data_4EOH
# 
_entry.id   4EOH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4EOH         
RCSB  RCSB071873   
WWPDB D_1000071873 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2012-05-02 
_pdbx_database_PDB_obs_spr.pdb_id           4EOH 
_pdbx_database_PDB_obs_spr.replace_pdb_id   3KBI 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3KBI . unspecified 
PDB 4EN4 . unspecified 
# 
_pdbx_database_status.entry_id                        4EOH 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-04-14 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Safo, M.K.'    1 
'Gandhi, A.K.'  2 
'Musayev, F.N.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structures of human pyridoxal kinase in complex with the neurotoxins, ginkgotoxin and theophylline: insights into pyridoxal kinase inhibition.
;
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            7 
_citation.page_first                e40954 
_citation.page_last                 e40954 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22879864 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0040954 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gandhi, A.K.'      1  
primary 'Desai, J.V.'       2  
primary 'Ghatge, M.S.'      3  
primary 'di Salvo, M.L.'    4  
primary 'Di Biase, S.'      5  
primary 'Danso-Danquah, R.' 6  
primary 'Musayev, F.N.'     7  
primary 'Contestabile, R.'  8  
primary 'Schirch, V.'       9  
primary 'Safo, M.K.'        10 
# 
_cell.length_a           92.302 
_cell.length_b           115.848 
_cell.length_c           171.904 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4EOH 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.entry_id                         4EOH 
_symmetry.Int_Tables_number                23 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Pyridoxal Kinase'              35143.266 2   2.7.1.35 ? ? ? 
2 non-polymer syn 'SODIUM ION'                    22.990    2   ?        ? ? ? 
3 non-polymer syn THEOPHYLLINE                    180.164   2   ?        ? ? ? 
4 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174   14  ?        ? ? ? 
5 non-polymer syn 'SULFATE ION'                   96.063    7   ?        ? ? ? 
6 water       nat water                           18.015    355 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PL kinase, pyridoxine kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
KIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
KIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   GLU n 
1 4   GLU n 
1 5   CYS n 
1 6   ARG n 
1 7   VAL n 
1 8   LEU n 
1 9   SER n 
1 10  ILE n 
1 11  GLN n 
1 12  SER n 
1 13  HIS n 
1 14  VAL n 
1 15  ILE n 
1 16  ARG n 
1 17  GLY n 
1 18  TYR n 
1 19  VAL n 
1 20  GLY n 
1 21  ASN n 
1 22  ARG n 
1 23  ALA n 
1 24  ALA n 
1 25  THR n 
1 26  PHE n 
1 27  PRO n 
1 28  LEU n 
1 29  GLN n 
1 30  VAL n 
1 31  LEU n 
1 32  GLY n 
1 33  PHE n 
1 34  GLU n 
1 35  ILE n 
1 36  ASP n 
1 37  ALA n 
1 38  VAL n 
1 39  ASN n 
1 40  SER n 
1 41  VAL n 
1 42  GLN n 
1 43  PHE n 
1 44  SER n 
1 45  ASN n 
1 46  HIS n 
1 47  THR n 
1 48  GLY n 
1 49  TYR n 
1 50  ALA n 
1 51  HIS n 
1 52  TRP n 
1 53  LYS n 
1 54  GLY n 
1 55  GLN n 
1 56  VAL n 
1 57  LEU n 
1 58  ASN n 
1 59  SER n 
1 60  ASP n 
1 61  GLU n 
1 62  LEU n 
1 63  GLN n 
1 64  GLU n 
1 65  LEU n 
1 66  TYR n 
1 67  GLU n 
1 68  GLY n 
1 69  LEU n 
1 70  ARG n 
1 71  LEU n 
1 72  ASN n 
1 73  ASN n 
1 74  MET n 
1 75  ASN n 
1 76  LYS n 
1 77  TYR n 
1 78  ASP n 
1 79  TYR n 
1 80  VAL n 
1 81  LEU n 
1 82  THR n 
1 83  GLY n 
1 84  TYR n 
1 85  THR n 
1 86  ARG n 
1 87  ASP n 
1 88  LYS n 
1 89  SER n 
1 90  PHE n 
1 91  LEU n 
1 92  ALA n 
1 93  MET n 
1 94  VAL n 
1 95  VAL n 
1 96  ASP n 
1 97  ILE n 
1 98  VAL n 
1 99  GLN n 
1 100 GLU n 
1 101 LEU n 
1 102 LYS n 
1 103 GLN n 
1 104 GLN n 
1 105 ASN n 
1 106 PRO n 
1 107 ARG n 
1 108 LEU n 
1 109 VAL n 
1 110 TYR n 
1 111 VAL n 
1 112 CYS n 
1 113 ASP n 
1 114 PRO n 
1 115 VAL n 
1 116 LEU n 
1 117 GLY n 
1 118 ASP n 
1 119 LYS n 
1 120 TRP n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 GLY n 
1 125 SER n 
1 126 MET n 
1 127 TYR n 
1 128 VAL n 
1 129 PRO n 
1 130 GLU n 
1 131 ASP n 
1 132 LEU n 
1 133 LEU n 
1 134 PRO n 
1 135 VAL n 
1 136 TYR n 
1 137 LYS n 
1 138 GLU n 
1 139 LYS n 
1 140 VAL n 
1 141 VAL n 
1 142 PRO n 
1 143 LEU n 
1 144 ALA n 
1 145 ASP n 
1 146 ILE n 
1 147 ILE n 
1 148 THR n 
1 149 PRO n 
1 150 ASN n 
1 151 GLN n 
1 152 PHE n 
1 153 GLU n 
1 154 ALA n 
1 155 GLU n 
1 156 LEU n 
1 157 LEU n 
1 158 SER n 
1 159 GLY n 
1 160 ARG n 
1 161 LYS n 
1 162 ILE n 
1 163 HIS n 
1 164 SER n 
1 165 GLN n 
1 166 GLU n 
1 167 GLU n 
1 168 ALA n 
1 169 LEU n 
1 170 ARG n 
1 171 VAL n 
1 172 MET n 
1 173 ASP n 
1 174 MET n 
1 175 LEU n 
1 176 HIS n 
1 177 SER n 
1 178 MET n 
1 179 GLY n 
1 180 PRO n 
1 181 ASP n 
1 182 THR n 
1 183 VAL n 
1 184 VAL n 
1 185 ILE n 
1 186 THR n 
1 187 SER n 
1 188 SER n 
1 189 ASP n 
1 190 LEU n 
1 191 PRO n 
1 192 SER n 
1 193 PRO n 
1 194 GLN n 
1 195 GLY n 
1 196 SER n 
1 197 ASN n 
1 198 TYR n 
1 199 LEU n 
1 200 ILE n 
1 201 VAL n 
1 202 LEU n 
1 203 GLY n 
1 204 SER n 
1 205 GLN n 
1 206 ARG n 
1 207 ARG n 
1 208 ARG n 
1 209 ASN n 
1 210 PRO n 
1 211 ALA n 
1 212 GLY n 
1 213 SER n 
1 214 VAL n 
1 215 VAL n 
1 216 MET n 
1 217 GLU n 
1 218 ARG n 
1 219 ILE n 
1 220 ARG n 
1 221 MET n 
1 222 ASP n 
1 223 ILE n 
1 224 ARG n 
1 225 LYS n 
1 226 VAL n 
1 227 ASP n 
1 228 ALA n 
1 229 VAL n 
1 230 PHE n 
1 231 VAL n 
1 232 GLY n 
1 233 THR n 
1 234 GLY n 
1 235 ASP n 
1 236 LEU n 
1 237 PHE n 
1 238 ALA n 
1 239 ALA n 
1 240 MET n 
1 241 LEU n 
1 242 LEU n 
1 243 ALA n 
1 244 TRP n 
1 245 THR n 
1 246 HIS n 
1 247 LYS n 
1 248 HIS n 
1 249 PRO n 
1 250 ASN n 
1 251 ASN n 
1 252 LEU n 
1 253 LYS n 
1 254 VAL n 
1 255 ALA n 
1 256 CYS n 
1 257 GLU n 
1 258 LYS n 
1 259 THR n 
1 260 VAL n 
1 261 SER n 
1 262 THR n 
1 263 LEU n 
1 264 HIS n 
1 265 HIS n 
1 266 VAL n 
1 267 LEU n 
1 268 GLN n 
1 269 ARG n 
1 270 THR n 
1 271 ILE n 
1 272 GLN n 
1 273 CYS n 
1 274 ALA n 
1 275 LYS n 
1 276 ALA n 
1 277 GLN n 
1 278 ALA n 
1 279 GLY n 
1 280 GLU n 
1 281 GLY n 
1 282 VAL n 
1 283 ARG n 
1 284 PRO n 
1 285 SER n 
1 286 PRO n 
1 287 MET n 
1 288 GLN n 
1 289 LEU n 
1 290 GLU n 
1 291 LEU n 
1 292 ARG n 
1 293 MET n 
1 294 VAL n 
1 295 GLN n 
1 296 SER n 
1 297 LYS n 
1 298 ARG n 
1 299 ASP n 
1 300 ILE n 
1 301 GLU n 
1 302 ASP n 
1 303 PRO n 
1 304 GLU n 
1 305 ILE n 
1 306 VAL n 
1 307 VAL n 
1 308 GLN n 
1 309 ALA n 
1 310 THR n 
1 311 VAL n 
1 312 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PDXK, C21orf124, C21orf97, PKH, PNK, PRED79' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDXK_HUMAN 
_struct_ref.pdbx_db_accession          O00764 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYV
LTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGR
KIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4EOH A 1 ? 312 ? O00764 1 ? 312 ? 1 312 
2 1 4EOH B 1 ? 312 ? O00764 1 ? 312 ? 1 312 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'  149.211 
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2'      118.174 
NA  non-polymer         . 'SODIUM ION'                    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                   ? 'O4 S -2'        96.063  
TEP non-polymer         . THEOPHYLLINE                    ? 'C7 H8 N4 O2'    180.164 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4EOH 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.27 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.37 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '48-50% MPD, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Ni filter' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     4EOH 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             37.68 
_reflns.number_obs                   52989 
_reflns.pdbx_scaling_rejects         17026 
_reflns.pdbx_Rmerge_I_obs            0.032 
_reflns.pdbx_netI_over_sigmaI        18.5 
_reflns.pdbx_chi_squared             0.860 
_reflns.pdbx_redundancy              2.97 
_reflns.percent_possible_obs         98.1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.100 2.180  ? 16065 ? 0.241 4.10  ? 0.95 2.84 ? 5211 98.0 1  1 
2.180 2.260  ? 16833 ? 0.192 4.80  ? 0.90 2.95 ? 5280 98.7 2  1 
2.260 2.370  ? 17224 ? 0.160 5.60  ? 0.92 2.99 ? 5338 99.3 3  1 
2.370 2.490  ? 17170 ? 0.125 6.90  ? 0.90 3.02 ? 5298 99.7 4  1 
2.490 2.650  ? 17555 ? 0.088 9.20  ? 0.84 3.04 ? 5356 99.6 5  1 
2.650 2.850  ? 17677 ? 0.066 12.00 ? 0.82 3.11 ? 5332 99.5 6  1 
2.850 3.140  ? 17955 ? 0.047 16.40 ? 0.77 3.15 ? 5392 99.7 7  1 
3.140 3.590  ? 17939 ? 0.029 26.60 ? 0.78 3.11 ? 5374 99.5 8  1 
3.590 4.520  ? 18063 ? 0.019 42.20 ? 0.81 2.89 ? 5328 97.2 9  1 
4.520 37.680 ? 18143 ? 0.014 64.70 ? 0.93 2.62 ? 5080 90.1 10 1 
# 
_refine.entry_id                                 4EOH 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             29.19 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2572397.0 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.ls_percent_reflns_obs                    98.0 
_refine.ls_number_reflns_obs                     52986 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2050 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2540 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2688 
_refine.ls_R_factor_R_free_error                 0.0050 
_refine.B_iso_mean                               49.4575 
_refine.solvent_model_param_bsol                 74.3587 
_refine.solvent_model_param_ksol                 0.3571 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.aniso_B[1][1]                            11.0500 
_refine.aniso_B[2][2]                            -2.6600 
_refine.aniso_B[3][3]                            -8.3900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3FHX' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                100.000 
_refine.B_iso_min                                15.510 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        4EOH 
_refine_analyze.Luzzati_coordinate_error_obs    0.260 
_refine_analyze.Luzzati_sigma_a_obs             0.350 
_refine_analyze.Luzzati_d_res_low_obs           5.000 
_refine_analyze.Luzzati_coordinate_error_free   0.320 
_refine_analyze.Luzzati_sigma_a_free            0.410 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4818 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         175 
_refine_hist.number_atoms_solvent             355 
_refine_hist.number_atoms_total               5348 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        29.19 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
c_bond_d           ? 0.006  ?     ? ? 'X-RAY DIFFRACTION' 
c_angle_deg        ? 1.300  ?     ? ? 'X-RAY DIFFRACTION' 
c_dihedral_angle_d ? 22.300 ?     ? ? 'X-RAY DIFFRACTION' 
c_improper_angle_d ? 2.220  ?     ? ? 'X-RAY DIFFRACTION' 
c_mcbond_it        ? 5.210  1.500 ? ? 'X-RAY DIFFRACTION' 
c_mcangle_it       ? 6.360  2.000 ? ? 'X-RAY DIFFRACTION' 
c_scbond_it        ? 7.550  2.000 ? ? 'X-RAY DIFFRACTION' 
c_scangle_it       ? 9.000  2.500 ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.180 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.percent_reflns_obs               98.0 
_refine_ls_shell.number_reflns_R_work             4941 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3370 
_refine_ls_shell.R_factor_R_free                  0.3720 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             264 
_refine_ls_shell.R_factor_R_free_error            0.0230 
_refine_ls_shell.number_reflns_all                5205 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param &_1_TOPOLOGY_INFILE_1 'X-RAY DIFFRACTION' 
2 water_rep.param   &_1_TOPOLOGY_INFILE_2 'X-RAY DIFFRACTION' 
3 sulfate.par       &_1_TOPOLOGY_INFILE_3 'X-RAY DIFFRACTION' 
4 mpd.par           &_1_TOPOLOGY_INFILE_4 'X-RAY DIFFRACTION' 
5 ion.param         &_1_TOPOLOGY_INFILE_5 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4EOH 
_struct.title                     'Crystal Structure of Human PL Kinase with bound Theophylline' 
_struct.pdbx_descriptor           'Pyridoxal Kinase (E.C.2.7.1.35)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4EOH 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            'TRANSFERASE-TRANSFERASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 4 ? 
F  N N 4 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 6 ? 
CA N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 20  ? LEU A 31  ? GLY A 20  LEU A 31  1 ? 12 
HELX_P HELX_P2  2  ASN A 58  ? ASN A 72  ? ASN A 58  ASN A 72  1 ? 15 
HELX_P HELX_P3  3  ASP A 87  ? ASN A 105 ? ASP A 87  ASN A 105 1 ? 19 
HELX_P HELX_P4  4  LEU A 132 ? LYS A 139 ? LEU A 132 LYS A 139 1 ? 8  
HELX_P HELX_P5  5  LYS A 139 ? ALA A 144 ? LYS A 139 ALA A 144 1 ? 6  
HELX_P HELX_P6  6  ASN A 150 ? GLY A 159 ? ASN A 150 GLY A 159 1 ? 10 
HELX_P HELX_P7  7  SER A 164 ? GLY A 179 ? SER A 164 GLY A 179 1 ? 16 
HELX_P HELX_P8  8  GLY A 232 ? HIS A 248 ? GLY A 232 HIS A 248 1 ? 17 
HELX_P HELX_P9  9  ASN A 251 ? ALA A 278 ? ASN A 251 ALA A 278 1 ? 28 
HELX_P HELX_P10 10 MET A 293 ? GLN A 295 ? MET A 293 GLN A 295 5 ? 3  
HELX_P HELX_P11 11 SER A 296 ? ASP A 302 ? SER A 296 ASP A 302 1 ? 7  
HELX_P HELX_P12 12 GLY B 20  ? LEU B 31  ? GLY B 20  LEU B 31  1 ? 12 
HELX_P HELX_P13 13 ASN B 58  ? ASN B 72  ? ASN B 58  ASN B 72  1 ? 15 
HELX_P HELX_P14 14 ASP B 87  ? ASN B 105 ? ASP B 87  ASN B 105 1 ? 19 
HELX_P HELX_P15 15 PRO B 129 ? ASP B 131 ? PRO B 129 ASP B 131 5 ? 3  
HELX_P HELX_P16 16 LEU B 132 ? LYS B 139 ? LEU B 132 LYS B 139 1 ? 8  
HELX_P HELX_P17 17 LYS B 139 ? ALA B 144 ? LYS B 139 ALA B 144 1 ? 6  
HELX_P HELX_P18 18 ASN B 150 ? GLY B 159 ? ASN B 150 GLY B 159 1 ? 10 
HELX_P HELX_P19 19 SER B 164 ? GLY B 179 ? SER B 164 GLY B 179 1 ? 16 
HELX_P HELX_P20 20 GLY B 232 ? HIS B 248 ? GLY B 232 HIS B 248 1 ? 17 
HELX_P HELX_P21 21 ASN B 251 ? GLN B 277 ? ASN B 251 GLN B 277 1 ? 27 
HELX_P HELX_P22 22 MET B 293 ? GLN B 295 ? MET B 293 GLN B 295 5 ? 3  
HELX_P HELX_P23 23 SER B 296 ? ASP B 302 ? SER B 296 ASP B 302 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C NA . NA ? ? ? 1_555 BA HOH . O ? ? A NA 401 A HOH 645 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc2 metalc ? ? M NA . NA ? ? ? 1_555 CA HOH . O ? ? B NA 401 B HOH 691 1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc3 metalc ? ? C NA . NA ? ? ? 1_555 BA HOH . O ? ? A NA 401 A HOH 537 1_555 ? ? ? ? ? ? ? 2.663 ? 
metalc4 metalc ? ? M NA . NA ? ? ? 1_555 CA HOH . O ? ? B NA 401 B HOH 615 1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc5 metalc ? ? C NA . NA ? ? ? 1_555 BA HOH . O ? ? A NA 401 A HOH 539 1_555 ? ? ? ? ? ? ? 2.838 ? 
metalc6 metalc ? ? C NA . NA ? ? ? 1_555 BA HOH . O ? ? A NA 401 A HOH 536 1_555 ? ? ? ? ? ? ? 2.847 ? 
metalc7 metalc ? ? M NA . NA ? ? ? 1_555 CA HOH . O ? ? B NA 401 B HOH 628 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc8 metalc ? ? M NA . NA ? ? ? 1_555 CA HOH . O ? ? B NA 401 B HOH 690 1_555 ? ? ? ? ? ? ? 2.867 ? 
metalc9 metalc ? ? C NA . NA ? ? ? 1_555 BA HOH . O ? ? A NA 401 A HOH 538 1_555 ? ? ? ? ? ? ? 3.081 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 2  ? 
C ? 10 ? 
D ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
B 1 2  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? parallel      
C 3 4  ? parallel      
C 4 5  ? parallel      
C 5 6  ? parallel      
C 6 7  ? parallel      
C 7 8  ? anti-parallel 
C 8 9  ? anti-parallel 
C 9 10 ? anti-parallel 
D 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLY A 54  ? VAL A 56  ? GLY A 54  VAL A 56  
A 2  GLU A 34  ? PHE A 43  ? GLU A 34  PHE A 43  
A 3  ARG A 6   ? VAL A 14  ? ARG A 6   VAL A 14  
A 4  TYR A 79  ? THR A 82  ? TYR A 79  THR A 82  
A 5  VAL A 109 ? CYS A 112 ? VAL A 109 CYS A 112 
A 6  ILE A 146 ? ILE A 147 ? ILE A 146 ILE A 147 
A 7  THR A 182 ? ILE A 185 ? THR A 182 ILE A 185 
A 8  TYR A 198 ? ARG A 206 ? TYR A 198 ARG A 206 
A 9  MET A 216 ? ARG A 224 ? MET A 216 ARG A 224 
A 10 THR A 310 ? VAL A 311 ? THR A 310 VAL A 311 
B 1  GLY A 117 ? LYS A 119 ? GLY A 117 LYS A 119 
B 2  GLY A 124 ? MET A 126 ? GLY A 124 MET A 126 
C 1  GLY B 54  ? VAL B 56  ? GLY B 54  VAL B 56  
C 2  GLU B 34  ? PHE B 43  ? GLU B 34  PHE B 43  
C 3  ARG B 6   ? VAL B 14  ? ARG B 6   VAL B 14  
C 4  TYR B 79  ? THR B 82  ? TYR B 79  THR B 82  
C 5  VAL B 109 ? CYS B 112 ? VAL B 109 CYS B 112 
C 6  ILE B 146 ? ILE B 147 ? ILE B 146 ILE B 147 
C 7  THR B 182 ? ILE B 185 ? THR B 182 ILE B 185 
C 8  TYR B 198 ? ARG B 208 ? TYR B 198 ARG B 208 
C 9  VAL B 214 ? ARG B 224 ? VAL B 214 ARG B 224 
C 10 THR B 310 ? VAL B 311 ? THR B 310 VAL B 311 
D 1  GLY B 117 ? ASP B 118 ? GLY B 117 ASP B 118 
D 2  SER B 125 ? MET B 126 ? SER B 125 MET B 126 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O GLN A 55  ? O GLN A 55  N GLN A 42  ? N GLN A 42  
A 2 3  O ASP A 36  ? O ASP A 36  N VAL A 7   ? N VAL A 7   
A 3 4  N LEU A 8   ? N LEU A 8   O LEU A 81  ? O LEU A 81  
A 4 5  N VAL A 80  ? N VAL A 80  O VAL A 111 ? O VAL A 111 
A 5 6  N CYS A 112 ? N CYS A 112 O ILE A 146 ? O ILE A 146 
A 6 7  N ILE A 147 ? N ILE A 147 O THR A 182 ? O THR A 182 
A 7 8  N ILE A 185 ? N ILE A 185 O LEU A 202 ? O LEU A 202 
A 8 9  N LEU A 199 ? N LEU A 199 O ILE A 223 ? O ILE A 223 
A 9 10 N ARG A 220 ? N ARG A 220 O THR A 310 ? O THR A 310 
B 1 2  N ASP A 118 ? N ASP A 118 O SER A 125 ? O SER A 125 
C 1 2  O GLN B 55  ? O GLN B 55  N GLN B 42  ? N GLN B 42  
C 2 3  O ASP B 36  ? O ASP B 36  N VAL B 7   ? N VAL B 7   
C 3 4  N LEU B 8   ? N LEU B 8   O LEU B 81  ? O LEU B 81  
C 4 5  N VAL B 80  ? N VAL B 80  O VAL B 111 ? O VAL B 111 
C 5 6  N CYS B 112 ? N CYS B 112 O ILE B 146 ? O ILE B 146 
C 6 7  N ILE B 147 ? N ILE B 147 O THR B 182 ? O THR B 182 
C 7 8  N VAL B 183 ? N VAL B 183 O SER B 204 ? O SER B 204 
C 8 9  N LEU B 199 ? N LEU B 199 O ILE B 223 ? O ILE B 223 
C 9 10 N ARG B 220 ? N ARG B 220 O THR B 310 ? O THR B 310 
D 1 2  N ASP B 118 ? N ASP B 118 O SER B 125 ? O SER B 125 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 401'  
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE TEP A 402' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD A 403' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MPD A 404' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD A 405' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD A 406' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD A 407' 
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 408' 
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 409' 
BC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 410' 
BC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA B 401'  
BC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE TEP B 402' 
BC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD B 403' 
BC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MPD B 404' 
BC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MPD B 405' 
BC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MPD B 406' 
BC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MPD B 407' 
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MPD B 408' 
CC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MPD B 409' 
CC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD B 410' 
CC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MPD B 411' 
CC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 412' 
CC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 413' 
CC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 414' 
CC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 B 415' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6 GLU A  153 ? GLU A 153 . ? 1_555 ? 
2   AC1 6 HOH BA .   ? HOH A 536 . ? 1_555 ? 
3   AC1 6 HOH BA .   ? HOH A 537 . ? 1_555 ? 
4   AC1 6 HOH BA .   ? HOH A 538 . ? 1_555 ? 
5   AC1 6 HOH BA .   ? HOH A 539 . ? 1_555 ? 
6   AC1 6 HOH BA .   ? HOH A 645 . ? 1_555 ? 
7   AC2 7 SER A  12  ? SER A 12  . ? 1_555 ? 
8   AC2 7 GLY A  20  ? GLY A 20  . ? 1_555 ? 
9   AC2 7 VAL A  231 ? VAL A 231 . ? 1_555 ? 
10  AC2 7 ASP A  235 ? ASP A 235 . ? 1_555 ? 
11  AC2 7 HOH BA .   ? HOH A 546 . ? 1_555 ? 
12  AC2 7 HOH BA .   ? HOH A 631 . ? 1_555 ? 
13  AC2 7 HOH BA .   ? HOH A 633 . ? 1_555 ? 
14  AC3 5 SER A  12  ? SER A 12  . ? 1_555 ? 
15  AC3 5 PHE A  43  ? PHE A 43  . ? 1_555 ? 
16  AC3 5 HIS A  46  ? HIS A 46  . ? 1_555 ? 
17  AC3 5 THR A  47  ? THR A 47  . ? 1_555 ? 
18  AC3 5 HOH BA .   ? HOH A 647 . ? 1_555 ? 
19  AC4 3 THR A  186 ? THR A 186 . ? 1_555 ? 
20  AC4 3 GLY A  234 ? GLY A 234 . ? 1_555 ? 
21  AC4 3 LEU A  263 ? LEU A 263 . ? 1_555 ? 
22  AC5 5 LYS A  76  ? LYS A 76  . ? 1_555 ? 
23  AC5 5 TYR A  77  ? TYR A 77  . ? 1_555 ? 
24  AC5 5 ASP A  78  ? ASP A 78  . ? 1_555 ? 
25  AC5 5 ASN A  105 ? ASN A 105 . ? 1_555 ? 
26  AC5 5 HOH BA .   ? HOH A 636 . ? 1_555 ? 
27  AC6 5 ILE A  223 ? ILE A 223 . ? 1_555 ? 
28  AC6 5 ARG A  224 ? ARG A 224 . ? 1_555 ? 
29  AC6 5 VAL A  226 ? VAL A 226 . ? 1_555 ? 
30  AC6 5 HIS A  264 ? HIS A 264 . ? 1_555 ? 
31  AC6 5 HOH BA .   ? HOH A 541 . ? 1_555 ? 
32  AC7 4 CYS A  5   ? CYS A 5   . ? 1_555 ? 
33  AC7 4 LEU A  31  ? LEU A 31  . ? 1_555 ? 
34  AC7 4 GLY A  32  ? GLY A 32  . ? 1_555 ? 
35  AC7 4 LYS A  247 ? LYS A 247 . ? 1_555 ? 
36  AC8 2 LEU A  156 ? LEU A 156 . ? 1_555 ? 
37  AC8 2 LYS A  161 ? LYS A 161 . ? 1_555 ? 
38  AC9 3 ARG A  70  ? ARG A 70  . ? 1_555 ? 
39  AC9 3 MET A  93  ? MET A 93  . ? 1_555 ? 
40  AC9 3 GLU A  100 ? GLU A 100 . ? 1_555 ? 
41  BC1 7 SER A  40  ? SER A 40  . ? 1_555 ? 
42  BC1 7 VAL A  56  ? VAL A 56  . ? 1_555 ? 
43  BC1 7 THR A  85  ? THR A 85  . ? 1_555 ? 
44  BC1 7 ARG A  86  ? ARG A 86  . ? 1_555 ? 
45  BC1 7 ASP A  87  ? ASP A 87  . ? 1_555 ? 
46  BC1 7 PHE A  90  ? PHE A 90  . ? 1_555 ? 
47  BC1 7 HOH BA .   ? HOH A 600 . ? 1_555 ? 
48  BC2 5 GLU B  153 ? GLU B 153 . ? 1_555 ? 
49  BC2 5 HOH CA .   ? HOH B 615 . ? 1_555 ? 
50  BC2 5 HOH CA .   ? HOH B 628 . ? 1_555 ? 
51  BC2 5 HOH CA .   ? HOH B 690 . ? 1_555 ? 
52  BC2 5 HOH CA .   ? HOH B 691 . ? 1_555 ? 
53  BC3 7 SER B  12  ? SER B 12  . ? 1_555 ? 
54  BC3 7 TYR B  84  ? TYR B 84  . ? 1_555 ? 
55  BC3 7 VAL B  231 ? VAL B 231 . ? 1_555 ? 
56  BC3 7 ASP B  235 ? ASP B 235 . ? 1_555 ? 
57  BC3 7 HOH CA .   ? HOH B 630 . ? 1_555 ? 
58  BC3 7 HOH CA .   ? HOH B 660 . ? 1_555 ? 
59  BC3 7 HOH CA .   ? HOH B 693 . ? 1_555 ? 
60  BC4 4 HIS B  46  ? HIS B 46  . ? 1_555 ? 
61  BC4 4 THR B  47  ? THR B 47  . ? 1_555 ? 
62  BC4 4 TYR B  84  ? TYR B 84  . ? 1_555 ? 
63  BC4 4 MPD S  .   ? MPD B 407 . ? 1_555 ? 
64  BC5 2 ASP B  181 ? ASP B 181 . ? 1_555 ? 
65  BC5 2 ARG B  208 ? ARG B 208 . ? 1_555 ? 
66  BC6 1 PRO B  193 ? PRO B 193 . ? 1_555 ? 
67  BC7 4 MET B  126 ? MET B 126 . ? 1_555 ? 
68  BC7 4 GLU B  130 ? GLU B 130 . ? 1_555 ? 
69  BC7 4 LEU B  156 ? LEU B 156 . ? 1_555 ? 
70  BC7 4 HOH CA .   ? HOH B 636 . ? 1_555 ? 
71  BC8 6 SER A  192 ? SER A 192 . ? 7_555 ? 
72  BC8 6 PRO A  193 ? PRO A 193 . ? 7_555 ? 
73  BC8 6 PHE B  43  ? PHE B 43  . ? 1_555 ? 
74  BC8 6 TYR B  84  ? TYR B 84  . ? 1_555 ? 
75  BC8 6 ARG B  86  ? ARG B 86  . ? 1_555 ? 
76  BC8 6 MPD O  .   ? MPD B 403 . ? 1_555 ? 
77  BC9 2 THR B  186 ? THR B 186 . ? 1_555 ? 
78  BC9 2 THR B  233 ? THR B 233 . ? 1_555 ? 
79  CC1 7 VAL B  109 ? VAL B 109 . ? 1_555 ? 
80  CC1 7 THR B  245 ? THR B 245 . ? 1_555 ? 
81  CC1 7 PRO B  249 ? PRO B 249 . ? 1_555 ? 
82  CC1 7 HOH CA .   ? HOH B 514 . ? 1_555 ? 
83  CC1 7 HOH CA .   ? HOH B 572 . ? 1_555 ? 
84  CC1 7 HOH CA .   ? HOH B 678 . ? 1_555 ? 
85  CC1 7 HOH CA .   ? HOH B 684 . ? 1_555 ? 
86  CC2 5 ILE B  223 ? ILE B 223 . ? 1_555 ? 
87  CC2 5 ARG B  224 ? ARG B 224 . ? 1_555 ? 
88  CC2 5 VAL B  226 ? VAL B 226 . ? 1_555 ? 
89  CC2 5 HIS B  264 ? HIS B 264 . ? 1_555 ? 
90  CC2 5 LEU B  267 ? LEU B 267 . ? 1_555 ? 
91  CC3 5 ILE B  223 ? ILE B 223 . ? 1_555 ? 
92  CC3 5 ARG B  224 ? ARG B 224 . ? 1_555 ? 
93  CC3 5 HIS B  264 ? HIS B 264 . ? 1_555 ? 
94  CC3 5 VAL B  306 ? VAL B 306 . ? 1_555 ? 
95  CC3 5 VAL B  307 ? VAL B 307 . ? 1_555 ? 
96  CC4 3 GLN B  63  ? GLN B 63  . ? 1_555 ? 
97  CC4 3 GLU B  100 ? GLU B 100 . ? 1_555 ? 
98  CC4 3 HOH CA .   ? HOH B 689 . ? 1_555 ? 
99  CC5 6 GLU B  4   ? GLU B 4   . ? 1_555 ? 
100 CC5 6 CYS B  5   ? CYS B 5   . ? 1_555 ? 
101 CC5 6 ASP B  78  ? ASP B 78  . ? 1_555 ? 
102 CC5 6 HIS B  246 ? HIS B 246 . ? 1_555 ? 
103 CC5 6 HOH CA .   ? HOH B 581 . ? 1_555 ? 
104 CC5 6 HOH CA .   ? HOH B 663 . ? 1_555 ? 
105 CC6 6 CYS B  5   ? CYS B 5   . ? 1_555 ? 
106 CC6 6 LEU B  31  ? LEU B 31  . ? 1_555 ? 
107 CC6 6 GLY B  32  ? GLY B 32  . ? 1_555 ? 
108 CC6 6 PHE B  33  ? PHE B 33  . ? 1_555 ? 
109 CC6 6 HIS B  246 ? HIS B 246 . ? 1_555 ? 
110 CC6 6 LYS B  247 ? LYS B 247 . ? 1_555 ? 
111 CC7 2 GLU B  155 ? GLU B 155 . ? 1_555 ? 
112 CC7 2 LEU B  156 ? LEU B 156 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4EOH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    4EOH 
_atom_sites.fract_transf_matrix[1][1]   0.010834 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008632 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005817 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A  1 4   ? 2.093   16.259  48.044 1.00 70.34  ? 4   GLU A N   1 
ATOM   2    C  CA  . GLU A  1 4   ? 3.146   15.506  47.306 1.00 72.99  ? 4   GLU A CA  1 
ATOM   3    C  C   . GLU A  1 4   ? 4.365   15.188  48.161 1.00 70.81  ? 4   GLU A C   1 
ATOM   4    O  O   . GLU A  1 4   ? 4.641   15.857  49.160 1.00 64.31  ? 4   GLU A O   1 
ATOM   5    C  CB  . GLU A  1 4   ? 3.600   16.286  46.070 1.00 76.38  ? 4   GLU A CB  1 
ATOM   6    C  CG  . GLU A  1 4   ? 3.813   17.762  46.315 1.00 80.09  ? 4   GLU A CG  1 
ATOM   7    C  CD  . GLU A  1 4   ? 2.621   18.586  45.882 1.00 89.54  ? 4   GLU A CD  1 
ATOM   8    O  OE1 . GLU A  1 4   ? 2.599   19.801  46.170 1.00 100.00 ? 4   GLU A OE1 1 
ATOM   9    O  OE2 . GLU A  1 4   ? 1.708   18.017  45.244 1.00 96.90  ? 4   GLU A OE2 1 
ATOM   10   N  N   . CYS A  1 5   ? 5.090   14.155  47.746 1.00 57.50  ? 5   CYS A N   1 
ATOM   11   C  CA  . CYS A  1 5   ? 6.291   13.720  48.437 1.00 52.88  ? 5   CYS A CA  1 
ATOM   12   C  C   . CYS A  1 5   ? 7.499   14.178  47.626 1.00 46.29  ? 5   CYS A C   1 
ATOM   13   O  O   . CYS A  1 5   ? 7.786   13.643  46.553 1.00 44.10  ? 5   CYS A O   1 
ATOM   14   C  CB  . CYS A  1 5   ? 6.290   12.201  48.575 1.00 55.21  ? 5   CYS A CB  1 
ATOM   15   S  SG  . CYS A  1 5   ? 7.683   11.595  49.509 1.00 58.65  ? 5   CYS A SG  1 
ATOM   16   N  N   . ARG A  1 6   ? 8.198   15.177  48.150 1.00 37.43  ? 6   ARG A N   1 
ATOM   17   C  CA  . ARG A  1 6   ? 9.349   15.745  47.474 1.00 39.33  ? 6   ARG A CA  1 
ATOM   18   C  C   . ARG A  1 6   ? 10.662  15.120  47.900 1.00 35.18  ? 6   ARG A C   1 
ATOM   19   O  O   . ARG A  1 6   ? 10.892  14.867  49.077 1.00 40.55  ? 6   ARG A O   1 
ATOM   20   C  CB  . ARG A  1 6   ? 9.382   17.257  47.704 1.00 36.32  ? 6   ARG A CB  1 
ATOM   21   C  CG  . ARG A  1 6   ? 8.123   17.928  47.207 1.00 42.47  ? 6   ARG A CG  1 
ATOM   22   C  CD  . ARG A  1 6   ? 8.144   19.439  47.326 1.00 42.46  ? 6   ARG A CD  1 
ATOM   23   N  NE  . ARG A  1 6   ? 6.921   19.974  46.734 1.00 48.72  ? 6   ARG A NE  1 
ATOM   24   C  CZ  . ARG A  1 6   ? 6.708   20.098  45.425 1.00 49.02  ? 6   ARG A CZ  1 
ATOM   25   N  NH1 . ARG A  1 6   ? 7.641   19.743  44.549 1.00 41.00  ? 6   ARG A NH1 1 
ATOM   26   N  NH2 . ARG A  1 6   ? 5.540   20.546  44.989 1.00 46.10  ? 6   ARG A NH2 1 
ATOM   27   N  N   . VAL A  1 7   ? 11.524  14.894  46.918 1.00 38.02  ? 7   VAL A N   1 
ATOM   28   C  CA  . VAL A  1 7   ? 12.822  14.288  47.137 1.00 32.77  ? 7   VAL A CA  1 
ATOM   29   C  C   . VAL A  1 7   ? 13.916  15.135  46.499 1.00 40.11  ? 7   VAL A C   1 
ATOM   30   O  O   . VAL A  1 7   ? 13.821  15.490  45.325 1.00 40.54  ? 7   VAL A O   1 
ATOM   31   C  CB  . VAL A  1 7   ? 12.881  12.880  46.488 1.00 37.47  ? 7   VAL A CB  1 
ATOM   32   C  CG1 . VAL A  1 7   ? 14.259  12.268  46.679 1.00 28.01  ? 7   VAL A CG1 1 
ATOM   33   C  CG2 . VAL A  1 7   ? 11.796  11.989  47.065 1.00 32.16  ? 7   VAL A CG2 1 
ATOM   34   N  N   . LEU A  1 8   ? 14.944  15.471  47.275 1.00 37.90  ? 8   LEU A N   1 
ATOM   35   C  CA  . LEU A  1 8   ? 16.076  16.222  46.745 1.00 36.19  ? 8   LEU A CA  1 
ATOM   36   C  C   . LEU A  1 8   ? 17.205  15.206  46.599 1.00 41.03  ? 8   LEU A C   1 
ATOM   37   O  O   . LEU A  1 8   ? 17.746  14.726  47.593 1.00 37.89  ? 8   LEU A O   1 
ATOM   38   C  CB  . LEU A  1 8   ? 16.510  17.333  47.701 1.00 31.90  ? 8   LEU A CB  1 
ATOM   39   C  CG  . LEU A  1 8   ? 17.714  18.163  47.240 1.00 35.56  ? 8   LEU A CG  1 
ATOM   40   C  CD1 . LEU A  1 8   ? 17.363  18.957  45.981 1.00 36.55  ? 8   LEU A CD1 1 
ATOM   41   C  CD2 . LEU A  1 8   ? 18.131  19.109  48.353 1.00 33.15  ? 8   LEU A CD2 1 
ATOM   42   N  N   . SER A  1 9   ? 17.551  14.881  45.359 1.00 34.59  ? 9   SER A N   1 
ATOM   43   C  CA  . SER A  1 9   ? 18.591  13.900  45.080 1.00 27.03  ? 9   SER A CA  1 
ATOM   44   C  C   . SER A  1 9   ? 19.838  14.554  44.522 1.00 36.89  ? 9   SER A C   1 
ATOM   45   O  O   . SER A  1 9   ? 19.834  15.074  43.408 1.00 40.33  ? 9   SER A O   1 
ATOM   46   C  CB  . SER A  1 9   ? 18.068  12.860  44.088 1.00 32.17  ? 9   SER A CB  1 
ATOM   47   O  OG  . SER A  1 9   ? 19.087  11.955  43.711 1.00 35.02  ? 9   SER A OG  1 
ATOM   48   N  N   . ILE A  1 10  ? 20.912  14.516  45.300 1.00 34.17  ? 10  ILE A N   1 
ATOM   49   C  CA  . ILE A  1 10  ? 22.162  15.122  44.879 1.00 36.34  ? 10  ILE A CA  1 
ATOM   50   C  C   . ILE A  1 10  ? 23.106  14.033  44.407 1.00 40.46  ? 10  ILE A C   1 
ATOM   51   O  O   . ILE A  1 10  ? 23.771  13.382  45.211 1.00 42.99  ? 10  ILE A O   1 
ATOM   52   C  CB  . ILE A  1 10  ? 22.802  15.910  46.037 1.00 34.79  ? 10  ILE A CB  1 
ATOM   53   C  CG1 . ILE A  1 10  ? 21.770  16.873  46.624 1.00 31.64  ? 10  ILE A CG1 1 
ATOM   54   C  CG2 . ILE A  1 10  ? 24.012  16.670  45.534 1.00 30.27  ? 10  ILE A CG2 1 
ATOM   55   C  CD1 . ILE A  1 10  ? 22.250  17.658  47.841 1.00 37.26  ? 10  ILE A CD1 1 
ATOM   56   N  N   . GLN A  1 11  ? 23.161  13.839  43.094 1.00 35.64  ? 11  GLN A N   1 
ATOM   57   C  CA  . GLN A  1 11  ? 23.995  12.799  42.520 1.00 36.54  ? 11  GLN A CA  1 
ATOM   58   C  C   . GLN A  1 11  ? 24.529  13.143  41.144 1.00 34.64  ? 11  GLN A C   1 
ATOM   59   O  O   . GLN A  1 11  ? 24.191  14.168  40.560 1.00 38.02  ? 11  GLN A O   1 
ATOM   60   C  CB  . GLN A  1 11  ? 23.204  11.489  42.426 1.00 33.34  ? 11  GLN A CB  1 
ATOM   61   C  CG  . GLN A  1 11  ? 22.728  10.931  43.766 1.00 30.14  ? 11  GLN A CG  1 
ATOM   62   C  CD  . GLN A  1 11  ? 22.036  9.579   43.624 1.00 35.21  ? 11  GLN A CD  1 
ATOM   63   O  OE1 . GLN A  1 11  ? 20.822  9.468   43.785 1.00 42.68  ? 11  GLN A OE1 1 
ATOM   64   N  NE2 . GLN A  1 11  ? 22.810  8.550   43.316 1.00 33.23  ? 11  GLN A NE2 1 
ATOM   65   N  N   . SER A  1 12  ? 25.358  12.249  40.626 1.00 31.23  ? 12  SER A N   1 
ATOM   66   C  CA  . SER A  1 12  ? 25.965  12.420  39.320 1.00 38.59  ? 12  SER A CA  1 
ATOM   67   C  C   . SER A  1 12  ? 24.973  12.333  38.167 1.00 36.85  ? 12  SER A C   1 
ATOM   68   O  O   . SER A  1 12  ? 23.936  11.671  38.258 1.00 33.34  ? 12  SER A O   1 
ATOM   69   C  CB  . SER A  1 12  ? 27.025  11.347  39.105 1.00 34.09  ? 12  SER A CB  1 
ATOM   70   O  OG  . SER A  1 12  ? 28.061  11.463  40.060 1.00 64.38  ? 12  SER A OG  1 
ATOM   71   N  N   . HIS A  1 13  ? 25.315  13.005  37.077 1.00 37.09  ? 13  HIS A N   1 
ATOM   72   C  CA  . HIS A  1 13  ? 24.508  12.964  35.874 1.00 29.74  ? 13  HIS A CA  1 
ATOM   73   C  C   . HIS A  1 13  ? 25.421  12.563  34.734 1.00 41.90  ? 13  HIS A C   1 
ATOM   74   O  O   . HIS A  1 13  ? 26.579  12.977  34.681 1.00 37.32  ? 13  HIS A O   1 
ATOM   75   C  CB  . HIS A  1 13  ? 23.900  14.324  35.541 1.00 37.06  ? 13  HIS A CB  1 
ATOM   76   C  CG  . HIS A  1 13  ? 23.053  14.306  34.298 1.00 42.82  ? 13  HIS A CG  1 
ATOM   77   N  ND1 . HIS A  1 13  ? 21.851  13.639  34.230 1.00 33.24  ? 13  HIS A ND1 1 
ATOM   78   C  CD2 . HIS A  1 13  ? 23.252  14.854  33.077 1.00 40.93  ? 13  HIS A CD2 1 
ATOM   79   C  CE1 . HIS A  1 13  ? 21.340  13.777  33.016 1.00 36.45  ? 13  HIS A CE1 1 
ATOM   80   N  NE2 . HIS A  1 13  ? 22.174  14.512  32.298 1.00 37.75  ? 13  HIS A NE2 1 
ATOM   81   N  N   . VAL A  1 14  ? 24.900  11.729  33.842 1.00 33.51  ? 14  VAL A N   1 
ATOM   82   C  CA  . VAL A  1 14  ? 25.633  11.308  32.661 1.00 33.37  ? 14  VAL A CA  1 
ATOM   83   C  C   . VAL A  1 14  ? 24.677  11.535  31.489 1.00 41.15  ? 14  VAL A C   1 
ATOM   84   O  O   . VAL A  1 14  ? 23.460  11.506  31.664 1.00 32.92  ? 14  VAL A O   1 
ATOM   85   C  CB  . VAL A  1 14  ? 26.041  9.810   32.721 1.00 39.60  ? 14  VAL A CB  1 
ATOM   86   C  CG1 . VAL A  1 14  ? 27.120  9.607   33.780 1.00 36.19  ? 14  VAL A CG1 1 
