0.2699  -0.0571 66  ILE A N     
532  C CA    . ILE A 66  ? 0.9366 1.6262 1.0225 -0.4515 0.3022  -0.0173 66  ILE A CA    
533  C C     . ILE A 66  ? 1.1425 1.7849 1.2174 -0.5270 0.3195  0.0127  66  ILE A C     
534  O O     . ILE A 66  ? 1.1456 1.8096 1.2667 -0.5816 0.3224  -0.0038 66  ILE A O     
535  C CB    . ILE A 66  ? 0.8780 1.7401 1.0045 -0.4419 0.3251  -0.0307 66  ILE A CB    
536  C CG1   . ILE A 66  ? 0.8088 1.7121 0.9368 -0.3626 0.3096  -0.0547 66  ILE A CG1   
537  C CG2   . ILE A 66  ? 0.7576 1.6786 0.8545 -0.4653 0.3609  0.0114  66  ILE A CG2   
538  C CD1   . ILE A 66  ? 0.8248 1.8935 0.9835 -0.3457 0.3331  -0.0628 66  ILE A CD1   
539  N N     . SER A 67  ? 1.2232 2.2999 0.9373 0.1041  0.1253  -0.2210 67  SER A N     
540  C CA    . SER A 67  ? 1.1689 2.1618 1.0206 0.1086  0.1923  -0.2454 67  SER A CA    
541  C C     . SER A 67  ? 1.0997 2.1004 1.0634 0.0714  0.1438  -0.2480 67  SER A C     
542  O O     . SER A 67  ? 0.9328 2.0047 0.9371 0.0816  0.0871  -0.1780 67  SER A O     
543  C CB    . SER A 67  ? 1.0314 2.0084 0.9678 0.1860  0.2684  -0.1661 67  SER A CB    
544  O OG    . SER A 67  ? 0.9527 2.0039 0.8087 0.2268  0.2457  -0.0936 67  SER A OG    
545  N N     . LYS A 68  ? 1.3108 2.2374 1.3246 0.0287  0.1672  -0.3289 68  LYS A N     
546  C CA    . LYS A 68  ? 1.3708 2.2938 1.4984 -0.0082 0.1292  -0.3390 68  LYS A CA    
547  C C     . LYS A 68  ? 1.2751 2.2041 1.5571 0.0448  0.1592  -0.2502 68  LYS A C     
548  O O     . LYS A 68  ? 1.2331 2.1171 1.5715 0.0988  0.2420  -0.2197 68  LYS A O     
549  C CB    . LYS A 68  ? 1.5571 2.3885 1.7144 -0.0566 0.1643  -0.4421 68  LYS A CB    
550  C CG    . LYS A 68  ? 1.8048 2.6350 1.8310 -0.1248 0.1148  -0.5363 68  LYS A CG    
551  C CD    . LYS A 68  ? 1.9363 2.7734 1.8086 -0.1106 0.1328  -0.5543 68  LYS A CD    
552  C CE    . LYS A 68  ? 2.0032 2.7583 1.8935 -0.0680 0.2404  -0.5696 68  LYS A CE    
553  N NZ    . LYS A 68  ? 1.9896 2.7655 1.7465 -0.0367 0.2603  -0.5573 68  LYS A NZ    
554  N N     . ARG A 69  ? 1.2126 2.1976 1.5623 0.0292  0.0915  -0.2089 69  ARG A N     
555  C CA    . ARG A 69  ? 1.1126 2.1081 1.6109 0.0747  0.1112  -0.1252 69  ARG A CA    
556  C C     . ARG A 69  ? 1.3816 2.3119 2.0142 0.0462  0.1337  -0.1670 69  ARG A C     
557  O O     . ARG A 69  ? 1.4442 2.3813 2.0789 -0.0147 0.0744  -0.2178 69  ARG A O     
558  C CB    . ARG A 69  ? 0.8508 1.9485 1.3505 0.0767  0.0231  -0.0503 69  ARG A CB    
559  C CG    . ARG A 69  ? 0.7337 1.9071 1.0851 0.0848  -0.0257 -0.0226 69  ARG A CG    
560  C CD    . ARG A 69  ? 0.6918 1.8637 1.0172 0.1552  0.0393  0.0356  69  ARG A CD    
561  N NE    . ARG A 69  ? 0.7456 2.0109 0.9785 0.1774  -0.0170 0.1021  69  ARG A NE    
562  C CZ    . ARG A 69  ? 0.8978 2.1906 0.9759 0.1681  -0.0378 0.0781  69  ARG A CZ    
563  N NH1   . ARG A 69  ? 1.0926 2.3270 1.0881 0.1368  -0.0071 -0.0120 69  ARG A NH1   
564  N NH2   . ARG A 69  ? 0.7668 2.1459 0.7720 0.1908  -0.0891 0.1448  69  ARG A NH2   
565  N N     . ASP A 70  ? 1.5587 2.4269 2.3044 0.0902  0.2184  -0.1446 70  ASP A N     
566  C CA    . ASP A 70  ? 1.7077 2.5158 2.5949 0.0703  0.2433  -0.1730 70  ASP A CA    
567  C C     . ASP A 70  ? 1.5156 2.3859 2.4977 0.0616  0.1747  -0.1150 70  ASP A C     
568  O O     . ASP A 70  ? 1.5427 2.3830 2.6194 0.0254  0.1629  -0.1478 70  ASP A O     
569  C CB    . ASP A 70  ? 1.7843 2.5147 2.7711 0.1235  0.3504  -0.1561 70  ASP A CB    
570  C CG    . ASP A 70  ? 1.9188 2.5743 2.8244 0.1222  0.4201  -0.2291 70  ASP A CG    
571  O OD1   . ASP A 70  ? 1.9184 2.5207 2.8755 0.1732  0.5073  -0.2083 70  ASP A OD1   
572  O OD2   . ASP A 70  ? 1.9942 2.6441 2.7850 0.0706  0.3879  -0.3069 70  ASP A OD2   
573  N N     . ILE A 71  ? 1.2838 2.2409 2.2395 0.0953  0.1301  -0.0287 71  ILE A N     
574  C CA    . ILE A 71  ? 1.1145 2.1464 2.1219 0.0796  0.0472  0.0216  71  ILE A CA    
575  C C     . ILE A 71  ? 0.9823 2.1069 1.8522 0.0707  -0.0324 0.0477  71  ILE A C     
576  O O     . ILE A 71  ? 0.8869 2.0363 1.6752 0.1125  -0.0122 0.0855  71  ILE A O     
577  C CB    . ILE A 71  ? 1.2835 2.3354 2.4329 0.1395  0.0717  0.1232  71  ILE A CB    
578  C CG1   . ILE A 71  ? 1.3117 2.2758 2.5626 0.1824  0.1790  0.1237  71  ILE A CG1   
579  C CG2   . ILE A 71  ? 1.1564 2.2463 2.4038 0.1085  0.0047  0.1437  71  ILE A CG2   
580  C CD1   . ILE A 71  ? 1.1077 2.0930 2.4828 0.2490  0.2094  0.2282  71  ILE A CD1   
581  N N     . SER A 72  ? 0.9507 2.1251 1.7936 0.0157  -0.1221 0.0261  72  SER A N     
582  C CA    . SER A 72  ? 0.8230 2.0951 1.5596 0.0091  -0.2066 0.0651  72  SER A CA    
583  C C     . SER A 72  ? 0.8271 2.1087 1.3883 -0.0217 -0.2294 0.0036  72  SER A C     
584  O O     . SER A 72  ? 0.7199 2.0142 1.1962 0.0172  -0.2009 0.0296  72  SER A O     
585  C CB    . SER A 72  ? 0.7278 2.0565 1.4936 0.0811  -0.1966 0.1788  72  SER A CB    
586  O OG    . SER A 72  ? 0.7726 2.1882 1.4164 0.0813  -0.2649 0.2135  72  SER A OG    
587  N N     . ALA A 73  ? 0.9284 2.2059 1.4347 -0.0919 -0.2829 -0.0770 73  ALA A N     
588  C CA    . ALA A 73  ? 0.9061 2.1982 1.2459 -0.1258 -0.3135 -0.1359 73  ALA A CA    
589  C C     . ALA A 73  ? 0.7719 2.1687 1.0178 -0.1183 -0.3930 -0.0756 73  ALA A C     
590  O O     . ALA A 73  ? 0.6692 2.1165 0.8591 -0.1681 -0.4771 -0.0988 73  ALA A O     
591  C CB    . ALA A 73  ? 1.0248 2.2807 1.3376 -0.2027 -0.3464 -0.2394 73  ALA A CB    
592  N N     . GLY A 74  ? 0.8745 2.3043 1.1082 -0.0541 -0.3657 0.0051  74  GLY A N     
593  C CA    . GLY A 74  ? 0.9902 2.5114 1.1147 -0.0426 -0.4294 0.0567  74  GLY A CA    
594  C C     . GLY A 74  ? 1.1910 2.6923 1.1930 -0.0187 -0.3817 0.0371  74  GLY A C     
595  O O     . GLY A 74  ? 1.1327 2.6751 1.0706 0.0215  -0.3747 0.0991  74  GLY A O     
596  N N     . GLU A 75  ? 1.1979 2.5437 1.5417 0.1739  -0.1767 -0.2401 75  GLU A N     
597  C CA    . GLU A 75  ? 1.0904 2.3303 1.4717 0.1798  -0.1598 -0.2045 75  GLU A CA    
598  C C     . GLU A 75  ? 0.9981 2.1214 1.3757 0.1962  -0.1568 -0.2496 75  GLU A C     
599  O O     . GLU A 75  ? 0.9677 2.0092 1.3806 0.2060  -0.1536 -0.2514 75  GLU A O     
600  C CB    . GLU A 75  ? 1.0723 2.2515 1.4421 0.1705  -0.1255 -0.1229 75  GLU A CB    
601  C CG    . GLU A 75  ? 1.1670 2.2398 1.4937 0.1738  -0.1000 -0.1130 75  GLU A CG    
602  C CD    . GLU A 75  ? 1.2988 2.3252 1.6126 0.1634  -0.0680 -0.0316 75  GLU A CD    
603  O OE1   . GLU A 75  ? 1.3603 2.4802 1.6749 0.1493  -0.0694 0.0079  75  GLU A OE1   
604  O OE2   . GLU A 75  ? 1.2824 2.1796 1.5855 0.1694  -0.0417 -0.0071 75  GLU A OE2   
605  N N     . GLN A 76  ? 0.9838 2.1023 1.3176 0.1989  -0.1583 -0.2865 76  GLN A N     
606  C CA    . GLN A 76  ? 0.9856 2.0106 1.3106 0.2143  -0.1601 -0.3397 76  GLN A CA    
607  C C     . GLN A 76  ? 0.9922 2.0650 1.3519 0.2238  -0.1928 -0.4038 76  GLN A C     
608  O O     . GLN A 76  ? 1.0109 1.9968 1.3968 0.2365  -0.1938 -0.4269 76  GLN A O     
609  C CB    . GLN A 76  ? 0.9150 1.9528 1.1857 0.2137  -0.1598 -0.3699 76  GLN A CB    
610  C CG    . GLN A 76  ? 0.9402 1.8380 1.1896 0.2255  -0.1417 -0.3845 76  GLN A CG    
611  C CD    . GLN A 76  ? 0.9984 1.7804 1.2491 0.2236  -0.1059 -0.3137 76  GLN A CD    
612  O OE1   . GLN A 76  ? 0.9968 1.6541 1.2585 0.2350  -0.0922 -0.3152 76  GLN A OE1   
613  N NE2   . GLN A 76  ? 1.0210 1.8443 1.2608 0.2091  -0.0905 -0.2509 76  GLN A NE2   
614  N N     . ARG A 77  ? 0.9406 2.1537 1.3002 0.2174  -0.2196 -0.4317 77  ARG A N     
615  C CA    . ARG A 77  ? 0.9332 2.2083 1.3222 0.2254  -0.2533 -0.4951 77  ARG A CA    
616  C C     . ARG A 77  ? 0.9122 2.1576 1.3575 0.2286  -0.2548 -0.4734 77  ARG A C     
617  O O     . ARG A 77  ? 1.0386 2.2900 1.5149 0.2386  -0.2775 -0.5225 77  ARG A O     
618  C CB    . ARG A 77  ? 1.0017 2.4386 1.3780 0.2160  -0.2789 -0.5187 77  ARG A CB    
619  C CG    . ARG A 77  ? 1.0688 2.5915 1.4717 0.2231  -0.3167 -0.5863 77  ARG A CG    
620  C CD    . ARG A 77  ? 1.0796 2.7637 1.4791 0.2104  -0.3362 -0.5837 77  ARG A CD    
621  N NE    . ARG A 77  ? 1.1156 2.8949 1.5338 0.2164  -0.3735 -0.6505 77  ARG A NE    
622  C CZ    . ARG A 77  ? 1.1485 3.0608 1.5822 0.2082  -0.3948 -0.6513 77  ARG A CZ    
623  N NH1   . ARG A 77  ? 1.0690 3.0357 1.5027 0.1934  -0.3825 -0.5884 77  ARG A NH1   
624  N NH2   . ARG A 77  ? 1.1793 3.1701 1.6292 0.2150  -0.4286 -0.7150 77  ARG A NH2   
625  N N     . GLN A 78  ? 0.7309 1.9413 1.1898 0.2204  -0.2305 -0.4001 78  GLN A N     
626  C CA    . GLN A 78  ? 0.7351 1.9174 1.2475 0.2228  -0.2306 -0.3758 78  GLN A CA    
627  C C     . GLN A 78  ? 0.8661 1.8942 1.3936 0.2360  -0.2131 -0.3757 78  GLN A C     
628  O O     . GLN A 78  ? 0.8012 1.8017 1.3703 0.2450  -0.2255 -0.3991 78  GLN A O     
629  C CB    . GLN A 78  ? 0.6039 1.8212 1.1288 0.2086  -0.2142 -0.2984 78  GLN A CB    
630  C CG    . GLN A 78  ? 0.5102 1.7045 1.0914 0.2109  -0.2154 -0.2738 78  GLN A CG    
631  C CD    . GLN A 78  ? 0.5873 1.8290 1.1835 0.1968  -0.2027 -0.2007 78  GLN A CD    
632  O OE1   . GLN A 78  ? 0.5813 1.8400 1.1448 0.1858  -0.1850 -0.1566 78  GLN A OE1   
633  N NE2   . GLN A 78  ? 0.4561 1.7179 1.1024 0.1970  -0.2117 -0.1872 78  GLN A NE2   
634  N N     . LYS A 79  ? 0.9941 1.9223 1.4879 0.2370  -0.1844 -0.3485 79  LYS A N     
635  C CA    . LYS A 79  ? 1.0337 1.8119 1.5342 0.2500  -0.1669 -0.3520 79  LYS A CA    
636  C C     . LYS A 79  ? 1.0009 1.7635 1.5085 0.2643  -0.1913 -0.4322 79  LYS A C     
637  O O     . LYS A 79  ? 1.1129 1.8141 1.6583 0.2743  -0.1958 -0.4476 79  LYS A O     
638  C CB    . LYS A 79  ? 1.0810 1.7700 1.5353 0.2491  -0.1367 -0.3228 79  LYS A CB    
639  C CG    . LYS A 79  ? 1.1844 1.7204 1.6396 0.2635  -0.1202 -0.3349 79  LYS A CG    
640  C CD    . LYS A 79  ? 1.2892 1.7722 1.6912 0.2673  -0.1097 -0.3574 79  LYS A CD    
641  C CE    . LYS A 79  ? 1.3418 1.6704 1.7444 0.2818  -0.0931 -0.3691 79  LYS A CE    
642  N NZ    . LYS A 79  ? 1.3250 1.6067 1.6795 0.2879  -0.0892 -0.4068 79  LYS A NZ    
643  N N     . ASP A 80  ? 1.2227 1.9250 1.8812 0.3083  0.1448  0.1600  80  ASP A N     
644  C CA    . ASP A 80  ? 1.1699 1.8429 1.8513 0.3246  0.0582  0.1396  80  ASP A CA    
645  C C     . ASP A 80  ? 1.0903 1.7633 1.6925 0.3538  0.0655  0.1275  80  ASP A C     
646  O O     . ASP A 80  ? 1.1206 1.7073 1.6292 0.3309  0.0001  0.1205  80  ASP A O     
647  C CB    . ASP A 80  ? 1.2346 1.9921 2.0851 0.3697  0.0466  0.1276  80  ASP A CB    
648  C CG    . ASP A 80  ? 1.4234 2.1207 2.3152 0.3544  -0.0617 0.1154  80  ASP A CG    
649  O OD1   . ASP A 80  ? 1.3961 2.1495 2.4260 0.3805  -0.0791 0.1080  80  ASP A OD1   
650  O OD2   . ASP A 80  ? 1.5546 2.1481 2.3411 0.3157  -0.1293 0.1133  80  ASP A OD2   
651  N N     . ARG A 81  ? 1.0478 1.8172 1.6865 0.4036  0.1460  0.1256  81  ARG A N     
652  C CA    . ARG A 81  ? 1.0105 1.7921 1.5842 0.4368  0.1612  0.1143  81  ARG A CA    
653  C C     . ARG A 81  ? 1.0030 1.6854 1.4065 0.3922  0.1463  0.1214  81  ARG A C     
654  O O     . ARG A 81  ? 1.0314 1.6773 1.3651 0.4016  0.1104  0.1092  81  ARG A O     
655  C CB    . ARG A 81  ? 0.9021 1.7984 1.5272 0.4880  0.2635  0.1165  81  ARG A CB    
656  C CG    . ARG A 81  ? 0.9103 1.9090 1.7024 0.5398  0.2765  0.1059  81  ARG A CG    
657  C CD    . ARG A 81  ? 0.9704 1.9977 1.8017 0.5897  0.2387  0.0824  81  ARG A CD    
658  N NE    . ARG A 81  ? 1.0443 2.1363 1.8471 0.6330  0.3115  0.0794  81  ARG A NE    
659  C CZ    . ARG A 81  ? 0.9727 2.1761 1.8790 0.6879  0.3738  0.0742  81  ARG A CZ    
660  N NH1   . ARG A 81  ? 0.9311 2.1950 1.9790 0.7074  0.3714  0.0709  81  ARG A NH1   
661  N NH2   . ARG A 81  ? 0.8941 2.1478 1.7623 0.7233  0.4378  0.0722  81  ARG A NH2   
662  N N     . LEU A 82  ? 0.9428 1.5807 1.2802 0.3430  0.1730  0.1410  82  LEU A N     