ATOM   87   C  CG2 . VAL A  1 14  ? 24.827  8.939   33.025 1.00 28.45  ? 14  VAL A CG2 1 
ATOM   88   N  N   . ILE A  1 15  ? 25.225  11.787  30.306 1.00 39.24  ? 15  ILE A N   1 
ATOM   89   C  CA  . ILE A  1 15  ? 24.404  12.013  29.122 1.00 39.39  ? 15  ILE A CA  1 
ATOM   90   C  C   . ILE A  1 15  ? 23.905  10.669  28.620 1.00 31.45  ? 15  ILE A C   1 
ATOM   91   O  O   . ILE A  1 15  ? 22.710  10.465  28.441 1.00 40.93  ? 15  ILE A O   1 
ATOM   92   C  CB  . ILE A  1 15  ? 25.223  12.725  28.023 1.00 29.40  ? 15  ILE A CB  1 
ATOM   93   C  CG1 . ILE A  1 15  ? 25.614  14.126  28.518 1.00 35.19  ? 15  ILE A CG1 1 
ATOM   94   C  CG2 . ILE A  1 15  ? 24.408  12.819  26.729 1.00 32.22  ? 15  ILE A CG2 1 
ATOM   95   C  CD1 . ILE A  1 15  ? 26.560  14.863  27.599 1.00 45.83  ? 15  ILE A CD1 1 
ATOM   96   N  N   . ARG A  1 16  ? 24.838  9.754   28.400 1.00 36.04  ? 16  ARG A N   1 
ATOM   97   C  CA  . ARG A  1 16  ? 24.521  8.407   27.947 1.00 40.12  ? 16  ARG A CA  1 
ATOM   98   C  C   . ARG A  1 16  ? 24.629  7.445   29.123 1.00 39.93  ? 16  ARG A C   1 
ATOM   99   O  O   . ARG A  1 16  ? 25.636  7.433   29.831 1.00 38.91  ? 16  ARG A O   1 
ATOM   100  C  CB  . ARG A  1 16  ? 25.508  7.961   26.866 1.00 36.42  ? 16  ARG A CB  1 
ATOM   101  C  CG  . ARG A  1 16  ? 25.353  6.506   26.441 1.00 38.11  ? 16  ARG A CG  1 
ATOM   102  C  CD  . ARG A  1 16  ? 24.013  6.275   25.768 1.00 49.50  ? 16  ARG A CD  1 
ATOM   103  N  NE  . ARG A  1 16  ? 23.907  7.064   24.547 1.00 52.48  ? 16  ARG A NE  1 
ATOM   104  C  CZ  . ARG A  1 16  ? 24.328  6.660   23.354 1.00 52.67  ? 16  ARG A CZ  1 
ATOM   105  N  NH1 . ARG A  1 16  ? 24.882  5.462   23.211 1.00 47.72  ? 16  ARG A NH1 1 
ATOM   106  N  NH2 . ARG A  1 16  ? 24.210  7.463   22.307 1.00 62.44  ? 16  ARG A NH2 1 
ATOM   107  N  N   . GLY A  1 17  ? 23.596  6.641   29.338 1.00 37.42  ? 17  GLY A N   1 
ATOM   108  C  CA  . GLY A  1 17  ? 23.654  5.675   30.415 1.00 33.39  ? 17  GLY A CA  1 
ATOM   109  C  C   . GLY A  1 17  ? 22.845  5.988   31.654 1.00 33.17  ? 17  GLY A C   1 
ATOM   110  O  O   . GLY A  1 17  ? 22.185  7.020   31.743 1.00 32.91  ? 17  GLY A O   1 
ATOM   111  N  N   . TYR A  1 18  ? 22.915  5.079   32.622 1.00 30.71  ? 18  TYR A N   1 
ATOM   112  C  CA  . TYR A  1 18  ? 22.175  5.214   33.861 1.00 31.28  ? 18  TYR A CA  1 
ATOM   113  C  C   . TYR A  1 18  ? 22.989  4.954   35.133 1.00 35.82  ? 18  TYR A C   1 
ATOM   114  O  O   . TYR A  1 18  ? 23.252  3.806   35.499 1.00 42.58  ? 18  TYR A O   1 
ATOM   115  C  CB  . TYR A  1 18  ? 20.959  4.280   33.823 1.00 28.28  ? 18  TYR A CB  1 
ATOM   116  C  CG  . TYR A  1 18  ? 20.037  4.581   32.667 1.00 44.67  ? 18  TYR A CG  1 
ATOM   117  C  CD1 . TYR A  1 18  ? 20.254  4.024   31.406 1.00 37.50  ? 18  TYR A CD1 1 
ATOM   118  C  CD2 . TYR A  1 18  ? 18.999  5.499   32.811 1.00 35.66  ? 18  TYR A CD2 1 
ATOM   119  C  CE1 . TYR A  1 18  ? 19.458  4.383   30.315 1.00 42.22  ? 18  TYR A CE1 1 
ATOM   120  C  CE2 . TYR A  1 18  ? 18.204  5.864   31.733 1.00 41.87  ? 18  TYR A CE2 1 
ATOM   121  C  CZ  . TYR A  1 18  ? 18.437  5.307   30.492 1.00 36.58  ? 18  TYR A CZ  1 
ATOM   122  O  OH  . TYR A  1 18  ? 17.645  5.683   29.436 1.00 44.03  ? 18  TYR A OH  1 
ATOM   123  N  N   . VAL A  1 19  ? 23.390  6.037   35.787 1.00 31.55  ? 19  VAL A N   1 
ATOM   124  C  CA  . VAL A  1 19  ? 24.129  5.988   37.045 1.00 39.40  ? 19  VAL A CA  1 
ATOM   125  C  C   . VAL A  1 19  ? 23.732  7.249   37.800 1.00 40.88  ? 19  VAL A C   1 
ATOM   126  O  O   . VAL A  1 19  ? 23.250  8.211   37.200 1.00 40.91  ? 19  VAL A O   1 
ATOM   127  C  CB  . VAL A  1 19  ? 25.664  5.987   36.838 1.00 43.27  ? 19  VAL A CB  1 
ATOM   128  C  CG1 . VAL A  1 19  ? 26.073  4.789   36.011 1.00 49.08  ? 19  VAL A CG1 1 
ATOM   129  C  CG2 . VAL A  1 19  ? 26.108  7.275   36.172 1.00 38.82  ? 19  VAL A CG2 1 
ATOM   130  N  N   . GLY A  1 20  ? 23.921  7.243   39.112 1.00 32.99  ? 20  GLY A N   1 
ATOM   131  C  CA  . GLY A  1 20  ? 23.567  8.407   39.898 1.00 35.16  ? 20  GLY A CA  1 
ATOM   132  C  C   . GLY A  1 20  ? 22.134  8.839   39.658 1.00 34.35  ? 20  GLY A C   1 
ATOM   133  O  O   . GLY A  1 20  ? 21.223  8.014   39.677 1.00 38.20  ? 20  GLY A O   1 
ATOM   134  N  N   . ASN A  1 21  ? 21.931  10.132  39.425 1.00 38.12  ? 21  ASN A N   1 
ATOM   135  C  CA  . ASN A  1 21  ? 20.592  10.658  39.195 1.00 38.56  ? 21  ASN A CA  1 
ATOM   136  C  C   . ASN A  1 21  ? 19.889  10.053  37.976 1.00 27.04  ? 21  ASN A C   1 
ATOM   137  O  O   . ASN A  1 21  ? 18.666  9.991   37.937 1.00 32.81  ? 21  ASN A O   1 
ATOM   138  C  CB  . ASN A  1 21  ? 20.648  12.182  39.099 1.00 32.80  ? 21  ASN A CB  1 
ATOM   139  C  CG  . ASN A  1 21  ? 20.448  12.840  40.443 1.00 38.86  ? 21  ASN A CG  1 
ATOM   140  O  OD1 . ASN A  1 21  ? 20.980  13.919  40.721 1.00 35.99  ? 21  ASN A OD1 1 
ATOM   141  N  ND2 . ASN A  1 21  ? 19.662  12.193  41.289 1.00 30.94  ? 21  ASN A ND2 1 
ATOM   142  N  N   . ARG A  1 22  ? 20.657  9.600   36.990 1.00 29.42  ? 22  ARG A N   1 
ATOM   143  C  CA  . ARG A  1 22  ? 20.053  8.975   35.821 1.00 37.30  ? 22  ARG A CA  1 
ATOM   144  C  C   . ARG A  1 22  ? 19.412  7.644   36.227 1.00 41.08  ? 22  ARG A C   1 
ATOM   145  O  O   . ARG A  1 22  ? 18.405  7.224   35.653 1.00 37.19  ? 22  ARG A O   1 
ATOM   146  C  CB  . ARG A  1 22  ? 21.102  8.763   34.730 1.00 28.71  ? 22  ARG A CB  1 
ATOM   147  C  CG  . ARG A  1 22  ? 21.395  10.031  33.930 1.00 35.23  ? 22  ARG A CG  1 
ATOM   148  C  CD  . ARG A  1 22  ? 20.249  10.356  32.954 1.00 27.41  ? 22  ARG A CD  1 
ATOM   149  N  NE  . ARG A  1 22  ? 20.277  9.454   31.804 1.00 35.29  ? 22  ARG A NE  1 
ATOM   150  C  CZ  . ARG A  1 22  ? 19.435  9.498   30.773 1.00 39.23  ? 22  ARG A CZ  1 
ATOM   151  N  NH1 . ARG A  1 22  ? 18.468  10.404  30.723 1.00 28.08  ? 22  ARG A NH1 1 
ATOM   152  N  NH2 . ARG A  1 22  ? 19.574  8.633   29.780 1.00 31.96  ? 22  ARG A NH2 1 
ATOM   153  N  N   . ALA A  1 23  ? 19.974  6.994   37.245 1.00 36.42  ? 23  ALA A N   1 
ATOM   154  C  CA  . ALA A  1 23  ? 19.421  5.726   37.696 1.00 23.22  ? 23  ALA A CA  1 
ATOM   155  C  C   . ALA A  1 23  ? 18.302  5.902   38.707 1.00 24.61  ? 23  ALA A C   1 
ATOM   156  O  O   . ALA A  1 23  ? 17.435  5.052   38.820 1.00 31.34  ? 23  ALA A O   1 
ATOM   157  C  CB  . ALA A  1 23  ? 20.518  4.855   38.296 1.00 38.76  ? 23  ALA A CB  1 
ATOM   158  N  N   . ALA A  1 24  ? 18.298  7.017   39.428 1.00 30.51  ? 24  ALA A N   1 
ATOM   159  C  CA  . ALA A  1 24  ? 17.296  7.214   40.474 1.00 29.90  ? 24  ALA A CA  1 
ATOM   160  C  C   . ALA A  1 24  ? 16.077  8.060   40.148 1.00 28.87  ? 24  ALA A C   1 
ATOM   161  O  O   . ALA A  1 24  ? 15.033  7.894   40.772 1.00 32.64  ? 24  ALA A O   1 
ATOM   162  C  CB  . ALA A  1 24  ? 17.974  7.784   41.716 1.00 36.28  ? 24  ALA A CB  1 
ATOM   163  N  N   . THR A  1 25  ? 16.207  8.961   39.183 1.00 30.54  ? 25  THR A N   1 
ATOM   164  C  CA  . THR A  1 25  ? 15.113  9.864   38.834 1.00 33.68  ? 25  THR A CA  1 
ATOM   165  C  C   . THR A  1 25  ? 13.915  9.232   38.118 1.00 29.53  ? 25  THR A C   1 
ATOM   166  O  O   . THR A  1 25  ? 12.792  9.264   38.636 1.00 31.79  ? 25  THR A O   1 
ATOM   167  C  CB  . THR A  1 25  ? 15.658  11.047  38.007 1.00 40.99  ? 25  THR A CB  1 
ATOM   168  O  OG1 . THR A  1 25  ? 16.677  11.710  38.770 1.00 34.22  ? 25  THR A OG1 1 
ATOM   169  C  CG2 . THR A  1 25  ? 14.537  12.053  37.668 1.00 24.79  ? 25  THR A CG2 1 
ATOM   170  N  N   . PHE A  1 26  ? 14.138  8.654   36.943 1.00 31.70  ? 26  PHE A N   1 
ATOM   171  C  CA  . PHE A  1 26  ? 13.025  8.051   36.212 1.00 35.37  ? 26  PHE A CA  1 
ATOM   172  C  C   . PHE A  1 26  ? 12.183  7.130   37.092 1.00 34.49  ? 26  PHE A C   1 
ATOM   173  O  O   . PHE A  1 26  ? 10.970  7.311   37.194 1.00 33.41  ? 26  PHE A O   1 
ATOM   174  C  CB  . PHE A  1 26  ? 13.524  7.281   34.991 1.00 33.98  ? 26  PHE A CB  1 
ATOM   175  C  CG  . PHE A  1 26  ? 12.428  6.600   34.216 1.00 43.37  ? 26  PHE A CG  1 
ATOM   176  C  CD1 . PHE A  1 26  ? 11.385  7.341   33.655 1.00 27.22  ? 26  PHE A CD1 1 
ATOM   177  C  CD2 . PHE A  1 26  ? 12.446  5.219   34.031 1.00 35.68  ? 26  PHE A CD2 1 
ATOM   178  C  CE1 . PHE A  1 26  ? 10.380  6.715   32.916 1.00 34.03  ? 26  PHE A CE1 1 
ATOM   179  C  CE2 . PHE A  1 26  ? 11.441  4.581   33.292 1.00 44.58  ? 26  PHE A CE2 1 
ATOM   180  C  CZ  . PHE A  1 26  ? 10.408  5.331   32.733 1.00 41.78  ? 26  PHE A CZ  1 
ATOM   181  N  N   . PRO A  1 27  ? 12.810  6.134   37.747 1.00 33.69  ? 27  PRO A N   1 
ATOM   182  C  CA  . PRO A  1 27  ? 12.026  5.230   38.603 1.00 32.86  ? 27  PRO A CA  1 
ATOM   183  C  C   . PRO A  1 27  ? 11.200  5.912   39.692 1.00 30.29  ? 27  PRO A C   1 
ATOM   184  O  O   . PRO A  1 27  ? 10.057  5.532   39.932 1.00 35.35  ? 27  PRO A O   1 
ATOM   185  C  CB  . PRO A  1 27  ? 13.080  4.263   39.165 1.00 33.03  ? 27  PRO A CB  1 
ATOM   186  C  CG  . PRO A  1 27  ? 14.392  4.995   38.981 1.00 41.53  ? 27  PRO A CG  1 
ATOM   187  C  CD  . PRO A  1 27  ? 14.215  5.695   37.665 1.00 29.28  ? 27  PRO A CD  1 
ATOM   188  N  N   . LEU A  1 28  ? 11.776  6.914   40.350 1.00 33.21  ? 28  LEU A N   1 
ATOM   189  C  CA  . LEU A  1 28  ? 11.059  7.644   41.388 1.00 31.21  ? 28  LEU A CA  1 
ATOM   190  C  C   . LEU A  1 28  ? 9.934   8.491   40.779 1.00 36.60  ? 28  LEU A C   1 
ATOM   191  O  O   . LEU A  1 28  ? 8.902   8.694   41.408 1.00 30.07  ? 28  LEU A O   1 
ATOM   192  C  CB  . LEU A  1 28  ? 12.028  8.531   42.187 1.00 28.94  ? 28  LEU A CB  1 
ATOM   193  C  CG  . LEU A  1 28  ? 12.936  7.776   43.171 1.00 43.11  ? 28  LEU A CG  1 
ATOM   194  C  CD1 . LEU A  1 28  ? 14.024  8.685   43.724 1.00 33.31  ? 28  LEU A CD1 1 
ATOM   195  C  CD2 . LEU A  1 28  ? 12.079  7.221   44.293 1.00 28.86  ? 28  LEU A CD2 1 
ATOM   196  N  N   . GLN A  1 29  ? 10.137  9.001   39.567 1.00 32.95  ? 29  GLN A N   1 
ATOM   197  C  CA  . GLN A  1 29  ? 9.088   9.786   38.906 1.00 40.41  ? 29  GLN A CA  1 
ATOM   198  C  C   . GLN A  1 29  ? 7.947   8.836   38.535 1.00 34.93  ? 29  GLN A C   1 
ATOM   199  O  O   . GLN A  1 29  ? 6.778   9.124   38.779 1.00 31.90  ? 29  GLN A O   1 
ATOM   200  C  CB  . GLN A  1 29  ? 9.632   10.472  37.648 1.00 29.54  ? 29  GLN A CB  1 
ATOM   201  C  CG  . GLN A  1 29  ? 10.653  11.559  37.955 1.00 25.96  ? 29  GLN A CG  1 
ATOM   202  C  CD  . GLN A  1 29  ? 11.203  12.241  36.717 1.00 41.20  ? 29  GLN A CD  1 
ATOM   203  O  OE1 . GLN A  1 29  ? 11.755  11.592  35.820 1.00 34.41  ? 29  GLN A OE1 1 
ATOM   204  N  NE2 . GLN A  1 29  ? 11.073  13.564  36.670 1.00 35.98  ? 29  GLN A NE2 1 
ATOM   205  N  N   . VAL A  1 30  ? 8.307   7.693   37.961 1.00 27.73  ? 30  VAL A N   1 
ATOM   206  C  CA  . VAL A  1 30  ? 7.334   6.678   37.573 1.00 35.62  ? 30  VAL A CA  1 
ATOM   207  C  C   . VAL A  1 30  ? 6.493   6.312   38.786 1.00 42.17  ? 30  VAL A C   1 
ATOM   208  O  O   . VAL A  1 30  ? 5.288   6.090   38.666 1.00 40.98  ? 30  VAL A O   1 
ATOM   209  C  CB  . VAL A  1 30  ? 8.036   5.405   37.040 1.00 36.81  ? 30  VAL A CB  1 
ATOM   210  C  CG1 . VAL A  1 30  ? 7.061   4.237   37.007 1.00 43.66  ? 30  VAL A CG1 1 
ATOM   211  C  CG2 . VAL A  1 30  ? 8.590   5.666   35.650 1.00 36.14  ? 30  VAL A CG2 1 
ATOM   212  N  N   . LEU A  1 31  ? 7.129   6.264   39.956 1.00 37.27  ? 31  LEU A N   1 
ATOM   213  C  CA  . LEU A  1 31  ? 6.421   5.921   41.183 1.00 34.05  ? 31  LEU A CA  1 
ATOM   214  C  C   . LEU A  1 31  ? 5.669   7.093   41.815 1.00 37.44  ? 31  LEU A C   1 
ATOM   215  O  O   . LEU A  1 31  ? 5.078   6.956   42.882 1.00 36.26  ? 31  LEU A O   1 
ATOM   216  C  CB  . LEU A  1 31  ? 7.387   5.281   42.198 1.00 43.48  ? 31  LEU A CB  1 
ATOM   217  C  CG  . LEU A  1 31  ? 7.806   3.848   41.830 1.00 46.75  ? 31  LEU A CG  1 
ATOM   218  C  CD1 . LEU A  1 31  ? 8.737   3.271   42.889 1.00 35.58  ? 31  LEU A CD1 1 
ATOM   219  C  CD2 . LEU A  1 31  ? 6.561   2.975   41.694 1.00 41.62  ? 31  LEU A CD2 1 
ATOM   220  N  N   . GLY A  1 32  ? 5.694   8.250   41.162 1.00 40.46  ? 32  GLY A N   1 
ATOM   221  C  CA  . GLY A  1 32  ? 4.950   9.387   41.677 1.00 33.25  ? 32  GLY A CA  1 
ATOM   222  C  C   . GLY A  1 32  ? 5.624   10.373  42.608 1.00 31.52  ? 32  GLY A C   1 
ATOM   223  O  O   . GLY A  1 32  ? 4.959   11.254  43.155 1.00 38.84  ? 32  GLY A O   1 
ATOM   224  N  N   . PHE A  1 33  ? 6.926   10.242  42.815 1.00 39.28  ? 33  PHE A N   1 
ATOM   225  C  CA  . PHE A  1 33  ? 7.615   11.177  43.696 1.00 36.79  ? 33  PHE A CA  1 
ATOM   226  C  C   . PHE A  1 33  ? 8.024   12.438  42.949 1.00 38.70  ? 33  PHE A C   1 
ATOM   227  O  O   . PHE A  1 33  ? 8.420   12.380  41.781 1.00 36.03  ? 33  PHE A O   1 
ATOM   228  C  CB  . PHE A  1 33  ? 8.870   10.535  44.304 1.00 35.03  ? 33  PHE A CB  1 
ATOM   229  C  CG  . PHE A  1 33  ? 8.576   9.429   45.280 1.00 31.50  ? 33  PHE A CG  1 
ATOM   230  C  CD1 . PHE A  1 33  ? 8.259   8.151   44.832 1.00 33.29  ? 33  PHE A CD1 1 
ATOM   231  C  CD2 . PHE A  1 33  ? 8.579   9.678   46.650 1.00 38.17  ? 33  PHE A CD2 1 
ATOM   232  C  CE1 . PHE A  1 33  ? 7.946   7.131   45.738 1.00 45.90  ? 33  PHE A CE1 1 
ATOM   233  C  CE2 . PHE A  1 33  ? 8.266   8.667   47.563 1.00 41.57  ? 33  PHE A CE2 1 
ATOM   234  C  CZ  . PHE A  1 33  ? 7.949   7.390   47.104 1.00 34.31  ? 33  PHE A CZ  1 
ATOM   235  N  N   . GLU A  1 34  ? 7.906   13.583  43.610 1.00 38.47  ? 34  GLU A N   1 
ATOM   236  C  CA  . GLU A  1 34  ? 8.348   14.828  42.994 1.00 38.78  ? 34  GLU A CA  1 
ATOM   237  C  C   . GLU A  1 34  ? 9.844   14.901  43.297 1.00 35.60  ? 34  GLU A C   1 
ATOM   238  O  O   . GLU A  1 34  ? 10.263  15.560  44.251 1.00 40.73  ? 34  GLU A O   1 
ATOM   239  C  CB  . GLU A  1 34  ? 7.639   16.044  43.607 1.00 34.39  ? 34  GLU A CB  1 
ATOM   240  C  CG  . GLU A  1 34  ? 6.195   16.261  43.146 1.00 43.63  ? 34  GLU A CG  1 
ATOM   241  C  CD  . GLU A  1 34  ? 6.085   16.829  41.731 1.00 42.86  ? 34  GLU A CD  1 
ATOM   242  O  OE1 . GLU A  1 34  ? 4.947   16.988  41.250 1.00 52.71  ? 34  GLU A OE1 1 
ATOM   243  O  OE2 . GLU A  1 34  ? 7.122   17.123  41.099 1.00 40.12  ? 34  GLU A OE2 1 
ATOM   244  N  N   . ILE A  1 35  ? 10.648  14.198  42.508 1.00 39.46  ? 35  ILE A N   1 
ATOM   245  C  CA  . ILE A  1 35  ? 12.090  14.221  42.727 1.00 41.23  ? 35  ILE A CA  1 
ATOM   246  C  C   . ILE A  1 35  ? 12.804  15.324  41.950 1.00 41.07  ? 35  ILE A C   1 
ATOM   247  O  O   . ILE A  1 35  ? 12.660  15.452  40.729 1.00 34.42  ? 35  ILE A O   1 
ATOM   248  C  CB  . ILE A  1 35  ? 12.750  12.867  42.381 1.00 39.87  ? 35  ILE A CB  1 
ATOM   249  C  CG1 . ILE A  1 35  ? 14.280  13.025  42.378 1.00 30.00  ? 35  ILE A CG1 1 
ATOM   250  C  CG2 . ILE A  1 35  ? 12.237  12.365  41.043 1.00 27.91  ? 35  ILE A CG2 1 
ATOM   251  C  CD1 . ILE A  1 35  ? 15.041  11.735  42.174 1.00 45.59  ? 35  ILE A CD1 1 
ATOM   252  N  N   . ASP A  1 36  ? 13.568  16.116  42.695 1.00 36.32  ? 36  ASP A N   1 
ATOM   253  C  CA  . ASP A  1 36  ? 14.349  17.223  42.163 1.00 25.42  ? 36  ASP A CA  1 
ATOM   254  C  C   . ASP A  1 36  ? 15.778  16.725  42.116 1.00 32.15  ? 36  ASP A C   1 
ATOM   255  O  O   . ASP A  1 36  ? 16.297  16.215  43.108 1.00 37.42  ? 36  ASP A O   1 
ATOM   256  C  CB  . ASP A  1 36  ? 14.260  18.439  43.088 1.00 25.12  ? 36  ASP A CB  1 
ATOM   257  C  CG  . ASP A  1 36  ? 12.866  19.034  43.135 1.00 38.49  ? 36  ASP A CG  1 
ATOM   258  O  OD1 . ASP A  1 36  ? 11.998  18.561  42.373 1.00 36.89  ? 36  ASP A OD1 1 
ATOM   259  O  OD2 . ASP A  1 36  ? 12.643  19.977  43.926 1.00 34.51  ? 36  ASP A OD2 1 
ATOM   260  N  N   . ALA A  1 37  ? 16.410  16.886  40.962 1.00 35.22  ? 37  ALA A N   1 
ATOM   261  C  CA  . ALA A  1 37  ? 17.762  16.409  40.755 1.00 31.64  ? 37  ALA A CA  1 
ATOM   262  C  C   . ALA A  1 37  ? 18.838  17.484  40.721 1.00 36.11  ? 37  ALA A C   1 
ATOM   263  O  O   . ALA A  1 37  ? 18.786  18.399  39.903 1.00 32.34  ? 37  ALA A O   1 
ATOM   264  C  CB  . ALA A  1 37  ? 17.811  15.590  39.459 1.00 29.71  ? 37  ALA A CB  1 
ATOM   265  N  N   . VAL A  1 38  ? 19.808  17.369  41.623 1.00 36.14  ? 38  VAL A N   1 
ATOM   266  C  CA  . VAL A  1 38  ? 20.939  18.287  41.658 1.00 27.78  ? 38  VAL A CA  1 
ATOM   267  C  C   . VAL A  1 38  ? 22.057  17.422  41.106 1.00 28.09  ? 38  VAL A C   1 
ATOM   268  O  O   . VAL A  1 38  ? 22.439  16.422  41.713 1.00 33.15  ? 38  VAL A O   1 
ATOM   269  C  CB  . VAL A  1 38  ? 21.284  18.732  43.096 1.00 38.85  ? 38  VAL A CB  1 
ATOM   270  C  CG1 . VAL A  1 38  ? 22.535  19.595  43.087 1.00 35.15  ? 38  VAL A CG1 1 
ATOM   271  C  CG2 . VAL A  1 38  ? 20.120  19.515  43.691 1.00 34.39  ? 38  VAL A CG2 1 
ATOM   272  N  N   . ASN A  1 39  ? 22.569  17.793  39.944 1.00 30.67  ? 39  ASN A N   1 
ATOM   273  C  CA  . ASN A  1 39  ? 23.611  17.008  39.308 1.00 38.10  ? 39  ASN A CA  1 
ATOM   274  C  C   . ASN A  1 39  ? 24.984  17.411  39.824 1.00 34.76  ? 39  ASN A C   1 
ATOM   275  O  O   . ASN A  1 39  ? 25.486  18.476  39.481 1.00 30.55  ? 39  ASN A O   1 
ATOM   276  C  CB  . ASN A  1 39  ? 23.511  17.190  37.791 1.00 30.82  ? 39  ASN A CB  1 
ATOM   277  C  CG  . ASN A  1 39  ? 22.156  16.761  37.245 1.00 40.78  ? 39  ASN A CG  1 
ATOM   278  O  OD1 . ASN A  1 39  ? 21.627  17.368  36.314 1.00 38.80  ? 39  ASN A OD1 1 
ATOM   279  N  ND2 . ASN A  1 39  ? 21.592  15.708  37.823 1.00 31.66  ? 39  ASN A ND2 1 
ATOM   280  N  N   . SER A  1 40  ? 25.578  16.555  40.656 1.00 36.58  ? 40  SER A N   1 
ATOM   281  C  CA  . SER A  1 40  ? 26.896  16.825  41.238 1.00 40.14  ? 40  SER A CA  1 
ATOM   282  C  C   . SER A  1 40  ? 27.973  16.859  40.157 1.00 39.15  ? 40  SER A C   1 
ATOM   283  O  O   . SER A  1 40  ? 29.019  17.483  40.337 1.00 51.42  ? 40  SER A O   1 
ATOM   284  C  CB  . SER A  1 40  ? 27.228  15.782  42.314 1.00 28.28  ? 40  SER A CB  1 
ATOM   285  O  OG  . SER A  1 40  ? 27.146  14.473  41.796 1.00 33.33  ? 40  SER A OG  1 
ATOM   286  N  N   . VAL A  1 41  ? 27.724  16.164  39.045 1.00 37.03  ? 41  VAL A N   1 
ATOM   287  C  CA  . VAL A  1 41  ? 28.628  16.179  37.889 1.00 31.81  ? 41  VAL A CA  1 
ATOM   288  C  C   . VAL A  1 41  ? 27.807  15.946  36.623 1.00 40.60  ? 41  VAL A C   1 
ATOM   289  O  O   . VAL A  1 41  ? 26.672  15.477  36.690 1.00 35.13  ? 41  VAL A O   1 
ATOM   290  C  CB  . VAL A  1 41  ? 29.730  15.065  37.921 1.00 46.77  ? 41  VAL A CB  1 
ATOM   291  C  CG1 . VAL A  1 41  ? 30.402  15.011  39.287 1.00 45.76  ? 41  VAL A CG1 1 
ATOM   292  C  CG2 . VAL A  1 41  ? 29.136  13.711  37.513 1.00 35.97  ? 41  VAL A CG2 1 
ATOM   293  N  N   . GLN A  1 42  ? 28.377  16.302  35.478 1.00 31.08  ? 42  GLN A N   1 
ATOM   294  C  CA  . GLN A  1 42  ? 27.736  16.062  34.198 1.00 35.05  ? 42  GLN A CA  1 
ATOM   295  C  C   . GLN A  1 42  ? 28.814  15.495  33.278 1.00 32.57  ? 42  GLN A C   1 
ATOM   296  O  O   . GLN A  1 42  ? 29.650  16.224  32.745 1.00 37.28  ? 42  GLN A O   1 
ATOM   297  C  CB  . GLN A  1 42  ? 27.119  17.342  33.607 1.00 26.52  ? 42  GLN A CB  1 
ATOM   298  C  CG  . GLN A  1 42  ? 26.839  17.223  32.108 1.00 32.22  ? 42  GLN A CG  1 
ATOM   299  C  CD  . GLN A  1 42  ? 25.689  18.089  31.629 1.00 40.93  ? 42  GLN A CD  1 
ATOM   300  O  OE1 . GLN A  1 42  ? 24.630  17.576  31.288 1.00 32.78  ? 42  GLN A OE1 1 
ATOM   301  N  NE2 . GLN A  1 42  ? 25.893  19.403  31.600 1.00 28.78  ? 42  GLN A NE2 1 
ATOM   302  N  N   . PHE A  1 43  ? 28.794  14.175  33.129 1.00 30.99  ? 43  PHE A N   1 
ATOM   303  C  CA  . PHE A  1 43  ? 29.750  13.454  32.304 1.00 30.74  ? 43  PHE A CA  1 
ATOM   304  C  C   . PHE A  1 43  ? 29.038  12.861  31.094 1.00 41.14  ? 43  PHE A C   1 
ATOM   305  O  O   . PHE A  1 43  ? 27.823  12.673  31.109 1.00 38.71  ? 43  PHE A O   1 
ATOM   306  C  CB  . PHE A  1 43  ? 30.392  12.329  33.126 1.00 38.75  ? 43  PHE A CB  1 
ATOM   307  C  CG  . PHE A  1 43  ? 31.419  12.803  34.130 1.00 40.76  ? 43  PHE A CG  1 
ATOM   308  C  CD1 . PHE A  1 43  ? 31.521  14.149  34.478 1.00 39.44  ? 43  PHE A CD1 1 
ATOM   309  C  CD2 . PHE A  1 43  ? 32.280  11.893  34.735 1.00 51.29  ? 43  PHE A CD2 1 
ATOM   310  C  CE1 . PHE A  1 43  ? 32.463  14.582  35.411 1.00 48.92  ? 43  PHE A CE1 1 
ATOM   311  C  CE2 . PHE A  1 43  ? 33.228  12.316  35.672 1.00 55.54  ? 43  PHE A CE2 1 
ATOM   312  C  CZ  . PHE A  1 43  ? 33.317  13.662  36.008 1.00 52.62  ? 43  PHE A CZ  1 
ATOM   313  N  N   . SER A  1 44  ? 29.801  12.567  30.048 1.00 37.32  ? 44  SER A N   1 
ATOM   314  C  CA  . SER A  1 44  ? 29.242  11.996  28.836 1.00 43.55  ? 44  SER A CA  1 
ATOM   315  C  C   . SER A  1 44  ? 28.755  10.577  29.098 1.00 42.63  ? 44  SER A C   1 
ATOM   316  O  O   . SER A  1 44  ? 27.846  10.089  28.430 1.00 40.56  ? 44  SER A O   1 
ATOM   317  C  CB  . SER A  1 44  ? 30.301  11.988  27.732 1.00 46.12  ? 44  SER A CB  1 
ATOM   318  O  OG  . SER A  1 44  ? 31.437  11.239  28.126 1.00 47.86  ? 44  SER A OG  1 
ATOM   319  N  N   . ASN A  1 45  ? 29.365  9.927   30.085 1.00 41.54  ? 45  ASN A N   1 
ATOM   320  C  CA  . ASN A  1 45  ? 29.030  8.554   30.457 1.00 44.16  ? 45  ASN A CA  1 
ATOM   321  C  C   . ASN A  1 45  ? 29.823  8.194   31.718 1.00 44.75  ? 45  ASN A C   1 
ATOM   322  O  O   . ASN A  1 45  ? 30.705  8.956   32.127 1.00 43.81  ? 45  ASN A O   1 
ATOM   323  C  CB  . ASN A  1 45  ? 29.389  7.617   29.302 1.00 32.28  ? 45  ASN A CB  1 
ATOM   324  C  CG  . ASN A  1 45  ? 30.808  7.819   28.815 1.00 41.42  ? 45  ASN A CG  1 
ATOM   325  O  OD1 . ASN A  1 45  ? 31.766  7.350   29.435 1.00 48.85  ? 45  ASN A OD1 1 
ATOM   326  N  ND2 . ASN A  1 45  ? 30.953  8.535   27.711 1.00 32.92  ? 45  ASN A ND2 1 
ATOM   327  N  N   . HIS A  1 46  ? 29.524  7.052   32.338 1.00 40.98  ? 46  HIS A N   1 
ATOM   328  C  CA  . HIS A  1 46  ? 30.243  6.677   33.558 1.00 41.10  ? 46  HIS A CA  1 
ATOM   329  C  C   . HIS A  1 46  ? 31.711  6.337   33.321 1.00 46.04  ? 46  HIS A C   1 
ATOM   330  O  O   . HIS A  1 46  ? 32.142  6.101   32.188 1.00 46.22  ? 46  HIS A O   1 
ATOM   331  C  CB  . HIS A  1 46  ? 29.527  5.540   34.307 1.00 41.86  ? 46  HIS A CB  1 
ATOM   332  C  CG  . HIS A  1 46  ? 29.543  4.218   33.605 1.00 46.59  ? 46  HIS A CG  1 
ATOM   333  N  ND1 . HIS A  1 46  ? 30.704  3.519   33.352 1.00 52.46  ? 46  HIS A ND1 1 
ATOM   334  C  CD2 . HIS A  1 46  ? 28.528  3.428   33.175 1.00 41.79  ? 46  HIS A CD2 1 
ATOM   335  C  CE1 . HIS A  1 46  ? 30.405  2.356   32.802 1.00 46.14  ? 46  HIS A CE1 1 
ATOM   336  N  NE2 . HIS A  1 46  ? 29.092  2.275   32.684 1.00 51.59  ? 46  HIS A NE2 1 
ATOM   337  N  N   . THR A  1 47  ? 32.484  6.327   34.400 1.00 50.32  ? 47  THR A N   1 
ATOM   338  C  CA  . THR A  1 47  ? 33.919  6.075   34.312 1.00 55.46  ? 47  THR A CA  1 
ATOM   339  C  C   . THR A  1 47  ? 34.347  4.631   34.043 1.00 56.92  ? 47  THR A C   1 
ATOM   340  O  O   . THR A  1 47  ? 35.533  4.314   34.097 1.00 60.88  ? 47  THR A O   1 
ATOM   341  C  CB  . THR A  1 47  ? 34.623  6.600   35.578 1.00 45.24  ? 47  THR A CB  1 
ATOM   342  O  OG1 . THR A  1 47  ? 34.066  5.967   36.736 1.00 50.44  ? 47  THR A OG1 1 
ATOM   343  C  CG2 . THR A  1 47  ? 34.422  8.112   35.698 1.00 44.55  ? 47  THR A CG2 1 
ATOM   344  N  N   . GLY A  1 48  ? 33.386  3.766   33.736 1.00 50.97  ? 48  GLY A N   1 
ATOM   345  C  CA  . GLY A  1 48  ? 33.702  2.383   33.434 1.00 43.73  ? 48  GLY A CA  1 
ATOM   346  C  C   . GLY A  1 48  ? 34.048  2.191   31.963 1.00 54.73  ? 48  GLY A C   1 
ATOM   347  O  O   . GLY A  1 48  ? 34.546  1.133   31.569 1.00 47.96  ? 48  GLY A O   1 
ATOM   348  N  N   . TYR A  1 49  ? 33.775  3.207   31.146 1.00 46.47  ? 49  TYR A N   1 
ATOM   349  C  CA  . TYR A  1 49  ? 34.081  3.144   29.716 1.00 56.71  ? 49  TYR A CA  1 
ATOM   350  C  C   . TYR A  1 49  ? 35.544  3.510   29.482 1.00 50.97  ? 49  TYR A C   1 
ATOM   351  O  O   . TYR A  1 49  ? 36.197  4.078   30.355 1.00 56.44  ? 49  TYR A O   1 
ATOM   352  C  CB  . TYR A  1 49  ? 33.205  4.120   28.912 1.00 52.98  ? 49  TYR A CB  1 
ATOM   353  C  CG  . TYR A  1 49  ? 31.744  3.742   28.788 1.00 46.05  ? 49  TYR A CG  1 
ATOM   354  C  CD1 . TYR A  1 49  ? 30.854  3.948   29.841 1.00 34.82  ? 49  TYR A CD1 1 
ATOM   355  C  CD2 . TYR A  1 49  ? 31.246  3.207   27.601 1.00 51.35  ? 49  TYR A CD2 1 
ATOM   356  C  CE1 . TYR A  1 49  ? 29.497  3.632   29.711 1.00 47.22  ? 49  TYR A CE1 1 
ATOM   357  C  CE2 . TYR A  1 49  ? 29.895  2.888   27.460 1.00 49.66  ? 49  TYR A CE2 1 
ATOM   358  C  CZ  . TYR A  1 49  ? 29.026  3.103   28.514 1.00 49.94  ? 49  TYR A CZ  1 
ATOM   359  O  OH  . TYR A  1 49  ? 27.694  2.785   28.368 1.00 44.92  ? 49  TYR A OH  1 
ATOM   360  N  N   . ALA A  1 50  ? 36.047  3.204   28.292 1.00 50.46  ? 50  ALA A N   1 
ATOM   361  C  CA  . ALA A  1 50  ? 37.430  3.515   27.955 1.00 55.62  ? 50  ALA A CA  1 
ATOM   362  C  C   . ALA A  1 50  ? 37.656  5.017   27.998 1.00 59.96  ? 50  ALA A C   1 
ATOM   363  O  O   . ALA A  1 50  ? 38.758  5.474   28.289 1.00 56.85  ? 50  ALA A O   1 
ATOM   364  C  CB  . ALA A  1 50  ? 37.766  2.980   26.574 1.00 56.58  ? 50  ALA A CB  1 
ATOM   365  N  N   . HIS A  1 51  ? 36.605  5.784   27.714 1.00 55.76  ? 51  HIS A N   1 
ATOM   366  C  CA  . HIS A  1 51  ? 36.702  7.241   27.717 1.00 53.54  ? 51  HIS A CA  1 
ATOM   367  C  C   . HIS A  1 51  ? 35.535  7.908   28.437 1.00 53.23  ? 51  HIS A C   1 
ATOM   368  O  O   . HIS A  1 51  ? 34.476  7.315   28.622 1.00 55.10  ? 51  HIS A O   1 
ATOM   369  C  CB  . HIS A  1 51  ? 36.732  7.773   26.283 1.00 60.34  ? 51  HIS A CB  1 
ATOM   370  C  CG  . HIS A  1 51  ? 37.739  7.102   25.406 1.00 65.19  ? 51  HIS A CG  1 
ATOM   371  N  ND1 . HIS A  1 51  ? 39.063  7.482   25.367 1.00 63.80  ? 51  HIS A ND1 1 
ATOM   372  C  CD2 . HIS A  1 51  ? 37.620  6.059   24.552 1.00 67.05  ? 51  HIS A CD2 1 
ATOM   373  C  CE1 . HIS A  1 51  ? 39.716  6.701   24.525 1.00 66.66  ? 51  HIS A CE1 1 
ATOM   374  N  NE2 . HIS A  1 51  ? 38.863  5.828   24.017 1.00 60.34  ? 51  HIS A NE2 1 
ATOM   375  N  N   . TRP A  1 52  ? 35.750  9.155   28.834 1.00 48.53  ? 52  TRP A N   1 
ATOM   376  C  CA  . TRP A  1 52  ? 34.730  9.958   29.483 1.00 49.34  ? 52  TRP A CA  1 
ATOM   377  C  C   . TRP A  1 52  ? 35.222  11.386  29.664 1.00 49.45  ? 52  TRP A C   1 
ATOM   378  O  O   . TRP A  1 52  ? 36.401  11.618  29.912 1.00 50.41  ? 52  TRP A O   1 
ATOM   379  C  CB  . TRP A  1 52  ? 34.326  9.363   30.832 1.00 53.47  ? 52  TRP A CB  1 
ATOM   380  C  CG  . TRP A  1 52  ? 35.455  9.094   31.761 1.00 61.61  ? 52  TRP A CG  1 
ATOM   381  C  CD1 . TRP A  1 52  ? 36.210  7.960   31.827 1.00 64.35  ? 52  TRP A CD1 1 
ATOM   382  C  CD2 . TRP A  1 52  ? 35.944  9.964   32.785 1.00 57.27  ? 52  TRP A CD2 1 
ATOM   383  N  NE1 . TRP A  1 52  ? 37.138  8.068   32.835 1.00 65.42  ? 52  TRP A NE1 1 
ATOM   384  C  CE2 . TRP A  1 52  ? 36.997  9.289   33.439 1.00 64.07  ? 52  TRP A CE2 1 
ATOM   385  C  CE3 . TRP A  1 52  ? 35.595  11.250  33.215 1.00 64.88  ? 52  TRP A CE3 1 
ATOM   386  C  CZ2 . TRP A  1 52  ? 37.704  9.856   34.502 1.00 75.08  ? 52  TRP A CZ2 1 
ATOM   387  C  CZ3 . TRP A  1 52  ? 36.297  11.814  34.271 1.00 77.24  ? 52  TRP A CZ3 1 
ATOM   388  C  CH2 . TRP A  1 52  ? 37.341  11.116  34.903 1.00 77.48  ? 52  TRP A CH2 1 
ATOM   389  N  N   . LYS A  1 53  ? 34.312  12.340  29.515 1.00 49.26  ? 53  LYS A N   1 
ATOM   390  C  CA  . LYS A  1 53  ? 34.628  13.759  29.663 1.00 40.76  ? 53  LYS A CA  1 
ATOM   391  C  C   . LYS A  1 53  ? 33.468  14.385  30.423 1.00 42.43  ? 53  LYS A C   1 
ATOM   392  O  O   . LYS A  1 53  ? 32.385  13.808  30.478 1.00 52.97  ? 53  LYS A O   1 
ATOM   393  C  CB  . LYS A  1 53  ? 34.742  14.430  28.292 1.00 47.63  ? 53  LYS A CB  1 
ATOM   394  C  CG  . LYS A  1 53  ? 35.760  13.820  27.346 1.00 53.08  ? 53  LYS A CG  1 
ATOM   395  C  CD  . LYS A  1 53  ? 37.176  14.220  27.709 1.00 63.91  ? 53  LYS A CD  1 
ATOM   396  C  CE  . LYS A  1 53  ? 38.171  13.660  26.701 1.00 74.91  ? 53  LYS A CE  1 
ATOM   397  N  NZ  . LYS A  1 53  ? 39.568  14.101  26.975 1.00 68.79  ? 53  LYS A NZ  1 
ATOM   398  N  N   . GLY A  1 54  ? 33.684  15.561  31.003 1.00 40.99  ? 54  GLY A N   1 
ATOM   399  C  CA  . GLY A  1 54  ? 32.614  16.216  31.734 1.00 38.42  ? 54  GLY A CA  1 
ATOM   400  C  C   . GLY A  1 54  ? 33.089  17.256  32.728 1.00 50.85  ? 54  GLY A C   1 
ATOM   401  O  O   . GLY A  1 54  ? 34.285  17.508  32.853 1.00 50.68  ? 54  GLY A O   1 
ATOM   402  N  N   . GLN A  1 55  ? 32.148  17.872  33.434 1.00 44.11  ? 55  GLN A N   1 
ATOM   403  C  CA  . GLN A  1 55  ? 32.496  18.882  34.422 1.00 45.31  ? 55  GLN A CA  1 
ATOM   404  C  C   . GLN A  1 55  ? 31.952  18.477  35.791 1.00 48.66  ? 55  GLN A C   1 
ATOM   405  O  O   . GLN A  1 55  ? 31.058  17.635  35.896 1.00 47.13  ? 55  GLN A O   1 
ATOM   406  C  CB  . GLN A  1 55  ? 31.922  20.249  34.034 1.00 44.86  ? 55  GLN A CB  1 
ATOM   407  C  CG  . GLN A  1 55  ? 32.204  20.701  32.605 1.00 55.60  ? 55  GLN A CG  1 
ATOM   408  C  CD  . GLN A  1 55  ? 31.268  20.057  31.595 1.00 53.59  ? 55  GLN A CD  1 
ATOM   409  O  OE1 . GLN A  1 55  ? 30.069  19.932  31.842 1.00 51.79  ? 55  GLN A OE1 1 
ATOM   410  N  NE2 . GLN A  1 55  ? 31.810  19.657  30.448 1.00 51.30  ? 55  GLN A NE2 1 
ATOM   411  N  N   . VAL A  1 56  ? 32.495  19.081  36.838 1.00 47.16  ? 56  VAL A N   1 
ATOM   412  C  CA  . VAL A  1 56  ? 32.065  18.777  38.193 1.00 38.28  ? 56  VAL A CA  1 
ATOM   413  C  C   . VAL A  1 56  ? 31.480  20.006  38.860 1.00 38.57  ? 56  VAL A C   1 
ATOM   414  O  O   . VAL A  1 56  ? 31.924  21.128  38.625 1.00 50.14  ? 56  VAL A O   1 
ATOM   415  C  CB  . VAL A  1 56  ? 33.246  18.272  39.062 1.00 51.07  ? 56  VAL A CB  1 
ATOM   416  C  CG1 . VAL A  1 56  ? 32.764  17.978  40.481 1.00 45.00  ? 56  VAL A CG1 1 
ATOM   417  C  CG2 . VAL A  1 56  ? 33.859  17.031  38.440 1.00 38.59  ? 56  VAL A CG2 1 
ATOM   418  N  N   . LEU A  1 57  ? 30.475  19.782  39.693 1.00 32.06  ? 57  LEU A N   1 
ATOM   419  C  CA  . LEU A  1 57  ? 29.831  20.852  40.424 1.00 34.38  ? 57  LEU A CA  1 
ATOM   420  C  C   . LEU A  1 57  ? 30.683  21.021  41.684 1.00 48.80  ? 57  LEU A C   1 
ATOM   421  O  O   . LEU A  1 57  ? 30.980  20.030  42.353 1.00 40.07  ? 57  LEU A O   1 
ATOM   422  C  CB  . LEU A  1 57  ? 28.412  20.423  40.815 1.00 32.61  ? 57  LEU A CB  1 
ATOM   423  C  CG  . LEU A  1 57  ? 27.533  21.473  41.488 1.00 32.10  ? 57  LEU A CG  1 
ATOM   424  C  CD1 . LEU A  1 57  ? 27.073  22.469  40.441 1.00 30.77  ? 57  LEU A CD1 1 
ATOM   425  C  CD2 . LEU A  1 57  ? 26.338  20.806  42.157 1.00 28.48  ? 57  LEU A CD2 1 
ATOM   426  N  N   . ASN A  1 58  ? 31.096  22.247  42.002 1.00 43.74  ? 58  ASN A N   1 
ATOM   427  C  CA  . ASN A  1 58  ? 31.892  22.449  43.208 1.00 45.39  ? 58  ASN A CA  1 
ATOM   428  C  C   . ASN A  1 58  ? 30.974  22.843  44.354 1.00 44.66  ? 58  ASN A C   1 
ATOM   429  O  O   . ASN A  1 58  ? 29.806  23.158  44.130 1.00 42.01  ? 58  ASN A O   1 
ATOM   430  C  CB  . ASN A  1 58  ? 33.002  23.497  42.997 1.00 36.63  ? 58  ASN A CB  1 
ATOM   431  C  CG  . ASN A  1 58  ? 32.475  24.890  42.724 1.00 36.76  ? 58  ASN A CG  1 
ATOM   432  O  OD1 . ASN A  1 58  ? 31.676  25.442  43.487 1.00 45.80  ? 58  ASN A OD1 1 
ATOM   433  N  ND2 . ASN A  1 58  ? 32.948  25.483  41.634 1.00 39.88  ? 58  ASN A ND2 1 
ATOM   434  N  N   . SER A  1 59  ? 31.493  22.817  45.577 1.00 40.64  ? 59  SER A N   1 
ATOM   435  C  CA  . SER A  1 59  ? 30.686  23.133  46.754 1.00 36.71  ? 59  SER A CA  1 
ATOM   436  C  C   . SER A  1 59  ? 30.074  24.531  46.757 1.00 32.01  ? 59  SER A C   1 
ATOM   437  O  O   . SER A  1 59  ? 29.025  24.746  47.365 1.00 42.03  ? 59  SER A O   1 
ATOM   438  C  CB  . SER A  1 59  ? 31.506  22.924  48.032 1.00 48.00  ? 59  SER A CB  1 
ATOM   439  O  OG  . SER A  1 59  ? 32.614  23.803  48.076 1.00 57.89  ? 59  SER A OG  1 
ATOM   440  N  N   . ASP A  1 60  ? 30.712  25.484  46.087 1.00 31.69  ? 60  ASP A N   1 
ATOM   441  C  CA  . ASP A  1 60  ? 30.159  26.835  46.055 1.00 43.11  ? 60  ASP A CA  1 
ATOM   442  C  C   . ASP A  1 60  ? 28.930  26.859  45.156 1.00 44.06  ? 60  ASP A C   1 
ATOM   443  O  O   . ASP A  1 60  ? 27.937  27.524  45.453 1.00 48.17  ? 60  ASP A O   1 
ATOM   444  C  CB  . ASP A  1 60  ? 31.193  27.842  45.542 1.00 45.91  ? 60  ASP A CB  1 
ATOM   445  C  CG  . ASP A  1 60  ? 32.314  28.090  46.536 1.00 61.26  ? 60  ASP A CG  1 
ATOM   446  O  OD1 . ASP A  1 60  ? 32.009  28.391  47.711 1.00 56.94  ? 60  ASP A OD1 1 
ATOM   447  O  OD2 . ASP A  1 60  ? 33.496  27.993  46.142 1.00 57.06  ? 60  ASP A OD2 1 
ATOM   448  N  N   . GLU A  1 61  ? 29.002  26.118  44.058 1.00 46.19  ? 61  GLU A N   1 
ATOM   449  C  CA  . GLU A  1 61  ? 27.893  26.052  43.112 1.00 46.69  ? 61  GLU A CA  1 
ATOM   450  C  C   . GLU A  1 61  ? 26.698  25.338  43.740 1.00 44.38  ? 61  GLU A C   1 
ATOM   451  O  O   . GLU A  1 61  ? 25.551  25.725  43.515 1.00 42.90  ? 61  GLU A O   1 
ATOM   452  C  CB  . GLU A  1 61  ? 28.365  25.364  41.831 1.00 35.90  ? 61  GLU A CB  1 
ATOM   453  C  CG  . GLU A  1 61  ? 29.488  26.154  41.177 1.00 32.52  ? 61  GLU A CG  1 
ATOM   454  C  CD  . GLU A  1 61  ? 30.069  25.496  39.951 1.00 42.05  ? 61  GLU A CD  1 
ATOM   455  O  OE1 . GLU A  1 61  ? 30.434  24.303  40.016 1.00 43.77  ? 61  GLU A OE1 1 
ATOM   456  O  OE2 . GLU A  1 61  ? 30.173  26.186  38.920 1.00 49.21  ? 61  GLU A OE2 1 
ATOM   457  N  N   . LEU A  1 62  ? 26.967  24.312  44.546 1.00 38.36  ? 62  LEU A N   1 
ATOM   458  C  CA  . LEU A  1 62  ? 25.892  23.593  45.222 1.00 42.13  ? 62  LEU A CA  1 
ATOM   459  C  C   . LEU A  1 62  ? 25.187  24.542  46.184 1.00 43.44  ? 62  LEU A C   1 
ATOM   460  O  O   . LEU A  1 62  ? 23.960  24.542  46.290 1.00 50.46  ? 62  LEU A O   1 
ATOM   461  C  CB  . LEU A  1 62  ? 26.448  22.403  46.008 1.00 27.04  ? 62  LEU A CB  1 
ATOM   462  C  CG  . LEU A  1 62  ? 25.489  21.693  46.965 1.00 42.17  ? 62  LEU A CG  1 
ATOM   463  C  CD1 . LEU A  1 62  ? 24.325  21.072  46.189 1.00 43.81  ? 62  LEU A CD1 1 
ATOM   464  C  CD2 . LEU A  1 62  ? 26.257  20.624  47.738 1.00 35.76  ? 62  LEU A CD2 1 
ATOM   465  N  N   . GLN A  1 63  ? 25.971  25.353  46.887 1.00 45.53  ? 63  GLN A N   1 
ATOM   466  C  CA  . GLN A  1 63  ? 25.415  26.300  47.849 1.00 43.45  ? 63  GLN A CA  1 
ATOM   467  C  C   . GLN A  1 63  ? 24.540  27.351  47.175 1.00 32.78  ? 63  GLN A C   1 
ATOM   468  O  O   . GLN A  1 63  ? 23.475  27.692  47.687 1.00 37.44  ? 63  GLN A O   1 
ATOM   469  C  CB  . GLN A  1 63  ? 26.535  27.001  48.632 1.00 44.57  ? 63  GLN A CB  1 
ATOM   470  C  CG  . GLN A  1 63  ? 26.022  27.927  49.737 1.00 51.23  ? 63  GLN A CG  1 
ATOM   471  C  CD  . GLN A  1 63  ? 27.125  28.775  50.359 1.00 61.93  ? 63  GLN A CD  1 
ATOM   472  O  OE1 . GLN A  1 63  ? 28.180  28.267  50.729 1.00 52.85  ? 63  GLN A OE1 1 
ATOM   473  N  NE2 . GLN A  1 63  ? 26.878  30.073  50.477 1.00 58.95  ? 63  GLN A NE2 1 
ATOM   474  N  N   . GLU A  1 64  ? 24.981  27.878  46.037 1.00 36.00  ? 64  GLU A N   1 
ATOM   475  C  CA  . GLU A  1 64  ? 24.175  28.887  45.362 1.00 46.90  ? 64  GLU A CA  1 
ATOM   476  C  C   . GLU A  1 64  ? 22.879  28.281  44.824 1.00 38.91  ? 64  GLU A C   1 
ATOM   477  O  O   . GLU A  1 64  ? 21.822  28.913  44.897 1.00 47.41  ? 64  GLU A O   1 
ATOM   478  C  CB  . GLU A  1 64  ? 24.974  29.585  44.247 1.00 42.98  ? 64  GLU A CB  1 
ATOM   479  C  CG  . GLU A  1 64  ? 25.081  28.860  42.921 1.00 69.32  ? 64  GLU A CG  1 
ATOM   480  C  CD  . GLU A  1 64  ? 25.769  29.715  41.861 1.00 74.61  ? 64  GLU A CD  1 
ATOM   481  O  OE1 . GLU A  1 64  ? 25.372  30.888  41.689 1.00 80.19  ? 64  GLU A OE1 1 
ATOM   482  O  OE2 . GLU A  1 64  ? 26.703  29.217  41.196 1.00 78.23  ? 64  GLU A OE2 1 
ATOM   483  N  N   . LEU A  1 65  ? 22.949  27.051  44.313 1.00 43.35  ? 65  LEU A N   1 
ATOM   484  C  CA  . LEU A  1 65  ? 21.751  26.380  43.805 1.00 36.67  ? 65  LEU A CA  1 
ATOM   485  C  C   . LEU A  1 65  ? 20.760  26.239  44.945 1.00 43.65  ? 65  LEU A C   1 
ATOM   486  O  O   . LEU A  1 65  ? 19.555  26.424  44.761 1.00 41.87  ? 65  LEU A O   1 
ATOM   487  C  CB  . LEU A  1 65  ? 22.078  24.987  43.246 1.00 31.31  ? 65  LEU A CB  1 
ATOM   488  C  CG  . LEU A  1 65  ? 22.717  24.916  41.858 1.00 42.35  ? 65  LEU A CG  1 
ATOM   489  C  CD1 . LEU A  1 65  ? 23.126  23.489  41.549 1.00 41.96  ? 65  LEU A CD1 1 
ATOM   490  C  CD2 . LEU A  1 65  ? 21.725  25.422  40.818 1.00 44.15  ? 65  LEU A CD2 1 
ATOM   491  N  N   . TYR A  1 66  ? 21.277  25.908  46.126 1.00 38.67  ? 66  TYR A N   1 
ATOM   492  C  CA  . TYR A  1 66  ? 20.440  25.753  47.309 1.00 34.41  ? 66  TYR A CA  1 
ATOM   493  C  C   . TYR A  1 66  ? 19.882  27.107  47.722 1.00 36.15  ? 66  TYR A C   1 
ATOM   494  O  O   . TYR A  1 66  ? 18.739  27.207  48.169 1.00 37.80  ? 66  TYR A O   1 
ATOM   495  C  CB  . TYR A  1 66  ? 21.243  25.151  48.470 1.00 38.34  ? 66  TYR A CB  1 
ATOM   496  C  CG  . TYR A  1 66  ? 20.465  25.105  49.760 1.00 37.33  ? 66  TYR A CG  1 
ATOM   497  C  CD1 . TYR A  1 66  ? 19.392  24.229  49.919 1.00 40.45  ? 66  TYR A CD1 1 
ATOM   498  C  CD2 . TYR A  1 66  ? 20.755  25.987  50.800 1.00 49.43  ? 66  TYR A CD2 1 
ATOM   499  C  CE1 . TYR A  1 66  ? 18.626  24.237  51.078 1.00 42.74  ? 66  TYR A CE1 1 
ATOM   500  C  CE2 . TYR A  1 66  ? 19.993  26.001  51.965 1.00 47.57  ? 66  TYR A CE2 1 
ATOM   501  C  CZ  . TYR A  1 66  ? 18.930  25.128  52.096 1.00 47.88  ? 66  TYR A CZ  1 
ATOM   502  O  OH  . TYR A  1 66  ? 18.158  25.160  53.233 1.00 60.00  ? 66  TYR A OH  1 
ATOM   503  N  N   . GLU A  1 67  ? 20.695  28.149  47.574 1.00 40.62  ? 67  GLU A N   1 
ATOM   504  C  CA  . GLU A  1 67  ? 20.264  29.503  47.920 1.00 45.83  ? 67  GLU A CA  1 
ATOM   505  C  C   . GLU A  1 67  ? 19.040  29.889  47.098 1.00 47.75  ? 67  GLU A C   1 
ATOM   506  O  O   . GLU A  1 67  ? 18.127  30.553  47.598 1.00 41.12  ? 67  GLU A O   1 
ATOM   507  C  CB  . GLU A  1 67  ? 21.384  30.517  47.661 1.00 43.60  ? 67  GLU A CB  1 
ATOM   508  C  CG  . GLU A  1 67  ? 22.155  30.916  48.903 1.00 69.68  ? 67  GLU A CG  1 
ATOM   509  C  CD  . GLU A  1 67  ? 21.244  31.456  49.992 1.00 82.18  ? 67  GLU A CD  1 
ATOM   510  O  OE1 . GLU A  1 67  ? 20.647  32.541  49.801 1.00 78.72  ? 67  GLU A OE1 1 
ATOM   511  O  OE2 . GLU A  1 67  ? 21.121  30.784  51.038 1.00 78.91  ? 67  GLU A OE2 1 
ATOM   512  N  N   . GLY A  1 68  ? 19.031  29.477  45.833 1.00 44.83  ? 68  GLY A N   1 
ATOM   513  C  CA  . GLY A  1 68  ? 17.900  29.786  44.974 1.00 35.30  ? 68  GLY A CA  1 
ATOM   514  C  C   . GLY A  1 68  ? 16.638  29.163  45.537 1.00 33.45  ? 68  GLY A C   1 
ATOM   515  O  O   . GLY A  1 68  ? 15.585  29.801  45.589 1.00 38.48  ? 68  GLY A O   1 
ATOM   516  N  N   . LEU A  1 69  ? 16.743  27.910  45.970 1.00 37.04  ? 69  LEU A N   1 
ATOM   517  C  CA  . LEU A  1 69  ? 15.593  27.218  46.531 1.00 32.00  ? 69  LEU A CA  1 
ATOM   518  C  C   . LEU A  1 69  ? 15.166  27.885  47.824 1.00 35.12  ? 69  LEU A C   1 
ATOM   519  O  O   . LEU A  1 69  ? 13.976  28.120  48.051 1.00 37.95  ? 69  LEU A O   1 
ATOM   520  C  CB  . LEU A  1 69  ? 15.921  25.749  46.808 1.00 35.94  ? 69  LEU A CB  1 
ATOM   521  C  CG  . LEU A  1 69  ? 16.302  24.827  45.646 1.00 38.06  ? 69  LEU A CG  1 
ATOM   522  C  CD1 . LEU A  1 69  ? 16.509  23.425  46.197 1.00 32.39  ? 69  LEU A CD1 1 
ATOM   523  C  CD2 . LEU A  1 69  ? 15.211  24.813  44.591 1.00 35.70  ? 69  LEU A CD2 1 
ATOM   524  N  N   . ARG A  1 70  ? 16.136  28.187  48.681 1.00 44.64  ? 70  ARG A N   1 
ATOM   525  C  CA  . ARG A  1 70  ? 15.823  28.826  49.956 1.00 49.46  ? 70  ARG A CA  1 
ATOM   526  C  C   . ARG A  1 70  ? 15.119  30.165  49.742 1.00 42.11  ? 70  ARG A C   1 
ATOM   527  O  O   . ARG A  1 70  ? 14.072  30.425  50.338 1.00 40.60  ? 70  ARG A O   1 
ATOM   528  C  CB  . ARG A  1 70  ? 17.094  29.045  50.783 1.00 45.47  ? 70  ARG A CB  1 
ATOM   529  C  CG  . ARG A  1 70  ? 16.812  29.619  52.165 1.00 45.49  ? 70  ARG A CG  1 
ATOM   530  C  CD  . ARG A  1 70  ? 18.050  30.255  52.769 1.00 60.46  ? 70  ARG A CD  1 
ATOM   531  N  NE  . ARG A  1 70  ? 19.093  29.276  53.050 1.00 72.83  ? 70  ARG A NE  1 
ATOM   532  C  CZ  . ARG A  1 70  ? 20.322  29.592  53.442 1.00 82.60  ? 70  ARG A CZ  1 
ATOM   533  N  NH1 . ARG A  1 70  ? 20.662  30.865  53.595 1.00 88.63  ? 70  ARG A NH1 1 
ATOM   534  N  NH2 . ARG A  1 70  ? 21.211  28.638  53.685 1.00 84.50  ? 70  ARG A NH2 1 
ATOM   535  N  N   . LEU A  1 71  ? 15.692  31.008  48.888 1.00 34.74  ? 71  LEU A N   1 
ATOM   536  C  CA  . LEU A  1 71  ? 15.109  32.324  48.606 1.00 38.64  ? 71  LEU A CA  1 
ATOM   537  C  C   . LEU A  1 71  ? 13.647  32.231  48.166 1.00 47.82  ? 71  LEU A C   1 
ATOM   538  O  O   . LEU A  1 71  ? 12.845  33.108  48.492 1.00 47.95  ? 71  LEU A O   1 
ATOM   539  C  CB  . LEU A  1 71  ? 15.928  33.052  47.527 1.00 40.07  ? 71  LEU A CB  1 
ATOM   540  C  CG  . LEU A  1 71  ? 17.308  33.592  47.922 1.00 45.21  ? 71  LEU A CG  1 
ATOM   541  C  CD1 . LEU A  1 71  ? 18.135  33.883  46.680 1.00 44.57  ? 71  LEU A CD1 1 
ATOM   542  C  CD2 . LEU A  1 71  ? 17.140  34.854  48.760 1.00 47.25  ? 71  LEU A CD2 1 
ATOM   543  N  N   . ASN A  1 72  ? 13.295  31.178  47.427 1.00 39.23  ? 72  ASN A N   1 
ATOM   544  C  CA  . ASN A  1 72  ? 11.911  31.017  46.974 1.00 43.97  ? 72  ASN A CA  1 
ATOM   545  C  C   . ASN A  1 72  ? 11.070  30.200  47.943 1.00 43.15  ? 72  ASN A C   1 
ATOM   546  O  O   . ASN A  1 72  ? 9.906   29.899  47.670 1.00 41.05  ? 72  ASN A O   1 
ATOM   547  C  CB  . ASN A  1 72  ? 11.868  30.358  45.595 1.00 44.71  ? 72  ASN A CB  1 
ATOM   548  C  CG  . ASN A  1 72  ? 12.313  31.292  44.498 1.00 51.39  ? 72  ASN A CG  1 
ATOM   549  O  OD1 . ASN A  1 72  ? 11.771  32.386  44.350 1.00 42.30  ? 72  ASN A OD1 1 
ATOM   550  N  ND2 . ASN A  1 72  ? 13.304  30.869  43.720 1.00 34.01  ? 72  ASN A ND2 1 
ATOM   551  N  N   . ASN A  1 73  ? 11.661  29.851  49.080 1.00 47.84  ? 73  ASN A N   1 
ATOM   552  C  CA  . ASN A  1 73  ? 10.970  29.055  50.084 1.00 48.46  ? 73  ASN A CA  1 
ATOM   553  C  C   . ASN A  1 73  ? 10.623  27.679  49.554 1.00 52.99  ? 73  ASN A C   1 
ATOM   554  O  O   . ASN A  1 73  ? 9.593   27.111  49.918 1.00 43.30  ? 73  ASN A O   1 
ATOM   555  C  CB  . ASN A  1 73  ? 9.689   29.743  50.550 1.00 57.12  ? 73  ASN A CB  1 
ATOM   556  C  CG  . ASN A  1 73  ? 9.919   30.649  51.730 1.00 66.84  ? 73  ASN A CG  1 
ATOM   557  O  OD1 . ASN A  1 73  ? 10.392  31.776  51.584 1.00 71.78  ? 73  ASN A OD1 1 
ATOM   558  N  ND2 . ASN A  1 73  ? 9.597   30.154  52.918 1.00 72.78  ? 73  ASN A ND2 1 
ATOM   559  N  N   . MET A  1 74  ? 11.485  27.146  48.695 1.00 46.28  ? 74  MET A N   1 
ATOM   560  C  CA  . MET A  1 74  ? 11.263  25.823  48.127 1.00 58.69  ? 74  MET A CA  1 
ATOM   561  C  C   . MET A  1 74  ? 12.205  24.822  48.784 1.00 53.59  ? 74  MET A C   1 
ATOM   562  O  O   . MET A  1 74  ? 12.491  23.763  48.229 1.00 55.85  ? 74  MET A O   1 
ATOM   563  C  CB  . MET A  1 74  ? 11.493  25.856  46.612 1.00 46.65  ? 74  MET A CB  1 
ATOM   564  C  CG  . MET A  1 74  ? 10.545  26.794  45.877 1.00 47.25  ? 74  MET A CG  1 
ATOM   565  S  SD  . MET A  1 74  ? 10.871  26.940  44.117 1.00 56.25  ? 74  MET A SD  1 
ATOM   566  C  CE  . MET A  1 74  ? 12.607  27.053  44.121 1.00 25.27  ? 74  MET A CE  1 
ATOM   567  N  N   . ASN A  1 75  ? 12.683  25.167  49.975 1.00 53.89  ? 75  ASN A N   1 
ATOM   568  C  CA  . ASN A  1 75  ? 13.597  24.302  50.713 1.00 52.58  ? 75  ASN A CA  1 
ATOM   569  C  C   . ASN A  1 75  ? 12.839  23.446  51.730 1.00 52.34  ? 75  ASN A C   1 
ATOM   570  O  O   . ASN A  1 75  ? 13.192  23.385  52.907 1.00 49.46  ? 75  ASN A O   1 
ATOM   571  C  CB  . ASN A  1 75  ? 14.665  25.151  51.410 1.00 52.48  ? 75  ASN A CB  1 
ATOM   572  C  CG  . ASN A  1 75  ? 14.086  26.064  52.469 1.00 54.31  ? 75  ASN A CG  1 
ATOM   573  O  OD1 . ASN A  1 75  ? 12.945  26.513  52.365 1.00 58.40  ? 75  ASN A OD1 1 
ATOM   574  N  ND2 . ASN A  1 75  ? 14.880  26.358  53.491 1.00 61.15  ? 75  ASN A ND2 1 
ATOM   575  N  N   . LYS A  1 76  ? 11.781  22.797  51.257 1.00 49.56  ? 76  LYS A N   1 
ATOM   576  C  CA  . LYS A  1 76  ? 10.962  21.931  52.089 1.00 43.14  ? 76  LYS A CA  1 
ATOM   577  C  C   . LYS A  1 76  ? 10.870  20.580  51.396 1.00 48.85  ? 76  LYS A C   1 
ATOM   578  O  O   . LYS A  1 76  ? 10.128  20.422  50.425 1.00 51.10  ? 76  LYS A O   1 
ATOM   579  C  CB  . LYS A  1 76  ? 9.562   22.526  52.259 1.00 45.13  ? 76  LYS A CB  1 
ATOM   580  C  CG  . LYS A  1 76  ? 9.545   23.869  52.965 1.00 59.57  ? 76  LYS A CG  1 
ATOM   581  C  CD  . LYS A  1 76  ? 8.144   24.458  53.005 1.00 78.52  ? 76  LYS A CD  1 
ATOM   582  C  CE  . LYS A  1 76  ? 8.096   25.715  53.861 1.00 85.16  ? 76  LYS A CE  1 
ATOM   583  N  NZ  . LYS A  1 76  ? 9.051   26.757  53.391 1.00 88.48  ? 76  LYS A NZ  1 
ATOM   584  N  N   . TYR A  1 77  ? 11.639  19.615  51.888 1.00 41.99  ? 77  TYR A N   1 
ATOM   585  C  CA  . TYR A  1 77  ? 11.650  18.277  51.314 1.00 30.49  ? 77  TYR A CA  1 
ATOM   586  C  C   . TYR A  1 77  ? 11.298  17.189  52.325 1.00 44.38  ? 77  TYR A C   1 
ATOM   587  O  O   . TYR A  1 77  ? 11.562  17.312  53.527 1.00 36.42  ? 77  TYR A O   1 
ATOM   588  C  CB  . TYR A  1 77  ? 13.020  17.970  50.694 1.00 37.01  ? 77  TYR A CB  1 
ATOM   589  C  CG  . TYR A  1 77  ? 13.317  18.752  49.436 1.00 33.52  ? 77  TYR A CG  1 
ATOM   590  C  CD1 . TYR A  1 77  ? 13.853  20.041  49.497 1.00 32.91  ? 77  TYR A CD1 1 
ATOM   591  C  CD2 . TYR A  1 77  ? 13.011  18.227  48.180 1.00 46.57  ? 77  TYR A CD2 1 
ATOM   592  C  CE1 . TYR A  1 77  ? 14.073  20.785  48.342 1.00 39.81  ? 77  TYR A CE1 1 
ATOM   593  C  CE2 . TYR A  1 77  ? 13.224  18.966  47.011 1.00 35.65  ? 77  TYR A CE2 1 
ATOM   594  C  CZ  . TYR A  1 77  ? 13.755  20.241  47.103 1.00 41.79  ? 77  TYR A CZ  1 
ATOM   595  O  OH  . TYR A  1 77  ? 13.972  20.967  45.960 1.00 45.08  ? 77  TYR A OH  1 
ATOM   596  N  N   . ASP A  1 78  ? 10.693  16.121  51.822 1.00 42.21  ? 78  ASP A N   1 
ATOM   597  C  CA  . ASP A  1 78  ? 10.307  14.992  52.651 1.00 38.86  ? 78  ASP A CA  1 
ATOM   598  C  C   . ASP A  1 78  ? 11.457  13.996  52.704 1.00 46.52  ? 78  ASP A C   1 
ATOM   599  O  O   . ASP A  1 78  ? 11.580  13.217  53.654 1.00 43.25  ? 78  ASP A O   1 
ATOM   600  C  CB  . ASP A  1 78  ? 9.065   14.319  52.068 1.00 39.42  ? 78  ASP A CB  1 
ATOM   601  C  CG  . ASP A  1 78  ? 7.891   15.265  51.973 1.00 46.83  ? 78  ASP A CG  1 
ATOM   602  O  OD1 . ASP A  1 78  ? 7.421   15.726  53.032 1.00 51.28  ? 78  ASP A OD1 1 
ATOM   603  O  OD2 . ASP A  1 78  ? 7.444   15.555  50.844 1.00 46.01  ? 78  ASP A OD2 1 
ATOM   604  N  N   . TYR A  1 79  ? 12.292  14.027  51.668 1.00 40.37  ? 79  TYR A N   1 
ATOM   605  C  CA  . TYR A  1 79  ? 13.439  13.137  51.578 1.00 35.24  ? 79  TYR A CA  1 
ATOM   606  C  C   . TYR A  1 79  ? 14.628  13.811  50.925 1.00 41.14  ? 79  TYR A C   1 
ATOM   607  O  O   . TYR A  1 79  ? 14.481  14.754  50.146 1.00 37.57  ? 79  TYR A O   1 
ATOM   608  C  CB  . TYR A  1 79  ? 13.125  11.890  50.736 1.00 36.43  ? 79  TYR A CB  1 
ATOM   609  C  CG  . TYR A  1 79  ? 12.133  10.921  51.335 1.00 43.98  ? 79  TYR A CG  1 
ATOM   610  C  CD1 . TYR A  1 79  ? 10.759  11.088  51.152 1.00 29.98  ? 79  TYR A CD1 1 
ATOM   611  C  CD2 . TYR A  1 79  ? 12.572  9.827   52.081 1.00 38.07  ? 79  TYR A CD2 1 
ATOM   612  C  CE1 . TYR A  1 79  ? 9.847   10.183  51.698 1.00 36.70  ? 79  TYR A CE1 1 
ATOM   613  C  CE2 . TYR A  1 79  ? 11.669  8.919   52.631 1.00 40.32  ? 79  TYR A CE2 1 
ATOM   614  C  CZ  . TYR A  1 79  ? 10.316  9.100   52.437 1.00 38.14  ? 79  TYR A CZ  1 
ATOM   615  O  OH  . TYR A  1 79  ? 9.437   8.195   52.980 1.00 50.27  ? 79  TYR A OH  1 
ATOM   616  N  N   . VAL A  1 80  ? 15.811  13.316  51.263 1.00 36.52  ? 80  VAL A N   1 
ATOM   617  C  CA  . VAL A  1 80  ? 17.044  13.779  50.653 1.00 33.94  ? 80  VAL A CA  1 
ATOM   618  C  C   . VAL A  1 80  ? 17.717  12.469  50.273 1.00 37.66  ? 80  VAL A C   1 
ATOM   619  O  O   . VAL A  1 80  ? 17.638  11.489  51.014 1.00 36.42  ? 80  VAL A O   1 
ATOM   620  C  CB  . VAL A  1 80  ? 17.921  14.582  51.622 1.00 42.33  ? 80  VAL A CB  1 
ATOM   621  C  CG1 . VAL A  1 80  ? 19.252  14.920  50.953 1.00 34.31  ? 80  VAL A CG1 1 
ATOM   622  C  CG2 . VAL A  1 80  ? 17.201  15.869  52.015 1.00 38.91  ? 80  VAL A CG2 1 
ATOM   623  N  N   . LEU A  1 81  ? 18.348  12.436  49.108 1.00 40.66  ? 81  LEU A N   1 
ATOM   624  C  CA  . LEU A  1 81  ? 18.994  11.220  48.639 1.00 33.82  ? 81  LEU A CA  1 
ATOM   625  C  C   . LEU A  1 81  ? 20.385  11.525  48.104 1.00 39.19  ? 81  LEU A C   1 
ATOM   626  O  O   . LEU A  1 81  ? 20.540  12.395  47.246 1.00 36.79  ? 81  LEU A O   1 
ATOM   627  C  CB  . LEU A  1 81  ? 18.134  10.592  47.534 1.00 35.32  ? 81  LEU A CB  1 
ATOM   628  C  CG  . LEU A  1 81  ? 18.547  9.301   46.825 1.00 41.31  ? 81  LEU A CG  1 
ATOM   629  C  CD1 . LEU A  1 81  ? 18.533  8.131   47.807 1.00 34.72  ? 81  LEU A CD1 1 
ATOM   630  C  CD2 . LEU A  1 81  ? 17.577  9.037   45.668 1.00 34.64  ? 81  LEU A CD2 1 
ATOM   631  N  N   . THR A  1 82  ? 21.393  10.818  48.617 1.00 34.89  ? 82  THR A N   1 
ATOM   632  C  CA  . THR A  1 82  ? 22.770  11.009  48.163 1.00 31.34  ? 82  THR A CA  1 
ATOM   633  C  C   . THR A  1 82  ? 23.484  9.682   47.969 1.00 31.18  ? 82  THR A C   1 
ATOM   634  O  O   . THR A  1 82  ? 23.112  8.661   48.549 1.00 32.24  ? 82  THR A O   1 
ATOM   635  C  CB  . THR A  1 82  ? 23.616  11.851  49.158 1.00 39.09  ? 82  THR A CB  1 
ATOM   636  O  OG1 . THR A  1 82  ? 23.775  11.130  50.390 1.00 45.44  ? 82  THR A OG1 1 
ATOM   637  C  CG2 . THR A  1 82  ? 22.947  13.187  49.436 1.00 34.96  ? 82  THR A CG2 1 
ATOM   638  N  N   . GLY A  1 83  ? 24.521  9.711   47.148 1.00 30.98  ? 83  GLY A N   1 
ATOM   639  C  CA  . GLY A  1 83  ? 25.284  8.511   46.890 1.00 33.42  ? 83  GLY A CA  1 
ATOM   640  C  C   . GLY A  1 83  ? 26.757  8.821   46.685 1.00 34.78  ? 83  GLY A C   1 
ATOM   641  O  O   . GLY A  1 83  ? 27.397  9.462   47.522 1.00 45.69  ? 83  GLY A O   1 
ATOM   642  N  N   . TYR A  1 84  ? 27.293  8.378   45.559 1.00 32.82  ? 84  TYR A N   1 
ATOM   643  C  CA  . TYR A  1 84  ? 28.688  8.584   45.277 1.00 44.90  ? 84  TYR A CA  1 
ATOM   644  C  C   . TYR A  1 84  ? 29.065  10.041  45.317 1.00 50.79  ? 84  TYR A C   1 
ATOM   645  O  O   . TYR A  1 84  ? 28.550  10.860  44.566 1.00 47.45  ? 84  TYR A O   1 
ATOM   646  C  CB  . TYR A  1 84  ? 29.075  7.992   43.920 1.00 42.61  ? 84  TYR A CB  1 
ATOM   647  C  CG  . TYR A  1 84  ? 30.514  8.259   43.526 1.00 50.83  ? 84  TYR A CG  1 
ATOM   648  C  CD1 . TYR A  1 84  ? 30.862  9.415   42.828 1.00 53.86  ? 84  TYR A CD1 1 
ATOM   649  C  CD2 . TYR A  1 84  ? 31.530  7.362   43.862 1.00 63.50  ? 84  TYR A CD2 1 
ATOM   650  C  CE1 . TYR A  1 84  ? 32.188  9.671   42.471 1.00 63.51  ? 84  TYR A CE1 1 
ATOM   651  C  CE2 . TYR A  1 84  ? 32.859  7.610   43.511 1.00 66.01  ? 84  TYR A CE2 1 
ATOM   652  C  CZ  . TYR A  1 84  ? 33.179  8.766   42.816 1.00 73.23  ? 84  TYR A CZ  1 
ATOM   653  O  OH  . TYR A  1 84  ? 34.486  9.018   42.464 1.00 81.11  ? 84  TYR A OH  1 
ATOM   654  N  N   . THR A  1 85  ? 29.958  10.363  46.234 1.00 50.37  ? 85  THR A N   1 
ATOM   655  C  CA  . THR A  1 85  ? 30.459  11.718  46.353 1.00 47.64  ? 85  THR A CA  1 
ATOM   656  C  C   . THR A  1 85  ? 31.979  11.540  46.408 1.00 57.35  ? 85  THR A C   1 
ATOM   657  O  O   . THR A  1 85  ? 32.458  10.566  46.968 1.00 53.90  ? 85  THR A O   1 
ATOM   658  C  CB  . THR A  1 85  ? 29.961  12.366  47.601 1.00 50.71  ? 85  THR A CB  1 
ATOM   659  O  OG1 . THR A  1 85  ? 28.520  12.329  47.640 1.00 56.88  ? 85  THR A OG1 1 
ATOM   660  C  CG2 . THR A  1 85  ? 30.430  13.796  47.632 1.00 52.40  ? 85  THR A CG2 1 
ATOM   661  N  N   . ARG A  1 86  ? 32.719  12.472  45.844 1.00 57.84  ? 86  ARG A N   1 
ATOM   662  C  CA  . ARG A  1 86  ? 34.149  12.331  45.820 1.00 56.96  ? 86  ARG A CA  1 
ATOM   663  C  C   . ARG A  1 86  ? 34.925  13.395  46.583 1.00 61.16  ? 86  ARG A C   1 
ATOM   664  O  O   . ARG A  1 86  ? 36.061  13.146  47.014 1.00 59.18  ? 86  ARG A O   1 
ATOM   665  C  CB  . ARG A  1 86  ? 34.578  12.336  44.376 1.00 66.90  ? 86  ARG A CB  1 
ATOM   666  C  CG  . ARG A  1 86  ? 35.974  11.966  44.143 1.00 75.64  ? 86  ARG A CG  1 
ATOM   667  C  CD  . ARG A  1 86  ? 36.199  11.927  42.679 1.00 88.45  ? 86  ARG A CD  1 
ATOM   668  N  NE  . ARG A  1 86  ? 37.611  11.749  42.413 1.00 98.10  ? 86  ARG A NE  1 
ATOM   669  C  CZ  . ARG A  1 86  ? 38.241  10.587  42.503 1.00 98.34  ? 86  ARG A CZ  1 
ATOM   670  N  NH1 . ARG A  1 86  ? 37.585  9.480   42.844 1.00 93.94  ? 86  ARG A NH1 1 
ATOM   671  N  NH2 . ARG A  1 86  ? 39.538  10.543  42.264 1.00 100.00 ? 86  ARG A NH2 1 
ATOM   672  N  N   . ASP A  1 87  ? 34.359  14.587  46.725 1.00 62.51  ? 87  ASP A N   1 
ATOM   673  C  CA  . ASP A  1 87  ? 35.053  15.640  47.460 1.00 59.12  ? 87  ASP A CA  1 
ATOM   674  C  C   . ASP A  1 87  ? 34.581  15.829  48.878 1.00 62.60  ? 87  ASP A C   1 
ATOM   675  O  O   . ASP A  1 87  ? 33.371  15.812  49.200 1.00 57.40  ? 87  ASP A O   1 
ATOM   676  C  CB  . ASP A  1 87  ? 34.912  16.998  46.824 1.00 68.21  ? 87  ASP A CB  1 
ATOM   677  C  CG  . ASP A  1 87  ? 35.442  17.066  45.419 1.00 77.27  ? 87  ASP A CG  1 
ATOM   678  O  OD1 . ASP A  1 87  ? 34.800  17.762  44.615 1.00 93.77  ? 87  ASP A OD1 1 
ATOM   679  O  OD2 . ASP A  1 87  ? 36.464  16.453  45.103 1.00 88.53  ? 87  ASP A OD2 1 
ATOM   680  N  N   . LYS A  1 88  ? 35.577  16.121  49.689 1.00 56.22  ? 88  LYS A N   1 
ATOM   681  C  CA  . LYS A  1 88  ? 35.379  16.413  51.060 1.00 56.19  ? 88  LYS A CA  1 
ATOM   682  C  C   . LYS A  1 88  ? 34.518  17.683  51.191 1.00 36.47  ? 88  LYS A C   1 
ATOM   683  O  O   . LYS A  1 88  ? 33.504  17.677  51.894 1.00 46.74  ? 88  LYS A O   1 
ATOM   684  C  CB  . LYS A  1 88  ? 36.744  16.635  51.675 1.00 57.53  ? 88  LYS A CB  1 
ATOM   685  C  CG  . LYS A  1 88  ? 36.713  16.800  53.145 1.00 70.25  ? 88  LYS A CG  1 
ATOM   686  C  CD  . LYS A  1 88  ? 38.102  16.986  53.640 1.00 76.53  ? 88  LYS A CD  1 
ATOM   687  C  CE  . LYS A  1 88  ? 38.077  17.264  55.101 1.00 68.60  ? 88  LYS A CE  1 
ATOM   688  N  NZ  . LYS A  1 88  ? 39.436  17.522  55.606 1.00 81.56  ? 88  LYS A NZ  1 
ATOM   689  N  N   . SER A  1 89  ? 34.897  18.775  50.530 1.00 39.09  ? 89  SER A N   1 
ATOM   690  C  CA  . SER A  1 89  ? 34.120  20.019  50.640 1.00 50.36  ? 89  SER A CA  1 
ATOM   691  C  C   . SER A  1 89  ? 32.679  19.900  50.136 1.00 49.49  ? 89  SER A C   1 
ATOM   692  O  O   . SER A  1 89  ? 31.763  20.493  50.708 1.00 47.05  ? 89  SER A O   1 
ATOM   693  C  CB  . SER A  1 89  ? 34.824  21.170  49.910 1.00 46.30  ? 89  SER A CB  1 
ATOM   694  O  OG  . SER A  1 89  ? 35.036  20.858  48.548 1.00 61.06  ? 89  SER A OG  1 
ATOM   695  N  N   . PHE A  1 90  ? 32.477  19.129  49.072 1.00 48.31  ? 90  PHE A N   1 
ATOM   696  C  CA  . PHE A  1 90  ? 31.143  18.946  48.506 1.00 39.98  ? 90  PHE A CA  1 
ATOM   697  C  C   . PHE A  1 90  ? 30.270  18.215  49.518 1.00 36.42  ? 90  PHE A C   1 
ATOM   698  O  O   . PHE A  1 90  ? 29.154  18.641  49.827 1.00 41.85  ? 90  PHE A O   1 
ATOM   699  C  CB  . PHE A  1 90  ? 31.226  18.131  47.213 1.00 45.09  ? 90  PHE A CB  1 
ATOM   700  C  CG  . PHE A  1 90  ? 29.979  18.187  46.378 1.00 51.38  ? 90  PHE A CG  1 
ATOM   701  C  CD1 . PHE A  1 90  ? 29.802  19.197  45.437 1.00 46.83  ? 90  PHE A CD1 1 
ATOM   702  C  CD2 . PHE A  1 90  ? 28.972  17.237  46.542 1.00 37.35  ? 90  PHE A CD2 1 
ATOM   703  C  CE1 . PHE A  1 90  ? 28.638  19.263  44.668 1.00 54.85  ? 90  PHE A CE1 1 
ATOM   704  C  CE2 . PHE A  1 90  ? 27.802  17.292  45.778 1.00 42.36  ? 90  PHE A CE2 1 
ATOM   705  C  CZ  . PHE A  1 90  ? 27.636  18.305  44.842 1.00 42.98  ? 90  PHE A CZ  1 
ATOM   706  N  N   . LEU A  1 91  ? 30.793  17.116  50.050 1.00 39.94  ? 91  LEU A N   1 
ATOM   707  C  CA  . LEU A  1 91  ? 30.059  16.330  51.035 1.00 41.16  ? 91  LEU A CA  1 
ATOM   708  C  C   . LEU A  1 91  ? 29.763  17.176  52.273 1.00 48.62  ? 91  LEU A C   1 
ATOM   709  O  O   . LEU A  1 91  ? 28.673  17.098  52.850 1.00 43.94  ? 91  LEU A O   1 
ATOM   710  C  CB  . LEU A  1 91  ? 30.864  15.087  51.419 1.00 39.76  ? 91  LEU A CB  1 
ATOM   711  C  CG  . LEU A  1 91  ? 30.176  14.079  52.342 1.00 44.61  ? 91  LEU A CG  1 
ATOM   712  C  CD1 . LEU A  1 91  ? 28.830  13.642  51.754 1.00 37.70  ? 91  LEU A CD1 1 
ATOM   713  C  CD2 . LEU A  1 91  ? 31.096  12.887  52.524 1.00 47.97  ? 91  LEU A CD2 1 
ATOM   714  N  N   . ALA A  1 92  ? 30.736  17.987  52.676 1.00 46.11  ? 92  ALA A N   1 
ATOM   715  C  CA  . ALA A  1 92  ? 30.561  18.856  53.828 1.00 48.64  ? 92  ALA A CA  1 
ATOM   716  C  C   . ALA A  1 92  ? 29.404  19.815  53.545 1.00 40.51  ? 92  ALA A C   1 
ATOM   717  O  O   . ALA A  1 92  ? 28.563  20.065  54.408 1.00 38.33  ? 92  ALA A O   1 
ATOM   718  C  CB  . ALA A  1 92  ? 31.846  19.633  54.098 1.00 53.22  ? 92  ALA A CB  1 
ATOM   719  N  N   . MET A  1 93  ? 29.360  20.346  52.327 1.00 41.66  ? 93  MET A N   1 
ATOM   720  C  CA  . MET A  1 93  ? 28.285  21.262  51.943 1.00 43.21  ? 93  MET A CA  1 
ATOM   721  C  C   . MET A  1 93  ? 26.953  20.514  51.994 1.00 33.56  ? 93  MET A C   1 
ATOM   722  O  O   . MET A  1 93  ? 25.925  21.058  52.419 1.00 42.25  ? 93  MET A O   1 
ATOM   723  C  CB  . MET A  1 93  ? 28.533  21.799  50.535 1.00 46.81  ? 93  MET A CB  1 
ATOM   724  C  CG  . MET A  1 93  ? 27.543  22.860  50.082 1.00 43.64  ? 93  MET A CG  1 
ATOM   725  S  SD  . MET A  1 93  ? 27.575  24.370  51.064 1.00 50.20  ? 93  MET A SD  1 
ATOM   726  C  CE  . MET A  1 93  ? 26.150  24.160  52.002 1.00 37.76  ? 93  MET A CE  1 
ATOM   727  N  N   . VAL A  1 94  ? 26.981  19.255  51.572 1.00 43.44  ? 94  VAL A N   1 
ATOM   728  C  CA  . VAL A  1 94  ? 25.782  18.423  51.576 1.00 44.43  ? 94  VAL A CA  1 
ATOM   729  C  C   . VAL A  1 94  ? 25.200  18.249  52.986 1.00 48.27  ? 94  VAL A C   1 
ATOM   730  O  O   . VAL A  1 94  ? 23.984  18.342  53.169 1.00 49.86  ? 94  VAL A O   1 
ATOM   731  C  CB  . VAL A  1 94  ? 26.072  17.024  50.962 1.00 41.24  ? 94  VAL A CB  1 
ATOM   732  C  CG1 . VAL A  1 94  ? 24.878  16.112  51.155 1.00 43.47  ? 94  VAL A CG1 1 
ATOM   733  C  CG2 . VAL A  1 94  ? 26.397  17.163  49.477 1.00 41.17  ? 94  VAL A CG2 1 
ATOM   734  N  N   . VAL A  1 95  ? 26.050  18.001  53.984 1.00 48.33  ? 95  VAL A N   1 
ATOM   735  C  CA  . VAL A  1 95  ? 25.538  17.830  55.346 1.00 41.79  ? 95  VAL A CA  1 
ATOM   736  C  C   . VAL A  1 95  ? 24.969  19.148  55.870 1.00 35.05  ? 95  VAL A C   1 
ATOM   737  O  O   . VAL A  1 95  ? 23.927  19.157  56.537 1.00 40.44  ? 95  VAL A O   1 
ATOM   738  C  CB  . VAL A  1 95  ? 26.626  17.299  56.346 1.00 53.87  ? 95  VAL A CB  1 
ATOM   739  C  CG1 . VAL A  1 95  ? 27.471  16.230  55.684 1.00 37.50  ? 95  VAL A CG1 1 
ATOM   740  C  CG2 . VAL A  1 95  ? 27.479  18.429  56.867 1.00 57.02  ? 95  VAL A CG2 1 
ATOM   741  N  N   . ASP A  1 96  ? 25.632  20.265  55.574 1.00 34.51  ? 96  ASP A N   1 
ATOM   742  C  CA  . ASP A  1 96  ? 25.105  21.557  56.031 1.00 43.39  ? 96  ASP A CA  1 
ATOM   743  C  C   . ASP A  1 96  ? 23.690  21.762  55.484 1.00 45.49  ? 96  ASP A C   1 
ATOM   744  O  O   . ASP A  1 96  ? 22.806  22.259  56.185 1.00 47.12  ? 96  ASP A O   1 
ATOM   745  C  CB  . ASP A  1 96  ? 26.001  22.719  55.588 1.00 50.26  ? 96  ASP A CB  1 
ATOM   746  C  CG  . ASP A  1 96  ? 27.352  22.716  56.283 1.00 57.97  ? 96  ASP A CG  1 
ATOM   747  O  OD1 . ASP A  1 96  ? 27.439  22.196  57.417 1.00 52.08  ? 96  ASP A OD1 1 
ATOM   748  O  OD2 . ASP A  1 96  ? 28.324  23.246  55.701 1.00 55.36  ? 96  ASP A OD2 1 
ATOM   749  N  N   . ILE A  1 97  ? 23.479  21.365  54.233 1.00 44.10  ? 97  ILE A N   1 
ATOM   750  C  CA  . ILE A  1 97  ? 22.169  21.495  53.603 1.00 40.57  ? 97  ILE A CA  1 
ATOM   751  C  C   . ILE A  1 97  ? 21.145  20.563  54.247 1.00 35.69  ? 97  ILE A C   1 
ATOM   752  O  O   . ILE A  1 97  ? 20.042  20.990  54.589 1.00 41.56  ? 97  ILE A O   1 
ATOM   753  C  CB  . ILE A  1 97  ? 22.266  21.220  52.085 1.00 42.74  ? 97  ILE A CB  1 
ATOM   754  C  CG1 . ILE A  1 97  ? 22.985  22.394  51.411 1.00 37.10  ? 97  ILE A CG1 1 
ATOM   755  C  CG2 . ILE A  1 97  ? 20.878  21.009  51.490 1.00 46.40  ? 97  ILE A CG2 1 
ATOM   756  C  CD1 . ILE A  1 97  ? 23.357  22.154  49.974 1.00 38.20  ? 97  ILE A CD1 1 
ATOM   757  N  N   . VAL A  1 98  ? 21.499  19.291  54.421 1.00 41.97  ? 98  VAL A N   1 
ATOM   758  C  CA  . VAL A  1 98  ? 20.573  18.356  55.052 1.00 34.73  ? 98  VAL A CA  1 
ATOM   759  C  C   . VAL A  1 98  ? 20.258  18.909  56.437 1.00 37.79  ? 98  VAL A C   1 
ATOM   760  O  O   . VAL A  1 98  ? 19.112  18.886  56.895 1.00 38.93  ? 98  VAL A O   1 
ATOM   761  C  CB  . VAL A  1 98  ? 21.186  16.944  55.173 1.00 43.13  ? 98  VAL A CB  1 
ATOM   762  C  CG1 . VAL A  1 98  ? 20.243  16.031  55.936 1.00 35.79  ? 98  VAL A CG1 1 
ATOM   763  C  CG2 . VAL A  1 98  ? 21.457  16.375  53.782 1.00 41.51  ? 98  VAL A CG2 1 
ATOM   764  N  N   . GLN A  1 99  ? 21.292  19.432  57.088 1.00 44.40  ? 99  GLN A N   1 
ATOM   765  C  CA  . GLN A  1 99  ? 21.167  20.028  58.413 1.00 45.99  ? 99  GLN A CA  1 
ATOM   766  C  C   . GLN A  1 99  ? 20.021  21.049  58.402 1.00 46.19  ? 99  GLN A C   1 
ATOM   767  O  O   . GLN A  1 99  ? 19.076  20.957  59.187 1.00 44.39  ? 99  GLN A O   1 
ATOM   768  C  CB  . GLN A  1 99  ? 22.476  20.734  58.769 1.00 59.11  ? 99  GLN A CB  1 
ATOM   769  C  CG  . GLN A  1 99  ? 22.747  20.894  60.247 1.00 70.46  ? 99  GLN A CG  1 
ATOM   770  C  CD  . GLN A  1 99  ? 23.181  19.598  60.889 1.00 85.05  ? 99  GLN A CD  1 
ATOM   771  O  OE1 . GLN A  1 99  ? 22.363  18.715  61.148 1.00 92.97  ? 99  GLN A OE1 1 
ATOM   772  N  NE2 . GLN A  1 99  ? 24.481  19.468  61.137 1.00 88.84  ? 99  GLN A NE2 1 
ATOM   773  N  N   . GLU A  1 100 ? 20.108  22.023  57.503 1.00 39.63  ? 100 GLU A N   1 
ATOM   774  C  CA  . GLU A  1 100 ? 19.074  23.040  57.417 1.00 46.79  ? 100 GLU A CA  1 
ATOM   775  C  C   . GLU A  1 100 ? 17.727  22.480  56.967 1.00 43.71  ? 100 GLU A C   1 
ATOM   776  O  O   . GLU A  1 100 ? 16.693  22.832  57.529 1.00 46.51  ? 100 GLU A O   1 
ATOM   777  C  CB  . GLU A  1 100 ? 19.508  24.166  56.482 1.00 47.79  ? 100 GLU A CB  1 
ATOM   778  C  CG  . GLU A  1 100 ? 18.475  25.275  56.377 1.00 67.80  ? 100 GLU A CG  1 
ATOM   779  C  CD  . GLU A  1 100 ? 19.036  26.549  55.782 1.00 75.67  ? 100 GLU A CD  1 
ATOM   780  O  OE1 . GLU A  1 100 ? 18.234  27.434  55.412 1.00 80.22  ? 100 GLU A OE1 1 
ATOM   781  O  OE2 . GLU A  1 100 ? 20.277  26.667  55.695 1.00 74.80  ? 100 GLU A OE2 1 
ATOM   782  N  N   . LEU A  1 101 ? 17.729  21.610  55.959 1.00 45.59  ? 101 LEU A N   1 
ATOM   783  C  CA  . LEU A  1 101 ? 16.474  21.026  55.488 1.00 37.83  ? 101 LEU A CA  1 
ATOM   784  C  C   . LEU A  1 101 ? 15.783  20.297  56.633 1.00 43.54  ? 101 LEU A C   1 
ATOM   785  O  O   . LEU A  1 101 ? 14.553  20.273  56.712 1.00 42.72  ? 101 LEU A O   1 
ATOM   786  C  CB  . LEU A  1 101 ? 16.725  20.058  54.328 1.00 37.26  ? 101 LEU A CB  1 
ATOM   787  C  CG  . LEU A  1 101 ? 17.236  20.699  53.032 1.00 41.73  ? 101 LEU A CG  1 
ATOM   788  C  CD1 . LEU A  1 101 ? 17.517  19.617  51.989 1.00 37.53  ? 101 LEU A CD1 1 
ATOM   789  C  CD2 . LEU A  1 101 ? 16.204  21.688  52.512 1.00 40.36  ? 101 LEU A CD2 1 
ATOM   790  N  N   . LYS A  1 102 ? 16.577  19.697  57.519 1.00 39.25  ? 102 LYS A N   1 
ATOM   791  C  CA  . LYS A  1 102 ? 16.017  18.995  58.664 1.00 48.98  ? 102 LYS A CA  1 
ATOM   792  C  C   . LYS A  1 102 ? 15.483  20.017  59.663 1.00 45.81  ? 102 LYS A C   1 
ATOM   793  O  O   . LYS A  1 102 ? 14.470  19.782  60.325 1.00 48.47  ? 102 LYS A O   1 
ATOM   794  C  CB  . LYS A  1 102 ? 17.069  18.090  59.308 1.00 49.61  ? 102 LYS A CB  1 
ATOM   795  C  CG  . LYS A  1 102 ? 17.134  16.690  58.696 1.00 43.35  ? 102 LYS A CG  1 
ATOM   796  C  CD  . LYS A  1 102 ? 18.249  15.861  59.324 1.00 52.46  ? 102 LYS A CD  1 
ATOM   797  C  CE  . LYS A  1 102 ? 18.239  14.429  58.817 1.00 51.75  ? 102 LYS A CE  1 
ATOM   798  N  NZ  . LYS A  1 102 ? 17.031  13.694  59.268 1.00 50.85  ? 102 LYS A NZ  1 
ATOM   799  N  N   . GLN A  1 103 ? 16.163  21.155  59.774 1.00 44.16  ? 103 GLN A N   1 
ATOM   800  C  CA  . GLN A  1 103 ? 15.696  22.214  60.665 1.00 52.14  ? 103 GLN A CA  1 
ATOM   801  C  C   . GLN A  1 103 ? 14.355  22.688  60.107 1.00 49.06  ? 103 GLN A C   1 
ATOM   802  O  O   . GLN A  1 103 ? 13.397  22.892  60.847 1.00 50.55  ? 103 GLN A O   1 
ATOM   803  C  CB  . GLN A  1 103 ? 16.669  23.392  60.676 1.00 52.74  ? 103 GLN A CB  1 
ATOM   804  C  CG  . GLN A  1 103 ? 18.040  23.084  61.241 1.00 75.38  ? 103 GLN A CG  1 
ATOM   805  C  CD  . GLN A  1 103 ? 18.992  24.254  61.094 1.00 81.82  ? 103 GLN A CD  1 
ATOM   806  O  OE1 . GLN A  1 103 ? 18.703  25.362  61.547 1.00 96.25  ? 103 GLN A OE1 1 
ATOM   807  N  NE2 . GLN A  1 103 ? 20.132  24.015  60.455 1.00 85.40  ? 103 GLN A NE2 1 
ATOM   808  N  N   . GLN A  1 104 ? 14.298  22.848  58.786 1.00 42.79  ? 104 GLN A N   1 
ATOM   809  C  CA  . GLN A  1 104 ? 13.083  23.293  58.116 1.00 42.93  ? 104 GLN A CA  1 
ATOM   810  C  C   . GLN A  1 104 ? 11.963  22.261  58.247 1.00 51.26  ? 104 GLN A C   1 
ATOM   811  O  O   . GLN A  1 104 ? 10.802  22.619  58.436 1.00 50.88  ? 104 GLN A O   1 
ATOM   812  C  CB  . GLN A  1 104 ? 13.365  23.566  56.638 1.00 46.16  ? 104 GLN A CB  1 
ATOM   813  C  CG  . GLN A  1 104 ? 12.268  24.353  55.953 1.00 71.95  ? 104 GLN A CG  1 
ATOM   814  C  CD  . GLN A  1 104 ? 12.183  25.782  56.460 1.00 74.67  ? 104 GLN A CD  1 
ATOM   815  O  OE1 . GLN A  1 104 ? 11.197  26.478  56.219 1.00 78.57  ? 104 GLN A OE1 1 