663  C CA    . LEU A 82  ? 0.9872 1.5321 1.1638 0.2978  0.1648  0.1493  82  LEU A CA    
664  C C     . LEU A 82  ? 1.2172 1.6480 1.3342 0.2532  0.0597  0.1436  82  LEU A C     
665  O O     . LEU A 82  ? 1.3254 1.6897 1.3341 0.2406  0.0226  0.1373  82  LEU A O     
666  C CB    . LEU A 82  ? 0.9775 1.5158 1.1066 0.2610  0.2317  0.1722  82  LEU A CB    
667  C CG    . LEU A 82  ? 0.9515 1.5751 1.0749 0.2952  0.3387  0.1796  82  LEU A CG    
668  C CD1   . LEU A 82  ? 0.8470 1.5038 0.9993 0.2754  0.4079  0.1999  82  LEU A CD1   
669  C CD2   . LEU A 82  ? 0.9428 1.5174 0.9181 0.2844  0.3536  0.1806  82  LEU A CD2   
670  N N     . GLU A 83  ? 1.2983 1.7065 1.4867 0.2289  0.0115  0.1461  83  GLU A N     
671  C CA    . GLU A 83  ? 1.2775 1.5750 1.4138 0.1822  -0.0888 0.1425  83  GLU A CA    
672  C C     . GLU A 83  ? 1.3415 1.6177 1.4686 0.2085  -0.1570 0.1210  83  GLU A C     
673  O O     . GLU A 83  ? 1.5195 1.6973 1.5467 0.1734  -0.2242 0.1175  83  GLU A O     
674  C CB    . GLU A 83  ? 1.2458 1.5360 1.4808 0.1601  -0.1287 0.1470  83  GLU A CB    
675  C CG    . GLU A 83  ? 1.3095 1.5816 1.5197 0.1149  -0.0835 0.1697  83  GLU A CG    
676  C CD    . GLU A 83  ? 1.5787 1.7635 1.7880 0.0598  -0.1603 0.1754  83  GLU A CD    
677  O OE1   . GLU A 83  ? 1.6055 1.8073 1.9261 0.0723  -0.2127 0.1666  83  GLU A OE1   
678  O OE2   . GLU A 83  ? 1.6974 1.7955 1.7938 0.0035  -0.1685 0.1887  83  GLU A OE2   
679  N N     . GLU A 84  ? 1.3338 1.7023 1.5628 0.2704  -0.1382 0.1068  84  GLU A N     
680  C CA    . GLU A 84  ? 1.4500 1.8065 1.6738 0.3003  -0.1964 0.0859  84  GLU A CA    
681  C C     . GLU A 84  ? 1.4665 1.7848 1.5506 0.2977  -0.1793 0.0848  84  GLU A C     
682  O O     . GLU A 84  ? 1.4983 1.7565 1.5226 0.2943  -0.2458 0.0721  84  GLU A O     
683  C CB    . GLU A 84  ? 1.4862 1.9558 1.8514 0.3689  -0.1715 0.0714  84  GLU A CB    
684  C CG    . GLU A 84  ? 1.6390 2.1368 2.1454 0.3746  -0.2113 0.0673  84  GLU A CG    
685  C CD    . GLU A 84  ? 1.6481 2.2736 2.2922 0.4275  -0.1382 0.0664  84  GLU A CD    
686  O OE1   . GLU A 84  ? 1.6591 2.3357 2.4229 0.4663  -0.1690 0.0511  84  GLU A OE1   
687  O OE2   . GLU A 84  ? 1.5992 2.2735 2.2315 0.4298  -0.0500 0.0809  84  GLU A OE2   
688  N N     . GLU A 85  ? 1.4543 1.8085 1.4876 0.2995  -0.0899 0.0982  85  GLU A N     
689  C CA    . GLU A 85  ? 1.4859 1.8059 1.3849 0.2950  -0.0665 0.0991  85  GLU A CA    
690  C C     . GLU A 85  ? 1.5829 1.7851 1.3499 0.2256  -0.1031 0.1113  85  GLU A C     
691  O O     . GLU A 85  ? 1.6753 1.8279 1.3149 0.2085  -0.0939 0.1141  85  GLU A O     
692  C CB    . GLU A 85  ? 1.4737 1.8803 1.3734 0.3252  0.0441  0.1087  85  GLU A CB    
693  C CG    . GLU A 85  ? 1.5120 2.0403 1.5571 0.3895  0.0872  0.0996  85  GLU A CG    
694  C CD    . GLU A 85  ? 1.5333 2.1385 1.5608 0.4344  0.1719  0.0990  85  GLU A CD    
695  O OE1   . GLU A 85  ? 1.5876 2.1574 1.4934 0.4140  0.2072  0.1084  85  GLU A OE1   
696  O OE2   . GLU A 85  ? 1.4913 2.1928 1.6278 0.4905  0.2028  0.0890  85  GLU A OE2   
697  N N     . GLY A 86  ? 1.3218 2.0151 1.3931 -0.3984 -0.3648 0.1482  86  GLY A N     
698  C CA    . GLY A 86  ? 1.5296 2.0820 1.4424 -0.3984 -0.2901 0.1650  86  GLY A CA    
699  C C     . GLY A 86  ? 1.4319 1.9734 1.3744 -0.4156 -0.2053 0.1607  86  GLY A C     
700  O O     . GLY A 86  ? 1.3991 1.9056 1.3941 -0.4245 -0.1191 0.1892  86  GLY A O     
701  N N     . VAL A 87  ? 1.3419 1.9123 1.2487 -0.4203 -0.2300 0.1247  87  VAL A N     
702  C CA    . VAL A 87  ? 1.2999 1.8763 1.2483 -0.4372 -0.1587 0.1158  87  VAL A CA    
703  C C     . VAL A 87  ? 1.4492 1.9539 1.2301 -0.4370 -0.1545 0.0904  87  VAL A C     
704  O O     . VAL A 87  ? 1.4095 1.9635 1.1602 -0.4339 -0.2256 0.0554  87  VAL A O     
705  C CB    . VAL A 87  ? 1.0072 1.7323 1.1589 -0.4490 -0.1820 0.0977  87  VAL A CB    
706  C CG1   . VAL A 87  ? 0.9074 1.6545 1.0608 -0.4623 -0.1554 0.0690  87  VAL A CG1   
707  C CG2   . VAL A 87  ? 0.7993 1.5618 1.1149 -0.4571 -0.1254 0.1304  87  VAL A CG2   
708  N N     . GLU A 88  ? 1.5763 1.9626 1.2462 -0.4402 -0.0707 0.1085  88  GLU A N     
709  C CA    . GLU A 88  ? 1.7037 2.0095 1.2060 -0.4399 -0.0582 0.0878  88  GLU A CA    
710  C C     . GLU A 88  ? 1.4838 1.8743 1.0634 -0.4528 -0.0642 0.0535  88  GLU A C     
711  O O     . GLU A 88  ? 1.3683 1.7941 1.0643 -0.4680 0.0010  0.0590  88  GLU A O     
712  C CB    . GLU A 88  ? 1.9857 2.1613 1.3857 -0.4440 0.0443  0.1149  88  GLU A CB    
713  C CG    . GLU A 88  ? 2.1956 2.2675 1.3941 -0.4404 0.0547  0.0985  88  GLU A CG    
714  C CD    . GLU A 88  ? 2.3604 2.3699 1.4010 -0.4219 -0.0134 0.0969  88  GLU A CD    
715  O OE1   . GLU A 88  ? 2.3214 2.4016 1.3722 -0.4139 -0.1075 0.0718  88  GLU A OE1   
716  O OE2   . GLU A 88  ? 2.5507 2.4404 1.4568 -0.4153 0.0272  0.1208  88  GLU A OE2   
717  N N     . ILE A 89  ? 1.4354 1.8588 0.9511 -0.4467 -0.1435 0.0183  89  ILE A N     
718  C CA    . ILE A 89  ? 1.3864 1.8947 0.9704 -0.4578 -0.1604 -0.0169 89  ILE A CA    
719  C C     . ILE A 89  ? 1.4977 1.9368 0.9074 -0.4550 -0.1705 -0.0438 89  ILE A C     
720  O O     . ILE A 89  ? 1.5824 1.9866 0.8641 -0.4410 -0.2366 -0.0557 89  ILE A O     
721  C CB    . ILE A 89  ? 1.2511 1.8987 0.9643 -0.4550 -0.2566 -0.0389 89  ILE A CB    
722  C CG1   . ILE A 89  ? 1.0331 1.7730 0.9554 -0.4639 -0.2335 -0.0195 89  ILE A CG1   
723  C CG2   . ILE A 89  ? 1.1881 1.9060 0.9175 -0.4621 -0.2943 -0.0807 89  ILE A CG2   
724  C CD1   . ILE A 89  ? 0.9170 1.7854 0.9605 -0.4600 -0.3258 -0.0369 89  ILE A CD1   
725  N N     . TYR A 90  ? 1.5498 1.9689 0.9544 -0.4684 -0.1050 -0.0534 90  TYR A N     
726  C CA    . TYR A 90  ? 1.7136 2.0689 0.9577 -0.4670 -0.1103 -0.0799 90  TYR A CA    
727  C C     . TYR A 90  ? 1.6752 2.1240 0.9883 -0.4769 -0.1404 -0.1184 90  TYR A C     
728  O O     . TYR A 90  ? 1.6155 2.1324 1.0732 -0.4919 -0.0982 -0.1196 90  TYR A O     
729  C CB    . TYR A 90  ? 1.8029 2.0283 0.9294 -0.4717 -0.0108 -0.0614 90  TYR A CB    
730  C CG    . TYR A 90  ? 1.7496 1.9848 0.9952 -0.4887 0.0868  -0.0437 90  TYR A CG    
731  C CD1   . TYR A 90  ? 1.7030 1.9421 1.0532 -0.4910 0.1324  -0.0072 90  TYR A CD1   
732  C CD2   . TYR A 90  ? 1.7735 2.0077 1.0197 -0.5021 0.1361  -0.0627 90  TYR A CD2   
733  C CE1   . TYR A 90  ? 1.7408 1.9860 1.1974 -0.5065 0.2234  0.0097  90  TYR A CE1   
734  C CE2   . TYR A 90  ? 1.8041 2.0441 1.1560 -0.5176 0.2271  -0.0462 90  TYR A CE2   
735  C CZ    . TYR A 90  ? 1.8025 2.0480 1.2594 -0.5197 0.2705  -0.0100 90  TYR A CZ    
736  O OH    . TYR A 90  ? 1.7486 1.9997 1.3107 -0.5350 0.3607  0.0067  90  TYR A OH    
737  N N     . GLN A 91  ? 1.6799 2.1327 0.8896 -0.4685 -0.2152 -0.1497 91  GLN A N     
738  C CA    . GLN A 91  ? 1.6093 2.1232 0.8400 -0.4772 -0.2370 -0.1875 91  GLN A CA    
739  C C     . GLN A 91  ? 1.6766 2.1105 0.8490 -0.4889 -0.1394 -0.1837 91  GLN A C     
740  O O     . GLN A 91  ? 1.7764 2.0860 0.7964 -0.4836 -0.0945 -0.1685 91  GLN A O     
741  C CB    . GLN A 91  ? 1.7645 2.2679 0.8576 -0.4649 -0.3246 -0.2190 91  GLN A CB    
742  C CG    . GLN A 91  ? 1.7915 2.3394 0.8913 -0.4496 -0.4199 -0.2191 91  GLN A CG    
743  C CD    . GLN A 91  ? 2.0563 2.4933 1.0263 -0.4353 -0.4119 -0.1895 91  GLN A CD    
744  O OE1   . GLN A 91  ? 2.1566 2.4710 0.9713 -0.4329 -0.3603 -0.1801 91  GLN A OE1   
745  N NE2   . GLN A 91  ? 2.0025 2.4828 1.0369 -0.4258 -0.4631 -0.1746 91  GLN A NE2   
746  N N     . THR A 92  ? 1.0857 2.0275 1.5985 0.1003  0.1212  -0.5576 92  THR A N     
747  C CA    . THR A 92  ? 1.2187 2.0987 1.7488 0.0635  0.1340  -0.5599 92  THR A CA    
748  C C     . THR A 92  ? 1.2953 2.2240 1.9512 0.0437  0.1095  -0.6273 92  THR A C     
749  O O     . THR A 92  ? 1.3068 2.3082 2.0169 0.0625  0.0785  -0.6697 92  THR A O     
750  C CB    . THR A 92  ? 1.1777 2.0464 1.7670 0.0252  0.2100  -0.4941 92  THR A CB    
751  O OG1   . THR A 92  ? 1.2918 2.0835 1.8665 -0.0048 0.2187  -0.4913 92  THR A OG1   
752  C CG2   . THR A 92  ? 1.0510 2.0160 1.8198 -0.0032 0.2508  -0.4968 92  THR A CG2   
753  N N     . SER A 93  ? 1.3146 2.2036 2.0169 0.0065  0.1219  -0.6386 93  SER A N     
754  C CA    . SER A 93  ? 1.3134 2.2503 2.1453 -0.0168 0.1050  -0.6993 93  SER A CA    
755  C C     . SER A 93  ? 1.1892 2.2342 2.1739 -0.0266 0.1371  -0.6984 93  SER A C     
756  O O     . SER A 93  ? 1.0818 2.1933 2.1421 -0.0187 0.1040  -0.7526 93  SER A O     
757  C CB    . SER A 93  ? 1.4199 2.3029 2.2954 -0.0608 0.1285  -0.7008 93  SER A CB    
758  O OG    . SER A 93  ? 1.4887 2.3657 2.4180 -0.0911 0.1988  -0.6375 93  SER A OG    
759  N N     . LEU A 94  ? 1.2056 2.2674 2.2333 -0.0440 0.2012  -0.6363 94  LEU A N     
760  C CA    . LEU A 94  ? 1.2094 2.3714 2.3569 -0.0475 0.2332  -0.6268 94  LEU A CA    
761  C C     . LEU A 94  ? 1.1897 2.3778 2.2495 -0.0006 0.2119  -0.6162 94  LEU A C     
762  O O     . LEU A 94  ? 1.2129 2.3416 2.1254 0.0327  0.1719  -0.6173 94  LEU A O     
763  C CB    . LEU A 94  ? 1.2048 2.3752 2.4343 -0.0870 0.3099  -0.5645 94  LEU A CB    
764  C CG    . LEU A 94  ? 1.2191 2.4937 2.5907 -0.1005 0.3503  -0.5542 94  LEU A CG    
765  C CD1   . LEU A 94  ? 1.1910 2.4919 2.7171 -0.1528 0.3977  -0.5483 94  LEU A CD1   
766  C CD2   . LEU A 94  ? 1.2117 2.4973 2.5286 -0.0858 0.3879  -0.4900 94  LEU A CD2   
767  N N     . GLY A 95  ? 1.1454 2.4221 2.2952 0.0017  0.2386  -0.6066 95  GLY A N     
768  C CA    . GLY A 95  ? 1.1292 2.4418 2.2142 0.0454  0.2172  -0.6046 95  GLY A CA    
769  C C     . GLY A 95  ? 1.1162 2.3881 2.0872 0.0606  0.2486  -0.5351 95  GLY A C     
770  O O     . GLY A 95  ? 1.1115 2.4285 2.0605 0.0879  0.2510  -0.5218 95  GLY A O     
771  N N     . GLU A 96  ? 1.1055 2.2921 2.0044 0.0429  0.2726  -0.4912 96  GLU A N     
772  C CA    . GLU A 96  ? 1.0944 2.2348 1.8828 0.0541  0.3038  -0.4221 96  GLU A CA    
773  C C     . GLU A 96  ? 1.0559 2.1484 1.6794 0.1033  0.2494  -0.4325 96  GLU A C     
774  O O     . GLU A 96  ? 1.2597 2.3101 1.8258 0.1167  0.1951  -0.4783 96  GLU A O     
775  C CB    . GLU A 96  ? 1.2014 2.2607 1.9644 0.0201  0.3402  -0.3775 96  GLU A CB    
776  C CG    . GLU A 96  ? 1.3264 2.3805 2.0888 0.0020  0.4059  -0.2991 96  GLU A CG    
777  C CD    . GLU A 96  ? 1.4121 2.4396 2.2595 -0.0488 0.4542  -0.2704 96  GLU A CD    
778  O OE1   . GLU A 96  ? 1.4838 2.5056 2.3444 -0.0702 0.5102  -0.2053 96  GLU A OE1   
779  O OE2   . GLU A 96  ? 1.3836 2.3962 2.2862 -0.0680 0.4352  -0.3137 96  GLU A OE2   
780  N N     . TYR A 97  ? 0.8397 1.9367 1.3842 0.1296  0.2627  -0.3906 97  TYR A N     
781  C CA    . TYR A 97  ? 0.8396 1.8791 1.2159 0.1746  0.2144  -0.3928 97  TYR A CA    
782  C C     . TYR A 97  ? 0.8755 1.8164 1.1318 0.1678  0.2377  -0.3339 97  TYR A C     
783  O O     . TYR A 97  ? 0.8162 1.7548 1.0683 0.1553  0.2911  -0.2715 97  TYR A O     
784  C CB    . TYR A 97  ? 0.7100 1.8053 1.0540 0.2127  0.2063  -0.3873 97  TYR A CB    
785  C CG    . TYR A 97  ? 0.8948 2.0931 1.3649 0.2192  0.1886  -0.4414 97  TYR A CG    
786  C CD1   . TYR A 97  ? 0.9229 2.1871 1.3965 0.2481  0.1888  -0.4394 97  TYR A CD1   
787  C CD2   . TYR A 97  ? 0.8509 2.0818 1.4402 0.1954  0.1733  -0.4943 97  TYR A CD2   
788  C CE1   . TYR A 97  ? 0.8968 2.2566 1.4900 0.2538  0.1739  -0.4889 97  TYR A CE1   
789  C CE2   . TYR A 97  ? 0.8868 2.2130 1.5948 0.2009  0.1574  -0.5435 97  TYR A CE2   
790  C CZ    . TYR A 97  ? 0.8975 2.2879 1.6076 0.2303  0.1578  -0.5405 97  TYR A CZ    
791  O OH    . TYR A 97  ? 0.8973 2.3825 1.7277 0.2357  0.1424  -0.5898 97  TYR A OH    
792  N N     . LYS A 98  ? 1.0398 1.8995 1.1998 0.1748  0.1973  -0.3545 98  LYS A N     
793  C CA    . LYS A 98  ? 1.0967 1.8578 1.1457 0.1667  0.2160  -0.3043 98  LYS A CA    