ATOM   816  N  NE2 . GLN A  1 104 ? 13.223  26.228  57.160 1.00 69.97  ? 104 GLN A NE2 1 
ATOM   817  N  N   . ASN A  1 105 ? 12.308  20.980  58.134 1.00 47.85  ? 105 ASN A N   1 
ATOM   818  C  CA  . ASN A  1 105 ? 11.315  19.916  58.270 1.00 50.84  ? 105 ASN A CA  1 
ATOM   819  C  C   . ASN A  1 105 ? 11.864  18.771  59.108 1.00 53.82  ? 105 ASN A C   1 
ATOM   820  O  O   . ASN A  1 105 ? 12.574  17.904  58.601 1.00 51.00  ? 105 ASN A O   1 
ATOM   821  C  CB  . ASN A  1 105 ? 10.873  19.379  56.902 1.00 39.98  ? 105 ASN A CB  1 
ATOM   822  C  CG  . ASN A  1 105 ? 9.981   18.148  57.025 1.00 42.10  ? 105 ASN A CG  1 
ATOM   823  O  OD1 . ASN A  1 105 ? 9.248   18.005  58.000 1.00 57.73  ? 105 ASN A OD1 1 
ATOM   824  N  ND2 . ASN A  1 105 ? 10.033  17.264  56.034 1.00 44.87  ? 105 ASN A ND2 1 
ATOM   825  N  N   . PRO A  1 106 ? 11.537  18.756  60.409 1.00 59.85  ? 106 PRO A N   1 
ATOM   826  C  CA  . PRO A  1 106 ? 11.978  17.731  61.359 1.00 54.74  ? 106 PRO A CA  1 
ATOM   827  C  C   . PRO A  1 106 ? 11.731  16.288  60.914 1.00 54.47  ? 106 PRO A C   1 
ATOM   828  O  O   . PRO A  1 106 ? 12.498  15.396  61.263 1.00 52.29  ? 106 PRO A O   1 
ATOM   829  C  CB  . PRO A  1 106 ? 11.198  18.083  62.622 1.00 60.77  ? 106 PRO A CB  1 
ATOM   830  C  CG  . PRO A  1 106 ? 11.115  19.570  62.547 1.00 53.85  ? 106 PRO A CG  1 
ATOM   831  C  CD  . PRO A  1 106 ? 10.755  19.800  61.097 1.00 60.99  ? 106 PRO A CD  1 
ATOM   832  N  N   . ARG A  1 107 ? 10.669  16.067  60.142 1.00 51.83  ? 107 ARG A N   1 
ATOM   833  C  CA  . ARG A  1 107 ? 10.316  14.728  59.672 1.00 46.50  ? 107 ARG A CA  1 
ATOM   834  C  C   . ARG A  1 107 ? 11.068  14.276  58.425 1.00 47.88  ? 107 ARG A C   1 
ATOM   835  O  O   . ARG A  1 107 ? 10.838  13.178  57.919 1.00 48.86  ? 107 ARG A O   1 
ATOM   836  C  CB  . ARG A  1 107 ? 8.811   14.655  59.389 1.00 55.63  ? 107 ARG A CB  1 
ATOM   837  C  CG  . ARG A  1 107 ? 7.929   14.830  60.618 1.00 62.57  ? 107 ARG A CG  1 
ATOM   838  C  CD  . ARG A  1 107 ? 6.453   14.897  60.244 1.00 69.74  ? 107 ARG A CD  1 
ATOM   839  N  NE  . ARG A  1 107 ? 6.009   13.720  59.497 1.00 93.16  ? 107 ARG A NE  1 
ATOM   840  C  CZ  . ARG A  1 107 ? 5.654   13.729  58.213 1.00 92.73  ? 107 ARG A CZ  1 
ATOM   841  N  NH1 . ARG A  1 107 ? 5.686   14.857  57.512 1.00 87.18  ? 107 ARG A NH1 1 
ATOM   842  N  NH2 . ARG A  1 107 ? 5.262   12.605  57.627 1.00 90.20  ? 107 ARG A NH2 1 
ATOM   843  N  N   . LEU A  1 108 ? 11.967  15.111  57.926 1.00 43.48  ? 108 LEU A N   1 
ATOM   844  C  CA  . LEU A  1 108 ? 12.711  14.769  56.723 1.00 38.36  ? 108 LEU A CA  1 
ATOM   845  C  C   . LEU A  1 108 ? 13.528  13.486  56.875 1.00 49.01  ? 108 LEU A C   1 
ATOM   846  O  O   . LEU A  1 108 ? 14.280  13.330  57.832 1.00 44.09  ? 108 LEU A O   1 
ATOM   847  C  CB  . LEU A  1 108 ? 13.623  15.932  56.345 1.00 38.37  ? 108 LEU A CB  1 
ATOM   848  C  CG  . LEU A  1 108 ? 14.424  15.862  55.048 1.00 40.11  ? 108 LEU A CG  1 
ATOM   849  C  CD1 . LEU A  1 108 ? 14.729  17.274  54.584 1.00 38.91  ? 108 LEU A CD1 1 
ATOM   850  C  CD2 . LEU A  1 108 ? 15.697  15.073  55.257 1.00 35.93  ? 108 LEU A CD2 1 
ATOM   851  N  N   . VAL A  1 109 ? 13.368  12.564  55.930 1.00 39.44  ? 109 VAL A N   1 
ATOM   852  C  CA  . VAL A  1 109 ? 14.117  11.313  55.952 1.00 36.61  ? 109 VAL A CA  1 
ATOM   853  C  C   . VAL A  1 109 ? 15.279  11.405  54.978 1.00 44.07  ? 109 VAL A C   1 
ATOM   854  O  O   . VAL A  1 109 ? 15.082  11.631  53.786 1.00 43.55  ? 109 VAL A O   1 
ATOM   855  C  CB  . VAL A  1 109 ? 13.245  10.111  55.543 1.00 43.54  ? 109 VAL A CB  1 
ATOM   856  C  CG1 . VAL A  1 109 ? 14.118  8.865   55.397 1.00 33.64  ? 109 VAL A CG1 1 
ATOM   857  C  CG2 . VAL A  1 109 ? 12.153  9.884   56.579 1.00 32.11  ? 109 VAL A CG2 1 
ATOM   858  N  N   . TYR A  1 110 ? 16.490  11.222  55.491 1.00 36.61  ? 110 TYR A N   1 
ATOM   859  C  CA  . TYR A  1 110 ? 17.688  11.291  54.670 1.00 35.87  ? 110 TYR A CA  1 
ATOM   860  C  C   . TYR A  1 110 ? 18.197  9.902   54.313 1.00 46.63  ? 110 TYR A C   1 
ATOM   861  O  O   . TYR A  1 110 ? 18.691  9.173   55.174 1.00 45.51  ? 110 TYR A O   1 
ATOM   862  C  CB  . TYR A  1 110 ? 18.774  12.088  55.410 1.00 33.57  ? 110 TYR A CB  1 
ATOM   863  C  CG  . TYR A  1 110 ? 20.139  12.112  54.742 1.00 41.52  ? 110 TYR A CG  1 
ATOM   864  C  CD1 . TYR A  1 110 ? 20.277  11.931  53.367 1.00 38.25  ? 110 TYR A CD1 1 
ATOM   865  C  CD2 . TYR A  1 110 ? 21.298  12.334  55.492 1.00 36.22  ? 110 TYR A CD2 1 
ATOM   866  C  CE1 . TYR A  1 110 ? 21.534  11.966  52.755 1.00 30.49  ? 110 TYR A CE1 1 
ATOM   867  C  CE2 . TYR A  1 110 ? 22.559  12.374  54.887 1.00 36.89  ? 110 TYR A CE2 1 
ATOM   868  C  CZ  . TYR A  1 110 ? 22.666  12.189  53.519 1.00 37.73  ? 110 TYR A CZ  1 
ATOM   869  O  OH  . TYR A  1 110 ? 23.902  12.224  52.904 1.00 38.80  ? 110 TYR A OH  1 
ATOM   870  N  N   . VAL A  1 111 ? 18.059  9.538   53.039 1.00 43.45  ? 111 VAL A N   1 
ATOM   871  C  CA  . VAL A  1 111 ? 18.525  8.247   52.551 1.00 34.98  ? 111 VAL A CA  1 
ATOM   872  C  C   . VAL A  1 111 ? 19.937  8.447   52.040 1.00 39.50  ? 111 VAL A C   1 
ATOM   873  O  O   . VAL A  1 111 ? 20.172  9.203   51.100 1.00 42.38  ? 111 VAL A O   1 
ATOM   874  C  CB  . VAL A  1 111 ? 17.647  7.715   51.407 1.00 37.09  ? 111 VAL A CB  1 
ATOM   875  C  CG1 . VAL A  1 111 ? 18.255  6.442   50.842 1.00 34.08  ? 111 VAL A CG1 1 
ATOM   876  C  CG2 . VAL A  1 111 ? 16.239  7.450   51.922 1.00 26.10  ? 111 VAL A CG2 1 
ATOM   877  N  N   . CYS A  1 112 ? 20.881  7.757   52.663 1.00 42.04  ? 112 CYS A N   1 
ATOM   878  C  CA  . CYS A  1 112 ? 22.273  7.904   52.289 1.00 32.65  ? 112 CYS A CA  1 
ATOM   879  C  C   . CYS A  1 112 ? 22.932  6.601   51.887 1.00 39.84  ? 112 CYS A C   1 
ATOM   880  O  O   . CYS A  1 112 ? 22.878  5.610   52.618 1.00 41.91  ? 112 CYS A O   1 
ATOM   881  C  CB  . CYS A  1 112 ? 23.046  8.531   53.464 1.00 42.08  ? 112 CYS A CB  1 
ATOM   882  S  SG  . CYS A  1 112 ? 24.855  8.442   53.345 1.00 44.28  ? 112 CYS A SG  1 
ATOM   883  N  N   . ASP A  1 113 ? 23.549  6.608   50.714 1.00 38.07  ? 113 ASP A N   1 
ATOM   884  C  CA  . ASP A  1 113 ? 24.280  5.447   50.237 1.00 46.78  ? 113 ASP A CA  1 
ATOM   885  C  C   . ASP A  1 113 ? 25.735  5.885   50.411 1.00 43.42  ? 113 ASP A C   1 
ATOM   886  O  O   . ASP A  1 113 ? 26.241  6.697   49.636 1.00 36.86  ? 113 ASP A O   1 
ATOM   887  C  CB  . ASP A  1 113 ? 23.956  5.166   48.765 1.00 44.61  ? 113 ASP A CB  1 
ATOM   888  C  CG  . ASP A  1 113 ? 24.655  3.921   48.242 1.00 56.85  ? 113 ASP A CG  1 
ATOM   889  O  OD1 . ASP A  1 113 ? 25.008  3.046   49.061 1.00 51.54  ? 113 ASP A OD1 1 
ATOM   890  O  OD2 . ASP A  1 113 ? 24.840  3.808   47.016 1.00 44.39  ? 113 ASP A OD2 1 
ATOM   891  N  N   . PRO A  1 114 ? 26.410  5.377   51.460 1.00 44.99  ? 114 PRO A N   1 
ATOM   892  C  CA  . PRO A  1 114 ? 27.808  5.674   51.816 1.00 45.38  ? 114 PRO A CA  1 
ATOM   893  C  C   . PRO A  1 114 ? 28.843  5.056   50.891 1.00 53.60  ? 114 PRO A C   1 
ATOM   894  O  O   . PRO A  1 114 ? 29.629  4.207   51.316 1.00 60.30  ? 114 PRO A O   1 
ATOM   895  C  CB  . PRO A  1 114 ? 27.941  5.115   53.238 1.00 44.03  ? 114 PRO A CB  1 
ATOM   896  C  CG  . PRO A  1 114 ? 26.522  4.909   53.704 1.00 61.33  ? 114 PRO A CG  1 
ATOM   897  C  CD  . PRO A  1 114 ? 25.813  4.477   52.456 1.00 52.63  ? 114 PRO A CD  1 
ATOM   898  N  N   . VAL A  1 115 ? 28.865  5.488   49.637 1.00 43.32  ? 115 VAL A N   1 
ATOM   899  C  CA  . VAL A  1 115 ? 29.815  4.938   48.684 1.00 49.42  ? 115 VAL A CA  1 
ATOM   900  C  C   . VAL A  1 115 ? 31.246  5.241   49.123 1.00 50.54  ? 115 VAL A C   1 
ATOM   901  O  O   . VAL A  1 115 ? 31.644  6.404   49.213 1.00 43.16  ? 115 VAL A O   1 
ATOM   902  C  CB  . VAL A  1 115 ? 29.582  5.511   47.270 1.00 47.35  ? 115 VAL A CB  1 
ATOM   903  C  CG1 . VAL A  1 115 ? 30.461  4.775   46.266 1.00 37.29  ? 115 VAL A CG1 1 
ATOM   904  C  CG2 . VAL A  1 115 ? 28.105  5.385   46.891 1.00 37.59  ? 115 VAL A CG2 1 
ATOM   905  N  N   . LEU A  1 116 ? 32.007  4.186   49.405 1.00 49.54  ? 116 LEU A N   1 
ATOM   906  C  CA  . LEU A  1 116 ? 33.399  4.316   49.835 1.00 46.43  ? 116 LEU A CA  1 
ATOM   907  C  C   . LEU A  1 116 ? 34.276  3.354   49.046 1.00 39.30  ? 116 LEU A C   1 
ATOM   908  O  O   . LEU A  1 116 ? 35.367  3.709   48.600 1.00 46.40  ? 116 LEU A O   1 
ATOM   909  C  CB  . LEU A  1 116 ? 33.523  4.018   51.333 1.00 44.37  ? 116 LEU A CB  1 
ATOM   910  C  CG  . LEU A  1 116 ? 32.819  4.994   52.280 1.00 45.69  ? 116 LEU A CG  1 
ATOM   911  C  CD1 . LEU A  1 116 ? 32.581  4.341   53.630 1.00 43.56  ? 116 LEU A CD1 1 
ATOM   912  C  CD2 . LEU A  1 116 ? 33.658  6.251   52.421 1.00 51.63  ? 116 LEU A CD2 1 
ATOM   913  N  N   . GLY A  1 117 ? 33.789  2.134   48.863 1.00 46.68  ? 117 GLY A N   1 
ATOM   914  C  CA  . GLY A  1 117 ? 34.553  1.150   48.123 1.00 47.91  ? 117 GLY A CA  1 
ATOM   915  C  C   . GLY A  1 117 ? 33.878  -0.203  48.125 1.00 60.52  ? 117 GLY A C   1 
ATOM   916  O  O   . GLY A  1 117 ? 32.681  -0.303  48.394 1.00 59.74  ? 117 GLY A O   1 
ATOM   917  N  N   . ASP A  1 118 ? 34.642  -1.248  47.828 1.00 57.02  ? 118 ASP A N   1 
ATOM   918  C  CA  . ASP A  1 118 ? 34.092  -2.595  47.803 1.00 62.66  ? 118 ASP A CA  1 
ATOM   919  C  C   . ASP A  1 118 ? 35.218  -3.622  47.842 1.00 62.64  ? 118 ASP A C   1 
ATOM   920  O  O   . ASP A  1 118 ? 36.385  -3.285  47.631 1.00 59.41  ? 118 ASP A O   1 
ATOM   921  C  CB  . ASP A  1 118 ? 33.233  -2.773  46.544 1.00 57.85  ? 118 ASP A CB  1 
ATOM   922  C  CG  . ASP A  1 118 ? 32.360  -4.017  46.596 1.00 65.76  ? 118 ASP A CG  1 
ATOM   923  O  OD1 . ASP A  1 118 ? 32.031  -4.479  47.710 1.00 74.92  ? 118 ASP A OD1 1 
ATOM   924  O  OD2 . ASP A  1 118 ? 31.983  -4.522  45.517 1.00 69.72  ? 118 ASP A OD2 1 
ATOM   925  N  N   . LYS A  1 119 ? 34.868  -4.870  48.133 1.00 61.01  ? 119 LYS A N   1 
ATOM   926  C  CA  . LYS A  1 119 ? 35.854  -5.942  48.190 1.00 74.22  ? 119 LYS A CA  1 
ATOM   927  C  C   . LYS A  1 119 ? 35.574  -6.997  47.131 1.00 79.80  ? 119 LYS A C   1 
ATOM   928  O  O   . LYS A  1 119 ? 34.576  -7.712  47.200 1.00 86.81  ? 119 LYS A O   1 
ATOM   929  C  CB  . LYS A  1 119 ? 35.866  -6.595  49.576 1.00 67.80  ? 119 LYS A CB  1 
ATOM   930  C  CG  . LYS A  1 119 ? 36.448  -5.711  50.668 1.00 76.52  ? 119 LYS A CG  1 
ATOM   931  C  CD  . LYS A  1 119 ? 36.658  -6.472  51.972 1.00 75.85  ? 119 LYS A CD  1 
ATOM   932  C  CE  . LYS A  1 119 ? 35.342  -6.944  52.569 1.00 74.58  ? 119 LYS A CE  1 
ATOM   933  N  NZ  . LYS A  1 119 ? 35.543  -7.624  53.878 1.00 68.95  ? 119 LYS A NZ  1 
ATOM   934  N  N   . TRP A  1 120 ? 36.461  -7.086  46.148 1.00 90.48  ? 120 TRP A N   1 
ATOM   935  C  CA  . TRP A  1 120 ? 36.314  -8.058  45.074 1.00 96.44  ? 120 TRP A CA  1 
ATOM   936  C  C   . TRP A  1 120 ? 36.619  -9.460  45.578 1.00 98.53  ? 120 TRP A C   1 
ATOM   937  O  O   . TRP A  1 120 ? 35.792  -10.066 46.260 1.00 100.00 ? 120 TRP A O   1 
ATOM   938  C  CB  . TRP A  1 120 ? 37.228  -7.677  43.908 1.00 97.66  ? 120 TRP A CB  1 
ATOM   939  C  CG  . TRP A  1 120 ? 36.774  -6.415  43.250 1.00 100.00 ? 120 TRP A CG  1 
ATOM   940  C  CD1 . TRP A  1 120 ? 37.528  -5.313  42.966 1.00 100.00 ? 120 TRP A CD1 1 
ATOM   941  C  CD2 . TRP A  1 120 ? 35.440  -6.109  42.825 1.00 100.00 ? 120 TRP A CD2 1 
ATOM   942  N  NE1 . TRP A  1 120 ? 36.744  -4.337  42.395 1.00 100.00 ? 120 TRP A NE1 1 
ATOM   943  C  CE2 . TRP A  1 120 ? 35.459  -4.801  42.297 1.00 100.00 ? 120 TRP A CE2 1 
ATOM   944  C  CE3 . TRP A  1 120 ? 34.229  -6.817  42.843 1.00 97.68  ? 120 TRP A CE3 1 
ATOM   945  C  CZ2 . TRP A  1 120 ? 34.311  -4.181  41.788 1.00 100.00 ? 120 TRP A CZ2 1 
ATOM   946  C  CZ3 . TRP A  1 120 ? 33.088  -6.203  42.338 1.00 100.00 ? 120 TRP A CZ3 1 
ATOM   947  C  CH2 . TRP A  1 120 ? 33.139  -4.896  41.818 1.00 100.00 ? 120 TRP A CH2 1 
ATOM   948  N  N   . ASP A  1 121 ? 37.797  -9.981  45.250 1.00 98.41  ? 121 ASP A N   1 
ATOM   949  C  CA  . ASP A  1 121 ? 38.168  -11.314 45.709 1.00 100.00 ? 121 ASP A CA  1 
ATOM   950  C  C   . ASP A  1 121 ? 38.048  -11.381 47.230 1.00 99.56  ? 121 ASP A C   1 
ATOM   951  O  O   . ASP A  1 121 ? 37.150  -12.030 47.764 1.00 100.00 ? 121 ASP A O   1 
ATOM   952  C  CB  . ASP A  1 121 ? 39.599  -11.648 45.278 1.00 100.00 ? 121 ASP A CB  1 
ATOM   953  C  CG  . ASP A  1 121 ? 39.707  -11.933 43.792 1.00 100.00 ? 121 ASP A CG  1 
ATOM   954  O  OD1 . ASP A  1 121 ? 39.081  -12.910 43.327 1.00 97.93  ? 121 ASP A OD1 1 
ATOM   955  O  OD2 . ASP A  1 121 ? 40.415  -11.181 43.089 1.00 100.00 ? 121 ASP A OD2 1 
ATOM   956  N  N   . GLY A  1 122 ? 38.954  -10.699 47.920 1.00 97.23  ? 122 GLY A N   1 
ATOM   957  C  CA  . GLY A  1 122 ? 38.925  -10.689 49.370 1.00 95.09  ? 122 GLY A CA  1 
ATOM   958  C  C   . GLY A  1 122 ? 39.397  -9.350  49.893 1.00 97.38  ? 122 GLY A C   1 
ATOM   959  O  O   . GLY A  1 122 ? 38.853  -8.817  50.862 1.00 95.93  ? 122 GLY A O   1 
ATOM   960  N  N   . GLU A  1 123 ? 40.419  -8.806  49.241 1.00 95.18  ? 123 GLU A N   1 
ATOM   961  C  CA  . GLU A  1 123 ? 40.981  -7.518  49.618 1.00 98.97  ? 123 GLU A CA  1 
ATOM   962  C  C   . GLU A  1 123 ? 39.985  -6.396  49.341 1.00 99.64  ? 123 GLU A C   1 
ATOM   963  O  O   . GLU A  1 123 ? 39.107  -6.525  48.485 1.00 98.63  ? 123 GLU A O   1 
ATOM   964  C  CB  . GLU A  1 123 ? 42.277  -7.268  48.839 1.00 99.87  ? 123 GLU A CB  1 
ATOM   965  C  CG  . GLU A  1 123 ? 42.842  -5.865  48.997 1.00 100.00 ? 123 GLU A CG  1 
ATOM   966  C  CD  . GLU A  1 123 ? 44.104  -5.648  48.187 1.00 100.00 ? 123 GLU A CD  1 
ATOM   967  O  OE1 . GLU A  1 123 ? 44.104  -6.001  46.988 1.00 100.00 ? 123 GLU A OE1 1 
ATOM   968  O  OE2 . GLU A  1 123 ? 45.089  -5.117  48.744 1.00 94.81  ? 123 GLU A OE2 1 
ATOM   969  N  N   . GLY A  1 124 ? 40.126  -5.296  50.072 1.00 99.48  ? 124 GLY A N   1 
ATOM   970  C  CA  . GLY A  1 124 ? 39.236  -4.170  49.886 1.00 95.14  ? 124 GLY A CA  1 
ATOM   971  C  C   . GLY A  1 124 ? 39.861  -3.061  49.070 1.00 93.53  ? 124 GLY A C   1 
ATOM   972  O  O   . GLY A  1 124 ? 41.012  -2.675  49.281 1.00 94.40  ? 124 GLY A O   1 
ATOM   973  N  N   . SER A  1 125 ? 39.096  -2.559  48.112 1.00 89.83  ? 125 SER A N   1 
ATOM   974  C  CA  . SER A  1 125 ? 39.557  -1.469  47.271 1.00 85.95  ? 125 SER A CA  1 
ATOM   975  C  C   . SER A  1 125 ? 38.673  -0.264  47.544 1.00 77.69  ? 125 SER A C   1 
ATOM   976  O  O   . SER A  1 125 ? 37.454  -0.394  47.712 1.00 77.78  ? 125 SER A O   1 
ATOM   977  C  CB  . SER A  1 125 ? 39.482  -1.859  45.796 1.00 86.96  ? 125 SER A CB  1 
ATOM   978  O  OG  . SER A  1 125 ? 38.203  -2.359  45.459 1.00 99.34  ? 125 SER A OG  1 
ATOM   979  N  N   . MET A  1 126 ? 39.306  0.903   47.597 1.00 70.22  ? 126 MET A N   1 
ATOM   980  C  CA  . MET A  1 126 ? 38.621  2.161   47.872 1.00 68.68  ? 126 MET A CA  1 
ATOM   981  C  C   . MET A  1 126 ? 38.234  2.903   46.581 1.00 66.68  ? 126 MET A C   1 
ATOM   982  O  O   . MET A  1 126 ? 39.014  2.928   45.617 1.00 68.66  ? 126 MET A O   1 
ATOM   983  C  CB  . MET A  1 126 ? 39.524  3.054   48.725 1.00 65.51  ? 126 MET A CB  1 
ATOM   984  C  CG  . MET A  1 126 ? 38.760  3.946   49.671 1.00 76.98  ? 126 MET A CG  1 
ATOM   985  S  SD  . MET A  1 126 ? 38.432  3.212   51.261 1.00 74.12  ? 126 MET A SD  1 
ATOM   986  C  CE  . MET A  1 126 ? 38.251  4.690   52.258 1.00 61.20  ? 126 MET A CE  1 
ATOM   987  N  N   . TYR A  1 127 ? 37.046  3.510   46.558 1.00 67.10  ? 127 TYR A N   1 
ATOM   988  C  CA  . TYR A  1 127 ? 36.602  4.253   45.378 1.00 71.24  ? 127 TYR A CA  1 
ATOM   989  C  C   . TYR A  1 127 ? 36.733  5.762   45.572 1.00 66.25  ? 127 TYR A C   1 
ATOM   990  O  O   . TYR A  1 127 ? 36.629  6.530   44.616 1.00 70.97  ? 127 TYR A O   1 
ATOM   991  C  CB  . TYR A  1 127 ? 35.134  3.957   45.045 1.00 71.33  ? 127 TYR A CB  1 
ATOM   992  C  CG  . TYR A  1 127 ? 34.804  2.520   44.726 1.00 71.47  ? 127 TYR A CG  1 
ATOM   993  C  CD1 . TYR A  1 127 ? 35.682  1.721   43.996 1.00 70.75  ? 127 TYR A CD1 1 
ATOM   994  C  CD2 . TYR A  1 127 ? 33.583  1.971   45.119 1.00 68.66  ? 127 TYR A CD2 1 
ATOM   995  C  CE1 . TYR A  1 127 ? 35.351  0.408   43.663 1.00 74.34  ? 127 TYR A CE1 1 
ATOM   996  C  CE2 . TYR A  1 127 ? 33.242  0.663   44.792 1.00 72.57  ? 127 TYR A CE2 1 
ATOM   997  C  CZ  . TYR A  1 127 ? 34.130  -0.113  44.062 1.00 70.22  ? 127 TYR A CZ  1 
ATOM   998  O  OH  . TYR A  1 127 ? 33.785  -1.401  43.720 1.00 73.30  ? 127 TYR A OH  1 
ATOM   999  N  N   . VAL A  1 128 ? 36.937  6.193   46.812 1.00 58.90  ? 128 VAL A N   1 
ATOM   1000 C  CA  . VAL A  1 128 ? 37.057  7.616   47.100 1.00 64.26  ? 128 VAL A CA  1 
ATOM   1001 C  C   . VAL A  1 128 ? 38.247  7.901   48.011 1.00 66.51  ? 128 VAL A C   1 
ATOM   1002 O  O   . VAL A  1 128 ? 38.744  7.007   48.697 1.00 70.02  ? 128 VAL A O   1 
ATOM   1003 C  CB  . VAL A  1 128 ? 35.779  8.140   47.793 1.00 70.40  ? 128 VAL A CB  1 
ATOM   1004 C  CG1 . VAL A  1 128 ? 34.545  7.639   47.053 1.00 70.78  ? 128 VAL A CG1 1 
ATOM   1005 C  CG2 . VAL A  1 128 ? 35.752  7.687   49.249 1.00 61.60  ? 128 VAL A CG2 1 
ATOM   1006 N  N   . PRO A  1 129 ? 38.729  9.153   48.013 1.00 65.74  ? 129 PRO A N   1 
ATOM   1007 C  CA  . PRO A  1 129 ? 39.863  9.530   48.859 1.00 62.28  ? 129 PRO A CA  1 
ATOM   1008 C  C   . PRO A  1 129 ? 39.517  9.171   50.299 1.00 67.73  ? 129 PRO A C   1 
ATOM   1009 O  O   . PRO A  1 129 ? 38.383  9.377   50.738 1.00 64.08  ? 129 PRO A O   1 
ATOM   1010 C  CB  . PRO A  1 129 ? 39.960  11.034  48.644 1.00 59.74  ? 129 PRO A CB  1 
ATOM   1011 C  CG  . PRO A  1 129 ? 39.518  11.188  47.222 1.00 67.43  ? 129 PRO A CG  1 
ATOM   1012 C  CD  . PRO A  1 129 ? 38.319  10.278  47.152 1.00 64.20  ? 129 PRO A CD  1 
ATOM   1013 N  N   . GLU A  1 130 ? 40.484  8.632   51.031 1.00 69.32  ? 130 GLU A N   1 
ATOM   1014 C  CA  . GLU A  1 130 ? 40.236  8.234   52.408 1.00 69.75  ? 130 GLU A CA  1 
ATOM   1015 C  C   . GLU A  1 130 ? 39.974  9.394   53.359 1.00 69.87  ? 130 GLU A C   1 
ATOM   1016 O  O   . GLU A  1 130 ? 39.660  9.176   54.529 1.00 76.26  ? 130 GLU A O   1 
ATOM   1017 C  CB  . GLU A  1 130 ? 41.393  7.377   52.928 1.00 80.47  ? 130 GLU A CB  1 
ATOM   1018 C  CG  . GLU A  1 130 ? 41.489  6.015   52.249 1.00 86.73  ? 130 GLU A CG  1 
ATOM   1019 C  CD  . GLU A  1 130 ? 42.433  5.067   52.962 1.00 89.81  ? 130 GLU A CD  1 
ATOM   1020 O  OE1 . GLU A  1 130 ? 43.636  5.388   53.060 1.00 89.66  ? 130 GLU A OE1 1 
ATOM   1021 O  OE2 . GLU A  1 130 ? 41.970  4.002   53.427 1.00 93.77  ? 130 GLU A OE2 1 
ATOM   1022 N  N   . ASP A  1 131 ? 40.088  10.623  52.865 1.00 61.30  ? 131 ASP A N   1 
ATOM   1023 C  CA  . ASP A  1 131 ? 39.839  11.782  53.713 1.00 64.96  ? 131 ASP A CA  1 
ATOM   1024 C  C   . ASP A  1 131 ? 38.331  12.017  53.882 1.00 64.92  ? 131 ASP A C   1 
ATOM   1025 O  O   . ASP A  1 131 ? 37.909  12.934  54.589 1.00 65.56  ? 131 ASP A O   1 
ATOM   1026 C  CB  . ASP A  1 131 ? 40.523  13.029  53.132 1.00 63.27  ? 131 ASP A CB  1 
ATOM   1027 C  CG  . ASP A  1 131 ? 39.820  13.572  51.905 1.00 70.52  ? 131 ASP A CG  1 
ATOM   1028 O  OD1 . ASP A  1 131 ? 39.535  12.788  50.978 1.00 81.13  ? 131 ASP A OD1 1 
ATOM   1029 O  OD2 . ASP A  1 131 ? 39.561  14.793  51.867 1.00 76.64  ? 131 ASP A OD2 1 
ATOM   1030 N  N   . LEU A  1 132 ? 37.525  11.173  53.238 1.00 64.22  ? 132 LEU A N   1 
ATOM   1031 C  CA  . LEU A  1 132 ? 36.066  11.272  53.316 1.00 50.12  ? 132 LEU A CA  1 
ATOM   1032 C  C   . LEU A  1 132 ? 35.493  10.404  54.425 1.00 42.50  ? 132 LEU A C   1 
ATOM   1033 O  O   . LEU A  1 132 ? 34.454  10.729  55.006 1.00 48.81  ? 132 LEU A O   1 
ATOM   1034 C  CB  . LEU A  1 132 ? 35.424  10.857  51.988 1.00 61.30  ? 132 LEU A CB  1 
ATOM   1035 C  CG  . LEU A  1 132 ? 35.156  11.920  50.920 1.00 57.08  ? 132 LEU A CG  1 
ATOM   1036 C  CD1 . LEU A  1 132 ? 36.449  12.589  50.492 1.00 72.03  ? 132 LEU A CD1 1 
ATOM   1037 C  CD2 . LEU A  1 132 ? 34.480  11.254  49.731 1.00 61.74  ? 132 LEU A CD2 1 
ATOM   1038 N  N   . LEU A  1 133 ? 36.167  9.294   54.709 1.00 44.33  ? 133 LEU A N   1 
ATOM   1039 C  CA  . LEU A  1 133 ? 35.722  8.376   55.749 1.00 48.11  ? 133 LEU A CA  1 
ATOM   1040 C  C   . LEU A  1 133 ? 35.380  9.092   57.054 1.00 50.74  ? 133 LEU A C   1 
ATOM   1041 O  O   . LEU A  1 133 ? 34.320  8.853   57.642 1.00 46.82  ? 133 LEU A O   1 
ATOM   1042 C  CB  . LEU A  1 133 ? 36.786  7.304   56.007 1.00 49.52  ? 133 LEU A CB  1 
ATOM   1043 C  CG  . LEU A  1 133 ? 36.418  6.291   57.095 1.00 52.28  ? 133 LEU A CG  1 
ATOM   1044 C  CD1 . LEU A  1 133 ? 35.030  5.728   56.811 1.00 54.37  ? 133 LEU A CD1 1 
ATOM   1045 C  CD2 . LEU A  1 133 ? 37.453  5.176   57.147 1.00 51.28  ? 133 LEU A CD2 1 
ATOM   1046 N  N   . PRO A  1 134 ? 36.276  9.973   57.533 1.00 52.77  ? 134 PRO A N   1 
ATOM   1047 C  CA  . PRO A  1 134 ? 36.010  10.700  58.782 1.00 45.70  ? 134 PRO A CA  1 
ATOM   1048 C  C   . PRO A  1 134 ? 34.724  11.530  58.686 1.00 46.02  ? 134 PRO A C   1 
ATOM   1049 O  O   . PRO A  1 134 ? 33.946  11.621  59.644 1.00 49.85  ? 134 PRO A O   1 
ATOM   1050 C  CB  . PRO A  1 134 ? 37.251  11.578  58.940 1.00 50.66  ? 134 PRO A CB  1 
ATOM   1051 C  CG  . PRO A  1 134 ? 38.323  10.770  58.288 1.00 51.42  ? 134 PRO A CG  1 
ATOM   1052 C  CD  . PRO A  1 134 ? 37.639  10.253  57.044 1.00 53.25  ? 134 PRO A CD  1 
ATOM   1053 N  N   . VAL A  1 135 ? 34.509  12.141  57.525 1.00 49.77  ? 135 VAL A N   1 
ATOM   1054 C  CA  . VAL A  1 135 ? 33.316  12.953  57.299 1.00 49.49  ? 135 VAL A CA  1 
ATOM   1055 C  C   . VAL A  1 135 ? 32.060  12.082  57.358 1.00 43.39  ? 135 VAL A C   1 
ATOM   1056 O  O   . VAL A  1 135 ? 31.067  12.451  57.989 1.00 44.60  ? 135 VAL A O   1 
ATOM   1057 C  CB  . VAL A  1 135 ? 33.375  13.654  55.933 1.00 54.69  ? 135 VAL A CB  1 
ATOM   1058 C  CG1 . VAL A  1 135 ? 32.154  14.545  55.753 1.00 45.34  ? 135 VAL A CG1 1 
ATOM   1059 C  CG2 . VAL A  1 135 ? 34.660  14.468  55.827 1.00 54.20  ? 135 VAL A CG2 1 
ATOM   1060 N  N   . TYR A  1 136 ? 32.105  10.922  56.708 1.00 37.49  ? 136 TYR A N   1 
ATOM   1061 C  CA  . TYR A  1 136 ? 30.957  10.026  56.727 1.00 47.45  ? 136 TYR A CA  1 
ATOM   1062 C  C   . TYR A  1 136 ? 30.651  9.575   58.153 1.00 46.82  ? 136 TYR A C   1 
ATOM   1063 O  O   . TYR A  1 136 ? 29.508  9.654   58.603 1.00 47.67  ? 136 TYR A O   1 
ATOM   1064 C  CB  . TYR A  1 136 ? 31.201  8.812   55.818 1.00 49.26  ? 136 TYR A CB  1 
ATOM   1065 C  CG  . TYR A  1 136 ? 30.718  8.998   54.386 1.00 42.59  ? 136 TYR A CG  1 
ATOM   1066 C  CD1 . TYR A  1 136 ? 29.354  8.997   54.077 1.00 43.34  ? 136 TYR A CD1 1 
ATOM   1067 C  CD2 . TYR A  1 136 ? 31.625  9.173   53.341 1.00 40.00  ? 136 TYR A CD2 1 
ATOM   1068 C  CE1 . TYR A  1 136 ? 28.909  9.165   52.756 1.00 35.52  ? 136 TYR A CE1 1 
ATOM   1069 C  CE2 . TYR A  1 136 ? 31.193  9.339   52.025 1.00 51.73  ? 136 TYR A CE2 1 
ATOM   1070 C  CZ  . TYR A  1 136 ? 29.836  9.332   51.741 1.00 45.75  ? 136 TYR A CZ  1 
ATOM   1071 O  OH  . TYR A  1 136 ? 29.417  9.490   50.441 1.00 52.79  ? 136 TYR A OH  1 
ATOM   1072 N  N   . LYS A  1 137 ? 31.677  9.121   58.867 1.00 54.26  ? 137 LYS A N   1 
ATOM   1073 C  CA  . LYS A  1 137 ? 31.516  8.652   60.245 1.00 50.70  ? 137 LYS A CA  1 
ATOM   1074 C  C   . LYS A  1 137 ? 31.006  9.727   61.199 1.00 44.16  ? 137 LYS A C   1 
ATOM   1075 O  O   . LYS A  1 137 ? 30.030  9.534   61.925 1.00 49.05  ? 137 LYS A O   1 
ATOM   1076 C  CB  . LYS A  1 137 ? 32.852  8.152   60.805 1.00 52.30  ? 137 LYS A CB  1 
ATOM   1077 C  CG  . LYS A  1 137 ? 33.452  6.924   60.150 1.00 48.75  ? 137 LYS A CG  1 
ATOM   1078 C  CD  . LYS A  1 137 ? 34.753  6.577   60.864 1.00 56.67  ? 137 LYS A CD  1 
ATOM   1079 C  CE  . LYS A  1 137 ? 35.435  5.357   60.279 1.00 64.68  ? 137 LYS A CE  1 
ATOM   1080 N  NZ  . LYS A  1 137 ? 36.805  5.178   60.851 1.00 58.19  ? 137 LYS A NZ  1 
ATOM   1081 N  N   . GLU A  1 138 ? 31.679  10.868  61.181 1.00 51.03  ? 138 GLU A N   1 
ATOM   1082 C  CA  . GLU A  1 138 ? 31.365  11.963  62.086 1.00 55.99  ? 138 GLU A CA  1 
ATOM   1083 C  C   . GLU A  1 138 ? 30.221  12.915  61.764 1.00 52.12  ? 138 GLU A C   1 
ATOM   1084 O  O   . GLU A  1 138 ? 29.602  13.457  62.677 1.00 54.52  ? 138 GLU A O   1 
ATOM   1085 C  CB  . GLU A  1 138 ? 32.646  12.769  62.319 1.00 53.60  ? 138 GLU A CB  1 
ATOM   1086 C  CG  . GLU A  1 138 ? 33.755  11.932  62.947 1.00 60.25  ? 138 GLU A CG  1 
ATOM   1087 C  CD  . GLU A  1 138 ? 35.127  12.559  62.801 1.00 75.73  ? 138 GLU A CD  1 
ATOM   1088 O  OE1 . GLU A  1 138 ? 35.298  13.722  63.224 1.00 76.00  ? 138 GLU A OE1 1 
ATOM   1089 O  OE2 . GLU A  1 138 ? 36.034  11.881  62.265 1.00 65.66  ? 138 GLU A OE2 1 
ATOM   1090 N  N   . LYS A  1 139 ? 29.920  13.121  60.489 1.00 57.22  ? 139 LYS A N   1 
ATOM   1091 C  CA  . LYS A  1 139 ? 28.867  14.069  60.140 1.00 57.21  ? 139 LYS A CA  1 
ATOM   1092 C  C   . LYS A  1 139 ? 27.744  13.534  59.257 1.00 55.66  ? 139 LYS A C   1 
ATOM   1093 O  O   . LYS A  1 139 ? 26.576  13.860  59.471 1.00 62.79  ? 139 LYS A O   1 
ATOM   1094 C  CB  . LYS A  1 139 ? 29.518  15.298  59.501 1.00 63.02  ? 139 LYS A CB  1 
ATOM   1095 C  CG  . LYS A  1 139 ? 30.514  15.981  60.443 1.00 68.81  ? 139 LYS A CG  1 
ATOM   1096 C  CD  . LYS A  1 139 ? 31.589  16.765  59.707 1.00 71.81  ? 139 LYS A CD  1 
ATOM   1097 C  CE  . LYS A  1 139 ? 31.025  17.972  58.980 1.00 78.74  ? 139 LYS A CE  1 
ATOM   1098 N  NZ  . LYS A  1 139 ? 32.103  18.737  58.293 1.00 69.92  ? 139 LYS A NZ  1 
ATOM   1099 N  N   . VAL A  1 140 ? 28.085  12.711  58.272 1.00 50.18  ? 140 VAL A N   1 
ATOM   1100 C  CA  . VAL A  1 140 ? 27.074  12.160  57.378 1.00 43.97  ? 140 VAL A CA  1 
ATOM   1101 C  C   . VAL A  1 140 ? 26.179  11.137  58.068 1.00 45.27  ? 140 VAL A C   1 
ATOM   1102 O  O   . VAL A  1 140 ? 25.000  11.404  58.313 1.00 42.32  ? 140 VAL A O   1 
ATOM   1103 C  CB  . VAL A  1 140 ? 27.712  11.494  56.146 1.00 50.96  ? 140 VAL A CB  1 
ATOM   1104 C  CG1 . VAL A  1 140 ? 26.615  10.975  55.214 1.00 44.51  ? 140 VAL A CG1 1 
ATOM   1105 C  CG2 . VAL A  1 140 ? 28.606  12.491  55.420 1.00 42.53  ? 140 VAL A CG2 1 
ATOM   1106 N  N   . VAL A  1 141 ? 26.737  9.970   58.384 1.00 38.99  ? 141 VAL A N   1 
ATOM   1107 C  CA  . VAL A  1 141 ? 25.972  8.906   59.036 1.00 38.73  ? 141 VAL A CA  1 
ATOM   1108 C  C   . VAL A  1 141 ? 25.118  9.371   60.215 1.00 44.09  ? 141 VAL A C   1 
ATOM   1109 O  O   . VAL A  1 141 ? 23.953  8.983   60.327 1.00 46.24  ? 141 VAL A O   1 
ATOM   1110 C  CB  . VAL A  1 141 ? 26.901  7.761   59.494 1.00 45.12  ? 141 VAL A CB  1 
ATOM   1111 C  CG1 . VAL A  1 141 ? 26.113  6.709   60.263 1.00 46.44  ? 141 VAL A CG1 1 
ATOM   1112 C  CG2 . VAL A  1 141 ? 27.559  7.136   58.284 1.00 41.37  ? 141 VAL A CG2 1 
ATOM   1113 N  N   . PRO A  1 142 ? 25.678  10.204  61.114 1.00 42.95  ? 142 PRO A N   1 
ATOM   1114 C  CA  . PRO A  1 142 ? 24.894  10.677  62.259 1.00 43.39  ? 142 PRO A CA  1 
ATOM   1115 C  C   . PRO A  1 142 ? 23.614  11.398  61.818 1.00 49.46  ? 142 PRO A C   1 
ATOM   1116 O  O   . PRO A  1 142 ? 22.622  11.432  62.552 1.00 47.74  ? 142 PRO A O   1 
ATOM   1117 C  CB  . PRO A  1 142 ? 25.866  11.612  62.979 1.00 44.83  ? 142 PRO A CB  1 
ATOM   1118 C  CG  . PRO A  1 142 ? 27.195  11.008  62.680 1.00 50.51  ? 142 PRO A CG  1 
ATOM   1119 C  CD  . PRO A  1 142 ? 27.073  10.671  61.209 1.00 49.18  ? 142 PRO A CD  1 
ATOM   1120 N  N   . LEU A  1 143 ? 23.647  11.972  60.616 1.00 41.61  ? 143 LEU A N   1 
ATOM   1121 C  CA  . LEU A  1 143 ? 22.498  12.694  60.060 1.00 49.90  ? 143 LEU A CA  1 
ATOM   1122 C  C   . LEU A  1 143 ? 21.535  11.802  59.280 1.00 46.98  ? 143 LEU A C   1 
ATOM   1123 O  O   . LEU A  1 143 ? 20.348  12.108  59.173 1.00 51.94  ? 143 LEU A O   1 
ATOM   1124 C  CB  . LEU A  1 143 ? 22.969  13.807  59.120 1.00 44.68  ? 143 LEU A CB  1 
ATOM   1125 C  CG  . LEU A  1 143 ? 22.998  15.251  59.612 1.00 52.11  ? 143 LEU A CG  1 
ATOM   1126 C  CD1 . LEU A  1 143 ? 23.371  16.151  58.442 1.00 40.77  ? 143 LEU A CD1 1 
ATOM   1127 C  CD2 . LEU A  1 143 ? 21.635  15.646  60.168 1.00 43.67  ? 143 LEU A CD2 1 
ATOM   1128 N  N   . ALA A  1 144 ? 22.056  10.711  58.726 1.00 41.52  ? 144 ALA A N   1 
ATOM   1129 C  CA  . ALA A  1 144 ? 21.260  9.785   57.926 1.00 38.77  ? 144 ALA A CA  1 
ATOM   1130 C  C   . ALA A  1 144 ? 20.202  9.008   58.701 1.00 45.62  ? 144 ALA A C   1 
ATOM   1131 O  O   . ALA A  1 144 ? 20.366  8.717   59.885 1.00 48.96  ? 144 ALA A O   1 
ATOM   1132 C  CB  . ALA A  1 144 ? 22.182  8.815   57.201 1.00 42.47  ? 144 ALA A CB  1 
ATOM   1133 N  N   . ASP A  1 145 ? 19.114  8.670   58.015 1.00 41.14  ? 145 ASP A N   1 
ATOM   1134 C  CA  . ASP A  1 145 ? 18.030  7.909   58.620 1.00 38.05  ? 145 ASP A CA  1 
ATOM   1135 C  C   . ASP A  1 145 ? 17.980  6.514   58.017 1.00 36.39  ? 145 ASP A C   1 
ATOM   1136 O  O   . ASP A  1 145 ? 17.473  5.577   58.631 1.00 38.16  ? 145 ASP A O   1 
ATOM   1137 C  CB  . ASP A  1 145 ? 16.693  8.599   58.388 1.00 35.14  ? 145 ASP A CB  1 
ATOM   1138 C  CG  . ASP A  1 145 ? 16.655  9.999   58.958 1.00 48.80  ? 145 ASP A CG  1 
ATOM   1139 O  OD1 . ASP A  1 145 ? 17.033  10.949  58.238 1.00 51.30  ? 145 ASP A OD1 1 
ATOM   1140 O  OD2 . ASP A  1 145 ? 16.254  10.145  60.132 1.00 52.79  ? 145 ASP A OD2 1 
ATOM   1141 N  N   . ILE A  1 146 ? 18.498  6.397   56.800 1.00 36.97  ? 146 ILE A N   1 
ATOM   1142 C  CA  . ILE A  1 146 ? 18.536  5.133   56.083 1.00 32.44  ? 146 ILE A CA  1 
ATOM   1143 C  C   . ILE A  1 146 ? 19.874  5.086   55.367 1.00 32.08  ? 146 ILE A C   1 
ATOM   1144 O  O   . ILE A  1 146 ? 20.240  6.030   54.677 1.00 38.78  ? 146 ILE A O   1 
ATOM   1145 C  CB  . ILE A  1 146 ? 17.403  5.036   55.024 1.00 44.02  ? 146 ILE A CB  1 
ATOM   1146 C  CG1 . ILE A  1 146 ? 16.032  5.143   55.705 1.00 36.52  ? 146 ILE A CG1 1 
ATOM   1147 C  CG2 . ILE A  1 146 ? 17.512  3.717   54.251 1.00 36.89  ? 146 ILE A CG2 1 
ATOM   1148 C  CD1 . ILE A  1 146 ? 14.856  4.960   54.751 1.00 33.81  ? 146 ILE A CD1 1 
ATOM   1149 N  N   . ILE A  1 147 ? 20.621  4.005   55.553 1.00 33.65  ? 147 ILE A N   1 
ATOM   1150 C  CA  . ILE A  1 147 ? 21.910  3.878   54.888 1.00 32.44  ? 147 ILE A CA  1 
ATOM   1151 C  C   . ILE A  1 147 ? 21.966  2.519   54.228 1.00 33.25  ? 147 ILE A C   1 
ATOM   1152 O  O   . ILE A  1 147 ? 21.360  1.563   54.714 1.00 37.74  ? 147 ILE A O   1 
ATOM   1153 C  CB  . ILE A  1 147 ? 23.097  4.031   55.873 1.00 35.83  ? 147 ILE A CB  1 
ATOM   1154 C  CG1 . ILE A  1 147 ? 23.060  2.937   56.934 1.00 39.63  ? 147 ILE A CG1 1 
ATOM   1155 C  CG2 . ILE A  1 147 ? 23.047  5.386   56.530 1.00 35.84  ? 147 ILE A CG2 1 
ATOM   1156 C  CD1 . ILE A  1 147 ? 24.323  2.886   57.773 1.00 53.74  ? 147 ILE A CD1 1 
ATOM   1157 N  N   . THR A  1 148 ? 22.695  2.437   53.121 1.00 39.13  ? 148 THR A N   1 
ATOM   1158 C  CA  . THR A  1 148 ? 22.790  1.198   52.359 1.00 39.74  ? 148 THR A CA  1 
ATOM   1159 C  C   . THR A  1 148 ? 24.231  0.830   52.034 1.00 39.51  ? 148 THR A C   1 
ATOM   1160 O  O   . THR A  1 148 ? 24.614  0.775   50.872 1.00 30.54  ? 148 THR A O   1 
ATOM   1161 C  CB  . THR A  1 148 ? 22.032  1.327   51.016 1.00 36.64  ? 148 THR A CB  1 
ATOM   1162 O  OG1 . THR A  1 148 ? 22.696  2.297   50.193 1.00 30.46  ? 148 THR A OG1 1 
ATOM   1163 C  CG2 . THR A  1 148 ? 20.600  1.787   51.245 1.00 29.29  ? 148 THR A CG2 1 
ATOM   1164 N  N   . PRO A  1 149 ? 25.053  0.566   53.055 1.00 44.70  ? 149 PRO A N   1 
ATOM   1165 C  CA  . PRO A  1 149 ? 26.436  0.213   52.738 1.00 33.39  ? 149 PRO A CA  1 
ATOM   1166 C  C   . PRO A  1 149 ? 26.560  -1.259  52.340 1.00 34.25  ? 149 PRO A C   1 
ATOM   1167 O  O   . PRO A  1 149 ? 25.732  -2.083  52.723 1.00 40.93  ? 149 PRO A O   1 
ATOM   1168 C  CB  . PRO A  1 149 ? 27.153  0.485   54.050 1.00 41.11  ? 149 PRO A CB  1 
ATOM   1169 C  CG  . PRO A  1 149 ? 26.143  -0.011  55.049 1.00 42.41  ? 149 PRO A CG  1 
ATOM   1170 C  CD  . PRO A  1 149 ? 24.835  0.583   54.513 1.00 44.46  ? 149 PRO A CD  1 
ATOM   1171 N  N   . ASN A  1 150 ? 27.581  -1.585  51.556 1.00 33.79  ? 150 ASN A N   1 
ATOM   1172 C  CA  . ASN A  1 150 ? 27.812  -2.981  51.226 1.00 35.72  ? 150 ASN A CA  1 
ATOM   1173 C  C   . ASN A  1 150 ? 28.584  -3.486  52.464 1.00 45.47  ? 150 ASN A C   1 
ATOM   1174 O  O   . ASN A  1 150 ? 28.741  -2.746  53.438 1.00 42.57  ? 150 ASN A O   1 
ATOM   1175 C  CB  . ASN A  1 150 ? 28.669  -3.109  49.963 1.00 38.51  ? 150 ASN A CB  1 
ATOM   1176 C  CG  . ASN A  1 150 ? 29.953  -2.313  50.045 1.00 55.24  ? 150 ASN A CG  1 
ATOM   1177 O  OD1 . ASN A  1 150 ? 30.532  -2.149  51.122 1.00 48.54  ? 150 ASN A OD1 1 
ATOM   1178 N  ND2 . ASN A  1 150 ? 30.418  -1.828  48.902 1.00 47.90  ? 150 ASN A ND2 1 
ATOM   1179 N  N   . GLN A  1 151 ? 29.070  -4.719  52.445 1.00 46.89  ? 151 GLN A N   1 