794  C C     . LYS A 98  ? 1.1598 1.8662 1.0323 0.2135  0.1716  -0.2995 98  LYS A C     
795  O O     . LYS A 98  ? 1.2171 1.9616 1.0612 0.2498  0.1257  -0.3373 98  LYS A O     
796  C CB    . LYS A 98  ? 1.1067 1.8124 1.1793 0.1365  0.2058  -0.3319 98  LYS A CB    
797  C CG    . LYS A 98  ? 1.0911 1.7028 1.0930 0.1146  0.2388  -0.2790 98  LYS A CG    
798  C CD    . LYS A 98  ? 1.1476 1.7338 1.2333 0.0736  0.2465  -0.3049 98  LYS A CD    
799  C CE    . LYS A 98  ? 1.3046 1.7839 1.2944 0.0599  0.2588  -0.2705 98  LYS A CE    
800  N NZ    . LYS A 98  ? 1.2099 1.6406 1.2001 0.0443  0.2249  -0.3236 98  LYS A NZ    
801  N N     . LEU A 99  ? 1.6862 1.8394 0.9691 -0.2164 0.1229  0.1837  99  LEU A N     
802  C CA    . LEU A 99  ? 1.6633 1.7988 0.9384 -0.2100 0.1268  0.1876  99  LEU A CA    
803  C C     . LEU A 99  ? 1.6585 1.7666 0.9452 -0.2014 0.1828  0.1991  99  LEU A C     
804  O O     . LEU A 99  ? 1.3427 1.4661 0.6634 -0.1968 0.2142  0.2048  99  LEU A O     
805  C CB    . LEU A 99  ? 1.5222 1.7434 0.8693 -0.1979 0.0890  0.1877  99  LEU A CB    
806  C CG    . LEU A 99  ? 1.3938 1.7070 0.8472 -0.1808 0.0972  0.1960  99  LEU A CG    
807  C CD1   . LEU A 99  ? 1.3990 1.7028 0.8810 -0.1687 0.1471  0.2081  99  LEU A CD1   
808  C CD2   . LEU A 99  ? 1.2760 1.6662 0.7848 -0.1726 0.0501  0.1931  99  LEU A CD2   
809  N N     . ASN A 100 ? 1.5584 1.6254 0.8157 -0.1993 0.1951  0.2023  100 ASN A N     
810  C CA    . ASN A 100 ? 1.6203 1.6543 0.8808 -0.1923 0.2484  0.2125  100 ASN A CA    
811  C C     . ASN A 100 ? 1.5896 1.7075 0.9519 -0.1733 0.2602  0.2218  100 ASN A C     
812  O O     . ASN A 100 ? 1.6214 1.7665 1.0156 -0.1639 0.2539  0.2254  100 ASN A O     
813  C CB    . ASN A 100 ? 1.8125 1.7757 1.0083 -0.1967 0.2574  0.2126  100 ASN A CB    
814  C CG    . ASN A 100 ? 1.8929 1.7923 1.0582 -0.1964 0.3145  0.2203  100 ASN A CG    
815  O OD1   . ASN A 100 ? 1.8986 1.8148 1.1051 -0.1843 0.3421  0.2289  100 ASN A OD1   
816  N ND2   . ASN A 100 ? 1.9460 1.7717 1.0387 -0.2097 0.3327  0.2168  100 ASN A ND2   
817  N N     . LEU A 101 ? 1.5023 1.6607 0.9150 -0.1678 0.2772  0.2255  101 LEU A N     
818  C CA    . LEU A 101 ? 1.3282 1.5708 0.8407 -0.1498 0.2875  0.2339  101 LEU A CA    
819  C C     . LEU A 101 ? 1.4275 1.6648 0.9622 -0.1382 0.3195  0.2429  101 LEU A C     
820  O O     . LEU A 101 ? 1.3831 1.6806 0.9763 -0.1269 0.3019  0.2456  101 LEU A O     
821  C CB    . LEU A 101 ? 1.3395 1.6016 0.8846 -0.1468 0.3142  0.2375  101 LEU A CB    
822  C CG    . LEU A 101 ? 1.2217 1.5839 0.8723 -0.1306 0.3107  0.2431  101 LEU A CG    
823  C CD1   . LEU A 101 ? 1.1512 1.5876 0.8480 -0.1273 0.2566  0.2380  101 LEU A CD1   
824  C CD2   . LEU A 101 ? 1.1486 1.5180 0.8101 -0.1328 0.3268  0.2434  101 LEU A CD2   
825  N N     . PRO A 102 ? 1.5834 1.7483 1.0706 -0.1413 0.3663  0.2474  102 PRO A N     
826  C CA    . PRO A 102 ? 1.5807 1.7382 1.0878 -0.1307 0.4004  0.2559  102 PRO A CA    
827  C C     . PRO A 102 ? 1.6302 1.7996 1.1384 -0.1285 0.3716  0.2543  102 PRO A C     
828  O O     . PRO A 102 ? 1.6142 1.8258 1.1796 -0.1152 0.3823  0.2610  102 PRO A O     
829  C CB    . PRO A 102 ? 1.6129 1.6695 1.0360 -0.1412 0.4410  0.2567  102 PRO A CB    
830  C CG    . PRO A 102 ? 1.6688 1.7020 1.0605 -0.1511 0.4428  0.2524  102 PRO A CG    
831  C CD    . PRO A 102 ? 1.6942 1.7764 1.1012 -0.1556 0.3883  0.2441  102 PRO A CD    
832  N N     . GLU A 103 ? 1.6819 1.8137 1.1263 -0.1414 0.3356  0.2453  103 GLU A N     
833  C CA    . GLU A 103 ? 1.7254 1.8608 1.1613 -0.1405 0.3066  0.2430  103 GLU A CA    
834  C C     . GLU A 103 ? 1.6828 1.9163 1.1995 -0.1298 0.2650  0.2421  103 GLU A C     
835  O O     . GLU A 103 ? 1.7395 2.0028 1.2883 -0.1212 0.2553  0.2449  103 GLU A O     
836  C CB    . GLU A 103 ? 1.8782 1.9425 1.2189 -0.1576 0.2799  0.2331  103 GLU A CB    
837  C CG    . GLU A 103 ? 1.9773 2.0572 1.3121 -0.1574 0.2367  0.2284  103 GLU A CG    
838  C CD    . GLU A 103 ? 2.1667 2.1793 1.4084 -0.1740 0.2081  0.2180  103 GLU A CD    
839  O OE1   . GLU A 103 ? 2.2058 2.2337 1.4399 -0.1748 0.1665  0.2125  103 GLU A OE1   
840  O OE2   . GLU A 103 ? 2.2517 2.1964 1.4278 -0.1860 0.2272  0.2152  103 GLU A OE2   
841  N N     . TYR A 104 ? 1.1794 1.4491 2.4107 0.1403  0.2359  0.2791  104 TYR A N     
842  C CA    . TYR A 104 ? 1.0962 1.3076 2.3101 0.0828  0.2816  0.2919  104 TYR A CA    
843  C C     . TYR A 104 ? 1.0403 1.1842 2.2222 0.0243  0.2475  0.2557  104 TYR A C     
844  O O     . TYR A 104 ? 1.0380 1.1453 2.2274 -0.0212 0.3022  0.2587  104 TYR A O     
845  C CB    . TYR A 104 ? 1.1349 1.3225 2.3035 0.0761  0.2660  0.3208  104 TYR A CB    
846  C CG    . TYR A 104 ? 1.1381 1.3797 2.3409 0.1164  0.3299  0.3648  104 TYR A CG    
847  C CD1   . TYR A 104 ? 1.1312 1.4058 2.3159 0.1591  0.2902  0.3816  104 TYR A CD1   
848  C CD2   . TYR A 104 ? 1.1423 1.4019 2.3952 0.1112  0.4303  0.3896  104 TYR A CD2   
849  C CE1   . TYR A 104 ? 1.0592 1.3842 2.2745 0.1958  0.3486  0.4220  104 TYR A CE1   
850  C CE2   . TYR A 104 ? 1.1118 1.4209 2.3956 0.1479  0.4891  0.4305  104 TYR A CE2   
851  C CZ    . TYR A 104 ? 1.0589 1.4009 2.3235 0.1902  0.4478  0.4465  104 TYR A CZ    
852  O OH    . TYR A 104 ? 1.0465 1.4391 2.3418 0.2269  0.5069  0.4872  104 TYR A OH    
853  N N     . MET A 105 ? 0.9886 1.1163 2.1349 0.0256  0.1575  0.2217  105 MET A N     
854  C CA    . MET A 105 ? 0.9888 1.0538 2.1009 -0.0274 0.1169  0.1861  105 MET A CA    
855  C C     . MET A 105 ? 1.0071 1.0686 2.1638 -0.0546 0.1832  0.1730  105 MET A C     
856  O O     . MET A 105 ? 0.9914 1.1081 2.2079 -0.0216 0.2352  0.1768  105 MET A O     
857  C CB    . MET A 105 ? 1.0291 1.0955 2.1131 -0.0095 0.0190  0.1502  105 MET A CB    
858  C CG    . MET A 105 ? 1.1426 1.1537 2.1987 -0.0579 -0.0230 0.1101  105 MET A CG    
859  S SD    . MET A 105 ? 1.1744 1.0955 2.1475 -0.1180 -0.0830 0.1046  105 MET A SD    
860  C CE    . MET A 105 ? 1.0603 1.0007 1.9963 -0.0744 -0.1490 0.1230  105 MET A CE    
861  N N     . TRP A 106 ? 1.0876 1.0840 2.2148 -0.1152 0.1807  0.1572  106 TRP A N     
862  C CA    . TRP A 106 ? 1.1372 1.1235 2.3023 -0.1477 0.2435  0.1443  106 TRP A CA    
863  C C     . TRP A 106 ? 1.2078 1.1612 2.3530 -0.1767 0.1873  0.0978  106 TRP A C     
864  O O     . TRP A 106 ? 1.1982 1.1094 2.2858 -0.1958 0.1064  0.0788  106 TRP A O     
865  C CB    . TRP A 106 ? 1.1501 1.0905 2.3057 -0.1973 0.3048  0.1672  106 TRP A CB    
866  C CG    . TRP A 106 ? 1.2290 1.1462 2.4121 -0.2405 0.3580  0.1496  106 TRP A CG    
867  C CD1   . TRP A 106 ? 1.2350 1.1924 2.4851 -0.2282 0.4370  0.1529  106 TRP A CD1   
868  C CD2   . TRP A 106 ? 1.3228 1.1716 2.4680 -0.3035 0.3370  0.1255  106 TRP A CD2   
869  N NE1   . TRP A 106 ? 1.2900 1.2084 2.5466 -0.2799 0.4666  0.1318  106 TRP A NE1   
870  C CE2   . TRP A 106 ? 1.3572 1.2093 2.5499 -0.3266 0.4062  0.1147  106 TRP A CE2   
871  C CE3   . TRP A 106 ? 1.4112 1.1969 2.4872 -0.3423 0.2668  0.1122  106 TRP A CE3   
872  C CZ2   . TRP A 106 ? 1.4390 1.2346 2.6120 -0.3869 0.4067  0.0906  106 TRP A CZ2   
873  C CZ3   . TRP A 106 ? 1.4368 1.1663 2.4930 -0.4018 0.2674  0.0889  106 TRP A CZ3   
874  C CH2   . TRP A 106 ? 1.4667 1.2020 2.5710 -0.4235 0.3367  0.0782  106 TRP A CH2   
875  N N     . LYS A 107 ? 1.2516 1.2250 2.4457 -0.1801 0.2313  0.0797  107 LYS A N     
876  C CA    . LYS A 107 ? 1.3574 1.3013 2.5379 -0.2100 0.1877  0.0356  107 LYS A CA    
877  C C     . LYS A 107 ? 1.3354 1.2800 2.5650 -0.2376 0.2642  0.0252  107 LYS A C     
878  O O     . LYS A 107 ? 1.1632 1.1603 2.4547 -0.2070 0.3314  0.0380  107 LYS A O     
879  C CB    . LYS A 107 ? 1.4379 1.4200 2.6210 -0.1654 0.1181  0.0093  107 LYS A CB    
880  C CG    . LYS A 107 ? 1.4420 1.5001 2.6717 -0.0982 0.1423  0.0304  107 LYS A CG    
881  C CD    . LYS A 107 ? 1.4860 1.5537 2.6754 -0.0639 0.0745  0.0436  107 LYS A CD    
882  C CE    . LYS A 107 ? 1.4625 1.6037 2.6885 0.0039  0.0606  0.0446  107 LYS A CE    
883  N NZ    . LYS A 107 ? 1.4562 1.6020 2.6377 0.0336  -0.0234 0.0458  107 LYS A NZ    
884  N N     . PRO A 108 ? 1.4486 1.3346 2.6505 -0.2962 0.2543  0.0020  108 PRO A N     
885  C CA    . PRO A 108 ? 1.4764 1.3559 2.7191 -0.3293 0.3183  -0.0140 108 PRO A CA    
886  C C     . PRO A 108 ? 1.4437 1.3695 2.7321 -0.2997 0.3150  -0.0434 108 PRO A C     
887  O O     . PRO A 108 ? 1.4127 1.3260 2.6767 -0.3045 0.2447  -0.0798 108 PRO A O     
888  C CB    . PRO A 108 ? 1.5300 1.3356 2.7180 -0.3934 0.2778  -0.0381 108 PRO A CB    
889  C CG    . PRO A 108 ? 1.5099 1.2903 2.6313 -0.3859 0.1776  -0.0441 108 PRO A CG    
890  C CD    . PRO A 108 ? 1.4485 1.2692 2.5766 -0.3357 0.1831  -0.0080 108 PRO A CD    
891  O "O5'" . DG  B 1   ? 1.7852 1.1558 1.5171 0.7564  0.7422  0.3439  1   DG  B "O5'" 
892  C "C5'" . DG  B 1   ? 1.9629 1.1988 1.7284 0.7628  0.8539  0.3212  1   DG  B "C5'" 
893  C "C4'" . DG  B 1   ? 2.1167 1.3244 1.8688 0.6774  0.8522  0.3223  1   DG  B "C4'" 
894  O "O4'" . DG  B 1   ? 2.0272 1.3652 1.8641 0.7389  0.7740  0.4026  1   DG  B "O4'" 
895  C "C3'" . DG  B 1   ? 2.2041 1.4026 1.8307 0.5276  0.8063  0.2732  1   DG  B "C3'" 
896  O "O3'" . DG  B 1   ? 2.3052 1.3496 1.8482 0.4373  0.8962  0.1931  1   DG  B "O3'" 
897  C "C2'" . DG  B 1   ? 2.2352 1.4843 1.8961 0.4958  0.7610  0.3157  1   DG  B "C2'" 
898  C "C1'" . DG  B 1   ? 2.0473 1.4253 1.8293 0.6328  0.7088  0.4013  1   DG  B "C1'" 
899  N N9    . DG  B 1   ? 1.9179 1.4456 1.6846 0.6388  0.5899  0.4352  1   DG  B N9    
900  C C8    . DG  B 1   ? 1.8427 1.4550 1.6263 0.7178  0.5455  0.4561  1   DG  B C8    
901  N N7    . DG  B 1   ? 1.7162 1.4594 1.4788 0.6992  0.4340  0.4851  1   DG  B N7    
902  C C5    . DG  B 1   ? 1.6940 1.4379 1.4247 0.6017  0.4034  0.4826  1   DG  B C5    
903  C C6    . DG  B 1   ? 1.5726 1.4278 1.2730 0.5405  0.2937  0.5058  1   DG  B C6    
904  O O6    . DG  B 1   ? 1.4698 1.4496 1.1648 0.5612  0.1985  0.5343  1   DG  B O6    
905  N N1    . DG  B 1   ? 1.6309 1.4422 1.3067 0.4463  0.2999  0.4934  1   DG  B N1    
906  C C2    . DG  B 1   ? 1.8471 1.5233 1.5264 0.4154  0.4004  0.4625  1   DG  B C2    
907  N N2    . DG  B 1   ? 1.9794 1.6335 1.6326 0.3221  0.3891  0.4550  1   DG  B N2    
908  N N3    . DG  B 1   ? 1.9169 1.4873 1.6244 0.4721  0.5042  0.4405  1   DG  B N3    
909  C C4    . DG  B 1   ? 1.8504 1.4627 1.5828 0.5636  0.4984  0.4522  1   DG  B C4    
910  P P     . DC  B 2   ? 2.5124 1.5249 1.9128 0.3198  0.8744  0.1218  2   DC  B P     
911  O OP1   . DC  B 2   ? 2.5148 1.4416 1.8975 0.3551  0.9524  0.0753  2   DC  B OP1   
912  O OP2   . DC  B 2   ? 2.4294 1.5894 1.8026 0.3021  0.7472  0.1557  2   DC  B OP2   
913  O "O5'" . DC  B 2   ? 2.6113 1.5131 1.9307 0.1792  0.9145  0.0687  2   DC  B "O5'" 
914  C "C5'" . DC  B 2   ? 2.5435 1.4169 1.9183 0.1720  0.9407  0.0944  2   DC  B "C5'" 
915  C "C4'" . DC  B 2   ? 2.4601 1.3942 1.7835 0.0699  0.8562  0.1037  2   DC  B "C4'" 
916  O "O4'" . DC  B 2   ? 2.1654 1.2633 1.5596 0.1449  0.7536  0.1797  2   DC  B "O4'" 
917  C "C3'" . DC  B 2   ? 2.6536 1.5765 1.8381 -0.0591 0.8112  0.0458  2   DC  B "C3'" 
918  O "O3'" . DC  B 2   ? 2.9823 1.7630 2.0813 -0.1785 0.8814  -0.0228 2   DC  B "O3'" 
919  C "C2'" . DC  B 2   ? 2.4662 1.5310 1.6507 -0.0882 0.6863  0.0940  2   DC  B "C2'" 
920  C "C1'" . DC  B 2   ? 2.2038 1.3795 1.5260 0.0508  0.6543  0.1789  2   DC  B "C1'" 
921  N N1    . DC  B 2   ? 2.0488 1.3728 1.3899 0.1138  0.5546  0.2220  2   DC  B N1    
922  C C2    . DC  B 2   ? 2.0097 1.4479 1.3182 0.0574  0.4405  0.2463  2   DC  B C2    
923  O O2    . DC  B 2   ? 2.1541 1.5664 1.4187 -0.0435 0.4254  0.2308  2   DC  B O2    
924  N N3    . DC  B 2   ? 1.8660 1.4399 1.1920 0.1135  0.3486  0.2857  2   DC  B N3    
925  C C4    . DC  B 2   ? 1.8447 1.4421 1.2185 0.2224  0.3681  0.3014  2   DC  B C4    
926  N N4    . DC  B 2   ? 1.7132 1.4468 1.1024 0.2742  0.2744  0.3406  2   DC  B N4    
927  C C5    . DC  B 2   ? 1.9118 1.3945 1.3209 0.2824  0.4836  0.2777  2   DC  B C5    
928  C C6    . DC  B 2   ? 2.0047 1.3537 1.3963 0.2254  0.5734  0.2384  2   DC  B C6    
929  P P     . DC  B 3   ? 2.7662 1.5357 1.7263 -0.3369 0.8250  -0.0727 3   DC  B P     
930  O OP1   . DC  B 3   ? 2.8704 1.4771 1.7601 -0.4358 0.9199  -0.1422 3   DC  B OP1   
931  O OP2   . DC  B 3   ? 2.6323 1.4695 1.5302 -0.3404 0.7609  -0.0854 3   DC  B OP2   
932  O "O5'" . DC  B 3   ? 2.8267 1.7097 1.8252 -0.3569 0.7293  -0.0138 3   DC  B "O5'" 
933  C "C5'" . DC  B 3   ? 2.8704 1.7521 1.7784 -0.4915 0.6755  -0.0389 3   DC  B "C5'" 
934  C "C4'" . DC  B 3   ? 2.7175 1.7313 1.5784 -0.5199 0.5499  -0.0202 3   DC  B "C4'" 
935  O "O4'" . DC  B 3   ? 2.4559 1.5957 1.4055 -0.3889 0.4997  0.0410  3   DC  B "O4'" 
936  C "C3'" . DC  B 3   ? 2.7912 1.7574 1.5149 -0.6164 0.5395  -0.0887 3   DC  B "C3'" 
937  O "O3'" . DC  B 3   ? 2.6618 1.6859 1.3064 -0.7236 0.4431  -0.0941 3   DC  B "O3'" 
938  C "C2'" . DC  B 3   ? 2.6413 1.6907 1.3956 -0.5154 0.5078  -0.0655 3   DC  B "C2'" 
939  C "C1'" . DC  B 3   ? 2.4719 1.6700 1.3384 -0.4280 0.4269  0.0214  3   DC  B "C1'" 
940  N N1    . DC  B 3   ? 2.3465 1.6527 1.2786 -0.3049 0.3859  0.0668  3   DC  B N1    
941  C C2    . DC  B 3   ? 2.2351 1.6962 1.1794 -0.2896 0.2631  0.1153  3   DC  B C2    
942  O O2    . DC  B 3   ? 2.2758 1.7788 1.1793 -0.3774 0.1931  0.1194  3   DC  B O2    
943  N N3    . DC  B 3   ? 2.0747 1.6354 1.0763 -0.1791 0.2238  0.1564  3   DC  B N3    
944  C C4    . DC  B 3   ? 2.0873 1.5968 1.1325 -0.0874 0.3019  0.1499  3   DC  B C4    
945  N N4    . DC  B 3   ? 1.9927 1.6047 1.0942 0.0204  0.2585  0.1920  3   DC  B N4    
946  C C5    . DC  B 3   ? 2.1831 1.5345 1.2176 -0.1016 0.4273  0.1001  3   DC  B C5    
947  C C6    . DC  B 3   ? 2.3172 1.5716 1.2945 -0.2113 0.4654  0.0598  3   DC  B C6    
948  P P     . DA  B 4   ? 3.0088 1.9435 1.4923 -0.8712 0.4451  -0.1762 4   DA  B P     
949  O OP1   . DA  B 4   ? 2.9782 1.8079 1.4172 -0.9780 0.4903  -0.2114 4   DA  B OP1   
950  O OP2   . DA  B 4   ? 2.8478 1.7194 1.2918 -0.8402 0.5051  -0.2198 4   DA  B OP2   
951  O "O5'" . DA  B 4   ? 2.8103 1.8838 1.2463 -0.9136 0.3043  -0.1520 4   DA  B "O5'" 
952  C "C5'" . DA  B 4   ? 2.7310 1.9173 1.2277 -0.9085 0.2180  -0.0917 4   DA  B "C5'" 
953  C "C4'" . DA  B 4   ? 2.5959 1.9273 1.0676 -0.9174 0.0862  -0.0615 4   DA  B "C4'" 
954  O "O4'" . DA  B 4   ? 2.4179 1.8587 0.9784 -0.7806 0.0553  -0.0079 4   DA  B "O4'" 
955  C "C3'" . DA  B 4   ? 2.5901 1.8924 0.9208 -1.0203 0.0516  -0.1205 4   DA  B "C3'" 
956  O "O3'" . DA  B 4   ? 3.0163 2.4448 1.3277 -1.0612 -0.0767 -0.0885 4   DA  B "O3'" 
957  C "C2'" . DA  B 4   ? 2.5188 1.8299 0.8661 -0.9244 0.0825  -0.1238 4   DA  B "C2'" 
958  C "C1'" . DA  B 4   ? 2.3498 1.8052 0.8348 -0.7891 0.0283  -0.0379 4   DA  B "C1'" 
959  N N9    . DA  B 4   ? 2.3041 1.7679 0.8696 -0.6537 0.0819  -0.0166 4   DA  B N9    
960  C C8    . DA  B 4   ? 2.3880 1.7340 0.9831 -0.6085 0.2030  -0.0430 4   DA  B C8    
961  N N7    . DA  B 4   ? 2.2987 1.6828 0.9701 -0.4825 0.2253  -0.0141 4   DA  B N7    
962  C C5    . DA  B 4   ? 2.1660 1.7057 0.8616 -0.4391 0.1115  0.0364  4   DA  B C5    
963  C C6    . DA  B 4   ? 1.9553 1.6050 0.7260 -0.3135 0.0719  0.0863  4   DA  B C6    
964  N N6    . DA  B 4   ? 1.8396 1.4577 0.6789 -0.2027 0.1457  0.0942  4   DA  B N6    
965  N N1    . DA  B 4   ? 1.8071 1.6025 0.5811 -0.3051 -0.0484 0.1284  4   DA  B N1    
966  C C2    . DA  B 4   ? 1.8819 1.7102 0.5903 -0.4144 -0.1242 0.1213  4   DA  B C2    
967  N N3    . DA  B 4   ? 2.1043 1.8394 0.7400 -0.5365 -0.0985 0.0772  4   DA  B N3    
968  C C4    . DA  B 4   ? 2.1845 1.7752 0.8162 -0.5435 0.0222  0.0354  4   DA  B C4    
969  P P     . DT  B 5   ? 1.7238 2.2549 1.3829 -0.8737 -0.1326 0.1307  5   DT  B P     
970  O OP1   . DT  B 5   ? 1.6533 2.2828 1.3348 -0.9211 -0.1466 0.1629  5   DT  B OP1   
971  O OP2   . DT  B 5   ? 1.7604 2.1536 1.3386 -0.8635 -0.1527 0.1240  5   DT  B OP2   
972  O "O5'" . DT  B 5   ? 1.5250 2.1200 1.2874 -0.8046 -0.0893 0.1072  5   DT  B "O5'" 
973  C "C5'" . DT  B 5   ? 1.4299 2.1306 1.2660 -0.7940 -0.0617 0.1003  5   DT  B "C5'" 
974  C "C4'" . DT  B 5   ? 1.2938 2.0090 1.2023 -0.7256 -0.0269 0.0725  5   DT  B "C4'" 
975  O "O4'" . DT  B 5   ? 1.1809 1.8077 1.0538 -0.7051 -0.0231 0.0501  5   DT  B "O4'" 
976  C "C3'" . DT  B 5   ? 1.3785 2.0704 1.3167 -0.6831 -0.0208 0.0680  5   DT  B "C3'" 
977  O "O3'" . DT  B 5   ? 1.3965 2.1956 1.4335 -0.6500 0.0058  0.0641  5   DT  B "O3'" 
978  C "C2'" . DT  B 5   ? 1.3336 1.9199 1.2460 -0.6417 -0.0138 0.0437  5   DT  B "C2'" 
979  C "C1'" . DT  B 5   ? 1.1529 1.7581 1.0736 -0.6440 -0.0019 0.0303  5   DT  B "C1'" 
980  N N1    . DT  B 5   ? 1.2093 1.7095 1.0825 -0.6283 -0.0049 0.0132  5   DT  B N1    
981  C C2    . DT  B 5   ? 1.2294 1.7360 1.1470 -0.5896 0.0174  -0.0082 5   DT  B C2    
982  O O2    . DT  B 5   ? 1.2214 1.8125 1.2137 -0.5649 0.0406  -0.0162 5   DT  B O2    
983  N N3    . DT  B 5   ? 1.2230 1.6291 1.0926 -0.5802 0.0103  -0.0196 5   DT  B N3    
984  C C4    . DT  B 5   ? 1.2561 1.5582 1.0398 -0.6021 -0.0149 -0.0134 5   DT  B C4    
985  O O4    . DT  B 5   ? 1.2253 1.4428 0.9739 -0.5894 -0.0195 -0.0237 5   DT  B O4    
986  C C5    . DT  B 5   ? 1.3590 1.6556 1.0953 -0.6409 -0.0372 0.0068  5   DT  B C5    
987  C C7    . DT  B 5   ? 1.4518 1.6307 1.0877 -0.6652 -0.0669 0.0131  5   DT  B C7    
988  C C6    . DT  B 5   ? 1.3074 1.7024 1.0900 -0.6538 -0.0322 0.0199  5   DT  B C6    
989  P P     . DG  B 6   ? 1.4217 2.2578 1.5083 -0.6284 0.0074  0.0745  6   DG  B P     
990  O OP1   . DG  B 6   ? 1.3833 2.3515 1.5379 -0.6436 0.0151  0.0913  6   DG  B OP1   
991  O OP2   . DG  B 6   ? 1.3109 2.0475 1.3190 -0.6464 -0.0197 0.0851  6   DG  B OP2   
992  O "O5'" . DG  B 6   ? 1.0084 1.8329 1.1562 -0.5597 0.0348  0.0487  6   DG  B "O5'" 
993  C "C5'" . DG  B 6   ? 1.0049 1.8515 1.1885 -0.5338 0.0569  0.0274  6   DG  B "C5'" 
994  C "C4'" . DG  B 6   ? 1.0171 1.7939 1.2146 -0.4808 0.0683  0.0073  6   DG  B "C4'" 
995  O "O4'" . DG  B 6   ? 1.1368 1.8090 1.2629 -0.4870 0.0589  -0.0023 6   DG  B "O4'" 
996  C "C3'" . DG  B 6   ? 0.9525 1.6975 1.1519 -0.4636 0.0615  0.0161  6   DG  B "C3'" 
997  O "O3'" . DG  B 6   ? 0.8212 1.5719 1.0856 -0.4080 0.0811  0.0014  6   DG  B "O3'" 
998  C "C2'" . DG  B 6   ? 1.0466 1.6718 1.1493 -0.4819 0.0417  0.0177  6   DG  B "C2'" 
999  C "C1'" . DG  B 6   ? 1.0344 1.6232 1.1328 -0.4648 0.0526  -0.0026 6   DG  B "C1'" 
1000 N N9    . DG  B 6   ? 1.0160 1.5021 1.0259 -0.4863 0.0355  -0.0041 6   DG  B N9    
1001 C C8    . DG  B 6   ? 1.0976 1.5226 1.0221 -0.5274 0.0092  0.0099  6   DG  B C8    
1002 N N7    . DG  B 6   ? 1.1631 1.4962 1.0217 -0.5344 -0.0012 0.0028  6   DG  B N7    
1003 C C5    . DG  B 6   ? 1.0646 1.4022 0.9704 -0.4971 0.0192  -0.0156 6   DG  B C5    
1004 C C6    . DG  B 6   ? 1.0306 1.2940 0.9057 -0.4861 0.0185  -0.0283 6   DG  B C6    
1005 O O6    . DG  B 6   ? 1.0929 1.2682 0.8907 -0.5059 0.0000  -0.0269 6   DG  B O6    
1006 N N1    . DG  B 6   ? 0.9850 1.2821 0.9291 -0.4476 0.0404  -0.0435 6   DG  B N1    
1007 C C2    . DG  B 6   ? 0.9628 1.3505 0.9922 -0.4215 0.0604  -0.0475 6   DG  B C2    
1008 N N2    . DG  B 6   ? 0.8981 1.2977 0.9791 -0.3867 0.0768  -0.0630 6   DG  B N2    
1009 N N3    . DG  B 6   ? 0.9356 1.3943 0.9963 -0.4292 0.0623  -0.0365 6   DG  B N3    
1010 C C4    . DG  B 6   ? 0.9816 1.4109 0.9781 -0.4679 0.0412  -0.0203 6   DG  B C4    
1011 P P     . BZG B 7   ? 0.9137 1.7430 1.2593 -0.3819 0.0897  0.0090  7   BZG B P     
1012 O O1P   . BZG B 7   ? 1.2103 2.0923 1.6395 -0.3355 0.1136  -0.0099 7   BZG B O1P   
1013 O O2P   . BZG B 7   ? 0.7982 1.7109 1.1519 -0.4239 0.0792  0.0309  7   BZG B O2P   
1014 O "O5'" . BZG B 7   ? 0.9508 1.7051 1.2711 -0.3631 0.0823  0.0140  7   BZG B "O5'" 
1015 C CZ1   . BZG B 7   ? 0.6374 1.9459 1.6731 -0.0363 0.1956  -0.0621 7   BZG B CZ1   
1016 C CT1   . BZG B 7   ? 0.6324 2.0350 1.7090 -0.0343 0.2080  -0.0653 7   BZG B CT1   
1017 C CI    . BZG B 7   ? 0.6414 2.0865 1.6822 -0.0751 0.2127  -0.0584 7   BZG B CI    
1018 C CT2   . BZG B 7   ? 0.6223 2.0099 1.5837 -0.1188 0.2024  -0.0494 7   BZG B CT2   
1019 C CZ2   . BZG B 7   ? 0.6203 1.9090 1.5389 -0.1182 0.1900  -0.0485 7   BZG B CZ2   
1020 C CE    . BZG B 7   ? 0.6325 1.8851 1.5893 -0.0768 0.1880  -0.0542 7   BZG B CE    
1021 C CW    . BZG B 7   ? 0.6021 1.7546 1.5138 -0.0757 0.1774  -0.0510 7   BZG B CW    
1022 O OL    . BZG B 7   ? 0.5142 1.6184 1.3476 -0.1169 0.1686  -0.0413 7   BZG B OL    
1023 C CK    . BZG B 7   ? 0.3711 1.3886 1.1543 -0.1211 0.1594  -0.0352 7   BZG B CK    
1024 N NJ    . BZG B 7   ? 0.3019 1.2768 1.1100 -0.0860 0.1591  -0.0361 7   BZG B NJ    
1025 C CH    . BZG B 7   ? 0.2784 1.1739 1.0345 -0.0906 0.1526  -0.0291 7   BZG B CH    
1026 N NI    . BZG B 7   ? 0.3369 1.1915 1.1201 -0.0544 0.1537  -0.0274 7   BZG B NI    
1027 N NG    . BZG B 7   ? 0.4785 1.3295 1.1551 -0.1283 0.1449  -0.0230 7   BZG B NG    
1028 C CF    . BZG B 7   ? 0.3493 1.2346 0.9950 -0.1670 0.1414  -0.0214 7   BZG B CF    
1029 C CM    . BZG B 7   ? 0.3778 1.3508 1.0786 -0.1644 0.1494  -0.0265 7   BZG B CM    
1030 N NN    . BZG B 7   ? 0.3877 1.3882 1.0474 -0.2084 0.1447  -0.0206 7   BZG B NN    
1031 C CO    . BZG B 7   ? 0.4641 1.3876 1.0412 -0.2383 0.1314  -0.0128 7   BZG B CO    
1032 N NE    . BZG B 7   ? 0.5319 1.3849 1.0995 -0.2116 0.1305  -0.0143 7   BZG B NE    
1033 C "CT'" . BZG B 7   ? 0.6460 1.4051 1.1341 -0.2262 0.1196  -0.0082 7   BZG B "CT'" 
1034 O "OS'" . BZG B 7   ? 0.6708 1.4306 1.0995 -0.2748 0.1042  0.0051  7   BZG B "OS'" 
1035 C "CP'" . BZG B 7   ? 0.7313 1.4186 1.1808 -0.2189 0.1233  -0.0226 7   BZG B "CP'" 
1036 C "C5'" . BZG B 7   ? 0.8353 1.5077 1.1385 -0.3303 0.0886  0.0007  7   BZG B "C5'" 
1037 C "C4'" . BZG B 7   ? 0.7300 1.3918 1.0711 -0.2915 0.0953  0.0022  7   BZG B "C4'" 
1038 C "C3'" . BZG B 7   ? 0.7716 1.3852 1.1295 -0.2512 0.1083  -0.0137 7   BZG B "C3'" 
1039 O "O3'" . BZG B 7   ? 0.6752 1.2275 1.0156 -0.2283 0.1083  -0.0090 7   BZG B "O3'" 
1040 P P     . DC  B 8   ? 0.9960 1.4453 1.2341 -0.2477 0.0957  -0.0039 8   DC  B P     
1041 O OP1   . DC  B 8   ? 1.0249 1.4372 1.2590 -0.2214 0.0987  0.0043  8   DC  B OP1   
1042 O OP2   . DC  B 8   ? 0.9057 1.3613 1.0853 -0.3006 0.0774  0.0044  8   DC  B OP2   
1043 O "O5'" . DC  B 8   ? 0.6147 1.0021 0.8336 -0.2319 0.1021  -0.0187 8   DC  B "O5'" 
1044 C "C5'" . DC  B 8   ? 0.6257 1.0362 0.9153 -0.1940 0.1174  -0.0298 8   DC  B "C5'" 
1045 C "C4'" . DC  B 8   ? 0.7241 1.0504 0.9875 -0.1684 0.1217  -0.0338 8   DC  B "C4'" 
1046 O "O4'" . DC  B 8   ? 0.7875 1.0486 0.9670 -0.1991 0.1095  -0.0362 8   DC  B "O4'" 
1047 C "C3'" . DC  B 8   ? 0.7605 1.0441 1.0095 -0.1448 0.1253  -0.0232 8   DC  B "C3'" 
1048 O "O3'" . DC  B 8   ? 0.7554 1.0119 1.0418 -0.1026 0.1377  -0.0247 8   DC  B "O3'" 
1049 C "C2'" . DC  B 8   ? 0.7587 0.9621 0.9052 -0.1718 0.1127  -0.0199 8   DC  B "C2'" 
1050 C "C1'" . DC  B 8   ? 0.7302 0.9080 0.8542 -0.1866 0.1081  -0.0310 8   DC  B "C1'" 
1051 N N1    . DC  B 8   ? 0.8296 0.9529 0.8610 -0.2274 0.0901  -0.0295 8   DC  B N1    
1052 C C2    . DC  B 8   ? 1.0611 1.0983 1.0345 -0.2259 0.0853  -0.0347 8   DC  B C2    
1053 O O2    . DC  B 8   ? 1.1066 1.1200 1.1126 -0.1895 0.0975  -0.0392 8   DC  B O2    
1054 N N3    . DC  B 8   ? 1.1215 1.1041 1.0057 -0.2654 0.0654  -0.0329 8   DC  B N3    
1055 C C4    . DC  B 8   ? 1.0861 1.0997 0.9408 -0.3064 0.0504  -0.0249 8   DC  B C4    