ATOM   1180 C  CA  . GLN A  1 151 ? 29.801  -5.234  53.604 1.00 47.65  ? 151 GLN A CA  1 
ATOM   1181 C  C   . GLN A  1 151 ? 31.051  -4.405  53.916 1.00 47.76  ? 151 GLN A C   1 
ATOM   1182 O  O   . GLN A  1 151 ? 31.258  -3.977  55.052 1.00 47.03  ? 151 GLN A O   1 
ATOM   1183 C  CB  . GLN A  1 151 ? 30.187  -6.699  53.379 1.00 45.17  ? 151 GLN A CB  1 
ATOM   1184 C  CG  . GLN A  1 151 ? 31.061  -7.296  54.475 1.00 60.43  ? 151 GLN A CG  1 
ATOM   1185 C  CD  . GLN A  1 151 ? 31.162  -8.806  54.377 1.00 61.30  ? 151 GLN A CD  1 
ATOM   1186 O  OE1 . GLN A  1 151 ? 31.353  -9.356  53.295 1.00 64.78  ? 151 GLN A OE1 1 
ATOM   1187 N  NE2 . GLN A  1 151 ? 31.040  -9.482  55.510 1.00 67.89  ? 151 GLN A NE2 1 
ATOM   1188 N  N   . PHE A  1 152 ? 31.880  -4.183  52.903 1.00 49.22  ? 152 PHE A N   1 
ATOM   1189 C  CA  . PHE A  1 152 ? 33.101  -3.403  53.061 1.00 42.54  ? 152 PHE A CA  1 
ATOM   1190 C  C   . PHE A  1 152 ? 32.854  -2.049  53.735 1.00 51.65  ? 152 PHE A C   1 
ATOM   1191 O  O   . PHE A  1 152 ? 33.502  -1.711  54.724 1.00 60.37  ? 152 PHE A O   1 
ATOM   1192 C  CB  . PHE A  1 152 ? 33.750  -3.189  51.693 1.00 49.06  ? 152 PHE A CB  1 
ATOM   1193 C  CG  . PHE A  1 152 ? 35.021  -2.389  51.739 1.00 58.59  ? 152 PHE A CG  1 
ATOM   1194 C  CD1 . PHE A  1 152 ? 36.095  -2.807  52.518 1.00 62.17  ? 152 PHE A CD1 1 
ATOM   1195 C  CD2 . PHE A  1 152 ? 35.147  -1.220  50.996 1.00 67.93  ? 152 PHE A CD2 1 
ATOM   1196 C  CE1 . PHE A  1 152 ? 37.276  -2.074  52.555 1.00 64.30  ? 152 PHE A CE1 1 
ATOM   1197 C  CE2 . PHE A  1 152 ? 36.325  -0.478  51.024 1.00 71.58  ? 152 PHE A CE2 1 
ATOM   1198 C  CZ  . PHE A  1 152 ? 37.392  -0.907  51.806 1.00 67.61  ? 152 PHE A CZ  1 
ATOM   1199 N  N   . GLU A  1 153 ? 31.915  -1.280  53.200 1.00 50.08  ? 153 GLU A N   1 
ATOM   1200 C  CA  . GLU A  1 153 ? 31.593  0.035   53.746 1.00 45.04  ? 153 GLU A CA  1 
ATOM   1201 C  C   . GLU A  1 153 ? 31.087  -0.033  55.184 1.00 43.32  ? 153 GLU A C   1 
ATOM   1202 O  O   . GLU A  1 153 ? 31.371  0.852   55.988 1.00 39.52  ? 153 GLU A O   1 
ATOM   1203 C  CB  . GLU A  1 153 ? 30.561  0.723   52.843 1.00 36.50  ? 153 GLU A CB  1 
ATOM   1204 C  CG  . GLU A  1 153 ? 31.023  0.757   51.393 1.00 47.00  ? 153 GLU A CG  1 
ATOM   1205 C  CD  . GLU A  1 153 ? 29.925  1.102   50.405 1.00 38.37  ? 153 GLU A CD  1 
ATOM   1206 O  OE1 . GLU A  1 153 ? 28.759  0.700   50.619 1.00 43.03  ? 153 GLU A OE1 1 
ATOM   1207 O  OE2 . GLU A  1 153 ? 30.248  1.758   49.401 1.00 39.84  ? 153 GLU A OE2 1 
ATOM   1208 N  N   . ALA A  1 154 ? 30.333  -1.076  55.513 1.00 37.20  ? 154 ALA A N   1 
ATOM   1209 C  CA  . ALA A  1 154 ? 29.826  -1.218  56.871 1.00 47.37  ? 154 ALA A CA  1 
ATOM   1210 C  C   . ALA A  1 154 ? 31.006  -1.420  57.827 1.00 47.98  ? 154 ALA A C   1 
ATOM   1211 O  O   . ALA A  1 154 ? 31.025  -0.878  58.931 1.00 38.87  ? 154 ALA A O   1 
ATOM   1212 C  CB  . ALA A  1 154 ? 28.873  -2.401  56.957 1.00 34.24  ? 154 ALA A CB  1 
ATOM   1213 N  N   . GLU A  1 155 ? 31.993  -2.195  57.387 1.00 46.82  ? 155 GLU A N   1 
ATOM   1214 C  CA  . GLU A  1 155 ? 33.171  -2.468  58.203 1.00 46.39  ? 155 GLU A CA  1 
ATOM   1215 C  C   . GLU A  1 155 ? 33.936  -1.175  58.464 1.00 57.62  ? 155 GLU A C   1 
ATOM   1216 O  O   . GLU A  1 155 ? 34.328  -0.898  59.597 1.00 58.92  ? 155 GLU A O   1 
ATOM   1217 C  CB  . GLU A  1 155 ? 34.080  -3.485  57.500 1.00 41.70  ? 155 GLU A CB  1 
ATOM   1218 C  CG  . GLU A  1 155 ? 33.399  -4.816  57.199 1.00 45.26  ? 155 GLU A CG  1 
ATOM   1219 C  CD  . GLU A  1 155 ? 34.313  -5.817  56.515 1.00 43.63  ? 155 GLU A CD  1 
ATOM   1220 O  OE1 . GLU A  1 155 ? 35.029  -5.431  55.566 1.00 53.07  ? 155 GLU A OE1 1 
ATOM   1221 O  OE2 . GLU A  1 155 ? 34.304  -6.998  56.918 1.00 54.76  ? 155 GLU A OE2 1 
ATOM   1222 N  N   . LEU A  1 156 ? 34.134  -0.385  57.412 1.00 49.17  ? 156 LEU A N   1 
ATOM   1223 C  CA  . LEU A  1 156 ? 34.850  0.882   57.519 1.00 53.17  ? 156 LEU A CA  1 
ATOM   1224 C  C   . LEU A  1 156 ? 34.144  1.890   58.417 1.00 54.13  ? 156 LEU A C   1 
ATOM   1225 O  O   . LEU A  1 156 ? 34.782  2.589   59.201 1.00 60.23  ? 156 LEU A O   1 
ATOM   1226 C  CB  . LEU A  1 156 ? 35.048  1.499   56.133 1.00 48.04  ? 156 LEU A CB  1 
ATOM   1227 C  CG  . LEU A  1 156 ? 36.055  0.806   55.214 1.00 58.39  ? 156 LEU A CG  1 
ATOM   1228 C  CD1 . LEU A  1 156 ? 36.107  1.532   53.872 1.00 59.36  ? 156 LEU A CD1 1 
ATOM   1229 C  CD2 . LEU A  1 156 ? 37.431  0.806   55.873 1.00 47.49  ? 156 LEU A CD2 1 
ATOM   1230 N  N   . LEU A  1 157 ? 32.825  1.961   58.301 1.00 54.03  ? 157 LEU A N   1 
ATOM   1231 C  CA  . LEU A  1 157 ? 32.042  2.897   59.093 1.00 53.05  ? 157 LEU A CA  1 
ATOM   1232 C  C   . LEU A  1 157 ? 32.017  2.541   60.576 1.00 57.27  ? 157 LEU A C   1 
ATOM   1233 O  O   . LEU A  1 157 ? 32.041  3.427   61.433 1.00 54.65  ? 157 LEU A O   1 
ATOM   1234 C  CB  . LEU A  1 157 ? 30.609  2.967   58.554 1.00 46.98  ? 157 LEU A CB  1 
ATOM   1235 C  CG  . LEU A  1 157 ? 30.456  3.587   57.161 1.00 46.37  ? 157 LEU A CG  1 
ATOM   1236 C  CD1 . LEU A  1 157 ? 29.003  3.505   56.707 1.00 43.38  ? 157 LEU A CD1 1 
ATOM   1237 C  CD2 . LEU A  1 157 ? 30.919  5.030   57.202 1.00 37.27  ? 157 LEU A CD2 1 
ATOM   1238 N  N   . SER A  1 158 ? 31.966  1.247   60.874 1.00 52.37  ? 158 SER A N   1 
ATOM   1239 C  CA  . SER A  1 158 ? 31.925  0.782   62.256 1.00 53.90  ? 158 SER A CA  1 
ATOM   1240 C  C   . SER A  1 158 ? 33.324  0.534   62.807 1.00 56.80  ? 158 SER A C   1 
ATOM   1241 O  O   . SER A  1 158 ? 33.532  0.538   64.018 1.00 55.67  ? 158 SER A O   1 
ATOM   1242 C  CB  . SER A  1 158 ? 31.123  -0.515  62.348 1.00 50.24  ? 158 SER A CB  1 
ATOM   1243 O  OG  . SER A  1 158 ? 31.812  -1.568  61.697 1.00 47.05  ? 158 SER A OG  1 
ATOM   1244 N  N   . GLY A  1 159 ? 34.276  0.310   61.908 1.00 63.67  ? 159 GLY A N   1 
ATOM   1245 C  CA  . GLY A  1 159 ? 35.640  0.043   62.320 1.00 62.58  ? 159 GLY A CA  1 
ATOM   1246 C  C   . GLY A  1 159 ? 35.793  -1.378  62.837 1.00 65.78  ? 159 GLY A C   1 
ATOM   1247 O  O   . GLY A  1 159 ? 36.777  -1.701  63.502 1.00 64.68  ? 159 GLY A O   1 
ATOM   1248 N  N   . ARG A  1 160 ? 34.815  -2.226  62.532 1.00 59.78  ? 160 ARG A N   1 
ATOM   1249 C  CA  . ARG A  1 160 ? 34.831  -3.617  62.971 1.00 60.62  ? 160 ARG A CA  1 
ATOM   1250 C  C   . ARG A  1 160 ? 34.652  -4.556  61.780 1.00 61.58  ? 160 ARG A C   1 
ATOM   1251 O  O   . ARG A  1 160 ? 33.837  -4.297  60.896 1.00 75.08  ? 160 ARG A O   1 
ATOM   1252 C  CB  . ARG A  1 160 ? 33.716  -3.853  63.997 1.00 53.36  ? 160 ARG A CB  1 
ATOM   1253 C  CG  . ARG A  1 160 ? 33.758  -5.224  64.651 1.00 77.16  ? 160 ARG A CG  1 
ATOM   1254 C  CD  . ARG A  1 160 ? 32.624  -5.426  65.652 1.00 75.55  ? 160 ARG A CD  1 
ATOM   1255 N  NE  . ARG A  1 160 ? 32.688  -4.497  66.779 1.00 76.99  ? 160 ARG A NE  1 
ATOM   1256 C  CZ  . ARG A  1 160 ? 31.875  -4.545  67.832 1.00 79.68  ? 160 ARG A CZ  1 
ATOM   1257 N  NH1 . ARG A  1 160 ? 30.934  -5.478  67.907 1.00 72.49  ? 160 ARG A NH1 1 
ATOM   1258 N  NH2 . ARG A  1 160 ? 32.000  -3.659  68.812 1.00 75.05  ? 160 ARG A NH2 1 
ATOM   1259 N  N   . LYS A  1 161 ? 35.418  -5.642  61.750 1.00 62.02  ? 161 LYS A N   1 
ATOM   1260 C  CA  . LYS A  1 161 ? 35.320  -6.596  60.655 1.00 54.00  ? 161 LYS A CA  1 
ATOM   1261 C  C   . LYS A  1 161 ? 34.140  -7.534  60.829 1.00 54.77  ? 161 LYS A C   1 
ATOM   1262 O  O   . LYS A  1 161 ? 33.657  -7.756  61.941 1.00 53.76  ? 161 LYS A O   1 
ATOM   1263 C  CB  . LYS A  1 161 ? 36.604  -7.416  60.527 1.00 64.46  ? 161 LYS A CB  1 
ATOM   1264 C  CG  . LYS A  1 161 ? 37.800  -6.618  60.041 1.00 78.26  ? 161 LYS A CG  1 
ATOM   1265 C  CD  . LYS A  1 161 ? 38.939  -7.533  59.620 1.00 86.62  ? 161 LYS A CD  1 
ATOM   1266 C  CE  . LYS A  1 161 ? 38.523  -8.431  58.461 1.00 94.46  ? 161 LYS A CE  1 
ATOM   1267 N  NZ  . LYS A  1 161 ? 39.652  -9.269  57.967 1.00 97.71  ? 161 LYS A NZ  1 
ATOM   1268 N  N   . ILE A  1 162 ? 33.681  -8.083  59.711 1.00 51.97  ? 162 ILE A N   1 
ATOM   1269 C  CA  . ILE A  1 162 ? 32.549  -8.995  59.701 1.00 47.98  ? 162 ILE A CA  1 
ATOM   1270 C  C   . ILE A  1 162 ? 32.980  -10.311 59.068 1.00 48.19  ? 162 ILE A C   1 
ATOM   1271 O  O   . ILE A  1 162 ? 33.568  -10.326 57.988 1.00 45.83  ? 162 ILE A O   1 
ATOM   1272 C  CB  . ILE A  1 162 ? 31.374  -8.390  58.895 1.00 52.93  ? 162 ILE A CB  1 
ATOM   1273 C  CG1 . ILE A  1 162 ? 30.920  -7.083  59.560 1.00 56.66  ? 162 ILE A CG1 1 
ATOM   1274 C  CG2 . ILE A  1 162 ? 30.226  -9.388  58.801 1.00 48.14  ? 162 ILE A CG2 1 
ATOM   1275 C  CD1 . ILE A  1 162 ? 29.867  -6.307  58.784 1.00 48.94  ? 162 ILE A CD1 1 
ATOM   1276 N  N   . HIS A  1 163 ? 32.696  -11.414 59.752 1.00 52.74  ? 163 HIS A N   1 
ATOM   1277 C  CA  . HIS A  1 163 ? 33.060  -12.736 59.252 1.00 54.83  ? 163 HIS A CA  1 
ATOM   1278 C  C   . HIS A  1 163 ? 31.816  -13.606 59.198 1.00 54.77  ? 163 HIS A C   1 
ATOM   1279 O  O   . HIS A  1 163 ? 31.818  -14.673 58.585 1.00 60.17  ? 163 HIS A O   1 
ATOM   1280 C  CB  . HIS A  1 163 ? 34.085  -13.418 60.174 1.00 59.25  ? 163 HIS A CB  1 
ATOM   1281 C  CG  . HIS A  1 163 ? 35.313  -12.604 60.448 1.00 48.99  ? 163 HIS A CG  1 
ATOM   1282 N  ND1 . HIS A  1 163 ? 35.375  -11.665 61.455 1.00 60.55  ? 163 HIS A ND1 1 
ATOM   1283 C  CD2 . HIS A  1 163 ? 36.531  -12.601 59.856 1.00 53.78  ? 163 HIS A CD2 1 
ATOM   1284 C  CE1 . HIS A  1 163 ? 36.579  -11.121 61.474 1.00 61.83  ? 163 HIS A CE1 1 
ATOM   1285 N  NE2 . HIS A  1 163 ? 37.299  -11.671 60.513 1.00 63.30  ? 163 HIS A NE2 1 
ATOM   1286 N  N   . SER A  1 164 ? 30.754  -13.146 59.845 1.00 50.43  ? 164 SER A N   1 
ATOM   1287 C  CA  . SER A  1 164 ? 29.516  -13.905 59.887 1.00 43.73  ? 164 SER A CA  1 
ATOM   1288 C  C   . SER A  1 164 ? 28.283  -13.016 59.959 1.00 42.46  ? 164 SER A C   1 
ATOM   1289 O  O   . SER A  1 164 ? 28.376  -11.797 60.076 1.00 50.02  ? 164 SER A O   1 
ATOM   1290 C  CB  . SER A  1 164 ? 29.521  -14.824 61.103 1.00 43.49  ? 164 SER A CB  1 
ATOM   1291 O  OG  . SER A  1 164 ? 29.579  -14.059 62.296 1.00 50.49  ? 164 SER A OG  1 
ATOM   1292 N  N   . GLN A  1 165 ? 27.124  -13.658 59.910 1.00 37.20  ? 165 GLN A N   1 
ATOM   1293 C  CA  . GLN A  1 165 ? 25.852  -12.971 59.973 1.00 48.54  ? 165 GLN A CA  1 
ATOM   1294 C  C   . GLN A  1 165 ? 25.659  -12.237 61.293 1.00 55.71  ? 165 GLN A C   1 
ATOM   1295 O  O   . GLN A  1 165 ? 25.269  -11.069 61.302 1.00 51.50  ? 165 GLN A O   1 
ATOM   1296 C  CB  . GLN A  1 165 ? 24.722  -13.977 59.759 1.00 40.06  ? 165 GLN A CB  1 
ATOM   1297 C  CG  . GLN A  1 165 ? 23.318  -13.428 59.956 1.00 54.46  ? 165 GLN A CG  1 
ATOM   1298 C  CD  . GLN A  1 165 ? 22.251  -14.354 59.389 1.00 43.80  ? 165 GLN A CD  1 
ATOM   1299 O  OE1 . GLN A  1 165 ? 21.173  -14.501 59.958 1.00 57.30  ? 165 GLN A OE1 1 
ATOM   1300 N  NE2 . GLN A  1 165 ? 22.551  -14.975 58.255 1.00 45.67  ? 165 GLN A NE2 1 
ATOM   1301 N  N   . GLU A  1 166 ? 25.934  -12.905 62.411 1.00 48.55  ? 166 GLU A N   1 
ATOM   1302 C  CA  . GLU A  1 166 ? 25.742  -12.250 63.695 1.00 42.33  ? 166 GLU A CA  1 
ATOM   1303 C  C   . GLU A  1 166 ? 26.733  -11.103 63.921 1.00 41.87  ? 166 GLU A C   1 
ATOM   1304 O  O   . GLU A  1 166 ? 26.423  -10.143 64.631 1.00 39.96  ? 166 GLU A O   1 
ATOM   1305 C  CB  . GLU A  1 166 ? 25.758  -13.273 64.850 1.00 49.83  ? 166 GLU A CB  1 
ATOM   1306 C  CG  . GLU A  1 166 ? 26.717  -14.432 64.703 1.00 56.27  ? 166 GLU A CG  1 
ATOM   1307 C  CD  . GLU A  1 166 ? 26.239  -15.524 63.751 1.00 46.99  ? 166 GLU A CD  1 
ATOM   1308 O  OE1 . GLU A  1 166 ? 25.279  -16.263 64.075 1.00 39.75  ? 166 GLU A OE1 1 
ATOM   1309 O  OE2 . GLU A  1 166 ? 26.843  -15.643 62.670 1.00 41.96  ? 166 GLU A OE2 1 
ATOM   1310 N  N   . GLU A  1 167 ? 27.912  -11.173 63.309 1.00 37.17  ? 167 GLU A N   1 
ATOM   1311 C  CA  . GLU A  1 167 ? 28.866  -10.069 63.446 1.00 40.19  ? 167 GLU A CA  1 
ATOM   1312 C  C   . GLU A  1 167 ? 28.351  -8.907  62.592 1.00 53.38  ? 167 GLU A C   1 
ATOM   1313 O  O   . GLU A  1 167 ? 28.560  -7.736  62.923 1.00 44.72  ? 167 GLU A O   1 
ATOM   1314 C  CB  . GLU A  1 167 ? 30.264  -10.462 62.963 1.00 46.99  ? 167 GLU A CB  1 
ATOM   1315 C  CG  . GLU A  1 167 ? 30.975  -11.490 63.829 1.00 59.40  ? 167 GLU A CG  1 
ATOM   1316 C  CD  . GLU A  1 167 ? 32.459  -11.581 63.522 1.00 69.00  ? 167 GLU A CD  1 
ATOM   1317 O  OE1 . GLU A  1 167 ? 32.825  -11.537 62.330 1.00 75.47  ? 167 GLU A OE1 1 
ATOM   1318 O  OE2 . GLU A  1 167 ? 33.262  -11.708 64.471 1.00 79.45  ? 167 GLU A OE2 1 
ATOM   1319 N  N   . ALA A  1 168 ? 27.676  -9.243  61.491 1.00 42.79  ? 168 ALA A N   1 
ATOM   1320 C  CA  . ALA A  1 168 ? 27.115  -8.235  60.598 1.00 47.47  ? 168 ALA A CA  1 
ATOM   1321 C  C   . ALA A  1 168 ? 26.010  -7.489  61.333 1.00 38.53  ? 168 ALA A C   1 
ATOM   1322 O  O   . ALA A  1 168 ? 25.912  -6.271  61.250 1.00 40.34  ? 168 ALA A O   1 
ATOM   1323 C  CB  . ALA A  1 168 ? 26.554  -8.892  59.341 1.00 43.19  ? 168 ALA A CB  1 
ATOM   1324 N  N   . LEU A  1 169 ? 25.182  -8.230  62.061 1.00 40.25  ? 169 LEU A N   1 
ATOM   1325 C  CA  . LEU A  1 169 ? 24.090  -7.627  62.809 1.00 41.94  ? 169 LEU A CA  1 
ATOM   1326 C  C   . LEU A  1 169 ? 24.601  -6.749  63.942 1.00 52.24  ? 169 LEU A C   1 
ATOM   1327 O  O   . LEU A  1 169 ? 23.987  -5.732  64.258 1.00 46.39  ? 169 LEU A O   1 
ATOM   1328 C  CB  . LEU A  1 169 ? 23.169  -8.708  63.373 1.00 35.66  ? 169 LEU A CB  1 
ATOM   1329 C  CG  . LEU A  1 169 ? 22.449  -9.556  62.325 1.00 45.72  ? 169 LEU A CG  1 
ATOM   1330 C  CD1 . LEU A  1 169 ? 21.646  -10.646 63.009 1.00 46.58  ? 169 LEU A CD1 1 
ATOM   1331 C  CD2 . LEU A  1 169 ? 21.539  -8.666  61.497 1.00 49.57  ? 169 LEU A CD2 1 
ATOM   1332 N  N   . ARG A  1 170 ? 25.713  -7.138  64.564 1.00 50.72  ? 170 ARG A N   1 
ATOM   1333 C  CA  . ARG A  1 170 ? 26.262  -6.335  65.650 1.00 52.30  ? 170 ARG A CA  1 
ATOM   1334 C  C   . ARG A  1 170 ? 26.808  -5.033  65.075 1.00 47.34  ? 170 ARG A C   1 
ATOM   1335 O  O   . ARG A  1 170 ? 26.707  -3.984  65.705 1.00 47.33  ? 170 ARG A O   1 
ATOM   1336 C  CB  . ARG A  1 170 ? 27.359  -7.097  66.421 1.00 48.20  ? 170 ARG A CB  1 
ATOM   1337 C  CG  . ARG A  1 170 ? 26.817  -8.189  67.356 1.00 52.83  ? 170 ARG A CG  1 
ATOM   1338 C  CD  . ARG A  1 170 ? 27.866  -8.667  68.372 1.00 45.51  ? 170 ARG A CD  1 
ATOM   1339 N  NE  . ARG A  1 170 ? 28.878  -9.539  67.781 1.00 44.13  ? 170 ARG A NE  1 
ATOM   1340 C  CZ  . ARG A  1 170 ? 28.724  -10.846 67.585 1.00 44.89  ? 170 ARG A CZ  1 
ATOM   1341 N  NH1 . ARG A  1 170 ? 27.599  -11.452 67.935 1.00 36.38  ? 170 ARG A NH1 1 
ATOM   1342 N  NH2 . ARG A  1 170 ? 29.695  -11.549 67.025 1.00 43.81  ? 170 ARG A NH2 1 
ATOM   1343 N  N   . VAL A  1 171 ? 27.380  -5.097  63.874 1.00 46.65  ? 171 VAL A N   1 
ATOM   1344 C  CA  . VAL A  1 171 ? 27.896  -3.891  63.236 1.00 46.64  ? 171 VAL A CA  1 
ATOM   1345 C  C   . VAL A  1 171 ? 26.719  -2.982  62.884 1.00 49.18  ? 171 VAL A C   1 
ATOM   1346 O  O   . VAL A  1 171 ? 26.806  -1.763  63.006 1.00 48.93  ? 171 VAL A O   1 
ATOM   1347 C  CB  . VAL A  1 171 ? 28.681  -4.206  61.944 1.00 46.52  ? 171 VAL A CB  1 
ATOM   1348 C  CG1 . VAL A  1 171 ? 28.914  -2.928  61.161 1.00 38.61  ? 171 VAL A CG1 1 
ATOM   1349 C  CG2 . VAL A  1 171 ? 30.024  -4.834  62.287 1.00 48.69  ? 171 VAL A CG2 1 
ATOM   1350 N  N   . MET A  1 172 ? 25.614  -3.582  62.451 1.00 45.47  ? 172 MET A N   1 
ATOM   1351 C  CA  . MET A  1 172 ? 24.434  -2.808  62.104 1.00 46.36  ? 172 MET A CA  1 
ATOM   1352 C  C   . MET A  1 172 ? 23.864  -2.132  63.350 1.00 50.70  ? 172 MET A C   1 
ATOM   1353 O  O   . MET A  1 172 ? 23.339  -1.022  63.266 1.00 52.89  ? 172 MET A O   1 
ATOM   1354 C  CB  . MET A  1 172 ? 23.382  -3.706  61.440 1.00 35.62  ? 172 MET A CB  1 
ATOM   1355 C  CG  . MET A  1 172 ? 23.808  -4.216  60.058 1.00 50.56  ? 172 MET A CG  1 
ATOM   1356 S  SD  . MET A  1 172 ? 22.572  -5.232  59.212 1.00 54.09  ? 172 MET A SD  1 
ATOM   1357 C  CE  . MET A  1 172 ? 23.281  -6.829  59.423 1.00 69.60  ? 172 MET A CE  1 
ATOM   1358 N  N   . ASP A  1 173 ? 23.966  -2.796  64.502 1.00 48.29  ? 173 ASP A N   1 
ATOM   1359 C  CA  . ASP A  1 173 ? 23.476  -2.214  65.750 1.00 49.46  ? 173 ASP A CA  1 
ATOM   1360 C  C   . ASP A  1 173 ? 24.347  -1.010  66.085 1.00 47.67  ? 173 ASP A C   1 
ATOM   1361 O  O   . ASP A  1 173 ? 23.871  -0.008  66.624 1.00 42.60  ? 173 ASP A O   1 
ATOM   1362 C  CB  . ASP A  1 173 ? 23.531  -3.223  66.903 1.00 54.85  ? 173 ASP A CB  1 
ATOM   1363 C  CG  . ASP A  1 173 ? 22.378  -4.213  66.873 1.00 59.02  ? 173 ASP A CG  1 
ATOM   1364 O  OD1 . ASP A  1 173 ? 21.308  -3.873  66.325 1.00 55.64  ? 173 ASP A OD1 1 
ATOM   1365 O  OD2 . ASP A  1 173 ? 22.536  -5.326  67.416 1.00 68.35  ? 173 ASP A OD2 1 
ATOM   1366 N  N   . MET A  1 174 ? 25.630  -1.121  65.756 1.00 31.68  ? 174 MET A N   1 
ATOM   1367 C  CA  . MET A  1 174 ? 26.581  -0.043  65.989 1.00 38.12  ? 174 MET A CA  1 
ATOM   1368 C  C   . MET A  1 174 ? 26.239  1.156   65.102 1.00 49.03  ? 174 MET A C   1 
ATOM   1369 O  O   . MET A  1 174 ? 26.268  2.299   65.558 1.00 53.33  ? 174 MET A O   1 
ATOM   1370 C  CB  . MET A  1 174 ? 28.007  -0.512  65.676 1.00 36.38  ? 174 MET A CB  1 
ATOM   1371 C  CG  . MET A  1 174 ? 28.559  -1.565  66.637 1.00 60.89  ? 174 MET A CG  1 
ATOM   1372 S  SD  . MET A  1 174 ? 30.240  -2.099  66.208 1.00 56.40  ? 174 MET A SD  1 
ATOM   1373 C  CE  . MET A  1 174 ? 31.171  -0.612  66.590 1.00 53.88  ? 174 MET A CE  1 
ATOM   1374 N  N   . LEU A  1 175 ? 25.920  0.892   63.835 1.00 48.44  ? 175 LEU A N   1 
ATOM   1375 C  CA  . LEU A  1 175 ? 25.573  1.955   62.890 1.00 42.94  ? 175 LEU A CA  1 
ATOM   1376 C  C   . LEU A  1 175 ? 24.296  2.643   63.353 1.00 32.31  ? 175 LEU A C   1 
ATOM   1377 O  O   . LEU A  1 175 ? 24.164  3.862   63.240 1.00 45.93  ? 175 LEU A O   1 
ATOM   1378 C  CB  . LEU A  1 175 ? 25.399  1.379   61.477 1.00 38.36  ? 175 LEU A CB  1 
ATOM   1379 C  CG  . LEU A  1 175 ? 26.680  0.763   60.901 1.00 43.23  ? 175 LEU A CG  1 
ATOM   1380 C  CD1 . LEU A  1 175 ? 26.378  0.012   59.619 1.00 45.54  ? 175 LEU A CD1 1 
ATOM   1381 C  CD2 . LEU A  1 175 ? 27.700  1.858   60.663 1.00 34.12  ? 175 LEU A CD2 1 
ATOM   1382 N  N   . HIS A  1 176 ? 23.359  1.857   63.875 1.00 33.37  ? 176 HIS A N   1 
ATOM   1383 C  CA  . HIS A  1 176 ? 22.105  2.400   64.395 1.00 38.57  ? 176 HIS A CA  1 
ATOM   1384 C  C   . HIS A  1 176 ? 22.390  3.394   65.517 1.00 50.75  ? 176 HIS A C   1 
ATOM   1385 O  O   . HIS A  1 176 ? 21.773  4.460   65.584 1.00 54.77  ? 176 HIS A O   1 
ATOM   1386 C  CB  . HIS A  1 176 ? 21.220  1.294   64.976 1.00 32.77  ? 176 HIS A CB  1 
ATOM   1387 C  CG  . HIS A  1 176 ? 20.406  0.553   63.961 1.00 50.98  ? 176 HIS A CG  1 
ATOM   1388 N  ND1 . HIS A  1 176 ? 19.477  1.174   63.154 1.00 48.39  ? 176 HIS A ND1 1 
ATOM   1389 C  CD2 . HIS A  1 176 ? 20.335  -0.768  63.669 1.00 45.20  ? 176 HIS A CD2 1 
ATOM   1390 C  CE1 . HIS A  1 176 ? 18.866  0.266   62.412 1.00 52.01  ? 176 HIS A CE1 1 
ATOM   1391 N  NE2 . HIS A  1 176 ? 19.368  -0.920  62.707 1.00 50.86  ? 176 HIS A NE2 1 
ATOM   1392 N  N   . SER A  1 177 ? 23.313  3.034   66.410 1.00 48.32  ? 177 SER A N   1 
ATOM   1393 C  CA  . SER A  1 177 ? 23.652  3.901   67.533 1.00 50.24  ? 177 SER A CA  1 
ATOM   1394 C  C   . SER A  1 177 ? 24.280  5.182   67.019 1.00 45.22  ? 177 SER A C   1 
ATOM   1395 O  O   . SER A  1 177 ? 24.165  6.231   67.645 1.00 47.72  ? 177 SER A O   1 
ATOM   1396 C  CB  . SER A  1 177 ? 24.606  3.196   68.511 1.00 47.06  ? 177 SER A CB  1 
ATOM   1397 O  OG  . SER A  1 177 ? 25.889  3.008   67.946 1.00 58.64  ? 177 SER A OG  1 
ATOM   1398 N  N   . MET A  1 178 ? 24.949  5.095   65.875 1.00 48.50  ? 178 MET A N   1 
ATOM   1399 C  CA  . MET A  1 178 ? 25.559  6.272   65.279 1.00 45.80  ? 178 MET A CA  1 
ATOM   1400 C  C   . MET A  1 178 ? 24.461  7.199   64.767 1.00 54.50  ? 178 MET A C   1 
ATOM   1401 O  O   . MET A  1 178 ? 24.687  8.399   64.612 1.00 51.80  ? 178 MET A O   1 
ATOM   1402 C  CB  . MET A  1 178 ? 26.483  5.880   64.124 1.00 53.70  ? 178 MET A CB  1 
ATOM   1403 C  CG  . MET A  1 178 ? 27.812  5.308   64.565 1.00 50.16  ? 178 MET A CG  1 
ATOM   1404 S  SD  . MET A  1 178 ? 28.764  4.657   63.198 1.00 57.17  ? 178 MET A SD  1 
ATOM   1405 C  CE  . MET A  1 178 ? 29.454  6.127   62.501 1.00 53.95  ? 178 MET A CE  1 
ATOM   1406 N  N   . GLY A  1 179 ? 23.275  6.648   64.501 1.00 49.50  ? 179 GLY A N   1 
ATOM   1407 C  CA  . GLY A  1 179 ? 22.188  7.486   64.023 1.00 45.26  ? 179 GLY A CA  1 
ATOM   1408 C  C   . GLY A  1 179 ? 21.041  6.900   63.208 1.00 40.76  ? 179 GLY A C   1 
ATOM   1409 O  O   . GLY A  1 179 ? 19.898  6.917   63.667 1.00 44.97  ? 179 GLY A O   1 
ATOM   1410 N  N   . PRO A  1 180 ? 21.295  6.379   61.997 1.00 44.12  ? 180 PRO A N   1 
ATOM   1411 C  CA  . PRO A  1 180 ? 20.210  5.819   61.179 1.00 41.74  ? 180 PRO A CA  1 
ATOM   1412 C  C   . PRO A  1 180 ? 19.367  4.720   61.799 1.00 41.78  ? 180 PRO A C   1 
ATOM   1413 O  O   . PRO A  1 180 ? 19.891  3.781   62.393 1.00 51.40  ? 180 PRO A O   1 
ATOM   1414 C  CB  . PRO A  1 180 ? 20.928  5.361   59.905 1.00 41.41  ? 180 PRO A CB  1 
ATOM   1415 C  CG  . PRO A  1 180 ? 22.319  5.096   60.359 1.00 43.61  ? 180 PRO A CG  1 
ATOM   1416 C  CD  . PRO A  1 180 ? 22.592  6.237   61.313 1.00 45.58  ? 180 PRO A CD  1 
ATOM   1417 N  N   . ASP A  1 181 ? 18.050  4.856   61.660 1.00 42.30  ? 181 ASP A N   1 
ATOM   1418 C  CA  . ASP A  1 181 ? 17.105  3.875   62.177 1.00 39.81  ? 181 ASP A CA  1 
ATOM   1419 C  C   . ASP A  1 181 ? 16.973  2.685   61.223 1.00 43.78  ? 181 ASP A C   1 
ATOM   1420 O  O   . ASP A  1 181 ? 16.479  1.626   61.604 1.00 46.18  ? 181 ASP A O   1 
ATOM   1421 C  CB  . ASP A  1 181 ? 15.720  4.502   62.370 1.00 44.99  ? 181 ASP A CB  1 
ATOM   1422 C  CG  . ASP A  1 181 ? 15.705  5.581   63.436 1.00 53.52  ? 181 ASP A CG  1 
ATOM   1423 O  OD1 . ASP A  1 181 ? 16.337  5.387   64.495 1.00 56.68  ? 181 ASP A OD1 1 
ATOM   1424 O  OD2 . ASP A  1 181 ? 15.047  6.619   63.219 1.00 58.75  ? 181 ASP A OD2 1 
ATOM   1425 N  N   . THR A  1 182 ? 17.394  2.867   59.977 1.00 42.17  ? 182 THR A N   1 
ATOM   1426 C  CA  . THR A  1 182 ? 17.316  1.791   59.000 1.00 39.00  ? 182 THR A CA  1 
ATOM   1427 C  C   . THR A  1 182 ? 18.673  1.534   58.386 1.00 37.80  ? 182 THR A C   1 
ATOM   1428 O  O   . THR A  1 182 ? 19.325  2.447   57.880 1.00 44.01  ? 182 THR A O   1 
ATOM   1429 C  CB  . THR A  1 182 ? 16.312  2.107   57.873 1.00 41.83  ? 182 THR A CB  1 
ATOM   1430 O  OG1 . THR A  1 182 ? 14.987  2.148   58.418 1.00 48.12  ? 182 THR A OG1 1 
ATOM   1431 C  CG2 . THR A  1 182 ? 16.372  1.027   56.786 1.00 37.90  ? 182 THR A CG2 1 
ATOM   1432 N  N   . VAL A  1 183 ? 19.101  0.281   58.447 1.00 37.07  ? 183 VAL A N   1 
ATOM   1433 C  CA  . VAL A  1 183 ? 20.387  -0.107  57.898 1.00 43.26  ? 183 VAL A CA  1 
ATOM   1434 C  C   . VAL A  1 183 ? 20.217  -1.368  57.069 1.00 42.60  ? 183 VAL A C   1 
ATOM   1435 O  O   . VAL A  1 183 ? 19.602  -2.340  57.514 1.00 45.83  ? 183 VAL A O   1 
ATOM   1436 C  CB  . VAL A  1 183 ? 21.416  -0.382  59.012 1.00 39.95  ? 183 VAL A CB  1 
ATOM   1437 C  CG1 . VAL A  1 183 ? 22.784  -0.639  58.403 1.00 40.25  ? 183 VAL A CG1 1 
ATOM   1438 C  CG2 . VAL A  1 183 ? 21.475  0.787   59.956 1.00 40.01  ? 183 VAL A CG2 1 
ATOM   1439 N  N   . VAL A  1 184 ? 20.759  -1.336  55.858 1.00 37.54  ? 184 VAL A N   1 
ATOM   1440 C  CA  . VAL A  1 184 ? 20.680  -2.466  54.955 1.00 31.78  ? 184 VAL A CA  1 
ATOM   1441 C  C   . VAL A  1 184 ? 22.049  -2.739  54.353 1.00 38.87  ? 184 VAL A C   1 
ATOM   1442 O  O   . VAL A  1 184 ? 22.665  -1.859  53.747 1.00 42.59  ? 184 VAL A O   1 
ATOM   1443 C  CB  . VAL A  1 184 ? 19.658  -2.206  53.804 1.00 32.29  ? 184 VAL A CB  1 
ATOM   1444 C  CG1 . VAL A  1 184 ? 19.672  -3.363  52.810 1.00 33.82  ? 184 VAL A CG1 1 
ATOM   1445 C  CG2 . VAL A  1 184 ? 18.260  -2.046  54.379 1.00 34.16  ? 184 VAL A CG2 1 
ATOM   1446 N  N   . ILE A  1 185 ? 22.532  -3.960  54.550 1.00 36.60  ? 185 ILE A N   1 
ATOM   1447 C  CA  . ILE A  1 185 ? 23.809  -4.374  53.992 1.00 41.79  ? 185 ILE A CA  1 
ATOM   1448 C  C   . ILE A  1 185 ? 23.419  -5.009  52.657 1.00 43.46  ? 185 ILE A C   1 
ATOM   1449 O  O   . ILE A  1 185 ? 22.973  -6.154  52.594 1.00 40.43  ? 185 ILE A O   1 
ATOM   1450 C  CB  . ILE A  1 185 ? 24.517  -5.378  54.925 1.00 45.88  ? 185 ILE A CB  1 
ATOM   1451 C  CG1 . ILE A  1 185 ? 24.925  -4.654  56.214 1.00 39.49  ? 185 ILE A CG1 1 
ATOM   1452 C  CG2 . ILE A  1 185 ? 25.740  -5.972  54.243 1.00 36.82  ? 185 ILE A CG2 1 
ATOM   1453 C  CD1 . ILE A  1 185 ? 25.611  -5.543  57.241 1.00 64.68  ? 185 ILE A CD1 1 
ATOM   1454 N  N   . THR A  1 186 ? 23.568  -4.214  51.603 1.00 49.73  ? 186 THR A N   1 
ATOM   1455 C  CA  . THR A  1 186 ? 23.194  -4.581  50.244 1.00 51.64  ? 186 THR A CA  1 
ATOM   1456 C  C   . THR A  1 186 ? 23.964  -5.717  49.593 1.00 52.96  ? 186 THR A C   1 
ATOM   1457 O  O   . THR A  1 186 ? 23.452  -6.378  48.694 1.00 50.70  ? 186 THR A O   1 
ATOM   1458 C  CB  . THR A  1 186 ? 23.284  -3.349  49.327 1.00 51.38  ? 186 THR A CB  1 
ATOM   1459 O  OG1 . THR A  1 186 ? 24.618  -2.830  49.355 1.00 41.71  ? 186 THR A OG1 1 
ATOM   1460 C  CG2 . THR A  1 186 ? 22.326  -2.266  49.800 1.00 49.41  ? 186 THR A CG2 1 
ATOM   1461 N  N   . SER A  1 187 ? 25.191  -5.944  50.036 1.00 50.83  ? 187 SER A N   1 
ATOM   1462 C  CA  . SER A  1 187 ? 26.002  -7.006  49.462 1.00 53.79  ? 187 SER A CA  1 
ATOM   1463 C  C   . SER A  1 187 ? 27.022  -7.452  50.495 1.00 47.98  ? 187 SER A C   1 
ATOM   1464 O  O   . SER A  1 187 ? 27.535  -6.626  51.242 1.00 43.93  ? 187 SER A O   1 
ATOM   1465 C  CB  . SER A  1 187 ? 26.714  -6.490  48.208 1.00 44.89  ? 187 SER A CB  1 
ATOM   1466 O  OG  . SER A  1 187 ? 27.452  -7.518  47.576 1.00 64.91  ? 187 SER A OG  1 
ATOM   1467 N  N   . SER A  1 188 ? 27.313  -8.751  50.534 1.00 51.09  ? 188 SER A N   1 
ATOM   1468 C  CA  . SER A  1 188 ? 28.278  -9.291  51.492 1.00 52.93  ? 188 SER A CA  1 
ATOM   1469 C  C   . SER A  1 188 ? 28.953  -10.564 50.987 1.00 63.13  ? 188 SER A C   1 
ATOM   1470 O  O   . SER A  1 188 ? 28.484  -11.196 50.040 1.00 59.75  ? 188 SER A O   1 
ATOM   1471 C  CB  . SER A  1 188 ? 27.587  -9.612  52.812 1.00 43.91  ? 188 SER A CB  1 
ATOM   1472 O  OG  . SER A  1 188 ? 26.885  -10.838 52.709 1.00 50.24  ? 188 SER A OG  1 
ATOM   1473 N  N   . ASP A  1 189 ? 30.054  -10.934 51.637 1.00 62.07  ? 189 ASP A N   1 
ATOM   1474 C  CA  . ASP A  1 189 ? 30.798  -12.137 51.284 1.00 61.22  ? 189 ASP A CA  1 
ATOM   1475 C  C   . ASP A  1 189 ? 30.321  -13.324 52.113 1.00 59.63  ? 189 ASP A C   1 
ATOM   1476 O  O   . ASP A  1 189 ? 30.961  -14.373 52.124 1.00 57.85  ? 189 ASP A O   1 
ATOM   1477 C  CB  . ASP A  1 189 ? 32.298  -11.942 51.518 1.00 58.63  ? 189 ASP A CB  1 
ATOM   1478 C  CG  . ASP A  1 189 ? 32.929  -10.999 50.518 1.00 66.93  ? 189 ASP A CG  1 
ATOM   1479 O  OD1 . ASP A  1 189 ? 32.723  -11.197 49.303 1.00 80.69  ? 189 ASP A OD1 1 
ATOM   1480 O  OD2 . ASP A  1 189 ? 33.640  -10.066 50.944 1.00 71.93  ? 189 ASP A OD2 1 
ATOM   1481 N  N   . LEU A  1 190 ? 29.200  -13.156 52.808 1.00 49.15  ? 190 LEU A N   1 
ATOM   1482 C  CA  . LEU A  1 190 ? 28.656  -14.229 53.630 1.00 50.47  ? 190 LEU A CA  1 
ATOM   1483 C  C   . LEU A  1 190 ? 28.115  -15.346 52.744 1.00 59.49  ? 190 LEU A C   1 
ATOM   1484 O  O   . LEU A  1 190 ? 27.582  -15.089 51.665 1.00 71.46  ? 190 LEU A O   1 
ATOM   1485 C  CB  . LEU A  1 190 ? 27.537  -13.701 54.531 1.00 41.35  ? 190 LEU A CB  1 
ATOM   1486 C  CG  . LEU A  1 190 ? 27.898  -12.533 55.455 1.00 57.25  ? 190 LEU A CG  1 
ATOM   1487 C  CD1 . LEU A  1 190 ? 26.687  -12.172 56.299 1.00 49.21  ? 190 LEU A CD1 1 
ATOM   1488 C  CD2 . LEU A  1 190 ? 29.072  -12.910 56.350 1.00 56.76  ? 190 LEU A CD2 1 
ATOM   1489 N  N   . PRO A  1 191 ? 28.248  -16.604 53.192 1.00 64.17  ? 191 PRO A N   1 
ATOM   1490 C  CA  . PRO A  1 191 ? 27.777  -17.775 52.449 1.00 58.86  ? 191 PRO A CA  1 
ATOM   1491 C  C   . PRO A  1 191 ? 26.288  -18.053 52.644 1.00 57.25  ? 191 PRO A C   1 
ATOM   1492 O  O   . PRO A  1 191 ? 25.726  -17.768 53.701 1.00 55.09  ? 191 PRO A O   1 
ATOM   1493 C  CB  . PRO A  1 191 ? 28.641  -18.893 53.012 1.00 66.65  ? 191 PRO A CB  1 
ATOM   1494 C  CG  . PRO A  1 191 ? 28.714  -18.513 54.459 1.00 59.36  ? 191 PRO A CG  1 
ATOM   1495 C  CD  . PRO A  1 191 ? 29.007  -17.022 54.387 1.00 64.62  ? 191 PRO A CD  1 
ATOM   1496 N  N   . SER A  1 192 ? 25.664  -18.618 51.614 1.00 54.90  ? 192 SER A N   1 
ATOM   1497 C  CA  . SER A  1 192 ? 24.245  -18.954 51.642 1.00 43.49  ? 192 SER A CA  1 
ATOM   1498 C  C   . SER A  1 192 ? 24.051  -20.428 51.322 1.00 46.90  ? 192 SER A C   1 
ATOM   1499 O  O   . SER A  1 192 ? 24.762  -20.989 50.490 1.00 53.17  ? 192 SER A O   1 
ATOM   1500 C  CB  . SER A  1 192 ? 23.481  -18.123 50.607 1.00 52.65  ? 192 SER A CB  1 
ATOM   1501 O  OG  . SER A  1 192 ? 22.196  -18.677 50.358 1.00 48.12  ? 192 SER A OG  1 
ATOM   1502 N  N   . PRO A  1 193 ? 23.085  -21.079 51.982 1.00 45.27  ? 193 PRO A N   1 
ATOM   1503 C  CA  . PRO A  1 193 ? 22.829  -22.499 51.727 1.00 49.34  ? 193 PRO A CA  1 
ATOM   1504 C  C   . PRO A  1 193 ? 22.259  -22.724 50.324 1.00 60.21  ? 193 PRO A C   1 
ATOM   1505 O  O   . PRO A  1 193 ? 22.184  -23.858 49.847 1.00 56.19  ? 193 PRO A O   1 
ATOM   1506 C  CB  . PRO A  1 193 ? 21.843  -22.875 52.832 1.00 55.47  ? 193 PRO A CB  1 
ATOM   1507 C  CG  . PRO A  1 193 ? 21.110  -21.594 53.082 1.00 54.61  ? 193 PRO A CG  1 
ATOM   1508 C  CD  . PRO A  1 193 ? 22.223  -20.576 53.066 1.00 47.38  ? 193 PRO A CD  1 
ATOM   1509 N  N   . GLN A  1 194 ? 21.860  -21.636 49.669 1.00 56.72  ? 194 GLN A N   1 
ATOM   1510 C  CA  . GLN A  1 194 ? 21.315  -21.717 48.320 1.00 51.21  ? 194 GLN A CA  1 
ATOM   1511 C  C   . GLN A  1 194 ? 22.401  -22.131 47.340 1.00 47.38  ? 194 GLN A C   1 
ATOM   1512 O  O   . GLN A  1 194 ? 22.113  -22.601 46.242 1.00 49.32  ? 194 GLN A O   1 
ATOM   1513 C  CB  . GLN A  1 194 ? 20.746  -20.367 47.885 1.00 57.42  ? 194 GLN A CB  1 
ATOM   1514 C  CG  . GLN A  1 194 ? 19.554  -19.912 48.683 1.00 66.76  ? 194 GLN A CG  1 
ATOM   1515 C  CD  . GLN A  1 194 ? 18.549  -21.017 48.860 1.00 66.62  ? 194 GLN A CD  1 
ATOM   1516 O  OE1 . GLN A  1 194 ? 18.693  -21.863 49.741 1.00 81.14  ? 194 GLN A OE1 1 
ATOM   1517 N  NE2 . GLN A  1 194 ? 17.533  -21.032 48.010 1.00 70.19  ? 194 GLN A NE2 1 
ATOM   1518 N  N   . GLY A  1 195 ? 23.654  -21.937 47.735 1.00 46.77  ? 195 GLY A N   1 
ATOM   1519 C  CA  . GLY A  1 195 ? 24.756  -22.299 46.865 1.00 44.75  ? 195 GLY A CA  1 
ATOM   1520 C  C   . GLY A  1 195 ? 25.814  -21.223 46.759 1.00 43.59  ? 195 GLY A C   1 
ATOM   1521 O  O   . GLY A  1 195 ? 25.626  -20.097 47.214 1.00 41.34  ? 195 GLY A O   1 
ATOM   1522 N  N   . SER A  1 196 ? 26.934  -21.571 46.140 1.00 40.21  ? 196 SER A N   1 
ATOM   1523 C  CA  . SER A  1 196 ? 28.043  -20.645 45.973 1.00 43.48  ? 196 SER A CA  1 
ATOM   1524 C  C   . SER A  1 196 ? 27.706  -19.434 45.097 1.00 51.13  ? 196 SER A C   1 
ATOM   1525 O  O   . SER A  1 196 ? 28.405  -18.423 45.140 1.00 54.57  ? 196 SER A O   1 
ATOM   1526 C  CB  . SER A  1 196 ? 29.228  -21.383 45.363 1.00 40.48  ? 196 SER A CB  1 
ATOM   1527 O  OG  . SER A  1 196 ? 28.862  -21.938 44.112 1.00 36.72  ? 196 SER A OG  1 
ATOM   1528 N  N   . ASN A  1 197 ? 26.645  -19.539 44.302 1.00 51.10  ? 197 ASN A N   1 
ATOM   1529 C  CA  . ASN A  1 197 ? 26.253  -18.453 43.404 1.00 60.84  ? 197 ASN A CA  1 
ATOM   1530 C  C   . ASN A  1 197 ? 25.240  -17.491 44.015 1.00 62.72  ? 197 ASN A C   1 
ATOM   1531 O  O   . ASN A  1 197 ? 24.526  -16.793 43.297 1.00 60.83  ? 197 ASN A O   1 
ATOM   1532 C  CB  . ASN A  1 197 ? 25.686  -19.029 42.104 1.00 54.97  ? 197 ASN A CB  1 
ATOM   1533 C  CG  . ASN A  1 197 ? 24.402  -19.802 42.323 1.00 64.45  ? 197 ASN A CG  1 
ATOM   1534 O  OD1 . ASN A  1 197 ? 24.338  -20.699 43.169 1.00 60.45  ? 197 ASN A OD1 1 
ATOM   1535 N  ND2 . ASN A  1 197 ? 23.370  -19.463 41.556 1.00 58.38  ? 197 ASN A ND2 1 
ATOM   1536 N  N   . TYR A  1 198 ? 25.176  -17.465 45.341 1.00 57.07  ? 198 TYR A N   1 
ATOM   1537 C  CA  . TYR A  1 198 ? 24.264  -16.576 46.048 1.00 52.09  ? 198 TYR A CA  1 
ATOM   1538 C  C   . TYR A  1 198 ? 25.030  -15.749 47.069 1.00 56.87  ? 198 TYR A C   1 
ATOM   1539 O  O   . TYR A  1 198 ? 26.084  -16.161 47.550 1.00 54.73  ? 198 TYR A O   1 
ATOM   1540 C  CB  . TYR A  1 198 ? 23.172  -17.369 46.772 1.00 46.99  ? 198 TYR A CB  1 
ATOM   1541 C  CG  . TYR A  1 198 ? 22.100  -17.931 45.868 1.00 60.64  ? 198 TYR A CG  1 
ATOM   1542 C  CD1 . TYR A  1 198 ? 22.392  -18.936 44.946 1.00 69.56  ? 198 TYR A CD1 1 
ATOM   1543 C  CD2 . TYR A  1 198 ? 20.791  -17.451 45.926 1.00 53.48  ? 198 TYR A CD2 1 
ATOM   1544 C  CE1 . TYR A  1 198 ? 21.409  -19.450 44.104 1.00 62.75  ? 198 TYR A CE1 1 
ATOM   1545 C  CE2 . TYR A  1 198 ? 19.800  -17.956 45.086 1.00 65.40  ? 198 TYR A CE2 1 
ATOM   1546 C  CZ  . TYR A  1 198 ? 20.118  -18.956 44.178 1.00 66.98  ? 198 TYR A CZ  1 
ATOM   1547 O  OH  . TYR A  1 198 ? 19.151  -19.460 43.340 1.00 60.86  ? 198 TYR A OH  1 
ATOM   1548 N  N   . LEU A  1 199 ? 24.502  -14.571 47.379 1.00 55.16  ? 199 LEU A N   1 
ATOM   1549 C  CA  . LEU A  1 199 ? 25.110  -13.696 48.368 1.00 55.49  ? 199 LEU A CA  1 
ATOM   1550 C  C   . LEU A  1 199 ? 24.004  -13.387 49.354 1.00 53.98  ? 199 LEU A C   1 
ATOM   1551 O  O   . LEU A  1 199 ? 22.827  -13.554 49.033 1.00 55.91  ? 199 LEU A O   1 
ATOM   1552 C  CB  . LEU A  1 199 ? 25.626  -12.402 47.722 1.00 62.45  ? 199 LEU A CB  1 
ATOM   1553 C  CG  . LEU A  1 199 ? 24.665  -11.394 47.083 1.00 69.48  ? 199 LEU A CG  1 
ATOM   1554 C  CD1 . LEU A  1 199 ? 23.791  -10.738 48.137 1.00 76.18  ? 199 LEU A CD1 1 
ATOM   1555 C  CD2 . LEU A  1 199 ? 25.476  -10.331 46.367 1.00 78.90  ? 199 LEU A CD2 1 
ATOM   1556 N  N   . ILE A  1 200 ? 24.368  -12.943 50.549 1.00 54.95  ? 200 ILE A N   1 
ATOM   1557 C  CA  . ILE A  1 200 ? 23.365  -12.623 51.555 1.00 48.97  ? 200 ILE A CA  1 
ATOM   1558 C  C   . ILE A  1 200 ? 23.176  -11.118 51.741 1.00 49.84  ? 200 ILE A C   1 
ATOM   1559 O  O   . ILE A  1 200 ? 24.132  -10.346 51.687 1.00 48.99  ? 200 ILE A O   1 
ATOM   1560 C  CB  . ILE A  1 200 ? 23.717  -13.291 52.915 1.00 53.21  ? 200 ILE A CB  1 
ATOM   1561 C  CG1 . ILE A  1 200 ? 23.409  -14.791 52.833 1.00 55.65  ? 200 ILE A CG1 1 
ATOM   1562 C  CG2 . ILE A  1 200 ? 22.947  -12.633 54.061 1.00 38.37  ? 200 ILE A CG2 1 
ATOM   1563 C  CD1 . ILE A  1 200 ? 23.410  -15.513 54.172 1.00 52.54  ? 200 ILE A CD1 1 
ATOM   1564 N  N   . VAL A  1 201 ? 21.924  -10.712 51.933 1.00 49.59  ? 201 VAL A N   1 
ATOM   1565 C  CA  . VAL A  1 201 ? 21.580  -9.313  52.154 1.00 40.44  ? 201 VAL A CA  1 
ATOM   1566 C  C   . VAL A  1 201 ? 20.903  -9.240  53.512 1.00 41.78  ? 201 VAL A C   1 
ATOM   1567 O  O   . VAL A  1 201 ? 20.030  -10.052 53.820 1.00 47.68  ? 201 VAL A O   1 
ATOM   1568 C  CB  . VAL A  1 201 ? 20.613  -8.780  51.065 1.00 44.96  ? 201 VAL A CB  1 
ATOM   1569 C  CG1 . VAL A  1 201 ? 20.025  -7.443  51.492 1.00 41.83  ? 201 VAL A CG1 1 
ATOM   1570 C  CG2 . VAL A  1 201 ? 21.358  -8.619  49.743 1.00 42.51  ? 201 VAL A CG2 1 
ATOM   1571 N  N   . LEU A  1 202 ? 21.310  -8.269  54.323 1.00 37.23  ? 202 LEU A N   1 
ATOM   1572 C  CA  . LEU A  1 202 ? 20.753  -8.111  55.661 1.00 43.34  ? 202 LEU A CA  1 
ATOM   1573 C  C   . LEU A  1 202 ? 20.167  -6.726  55.887 1.00 37.19  ? 202 LEU A C   1 
ATOM   1574 O  O   . LEU A  1 202 ? 20.749  -5.721  55.480 1.00 45.06  ? 202 LEU A O   1 
ATOM   1575 C  CB  . LEU A  1 202 ? 21.842  -8.366  56.706 1.00 45.27  ? 202 LEU A CB  1 
ATOM   1576 C  CG  . LEU A  1 202 ? 22.493  -9.747  56.691 1.00 49.06  ? 202 LEU A CG  1 
ATOM   1577 C  CD1 . LEU A  1 202 ? 23.723  -9.736  57.580 1.00 44.48  ? 202 LEU A CD1 1 
ATOM   1578 C  CD2 . LEU A  1 202 ? 21.494  -10.788 57.155 1.00 46.00  ? 202 LEU A CD2 1 
ATOM   1579 N  N   . GLY A  1 203 ? 19.021  -6.682  56.555 1.00 38.29  ? 203 GLY A N   1 
ATOM   1580 C  CA  . GLY A  1 203 ? 18.379  -5.412  56.831 1.00 38.39  ? 203 GLY A CA  1 
ATOM   1581 C  C   . GLY A  1 203 ? 17.918  -5.308  58.272 1.00 45.90  ? 203 GLY A C   1 
ATOM   1582 O  O   . GLY A  1 203 ? 17.469  -6.286  58.860 1.00 40.98  ? 203 GLY A O   1 
ATOM   1583 N  N   . SER A  1 204 ? 18.024  -4.114  58.844 1.00 44.99  ? 204 SER A N   1 
ATOM   1584 C  CA  . SER A  1 204 ? 17.623  -3.894  60.224 1.00 42.30  ? 204 SER A CA  1 
ATOM   1585 C  C   . SER A  1 204 ? 16.940  -2.537  60.367 1.00 40.76  ? 204 SER A C   1 
ATOM   1586 O  O   . SER A  1 204 ? 17.461  -1.525  59.913 1.00 39.60  ? 204 SER A O   1 
ATOM   1587 C  CB  . SER A  1 204 ? 18.856  -3.958  61.131 1.00 40.52  ? 204 SER A CB  1 
ATOM   1588 O  OG  . SER A  1 204 ? 18.494  -3.755  62.478 1.00 52.28  ? 204 SER A OG  1 
ATOM   1589 N  N   . GLN A  1 205 ? 15.774  -2.515  61.000 1.00 44.68  ? 205 GLN A N   1 
ATOM   1590 C  CA  . GLN A  1 205 ? 15.051  -1.264  61.174 1.00 47.97  ? 205 GLN A CA  1 
ATOM   1591 C  C   . GLN A  1 205 ? 14.562  -1.077  62.601 1.00 52.79  ? 205 GLN A C   1 
ATOM   1592 O  O   . GLN A  1 205 ? 13.937  -1.964  63.182 1.00 51.70  ? 205 GLN A O   1 
ATOM   1593 C  CB  . GLN A  1 205 ? 13.865  -1.197  60.205 1.00 42.23  ? 205 GLN A CB  1 
ATOM   1594 C  CG  . GLN A  1 205 ? 13.125  0.133   60.219 1.00 40.15  ? 205 GLN A CG  1 
ATOM   1595 C  CD  . GLN A  1 205 ? 12.195  0.292   59.029 1.00 53.43  ? 205 GLN A CD  1 
ATOM   1596 O  OE1 . GLN A  1 205 ? 11.181  -0.394  58.915 1.00 49.57  ? 205 GLN A OE1 1 
ATOM   1597 N  NE2 . GLN A  1 205 ? 12.547  1.198   58.128 1.00 51.49  ? 205 GLN A NE2 1 
ATOM   1598 N  N   . ARG A  1 206 ? 14.853  0.095   63.153 1.00 56.88  ? 206 ARG A N   1 
ATOM   1599 C  CA  . ARG A  1 206 ? 14.462  0.441   64.510 1.00 52.21  ? 206 ARG A CA  1 
ATOM   1600 C  C   . ARG A  1 206 ? 13.294  1.416   64.466 1.00 59.30  ? 206 ARG A C   1 
ATOM   1601 O  O   . ARG A  1 206 ? 13.286  2.346   63.659 1.00 54.17  ? 206 ARG A O   1 
ATOM   1602 C  CB  . ARG A  1 206 ? 15.649  1.074   65.234 1.00 46.78  ? 206 ARG A CB  1 
ATOM   1603 C  CG  . ARG A  1 206 ? 15.307  1.768   66.541 1.00 63.88  ? 206 ARG A CG  1 
ATOM   1604 C  CD  . ARG A  1 206 ? 16.541  2.441   67.120 1.00 57.38  ? 206 ARG A CD  1 
ATOM   1605 N  NE  . ARG A  1 206 ? 17.094  3.449   66.216 1.00 61.05  ? 206 ARG A NE  1 
ATOM   1606 C  CZ  . ARG A  1 206 ? 18.285  4.018   66.372 1.00 62.35  ? 206 ARG A CZ  1 
ATOM   1607 N  NH1 . ARG A  1 206 ? 19.052  3.678   67.399 1.00 69.27  ? 206 ARG A NH1 1 
ATOM   1608 N  NH2 . ARG A  1 206 ? 18.715  4.923   65.503 1.00 55.89  ? 206 ARG A NH2 1 
ATOM   1609 N  N   . ARG A  1 207 ? 12.305  1.200   65.327 1.00 61.86  ? 207 ARG A N   1 
ATOM   1610 C  CA  . ARG A  1 207 ? 11.143  2.079   65.368 1.00 66.92  ? 207 ARG A CA  1 
ATOM   1611 C  C   . ARG A  1 207 ? 10.320  1.872   66.636 1.00 70.32  ? 207 ARG A C   1 
ATOM   1612 O  O   . ARG A  1 207 ? 10.644  0.946   67.408 1.00 72.04  ? 207 ARG A O   1 
ATOM   1613 C  CB  . ARG A  1 207 ? 10.268  1.840   64.138 1.00 64.40  ? 207 ARG A CB  1 
ATOM   1614 C  CG  . ARG A  1 207 ? 9.615   0.474   64.103 1.00 61.02  ? 207 ARG A CG  1 
ATOM   1615 C  CD  . ARG A  1 207 ? 9.786   -0.173  62.746 1.00 70.56  ? 207 ARG A CD  1 
ATOM   1616 N  NE  . ARG A  1 207 ? 9.014   -1.405  62.625 1.00 71.28  ? 207 ARG A NE  1 
ATOM   1617 C  CZ  . ARG A  1 207 ? 9.161   -2.284  61.639 1.00 64.74  ? 207 ARG A CZ  1 
ATOM   1618 N  NH1 . ARG A  1 207 ? 10.058  -2.069  60.686 1.00 55.91  ? 207 ARG A NH1 1 
ATOM   1619 N  NH2 . ARG A  1 207 ? 8.406   -3.374  61.604 1.00 69.48  ? 207 ARG A NH2 1 
ATOM   1620 N  N   . VAL A  1 214 ? 11.066  0.680   72.152 1.00 65.48  ? 214 VAL A N   1 
ATOM   1621 C  CA  . VAL A  1 214 ? 11.707  0.559   70.812 1.00 74.89  ? 214 VAL A CA  1 
ATOM   1622 C  C   . VAL A  1 214 ? 11.668  -0.876  70.294 1.00 77.50  ? 214 VAL A C   1 
ATOM   1623 O  O   . VAL A  1 214 ? 12.021  -1.815  71.006 1.00 79.46  ? 214 VAL A O   1 
ATOM   1624 C  CB  . VAL A  1 214 ? 13.176  1.023   70.857 1.00 69.16  ? 214 VAL A CB  1 
ATOM   1625 C  CG1 . VAL A  1 214 ? 13.824  0.839   69.498 1.00 70.85  ? 214 VAL A CG1 1 
ATOM   1626 C  CG2 . VAL A  1 214 ? 13.241  2.480   71.280 1.00 83.00  ? 214 VAL A CG2 1 
ATOM   1627 N  N   . VAL A  1 215 ? 11.236  -1.035  69.047 1.00 71.41  ? 215 VAL A N   1 
ATOM   1628 C  CA  . VAL A  1 215 ? 11.153  -2.347  68.418 1.00 70.14  ? 215 VAL A CA  1 
ATOM   1629 C  C   . VAL A  1 215 ? 12.152  -2.448  67.266 1.00 67.25  ? 215 VAL A C   1 
ATOM   1630 O  O   . VAL A  1 215 ? 12.457  -1.453  66.611 1.00 69.54  ? 215 VAL A O   1 
ATOM   1631 C  CB  . VAL A  1 215 ? 9.734   -2.608  67.879 1.00 70.29  ? 215 VAL A CB  1 
ATOM   1632 C  CG1 . VAL A  1 215 ? 9.674   -3.962  67.202 1.00 76.82  ? 215 VAL A CG1 1 
ATOM   1633 C  CG2 . VAL A  1 215 ? 8.728   -2.537  69.019 1.00 69.59  ? 215 VAL A CG2 1 
ATOM   1634 N  N   . MET A  1 216 ? 12.657  -3.655  67.029 1.00 64.65  ? 216 MET A N   1 
ATOM   1635 C  CA  . MET A  1 216 ? 13.629  -3.905  65.965 1.00 62.01  ? 216 MET A CA  1 
ATOM   1636 C  C   . MET A  1 216 ? 13.134  -4.964  64.988 1.00 63.68  ? 216 MET A C   1 
ATOM   1637 O  O   . MET A  1 216 ? 12.586  -5.986  65.399 1.00 61.84  ? 216 MET A O   1 
ATOM   1638 C  CB  . MET A  1 216 ? 14.952  -4.397  66.559 1.00 58.19  ? 216 MET A CB  1 
ATOM   1639 C  CG  . MET A  1 216 ? 15.717  -3.388  67.393 1.00 65.47  ? 216 MET A CG  1 
ATOM   1640 S  SD  . MET A  1 216 ? 16.542  -2.149  66.391 1.00 76.61  ? 216 MET A SD  1 
ATOM   1641 C  CE  . MET A  1 216 ? 18.065  -2.993  65.981 1.00 72.90  ? 216 MET A CE  1 
ATOM   1642 N  N   . GLU A  1 217 ? 13.319  -4.719  63.695 1.00 54.62  ? 217 GLU A N   1 
ATOM   1643 C  CA  . GLU A  1 217 ? 12.934  -5.704  62.691 1.00 51.35  ? 217 GLU A CA  1 
ATOM   1644 C  C   . GLU A  1 217 ? 14.191  -6.028  61.901 1.00 46.33  ? 217 GLU A C   1 
ATOM   1645 O  O   . GLU A  1 217 ? 14.848  -5.132  61.370 1.00 51.23  ? 217 GLU A O   1 
ATOM   1646 C  CB  . GLU A  1 217 ? 11.852  -5.175  61.740 1.00 52.13  ? 217 GLU A CB  1 
ATOM   1647 C  CG  . GLU A  1 217 ? 11.364  -6.240  60.749 1.00 44.43  ? 217 GLU A CG  1 
ATOM   1648 C  CD  . GLU A  1 217 ? 10.412  -5.703  59.689 1.00 58.93  ? 217 GLU A CD  1 
ATOM   1649 O  OE1 . GLU A  1 217 ? 10.032  -6.478  58.785 1.00 58.46  ? 217 GLU A OE1 1 
ATOM   1650 O  OE2 . GLU A  1 217 ? 10.041  -4.513  59.752 1.00 60.70  ? 217 GLU A OE2 1 
ATOM   1651 N  N   . ARG A  1 218 ? 14.543  -7.306  61.855 1.00 43.60  ? 218 ARG A N   1 
ATOM   1652 C  CA  . ARG A  1 218 ? 15.725  -7.739  61.122 1.00 43.15  ? 218 ARG A CA  1 
ATOM   1653 C  C   . ARG A  1 218 ? 15.287  -8.760  60.094 1.00 43.08  ? 218 ARG A C   1 
ATOM   1654 O  O   . ARG A  1 218 ? 14.462  -9.624  60.387 1.00 46.34  ? 218 ARG A O   1 
ATOM   1655 C  CB  . ARG A  1 218 ? 16.755  -8.359  62.067 1.00 39.57  ? 218 ARG A CB  1 
ATOM   1656 C  CG  . ARG A  1 218 ? 17.250  -7.417  63.157 1.00 49.36  ? 218 ARG A CG  1 
ATOM   1657 C  CD  . ARG A  1 218 ? 18.404  -8.041  63.922 1.00 60.03  ? 218 ARG A CD  1 
ATOM   1658 N  NE  . ARG A  1 218 ? 19.100  -7.077  64.770 1.00 63.80  ? 218 ARG A NE  1 
ATOM   1659 C  CZ  . ARG A  1 218 ? 18.668  -6.662  65.956 1.00 62.21  ? 218 ARG A CZ  1 
ATOM   1660 N  NH1 . ARG A  1 218 ? 17.530  -7.127  66.454 1.00 61.59  ? 218 ARG A NH1 1 
ATOM   1661 N  NH2 . ARG A  1 218 ? 19.377  -5.776  66.644 1.00 60.16  ? 218 ARG A NH2 1 
ATOM   1662 N  N   . ILE A  1 219 ? 15.834  -8.647  58.887 1.00 42.32  ? 219 ILE A N   1 
ATOM   1663 C  CA  . ILE A  1 219 ? 15.486  -9.553  57.808 1.00 40.55  ? 219 ILE A CA  1 
ATOM   1664 C  C   . ILE A  1 219 ? 16.719  -10.042 57.073 1.00 40.71  ? 219 ILE A C   1 
ATOM   1665 O  O   . ILE A  1 219 ? 17.810  -9.485  57.212 1.00 41.53  ? 219 ILE A O   1 
ATOM   1666 C  CB  . ILE A  1 219 ? 14.509  -8.886  56.797 1.00 40.94  ? 219 ILE A CB  1 
ATOM   1667 C  CG1 . ILE A  1 219 ? 15.163  -7.676  56.124 1.00 42.45  ? 219 ILE A CG1 1 
ATOM   1668 C  CG2 . ILE A  1 219 ? 13.238  -8.460  57.511 1.00 38.30  ? 219 ILE A CG2 1 
ATOM   1669 C  CD1 . ILE A  1 219 ? 15.996  -8.010  54.896 1.00 40.66  ? 219 ILE A CD1 1 
ATOM   1670 N  N   . ARG A  1 220 ? 16.532  -11.095 56.289 1.00 44.88  ? 220 ARG A N   1 
ATOM   1671 C  CA  . ARG A  1 220 ? 17.618  -11.688 55.530 1.00 49.16  ? 220 ARG A CA  1 
ATOM   1672 C  C   . ARG A  1 220 ? 17.113  -12.194 54.185 1.00 43.95  ? 220 ARG A C   1 
ATOM   1673 O  O   . ARG A  1 220 ? 16.019  -12.751 54.090 1.00 45.28  ? 220 ARG A O   1 
ATOM   1674 C  CB  . ARG A  1 220 ? 18.231  -12.837 56.334 1.00 45.39  ? 220 ARG A CB  1 
ATOM   1675 C  CG  . ARG A  1 220 ? 19.284  -13.639 55.604 1.00 51.17  ? 220 ARG A CG  1 
ATOM   1676 C  CD  . ARG A  1 220 ? 20.015  -14.543 56.576 1.00 61.23  ? 220 ARG A CD  1 
ATOM   1677 N  NE  . ARG A  1 220 ? 20.756  -15.605 55.905 1.00 70.14  ? 220 ARG A NE  1 
ATOM   1678 C  CZ  . ARG A  1 220 ? 20.185  -16.635 55.291 1.00 79.02  ? 220 ARG A CZ  1 
ATOM   1679 N  NH1 . ARG A  1 220 ? 18.864  -16.740 55.263 1.00 91.40  ? 220 ARG A NH1 1 
ATOM   1680 N  NH2 . ARG A  1 220 ? 20.932  -17.567 54.716 1.00 84.82  ? 220 ARG A NH2 1 
ATOM   1681 N  N   . MET A  1 221 ? 17.918  -11.987 53.149 1.00 42.02  ? 221 MET A N   1 
ATOM   1682 C  CA  . MET A  1 221 ? 17.570  -12.420 51.809 1.00 48.96  ? 221 MET A CA  1 
ATOM   1683 C  C   . MET A  1 221 ? 18.789  -13.053 51.162 1.00 43.68  ? 221 MET A C   1 
ATOM   1684 O  O   . MET A  1 221 ? 19.905  -12.548 51.279 1.00 45.94  ? 221 MET A O   1 
ATOM   1685 C  CB  . MET A  1 221 ? 17.103  -11.231 50.955 1.00 40.79  ? 221 MET A CB  1 
ATOM   1686 C  CG  . MET A  1 221 ? 15.855  -10.529 51.458 1.00 51.01  ? 221 MET A CG  1 
ATOM   1687 S  SD  . MET A  1 221 ? 15.359  -9.175  50.353 1.00 48.88  ? 221 MET A SD  1 
ATOM   1688 C  CE  . MET A  1 221 ? 16.623  -8.014  50.734 1.00 53.63  ? 221 MET A CE  1 
ATOM   1689 N  N   . ASP A  1 222 ? 18.563  -14.167 50.480 1.00 46.09  ? 222 ASP A N   1 
ATOM   1690 C  CA  . ASP A  1 222 ? 19.623  -14.883 49.793 1.00 46.11  ? 222 ASP A CA  1 
ATOM   1691 C  C   . ASP A  1 222 ? 19.415  -14.592 48.323 1.00 48.19  ? 222 ASP A C   1 
ATOM   1692 O  O   . ASP A  1 222 ? 18.448  -15.053 47.723 1.00 51.39  ? 222 ASP A O   1 
ATOM   1693 C  CB  . ASP A  1 222 ? 19.502  -16.374 50.091 1.00 47.31  ? 222 ASP A CB  1 
ATOM   1694 C  CG  . ASP A  1 222 ? 19.772  -16.689 51.548 1.00 54.40  ? 222 ASP A CG  1 
ATOM   1695 O  OD1 . ASP A  1 222 ? 20.946  -16.924 51.894 1.00 62.89  ? 222 ASP A OD1 1 
ATOM   1696 O  OD2 . ASP A  1 222 ? 18.817  -16.673 52.351 1.00 61.10  ? 222 ASP A OD2 1 
ATOM   1697 N  N   . ILE A  1 223 ? 20.337  -13.829 47.749 1.00 45.19  ? 223 ILE A N   1 
ATOM   1698 C  CA  . ILE A  1 223 ? 20.226  -13.407 46.364 1.00 49.06  ? 223 ILE A CA  1 
ATOM   1699 C  C   . ILE A  1 223 ? 21.241  -14.018 45.416 1.00 55.61  ? 223 ILE A C   1 
ATOM   1700 O  O   . ILE A  1 223 ? 22.420  -14.161 45.741 1.00 55.48  ? 223 ILE A O   1 
ATOM   1701 C  CB  . ILE A  1 223 ? 20.321  -11.868 46.290 1.00 55.85  ? 223 ILE A CB  1 
ATOM   1702 C  CG1 . ILE A  1 223 ? 19.154  -11.257 47.069 1.00 46.77  ? 223 ILE A CG1 1 
ATOM   1703 C  CG2 . ILE A  1 223 ? 20.334  -11.400 44.842 1.00 53.77  ? 223 ILE A CG2 1 
ATOM   1704 C  CD1 . ILE A  1 223 ? 19.275  -9.765  47.275 1.00 69.09  ? 223 ILE A CD1 1 
ATOM   1705 N  N   . ARG A  1 224 ? 20.758  -14.362 44.228 1.00 50.58  ? 224 ARG A N   1 
ATOM   1706 C  CA  . ARG A  1 224 ? 21.574  -14.963 43.188 1.00 53.34  ? 224 ARG A CA  1 
ATOM   1707 C  C   . ARG A  1 224 ? 22.513  -13.915 42.609 1.00 50.05  ? 224 ARG A C   1 
ATOM   1708 O  O   . ARG A  1 224 ? 22.144  -12.754 42.476 1.00 60.27  ? 224 ARG A O   1 
ATOM   1709 C  CB  . ARG A  1 224 ? 20.660  -15.528 42.102 1.00 50.56  ? 224 ARG A CB  1 
ATOM   1710 C  CG  . ARG A  1 224 ? 21.304  -16.518 41.154 1.00 62.37  ? 224 ARG A CG  1 
ATOM   1711 C  CD  . ARG A  1 224 ? 20.225  -17.358 40.483 1.00 75.42  ? 224 ARG A CD  1 
ATOM   1712 N  NE  . ARG A  1 224 ? 20.763  -18.278 39.487 1.00 89.59  ? 224 ARG A NE  1 
ATOM   1713 C  CZ  . ARG A  1 224 ? 21.263  -17.901 38.314 1.00 98.25  ? 224 ARG A CZ  1 
ATOM   1714 N  NH1 . ARG A  1 224 ? 21.295  -16.615 37.984 1.00 98.61  ? 224 ARG A NH1 1 
ATOM   1715 N  NH2 . ARG A  1 224 ? 21.732  -18.811 37.471 1.00 93.68  ? 224 ARG A NH2 1 
ATOM   1716 N  N   . LYS A  1 225 ? 23.730  -14.330 42.282 1.00 59.76  ? 225 LYS A N   1 
ATOM   1717 C  CA  . LYS A  1 225 ? 24.738  -13.436 41.717 1.00 69.01  ? 225 LYS A CA  1 
ATOM   1718 C  C   . LYS A  1 225 ? 24.798  -13.574 40.193 1.00 71.99  ? 225 LYS A C   1 
ATOM   1719 O  O   . LYS A  1 225 ? 24.201  -14.487 39.620 1.00 72.72  ? 225 LYS A O   1 
ATOM   1720 C  CB  . LYS A  1 225 ? 26.109  -13.762 42.320 1.00 61.06  ? 225 LYS A CB  1 
ATOM   1721 C  CG  . LYS A  1 225 ? 26.166  -13.585 43.830 1.00 77.82  ? 225 LYS A CG  1 
ATOM   1722 C  CD  . LYS A  1 225 ? 27.155  -14.540 44.501 1.00 77.05  ? 225 LYS A CD  1 
ATOM   1723 C  CE  . LYS A  1 225 ? 28.598  -14.249 44.130 1.00 74.66  ? 225 LYS A CE  1 
ATOM   1724 N  NZ  . LYS A  1 225 ? 29.531  -15.138 44.881 1.00 65.51  ? 225 LYS A NZ  1 
ATOM   1725 N  N   . VAL A  1 226 ? 25.514  -12.659 39.546 1.00 76.52  ? 226 VAL A N   1 
ATOM   1726 C  CA  . VAL A  1 226 ? 25.672  -12.677 38.092 1.00 82.90  ? 226 VAL A CA  1 
ATOM   1727 C  C   . VAL A  1 226 ? 27.108  -12.367 37.696 1.00 83.98  ? 226 VAL A C   1 
ATOM   1728 O  O   . VAL A  1 226 ? 27.721  -11.443 38.228 1.00 81.48  ? 226 VAL A O   1 
ATOM   1729 C  CB  . VAL A  1 226 ? 24.753  -11.650 37.395 1.00 86.43  ? 226 VAL A CB  1 
ATOM   1730 C  CG1 . VAL A  1 226 ? 23.379  -12.252 37.164 1.00 89.45  ? 226 VAL A CG1 1 
ATOM   1731 C  CG2 . VAL A  1 226 ? 24.649  -10.388 38.239 1.00 90.64  ? 226 VAL A CG2 1 
ATOM   1732 N  N   . ASP A  1 227 ? 27.640  -13.146 36.759 1.00 87.68  ? 227 ASP A N   1 
ATOM   1733 C  CA  . ASP A  1 227 ? 29.005  -12.949 36.291 1.00 89.57  ? 227 ASP A CA  1 
ATOM   1734 C  C   . ASP A  1 227 ? 29.055  -11.816 35.277 1.00 86.97  ? 227 ASP A C   1 
ATOM   1735 O  O   . ASP A  1 227 ? 29.367  -12.019 34.104 1.00 87.37  ? 227 ASP A O   1 
ATOM   1736 C  CB  . ASP A  1 227 ? 29.551  -14.247 35.682 1.00 94.37  ? 227 ASP A CB  1 
ATOM   1737 C  CG  . ASP A  1 227 ? 28.630  -14.836 34.630 1.00 98.60  ? 227 ASP A CG  1 
ATOM   1738 O  OD1 . ASP A  1 227 ? 27.419  -14.976 34.907 1.00 86.39  ? 227 ASP A OD1 1 
ATOM   1739 O  OD2 . ASP A  1 227 ? 29.120  -15.171 33.529 1.00 100.00 ? 227 ASP A OD2 1 
ATOM   1740 N  N   . ALA A  1 228 ? 28.736  -10.617 35.751 1.00 84.84  ? 228 ALA A N   1 
ATOM   1741 C  CA  . ALA A  1 228 ? 28.735  -9.417  34.923 1.00 83.94  ? 228 ALA A CA  1 
ATOM   1742 C  C   . ALA A  1 228 ? 28.735  -8.208  35.848 1.00 77.47  ? 228 ALA A C   1 
ATOM   1743 O  O   . ALA A  1 228 ? 28.113  -8.239  36.909 1.00 76.45  ? 228 ALA A O   1 
ATOM   1744 C  CB  . ALA A  1 228 ? 27.502  -9.397  34.030 1.00 78.34  ? 228 ALA A CB  1 
ATOM   1745 N  N   . VAL A  1 229 ? 29.433  -7.149  35.451 1.00 70.24  ? 229 VAL A N   1 
ATOM   1746 C  CA  . VAL A  1 229 ? 29.501  -5.946  36.272 1.00 71.49  ? 229 VAL A CA  1 
ATOM   1747 C  C   . VAL A  1 229 ? 28.591  -4.836  35.748 1.00 67.29  ? 229 VAL A C   1 
ATOM   1748 O  O   . VAL A  1 229 ? 28.767  -4.331  34.638 1.00 67.42  ? 229 VAL A O   1 
ATOM   1749 C  CB  . VAL A  1 229 ? 30.950  -5.416  36.368 1.00 72.28  ? 229 VAL A CB  1 
ATOM   1750 C  CG1 . VAL A  1 229 ? 31.445  -4.991  34.996 1.00 80.44  ? 229 VAL A CG1 1 
ATOM   1751 C  CG2 . VAL A  1 229 ? 31.017  -4.258  37.350 1.00 69.25  ? 229 VAL A CG2 1 
ATOM   1752 N  N   . PHE A  1 230 ? 27.608  -4.465  36.561 1.00 59.31  ? 230 PHE A N   1 
ATOM   1753 C  CA  . PHE A  1 230 ? 26.664  -3.421  36.199 1.00 54.61  ? 230 PHE A CA  1 
ATOM   1754 C  C   . PHE A  1 230 ? 26.985  -2.149  36.966 1.00 59.58  ? 230 PHE A C   1 
ATOM   1755 O  O   . PHE A  1 230 ? 27.519  -2.199  38.073 1.00 65.61  ? 230 PHE A O   1 
ATOM   1756 C  CB  . PHE A  1 230 ? 25.241  -3.871  36.523 1.00 51.72  ? 230 PHE A CB  1 
ATOM   1757 C  CG  . PHE A  1 230 ? 24.830  -5.121  35.811 1.00 60.41  ? 230 PHE A CG  1 
ATOM   1758 C  CD1 . PHE A  1 230 ? 24.577  -5.106  34.443 1.00 58.82  ? 230 PHE A CD1 1 
ATOM   1759 C  CD2 . PHE A  1 230 ? 24.726  -6.325  36.501 1.00 67.00  ? 230 PHE A CD2 1 
ATOM   1760 C  CE1 . PHE A  1 230 ? 24.226  -6.270  33.772 1.00 62.82  ? 230 PHE A CE1 1 
ATOM   1761 C  CE2 . PHE A  1 230 ? 24.376  -7.497  35.840 1.00 66.65  ? 230 PHE A CE2 1 
ATOM   1762 C  CZ  . PHE A  1 230 ? 24.126  -7.469  34.472 1.00 72.20  ? 230 PHE A CZ  1 
ATOM   1763 N  N   . VAL A  1 231 ? 26.667  -1.006  36.373 1.00 51.29  ? 231 VAL A N   1 
ATOM   1764 C  CA  . VAL A  1 231 ? 26.918  0.264   37.030 1.00 44.66  ? 231 VAL A CA  1 
ATOM   1765 C  C   . VAL A  1 231 ? 25.581  0.927   37.315 1.00 48.52  ? 231 VAL A C   1 
ATOM   1766 O  O   . VAL A  1 231 ? 24.685  0.891   36.478 1.00 50.63  ? 231 VAL A O   1 
ATOM   1767 C  CB  . VAL A  1 231 ? 27.749  1.200   36.139 1.00 51.99  ? 231 VAL A CB  1 
ATOM   1768 C  CG1 . VAL A  1 231 ? 28.182  2.419   36.935 1.00 57.23  ? 231 VAL A CG1 1 
ATOM   1769 C  CG2 . VAL A  1 231 ? 28.959  0.460   35.590 1.00 61.98  ? 231 VAL A CG2 1 
ATOM   1770 N  N   . GLY A  1 232 ? 25.443  1.509   38.503 1.00 42.53  ? 232 GLY A N   1 
ATOM   1771 C  CA  . GLY A  1 232 ? 24.209  2.188   38.853 1.00 38.63  ? 232 GLY A CA  1 
ATOM   1772 C  C   . GLY A  1 232 ? 23.237  1.382   39.689 1.00 38.58  ? 232 GLY A C   1 
ATOM   1773 O  O   . GLY A  1 232 ? 22.241  1.923   40.171 1.00 35.22  ? 232 GLY A O   1 
ATOM   1774 N  N   . THR A  1 233 ? 23.516  0.095   39.866 1.00 36.29  ? 233 THR A N   1 
ATOM   1775 C  CA  . THR A  1 233 ? 22.640  -0.772  40.654 1.00 33.54  ? 233 THR A CA  1 
ATOM   1776 C  C   . THR A  1 233 ? 22.470  -0.285  42.092 1.00 38.02  ? 233 THR A C   1 
ATOM   1777 O  O   . THR A  1 233 ? 21.363  -0.302  42.635 1.00 39.37  ? 233 THR A O   1 
ATOM   1778 C  CB  . THR A  1 233 ? 23.168  -2.226  40.675 1.00 36.78  ? 233 THR A CB  1 
ATOM   1779 O  OG1 . THR A  1 233 ? 24.554  -2.224  41.042 1.00 52.39  ? 233 THR A OG1 1 
ATOM   1780 C  CG2 . THR A  1 233 ? 23.016  -2.870  39.300 1.00 40.51  ? 233 THR A CG2 1 
ATOM   1781 N  N   . GLY A  1 234 ? 23.562  0.151   42.713 1.00 34.96  ? 234 GLY A N   1 
ATOM   1782 C  CA  . GLY A  1 234 ? 23.468  0.642   44.077 1.00 35.97  ? 234 GLY A CA  1 
ATOM   1783 C  C   . GLY A  1 234 ? 22.610  1.898   44.130 1.00 39.14  ? 234 GLY A C   1 
ATOM   1784 O  O   . GLY A  1 234 ? 21.806  2.085   45.049 1.00 32.41  ? 234 GLY A O   1 
ATOM   1785 N  N   . ASP A  1 235 ? 22.784  2.762   43.134 1.00 33.60  ? 235 ASP A N   1 
ATOM   1786 C  CA  . ASP A  1 235 ? 22.017  4.002   43.037 1.00 29.52  ? 235 ASP A CA  1 
ATOM   1787 C  C   . ASP A  1 235 ? 20.529  3.677   42.929 1.00 27.75  ? 235 ASP A C   1 
ATOM   1788 O  O   . ASP A  1 235 ? 19.701  4.288   43.606 1.00 32.11  ? 235 ASP A O   1 
ATOM   1789 C  CB  . ASP A  1 235 ? 22.456  4.778   41.805 1.00 25.52  ? 235 ASP A CB  1 
ATOM   1790 C  CG  . ASP A  1 235 ? 23.907  5.168   41.854 1.00 34.45  ? 235 ASP A CG  1 
ATOM   1791 O  OD1 . ASP A  1 235 ? 24.513  5.274   40.769 1.00 35.63  ? 235 ASP A OD1 1 
ATOM   1792 O  OD2 . ASP A  1 235 ? 24.439  5.378   42.968 1.00 33.78  ? 235 ASP A OD2 1 
ATOM   1793 N  N   . LEU A  1 236 ? 20.200  2.703   42.078 1.00 39.29  ? 236 LEU A N   1 
ATOM   1794 C  CA  . LEU A  1 236 ? 18.813  2.285   41.880 1.00 29.75  ? 236 LEU A CA  1 
ATOM   1795 C  C   . LEU A  1 236 ? 18.259  1.655   43.150 1.00 35.04  ? 236 LEU A C   1 
ATOM   1796 O  O   . LEU A  1 236 ? 17.105  1.883   43.518 1.00 32.86  ? 236 LEU A O   1 
ATOM   1797 C  CB  . LEU A  1 236 ? 18.716  1.275   40.732 1.00 34.25  ? 236 LEU A CB  1 
ATOM   1798 C  CG  . LEU A  1 236 ? 17.315  0.739   40.393 1.00 33.43  ? 236 LEU A CG  1 
ATOM   1799 C  CD1 . LEU A  1 236 ? 16.404  1.889   39.992 1.00 33.32  ? 236 LEU A CD1 1 
ATOM   1800 C  CD2 . LEU A  1 236 ? 17.405  -0.267  39.263 1.00 32.39  ? 236 LEU A CD2 1 
ATOM   1801 N  N   . PHE A  1 237 ? 19.088  0.858   43.821 1.00 36.41  ? 237 PHE A N   1 
ATOM   1802 C  CA  . PHE A  1 237 ? 18.671  0.186   45.052 1.00 33.73  ? 237 PHE A CA  1 
ATOM   1803 C  C   . PHE A  1 237 ? 18.221  1.198   46.096 1.00 28.14  ? 237 PHE A C   1 
ATOM   1804 O  O   . PHE A  1 237 ? 17.144  1.067   46.678 1.00 33.55  ? 237 PHE A O   1 
ATOM   1805 C  CB  . PHE A  1 237 ? 19.824  -0.643  45.629 1.00 38.86  ? 237 PHE A CB  1 
ATOM   1806 C  CG  . PHE A  1 237 ? 19.428  -1.494  46.800 1.00 34.49  ? 237 PHE A CG  1 
ATOM   1807 C  CD1 . PHE A  1 237 ? 18.971  -2.796  46.609 1.00 45.68  ? 237 PHE A CD1 1 
ATOM   1808 C  CD2 . PHE A  1 237 ? 19.487  -0.989  48.096 1.00 37.84  ? 237 PHE A CD2 1 
ATOM   1809 C  CE1 . PHE A  1 237 ? 18.579  -3.584  47.689 1.00 42.06  ? 237 PHE A CE1 1 
ATOM   1810 C  CE2 . PHE A  1 237 ? 19.096  -1.767  49.184 1.00 42.59  ? 237 PHE A CE2 1 
ATOM   1811 C  CZ  . PHE A  1 237 ? 18.641  -3.068  48.979 1.00 45.53  ? 237 PHE A CZ  1 
ATOM   1812 N  N   . ALA A  1 238 ? 19.053  2.209   46.331 1.00 27.99  ? 238 ALA A N   1 
ATOM   1813 C  CA  . ALA A  1 238 ? 18.738  3.243   47.314 1.00 31.77  ? 238 ALA A CA  1 
ATOM   1814 C  C   . ALA A  1 238 ? 17.449  3.981   46.978 1.00 35.05  ? 238 ALA A C   1 
ATOM   1815 O  O   . ALA A  1 238 ? 16.630  4.253   47.862 1.00 37.22  ? 238 ALA A O   1 
ATOM   1816 C  CB  . ALA A  1 238 ? 19.895  4.237   47.420 1.00 34.45  ? 238 ALA A CB  1 
ATOM   1817 N  N   . ALA A  1 239 ? 17.271  4.299   45.697 1.00 36.03  ? 239 ALA A N   1 
ATOM   1818 C  CA  . ALA A  1 239 ? 16.078  5.011   45.238 1.00 28.89  ? 239 ALA A CA  1 
ATOM   1819 C  C   . ALA A  1 239 ? 14.827  4.187   45.498 1.00 29.99  ? 239 ALA A C   1 
ATOM   1820 O  O   . ALA A  1 239 ? 13.827  4.694   46.021 1.00 35.44  ? 239 ALA A O   1 
ATOM   1821 C  CB  . ALA A  1 239 ? 16.200  5.322   43.744 1.00 33.56  ? 239 ALA A CB  1 
ATOM   1822 N  N   . MET A  1 240 ? 14.885  2.910   45.128 1.00 33.32  ? 240 MET A N   1 
ATOM   1823 C  CA  . MET A  1 240 ? 13.752  2.017   45.319 1.00 31.48  ? 240 MET A CA  1 
ATOM   1824 C  C   . MET A  1 240 ? 13.491  1.721   46.795 1.00 36.12  ? 240 MET A C   1 
ATOM   1825 O  O   . MET A  1 240 ? 12.338  1.605   47.210 1.00 30.59  ? 240 MET A O   1 
ATOM   1826 C  CB  . MET A  1 240 ? 13.975  0.731   44.523 1.00 24.67  ? 240 MET A CB  1 
ATOM   1827 C  CG  . MET A  1 240 ? 14.022  0.980   43.026 1.00 33.65  ? 240 MET A CG  1 
ATOM   1828 S  SD  . MET A  1 240 ? 12.514  1.813   42.439 1.00 38.56  ? 240 MET A SD  1 
ATOM   1829 C  CE  . MET A  1 240 ? 12.904  3.539   42.688 1.00 42.51  ? 240 MET A CE  1 
ATOM   1830 N  N   . LEU A  1 241 ? 14.553  1.614   47.592 1.00 33.91  ? 241 LEU A N   1 
ATOM   1831 C  CA  . LEU A  1 241 ? 14.387  1.367   49.026 1.00 36.32  ? 241 LEU A CA  1 
ATOM   1832 C  C   . LEU A  1 241 ? 13.649  2.569   49.603 1.00 34.68  ? 241 LEU A C   1 
ATOM   1833 O  O   . LEU A  1 241 ? 12.759  2.425   50.443 1.00 37.52  ? 241 LEU A O   1 
ATOM   1834 C  CB  . LEU A  1 241 ? 15.748  1.210   49.720 1.00 36.99  ? 241 LEU A CB  1 
ATOM   1835 C  CG  . LEU A  1 241 ? 15.731  0.948   51.232 1.00 40.71  ? 241 LEU A CG  1 
ATOM   1836 C  CD1 . LEU A  1 241 ? 14.980  -0.334  51.520 1.00 35.76  ? 241 LEU A CD1 1 
ATOM   1837 C  CD2 . LEU A  1 241 ? 17.155  0.861   51.756 1.00 31.75  ? 241 LEU A CD2 1 
ATOM   1838 N  N   . LEU A  1 242 ? 14.019  3.760   49.140 1.00 35.57  ? 242 LEU A N   1 
ATOM   1839 C  CA  . LEU A  1 242 ? 13.361  4.978   49.592 1.00 30.72  ? 242 LEU A CA  1 
ATOM   1840 C  C   . LEU A  1 242 ? 11.875  4.898   49.235 1.00 34.07  ? 242 LEU A C   1 
ATOM   1841 O  O   . LEU A  1 242 ? 11.006  5.069   50.095 1.00 32.50  ? 242 LEU A O   1 
ATOM   1842 C  CB  . LEU A  1 242 ? 13.997  6.205   48.927 1.00 32.58  ? 242 LEU A CB  1 
ATOM   1843 C  CG  . LEU A  1 242 ? 13.430  7.590   49.281 1.00 39.66  ? 242 LEU A CG  1 
ATOM   1844 C  CD1 . LEU A  1 242 ? 14.436  8.648   48.892 1.00 37.63  ? 242 LEU A CD1 1 
ATOM   1845 C  CD2 . LEU A  1 242 ? 12.097  7.837   48.572 1.00 26.90  ? 242 LEU A CD2 1 
ATOM   1846 N  N   . ALA A  1 243 ? 11.591  4.619   47.965 1.00 34.55  ? 243 ALA A N   1 
ATOM   1847 C  CA  . ALA A  1 243 ? 10.211  4.525   47.487 1.00 36.09  ? 243 ALA A CA  1 
ATOM   1848 C  C   . ALA A  1 243 ? 9.372   3.522   48.266 1.00 34.70  ? 243 ALA A C   1 
ATOM   1849 O  O   . ALA A  1 243 ? 8.320   3.871   48.796 1.00 36.56  ? 243 ALA A O   1 
ATOM   1850 C  CB  . ALA A  1 243 ? 10.189  4.163   45.992 1.00 28.16  ? 243 ALA A CB  1 
ATOM   1851 N  N   . TRP A  1 244 ? 9.842   2.279   48.351 1.00 38.45  ? 244 TRP A N   1 
ATOM   1852 C  CA  . TRP A  1 244 ? 9.079   1.250   49.045 1.00 43.20  ? 244 TRP A CA  1 
ATOM   1853 C  C   . TRP A  1 244 ? 9.014   1.368   50.557 1.00 37.50  ? 244 TRP A C   1 
ATOM   1854 O  O   . TRP A  1 244 ? 8.003   1.000   51.150 1.00 40.53  ? 244 TRP A O   1 
ATOM   1855 C  CB  . TRP A  1 244 ? 9.557   -0.133  48.610 1.00 36.04  ? 244 TRP A CB  1 
ATOM   1856 C  CG  . TRP A  1 244 ? 9.307   -0.335  47.147 1.00 38.72  ? 244 TRP A CG  1 
ATOM   1857 C  CD1 . TRP A  1 244 ? 10.241  -0.516  46.175 1.00 40.99  ? 244 TRP A CD1 1 
ATOM   1858 C  CD2 . TRP A  1 244 ? 8.040   -0.250  46.475 1.00 37.37  ? 244 TRP A CD2 1 
ATOM   1859 N  NE1 . TRP A  1 244 ? 9.641   -0.538  44.936 1.00 43.03  ? 244 TRP A NE1 1 
ATOM   1860 C  CE2 . TRP A  1 244 ? 8.291   -0.376  45.093 1.00 38.13  ? 244 TRP A CE2 1 
ATOM   1861 C  CE3 . TRP A  1 244 ? 6.717   -0.074  46.910 1.00 46.71  ? 244 TRP A CE3 1 
ATOM   1862 C  CZ2 . TRP A  1 244 ? 7.271   -0.328  44.137 1.00 39.85  ? 244 TRP A CZ2 1 
ATOM   1863 C  CZ3 . TRP A  1 244 ? 5.699   -0.027  45.958 1.00 43.65  ? 244 TRP A CZ3 1 
ATOM   1864 C  CH2 . TRP A  1 244 ? 5.986   -0.154  44.585 1.00 34.82  ? 244 TRP A CH2 1 
ATOM   1865 N  N   . THR A  1 245 ? 10.063  1.878   51.197 1.00 44.51  ? 245 THR A N   1 
ATOM   1866 C  CA  . THR A  1 245 ? 9.983   2.040   52.642 1.00 45.99  ? 245 THR A CA  1 
ATOM   1867 C  C   . THR A  1 245 ? 8.950   3.147   52.875 1.00 48.34  ? 245 THR A C   1 
ATOM   1868 O  O   . THR A  1 245 ? 8.286   3.180   53.910 1.00 48.81  ? 245 THR A O   1 
ATOM   1869 C  CB  . THR A  1 245 ? 11.348  2.433   53.293 1.00 43.81  ? 245 THR A CB  1 
ATOM   1870 O  OG1 . THR A  1 245 ? 11.873  3.607   52.668 1.00 50.04  ? 245 THR A OG1 1 
ATOM   1871 C  CG2 . THR A  1 245 ? 12.355  1.289   53.170 1.00 30.45  ? 245 THR A CG2 1 
ATOM   1872 N  N   . HIS A  1 246 ? 8.800   4.042   51.897 1.00 39.34  ? 246 HIS A N   1 
ATOM   1873 C  CA  . HIS A  1 246 ? 7.816   5.119   52.015 1.00 40.42  ? 246 HIS A CA  1 
ATOM   1874 C  C   . HIS A  1 246 ? 6.387   4.566   51.963 1.00 45.39  ? 246 HIS A C   1 
ATOM   1875 O  O   . HIS A  1 246 ? 5.517   4.999   52.722 1.00 44.51  ? 246 HIS A O   1 
ATOM   1876 C  CB  . HIS A  1 246 ? 7.990   6.149   50.897 1.00 42.65  ? 246 HIS A CB  1 
ATOM   1877 C  CG  . HIS A  1 246 ? 6.977   7.252   50.938 1.00 41.80  ? 246 HIS A CG  1 
ATOM   1878 N  ND1 . HIS A  1 246 ? 7.066   8.316   51.809 1.00 43.49  ? 246 HIS A ND1 1 
ATOM   1879 C  CD2 . HIS A  1 246 ? 5.830   7.434   50.239 1.00 50.25  ? 246 HIS A CD2 1 
ATOM   1880 C  CE1 . HIS A  1 246 ? 6.019   9.106   51.646 1.00 42.40  ? 246 HIS A CE1 1 
ATOM   1881 N  NE2 . HIS A  1 246 ? 5.254   8.594   50.698 1.00 42.05  ? 246 HIS A NE2 1 
ATOM   1882 N  N   . LYS A  1 247 ? 6.152   3.611   51.066 1.00 42.63  ? 247 LYS A N   1 
ATOM   1883 C  CA  . LYS A  1 247 ? 4.834   2.994   50.914 1.00 51.31  ? 247 LYS A CA  1 
ATOM   1884 C  C   . LYS A  1 247 ? 4.535   2.034   52.066 1.00 52.33  ? 247 LYS A C   1 
ATOM   1885 O  O   . LYS A  1 247 ? 3.386   1.905   52.483 1.00 53.48  ? 247 LYS A O   1 
ATOM   1886 C  CB  . LYS A  1 247 ? 4.750   2.201   49.607 1.00 52.48  ? 247 LYS A CB  1 
ATOM   1887 C  CG  . LYS A  1 247 ? 5.405   2.846   48.397 1.00 78.47  ? 247 LYS A CG  1 
ATOM   1888 C  CD  . LYS A  1 247 ? 4.565   3.945   47.780 1.00 72.86  ? 247 LYS A CD  1 
ATOM   1889 C  CE  . LYS A  1 247 ? 4.890   4.062   46.296 1.00 82.24  ? 247 LYS A CE  1 
ATOM   1890 N  NZ  . LYS A  1 247 ? 4.111   5.123   45.604 1.00 89.65  ? 247 LYS A NZ  1 
ATOM   1891 N  N   . HIS A  1 248 ? 5.565   1.343   52.555 1.00 47.35  ? 248 HIS A N   1 
ATOM   1892 C  CA  . HIS A  1 248 ? 5.406   0.390   53.651 1.00 44.39  ? 248 HIS A CA  1 
ATOM   1893 C  C   . HIS A  1 248 ? 6.371   0.753   54.782 1.00 50.25  ? 248 HIS A C   1 
ATOM   1894 O  O   . HIS A  1 248 ? 7.332   0.031   55.052 1.00 46.66  ? 248 HIS A O   1 
ATOM   1895 C  CB  . HIS A  1 248 ? 5.694   -1.031  53.159 1.00 48.71  ? 248 HIS A CB  1 
ATOM   1896 C  CG  . HIS A  1 248 ? 4.965   -1.400  51.904 1.00 48.82  ? 248 HIS A CG  1 
ATOM   1897 N  ND1 . HIS A  1 248 ? 5.536   -1.298  50.653 1.00 56.31  ? 248 HIS A ND1 1 
ATOM   1898 C  CD2 . HIS A  1 248 ? 3.704   -1.853  51.705 1.00 49.46  ? 248 HIS A CD2 1 
ATOM   1899 C  CE1 . HIS A  1 248 ? 4.659   -1.674  49.739 1.00 48.15  ? 248 HIS A CE1 1 
ATOM   1900 N  NE2 . HIS A  1 248 ? 3.540   -2.015  50.352 1.00 48.16  ? 248 HIS A NE2 1 
ATOM   1901 N  N   . PRO A  1 249 ? 6.104   1.874   55.473 1.00 54.45  ? 249 PRO A N   1 
ATOM   1902 C  CA  . PRO A  1 249 ? 6.904   2.408   56.584 1.00 55.72  ? 249 PRO A CA  1 
ATOM   1903 C  C   . PRO A  1 249 ? 7.234   1.503   57.777 1.00 57.56  ? 249 PRO A C   1 
ATOM   1904 O  O   . PRO A  1 249 ? 8.281   1.667   58.404 1.00 67.08  ? 249 PRO A O   1 
ATOM   1905 C  CB  . PRO A  1 249 ? 6.119   3.655   57.001 1.00 54.77  ? 249 PRO A CB  1 
ATOM   1906 C  CG  . PRO A  1 249 ? 4.705   3.296   56.661 1.00 49.94  ? 249 PRO A CG  1 
ATOM   1907 C  CD  . PRO A  1 249 ? 4.860   2.650   55.309 1.00 52.62  ? 249 PRO A CD  1 
ATOM   1908 N  N   . ASN A  1 250 ? 6.361   0.556   58.099 1.00 53.74  ? 250 ASN A N   1 