1056 N N4    . DC  B 8   ? 0.9719 0.9270 0.7368 -0.3471 0.0277  -0.0216 8   DC  B N4    
1057 C C5    . DC  B 8   ? 0.9533 1.0594 0.8710 -0.3080 0.0562  -0.0181 8   DC  B C5    
1058 C C6    . DC  B 8   ? 0.8022 0.9592 0.8066 -0.2670 0.0764  -0.0215 8   DC  B C6    
1059 P P     . DT  B 9   ? 0.6609 0.8756 0.9385 -0.0718 0.1459  -0.0127 9   DT  B P     
1060 O OP1   . DT  B 9   ? 0.5694 0.8070 0.9279 -0.0300 0.1585  -0.0108 9   DT  B OP1   
1061 O OP2   . DT  B 9   ? 0.6718 0.9004 0.9181 -0.0916 0.1389  -0.0029 9   DT  B OP2   
1062 O "O5'" . DT  B 9   ? 0.8116 0.9285 1.0050 -0.0739 0.1437  -0.0143 9   DT  B "O5'" 
1063 C "C5'" . DT  B 9   ? 0.9441 1.0278 1.1489 -0.0576 0.1476  -0.0209 9   DT  B "C5'" 
1064 C "C4'" . DT  B 9   ? 1.0551 1.0458 1.1863 -0.0485 0.1486  -0.0183 9   DT  B "C4'" 
1065 O "O4'" . DT  B 9   ? 1.1371 1.0807 1.1805 -0.0885 0.1317  -0.0244 9   DT  B "O4'" 
1066 C "C3'" . DT  B 9   ? 1.1048 1.0714 1.2095 -0.0303 0.1568  -0.0073 9   DT  B "C3'" 
1067 O "O3'" . DT  B 9   ? 1.2675 1.1585 1.3318 -0.0041 0.1654  -0.0044 9   DT  B "O3'" 
1068 C "C2'" . DT  B 9   ? 1.0244 0.9746 1.0513 -0.0731 0.1400  -0.0089 9   DT  B "C2'" 
1069 C "C1'" . DT  B 9   ? 1.0059 0.8972 0.9775 -0.0913 0.1294  -0.0183 9   DT  B "C1'" 
1070 N N1    . DT  B 9   ? 1.0861 0.9553 0.9791 -0.1391 0.1083  -0.0201 9   DT  B N1    
1071 C C2    . DT  B 9   ? 1.2650 1.0514 1.0729 -0.1570 0.0949  -0.0251 9   DT  B C2    
1072 O O2    . DT  B 9   ? 1.4207 1.1522 1.2175 -0.1335 0.1007  -0.0290 9   DT  B O2    
1073 N N3    . DT  B 9   ? 1.2115 0.9823 0.9491 -0.2047 0.0724  -0.0238 9   DT  B N3    
1074 C C4    . DT  B 9   ? 1.1634 0.9966 0.9119 -0.2345 0.0634  -0.0166 9   DT  B C4    
1075 O O4    . DT  B 9   ? 1.2184 1.0357 0.9034 -0.2790 0.0412  -0.0125 9   DT  B O4    
1076 C C5    . DT  B 9   ? 1.1128 1.0322 0.9542 -0.2110 0.0798  -0.0121 9   DT  B C5    
1077 C C7    . DT  B 9   ? 0.9031 0.8956 0.7663 -0.2392 0.0710  -0.0027 9   DT  B C7    
1078 C C6    . DT  B 9   ? 1.0452 0.9764 0.9522 -0.1649 0.1009  -0.0145 9   DT  B C6    
1079 P P     . DA  B 10  ? 0.9910 1.5149 1.6486 0.2245  0.3561  -0.2795 10  DA  B P     
1080 O OP1   . DA  B 10  ? 0.8968 1.4840 1.6699 0.2464  0.3406  -0.2877 10  DA  B OP1   
1081 O OP2   . DA  B 10  ? 0.8949 1.4652 1.5589 0.2233  0.4248  -0.2659 10  DA  B OP2   
1082 O "O5'" . DA  B 10  ? 0.9222 1.3349 1.5847 0.2556  0.3309  -0.3102 10  DA  B "O5'" 
1083 C "C5'" . DA  B 10  ? 0.9769 1.3151 1.5903 0.2492  0.2617  -0.3223 10  DA  B "C5'" 
1084 C "C4'" . DA  B 10  ? 1.1097 1.3345 1.6304 0.2457  0.2421  -0.3334 10  DA  B "C4'" 
1085 O "O4'" . DA  B 10  ? 1.2235 1.4195 1.5789 0.1903  0.2244  -0.3070 10  DA  B "O4'" 
1086 C "C3'" . DA  B 10  ? 1.0728 1.2774 1.6372 0.2767  0.2953  -0.3457 10  DA  B "C3'" 
1087 O "O3'" . DA  B 10  ? 1.0985 1.1977 1.6404 0.2952  0.2619  -0.3700 10  DA  B "O3'" 
1088 C "C2'" . DA  B 10  ? 1.1029 1.3167 1.5452 0.2338  0.3252  -0.3169 10  DA  B "C2'" 
1089 C "C1'" . DA  B 10  ? 1.2140 1.3757 1.5138 0.1862  0.2627  -0.3030 10  DA  B "C1'" 
1090 N N9    . DA  B 10  ? 1.1939 1.3967 1.3838 0.1351  0.2772  -0.2685 10  DA  B N9    
1091 C C8    . DA  B 10  ? 1.1531 1.4575 1.3801 0.1261  0.3270  -0.2479 10  DA  B C8    
1092 N N7    . DA  B 10  ? 1.1389 1.4607 1.2447 0.0758  0.3289  -0.2175 10  DA  B N7    
1093 C C5    . DA  B 10  ? 1.1511 1.3758 1.1332 0.0505  0.2763  -0.2182 10  DA  B C5    
1094 C C6    . DA  B 10  ? 1.1841 1.3758 1.0069 -0.0033 0.2522  -0.1930 10  DA  B C6    
1095 N N6    . DA  B 10  ? 1.0239 1.2820 0.7884 -0.0408 0.2807  -0.1618 10  DA  B N6    
1096 N N1    . DA  B 10  ? 1.2570 1.3465 0.9857 -0.0164 0.1985  -0.2011 10  DA  B N1    
1097 C C2    . DA  B 10  ? 1.2906 1.3166 1.0829 0.0225  0.1713  -0.2328 10  DA  B C2    
1098 N N3    . DA  B 10  ? 1.2680 1.3163 1.2091 0.0747  0.1900  -0.2588 10  DA  B N3    
1099 C C4    . DA  B 10  ? 1.2073 1.3574 1.2381 0.0862  0.2434  -0.2495 10  DA  B C4    
1100 P P     . DG  B 11  ? 1.3951 1.4502 1.9914 0.3366  0.3031  -0.3914 11  DG  B P     
1101 O OP1   . DG  B 11  ? 1.3014 1.3365 2.0288 0.3887  0.2888  -0.4238 11  DG  B OP1   
1102 O OP2   . DG  B 11  ? 1.2820 1.4080 1.8958 0.3336  0.3727  -0.3738 11  DG  B OP2   
1103 O "O5'" . DG  B 11  ? 1.3487 1.2911 1.7957 0.3110  0.2699  -0.3919 11  DG  B "O5'" 
1104 C "C5'" . DG  B 11  ? 1.3475 1.2366 1.6850 0.2748  0.2035  -0.3855 11  DG  B "C5'" 
1105 C "C4'" . DG  B 11  ? 1.4077 1.2201 1.5898 0.2395  0.1935  -0.3739 11  DG  B "C4'" 
1106 O "O4'" . DG  B 11  ? 1.3744 1.2384 1.4580 0.1886  0.2057  -0.3387 11  DG  B "O4'" 
1107 C "C3'" . DG  B 11  ? 1.4028 1.1813 1.5989 0.2652  0.2409  -0.3849 11  DG  B "C3'" 
1108 O "O3'" . DG  B 11  ? 1.4077 1.0754 1.4981 0.2549  0.2053  -0.3938 11  DG  B "O3'" 
1109 C "C2'" . DG  B 11  ? 1.2622 1.1105 1.4112 0.2354  0.2929  -0.3548 11  DG  B "C2'" 
1110 C "C1'" . DG  B 11  ? 1.2850 1.1331 1.3069 0.1788  0.2480  -0.3289 11  DG  B "C1'" 
1111 N N9    . DG  B 11  ? 1.2257 1.1632 1.2187 0.1465  0.2862  -0.2975 11  DG  B N9    
1112 C C8    . DG  B 11  ? 1.1353 1.1772 1.2381 0.1638  0.3371  -0.2914 11  DG  B C8    
1113 N N7    . DG  B 11  ? 1.1390 1.2440 1.1817 0.1259  0.3628  -0.2609 11  DG  B N7    
1114 C C5    . DG  B 11  ? 1.2935 1.3310 1.1765 0.0807  0.3266  -0.2459 11  DG  B C5    
1115 C C6    . DG  B 11  ? 1.3666 1.4273 1.1252 0.0274  0.3320  -0.2125 11  DG  B C6    
1116 O O6    . DG  B 11  ? 1.2777 1.4267 1.0441 0.0095  0.3718  -0.1894 11  DG  B O6    
1117 N N1    . DG  B 11  ? 1.4628 1.4318 1.0782 -0.0062 0.2848  -0.2071 11  DG  B N1    
1118 C C2    . DG  B 11  ? 1.5314 1.3996 1.1273 0.0100  0.2385  -0.2312 11  DG  B C2    
1119 N N2    . DG  B 11  ? 1.6485 1.4379 1.0988 -0.0280 0.1963  -0.2212 11  DG  B N2    
1120 N N3    . DG  B 11  ? 1.4910 1.3368 1.2023 0.0598  0.2331  -0.2628 11  DG  B N3    
1121 C C4    . DG  B 11  ? 1.3484 1.2824 1.1992 0.0928  0.2789  -0.2681 11  DG  B C4    
1122 P P     . DT  B 12  ? 1.9433 1.5462 2.0501 0.2896  0.2366  -0.4147 12  DT  B P     
1123 O OP1   . DT  B 12  ? 1.9514 1.4756 2.1059 0.3248  0.1952  -0.4472 12  DT  B OP1   
1124 O OP2   . DT  B 12  ? 1.7685 1.4523 1.9715 0.3147  0.3105  -0.4110 12  DT  B OP2   
1125 O "O5'" . DT  B 12  ? 1.9457 1.4827 1.8779 0.2440  0.2248  -0.3963 12  DT  B "O5'" 
1126 C "C5'" . DT  B 12  ? 1.9268 1.4179 1.7330 0.1984  0.1635  -0.3829 12  DT  B "C5'" 
1127 C "C4'" . DT  B 12  ? 1.8818 1.3617 1.5416 0.1495  0.1743  -0.3543 12  DT  B "C4'" 
1128 O "O4'" . DT  B 12  ? 1.7470 1.3328 1.4142 0.1244  0.2102  -0.3257 12  DT  B "O4'" 
1129 C "C3'" . DT  B 12  ? 1.8578 1.2958 1.4932 0.1646  0.2165  -0.3605 12  DT  B "C3'" 
1130 O "O3'" . DT  B 12  ? 2.0018 1.3639 1.4780 0.1241  0.1882  -0.3476 12  DT  B "O3'" 
1131 C "C2'" . DT  B 12  ? 1.7179 1.2602 1.4056 0.1645  0.2858  -0.3418 12  DT  B "C2'" 
1132 C "C1'" . DT  B 12  ? 1.6873 1.2890 1.3155 0.1164  0.2642  -0.3122 12  DT  B "C1'" 
1133 N N1    . DT  B 12  ? 1.5829 1.3028 1.2839 0.1158  0.3188  -0.2943 12  DT  B N1    
1134 C C2    . DT  B 12  ? 1.5823 1.3493 1.1896 0.0667  0.3295  -0.2606 12  DT  B C2    
1135 O O2    . DT  B 12  ? 1.6848 1.4006 1.1530 0.0237  0.2951  -0.2448 12  DT  B O2    
1136 N N3    . DT  B 12  ? 1.4431 1.3193 1.1258 0.0695  0.3813  -0.2459 12  DT  B N3    
1137 C C4    . DT  B 12  ? 1.3771 1.3178 1.2177 0.1162  0.4222  -0.2615 12  DT  B C4    
1138 O O4    . DT  B 12  ? 1.1947 1.2326 1.0945 0.1154  0.4673  -0.2466 12  DT  B O4    
1139 C C5    . DT  B 12  ? 1.4027 1.2886 1.3345 0.1661  0.4083  -0.2963 12  DT  B C5    
1140 C C7    . DT  B 12  ? 1.3474 1.2960 1.4524 0.2188  0.4495  -0.3147 12  DT  B C7    
1141 C C6    . DT  B 12  ? 1.4844 1.2638 1.3434 0.1639  0.3584  -0.3111 12  DT  B C6    
1142 P P     . DA  B 13  ? 2.3231 1.5920 1.7481 0.1405  0.1996  -0.3632 13  DA  B P     
1143 O OP1   . DA  B 13  ? 2.4237 1.5857 1.7883 0.1390  0.1335  -0.3808 13  DA  B OP1   
1144 O OP2   . DA  B 13  ? 2.1455 1.4515 1.6981 0.1914  0.2611  -0.3803 13  DA  B OP2   
1145 O "O5'" . DA  B 13  ? 2.3910 1.6627 1.6762 0.0912  0.2184  -0.3315 13  DA  B "O5'" 
1146 C "C5'" . DA  B 13  ? 2.3190 1.5992 1.4895 0.0351  0.1818  -0.3033 13  DA  B "C5'" 
1147 C "C4'" . DA  B 13  ? 2.2405 1.5668 1.3392 0.0028  0.2278  -0.2740 13  DA  B "C4'" 
1148 O "O4'" . DA  B 13  ? 2.1087 1.5536 1.3007 0.0078  0.2745  -0.2607 13  DA  B "O4'" 
1149 C "C3'" . DA  B 13  ? 2.1891 1.4777 1.2818 0.0258  0.2729  -0.2840 13  DA  B "C3'" 
1150 O "O3'" . DA  B 13  ? 2.2214 1.4954 1.1785 -0.0185 0.2817  -0.2579 13  DA  B "O3'" 
1151 C "C2'" . DA  B 13  ? 2.0512 1.4367 1.2874 0.0628  0.3397  -0.2881 13  DA  B "C2'" 
1152 C "C1'" . DA  B 13  ? 2.0399 1.5155 1.2580 0.0233  0.3406  -0.2578 13  DA  B "C1'" 
1153 N N9    . DA  B 13  ? 1.9225 1.5079 1.2729 0.0471  0.3916  -0.2555 13  DA  B N9    
1154 C C8    . DA  B 13  ? 1.8632 1.4792 1.3668 0.1006  0.4162  -0.2802 13  DA  B C8    
1155 N N7    . DA  B 13  ? 1.7200 1.4421 1.3165 0.1091  0.4616  -0.2698 13  DA  B N7    
1156 C C5    . DA  B 13  ? 1.6995 1.4625 1.1954 0.0577  0.4671  -0.2364 13  DA  B C5    
1157 C C6    . DA  B 13  ? 1.5932 1.4629 1.1144 0.0390  0.5065  -0.2114 13  DA  B C6    
1158 N N6    . DA  B 13  ? 1.4327 1.3895 1.0948 0.0719  0.5492  -0.2170 13  DA  B N6    
1159 N N1    . DA  B 13  ? 1.6972 1.5804 1.0934 -0.0148 0.4998  -0.1803 13  DA  B N1    
1160 C C2    . DA  B 13  ? 1.8679 1.6624 1.1238 -0.0475 0.4562  -0.1746 13  DA  B C2    
1161 N N3    . DA  B 13  ? 1.9305 1.6203 1.1481 -0.0348 0.4160  -0.1961 13  DA  B N3    
1162 C C4    . DA  B 13  ? 1.8514 1.5314 1.1957 0.0191  0.4243  -0.2270 13  DA  B C4    
1163 O "O5'" . DC  C 1   ? 1.1059 2.4262 1.3792 0.5986  0.5366  0.0428  14  DC  C "O5'" 
1164 C "C5'" . DC  C 1   ? 0.9980 2.4350 1.2660 0.5745  0.5080  0.0271  14  DC  C "C5'" 
1165 C "C4'" . DC  C 1   ? 0.9571 2.4152 1.2017 0.4878  0.4541  0.0044  14  DC  C "C4'" 
1166 O "O4'" . DC  C 1   ? 1.0687 2.4175 1.2514 0.4622  0.4110  -0.0858 14  DC  C "O4'" 
1167 C "C3'" . DC  C 1   ? 0.9041 2.2880 1.1485 0.4480  0.4481  0.0216  14  DC  C "C3'" 
1168 O "O3'" . DC  C 1   ? 0.7542 2.2801 1.0572 0.4348  0.4688  0.1018  14  DC  C "O3'" 
1169 C "C2'" . DC  C 1   ? 0.9624 2.2799 1.1552 0.3731  0.3872  -0.0434 14  DC  C "C2'" 
1170 C "C1'" . DC  C 1   ? 1.0725 2.3377 1.2250 0.3940  0.3692  -0.1172 14  DC  C "C1'" 
1171 N N1    . DC  C 1   ? 1.1251 2.1855 1.2275 0.4052  0.3547  -0.1898 14  DC  C N1    
1172 C C2    . DC  C 1   ? 1.2314 2.2052 1.3305 0.4792  0.3907  -0.2015 14  DC  C C2    
1173 O O2    . DC  C 1   ? 1.3247 2.3903 1.4624 0.5347  0.4356  -0.1510 14  DC  C O2    
1174 N N3    . DC  C 1   ? 1.1873 1.9775 1.2432 0.4889  0.3754  -0.2677 14  DC  C N3    
1175 C C4    . DC  C 1   ? 1.1754 1.8674 1.1940 0.4289  0.3260  -0.3201 14  DC  C C4    
1176 N N4    . DC  C 1   ? 1.1409 1.6524 1.1221 0.4430  0.3116  -0.3826 14  DC  C N4    
1177 C C5    . DC  C 1   ? 1.2072 1.9835 1.2280 0.3527  0.2893  -0.3099 14  DC  C C5    
1178 C C6    . DC  C 1   ? 1.1537 2.1130 1.2156 0.3432  0.3052  -0.2454 14  DC  C C6    
1179 P P     . DT  C 2   ? 1.5195 2.9933 1.8402 0.4131  0.4847  0.1416  15  DT  C P     
1180 O OP1   . DT  C 2   ? 1.5102 3.1587 1.9014 0.4083  0.5100  0.2238  15  DT  C OP1   
1181 O OP2   . DT  C 2   ? 1.4108 2.7265 1.7126 0.4646  0.5145  0.1239  15  DT  C OP2   
1182 O "O5'" . DT  C 2   ? 1.0569 2.4569 1.3280 0.3275  0.4262  0.0932  15  DT  C "O5'" 
1183 C "C5'" . DT  C 2   ? 1.0762 2.5945 1.3504 0.2644  0.3871  0.0927  15  DT  C "C5'" 
1184 C "C4'" . DT  C 2   ? 1.1677 2.5733 1.3900 0.1918  0.3359  0.0387  15  DT  C "C4'" 
1185 O "O4'" . DT  C 2   ? 1.1589 2.3978 1.3258 0.2110  0.3181  -0.0380 15  DT  C "O4'" 
1186 C "C3'" . DT  C 2   ? 1.2625 2.5992 1.4880 0.1594  0.3422  0.0683  15  DT  C "C3'" 