ATOM   1909 C  CA  . ASN A  1 250 ? 6.616   -0.323  59.238 1.00 61.10  ? 250 ASN A CA  1 
ATOM   1910 C  C   . ASN A  1 250 ? 6.765   -1.778  58.824 1.00 58.12  ? 250 ASN A C   1 
ATOM   1911 O  O   . ASN A  1 250 ? 6.393   -2.683  59.570 1.00 63.41  ? 250 ASN A O   1 
ATOM   1912 C  CB  . ASN A  1 250 ? 5.481   -0.201  60.257 1.00 67.19  ? 250 ASN A CB  1 
ATOM   1913 C  CG  . ASN A  1 250 ? 5.244   1.230   60.697 1.00 77.79  ? 250 ASN A CG  1 
ATOM   1914 O  OD1 . ASN A  1 250 ? 6.141   1.885   61.231 1.00 76.35  ? 250 ASN A OD1 1 
ATOM   1915 N  ND2 . ASN A  1 250 ? 4.031   1.725   60.473 1.00 80.45  ? 250 ASN A ND2 1 
ATOM   1916 N  N   . ASN A  1 251 ? 7.317   -2.001  57.637 1.00 57.43  ? 251 ASN A N   1 
ATOM   1917 C  CA  . ASN A  1 251 ? 7.497   -3.351  57.125 1.00 49.14  ? 251 ASN A CA  1 
ATOM   1918 C  C   . ASN A  1 251 ? 8.748   -3.445  56.251 1.00 49.00  ? 251 ASN A C   1 
ATOM   1919 O  O   . ASN A  1 251 ? 8.663   -3.406  55.021 1.00 45.51  ? 251 ASN A O   1 
ATOM   1920 C  CB  . ASN A  1 251 ? 6.266   -3.761  56.313 1.00 44.92  ? 251 ASN A CB  1 
ATOM   1921 C  CG  . ASN A  1 251 ? 6.248   -5.237  55.999 1.00 56.18  ? 251 ASN A CG  1 
ATOM   1922 O  OD1 . ASN A  1 251 ? 7.274   -5.820  55.646 1.00 63.78  ? 251 ASN A OD1 1 
ATOM   1923 N  ND2 . ASN A  1 251 ? 5.079   -5.853  56.117 1.00 65.27  ? 251 ASN A ND2 1 
ATOM   1924 N  N   . LEU A  1 252 ? 9.905   -3.569  56.895 1.00 41.64  ? 252 LEU A N   1 
ATOM   1925 C  CA  . LEU A  1 252 ? 11.180  -3.663  56.189 1.00 40.05  ? 252 LEU A CA  1 
ATOM   1926 C  C   . LEU A  1 252 ? 11.223  -4.881  55.268 1.00 45.58  ? 252 LEU A C   1 
ATOM   1927 O  O   . LEU A  1 252 ? 11.873  -4.860  54.220 1.00 46.52  ? 252 LEU A O   1 
ATOM   1928 C  CB  . LEU A  1 252 ? 12.331  -3.746  57.195 1.00 41.69  ? 252 LEU A CB  1 
ATOM   1929 C  CG  . LEU A  1 252 ? 13.746  -3.821  56.608 1.00 37.74  ? 252 LEU A CG  1 
ATOM   1930 C  CD1 . LEU A  1 252 ? 14.072  -2.517  55.900 1.00 42.66  ? 252 LEU A CD1 1 
ATOM   1931 C  CD2 . LEU A  1 252 ? 14.751  -4.084  57.711 1.00 50.04  ? 252 LEU A CD2 1 
ATOM   1932 N  N   . LYS A  1 253 ? 10.523  -5.938  55.666 1.00 41.86  ? 253 LYS A N   1 
ATOM   1933 C  CA  . LYS A  1 253 ? 10.475  -7.175  54.894 1.00 48.61  ? 253 LYS A CA  1 
ATOM   1934 C  C   . LYS A  1 253 ? 9.953   -6.951  53.474 1.00 41.80  ? 253 LYS A C   1 
ATOM   1935 O  O   . LYS A  1 253 ? 10.625  -7.290  52.503 1.00 43.31  ? 253 LYS A O   1 
ATOM   1936 C  CB  . LYS A  1 253 ? 9.599   -8.203  55.622 1.00 45.09  ? 253 LYS A CB  1 
ATOM   1937 C  CG  . LYS A  1 253 ? 9.424   -9.524  54.884 1.00 50.07  ? 253 LYS A CG  1 
ATOM   1938 C  CD  . LYS A  1 253 ? 8.517   -10.469 55.665 1.00 46.89  ? 253 LYS A CD  1 
ATOM   1939 C  CE  . LYS A  1 253 ? 8.396   -11.832 54.994 1.00 45.10  ? 253 LYS A CE  1 
ATOM   1940 N  NZ  . LYS A  1 253 ? 7.638   -11.780 53.719 1.00 52.51  ? 253 LYS A NZ  1 
ATOM   1941 N  N   . VAL A  1 254 ? 8.754   -6.386  53.356 1.00 39.59  ? 254 VAL A N   1 
ATOM   1942 C  CA  . VAL A  1 254 ? 8.151   -6.122  52.049 1.00 43.63  ? 254 VAL A CA  1 
ATOM   1943 C  C   . VAL A  1 254 ? 8.890   -5.031  51.271 1.00 43.83  ? 254 VAL A C   1 
ATOM   1944 O  O   . VAL A  1 254 ? 9.051   -5.129  50.053 1.00 49.02  ? 254 VAL A O   1 
ATOM   1945 C  CB  . VAL A  1 254 ? 6.676   -5.701  52.188 1.00 49.01  ? 254 VAL A CB  1 
ATOM   1946 C  CG1 . VAL A  1 254 ? 6.096   -5.380  50.823 1.00 44.55  ? 254 VAL A CG1 1 
ATOM   1947 C  CG2 . VAL A  1 254 ? 5.884   -6.810  52.855 1.00 50.83  ? 254 VAL A CG2 1 
ATOM   1948 N  N   . ALA A  1 255 ? 9.336   -3.993  51.970 1.00 36.79  ? 255 ALA A N   1 
ATOM   1949 C  CA  . ALA A  1 255 ? 10.050  -2.912  51.308 1.00 36.28  ? 255 ALA A CA  1 
ATOM   1950 C  C   . ALA A  1 255 ? 11.275  -3.473  50.610 1.00 39.14  ? 255 ALA A C   1 
ATOM   1951 O  O   . ALA A  1 255 ? 11.579  -3.093  49.478 1.00 39.79  ? 255 ALA A O   1 
ATOM   1952 C  CB  . ALA A  1 255 ? 10.462  -1.833  52.321 1.00 34.47  ? 255 ALA A CB  1 
ATOM   1953 N  N   . CYS A  1 256 ? 11.977  -4.384  51.281 1.00 37.68  ? 256 CYS A N   1 
ATOM   1954 C  CA  . CYS A  1 256 ? 13.175  -4.986  50.701 1.00 38.59  ? 256 CYS A CA  1 
ATOM   1955 C  C   . CYS A  1 256 ? 12.869  -6.003  49.598 1.00 37.16  ? 256 CYS A C   1 
ATOM   1956 O  O   . CYS A  1 256 ? 13.648  -6.148  48.658 1.00 36.44  ? 256 CYS A O   1 
ATOM   1957 C  CB  . CYS A  1 256 ? 14.021  -5.655  51.790 1.00 44.25  ? 256 CYS A CB  1 
ATOM   1958 S  SG  . CYS A  1 256 ? 14.932  -4.509  52.852 1.00 41.58  ? 256 CYS A SG  1 
ATOM   1959 N  N   . GLU A  1 257 ? 11.749  -6.714  49.711 1.00 33.73  ? 257 GLU A N   1 
ATOM   1960 C  CA  . GLU A  1 257 ? 11.388  -7.702  48.690 1.00 41.92  ? 257 GLU A CA  1 
ATOM   1961 C  C   . GLU A  1 257 ? 11.035  -6.990  47.375 1.00 39.41  ? 257 GLU A C   1 
ATOM   1962 O  O   . GLU A  1 257 ? 11.421  -7.437  46.295 1.00 43.03  ? 257 GLU A O   1 
ATOM   1963 C  CB  . GLU A  1 257 ? 10.210  -8.570  49.168 1.00 34.47  ? 257 GLU A CB  1 
ATOM   1964 C  CG  . GLU A  1 257 ? 10.508  -9.370  50.442 1.00 44.39  ? 257 GLU A CG  1 
ATOM   1965 C  CD  . GLU A  1 257 ? 9.307   -10.144 50.970 1.00 55.49  ? 257 GLU A CD  1 
ATOM   1966 O  OE1 . GLU A  1 257 ? 8.167   -9.657  50.821 1.00 53.33  ? 257 GLU A OE1 1 
ATOM   1967 O  OE2 . GLU A  1 257 ? 9.505   -11.232 51.555 1.00 55.36  ? 257 GLU A OE2 1 
ATOM   1968 N  N   . LYS A  1 258 ? 10.314  -5.874  47.472 1.00 37.73  ? 258 LYS A N   1 
ATOM   1969 C  CA  . LYS A  1 258 ? 9.940   -5.104  46.287 1.00 34.59  ? 258 LYS A CA  1 
ATOM   1970 C  C   . LYS A  1 258 ? 11.163  -4.433  45.685 1.00 38.68  ? 258 LYS A C   1 
ATOM   1971 O  O   . LYS A  1 258 ? 11.329  -4.402  44.466 1.00 37.59  ? 258 LYS A O   1 
ATOM   1972 C  CB  . LYS A  1 258 ? 8.898   -4.042  46.640 1.00 37.09  ? 258 LYS A CB  1 
ATOM   1973 C  CG  . LYS A  1 258 ? 7.523   -4.621  46.890 1.00 42.07  ? 258 LYS A CG  1 
ATOM   1974 C  CD  . LYS A  1 258 ? 6.482   -3.546  47.075 1.00 53.33  ? 258 LYS A CD  1 
ATOM   1975 C  CE  . LYS A  1 258 ? 5.102   -4.159  47.187 1.00 49.47  ? 258 LYS A CE  1 
ATOM   1976 N  NZ  . LYS A  1 258 ? 4.055   -3.114  47.276 1.00 69.83  ? 258 LYS A NZ  1 
ATOM   1977 N  N   . THR A  1 259 ? 12.027  -3.917  46.552 1.00 37.08  ? 259 THR A N   1 
ATOM   1978 C  CA  . THR A  1 259 ? 13.236  -3.242  46.112 1.00 39.72  ? 259 THR A CA  1 
ATOM   1979 C  C   . THR A  1 259 ? 14.118  -4.213  45.342 1.00 37.66  ? 259 THR A C   1 
ATOM   1980 O  O   . THR A  1 259 ? 14.511  -3.944  44.209 1.00 37.79  ? 259 THR A O   1 
ATOM   1981 C  CB  . THR A  1 259 ? 14.031  -2.668  47.315 1.00 41.81  ? 259 THR A CB  1 
ATOM   1982 O  OG1 . THR A  1 259 ? 13.229  -1.702  48.011 1.00 32.75  ? 259 THR A OG1 1 
ATOM   1983 C  CG2 . THR A  1 259 ? 15.302  -1.996  46.837 1.00 29.88  ? 259 THR A CG2 1 
ATOM   1984 N  N   . VAL A  1 260 ? 14.418  -5.348  45.961 1.00 39.40  ? 260 VAL A N   1 
ATOM   1985 C  CA  . VAL A  1 260 ? 15.256  -6.359  45.334 1.00 32.91  ? 260 VAL A CA  1 
ATOM   1986 C  C   . VAL A  1 260 ? 14.579  -6.955  44.103 1.00 32.75  ? 260 VAL A C   1 
ATOM   1987 O  O   . VAL A  1 260 ? 15.235  -7.203  43.096 1.00 29.54  ? 260 VAL A O   1 
ATOM   1988 C  CB  . VAL A  1 260 ? 15.601  -7.491  46.335 1.00 42.39  ? 260 VAL A CB  1 
ATOM   1989 C  CG1 . VAL A  1 260 ? 16.373  -8.598  45.627 1.00 36.04  ? 260 VAL A CG1 1 
ATOM   1990 C  CG2 . VAL A  1 260 ? 16.424  -6.921  47.498 1.00 33.23  ? 260 VAL A CG2 1 
ATOM   1991 N  N   . SER A  1 261 ? 13.270  -7.187  44.179 1.00 29.89  ? 261 SER A N   1 
ATOM   1992 C  CA  . SER A  1 261 ? 12.549  -7.737  43.029 1.00 40.54  ? 261 SER A CA  1 
ATOM   1993 C  C   . SER A  1 261 ? 12.635  -6.776  41.842 1.00 42.88  ? 261 SER A C   1 
ATOM   1994 O  O   . SER A  1 261 ? 12.749  -7.204  40.690 1.00 40.49  ? 261 SER A O   1 
ATOM   1995 C  CB  . SER A  1 261 ? 11.078  -7.988  43.376 1.00 33.95  ? 261 SER A CB  1 
ATOM   1996 O  OG  . SER A  1 261 ? 10.934  -9.101  44.245 1.00 46.77  ? 261 SER A OG  1 
ATOM   1997 N  N   . THR A  1 262 ? 12.591  -5.476  42.127 1.00 41.12  ? 262 THR A N   1 
ATOM   1998 C  CA  . THR A  1 262 ? 12.673  -4.474  41.074 1.00 32.36  ? 262 THR A CA  1 
ATOM   1999 C  C   . THR A  1 262 ? 14.034  -4.535  40.396 1.00 40.79  ? 262 THR A C   1 
ATOM   2000 O  O   . THR A  1 262 ? 14.133  -4.472  39.168 1.00 34.00  ? 262 THR A O   1 
ATOM   2001 C  CB  . THR A  1 262 ? 12.460  -3.052  41.629 1.00 34.62  ? 262 THR A CB  1 
ATOM   2002 O  OG1 . THR A  1 262 ? 11.123  -2.932  42.127 1.00 38.12  ? 262 THR A OG1 1 
ATOM   2003 C  CG2 . THR A  1 262 ? 12.703  -2.009  40.538 1.00 34.46  ? 262 THR A CG2 1 
ATOM   2004 N  N   . LEU A  1 263 ? 15.088  -4.645  41.196 1.00 36.63  ? 263 LEU A N   1 
ATOM   2005 C  CA  . LEU A  1 263 ? 16.429  -4.717  40.639 1.00 33.29  ? 263 LEU A CA  1 
ATOM   2006 C  C   . LEU A  1 263 ? 16.554  -5.972  39.785 1.00 33.09  ? 263 LEU A C   1 
ATOM   2007 O  O   . LEU A  1 263 ? 17.129  -5.948  38.700 1.00 39.47  ? 263 LEU A O   1 
ATOM   2008 C  CB  . LEU A  1 263 ? 17.475  -4.760  41.754 1.00 40.17  ? 263 LEU A CB  1 
ATOM   2009 C  CG  . LEU A  1 263 ? 18.436  -3.573  41.829 1.00 49.55  ? 263 LEU A CG  1 
ATOM   2010 C  CD1 . LEU A  1 263 ? 17.686  -2.330  42.283 1.00 47.57  ? 263 LEU A CD1 1 
ATOM   2011 C  CD2 . LEU A  1 263 ? 19.552  -3.899  42.807 1.00 68.58  ? 263 LEU A CD2 1 
ATOM   2012 N  N   . HIS A  1 264 ? 16.019  -7.076  40.293 1.00 32.89  ? 264 HIS A N   1 
ATOM   2013 C  CA  . HIS A  1 264 ? 16.076  -8.335  39.572 1.00 38.39  ? 264 HIS A CA  1 
ATOM   2014 C  C   . HIS A  1 264 ? 15.515  -8.184  38.152 1.00 40.02  ? 264 HIS A C   1 
ATOM   2015 O  O   . HIS A  1 264 ? 16.157  -8.561  37.166 1.00 36.38  ? 264 HIS A O   1 
ATOM   2016 C  CB  . HIS A  1 264 ? 15.282  -9.408  40.320 1.00 28.94  ? 264 HIS A CB  1 
ATOM   2017 C  CG  . HIS A  1 264 ? 15.155  -10.682 39.554 1.00 45.73  ? 264 HIS A CG  1 
ATOM   2018 N  ND1 . HIS A  1 264 ? 16.225  -11.520 39.325 1.00 50.65  ? 264 HIS A ND1 1 
ATOM   2019 C  CD2 . HIS A  1 264 ? 14.105  -11.223 38.892 1.00 43.77  ? 264 HIS A CD2 1 
ATOM   2020 C  CE1 . HIS A  1 264 ? 15.840  -12.520 38.552 1.00 48.10  ? 264 HIS A CE1 1 
ATOM   2021 N  NE2 . HIS A  1 264 ? 14.560  -12.363 38.275 1.00 53.39  ? 264 HIS A NE2 1 
ATOM   2022 N  N   . HIS A  1 265 ? 14.319  -7.623  38.049 1.00 34.72  ? 265 HIS A N   1 
ATOM   2023 C  CA  . HIS A  1 265 ? 13.692  -7.449  36.742 1.00 39.91  ? 265 HIS A CA  1 
ATOM   2024 C  C   . HIS A  1 265 ? 14.513  -6.562  35.822 1.00 33.18  ? 265 HIS A C   1 
ATOM   2025 O  O   . HIS A  1 265 ? 14.673  -6.862  34.646 1.00 38.05  ? 265 HIS A O   1 
ATOM   2026 C  CB  . HIS A  1 265 ? 12.280  -6.896  36.913 1.00 32.62  ? 265 HIS A CB  1 
ATOM   2027 C  CG  . HIS A  1 265 ? 11.366  -7.832  37.638 1.00 36.93  ? 265 HIS A CG  1 
ATOM   2028 N  ND1 . HIS A  1 265 ? 11.205  -9.149  37.262 1.00 40.05  ? 265 HIS A ND1 1 
ATOM   2029 C  CD2 . HIS A  1 265 ? 10.587  -7.654  38.730 1.00 32.05  ? 265 HIS A CD2 1 
ATOM   2030 C  CE1 . HIS A  1 265 ? 10.367  -9.741  38.094 1.00 37.81  ? 265 HIS A CE1 1 
ATOM   2031 N  NE2 . HIS A  1 265 ? 9.978   -8.857  38.993 1.00 36.92  ? 265 HIS A NE2 1 
ATOM   2032 N  N   . VAL A  1 266 ? 15.060  -5.483  36.360 1.00 31.00  ? 266 VAL A N   1 
ATOM   2033 C  CA  . VAL A  1 266 ? 15.871  -4.591  35.551 1.00 32.08  ? 266 VAL A CA  1 
ATOM   2034 C  C   . VAL A  1 266 ? 17.152  -5.272  35.063 1.00 41.37  ? 266 VAL A C   1 
ATOM   2035 O  O   . VAL A  1 266 ? 17.485  -5.202  33.883 1.00 47.34  ? 266 VAL A O   1 
ATOM   2036 C  CB  . VAL A  1 266 ? 16.230  -3.314  36.338 1.00 37.33  ? 266 VAL A CB  1 
ATOM   2037 C  CG1 . VAL A  1 266 ? 17.262  -2.500  35.581 1.00 32.72  ? 266 VAL A CG1 1 
ATOM   2038 C  CG2 . VAL A  1 266 ? 14.971  -2.481  36.557 1.00 32.13  ? 266 VAL A CG2 1 
ATOM   2039 N  N   . LEU A  1 267 ? 17.862  -5.938  35.969 1.00 44.69  ? 267 LEU A N   1 
ATOM   2040 C  CA  . LEU A  1 267 ? 19.109  -6.617  35.619 1.00 35.08  ? 267 LEU A CA  1 
ATOM   2041 C  C   . LEU A  1 267 ? 18.873  -7.796  34.687 1.00 31.39  ? 267 LEU A C   1 
ATOM   2042 O  O   . LEU A  1 267 ? 19.666  -8.053  33.787 1.00 37.98  ? 267 LEU A O   1 
ATOM   2043 C  CB  . LEU A  1 267 ? 19.818  -7.100  36.889 1.00 31.62  ? 267 LEU A CB  1 
ATOM   2044 C  CG  . LEU A  1 267 ? 20.387  -5.988  37.771 1.00 44.96  ? 267 LEU A CG  1 
ATOM   2045 C  CD1 . LEU A  1 267 ? 20.890  -6.564  39.091 1.00 51.00  ? 267 LEU A CD1 1 
ATOM   2046 C  CD2 . LEU A  1 267 ? 21.508  -5.285  37.016 1.00 37.08  ? 267 LEU A CD2 1 
ATOM   2047 N  N   . GLN A  1 268 ? 17.783  -8.517  34.924 1.00 38.69  ? 268 GLN A N   1 
ATOM   2048 C  CA  . GLN A  1 268 ? 17.419  -9.667  34.105 1.00 41.06  ? 268 GLN A CA  1 
ATOM   2049 C  C   . GLN A  1 268 ? 17.233  -9.195  32.661 1.00 46.04  ? 268 GLN A C   1 
ATOM   2050 O  O   . GLN A  1 268 ? 17.795  -9.769  31.730 1.00 47.77  ? 268 GLN A O   1 
ATOM   2051 C  CB  . GLN A  1 268 ? 16.113  -10.270 34.628 1.00 47.63  ? 268 GLN A CB  1 
ATOM   2052 C  CG  . GLN A  1 268 ? 15.686  -11.555 33.953 1.00 66.88  ? 268 GLN A CG  1 
ATOM   2053 C  CD  . GLN A  1 268 ? 16.461  -12.752 34.453 1.00 77.59  ? 268 GLN A CD  1 
ATOM   2054 O  OE1 . GLN A  1 268 ? 17.676  -12.845 34.270 1.00 75.81  ? 268 GLN A OE1 1 
ATOM   2055 N  NE2 . GLN A  1 268 ? 15.761  -13.676 35.098 1.00 85.37  ? 268 GLN A NE2 1 
ATOM   2056 N  N   . ARG A  1 269 ? 16.437  -8.143  32.481 1.00 43.18  ? 269 ARG A N   1 
ATOM   2057 C  CA  . ARG A  1 269 ? 16.190  -7.591  31.150 1.00 44.24  ? 269 ARG A CA  1 
ATOM   2058 C  C   . ARG A  1 269 ? 17.485  -7.054  30.548 1.00 42.38  ? 269 ARG A C   1 
ATOM   2059 O  O   . ARG A  1 269 ? 17.738  -7.206  29.357 1.00 42.68  ? 269 ARG A O   1 
ATOM   2060 C  CB  . ARG A  1 269 ? 15.148  -6.468  31.220 1.00 34.22  ? 269 ARG A CB  1 
ATOM   2061 C  CG  . ARG A  1 269 ? 15.014  -5.670  29.930 1.00 44.58  ? 269 ARG A CG  1 
ATOM   2062 C  CD  . ARG A  1 269 ? 13.865  -4.671  29.990 1.00 36.68  ? 269 ARG A CD  1 
ATOM   2063 N  NE  . ARG A  1 269 ? 12.572  -5.335  30.130 1.00 41.04  ? 269 ARG A NE  1 
ATOM   2064 C  CZ  . ARG A  1 269 ? 11.928  -5.499  31.282 1.00 53.64  ? 269 ARG A CZ  1 
ATOM   2065 N  NH1 . ARG A  1 269 ? 12.446  -5.041  32.418 1.00 41.28  ? 269 ARG A NH1 1 
ATOM   2066 N  NH2 . ARG A  1 269 ? 10.763  -6.131  31.298 1.00 45.36  ? 269 ARG A NH2 1 
ATOM   2067 N  N   . THR A  1 270 ? 18.308  -6.435  31.386 1.00 42.01  ? 270 THR A N   1 
ATOM   2068 C  CA  . THR A  1 270 ? 19.581  -5.877  30.948 1.00 38.56  ? 270 THR A CA  1 
ATOM   2069 C  C   . THR A  1 270 ? 20.543  -6.955  30.444 1.00 42.06  ? 270 THR A C   1 
ATOM   2070 O  O   . THR A  1 270 ? 21.182  -6.797  29.405 1.00 47.91  ? 270 THR A O   1 
ATOM   2071 C  CB  . THR A  1 270 ? 20.250  -5.108  32.100 1.00 42.83  ? 270 THR A CB  1 
ATOM   2072 O  OG1 . THR A  1 270 ? 19.395  -4.036  32.508 1.00 40.10  ? 270 THR A OG1 1 
ATOM   2073 C  CG2 . THR A  1 270 ? 21.596  -4.548  31.672 1.00 36.58  ? 270 THR A CG2 1 
ATOM   2074 N  N   . ILE A  1 271 ? 20.646  -8.052  31.183 1.00 43.42  ? 271 ILE A N   1 
ATOM   2075 C  CA  . ILE A  1 271 ? 21.540  -9.142  30.804 1.00 45.71  ? 271 ILE A CA  1 
ATOM   2076 C  C   . ILE A  1 271 ? 21.125  -9.797  29.491 1.00 48.46  ? 271 ILE A C   1 
ATOM   2077 O  O   . ILE A  1 271 ? 21.968  -10.122 28.653 1.00 53.59  ? 271 ILE A O   1 
ATOM   2078 C  CB  . ILE A  1 271 ? 21.588  -10.230 31.900 1.00 52.77  ? 271 ILE A CB  1 
ATOM   2079 C  CG1 . ILE A  1 271 ? 21.988  -9.602  33.234 1.00 61.84  ? 271 ILE A CG1 1 
ATOM   2080 C  CG2 . ILE A  1 271 ? 22.590  -11.307 31.519 1.00 63.86  ? 271 ILE A CG2 1 
ATOM   2081 C  CD1 . ILE A  1 271 ? 22.038  -10.576 34.391 1.00 75.35  ? 271 ILE A CD1 1 
ATOM   2082 N  N   . GLN A  1 272 ? 19.825  -10.003 29.313 1.00 45.28  ? 272 GLN A N   1 
ATOM   2083 C  CA  . GLN A  1 272 ? 19.335  -10.619 28.087 1.00 55.37  ? 272 GLN A CA  1 
ATOM   2084 C  C   . GLN A  1 272 ? 19.652  -9.775  26.857 1.00 58.88  ? 272 GLN A C   1 
ATOM   2085 O  O   . GLN A  1 272 ? 20.108  -10.296 25.840 1.00 59.82  ? 272 GLN A O   1 
ATOM   2086 C  CB  . GLN A  1 272 ? 17.830  -10.856 28.176 1.00 45.40  ? 272 GLN A CB  1 
ATOM   2087 C  CG  . GLN A  1 272 ? 17.459  -12.139 28.884 1.00 62.95  ? 272 GLN A CG  1 
ATOM   2088 C  CD  . GLN A  1 272 ? 15.970  -12.398 28.854 1.00 77.45  ? 272 GLN A CD  1 
ATOM   2089 O  OE1 . GLN A  1 272 ? 15.328  -12.275 27.808 1.00 80.69  ? 272 GLN A OE1 1 
ATOM   2090 N  NE2 . GLN A  1 272 ? 15.410  -12.768 30.000 1.00 68.63  ? 272 GLN A NE2 1 
ATOM   2091 N  N   . CYS A  1 273 ? 19.417  -8.471  26.954 1.00 58.01  ? 273 CYS A N   1 
ATOM   2092 C  CA  . CYS A  1 273 ? 19.685  -7.571  25.840 1.00 54.66  ? 273 CYS A CA  1 
ATOM   2093 C  C   . CYS A  1 273 ? 21.181  -7.469  25.565 1.00 59.93  ? 273 CYS A C   1 
ATOM   2094 O  O   . CYS A  1 273 ? 21.601  -7.340  24.414 1.00 55.93  ? 273 CYS A O   1 
ATOM   2095 C  CB  . CYS A  1 273 ? 19.109  -6.183  26.137 1.00 61.30  ? 273 CYS A CB  1 
ATOM   2096 S  SG  . CYS A  1 273 ? 17.302  -6.168  26.381 1.00 87.08  ? 273 CYS A SG  1 
ATOM   2097 N  N   . ALA A  1 274 ? 21.984  -7.535  26.624 1.00 55.02  ? 274 ALA A N   1 
ATOM   2098 C  CA  . ALA A  1 274 ? 23.433  -7.443  26.484 1.00 60.23  ? 274 ALA A CA  1 
ATOM   2099 C  C   . ALA A  1 274 ? 23.976  -8.609  25.673 1.00 54.58  ? 274 ALA A C   1 
ATOM   2100 O  O   . ALA A  1 274 ? 24.810  -8.425  24.785 1.00 52.53  ? 274 ALA A O   1 
ATOM   2101 C  CB  . ALA A  1 274 ? 24.099  -7.410  27.855 1.00 51.88  ? 274 ALA A CB  1 
ATOM   2102 N  N   . LYS A  1 275 ? 23.506  -9.811  25.982 1.00 57.05  ? 275 LYS A N   1 
ATOM   2103 C  CA  . LYS A  1 275 ? 23.960  -10.996 25.268 1.00 57.29  ? 275 LYS A CA  1 
ATOM   2104 C  C   . LYS A  1 275 ? 23.404  -11.029 23.848 1.00 61.31  ? 275 LYS A C   1 
ATOM   2105 O  O   . LYS A  1 275 ? 24.085  -11.445 22.916 1.00 64.40  ? 275 LYS A O   1 
ATOM   2106 C  CB  . LYS A  1 275 ? 23.561  -12.253 26.040 1.00 52.17  ? 275 LYS A CB  1 
ATOM   2107 C  CG  . LYS A  1 275 ? 24.206  -12.315 27.416 1.00 63.53  ? 275 LYS A CG  1 
ATOM   2108 C  CD  . LYS A  1 275 ? 24.046  -13.669 28.083 1.00 68.28  ? 275 LYS A CD  1 
ATOM   2109 C  CE  . LYS A  1 275 ? 22.602  -13.961 28.442 1.00 75.13  ? 275 LYS A CE  1 
ATOM   2110 N  NZ  . LYS A  1 275 ? 22.494  -15.237 29.204 1.00 80.38  ? 275 LYS A NZ  1 
ATOM   2111 N  N   . ALA A  1 276 ? 22.168  -10.575 23.682 1.00 59.75  ? 276 ALA A N   1 
ATOM   2112 C  CA  . ALA A  1 276 ? 21.554  -10.548 22.363 1.00 60.94  ? 276 ALA A CA  1 
ATOM   2113 C  C   . ALA A  1 276 ? 22.423  -9.709  21.429 1.00 71.10  ? 276 ALA A C   1 
ATOM   2114 O  O   . ALA A  1 276 ? 22.643  -10.078 20.273 1.00 70.53  ? 276 ALA A O   1 
ATOM   2115 C  CB  . ALA A  1 276 ? 20.153  -9.959  22.450 1.00 54.11  ? 276 ALA A CB  1 
ATOM   2116 N  N   . GLN A  1 277 ? 22.921  -8.584  21.938 1.00 69.31  ? 277 GLN A N   1 
ATOM   2117 C  CA  . GLN A  1 277 ? 23.767  -7.695  21.148 1.00 70.99  ? 277 GLN A CA  1 
ATOM   2118 C  C   . GLN A  1 277 ? 25.161  -8.283  20.987 1.00 74.97  ? 277 GLN A C   1 
ATOM   2119 O  O   . GLN A  1 277 ? 25.786  -8.145  19.938 1.00 79.30  ? 277 GLN A O   1 
ATOM   2120 C  CB  . GLN A  1 277 ? 23.870  -6.319  21.810 1.00 69.45  ? 277 GLN A CB  1 
ATOM   2121 C  CG  . GLN A  1 277 ? 22.541  -5.607  21.987 1.00 57.55  ? 277 GLN A CG  1 
ATOM   2122 C  CD  . GLN A  1 277 ? 22.712  -4.172  22.446 1.00 68.26  ? 277 GLN A CD  1 
ATOM   2123 O  OE1 . GLN A  1 277 ? 23.368  -3.903  23.450 1.00 67.36  ? 277 GLN A OE1 1 
ATOM   2124 N  NE2 . GLN A  1 277 ? 22.115  -3.241  21.712 1.00 76.18  ? 277 GLN A NE2 1 
ATOM   2125 N  N   . ALA A  1 278 ? 25.648  -8.931  22.039 1.00 81.32  ? 278 ALA A N   1 
ATOM   2126 C  CA  . ALA A  1 278 ? 26.964  -9.554  22.016 1.00 83.64  ? 278 ALA A CA  1 
ATOM   2127 C  C   . ALA A  1 278 ? 26.774  -11.066 22.010 1.00 90.08  ? 278 ALA A C   1 
ATOM   2128 O  O   . ALA A  1 278 ? 26.493  -11.664 23.048 1.00 98.86  ? 278 ALA A O   1 
ATOM   2129 C  CB  . ALA A  1 278 ? 27.763  -9.128  23.236 1.00 71.21  ? 278 ALA A CB  1 
ATOM   2130 N  N   . GLY A  1 279 ? 26.923  -11.670 20.833 1.00 89.92  ? 279 GLY A N   1 
ATOM   2131 C  CA  . GLY A  1 279 ? 26.757  -13.108 20.678 1.00 92.22  ? 279 GLY A CA  1 
ATOM   2132 C  C   . GLY A  1 279 ? 27.093  -13.965 21.884 1.00 92.56  ? 279 GLY A C   1 
ATOM   2133 O  O   . GLY A  1 279 ? 27.881  -13.570 22.744 1.00 93.63  ? 279 GLY A O   1 
ATOM   2134 N  N   . GLU A  1 280 ? 26.500  -15.154 21.945 1.00 92.99  ? 280 GLU A N   1 
ATOM   2135 C  CA  . GLU A  1 280 ? 26.741  -16.057 23.062 1.00 96.22  ? 280 GLU A CA  1 
ATOM   2136 C  C   . GLU A  1 280 ? 28.227  -16.349 23.221 1.00 91.55  ? 280 GLU A C   1 
ATOM   2137 O  O   . GLU A  1 280 ? 28.958  -16.466 22.237 1.00 90.88  ? 280 GLU A O   1 
ATOM   2138 C  CB  . GLU A  1 280 ? 25.965  -17.365 22.875 1.00 97.49  ? 280 GLU A CB  1 
ATOM   2139 C  CG  . GLU A  1 280 ? 26.002  -18.267 24.100 1.00 100.00 ? 280 GLU A CG  1 
ATOM   2140 C  CD  . GLU A  1 280 ? 24.881  -19.289 24.114 1.00 100.00 ? 280 GLU A CD  1 
ATOM   2141 O  OE1 . GLU A  1 280 ? 24.860  -20.171 23.230 1.00 100.00 ? 280 GLU A OE1 1 
ATOM   2142 O  OE2 . GLU A  1 280 ? 24.017  -19.204 25.012 1.00 100.00 ? 280 GLU A OE2 1 
ATOM   2143 N  N   . GLY A  1 281 ? 28.665  -16.461 24.470 1.00 90.58  ? 281 GLY A N   1 
ATOM   2144 C  CA  . GLY A  1 281 ? 30.063  -16.722 24.747 1.00 87.78  ? 281 GLY A CA  1 
ATOM   2145 C  C   . GLY A  1 281 ? 30.837  -15.421 24.830 1.00 91.89  ? 281 GLY A C   1 
ATOM   2146 O  O   . GLY A  1 281 ? 31.846  -15.329 25.531 1.00 94.93  ? 281 GLY A O   1 
ATOM   2147 N  N   . VAL A  1 282 ? 30.355  -14.410 24.114 1.00 93.62  ? 282 VAL A N   1 
ATOM   2148 C  CA  . VAL A  1 282 ? 30.998  -13.100 24.095 1.00 90.17  ? 282 VAL A CA  1 
ATOM   2149 C  C   . VAL A  1 282 ? 30.647  -12.296 25.341 1.00 91.84  ? 282 VAL A C   1 
ATOM   2150 O  O   . VAL A  1 282 ? 29.488  -12.238 25.751 1.00 92.46  ? 282 VAL A O   1 
ATOM   2151 C  CB  . VAL A  1 282 ? 30.570  -12.290 22.857 1.00 87.87  ? 282 VAL A CB  1 
ATOM   2152 C  CG1 . VAL A  1 282 ? 31.384  -11.009 22.767 1.00 81.48  ? 282 VAL A CG1 1 
ATOM   2153 C  CG2 . VAL A  1 282 ? 30.743  -13.131 21.604 1.00 88.29  ? 282 VAL A CG2 1 
ATOM   2154 N  N   . ARG A  1 283 ? 31.659  -11.677 25.938 1.00 91.56  ? 283 ARG A N   1 
ATOM   2155 C  CA  . ARG A  1 283 ? 31.473  -10.871 27.139 1.00 89.18  ? 283 ARG A CA  1 
ATOM   2156 C  C   . ARG A  1 283 ? 30.973  -9.487  26.725 1.00 84.14  ? 283 ARG A C   1 
ATOM   2157 O  O   . ARG A  1 283 ? 31.634  -8.782  25.960 1.00 89.52  ? 283 ARG A O   1 
ATOM   2158 C  CB  . ARG A  1 283 ? 32.803  -10.761 27.891 1.00 89.89  ? 283 ARG A CB  1 
ATOM   2159 C  CG  . ARG A  1 283 ? 32.712  -10.196 29.297 1.00 91.61  ? 283 ARG A CG  1 
ATOM   2160 C  CD  . ARG A  1 283 ? 34.005  -10.477 30.055 1.00 97.63  ? 283 ARG A CD  1 
ATOM   2161 N  NE  . ARG A  1 283 ? 33.986  -9.972  31.425 1.00 100.00 ? 283 ARG A NE  1 
ATOM   2162 C  CZ  . ARG A  1 283 ? 34.010  -8.684  31.752 1.00 98.25  ? 283 ARG A CZ  1 
ATOM   2163 N  NH1 . ARG A  1 283 ? 34.054  -7.756  30.805 1.00 97.70  ? 283 ARG A NH1 1 
ATOM   2164 N  NH2 . ARG A  1 283 ? 33.992  -8.322  33.028 1.00 99.44  ? 283 ARG A NH2 1 
ATOM   2165 N  N   . PRO A  1 284 ? 29.786  -9.087  27.215 1.00 73.85  ? 284 PRO A N   1 
ATOM   2166 C  CA  . PRO A  1 284 ? 29.190  -7.785  26.894 1.00 59.70  ? 284 PRO A CA  1 
ATOM   2167 C  C   . PRO A  1 284 ? 30.059  -6.596  27.301 1.00 59.11  ? 284 PRO A C   1 
ATOM   2168 O  O   . PRO A  1 284 ? 30.811  -6.665  28.275 1.00 61.84  ? 284 PRO A O   1 
ATOM   2169 C  CB  . PRO A  1 284 ? 27.869  -7.817  27.655 1.00 56.40  ? 284 PRO A CB  1 
ATOM   2170 C  CG  . PRO A  1 284 ? 27.533  -9.275  27.690 1.00 57.42  ? 284 PRO A CG  1 
ATOM   2171 C  CD  . PRO A  1 284 ? 28.861  -9.890  28.032 1.00 65.83  ? 284 PRO A CD  1 
ATOM   2172 N  N   . SER A  1 285 ? 29.949  -5.505  26.551 1.00 53.45  ? 285 SER A N   1 
ATOM   2173 C  CA  . SER A  1 285 ? 30.717  -4.302  26.839 1.00 58.45  ? 285 SER A CA  1 
ATOM   2174 C  C   . SER A  1 285 ? 29.934  -3.436  27.820 1.00 62.52  ? 285 SER A C   1 
ATOM   2175 O  O   . SER A  1 285 ? 28.760  -3.700  28.088 1.00 55.53  ? 285 SER A O   1 
ATOM   2176 C  CB  . SER A  1 285 ? 30.963  -3.505  25.557 1.00 52.67  ? 285 SER A CB  1 
ATOM   2177 O  OG  . SER A  1 285 ? 29.793  -2.810  25.163 1.00 60.93  ? 285 SER A OG  1 
ATOM   2178 N  N   . PRO A  1 286 ? 30.577  -2.393  28.375 1.00 57.61  ? 286 PRO A N   1 
ATOM   2179 C  CA  . PRO A  1 286 ? 29.890  -1.511  29.323 1.00 54.21  ? 286 PRO A CA  1 
ATOM   2180 C  C   . PRO A  1 286 ? 28.667  -0.860  28.676 1.00 53.20  ? 286 PRO A C   1 
ATOM   2181 O  O   . PRO A  1 286 ? 27.676  -0.579  29.347 1.00 53.33  ? 286 PRO A O   1 
ATOM   2182 C  CB  . PRO A  1 286 ? 30.965  -0.486  29.679 1.00 57.16  ? 286 PRO A CB  1 
ATOM   2183 C  CG  . PRO A  1 286 ? 32.231  -1.279  29.564 1.00 56.77  ? 286 PRO A CG  1 
ATOM   2184 C  CD  . PRO A  1 286 ? 32.008  -2.047  28.283 1.00 54.85  ? 286 PRO A CD  1 
ATOM   2185 N  N   . MET A  1 287 ? 28.746  -0.627  27.369 1.00 49.01  ? 287 MET A N   1 
ATOM   2186 C  CA  . MET A  1 287 ? 27.650  -0.003  26.637 1.00 51.12  ? 287 MET A CA  1 
ATOM   2187 C  C   . MET A  1 287 ? 26.436  -0.920  26.595 1.00 47.97  ? 287 MET A C   1 
ATOM   2188 O  O   . MET A  1 287 ? 25.309  -0.478  26.809 1.00 48.36  ? 287 MET A O   1 
ATOM   2189 C  CB  . MET A  1 287 ? 28.084  0.330   25.213 1.00 57.93  ? 287 MET A CB  1 
ATOM   2190 C  CG  . MET A  1 287 ? 27.139  1.271   24.482 1.00 64.25  ? 287 MET A CG  1 
ATOM   2191 S  SD  . MET A  1 287 ? 27.661  1.586   22.782 1.00 83.75  ? 287 MET A SD  1 
ATOM   2192 C  CE  . MET A  1 287 ? 29.257  2.376   23.047 1.00 75.79  ? 287 MET A CE  1 
ATOM   2193 N  N   . GLN A  1 288 ? 26.674  -2.199  26.327 1.00 46.53  ? 288 GLN A N   1 
ATOM   2194 C  CA  . GLN A  1 288 ? 25.602  -3.187  26.251 1.00 42.78  ? 288 GLN A CA  1 
ATOM   2195 C  C   . GLN A  1 288 ? 25.060  -3.552  27.631 1.00 47.38  ? 288 GLN A C   1 
ATOM   2196 O  O   . GLN A  1 288 ? 23.951  -4.074  27.756 1.00 51.68  ? 288 GLN A O   1 
ATOM   2197 C  CB  . GLN A  1 288 ? 26.117  -4.438  25.540 1.00 51.23  ? 288 GLN A CB  1 
ATOM   2198 C  CG  . GLN A  1 288 ? 26.697  -4.143  24.163 1.00 54.02  ? 288 GLN A CG  1 
ATOM   2199 C  CD  . GLN A  1 288 ? 27.474  -5.307  23.583 1.00 60.07  ? 288 GLN A CD  1 
ATOM   2200 O  OE1 . GLN A  1 288 ? 28.360  -5.862  24.235 1.00 66.22  ? 288 GLN A OE1 1 
ATOM   2201 N  NE2 . GLN A  1 288 ? 27.157  -5.675  22.348 1.00 60.49  ? 288 GLN A NE2 1 
ATOM   2202 N  N   . LEU A  1 289 ? 25.844  -3.260  28.664 1.00 47.44  ? 289 LEU A N   1 
ATOM   2203 C  CA  . LEU A  1 289 ? 25.453  -3.559  30.038 1.00 50.00  ? 289 LEU A CA  1 
ATOM   2204 C  C   . LEU A  1 289 ? 24.718  -2.424  30.763 1.00 49.86  ? 289 LEU A C   1 
ATOM   2205 O  O   . LEU A  1 289 ? 24.383  -2.573  31.938 1.00 41.12  ? 289 LEU A O   1 
ATOM   2206 C  CB  . LEU A  1 289 ? 26.682  -3.967  30.859 1.00 43.01  ? 289 LEU A CB  1 
ATOM   2207 C  CG  . LEU A  1 289 ? 27.335  -5.318  30.545 1.00 56.46  ? 289 LEU A CG  1 
ATOM   2208 C  CD1 . LEU A  1 289 ? 28.670  -5.427  31.277 1.00 52.09  ? 289 LEU A CD1 1 
ATOM   2209 C  CD2 . LEU A  1 289 ? 26.404  -6.448  30.958 1.00 47.23  ? 289 LEU A CD2 1 
ATOM   2210 N  N   . GLU A  1 290 ? 24.476  -1.299  30.084 1.00 41.42  ? 290 GLU A N   1 
ATOM   2211 C  CA  . GLU A  1 290 ? 23.764  -0.180  30.709 1.00 37.31  ? 290 GLU A CA  1 
ATOM   2212 C  C   . GLU A  1 290 ? 22.391  -0.673  31.134 1.00 37.62  ? 290 GLU A C   1 
ATOM   2213 O  O   . GLU A  1 290 ? 21.730  -1.409  30.396 1.00 39.36  ? 290 GLU A O   1 
ATOM   2214 C  CB  . GLU A  1 290 ? 23.584  0.988   29.728 1.00 45.27  ? 290 GLU A CB  1 
ATOM   2215 C  CG  . GLU A  1 290 ? 24.829  1.819   29.428 1.00 39.84  ? 290 GLU A CG  1 
ATOM   2216 C  CD  . GLU A  1 290 ? 25.271  2.685   30.594 1.00 48.43  ? 290 GLU A CD  1 
ATOM   2217 O  OE1 . GLU A  1 290 ? 24.543  2.757   31.607 1.00 41.99  ? 290 GLU A OE1 1 
ATOM   2218 O  OE2 . GLU A  1 290 ? 26.348  3.307   30.491 1.00 43.90  ? 290 GLU A OE2 1 
ATOM   2219 N  N   . LEU A  1 291 ? 21.946  -0.271  32.317 1.00 34.46  ? 291 LEU A N   1 
ATOM   2220 C  CA  . LEU A  1 291 ? 20.641  -0.716  32.784 1.00 30.17  ? 291 LEU A CA  1 
ATOM   2221 C  C   . LEU A  1 291 ? 19.555  -0.352  31.772 1.00 46.67  ? 291 LEU A C   1 
ATOM   2222 O  O   . LEU A  1 291 ? 19.565  0.739   31.195 1.00 39.66  ? 291 LEU A O   1 
ATOM   2223 C  CB  . LEU A  1 291 ? 20.318  -0.095  34.146 1.00 42.41  ? 291 LEU A CB  1 
ATOM   2224 C  CG  . LEU A  1 291 ? 21.274  -0.417  35.305 1.00 42.37  ? 291 LEU A CG  1 
ATOM   2225 C  CD1 . LEU A  1 291 ? 20.758  0.231   36.576 1.00 44.28  ? 291 LEU A CD1 1 
ATOM   2226 C  CD2 . LEU A  1 291 ? 21.385  -1.919  35.498 1.00 40.43  ? 291 LEU A CD2 1 
ATOM   2227 N  N   . ARG A  1 292 ? 18.634  -1.283  31.544 1.00 39.57  ? 292 ARG A N   1 
ATOM   2228 C  CA  . ARG A  1 292 ? 17.529  -1.062  30.617 1.00 37.57  ? 292 ARG A CA  1 
ATOM   2229 C  C   . ARG A  1 292 ? 16.415  -0.479  31.469 1.00 38.41  ? 292 ARG A C   1 
ATOM   2230 O  O   . ARG A  1 292 ? 15.427  -1.149  31.778 1.00 42.01  ? 292 ARG A O   1 
ATOM   2231 C  CB  . ARG A  1 292 ? 17.092  -2.387  29.981 1.00 35.32  ? 292 ARG A CB  1 
ATOM   2232 C  CG  . ARG A  1 292 ? 18.121  -2.990  29.014 1.00 40.77  ? 292 ARG A CG  1 
ATOM   2233 C  CD  . ARG A  1 292 ? 18.370  -2.062  27.824 1.00 43.84  ? 292 ARG A CD  1 
ATOM   2234 N  NE  . ARG A  1 292 ? 19.236  -2.652  26.804 1.00 59.24  ? 292 ARG A NE  1 
ATOM   2235 C  CZ  . ARG A  1 292 ? 20.540  -2.885  26.950 1.00 79.50  ? 292 ARG A CZ  1 
ATOM   2236 N  NH1 . ARG A  1 292 ? 21.163  -2.577  28.084 1.00 56.08  ? 292 ARG A NH1 1 
ATOM   2237 N  NH2 . ARG A  1 292 ? 21.227  -3.435  25.956 1.00 81.44  ? 292 ARG A NH2 1 
ATOM   2238 N  N   . MET A  1 293 ? 16.600  0.780   31.849 1.00 34.32  ? 293 MET A N   1 
ATOM   2239 C  CA  . MET A  1 293 ? 15.663  1.488   32.712 1.00 36.37  ? 293 MET A CA  1 
ATOM   2240 C  C   . MET A  1 293 ? 14.317  1.802   32.075 1.00 30.47  ? 293 MET A C   1 
ATOM   2241 O  O   . MET A  1 293 ? 13.274  1.476   32.628 1.00 31.94  ? 293 MET A O   1 
ATOM   2242 C  CB  . MET A  1 293 ? 16.296  2.796   33.191 1.00 40.49  ? 293 MET A CB  1 
ATOM   2243 C  CG  . MET A  1 293 ? 15.671  3.374   34.451 1.00 43.32  ? 293 MET A CG  1 
ATOM   2244 S  SD  . MET A  1 293 ? 15.950  2.339   35.896 1.00 62.13  ? 293 MET A SD  1 
ATOM   2245 C  CE  . MET A  1 293 ? 17.552  1.748   35.580 1.00 29.22  ? 293 MET A CE  1 
ATOM   2246 N  N   . VAL A  1 294 ? 14.354  2.464   30.927 1.00 36.83  ? 294 VAL A N   1 
ATOM   2247 C  CA  . VAL A  1 294 ? 13.138  2.855   30.225 1.00 39.25  ? 294 VAL A CA  1 
ATOM   2248 C  C   . VAL A  1 294 ? 12.223  1.662   29.965 1.00 34.29  ? 294 VAL A C   1 
ATOM   2249 O  O   . VAL A  1 294 ? 11.019  1.731   30.205 1.00 35.17  ? 294 VAL A O   1 
ATOM   2250 C  CB  . VAL A  1 294 ? 13.493  3.564   28.890 1.00 47.82  ? 294 VAL A CB  1 
ATOM   2251 C  CG1 . VAL A  1 294 ? 12.254  3.726   28.026 1.00 51.52  ? 294 VAL A CG1 1 
ATOM   2252 C  CG2 . VAL A  1 294 ? 14.114  4.933   29.189 1.00 36.57  ? 294 VAL A CG2 1 
ATOM   2253 N  N   . GLN A  1 295 ? 12.806  0.566   29.497 1.00 35.24  ? 295 GLN A N   1 
ATOM   2254 C  CA  . GLN A  1 295 ? 12.043  -0.635  29.203 1.00 36.09  ? 295 GLN A CA  1 
ATOM   2255 C  C   . GLN A  1 295 ? 11.500  -1.349  30.438 1.00 44.64  ? 295 GLN A C   1 
ATOM   2256 O  O   . GLN A  1 295 ? 10.674  -2.250  30.308 1.00 36.18  ? 295 GLN A O   1 
ATOM   2257 C  CB  . GLN A  1 295 ? 12.898  -1.615  28.395 1.00 40.12  ? 295 GLN A CB  1 
ATOM   2258 C  CG  . GLN A  1 295 ? 13.500  -1.033  27.117 1.00 35.30  ? 295 GLN A CG  1 
ATOM   2259 C  CD  . GLN A  1 295 ? 14.722  -0.151  27.371 1.00 57.63  ? 295 GLN A CD  1 
ATOM   2260 O  OE1 . GLN A  1 295 ? 15.159  0.024   28.510 1.00 41.18  ? 295 GLN A OE1 1 
ATOM   2261 N  NE2 . GLN A  1 295 ? 15.281  0.404   26.300 1.00 47.28  ? 295 GLN A NE2 1 
ATOM   2262 N  N   . SER A  1 296 ? 11.949  -0.948  31.627 1.00 36.04  ? 296 SER A N   1 
ATOM   2263 C  CA  . SER A  1 296 ? 11.508  -1.585  32.872 1.00 32.20  ? 296 SER A CA  1 
ATOM   2264 C  C   . SER A  1 296 ? 10.443  -0.811  33.628 1.00 34.49  ? 296 SER A C   1 
ATOM   2265 O  O   . SER A  1 296 ? 10.179  -1.087  34.795 1.00 44.96  ? 296 SER A O   1 
ATOM   2266 C  CB  . SER A  1 296 ? 12.703  -1.803  33.808 1.00 36.17  ? 296 SER A CB  1 
ATOM   2267 O  OG  . SER A  1 296 ? 13.653  -2.679  33.231 1.00 37.42  ? 296 SER A OG  1 
ATOM   2268 N  N   . LYS A  1 297 ? 9.832   0.159   32.966 1.00 35.83  ? 297 LYS A N   1 
ATOM   2269 C  CA  . LYS A  1 297 ? 8.807   0.975   33.597 1.00 35.40  ? 297 LYS A CA  1 
ATOM   2270 C  C   . LYS A  1 297 ? 7.746   0.168   34.344 1.00 30.95  ? 297 LYS A C   1 
ATOM   2271 O  O   . LYS A  1 297 ? 7.404   0.489   35.484 1.00 36.08  ? 297 LYS A O   1 
ATOM   2272 C  CB  . LYS A  1 297 ? 8.133   1.860   32.541 1.00 38.65  ? 297 LYS A CB  1 
ATOM   2273 C  CG  . LYS A  1 297 ? 6.989   2.712   33.076 1.00 35.81  ? 297 LYS A CG  1 