1187 O "O3'" . DT  C 2   ? 1.3637 2.7789 1.5956 0.0796  0.3090  0.0827  15  DT  C "O3'" 
1188 C "C2'" . DT  C 2   ? 1.2426 2.3639 1.4117 0.1697  0.3300  0.0089  15  DT  C "C2'" 
1189 C "C1'" . DT  C 2   ? 1.2016 2.2835 1.3324 0.1755  0.2970  -0.0653 15  DT  C "C1'" 
1190 N N1    . DT  C 2   ? 1.2077 2.1168 1.3004 0.2226  0.3015  -0.1189 15  DT  C N1    
1191 C C2    . DT  C 2   ? 1.3540 2.0998 1.3952 0.1859  0.2588  -0.1842 15  DT  C C2    
1192 O O2    . DT  C 2   ? 1.5100 2.2423 1.5337 0.1154  0.2175  -0.2007 15  DT  C O2    
1193 N N3    . DT  C 2   ? 1.3019 1.8974 1.3144 0.2349  0.2655  -0.2299 15  DT  C N3    
1194 C C4    . DT  C 2   ? 1.1774 1.7707 1.2054 0.3147  0.3109  -0.2182 15  DT  C C4    
1195 O O4    . DT  C 2   ? 1.0478 1.5019 1.0486 0.3543  0.3135  -0.2633 15  DT  C O4    
1196 C C5    . DT  C 2   ? 1.1648 1.9321 1.2462 0.3485  0.3545  -0.1490 15  DT  C C5    
1197 C C7    . DT  C 2   ? 1.1766 1.9538 1.2801 0.4342  0.4056  -0.1311 15  DT  C C7    
1198 C C6    . DT  C 2   ? 1.1289 2.0439 1.2409 0.3022  0.3475  -0.1026 15  DT  C C6    
1199 P P     . DA  C 3   ? 2.1762 3.4556 2.3544 0.0046  0.2590  0.0327  16  DA  C P     
1200 O OP1   . DA  C 3   ? 2.2214 3.3666 2.3445 0.0112  0.2262  -0.0505 16  DA  C OP1   
1201 O OP2   . DA  C 3   ? 2.1931 3.5960 2.3896 -0.0674 0.2320  0.0551  16  DA  C OP2   
1202 O "O5'" . DA  C 3   ? 1.2113 2.3791 1.3890 0.0130  0.2878  0.0641  16  DA  C "O5'" 
1203 C "C5'" . DA  C 3   ? 1.2768 2.2474 1.4058 0.0339  0.2823  0.0172  16  DA  C "C5'" 
1204 C "C4'" . DA  C 3   ? 1.4256 2.2733 1.4988 -0.0312 0.2223  -0.0481 16  DA  C "C4'" 
1205 O "O4'" . DA  C 3   ? 1.4274 2.1365 1.4588 0.0023  0.2050  -0.1184 16  DA  C "O4'" 
1206 C "C3'" . DA  C 3   ? 1.6008 2.3303 1.6507 -0.0735 0.2144  -0.0369 16  DA  C "C3'" 
1207 O "O3'" . DA  C 3   ? 1.7243 2.4094 1.7413 -0.1511 0.1586  -0.0764 16  DA  C "O3'" 
1208 C "C2'" . DA  C 3   ? 1.5914 2.1441 1.6082 -0.0212 0.2268  -0.0677 16  DA  C "C2'" 
1209 C "C1'" . DA  C 3   ? 1.5279 2.0627 1.5293 0.0164  0.2106  -0.1293 16  DA  C "C1'" 
1210 N N9    . DA  C 3   ? 1.4049 1.9018 1.4138 0.1013  0.2523  -0.1289 16  DA  C N9    
1211 C C8    . DA  C 3   ? 1.2352 1.8463 1.2915 0.1605  0.3072  -0.0738 16  DA  C C8    
1212 N N7    . DA  C 3   ? 1.1371 1.6750 1.1876 0.2307  0.3347  -0.0908 16  DA  C N7    
1213 C C5    . DA  C 3   ? 1.1992 1.5644 1.1957 0.2169  0.2945  -0.1623 16  DA  C C5    
1214 C C6    . DA  C 3   ? 1.1944 1.4142 1.1613 0.2673  0.2965  -0.2127 16  DA  C C6    
1215 N N6    . DA  C 3   ? 1.0266 1.2535 1.0124 0.3444  0.3438  -0.1980 16  DA  C N6    
1216 N N1    . DA  C 3   ? 1.3559 1.4215 1.2755 0.2355  0.2475  -0.2796 16  DA  C N1    
1217 C C2    . DA  C 3   ? 1.4752 1.5333 1.3777 0.1578  0.2006  -0.2941 16  DA  C C2    
1218 N N3    . DA  C 3   ? 1.4568 1.6422 1.3811 0.1037  0.1943  -0.2518 16  DA  C N3    
1219 C C4    . DA  C 3   ? 1.3517 1.6891 1.3234 0.1378  0.2432  -0.1862 16  DA  C C4    
1220 P P     . DC  C 4   ? 1.7836 2.3808 1.7789 -0.2165 0.1419  -0.0591 17  DC  C P     
1221 O OP1   . DC  C 4   ? 1.8718 2.4907 1.8505 -0.2964 0.0884  -0.0900 17  DC  C OP1   
1222 O OP2   . DC  C 4   ? 1.6344 2.3121 1.6709 -0.2010 0.1935  0.0186  17  DC  C OP2   
1223 O "O5'" . DC  C 4   ? 1.7507 2.1259 1.6950 -0.1946 0.1302  -0.1040 17  DC  C "O5'" 
1224 C "C5'" . DC  C 4   ? 1.8010 2.0753 1.7109 -0.1854 0.0919  -0.1811 17  DC  C "C5'" 
1225 C "C4'" . DC  C 4   ? 1.7660 1.8367 1.6355 -0.1617 0.0869  -0.2102 17  DC  C "C4'" 
1226 O "O4'" . DC  C 4   ? 1.6835 1.7401 1.5641 -0.0755 0.1280  -0.2104 17  DC  C "O4'" 
1227 C "C3'" . DC  C 4   ? 1.6466 1.6532 1.5067 -0.1869 0.1022  -0.1617 17  DC  C "C3'" 
1228 O "O3'" . DC  C 4   ? 1.6145 1.4197 1.4248 -0.2015 0.0677  -0.2055 17  DC  C "O3'" 
1229 C "C2'" . DC  C 4   ? 1.5475 1.6083 1.4404 -0.1117 0.1677  -0.1120 17  DC  C "C2'" 
1230 C "C1'" . DC  C 4   ? 1.6036 1.5809 1.4793 -0.0520 0.1613  -0.1715 17  DC  C "C1'" 
1231 N N1    . DC  C 4   ? 1.5590 1.5940 1.4663 0.0317  0.2178  -0.1449 17  DC  C N1    
1232 C C2    . DC  C 4   ? 1.5371 1.4475 1.4224 0.0916  0.2240  -0.1867 17  DC  C C2    
1233 O O2    . DC  C 4   ? 1.6266 1.3817 1.4686 0.0729  0.1806  -0.2451 17  DC  C O2    
1234 N N3    . DC  C 4   ? 1.3279 1.2927 1.2432 0.1680  0.2770  -0.1618 17  DC  C N3    
1235 C C4    . DC  C 4   ? 1.1863 1.3198 1.1530 0.1844  0.3206  -0.0980 17  DC  C C4    
1236 N N4    . DC  C 4   ? 1.0206 1.2016 1.0181 0.2599  0.3719  -0.0748 17  DC  C N4    
1237 C C5    . DC  C 4   ? 1.2052 1.4672 1.1971 0.1247  0.3137  -0.0551 17  DC  C C5    
1238 C C6    . DC  C 4   ? 1.4019 1.6096 1.3616 0.0494  0.2624  -0.0808 17  DC  C C6    
1239 P P     . DT  C 5   ? 2.2642 1.9550 2.0507 -0.2173 0.0813  -0.1668 18  DT  C P     
1240 O OP1   . DT  C 5   ? 2.2251 1.9964 2.0212 -0.2893 0.0769  -0.1209 18  DT  C OP1   
1241 O OP2   . DT  C 5   ? 2.2183 1.9079 2.0213 -0.1404 0.1388  -0.1353 18  DT  C OP2   
1242 O "O5'" . DT  C 5   ? 2.0609 1.5360 1.7924 -0.2389 0.0262  -0.2313 18  DT  C "O5'" 
1243 C "C5'" . DT  C 5   ? 2.0334 1.4133 1.7515 -0.1856 0.0134  -0.2930 18  DT  C "C5'" 
1244 C "C4'" . DT  C 5   ? 1.9592 1.2205 1.6618 -0.1260 0.0438  -0.2840 18  DT  C "C4'" 
1245 O "O4'" . DT  C 5   ? 1.7509 1.1104 1.4884 -0.0474 0.0985  -0.2657 18  DT  C "O4'" 
1246 C "C3'" . DT  C 5   ? 2.0324 1.2533 1.7221 -0.1498 0.0662  -0.2243 18  DT  C "C3'" 
1247 O "O3'" . DT  C 5   ? 2.1596 1.2006 1.8004 -0.1970 0.0168  -0.2518 18  DT  C "O3'" 
1248 C "C2'" . DT  C 5   ? 1.8978 1.1244 1.6036 -0.0696 0.1270  -0.1946 18  DT  C "C2'" 
1249 C "C1'" . DT  C 5   ? 1.7105 1.0093 1.4436 -0.0056 0.1406  -0.2289 18  DT  C "C1'" 
1250 N N1    . DT  C 5   ? 1.5398 1.0016 1.3226 0.0448  0.2049  -0.1747 18  DT  C N1    
1251 C C2    . DT  C 5   ? 1.5793 1.0306 1.3755 0.1264  0.2452  -0.1788 18  DT  C C2    
1252 O O2    . DT  C 5   ? 1.6873 1.0004 1.4552 0.1602  0.2308  -0.2267 18  DT  C O2    
1253 N N3    . DT  C 5   ? 1.4821 1.0913 1.3289 0.1671  0.3027  -0.1248 18  DT  C N3    
1254 C C4    . DT  C 5   ? 1.3754 1.1484 1.2620 0.1350  0.3224  -0.0687 18  DT  C C4    
1255 O O4    . DT  C 5   ? 1.2230 1.1306 1.1590 0.1765  0.3737  -0.0218 18  DT  C O4    
1256 C C5    . DT  C 5   ? 1.4107 1.1848 1.2792 0.0489  0.2778  -0.0691 18  DT  C C5    
1257 C C7    . DT  C 5   ? 1.4134 1.3579 1.3229 0.0063  0.2930  -0.0127 18  DT  C C7    
1258 C C6    . DT  C 5   ? 1.4743 1.0948 1.2918 0.0084  0.2225  -0.1210 18  DT  C C6    
1259 P P     . DA  C 6   ? 2.6648 1.5208 2.2696 -0.1585 0.0199  -0.2627 19  DA  C P     
1260 O OP1   . DA  C 6   ? 2.7190 1.4034 2.2811 -0.2065 -0.0477 -0.3126 19  DA  C OP1   
1261 O OP2   . DA  C 6   ? 2.6012 1.4887 2.2102 -0.1504 0.0720  -0.1929 19  DA  C OP2   
1262 O "O5'" . DA  C 6   ? 2.3443 1.2032 1.9676 -0.0693 0.0429  -0.3020 19  DA  C "O5'" 
1263 C "C5'" . DA  C 6   ? 2.3107 0.9970 1.9052 -0.0296 0.0258  -0.3479 19  DA  C "C5'" 
1264 C "C4'" . DA  C 6   ? 2.1991 0.8561 1.7955 0.0379  0.0806  -0.3162 19  DA  C "C4'" 
1265 O "O4'" . DA  C 6   ? 2.0970 0.9309 1.7399 0.0826  0.1441  -0.2708 19  DA  C "O4'" 
1266 C "C3'" . DA  C 6   ? 2.2327 0.7960 1.7981 0.0127  0.0900  -0.2712 19  DA  C "C3'" 
1267 O "O3'" . DA  C 6   ? 2.2880 0.6945 1.8274 0.0614  0.0871  -0.3011 19  DA  C "O3'" 
1268 C "C2'" . DA  C 6   ? 2.0751 0.7985 1.6777 0.0322  0.1595  -0.1992 19  DA  C "C2'" 
1269 C "C1'" . DA  C 6   ? 1.9873 0.8001 1.6284 0.1097  0.1923  -0.2202 19  DA  C "C1'" 
1270 N N9    . DA  C 6   ? 1.8631 0.8559 1.5556 0.1466  0.2568  -0.1665 19  DA  C N9    
1271 C C8    . DA  C 6   ? 1.7494 0.7906 1.4716 0.2280  0.3081  -0.1607 19  DA  C C8    
1272 N N7    . DA  C 6   ? 1.5414 0.7513 1.3132 0.2473  0.3594  -0.1080 19  DA  C N7    
1273 C C5    . DA  C 6   ? 1.5649 0.8436 1.3397 0.1730  0.3403  -0.0783 19  DA  C C5    
1274 C C6    . DA  C 6   ? 1.4580 0.9106 1.2788 0.1529  0.3726  -0.0208 19  DA  C C6    
1275 N N6    . DA  C 6   ? 1.2467 0.8315 1.1209 0.2095  0.4309  0.0170  19  DA  C N6    
1276 N N1    . DA  C 6   ? 1.6283 1.1101 1.4401 0.0731  0.3421  -0.0046 19  DA  C N1    
1277 C C2    . DA  C 6   ? 1.7355 1.0785 1.4947 0.0174  0.2827  -0.0432 19  DA  C C2    
1278 N N3    . DA  C 6   ? 1.7726 0.9437 1.4871 0.0295  0.2461  -0.0978 19  DA  C N3    
1279 C C4    . DA  C 6   ? 1.7558 0.9045 1.4812 0.1097  0.2783  -0.1130 19  DA  C C4    
1280 P P     . DG  C 7   ? 2.9912 1.6834 2.0583 -0.1083 0.3650  -0.1801 20  DG  C P     
1281 O OP1   . DG  C 7   ? 2.9889 1.6061 2.0582 -0.0330 0.3727  -0.2296 20  DG  C OP1   
1282 O OP2   . DG  C 7   ? 3.0431 1.6895 2.0530 -0.1614 0.3414  -0.1346 20  DG  C OP2   
1283 O "O5'" . DG  C 7   ? 2.4480 1.3007 1.6301 -0.0851 0.3727  -0.1545 20  DG  C "O5'" 
1284 C "C5'" . DG  C 7   ? 2.3287 1.2486 1.5820 -0.0318 0.3922  -0.1875 20  DG  C "C5'" 
1285 C "C4'" . DG  C 7   ? 2.1311 1.1994 1.4884 -0.0229 0.3926  -0.1544 20  DG  C "C4'" 
1286 O "O4'" . DG  C 7   ? 2.1419 1.2749 1.5007 -0.0983 0.3845  -0.1191 20  DG  C "O4'" 
1287 C "C3'" . DG  C 7   ? 1.9936 1.0885 1.3880 0.0032  0.3816  -0.1220 20  DG  C "C3'" 
1288 O "O3'" . DG  C 7   ? 1.8877 1.0318 1.3584 0.0794  0.3908  -0.1386 20  DG  C "O3'" 
1289 C "C2'" . DG  C 7   ? 1.9532 1.1531 1.3901 -0.0523 0.3720  -0.0727 20  DG  C "C2'" 
1290 C "C1'" . DG  C 7   ? 1.9476 1.1885 1.3862 -0.0993 0.3758  -0.0771 20  DG  C "C1'" 
1291 N N9    . DG  C 7   ? 1.8313 1.1026 1.2517 -0.1795 0.3610  -0.0351 20  DG  C N9    
1292 C C8    . DG  C 7   ? 1.9123 1.1031 1.2469 -0.2335 0.3484  -0.0149 20  DG  C C8    
1293 N N7    . DG  C 7   ? 1.8841 1.1315 1.2273 -0.3011 0.3361  0.0234  20  DG  C N7    
1294 C C5    . DG  C 7   ? 1.7247 1.0962 1.1680 -0.2909 0.3387  0.0294  20  DG  C C5    
1295 C C6    . DG  C 7   ? 1.6410 1.1163 1.1437 -0.3437 0.3255  0.0658  20  DG  C C6    
1296 O O6    . DG  C 7   ? 1.7177 1.1996 1.1963 -0.4120 0.3102  0.1009  20  DG  C O6    
1297 N N1    . DG  C 7   ? 1.4225 1.0015 1.0253 -0.3103 0.3286  0.0598  20  DG  C N1    
1298 C C2    . DG  C 7   ? 1.3587 0.9429 0.9966 -0.2370 0.3443  0.0237  20  DG  C C2    
1299 N N2    . DG  C 7   ? 1.2765 0.9668 1.0109 -0.2179 0.3423  0.0254  20  DG  C N2    
1300 N N3    . DG  C 7   ? 1.4234 0.9150 1.0085 -0.1866 0.3585  -0.0109 20  DG  C N3    
1301 C C4    . DG  C 7   ? 1.6458 1.0329 1.1354 -0.2171 0.3539  -0.0060 20  DG  C C4    
1302 P P     . DC  C 8   ? 2.1807 1.3464 1.6876 0.1159  0.3819  -0.1133 21  DC  C P     
1303 O OP1   . DC  C 8   ? 2.0858 1.2376 1.6306 0.1975  0.3902  -0.1459 21  DC  C OP1   
1304 O OP2   . DC  C 8   ? 2.1551 1.2345 1.5792 0.0721  0.3651  -0.0882 21  DC  C OP2   
1305 O "O5'" . DC  C 8   ? 1.9148 1.2338 1.5169 0.0987  0.3821  -0.0787 21  DC  C "O5'" 
1306 C "C5'" . DC  C 8   ? 1.7486 1.1603 1.4286 0.1201  0.3924  -0.0931 21  DC  C "C5'" 
1307 C "C4'" . DC  C 8   ? 1.5487 1.0853 1.3006 0.0787  0.3856  -0.0577 21  DC  C "C4'" 
1308 O "O4'" . DC  C 8   ? 1.6091 1.1217 1.3037 -0.0006 0.3758  -0.0351 21  DC  C "O4'" 
1309 C "C3'" . DC  C 8   ? 1.3854 0.9932 1.1943 0.0863  0.3797  -0.0272 21  DC  C "C3'" 
1310 O "O3'" . DC  C 8   ? 1.2370 0.9101 1.1295 0.1546  0.3870  -0.0410 21  DC  C "O3'" 
1311 C "C2'" . DC  C 8   ? 1.3504 1.0499 1.2030 0.0232  0.3696  0.0063  21  DC  C "C2'" 
1312 C "C1'" . DC  C 8   ? 1.4247 1.0505 1.1926 -0.0346 0.3659  0.0026  21  DC  C "C1'" 
1313 N N1    . DC  C 8   ? 1.4138 1.0020 1.1165 -0.1083 0.3538  0.0336  21  DC  C N1    
1314 C C2    . DC  C 8   ? 1.3811 1.0538 1.1273 -0.1674 0.3415  0.0666  21  DC  C C2    
1315 O O2    . DC  C 8   ? 1.2672 1.0422 1.1069 -0.1564 0.3390  0.0699  21  DC  C O2    
1316 N N3    . DC  C 8   ? 1.4689 1.1082 1.1560 -0.2354 0.3302  0.0952  21  DC  C N3    
1317 C C4    . DC  C 8   ? 1.5809 1.1055 1.1664 -0.2466 0.3300  0.0920  21  DC  C C4    
1318 N N4    . DC  C 8   ? 1.4918 0.9885 1.0212 -0.3165 0.3174  0.1222  21  DC  C N4    
1319 C C5    . DC  C 8   ? 1.4731 0.9059 1.0129 -0.1873 0.3398  0.0588  21  DC  C C5    
1320 C C6    . DC  C 8   ? 1.5081 0.9773 1.1101 -0.1193 0.3519  0.0303  21  DC  C C6    
1321 P P     . DC  C 9   ? 1.3732 1.0797 1.3029 0.1895  0.3866  -0.0276 22  DC  C P     
1322 O OP1   . DC  C 9   ? 1.2894 1.0676 1.3084 0.2566  0.3938  -0.0449 22  DC  C OP1   
1323 O OP2   . DC  C 9   ? 1.5031 1.0903 1.3355 0.1854  0.3828  -0.0277 22  DC  C OP2   
1324 O "O5'" . DC  C 9   ? 1.0978 0.9028 1.0765 0.1354  0.3790  0.0102  22  DC  C "O5'" 
1325 C "C5'" . DC  C 9   ? 0.8655 0.7945 0.9499 0.1338  0.3763  0.0183  22  DC  C "C5'" 
1326 C "C4'" . DC  C 9   ? 1.0374 1.0463 1.1658 0.0947  0.3704  0.0497  22  DC  C "C4'" 
1327 O "O4'" . DC  C 9   ? 0.9007 0.8770 0.9708 0.0200  0.3608  0.0717  22  DC  C "O4'" 
1328 C "C3'" . DC  C 9   ? 1.0472 1.0317 1.1455 0.1086  0.3761  0.0549  22  DC  C "C3'" 
1329 O "O3'" . DC  C 9   ? 1.0547 1.1599 1.2459 0.1054  0.3774  0.0697  22  DC  C "O3'" 
1330 C "C2'" . DC  C 9   ? 1.0521 0.9427 1.0402 0.0460  0.3694  0.0723  22  DC  C "C2'" 
1331 C "C1'" . DC  C 9   ? 1.0057 0.9660 1.0368 -0.0091 0.3604  0.0916  22  DC  C "C1'" 
1332 N N1    . DC  C 9   ? 1.1393 1.0264 1.0792 -0.0787 0.3512  0.1095  22  DC  C N1    
1333 C C2    . DC  C 9   ? 1.2669 1.2264 1.2449 -0.1404 0.3406  0.1382  22  DC  C C2    
1334 O O2    . DC  C 9   ? 1.1849 1.2670 1.2764 -0.1326 0.3384  0.1461  22  DC  C O2    
1335 N N3    . DC  C 9   ? 1.4115 1.3033 1.3034 -0.2071 0.3309  0.1563  22  DC  C N3    
1336 C C4    . DC  C 9   ? 1.4778 1.2343 1.2516 -0.2115 0.3317  0.1447  22  DC  C C4    
1337 N N4    . DC  C 9   ? 1.4885 1.1800 1.1791 -0.2792 0.3209  0.1629  22  DC  C N4    
1338 C C5    . DC  C 9   ? 1.4634 1.1446 1.2024 -0.1470 0.3414  0.1141  22  DC  C C5    
1339 C C6    . DC  C 9   ? 1.2596 1.0106 1.0838 -0.0826 0.3510  0.0983  22  DC  C C6    
1340 P P     . DA  C 10  ? 0.9713 1.1002 1.1789 0.1433  0.3874  0.0655  23  DA  C P     
1341 O OP1   . DA  C 10  ? 0.8546 1.0260 1.1353 0.2151  0.3932  0.0414  23  DA  C OP1   
1342 O OP2   . DA  C 10  ? 0.9702 0.9827 1.0587 0.1248  0.3864  0.0716  23  DA  C OP2   
1343 O "O5'" . DA  C 10  ? 0.6974 0.9527 0.9882 0.1077  0.3883  0.0852  23  DA  C "O5'" 
1344 C "C5'" . DA  C 10  ? 0.6484 1.0175 1.0643 0.1326  0.3862  0.0783  23  DA  C "C5'" 
1345 C "C4'" . DA  C 10  ? 0.6063 1.0627 1.0819 0.0748  0.3777  0.1012  23  DA  C "C4'" 
1346 O "O4'" . DA  C 10  ? 0.6676 1.0450 1.0543 0.0153  0.3677  0.1195  23  DA  C "O4'" 
1347 C "C3'" . DA  C 10  ? 0.6314 1.1518 1.1284 0.0510  0.3873  0.1111  23  DA  C "C3'" 
1348 O "O3'" . DA  C 10  ? 0.5413 1.1890 1.1585 0.0329  0.3816  0.1185  23  DA  C "O3'" 
1349 C "C2'" . DA  C 10  ? 0.6671 1.0995 1.0458 -0.0126 0.3841  0.1333  23  DA  C "C2'" 
1350 C "C1'" . DA  C 10  ? 0.7196 1.1113 1.0782 -0.0417 0.3683  0.1423  23  DA  C "C1'" 
1351 N N9    . DA  C 10  ? 0.9070 1.1704 1.1293 -0.0831 0.3640  0.1535  23  DA  C N9    
1352 C C8    . DA  C 10  ? 0.9821 1.1227 1.1015 -0.0579 0.3679  0.1402  23  DA  C C8    
1353 N N7    . DA  C 10  ? 1.1444 1.1824 1.1540 -0.1067 0.3600  0.1536  23  DA  C N7    
1354 C C5    . DA  C 10  ? 1.1852 1.2846 1.2251 -0.1695 0.3512  0.1788  23  DA  C C5    
1355 C C6    . DA  C 10  ? 1.2634 1.3090 1.2275 -0.2422 0.3394  0.2032  23  DA  C C6    
1356 N N6    . DA  C 10  ? 1.4007 1.3096 1.2363 -0.2636 0.3342  0.2042  23  DA  C N6    
1357 N N1    . DA  C 10  ? 1.1140 1.2503 1.1421 -0.2922 0.3308  0.2264  23  DA  C N1    
1358 C C2    . DA  C 10  ? 0.9825 1.2524 1.1449 -0.2694 0.3329  0.2237  23  DA  C C2    
1359 N N3    . DA  C 10  ? 0.9772 1.3069 1.2207 -0.2023 0.3433  0.2004  23  DA  C N3    
1360 C C4    . DA  C 10  ? 1.0328 1.2717 1.2062 -0.1553 0.3529  0.1792  23  DA  C C4    
1361 P P     . DT  C 11  ? 0.7016 1.4640 1.3993 0.0330  0.3956  0.1140  24  DT  C P     
1362 O OP1   . DT  C 11  ? 0.5646 1.4536 1.4161 0.0556  0.3877  0.1051  24  DT  C OP1   
1363 O OP2   . DT  C 11  ? 0.7288 1.4429 1.3612 0.0659  0.4131  0.0996  24  DT  C OP2   
1364 O "O5'" . DT  C 11  ? 0.5151 1.2902 1.1795 -0.0470 0.3929  0.1418  24  DT  C "O5'" 
1365 C "C5'" . DT  C 11  ? 0.5498 1.3591 1.2614 -0.0886 0.3734  0.1609  24  DT  C "C5'" 
1366 C "C4'" . DT  C 11  ? 0.6166 1.4081 1.2651 -0.1653 0.3709  0.1888  24  DT  C "C4'" 
1367 O "O4'" . DT  C 11  ? 0.8012 1.4458 1.3003 -0.1900 0.3657  0.2004  24  DT  C "O4'" 
1368 C "C3'" . DT  C 11  ? 0.6024 1.4414 1.2446 -0.1803 0.3911  0.1868  24  DT  C "C3'" 
1369 O "O3'" . DT  C 11  ? 0.6204 1.5607 1.3315 -0.2344 0.3894  0.2028  24  DT  C "O3'" 
1370 C "C2'" . DT  C 11  ? 0.7573 1.4565 1.2345 -0.2045 0.3941  0.1982  24  DT  C "C2'" 
1371 C "C1'" . DT  C 11  ? 0.8691 1.4799 1.2842 -0.2363 0.3735  0.2159  24  DT  C "C1'" 
1372 N N1    . DT  C 11  ? 1.0046 1.4587 1.2665 -0.2410 0.3717  0.2186  24  DT  C N1    
1373 C C2    . DT  C 11  ? 1.0916 1.4687 1.2552 -0.3074 0.3603  0.2444  24  DT  C C2    
1374 O O2    . DT  C 11  ? 1.1097 1.5417 1.3033 -0.3639 0.3521  0.2668  24  DT  C O2    
1375 N N3    . DT  C 11  ? 1.1780 1.4092 1.2087 -0.3053 0.3569  0.2428  24  DT  C N3    
1376 C C4    . DT  C 11  ? 1.2028 1.3609 1.1937 -0.2442 0.3631  0.2190  24  DT  C C4    
1377 O O4    . DT  C 11  ? 1.2161 1.2415 1.0919 -0.2468 0.3566  0.2186  24  DT  C O4    
1378 C C5    . DT  C 11  ? 1.1460 1.3934 1.2430 -0.1777 0.3757  0.1947  24  DT  C C5    
1379 C C7    . DT  C 11  ? 0.9637 1.1460 1.0320 -0.1088 0.3819  0.1694  24  DT  C C7    
1380 C C6    . DT  C 11  ? 1.0211 1.4091 1.2448 -0.1797 0.3794  0.1954  24  DT  C C6    
1381 P P     . DG  C 12  ? 0.9906 2.0502 1.7713 -0.2369 0.4132  0.1888  25  DG  C P     
1382 O OP1   . DG  C 12  ? 0.9095 2.0984 1.8565 -0.1917 0.4135  0.1650  25  DG  C OP1   
1383 O OP2   . DG  C 12  ? 0.8886 1.8757 1.5589 -0.2244 0.4316  0.1808  25  DG  C OP2   
1384 O "O5'" . DG  C 12  ? 0.6226 1.7219 1.3948 -0.3199 0.4092  0.2175  25  DG  C "O5'" 
1385 C "C5'" . DG  C 12  ? 0.6672 1.7002 1.3811 -0.3743 0.3864  0.2496  25  DG  C "C5'" 
1386 C "C4'" . DG  C 12  ? 0.7515 1.6847 1.3122 -0.4345 0.3880  0.2746  25  DG  C "C4'" 
1387 O "O4'" . DG  C 12  ? 0.8729 1.6589 1.3060 -0.4058 0.3864  0.2699  25  DG  C "O4'" 
1388 C "C3'" . DG  C 12  ? 0.8362 1.8170 1.3699 -0.4673 0.4096  0.2758  25  DG  C "C3'" 
1389 O "O3'" . DG  C 12  ? 0.8375 1.8337 1.3430 -0.5463 0.4021  0.3066  25  DG  C "O3'" 
1390 C "C2'" . DG  C 12  ? 0.8722 1.7189 1.2580 -0.4528 0.4151  0.2742  25  DG  C "C2'" 
1391 C "C1'" . DG  C 12  ? 1.0697 1.7883 1.3818 -0.4495 0.3923  0.2856  25  DG  C "C1'" 
1392 N N9    . DG  C 12  ? 1.2317 1.8105 1.4304 -0.4130 0.3904  0.2767  25  DG  C N9    
1393 C C8    . DG  C 12  ? 1.2145 1.7775 1.4263 -0.3415 0.4006  0.2488  25  DG  C C8    
1394 N N7    . DG  C 12  ? 1.2872 1.7088 1.3836 -0.3246 0.3931  0.2477  25  DG  C N7    
1395 C C5    . DG  C 12  ? 1.4095 1.7470 1.4102 -0.3884 0.3773  0.2752  25  DG  C C5    
1396 C C6    . DG  C 12  ? 1.5323 1.7092 1.3950 -0.4028 0.3624  0.2841  25  DG  C C6    
1397 O O6    . DG  C 12  ? 1.6882 1.7621 1.4865 -0.3595 0.3599  0.2690  25  DG  C O6    
1398 N N1    . DG  C 12  ? 1.5063 1.6443 1.3077 -0.4760 0.3481  0.3129  25  DG  C N1    
1399 C C2    . DG  C 12  ? 1.4534 1.6969 1.3202 -0.5294 0.3476  0.3328  25  DG  C C2    
1400 N N2    . DG  C 12  ? 1.5310 1.7150 1.3209 -0.5987 0.3314  0.3612  25  DG  C N2    
1401 N N3    . DG  C 12  ? 1.3960 1.7923 1.3976 -0.5158 0.3609  0.3243  25  DG  C N3    
1402 C C4    . DG  C 12  ? 1.3738 1.8067 1.4340 -0.4441 0.3754  0.2945  25  DG  C C4    
1403 P P     . DG  C 13  ? 1.3113 2.4260 1.8556 -0.5913 0.4236  0.3074  26  DG  C P     
1404 O OP1   . DG  C 13  ? 1.2812 2.5404 1.9818 -0.6073 0.4197  0.3068  26  DG  C OP1   
1405 O OP2   . DG  C 13  ? 1.1670 2.2990 1.6984 -0.5502 0.4491  0.2797  26  DG  C OP2   
1406 O "O5'" . DG  C 13  ? 1.1657 2.1812 1.5571 -0.6716 0.4138  0.3457  26  DG  C "O5'" 
1407 C "C5'" . DG  C 13  ? 1.1893 2.1140 1.5194 -0.7101 0.3862  0.3753  26  DG  C "C5'" 
1408 C "C4'" . DG  C 13  ? 1.2931 2.0644 1.4419 -0.7544 0.3761  0.4005  26  DG  C "C4'" 
1409 O "O4'" . DG  C 13  ? 1.3741 2.0121 1.4368 -0.7001 0.3719  0.3857  26  DG  C "O4'" 
1410 C "C3'" . DG  C 13  ? 1.3664 2.1571 1.4517 -0.7982 0.3913  0.4098  26  DG  C "C3'" 
1411 O "O3'" . DG  C 13  ? 1.5194 2.2130 1.4786 -0.8712 0.3725  0.4468  26  DG  C "O3'" 
1412 C "C2'" . DG  C 13  ? 1.3783 2.0929 1.3987 -0.7417 0.4010  0.3879  26  DG  C "C2'" 
1413 C "C1'" . DG  C 13  ? 1.4792 2.0483 1.4305 -0.7119 0.3788  0.3896  26  DG  C "C1'" 
1414 N N9    . DG  C 13  ? 1.5449 2.0410 1.4657 -0.6394 0.3836  0.3635  26  DG  C N9    
1415 C C8    . DG  C 13  ? 1.4472 2.0212 1.4648 -0.5699 0.4016  0.3304  26  DG  C C8    
1416 N N7    . DG  C 13  ? 1.4536 1.9304 1.4126 -0.5164 0.4001  0.3147  26  DG  C N7    
1417 C C5    . DG  C 13  ? 1.5883 1.9123 1.4055 -0.5512 0.3795  0.3369  26  DG  C C5    
1418 C C6    . DG  C 13  ? 1.6475 1.8181 1.3567 -0.5199 0.3672  0.3318  26  DG  C C6    
1419 O O6    . DG  C 13  ? 1.5643 1.7052 1.2810 -0.4539 0.3725  0.3076  26  DG  C O6    
1420 N N1    . DG  C 13  ? 1.8010 1.8450 1.3867 -0.5734 0.3452  0.3575  26  DG  C N1    
1421 C C2    . DG  C 13  ? 1.8720 1.9350 1.4365 -0.6497 0.3364  0.3869  26  DG  C C2    
1422 N N2    . DG  C 13  ? 2.0065 1.9304 1.4436 -0.6935 0.3136  0.4083  26  DG  C N2    
1423 N N3    . DG  C 13  ? 1.8092 2.0173 1.4739 -0.6808 0.3479  0.3941  26  DG  C N3    
1424 C C4    . DG  C 13  ? 1.6682 2.0008 1.4580 -0.6274 0.3692  0.3670  26  DG  C C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ARG 2   2   2   ARG ARG A . n 
A 1 3   MET 3   3   3   MET MET A . n 
A 1 4   ASP 4   4   4   ASP ASP A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  CYS 15  15  15  CYS CYS A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  TYR 31  31  31  TYR TYR A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  MET 34  34  34  MET MET A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  MET 45  45  45  MET MET A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  HIS 47  47  47  HIS HIS A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ASP 80  80  80  ASP ASP A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 MET 105 105 105 MET MET A . n 
A 1 106 TRP 106 106 106 TRP TRP A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 GLY 109 109 ?   ?   ?   A . n 
A 1 110 SER 110 110 ?   ?   ?   A . n 
A 1 111 HIS 111 111 ?   ?   ?   A . n 
A 1 112 HIS 112 112 ?   ?   ?   A . n 
A 1 113 HIS 113 113 ?   ?   ?   A . n 
A 1 114 HIS 114 114 ?   ?   ?   A . n 
A 1 115 HIS 115 115 ?   ?   ?   A . n 
A 1 116 HIS 116 116 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  B . n 
B 2 2   DC  2   2   2   DC  DC  B . n 
B 2 3   DC  3   3   3   DC  DC  B . n 
B 2 4   DA  4   4   4   DA  DA  B . n 
B 2 5   DT  5   5   5   DT  DT  B . n 
B 2 6   DG  6   6   6   DG  DG  B . n 
B 2 7   BZG 7   7   7   BZG BZG B . n 
B 2 8   DC  8   8   8   DC  DC  B . n 
B 2 9   DT  9   9   9   DT  DT  B . n 
B 2 10  DA  10  10  10  DA  DA  B . n 
B 2 11  DG  11  11  11  DG  DG  B . n 
B 2 12  DT  12  12  12  DT  DT  B . n 
B 2 13  DA  13  13  13  DA  DA  B . n 
C 3 1   DC  1   14  14  DC  DC  C . n 
C 3 2   DT  2   15  15  DT  DT  C . n 
C 3 3   DA  3   16  16  DA  DA  C . n 
C 3 4   DC  4   17  17  DC  DC  C . n 
C 3 5   DT  5   18  18  DT  DT  C . n 
C 3 6   DA  6   19  19  DA  DA  C . n 
C 3 7   DG  7   20  20  DG  DG  C . n 
C 3 8   DC  8   21  21  DC  DC  C . n 
C 3 9   DC  9   22  22  DC  DC  C . n 
C 3 10  DA  10  23  23  DA  DA  C . n 
C 3 11  DT  11  24  24  DT  DT  C . n 
C 3 12  DG  12  25  25  DG  DG  C . n 
C 3 13  DG  13  26  26  DG  DG  C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3380 ? 
1 MORE         -13  ? 
1 'SSA (A^2)'  9610 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-06-20 
2 'Structure model' 1 1 2012-08-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 32.7237 -23.2597 19.6716  0.4816 0.9007 0.8785 -0.1258 0.3332  0.0072  1.1182  2.0804  1.8666 
-1.0983 0.6618  -1.9062 -1.3337 -1.6990 -0.7292 0.7297  -0.0830 -0.4809 -0.4833 -0.9554 -0.0908 
'X-RAY DIFFRACTION' 2  ? refined 30.1168 -19.1712 13.9637  0.7093 0.8646 0.6683 0.1351  -0.0528 -0.2278 0.0474  0.9452  0.3273 
-0.2179 0.0129  -0.0480 -1.1288 0.6982  1.1224  0.9969  -0.7899 -0.9156 -0.0067 -1.8900 0.0218  
'X-RAY DIFFRACTION' 3  ? refined 32.2269 -13.0915 5.9153   0.7146 0.8737 0.8804 0.0289  0.2315  0.0832  0.1721  0.7085  0.0974 
0.0900  -0.0050 -0.2686 0.7937  -1.2628 3.0528  1.2530  -0.9719 -1.3877 -2.8951 -0.1264 -0.0320 
'X-RAY DIFFRACTION' 4  ? refined 30.5143 -14.8439 -2.8125  0.9591 0.8404 1.0479 0.3669  0.0874  0.1312  0.6579  0.0703  0.0403 
0.2183  -0.3093 -0.1117 -0.1762 -0.5342 2.3566  0.2695  1.2354  -0.5179 -2.3304 -0.4724 0.0162  
'X-RAY DIFFRACTION' 5  ? refined 35.7698 -23.2259 4.9532   0.4196 0.7021 0.9898 0.0121  0.2039  -0.1707 1.7530  0.7927  7.9810 
-1.0578 3.4719  -1.3196 0.2744  -0.5554 0.7418  -1.3521 -0.8397 -0.6916 3.8271  0.6019  0.0592  
'X-RAY DIFFRACTION' 6  ? refined 36.8858 -27.6025 11.5308  0.2661 0.5971 0.8304 0.1505  0.0282  0.0823  0.2184  2.3685  2.1655 
0.4165  -0.0291 1.1669  0.5723  0.4139  1.0964  -1.8493 -1.0350 -3.2490 0.2043  3.2761  -0.0298 
'X-RAY DIFFRACTION' 7  ? refined 27.9272 -28.7356 9.3148   0.5042 0.8938 0.7001 -0.0337 0.2346  0.0680  0.1667  0.1711  0.4690 
0.0026  0.2950  -0.0969 -0.4458 -2.4498 0.7331  -0.4759 0.4478  0.0359  1.6588  -0.5029 0.0028  
'X-RAY DIFFRACTION' 8  ? refined 20.2070 -20.5583 10.9369  0.3829 1.1691 1.0793 -0.0352 0.3378  0.0590  0.7143  1.1117  2.2850 
0.1607  0.0812  1.3556  0.0533  -1.5971 0.4847  0.5397  0.4503  1.2310  0.9346  -1.9967 -0.0222 
'X-RAY DIFFRACTION' 9  ? refined 21.2130 -11.6590 8.4439   1.1922 1.4971 0.8613 0.3022  0.2738  -0.2349 -0.0032 1.3935  0.0065 
-0.1432 0.0360  -0.1171 -0.4559 0.0537  2.6185  0.5828  0.3957  1.6532  2.3166  -0.9221 -0.0172 
'X-RAY DIFFRACTION' 10 ? refined 25.0324 -17.4883 1.0380   0.5869 0.6332 0.7769 0.1555  0.0344  -0.0754 0.2878  0.4384  0.1414 
-0.0005 0.0435  0.2767  0.3086  -0.7365 0.7200  -1.2596 -0.9685 -1.0581 -0.9894 0.0705  -0.0036 
'X-RAY DIFFRACTION' 11 ? refined 27.7688 -27.3898 -5.1953  0.9240 1.0987 0.9312 -0.3889 0.1863  -0.0453 0.1663  0.0135  0.1101 
0.0442  -0.1317 -0.0458 0.0044  -0.4569 -1.8999 1.2768  0.1272  0.6626  1.9716  -2.4082 -0.0011 
'X-RAY DIFFRACTION' 12 ? refined 16.8673 -28.2926 1.3971   0.7358 1.8097 1.1768 0.0502  0.0250  -0.1050 0.0107  -0.0185 0.2113 
-0.0733 0.0393  -0.0351 -1.7176 2.5127  -3.5594 -2.6828 0.5420  1.2876  1.9880  -0.4288 0.0074  
'X-RAY DIFFRACTION' 13 ? refined 17.0891 -20.2343 -3.1971  0.4705 1.5720 0.8862 0.2173  -0.1918 -0.3500 0.3085  0.2177  0.2468 
-0.1029 0.2636  -0.0295 -0.2171 -2.8637 0.3961  -0.1643 -0.6055 -0.9895 0.0123  -0.5276 0.0289  
'X-RAY DIFFRACTION' 14 ? refined 20.4322 -12.9598 -5.4993  0.9989 1.5658 1.3561 0.3428  0.0373  0.1174  0.1302  0.7284  0.2473 
0.2606  0.1803  -0.0074 -1.7691 -0.7895 0.2658  -1.4721 0.7448  2.8280  -0.6279 -0.7577 0.0089  
'X-RAY DIFFRACTION' 15 ? refined 23.5729 -19.6425 -13.1572 1.3855 1.8061 0.8669 -0.4561 -0.1202 -0.0066 0.3258  0.0284  0.0236 
0.0762  0.1159  0.0160  -0.2449 1.1116  0.3439  -3.9364 -0.4796 -1.6346 -0.4667 -0.4999 0.0287  
'X-RAY DIFFRACTION' 16 ? refined 21.2125 -28.3011 -11.7942 0.7326 1.7639 1.3979 0.0666  0.2272  -0.4785 0.9057  1.1845  0.1034 
1.0170  0.2578  0.1567  -0.4760 -0.1297 -2.3767 -0.6476 -0.7136 2.2951  -0.2464 -1.9677 0.0304  
'X-RAY DIFFRACTION' 17 ? refined 32.6489 -20.3521 -10.8029 1.2989 1.4422 0.6986 -0.1631 0.2675  0.2272  0.0163  0.1305  0.5319 
-0.0445 -0.0399 0.2387  -0.5081 -0.0078 -0.1470 -1.9656 0.0426  -0.4838 0.4121  -0.2167 -0.0268 
'X-RAY DIFFRACTION' 18 ? refined 36.5310 -16.1756 -3.2393  0.9520 0.9622 2.1272 -0.1248 0.2361  0.1446  0.6948  -0.0327 0.1589 
-0.1748 -0.3982 0.1022  2.2132  0.6783  0.7639  0.7536  -0.3797 -0.5230 0.3423  0.3807  -0.0020 
'X-RAY DIFFRACTION' 19 ? refined 22.8433 -45.2598 17.8018  2.0610 1.3575 1.1672 -0.1086 0.4797  0.1234  0.1947  1.2946  0.0327 
0.5874  0.1866  0.2492  -3.1726 1.2493  -2.9442 -2.7494 2.0767  -0.1284 2.7693  -1.1178 0.0016  
'X-RAY DIFFRACTION' 20 ? refined 23.9601 -32.1910 5.3387   0.6710 1.1441 0.8206 -0.3484 0.0749  -0.0164 1.5140  2.7354  3.0680 
0.3951  1.5198  -1.7034 0.3593  -0.2290 0.4679  -0.2935 0.0571  0.2282  1.4154  -1.5732 0.0016  
'X-RAY DIFFRACTION' 21 ? refined 36.8309 -40.6053 -5.7709  1.3185 1.1724 1.2130 0.1398  0.3008  -0.2990 0.3115  0.2292  0.1724 
-0.2794 0.3733  -0.2108 0.6662  0.2336  0.1552  -0.1292 0.3498  -2.3349 2.2228  -0.6664 0.0047  
'X-RAY DIFFRACTION' 22 ? refined 29.0588 -41.2727 -7.3715  1.1577 1.3786 1.1183 0.1231  0.2627  -0.1409 2.6077  1.5726  0.6724 
1.5676  0.0550  0.7586  0.8281  1.9334  -1.0497 0.2809  0.7547  0.6453  1.9015  -2.7940 0.0079  
'X-RAY DIFFRACTION' 23 ? refined 26.6123 -36.6280 14.4888  1.0685 1.0884 1.0297 -0.1908 0.3473  0.1830  3.5534  2.7958  2.3070 
2.7550  2.0358  0.3549  -0.2734 -0.3098 0.0602  -0.2388 0.7466  0.4221  2.6294  -1.3279 0.0005  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '(chain A and resid 1:6)'     
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '(chain A and resid 7:11)'    
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '(chain A and resid 12:18)'   
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '(chain A and resid 19:24)'   
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '(chain A and resid 25:31)'   
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '(chain A and resid 32:37)'   
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '(chain A and resid 38:43)'   
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '(chain A and resid 44:50)'   
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '(chain A and resid 51:55)'   
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(chain A and resid 56:60)'   
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(chain A and resid 61:66)'   
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(chain A and resid 67:74)'   
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(chain A and resid 75:79)'   
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(chain A and resid 80:85)'   
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(chain A and resid 86:91)'   
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(chain A and resid 92:98)'   
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(chain A and resid 99:103)'  
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(chain A and resid 104:108)' 
'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(chain B and resid 1:4)'     
'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(chain B and resid 5:9)'     
'X-RAY DIFFRACTION' 21 21 ? ? ? ? ? ? ? ? ? '(chain B and resid 10:13)'   
'X-RAY DIFFRACTION' 22 22 ? ? ? ? ? ? ? ? ? '(chain C and resid 14:19)'   
'X-RAY DIFFRACTION' 23 23 ? ? ? ? ? ? ? ? ? '(chain C and resid 20:26)'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHASER   phasing           .                            ? 2 
PHENIX   refinement        '(phenix.refine: 1.6.1_357)' ? 3 
HKL-2000 'data reduction'  .                            ? 4 
HKL-2000 'data scaling'    .                            ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C1'" B DC 3  ? ? "O4'" B DC 3  ? ? "C4'" B DC 3  ? ? 103.75 110.10 -6.35 1.00 N 
2  1 "C3'" B DC 3  ? ? "C2'" B DC 3  ? ? "C1'" B DC 3  ? ? 97.09  102.40 -5.31 0.80 N 
3  1 "O4'" B DC 3  ? ? "C1'" B DC 3  ? ? N1    B DC 3  ? ? 113.01 108.30 4.71  0.30 N 
4  1 "C3'" B DT 9  ? ? "C2'" B DT 9  ? ? "C1'" B DT 9  ? ? 95.57  102.40 -6.83 0.80 N 
5  1 "O4'" B DT 9  ? ? "C1'" B DT 9  ? ? N1    B DT 9  ? ? 113.98 108.30 5.68  0.30 N 
6  1 C5    B DT 9  ? ? C4    B DT 9  ? ? O4    B DT 9  ? ? 120.67 124.90 -4.23 0.70 N 
7  1 "O4'" B DT 12 ? ? "C1'" B DT 12 ? ? N1    B DT 12 ? ? 110.29 108.30 1.99  0.30 N 
8  1 "C3'" B DA 13 ? ? "C2'" B DA 13 ? ? "C1'" B DA 13 ? ? 96.99  102.40 -5.41 0.80 N 
9  1 "O4'" B DA 13 ? ? "C1'" B DA 13 ? ? N9    B DA 13 ? ? 110.54 108.30 2.24  0.30 N 
10 1 "C3'" C DC 17 ? ? "C2'" C DC 17 ? ? "C1'" C DC 17 ? ? 96.63  102.40 -5.77 0.80 N 
11 1 "O4'" C DC 21 ? ? "C4'" C DC 21 ? ? "C3'" C DC 21 ? ? 102.05 104.50 -2.45 0.40 N 
12 1 "C3'" C DC 22 ? ? "C2'" C DC 22 ? ? "C1'" C DC 22 ? ? 97.04  102.40 -5.36 0.80 N 
13 1 "O4'" C DT 24 ? ? "C1'" C DT 24 ? ? N1    C DT 24 ? ? 112.45 108.30 4.15  0.30 N 
14 1 "O4'" C DG 26 ? ? "C1'" C DG 26 ? ? N9    C DG 26 ? ? 110.99 108.30 2.69  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 25 ? ? -9.39   -73.50  
2 1 PRO A 50 ? ? -39.13  -27.44  
3 1 GLU A 51 ? ? -104.02 54.86   
4 1 SER A 72 ? ? 82.27   85.38   
5 1 THR A 92 ? ? -68.26  -174.68 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 109 ? A GLY 109 
2 1 Y 1 A SER 110 ? A SER 110 
3 1 Y 1 A HIS 111 ? A HIS 111 
4 1 Y 1 A HIS 112 ? A HIS 112 
5 1 Y 1 A HIS 113 ? A HIS 113 
6 1 Y 1 A HIS 114 ? A HIS 114 
7 1 Y 1 A HIS 115 ? A HIS 115 
8 1 Y 1 A HIS 116 ? A HIS 116 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4ENM 'double helix'         
4ENM 'b-form double helix'  
4ENM 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 2  1_555 C DG 13 1_555 -0.563 0.095  0.861  -11.394 -4.364  -5.974   1  B_DC2:DG26_C  B 2  ? C 26 ? 19 1 
1 B DC 3  1_555 C DG 12 1_555 -0.525 0.310  0.426  -5.703  0.959   -11.269  2  B_DC3:DG25_C  B 3  ? C 25 ? ?  1 
1 B DA 4  1_555 C DT 11 1_555 -0.374 0.268  0.540  8.275   6.306   2.164    3  B_DA4:DT24_C  B 4  ? C 24 ? 20 1 
1 B DT 5  1_555 C DA 10 1_555 -0.390 -0.151 0.113  7.184   -11.506 -1.809   4  B_DT5:DA23_C  B 5  ? C 23 ? 20 1 
1 B DG 6  1_555 C DC 9  1_555 -0.388 -0.142 -0.036 9.793   1.780   -3.842   5  B_DG6:DC22_C  B 6  ? C 22 ? 19 1 
1 B DC 8  1_555 C DG 7  1_555 -1.158 -0.334 -0.261 -6.437  -3.726  -0.039   6  B_DC8:DG20_C  B 8  ? C 20 ? 19 1 
1 B DT 9  1_555 C DA 6  1_555 -0.376 2.858  0.223  -6.844  -5.952  -102.427 7  B_DT9:DA19_C  B 9  ? C 19 ? ?  ? 
1 B DA 10 1_555 C DT 5  1_555 0.586  0.242  -0.039 4.642   -10.194 10.203   8  B_DA10:DT18_C B 10 ? C 18 ? ?  ? 
1 B DG 11 1_555 C DC 4  1_555 0.263  -0.162 0.042  -2.599  -8.576  1.248    9  B_DG11:DC17_C B 11 ? C 17 ? 19 1 
1 B DT 12 1_555 C DA 3  1_555 0.247  -0.041 -0.090 1.179   -12.853 7.760    10 B_DT12:DA16_C B 12 ? C 16 ? 20 1 
1 B DA 13 1_555 C DT 2  1_555 0.616  -0.095 0.272  10.076  -7.224  -13.171  11 B_DA13:DT15_C B 13 ? C 15 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 2  1_555 C DG 13 1_555 B DC 3  1_555 C DG 12 1_555 0.128  -0.868 3.094 5.788  4.986  33.186 -2.224  0.640  2.917 8.588  
-9.971 34.030 1 BB_DC2DC3:DG25DG26_CC   B 2  ? C 26 ? B 3  ? C 25 ? 
1 B DC 3  1_555 C DG 12 1_555 B DA 4  1_555 C DT 11 1_555 -0.102 -0.409 2.792 -4.315 7.986  35.084 -1.605  -0.348 2.633 12.981 
7.015  36.203 2 BB_DC3DA4:DT24DG25_CC   B 3  ? C 25 ? B 4  ? C 24 ? 
1 B DA 4  1_555 C DT 11 1_555 B DT 5  1_555 C DA 10 1_555 -0.377 -1.073 3.390 3.403  -1.943 30.408 -1.632  1.411  3.390 -3.686 
-6.454 30.654 3 BB_DA4DT5:DA23DT24_CC   B 4  ? C 24 ? B 5  ? C 23 ? 
1 B DT 5  1_555 C DA 10 1_555 B DG 6  1_555 C DC 9  1_555 0.791  0.655  3.329 2.556  6.534  33.337 0.030   -0.925 3.442 11.235 
-4.395 34.047 4 BB_DT5DG6:DC22DA23_CC   B 5  ? C 23 ? B 6  ? C 22 ? 
1 B DC 8  1_555 C DG 7  1_555 B DT 9  1_555 C DA 6  1_555 0.383  -1.652 3.116 1.237  6.175  81.685 -1.406  -0.263 3.012 4.715  
-0.945 81.885 5 BB_DC8DT9:DA19DG20_CC   B 8  ? C 20 ? B 9  ? C 19 ? 
1 B DT 9  1_555 C DA 6  1_555 B DA 10 1_555 C DT 5  1_555 0.448  2.161  3.415 -0.120 -0.963 -9.085 -11.236 2.521  3.629 6.054  
-0.753 -9.136 6 BB_DT9DA10:DT18DA19_CC  B 9  ? C 19 ? B 10 ? C 18 ? 
1 B DA 10 1_555 C DT 5  1_555 B DG 11 1_555 C DC 4  1_555 -0.133 -0.426 3.473 -2.536 2.297  33.191 -1.146  -0.214 3.437 4.008  
4.424  33.362 7 BB_DA10DG11:DC17DT18_CC B 10 ? C 18 ? B 11 ? C 17 ? 
1 B DG 11 1_555 C DC 4  1_555 B DT 12 1_555 C DA 3  1_555 0.152  -0.220 3.114 2.661  1.364  31.705 -0.637  0.185  3.104 2.490  
-4.856 31.842 8 BB_DG11DT12:DA16DC17_CC B 11 ? C 17 ? B 12 ? C 16 ? 
1 B DT 12 1_555 C DA 3  1_555 B DA 13 1_555 C DT 2  1_555 -0.957 -0.618 3.128 -2.459 1.643  35.608 -1.236  1.218  3.154 2.682  
4.012  35.726 9 BB_DT12DA13:DT15DA16_CC B 12 ? C 16 ? B 13 ? C 15 ? 
#