ATOM   2274 C  CD  . LYS A  1 297 ? 6.397   3.604   31.994 1.00 45.10  ? 297 LYS A CD  1 
ATOM   2275 C  CE  . LYS A  1 297 ? 5.877   2.797   30.813 1.00 43.45  ? 297 LYS A CE  1 
ATOM   2276 N  NZ  . LYS A  1 297 ? 5.148   3.665   29.855 1.00 47.75  ? 297 LYS A NZ  1 
ATOM   2277 N  N   . ARG A  1 298 ? 7.223   -0.877  33.707 1.00 36.07  ? 298 ARG A N   1 
ATOM   2278 C  CA  . ARG A  1 298 ? 6.173   -1.697  34.325 1.00 42.27  ? 298 ARG A CA  1 
ATOM   2279 C  C   . ARG A  1 298 ? 6.675   -2.446  35.558 1.00 40.12  ? 298 ARG A C   1 
ATOM   2280 O  O   . ARG A  1 298 ? 5.941   -2.628  36.538 1.00 34.40  ? 298 ARG A O   1 
ATOM   2281 C  CB  . ARG A  1 298 ? 5.618   -2.694  33.301 1.00 46.95  ? 298 ARG A CB  1 
ATOM   2282 C  CG  . ARG A  1 298 ? 5.196   -2.057  31.977 1.00 58.91  ? 298 ARG A CG  1 
ATOM   2283 C  CD  . ARG A  1 298 ? 3.751   -1.581  31.978 1.00 67.38  ? 298 ARG A CD  1 
ATOM   2284 N  NE  . ARG A  1 298 ? 2.812   -2.675  31.727 1.00 86.50  ? 298 ARG A NE  1 
ATOM   2285 C  CZ  . ARG A  1 298 ? 2.852   -3.468  30.658 1.00 86.62  ? 298 ARG A CZ  1 
ATOM   2286 N  NH1 . ARG A  1 298 ? 3.787   -3.295  29.731 1.00 88.20  ? 298 ARG A NH1 1 
ATOM   2287 N  NH2 . ARG A  1 298 ? 1.960   -4.439  30.515 1.00 77.19  ? 298 ARG A NH2 1 
ATOM   2288 N  N   . ASP A  1 299 ? 7.928   -2.883  35.509 1.00 42.33  ? 299 ASP A N   1 
ATOM   2289 C  CA  . ASP A  1 299 ? 8.520   -3.605  36.626 1.00 38.44  ? 299 ASP A CA  1 
ATOM   2290 C  C   . ASP A  1 299 ? 8.717   -2.666  37.814 1.00 40.69  ? 299 ASP A C   1 
ATOM   2291 O  O   . ASP A  1 299 ? 8.622   -3.070  38.974 1.00 42.54  ? 299 ASP A O   1 
ATOM   2292 C  CB  . ASP A  1 299 ? 9.848   -4.228  36.189 1.00 42.09  ? 299 ASP A CB  1 
ATOM   2293 C  CG  . ASP A  1 299 ? 9.671   -5.213  35.046 1.00 39.34  ? 299 ASP A CG  1 
ATOM   2294 O  OD1 . ASP A  1 299 ? 8.811   -6.109  35.175 1.00 44.59  ? 299 ASP A OD1 1 
ATOM   2295 O  OD2 . ASP A  1 299 ? 10.382  -5.100  34.024 1.00 43.92  ? 299 ASP A OD2 1 
ATOM   2296 N  N   . ILE A  1 300 ? 8.979   -1.401  37.518 1.00 40.93  ? 300 ILE A N   1 
ATOM   2297 C  CA  . ILE A  1 300 ? 9.160   -0.405  38.565 1.00 35.69  ? 300 ILE A CA  1 
ATOM   2298 C  C   . ILE A  1 300 ? 7.820   -0.072  39.230 1.00 32.34  ? 300 ILE A C   1 
ATOM   2299 O  O   . ILE A  1 300 ? 7.727   0.017   40.454 1.00 38.06  ? 300 ILE A O   1 
ATOM   2300 C  CB  . ILE A  1 300 ? 9.791   0.875   37.976 1.00 34.23  ? 300 ILE A CB  1 
ATOM   2301 C  CG1 . ILE A  1 300 ? 11.221  0.564   37.532 1.00 26.52  ? 300 ILE A CG1 1 
ATOM   2302 C  CG2 . ILE A  1 300 ? 9.745   2.004   38.991 1.00 30.18  ? 300 ILE A CG2 1 
ATOM   2303 C  CD1 . ILE A  1 300 ? 11.784  1.536   36.532 1.00 34.56  ? 300 ILE A CD1 1 
ATOM   2304 N  N   . GLU A  1 301 ? 6.781   0.097   38.417 1.00 36.99  ? 301 GLU A N   1 
ATOM   2305 C  CA  . GLU A  1 301 ? 5.443   0.424   38.921 1.00 38.81  ? 301 GLU A CA  1 
ATOM   2306 C  C   . GLU A  1 301 ? 4.860   -0.641  39.845 1.00 43.79  ? 301 GLU A C   1 
ATOM   2307 O  O   . GLU A  1 301 ? 4.313   -0.319  40.898 1.00 50.86  ? 301 GLU A O   1 
ATOM   2308 C  CB  . GLU A  1 301 ? 4.470   0.646   37.752 1.00 35.95  ? 301 GLU A CB  1 
ATOM   2309 C  CG  . GLU A  1 301 ? 4.932   1.687   36.751 1.00 46.94  ? 301 GLU A CG  1 
ATOM   2310 C  CD  . GLU A  1 301 ? 3.929   1.937   35.636 1.00 48.39  ? 301 GLU A CD  1 
ATOM   2311 O  OE1 . GLU A  1 301 ? 3.576   0.987   34.905 1.00 46.00  ? 301 GLU A OE1 1 
ATOM   2312 O  OE2 . GLU A  1 301 ? 3.499   3.096   35.489 1.00 44.97  ? 301 GLU A OE2 1 
ATOM   2313 N  N   . ASP A  1 302 ? 4.971   -1.904  39.442 1.00 48.42  ? 302 ASP A N   1 
ATOM   2314 C  CA  . ASP A  1 302 ? 4.436   -3.016  40.228 1.00 52.23  ? 302 ASP A CA  1 
ATOM   2315 C  C   . ASP A  1 302 ? 5.305   -4.256  39.997 1.00 53.95  ? 302 ASP A C   1 
ATOM   2316 O  O   . ASP A  1 302 ? 4.999   -5.101  39.154 1.00 40.59  ? 302 ASP A O   1 
ATOM   2317 C  CB  . ASP A  1 302 ? 2.989   -3.292  39.805 1.00 54.72  ? 302 ASP A CB  1 
ATOM   2318 C  CG  . ASP A  1 302 ? 2.314   -4.334  40.671 1.00 66.04  ? 302 ASP A CG  1 
ATOM   2319 O  OD1 . ASP A  1 302 ? 2.183   -4.108  41.893 1.00 71.85  ? 302 ASP A OD1 1 
ATOM   2320 O  OD2 . ASP A  1 302 ? 1.913   -5.383  40.129 1.00 71.08  ? 302 ASP A OD2 1 
ATOM   2321 N  N   . PRO A  1 303 ? 6.399   -4.384  40.762 1.00 41.63  ? 303 PRO A N   1 
ATOM   2322 C  CA  . PRO A  1 303 ? 7.328   -5.508  40.647 1.00 42.63  ? 303 PRO A CA  1 
ATOM   2323 C  C   . PRO A  1 303 ? 6.802   -6.853  41.130 1.00 44.73  ? 303 PRO A C   1 
ATOM   2324 O  O   . PRO A  1 303 ? 6.362   -6.978  42.274 1.00 42.85  ? 303 PRO A O   1 
ATOM   2325 C  CB  . PRO A  1 303 ? 8.521   -5.037  41.468 1.00 38.06  ? 303 PRO A CB  1 
ATOM   2326 C  CG  . PRO A  1 303 ? 7.857   -4.313  42.590 1.00 38.06  ? 303 PRO A CG  1 
ATOM   2327 C  CD  . PRO A  1 303 ? 6.797   -3.492  41.868 1.00 41.11  ? 303 PRO A CD  1 
ATOM   2328 N  N   . GLU A  1 304 ? 6.836   -7.855  40.252 1.00 40.51  ? 304 GLU A N   1 
ATOM   2329 C  CA  . GLU A  1 304 ? 6.403   -9.190  40.640 1.00 42.28  ? 304 GLU A CA  1 
ATOM   2330 C  C   . GLU A  1 304 ? 7.446   -9.676  41.653 1.00 38.89  ? 304 GLU A C   1 
ATOM   2331 O  O   . GLU A  1 304 ? 8.646   -9.679  41.368 1.00 37.71  ? 304 GLU A O   1 
ATOM   2332 C  CB  . GLU A  1 304 ? 6.360   -10.122 39.419 1.00 36.99  ? 304 GLU A CB  1 
ATOM   2333 C  CG  . GLU A  1 304 ? 6.248   -11.607 39.770 1.00 41.03  ? 304 GLU A CG  1 
ATOM   2334 C  CD  . GLU A  1 304 ? 5.979   -12.492 38.562 1.00 43.11  ? 304 GLU A CD  1 
ATOM   2335 O  OE1 . GLU A  1 304 ? 6.542   -12.228 37.481 1.00 45.49  ? 304 GLU A OE1 1 
ATOM   2336 O  OE2 . GLU A  1 304 ? 5.211   -13.466 38.697 1.00 50.67  ? 304 GLU A OE2 1 
ATOM   2337 N  N   . ILE A  1 305 ? 6.992   -10.055 42.841 1.00 37.67  ? 305 ILE A N   1 
ATOM   2338 C  CA  . ILE A  1 305 ? 7.895   -10.527 43.886 1.00 40.97  ? 305 ILE A CA  1 
ATOM   2339 C  C   . ILE A  1 305 ? 8.564   -11.840 43.494 1.00 42.32  ? 305 ILE A C   1 
ATOM   2340 O  O   . ILE A  1 305 ? 7.893   -12.838 43.243 1.00 42.89  ? 305 ILE A O   1 
ATOM   2341 C  CB  . ILE A  1 305 ? 7.149   -10.745 45.211 1.00 43.07  ? 305 ILE A CB  1 
ATOM   2342 C  CG1 . ILE A  1 305 ? 6.324   -9.501  45.557 1.00 50.22  ? 305 ILE A CG1 1 
ATOM   2343 C  CG2 . ILE A  1 305 ? 8.150   -11.052 46.321 1.00 47.34  ? 305 ILE A CG2 1 
ATOM   2344 C  CD1 . ILE A  1 305 ? 7.127   -8.212  45.638 1.00 39.44  ? 305 ILE A CD1 1 
ATOM   2345 N  N   . VAL A  1 306 ? 9.890   -11.840 43.439 1.00 40.00  ? 306 VAL A N   1 
ATOM   2346 C  CA  . VAL A  1 306 ? 10.616  -13.044 43.070 1.00 43.68  ? 306 VAL A CA  1 
ATOM   2347 C  C   . VAL A  1 306 ? 11.622  -13.470 44.139 1.00 48.59  ? 306 VAL A C   1 
ATOM   2348 O  O   . VAL A  1 306 ? 12.451  -14.344 43.903 1.00 51.58  ? 306 VAL A O   1 
ATOM   2349 C  CB  . VAL A  1 306 ? 11.352  -12.856 41.725 1.00 43.50  ? 306 VAL A CB  1 
ATOM   2350 C  CG1 . VAL A  1 306 ? 10.361  -12.437 40.651 1.00 53.14  ? 306 VAL A CG1 1 
ATOM   2351 C  CG2 . VAL A  1 306 ? 12.457  -11.825 41.869 1.00 42.19  ? 306 VAL A CG2 1 
ATOM   2352 N  N   . VAL A  1 307 ? 11.542  -12.845 45.310 1.00 50.51  ? 307 VAL A N   1 
ATOM   2353 C  CA  . VAL A  1 307 ? 12.434  -13.159 46.425 1.00 52.26  ? 307 VAL A CA  1 
ATOM   2354 C  C   . VAL A  1 307 ? 11.706  -12.983 47.751 1.00 49.03  ? 307 VAL A C   1 
ATOM   2355 O  O   . VAL A  1 307 ? 10.956  -12.026 47.935 1.00 53.75  ? 307 VAL A O   1 
ATOM   2356 C  CB  . VAL A  1 307 ? 13.670  -12.238 46.444 1.00 62.13  ? 307 VAL A CB  1 
ATOM   2357 C  CG1 . VAL A  1 307 ? 14.529  -12.489 45.217 1.00 73.21  ? 307 VAL A CG1 1 
ATOM   2358 C  CG2 . VAL A  1 307 ? 13.228  -10.781 46.503 1.00 56.41  ? 307 VAL A CG2 1 
ATOM   2359 N  N   . GLN A  1 308 ? 11.929  -13.909 48.673 1.00 54.90  ? 308 GLN A N   1 
ATOM   2360 C  CA  . GLN A  1 308 ? 11.299  -13.840 49.984 1.00 51.66  ? 308 GLN A CA  1 
ATOM   2361 C  C   . GLN A  1 308 ? 12.312  -13.499 51.067 1.00 56.85  ? 308 GLN A C   1 
ATOM   2362 O  O   . GLN A  1 308 ? 13.380  -14.108 51.159 1.00 58.34  ? 308 GLN A O   1 
ATOM   2363 C  CB  . GLN A  1 308 ? 10.626  -15.172 50.324 1.00 67.19  ? 308 GLN A CB  1 
ATOM   2364 C  CG  . GLN A  1 308 ? 9.447   -15.517 49.436 1.00 81.07  ? 308 GLN A CG  1 
ATOM   2365 C  CD  . GLN A  1 308 ? 8.369   -14.451 49.471 1.00 93.43  ? 308 GLN A CD  1 
ATOM   2366 O  OE1 . GLN A  1 308 ? 8.583   -13.320 49.032 1.00 96.82  ? 308 GLN A OE1 1 
ATOM   2367 N  NE2 . GLN A  1 308 ? 7.204   -14.804 50.001 1.00 98.11  ? 308 GLN A NE2 1 
ATOM   2368 N  N   . ALA A  1 309 ? 11.975  -12.513 51.885 1.00 45.96  ? 309 ALA A N   1 
ATOM   2369 C  CA  . ALA A  1 309 ? 12.848  -12.114 52.972 1.00 49.70  ? 309 ALA A CA  1 
ATOM   2370 C  C   . ALA A  1 309 ? 12.400  -12.898 54.198 1.00 54.44  ? 309 ALA A C   1 
ATOM   2371 O  O   . ALA A  1 309 ? 11.212  -13.164 54.371 1.00 54.80  ? 309 ALA A O   1 
ATOM   2372 C  CB  . ALA A  1 309 ? 12.724  -10.610 53.227 1.00 37.31  ? 309 ALA A CB  1 
ATOM   2373 N  N   . THR A  1 310 ? 13.352  -13.282 55.039 1.00 55.71  ? 310 THR A N   1 
ATOM   2374 C  CA  . THR A  1 310 ? 13.025  -14.018 56.251 1.00 58.16  ? 310 THR A CA  1 
ATOM   2375 C  C   . THR A  1 310 ? 13.296  -13.128 57.456 1.00 50.35  ? 310 THR A C   1 
ATOM   2376 O  O   . THR A  1 310 ? 14.327  -12.460 57.525 1.00 50.73  ? 310 THR A O   1 
ATOM   2377 C  CB  . THR A  1 310 ? 13.863  -15.313 56.373 1.00 62.58  ? 310 THR A CB  1 
ATOM   2378 O  OG1 . THR A  1 310 ? 15.257  -14.996 56.297 1.00 79.77  ? 310 THR A OG1 1 
ATOM   2379 C  CG2 . THR A  1 310 ? 13.516  -16.277 55.260 1.00 58.91  ? 310 THR A CG2 1 
ATOM   2380 N  N   . VAL A  1 311 ? 12.359  -13.104 58.396 1.00 57.81  ? 311 VAL A N   1 
ATOM   2381 C  CA  . VAL A  1 311 ? 12.520  -12.296 59.598 1.00 63.53  ? 311 VAL A CA  1 
ATOM   2382 C  C   . VAL A  1 311 ? 13.426  -13.033 60.575 1.00 59.89  ? 311 VAL A C   1 
ATOM   2383 O  O   . VAL A  1 311 ? 13.160  -14.176 60.944 1.00 63.75  ? 311 VAL A O   1 
ATOM   2384 C  CB  . VAL A  1 311 ? 11.167  -12.023 60.286 1.00 59.46  ? 311 VAL A CB  1 
ATOM   2385 C  CG1 . VAL A  1 311 ? 11.382  -11.177 61.534 1.00 63.47  ? 311 VAL A CG1 1 
ATOM   2386 C  CG2 . VAL A  1 311 ? 10.229  -11.317 59.324 1.00 64.95  ? 311 VAL A CG2 1 
ATOM   2387 N  N   . LEU A  1 312 ? 14.503  -12.377 60.982 1.00 56.60  ? 312 LEU A N   1 
ATOM   2388 C  CA  . LEU A  1 312 ? 15.445  -12.973 61.913 1.00 55.26  ? 312 LEU A CA  1 
ATOM   2389 C  C   . LEU A  1 312 ? 14.937  -12.825 63.344 1.00 58.60  ? 312 LEU A C   1 
ATOM   2390 O  O   . LEU A  1 312 ? 14.436  -11.733 63.683 1.00 63.44  ? 312 LEU A O   1 
ATOM   2391 C  CB  . LEU A  1 312 ? 16.816  -12.319 61.747 1.00 47.02  ? 312 LEU A CB  1 
ATOM   2392 C  CG  . LEU A  1 312 ? 17.354  -12.421 60.315 1.00 47.55  ? 312 LEU A CG  1 
ATOM   2393 C  CD1 . LEU A  1 312 ? 18.676  -11.684 60.187 1.00 42.67  ? 312 LEU A CD1 1 
ATOM   2394 C  CD2 . LEU A  1 312 ? 17.525  -13.886 59.942 1.00 46.66  ? 312 LEU A CD2 1 
ATOM   2395 O  OXT . LEU A  1 312 ? 15.042  -13.806 64.110 1.00 68.00  ? 312 LEU A OXT 1 
ATOM   2396 N  N   . GLU B  1 4   ? 16.111  0.316   19.833 1.00 49.73  ? 4   GLU B N   1 
ATOM   2397 C  CA  . GLU B  1 4   ? 15.727  1.536   20.585 1.00 55.05  ? 4   GLU B CA  1 
ATOM   2398 C  C   . GLU B  1 4   ? 15.739  2.780   19.701 1.00 59.09  ? 4   GLU B C   1 
ATOM   2399 O  O   . GLU B  1 4   ? 16.291  2.774   18.599 1.00 58.82  ? 4   GLU B O   1 
ATOM   2400 C  CB  . GLU B  1 4   ? 16.675  1.743   21.776 1.00 72.71  ? 4   GLU B CB  1 
ATOM   2401 C  CG  . GLU B  1 4   ? 18.160  1.729   21.423 1.00 82.69  ? 4   GLU B CG  1 
ATOM   2402 C  CD  . GLU B  1 4   ? 18.726  0.324   21.296 1.00 96.20  ? 4   GLU B CD  1 
ATOM   2403 O  OE1 . GLU B  1 4   ? 19.891  0.188   20.860 1.00 97.36  ? 4   GLU B OE1 1 
ATOM   2404 O  OE2 . GLU B  1 4   ? 18.011  -0.643  21.640 1.00 94.50  ? 4   GLU B OE2 1 
ATOM   2405 N  N   . CYS B  1 5   ? 15.118  3.843   20.198 1.00 49.56  ? 5   CYS B N   1 
ATOM   2406 C  CA  . CYS B  1 5   ? 15.050  5.115   19.486 1.00 40.01  ? 5   CYS B CA  1 
ATOM   2407 C  C   . CYS B  1 5   ? 15.742  6.150   20.374 1.00 36.16  ? 5   CYS B C   1 
ATOM   2408 O  O   . CYS B  1 5   ? 15.212  6.545   21.416 1.00 34.82  ? 5   CYS B O   1 
ATOM   2409 C  CB  . CYS B  1 5   ? 13.588  5.497   19.252 1.00 45.30  ? 5   CYS B CB  1 
ATOM   2410 S  SG  . CYS B  1 5   ? 13.356  7.049   18.381 1.00 49.88  ? 5   CYS B SG  1 
ATOM   2411 N  N   . ARG B  1 6   ? 16.930  6.578   19.960 1.00 36.67  ? 6   ARG B N   1 
ATOM   2412 C  CA  . ARG B  1 6   ? 17.722  7.522   20.741 1.00 36.43  ? 6   ARG B CA  1 
ATOM   2413 C  C   . ARG B  1 6   ? 17.564  8.983   20.383 1.00 36.50  ? 6   ARG B C   1 
ATOM   2414 O  O   . ARG B  1 6   ? 17.649  9.373   19.221 1.00 35.50  ? 6   ARG B O   1 
ATOM   2415 C  CB  . ARG B  1 6   ? 19.198  7.133   20.668 1.00 40.16  ? 6   ARG B CB  1 
ATOM   2416 C  CG  . ARG B  1 6   ? 19.470  5.791   21.301 1.00 45.51  ? 6   ARG B CG  1 
ATOM   2417 C  CD  . ARG B  1 6   ? 20.902  5.366   21.132 1.00 41.21  ? 6   ARG B CD  1 
ATOM   2418 N  NE  . ARG B  1 6   ? 21.108  4.048   21.711 1.00 44.76  ? 6   ARG B NE  1 
ATOM   2419 C  CZ  . ARG B  1 6   ? 21.215  3.812   23.014 1.00 48.96  ? 6   ARG B CZ  1 
ATOM   2420 N  NH1 . ARG B  1 6   ? 21.141  4.816   23.881 1.00 37.79  ? 6   ARG B NH1 1 
ATOM   2421 N  NH2 . ARG B  1 6   ? 21.392  2.569   23.445 1.00 44.92  ? 6   ARG B NH2 1 
ATOM   2422 N  N   . VAL B  1 7   ? 17.350  9.785   21.419 1.00 36.02  ? 7   VAL B N   1 
ATOM   2423 C  CA  . VAL B  1 7   ? 17.158  11.217  21.287 1.00 32.99  ? 7   VAL B CA  1 
ATOM   2424 C  C   . VAL B  1 7   ? 18.199  11.970  22.110 1.00 34.17  ? 7   VAL B C   1 
ATOM   2425 O  O   . VAL B  1 7   ? 18.381  11.687  23.293 1.00 36.50  ? 7   VAL B O   1 
ATOM   2426 C  CB  . VAL B  1 7   ? 15.750  11.610  21.788 1.00 30.65  ? 7   VAL B CB  1 
ATOM   2427 C  CG1 . VAL B  1 7   ? 15.557  13.110  21.698 1.00 29.07  ? 7   VAL B CG1 1 
ATOM   2428 C  CG2 . VAL B  1 7   ? 14.688  10.864  20.983 1.00 26.93  ? 7   VAL B CG2 1 
ATOM   2429 N  N   . LEU B  1 8   ? 18.896  12.911  21.477 1.00 37.98  ? 8   LEU B N   1 
ATOM   2430 C  CA  . LEU B  1 8   ? 19.885  13.723  22.179 1.00 32.01  ? 8   LEU B CA  1 
ATOM   2431 C  C   . LEU B  1 8   ? 19.221  15.075  22.413 1.00 36.04  ? 8   LEU B C   1 
ATOM   2432 O  O   . LEU B  1 8   ? 19.065  15.870  21.486 1.00 29.84  ? 8   LEU B O   1 
ATOM   2433 C  CB  . LEU B  1 8   ? 21.163  13.910  21.341 1.00 29.66  ? 8   LEU B CB  1 
ATOM   2434 C  CG  . LEU B  1 8   ? 22.280  14.720  22.027 1.00 32.38  ? 8   LEU B CG  1 
ATOM   2435 C  CD1 . LEU B  1 8   ? 22.858  13.916  23.200 1.00 38.32  ? 8   LEU B CD1 1 
ATOM   2436 C  CD2 . LEU B  1 8   ? 23.385  15.044  21.034 1.00 37.79  ? 8   LEU B CD2 1 
ATOM   2437 N  N   . SER B  1 9   ? 18.814  15.325  23.651 1.00 30.73  ? 9   SER B N   1 
ATOM   2438 C  CA  . SER B  1 9   ? 18.148  16.572  23.989 1.00 29.89  ? 9   SER B CA  1 
ATOM   2439 C  C   . SER B  1 9   ? 19.077  17.537  24.720 1.00 38.67  ? 9   SER B C   1 
ATOM   2440 O  O   . SER B  1 9   ? 19.533  17.270  25.839 1.00 35.00  ? 9   SER B O   1 
ATOM   2441 C  CB  . SER B  1 9   ? 16.909  16.280  24.841 1.00 22.90  ? 9   SER B CB  1 
ATOM   2442 O  OG  . SER B  1 9   ? 16.220  17.473  25.164 1.00 31.29  ? 9   SER B OG  1 
ATOM   2443 N  N   . ILE B  1 10  ? 19.345  18.667  24.073 1.00 37.89  ? 10  ILE B N   1 
ATOM   2444 C  CA  . ILE B  1 10  ? 20.219  19.699  24.616 1.00 28.05  ? 10  ILE B CA  1 
ATOM   2445 C  C   . ILE B  1 10  ? 19.408  20.891  25.092 1.00 34.26  ? 10  ILE B C   1 
ATOM   2446 O  O   . ILE B  1 10  ? 19.122  21.805  24.314 1.00 37.39  ? 10  ILE B O   1 
ATOM   2447 C  CB  . ILE B  1 10  ? 21.205  20.194  23.552 1.00 28.63  ? 10  ILE B CB  1 
ATOM   2448 C  CG1 . ILE B  1 10  ? 21.924  19.001  22.918 1.00 33.29  ? 10  ILE B CG1 1 
ATOM   2449 C  CG2 . ILE B  1 10  ? 22.192  21.166  24.183 1.00 32.13  ? 10  ILE B CG2 1 
ATOM   2450 C  CD1 . ILE B  1 10  ? 22.813  19.372  21.723 1.00 33.90  ? 10  ILE B CD1 1 
ATOM   2451 N  N   . GLN B  1 11  ? 19.039  20.879  26.370 1.00 27.70  ? 11  GLN B N   1 
ATOM   2452 C  CA  . GLN B  1 11  ? 18.241  21.958  26.945 1.00 29.23  ? 11  GLN B CA  1 
ATOM   2453 C  C   . GLN B  1 11  ? 18.562  22.244  28.416 1.00 38.87  ? 11  GLN B C   1 
ATOM   2454 O  O   . GLN B  1 11  ? 19.344  21.537  29.056 1.00 32.07  ? 11  GLN B O   1 
ATOM   2455 C  CB  . GLN B  1 11  ? 16.754  21.625  26.841 1.00 38.60  ? 11  GLN B CB  1 
ATOM   2456 C  CG  . GLN B  1 11  ? 16.254  21.229  25.450 1.00 27.82  ? 11  GLN B CG  1 
ATOM   2457 C  CD  . GLN B  1 11  ? 14.772  20.915  25.488 1.00 36.00  ? 11  GLN B CD  1 
ATOM   2458 O  OE1 . GLN B  1 11  ? 13.969  21.771  25.839 1.00 27.44  ? 11  GLN B OE1 1 
ATOM   2459 N  NE2 . GLN B  1 11  ? 14.406  19.681  25.151 1.00 33.40  ? 11  GLN B NE2 1 
ATOM   2460 N  N   . SER B  1 12  ? 17.911  23.279  28.937 1.00 29.70  ? 12  SER B N   1 
ATOM   2461 C  CA  . SER B  1 12  ? 18.068  23.722  30.312 1.00 34.86  ? 12  SER B CA  1 
ATOM   2462 C  C   . SER B  1 12  ? 17.591  22.716  31.341 1.00 37.93  ? 12  SER B C   1 
ATOM   2463 O  O   . SER B  1 12  ? 16.704  21.900  31.078 1.00 34.81  ? 12  SER B O   1 
ATOM   2464 C  CB  . SER B  1 12  ? 17.294  25.022  30.537 1.00 25.22  ? 12  SER B CB  1 
ATOM   2465 O  OG  . SER B  1 12  ? 17.756  26.051  29.683 1.00 49.40  ? 12  SER B OG  1 
ATOM   2466 N  N   . HIS B  1 13  ? 18.195  22.785  32.520 1.00 31.72  ? 13  HIS B N   1 
ATOM   2467 C  CA  . HIS B  1 13  ? 17.808  21.926  33.626 1.00 32.72  ? 13  HIS B CA  1 
ATOM   2468 C  C   . HIS B  1 13  ? 17.601  22.804  34.838 1.00 32.62  ? 13  HIS B C   1 
ATOM   2469 O  O   . HIS B  1 13  ? 18.330  23.778  35.036 1.00 35.85  ? 13  HIS B O   1 
ATOM   2470 C  CB  . HIS B  1 13  ? 18.884  20.885  33.935 1.00 41.73  ? 13  HIS B CB  1 
ATOM   2471 C  CG  . HIS B  1 13  ? 18.528  19.976  35.071 1.00 39.33  ? 13  HIS B CG  1 
ATOM   2472 N  ND1 . HIS B  1 13  ? 19.119  20.065  36.314 1.00 45.35  ? 13  HIS B ND1 1 
ATOM   2473 C  CD2 . HIS B  1 13  ? 17.625  18.969  35.157 1.00 29.74  ? 13  HIS B CD2 1 
ATOM   2474 C  CE1 . HIS B  1 13  ? 18.599  19.151  37.114 1.00 41.56  ? 13  HIS B CE1 1 
ATOM   2475 N  NE2 . HIS B  1 13  ? 17.690  18.472  36.437 1.00 37.35  ? 13  HIS B NE2 1 
ATOM   2476 N  N   . VAL B  1 14  ? 16.578  22.476  35.617 1.00 28.71  ? 14  VAL B N   1 
ATOM   2477 C  CA  . VAL B  1 14  ? 16.262  23.183  36.846 1.00 33.10  ? 14  VAL B CA  1 
ATOM   2478 C  C   . VAL B  1 14  ? 16.151  22.132  37.946 1.00 41.92  ? 14  VAL B C   1 
ATOM   2479 O  O   . VAL B  1 14  ? 15.809  20.977  37.673 1.00 36.03  ? 14  VAL B O   1 
ATOM   2480 C  CB  . VAL B  1 14  ? 14.916  23.934  36.762 1.00 31.60  ? 14  VAL B CB  1 
ATOM   2481 C  CG1 . VAL B  1 14  ? 15.049  25.151  35.854 1.00 29.46  ? 14  VAL B CG1 1 
ATOM   2482 C  CG2 . VAL B  1 14  ? 13.820  22.990  36.255 1.00 30.44  ? 14  VAL B CG2 1 
ATOM   2483 N  N   . ILE B  1 15  ? 16.455  22.527  39.178 1.00 34.88  ? 15  ILE B N   1 
ATOM   2484 C  CA  . ILE B  1 15  ? 16.369  21.619  40.316 1.00 36.21  ? 15  ILE B CA  1 
ATOM   2485 C  C   . ILE B  1 15  ? 14.889  21.423  40.630 1.00 25.19  ? 15  ILE B C   1 
ATOM   2486 O  O   . ILE B  1 15  ? 14.387  20.297  40.626 1.00 33.13  ? 15  ILE B O   1 
ATOM   2487 C  CB  . ILE B  1 15  ? 17.093  22.205  41.556 1.00 36.75  ? 15  ILE B CB  1 
ATOM   2488 C  CG1 . ILE B  1 15  ? 18.545  22.522  41.198 1.00 36.60  ? 15  ILE B CG1 1 
ATOM   2489 C  CG2 . ILE B  1 15  ? 17.021  21.226  42.727 1.00 29.89  ? 15  ILE B CG2 1 
ATOM   2490 C  CD1 . ILE B  1 15  ? 19.265  21.397  40.487 1.00 34.92  ? 15  ILE B CD1 1 
ATOM   2491 N  N   . ARG B  1 16  ? 14.201  22.529  40.905 1.00 32.09  ? 16  ARG B N   1 
ATOM   2492 C  CA  . ARG B  1 16  ? 12.766  22.510  41.176 1.00 35.00  ? 16  ARG B CA  1 
ATOM   2493 C  C   . ARG B  1 16  ? 12.029  22.942  39.904 1.00 46.15  ? 16  ARG B C   1 
ATOM   2494 O  O   . ARG B  1 16  ? 12.481  23.849  39.200 1.00 39.60  ? 16  ARG B O   1 
ATOM   2495 C  CB  . ARG B  1 16  ? 12.416  23.488  42.299 1.00 36.11  ? 16  ARG B CB  1 
ATOM   2496 C  CG  . ARG B  1 16  ? 10.909  23.672  42.543 1.00 33.02  ? 16  ARG B CG  1 
ATOM   2497 C  CD  . ARG B  1 16  ? 10.243  22.377  42.996 1.00 41.47  ? 16  ARG B CD  1 
ATOM   2498 N  NE  . ARG B  1 16  ? 10.727  21.963  44.308 1.00 45.19  ? 16  ARG B NE  1 
ATOM   2499 C  CZ  . ARG B  1 16  ? 10.208  22.363  45.466 1.00 45.01  ? 16  ARG B CZ  1 
ATOM   2500 N  NH1 . ARG B  1 16  ? 9.169   23.185  45.496 1.00 37.71  ? 16  ARG B NH1 1 
ATOM   2501 N  NH2 . ARG B  1 16  ? 10.752  21.960  46.600 1.00 43.43  ? 16  ARG B NH2 1 
ATOM   2502 N  N   . GLY B  1 17  ? 10.908  22.287  39.607 1.00 45.53  ? 17  GLY B N   1 
ATOM   2503 C  CA  . GLY B  1 17  ? 10.120  22.658  38.443 1.00 35.64  ? 17  GLY B CA  1 
ATOM   2504 C  C   . GLY B  1 17  ? 10.293  21.869  37.158 1.00 40.70  ? 17  GLY B C   1 
ATOM   2505 O  O   . GLY B  1 17  ? 11.116  20.954  37.074 1.00 30.74  ? 17  GLY B O   1 
ATOM   2506 N  N   . TYR B  1 18  ? 9.512   22.236  36.141 1.00 37.80  ? 18  TYR B N   1 
ATOM   2507 C  CA  . TYR B  1 18  ? 9.576   21.549  34.860 1.00 34.76  ? 18  TYR B CA  1 
ATOM   2508 C  C   . TYR B  1 18  ? 9.617   22.456  33.633 1.00 44.04  ? 18  TYR B C   1 
ATOM   2509 O  O   . TYR B  1 18  ? 8.596   23.006  33.211 1.00 34.77  ? 18  TYR B O   1 
ATOM   2510 C  CB  . TYR B  1 18  ? 8.405   20.569  34.734 1.00 33.21  ? 18  TYR B CB  1 
ATOM   2511 C  CG  . TYR B  1 18  ? 8.368   19.532  35.832 1.00 32.30  ? 18  TYR B CG  1 
ATOM   2512 C  CD1 . TYR B  1 18  ? 7.672   19.771  37.013 1.00 38.90  ? 18  TYR B CD1 1 
ATOM   2513 C  CD2 . TYR B  1 18  ? 9.084   18.339  35.718 1.00 35.47  ? 18  TYR B CD2 1 
ATOM   2514 C  CE1 . TYR B  1 18  ? 7.691   18.857  38.058 1.00 39.36  ? 18  TYR B CE1 1 
ATOM   2515 C  CE2 . TYR B  1 18  ? 9.113   17.412  36.763 1.00 34.54  ? 18  TYR B CE2 1 
ATOM   2516 C  CZ  . TYR B  1 18  ? 8.415   17.681  37.930 1.00 48.40  ? 18  TYR B CZ  1 
ATOM   2517 O  OH  . TYR B  1 18  ? 8.457   16.795  38.983 1.00 42.30  ? 18  TYR B OH  1 
ATOM   2518 N  N   . VAL B  1 19  ? 10.815  22.596  33.069 1.00 32.21  ? 19  VAL B N   1 
ATOM   2519 C  CA  . VAL B  1 19  ? 11.055  23.391  31.870 1.00 26.83  ? 19  VAL B CA  1 
ATOM   2520 C  C   . VAL B  1 19  ? 12.268  22.755  31.220 1.00 36.02  ? 19  VAL B C   1 
ATOM   2521 O  O   . VAL B  1 19  ? 13.005  22.034  31.882 1.00 32.94  ? 19  VAL B O   1 
ATOM   2522 C  CB  . VAL B  1 19  ? 11.391  24.869  32.199 1.00 38.68  ? 19  VAL B CB  1 
ATOM   2523 C  CG1 . VAL B  1 19  ? 10.228  25.500  32.928 1.00 36.58  ? 19  VAL B CG1 1 
ATOM   2524 C  CG2 . VAL B  1 19  ? 12.675  24.951  33.050 1.00 30.90  ? 19  VAL B CG2 1 
ATOM   2525 N  N   . GLY B  1 20  ? 12.475  23.020  29.935 1.00 30.25  ? 20  GLY B N   1 
ATOM   2526 C  CA  . GLY B  1 20  ? 13.609  22.443  29.249 1.00 33.26  ? 20  GLY B CA  1 
ATOM   2527 C  C   . GLY B  1 20  ? 13.647  20.928  29.355 1.00 34.75  ? 20  GLY B C   1 
ATOM   2528 O  O   . GLY B  1 20  ? 12.640  20.251  29.141 1.00 30.38  ? 20  GLY B O   1 
ATOM   2529 N  N   . ASN B  1 21  ? 14.815  20.391  29.686 1.00 31.04  ? 21  ASN B N   1 
ATOM   2530 C  CA  . ASN B  1 21  ? 14.967  18.953  29.806 1.00 32.36  ? 21  ASN B CA  1 
ATOM   2531 C  C   . ASN B  1 21  ? 14.108  18.324  30.885 1.00 26.08  ? 21  ASN B C   1 
ATOM   2532 O  O   . ASN B  1 21  ? 13.818  17.131  30.824 1.00 33.63  ? 21  ASN B O   1 
ATOM   2533 C  CB  . ASN B  1 21  ? 16.435  18.586  30.012 1.00 32.15  ? 21  ASN B CB  1 
ATOM   2534 C  CG  . ASN B  1 21  ? 17.152  18.371  28.699 1.00 33.79  ? 21  ASN B CG  1 
ATOM   2535 O  OD1 . ASN B  1 21  ? 16.538  17.936  27.730 1.00 35.40  ? 21  ASN B OD1 1 
ATOM   2536 N  ND2 . ASN B  1 21  ? 18.448  18.659  28.659 1.00 33.48  ? 21  ASN B ND2 1 
ATOM   2537 N  N   . ARG B  1 22  ? 13.696  19.117  31.870 1.00 28.43  ? 22  ARG B N   1 
ATOM   2538 C  CA  . ARG B  1 22  ? 12.837  18.604  32.927 1.00 27.97  ? 22  ARG B CA  1 
ATOM   2539 C  C   . ARG B  1 22  ? 11.427  18.397  32.360 1.00 34.12  ? 22  ARG B C   1 
ATOM   2540 O  O   . ARG B  1 22  ? 10.718  17.476  32.757 1.00 31.33  ? 22  ARG B O   1 
ATOM   2541 C  CB  . ARG B  1 22  ? 12.810  19.574  34.112 1.00 31.46  ? 22  ARG B CB  1 
ATOM   2542 C  CG  . ARG B  1 22  ? 14.047  19.457  35.018 1.00 37.62  ? 22  ARG B CG  1 
ATOM   2543 C  CD  . ARG B  1 22  ? 13.985  18.205  35.924 1.00 27.70  ? 22  ARG B CD  1 
ATOM   2544 N  NE  . ARG B  1 22  ? 13.010  18.380  37.003 1.00 29.55  ? 22  ARG B NE  1 
ATOM   2545 C  CZ  . ARG B  1 22  ? 12.814  17.525  38.002 1.00 30.25  ? 22  ARG B CZ  1 
ATOM   2546 N  NH1 . ARG B  1 22  ? 13.525  16.402  38.085 1.00 31.66  ? 22  ARG B NH1 1 
ATOM   2547 N  NH2 . ARG B  1 22  ? 11.906  17.802  38.927 1.00 28.75  ? 22  ARG B NH2 1 
ATOM   2548 N  N   . ALA B  1 23  ? 11.024  19.244  31.418 1.00 32.24  ? 23  ALA B N   1 
ATOM   2549 C  CA  . ALA B  1 23  ? 9.698   19.097  30.824 1.00 29.14  ? 23  ALA B CA  1 
ATOM   2550 C  C   . ALA B  1 23  ? 9.674   18.004  29.751 1.00 22.80  ? 23  ALA B C   1 
ATOM   2551 O  O   . ALA B  1 23  ? 8.683   17.309  29.602 1.00 34.87  ? 23  ALA B O   1 
ATOM   2552 C  CB  . ALA B  1 23  ? 9.232   20.423  30.228 1.00 33.42  ? 23  ALA B CB  1 
ATOM   2553 N  N   . ALA B  1 24  ? 10.787  17.834  29.039 1.00 27.06  ? 24  ALA B N   1 
ATOM   2554 C  CA  . ALA B  1 24  ? 10.884  16.868  27.948 1.00 27.73  ? 24  ALA B CA  1 
ATOM   2555 C  C   . ALA B  1 24  ? 11.335  15.448  28.259 1.00 38.80  ? 24  ALA B C   1 
ATOM   2556 O  O   . ALA B  1 24  ? 10.948  14.516  27.559 1.00 29.51  ? 24  ALA B O   1 
ATOM   2557 C  CB  . ALA B  1 24  ? 11.802  17.428  26.864 1.00 24.79  ? 24  ALA B CB  1 
ATOM   2558 N  N   . THR B  1 25  ? 12.166  15.280  29.282 1.00 32.75  ? 25  THR B N   1 
ATOM   2559 C  CA  . THR B  1 25  ? 12.704  13.966  29.609 1.00 29.37  ? 25  THR B CA  1 
ATOM   2560 C  C   . THR B  1 25  ? 11.734  12.910  30.117 1.00 23.40  ? 25  THR B C   1 
ATOM   2561 O  O   . THR B  1 25  ? 11.602  11.854  29.507 1.00 30.89  ? 25  THR B O   1 
ATOM   2562 C  CB  . THR B  1 25  ? 13.868  14.096  30.613 1.00 36.58  ? 25  THR B CB  1 
ATOM   2563 O  OG1 . THR B  1 25  ? 14.877  14.943  30.048 1.00 30.73  ? 25  THR B OG1 1 
ATOM   2564 C  CG2 . THR B  1 25  ? 14.480  12.727  30.907 1.00 24.22  ? 25  THR B CG2 1 
ATOM   2565 N  N   . PHE B  1 26  ? 11.065  13.181  31.232 1.00 29.28  ? 26  PHE B N   1 
ATOM   2566 C  CA  . PHE B  1 26  ? 10.128  12.210  31.785 1.00 28.03  ? 26  PHE B CA  1 
ATOM   2567 C  C   . PHE B  1 26  ? 9.098   11.702  30.753 1.00 31.52  ? 26  PHE B C   1 
ATOM   2568 O  O   . PHE B  1 26  ? 8.955   10.493  30.557 1.00 37.11  ? 26  PHE B O   1 
ATOM   2569 C  CB  . PHE B  1 26  ? 9.404   12.807  32.993 1.00 33.47  ? 26  PHE B CB  1 
ATOM   2570 C  CG  . PHE B  1 26  ? 8.403   11.878  33.625 1.00 36.03  ? 26  PHE B CG  1 
ATOM   2571 C  CD1 . PHE B  1 26  ? 8.808   10.670  34.190 1.00 39.82  ? 26  PHE B CD1 1 
ATOM   2572 C  CD2 . PHE B  1 26  ? 7.057   12.214  33.664 1.00 29.31  ? 26  PHE B CD2 1 
ATOM   2573 C  CE1 . PHE B  1 26  ? 7.883   9.808   34.789 1.00 39.86  ? 26  PHE B CE1 1 
ATOM   2574 C  CE2 . PHE B  1 26  ? 6.119   11.359  34.260 1.00 35.08  ? 26  PHE B CE2 1 
ATOM   2575 C  CZ  . PHE B  1 26  ? 6.536   10.155  34.823 1.00 36.91  ? 26  PHE B CZ  1 
ATOM   2576 N  N   . PRO B  1 27  ? 8.375   12.616  30.081 1.00 30.49  ? 27  PRO B N   1 
ATOM   2577 C  CA  . PRO B  1 27  ? 7.376   12.193  29.089 1.00 27.61  ? 27  PRO B CA  1 
ATOM   2578 C  C   . PRO B  1 27  ? 7.951   11.250  28.034 1.00 27.06  ? 27  PRO B C   1 
ATOM   2579 O  O   . PRO B  1 27  ? 7.385   10.199  27.755 1.00 31.03  ? 27  PRO B O   1 
ATOM   2580 C  CB  . PRO B  1 27  ? 6.925   13.511  28.460 1.00 33.19  ? 27  PRO B CB  1 
ATOM   2581 C  CG  . PRO B  1 27  ? 7.183   14.522  29.522 1.00 33.85  ? 27  PRO B CG  1 
ATOM   2582 C  CD  . PRO B  1 27  ? 8.484   14.085  30.120 1.00 30.98  ? 27  PRO B CD  1 
ATOM   2583 N  N   . LEU B  1 28  ? 9.077   11.638  27.440 1.00 28.38  ? 28  LEU B N   1 
ATOM   2584 C  CA  . LEU B  1 28  ? 9.698   10.817  26.412 1.00 32.32  ? 28  LEU B CA  1 
ATOM   2585 C  C   . LEU B  1 28  ? 10.193  9.476   26.941 1.00 32.58  ? 28  LEU B C   1 
ATOM   2586 O  O   . LEU B  1 28  ? 10.142  8.471   26.229 1.00 36.74  ? 28  LEU B O   1 
ATOM   2587 C  CB  . LEU B  1 28  ? 10.844  11.585  25.738 1.00 25.00  ? 28  LEU B CB  1 
ATOM   2588 C  CG  . LEU B  1 28  ? 10.375  12.680  24.769 1.00 40.61  ? 28  LEU B CG  1 
ATOM   2589 C  CD1 . LEU B  1 28  ? 11.556  13.483  24.238 1.00 24.46  ? 28  LEU B CD1 1 
ATOM   2590 C  CD2 . LEU B  1 28  ? 9.610   12.026  23.626 1.00 34.67  ? 28  LEU B CD2 1 
ATOM   2591 N  N   . GLN B  1 29  ? 10.678  9.454   28.182 1.00 34.12  ? 29  GLN B N   1 
ATOM   2592 C  CA  . GLN B  1 29  ? 11.150  8.200   28.773 1.00 41.01  ? 29  GLN B CA  1 
ATOM   2593 C  C   . GLN B  1 29  ? 9.922   7.310   28.989 1.00 24.40  ? 29  GLN B C   1 
ATOM   2594 O  O   . GLN B  1 29  ? 9.944   6.109   28.725 1.00 27.66  ? 29  GLN B O   1 
ATOM   2595 C  CB  . GLN B  1 29  ? 11.853  8.460   30.116 1.00 29.43  ? 29  GLN B CB  1 
ATOM   2596 C  CG  . GLN B  1 29  ? 13.205  9.185   30.006 1.00 27.55  ? 29  GLN B CG  1 
ATOM   2597 C  CD  . GLN B  1 29  ? 13.886  9.362   31.358 1.00 38.07  ? 29  GLN B CD  1 
ATOM   2598 O  OE1 . GLN B  1 29  ? 13.304  9.904   32.294 1.00 28.84  ? 29  GLN B OE1 1 
ATOM   2599 N  NE2 . GLN B  1 29  ? 15.127  8.900   31.461 1.00 34.80  ? 29  GLN B NE2 1 
ATOM   2600 N  N   . VAL B  1 30  ? 8.850   7.923   29.472 1.00 30.36  ? 30  VAL B N   1 
ATOM   2601 C  CA  . VAL B  1 30  ? 7.603   7.218   29.714 1.00 29.64  ? 30  VAL B CA  1 
ATOM   2602 C  C   . VAL B  1 30  ? 7.096   6.580   28.412 1.00 42.90  ? 30  VAL B C   1 
ATOM   2603 O  O   . VAL B  1 30  ? 6.507   5.496   28.423 1.00 39.83  ? 30  VAL B O   1 
ATOM   2604 C  CB  . VAL B  1 30  ? 6.544   8.195   30.284 1.00 34.97  ? 30  VAL B CB  1 
ATOM   2605 C  CG1 . VAL B  1 30  ? 5.136   7.660   30.044 1.00 33.20  ? 30  VAL B CG1 1 
ATOM   2606 C  CG2 . VAL B  1 30  ? 6.785   8.394   31.788 1.00 25.20  ? 30  VAL B CG2 1 
ATOM   2607 N  N   . LEU B  1 31  ? 7.344   7.249   27.290 1.00 40.65  ? 31  LEU B N   1 
ATOM   2608 C  CA  . LEU B  1 31  ? 6.909   6.747   25.992 1.00 43.83  ? 31  LEU B CA  1 
ATOM   2609 C  C   . LEU B  1 31  ? 7.897   5.772   25.371 1.00 44.64  ? 31  LEU B C   1 
ATOM   2610 O  O   . LEU B  1 31  ? 7.743   5.390   24.214 1.00 41.02  ? 31  LEU B O   1 
ATOM   2611 C  CB  . LEU B  1 31  ? 6.638   7.913   25.033 1.00 30.67  ? 31  LEU B CB  1 
ATOM   2612 C  CG  . LEU B  1 31  ? 5.356   8.664   25.401 1.00 44.55  ? 31  LEU B CG  1 
ATOM   2613 C  CD1 . LEU B  1 31  ? 5.194   9.919   24.537 1.00 34.21  ? 31  LEU B CD1 1 
ATOM   2614 C  CD2 . LEU B  1 31  ? 4.167   7.709   25.229 1.00 34.65  ? 31  LEU B CD2 1 
ATOM   2615 N  N   . GLY B  1 32  ? 8.917   5.387   26.136 1.00 39.10  ? 32  GLY B N   1 
ATOM   2616 C  CA  . GLY B  1 32  ? 9.890   4.421   25.647 1.00 27.25  ? 32  GLY B CA  1 
ATOM   2617 C  C   . GLY B  1 32  ? 11.097  4.900   24.863 1.00 27.54  ? 32  GLY B C   1 
ATOM   2618 O  O   . GLY B  1 32  ? 11.822  4.083   24.289 1.00 35.15  ? 32  GLY B O   1 
ATOM   2619 N  N   . PHE B  1 33  ? 11.335  6.206   24.822 1.00 28.74  ? 33  PHE B N   1 
ATOM   2620 C  CA  . PHE B  1 33  ? 12.492  6.702   24.087 1.00 28.11  ? 33  PHE B CA  1 
ATOM   2621 C  C   . PHE B  1 33  ? 13.732  6.708   24.981 1.00 35.72  ? 33  PHE B C   1 
ATOM   2622 O  O   . PHE B  1 33  ? 13.643  6.982   26.177 1.00 35.16  ? 33  PHE B O   1 
ATOM   2623 C  CB  . PHE B  1 33  ? 12.255  8.133   23.571 1.00 36.71  ? 33  PHE B CB  1 
ATOM   2624 C  CG  . PHE B  1 33  ? 11.202  8.236   22.491 1.00 36.73  ? 33  PHE B CG  1 
ATOM   2625 C  CD1 . PHE B  1 33  ? 9.849   8.194   22.809 1.00 21.99  ? 33  PHE B CD1 1 
ATOM   2626 C  CD2 . PHE B  1 33  ? 11.570  8.369   21.157 1.00 38.53  ? 33  PHE B CD2 1 
ATOM   2627 C  CE1 . PHE B  1 33  ? 8.871   8.285   21.809 1.00 29.94  ? 33  PHE B CE1 1 
ATOM   2628 C  CE2 . PHE B  1 33  ? 10.599  8.458   20.149 1.00 37.07  ? 33  PHE B CE2 1 
ATOM   2629 C  CZ  . PHE B  1 33  ? 9.251   8.415   20.479 1.00 32.22  ? 33  PHE B CZ  1 
ATOM   2630 N  N   . GLU B  1 34  ? 14.879  6.387   24.393 1.00 32.70  ? 34  GLU B N   1 
ATOM   2631 C  CA  . GLU B  1 34  ? 16.150  6.409   25.102 1.00 38.16  ? 34  GLU B CA  1 
ATOM   2632 C  C   . GLU B  1 34  ? 16.629  7.851   24.997 1.00 32.94  ? 34  GLU B C   1 
ATOM   2633 O  O   . GLU B  1 34  ? 17.462  8.169   24.154 1.00 33.65  ? 34  GLU B O   1 
ATOM   2634 C  CB  . GLU B  1 34  ? 17.172  5.492   24.417 1.00 31.29  ? 34  GLU B CB  1 
ATOM   2635 C  CG  . GLU B  1 34  ? 17.068  4.019   24.782 1.00 44.82  ? 34  GLU B CG  1 
ATOM   2636 C  CD  . GLU B  1 34  ? 17.344  3.765   26.252 1.00 45.99  ? 34  GLU B CD  1 
ATOM   2637 O  OE1 . GLU B  1 34  ? 18.007  4.607   26.887 1.00 45.17  ? 34  GLU B OE1 1 
ATOM   2638 O  OE2 . GLU B  1 34  ? 16.909  2.718   26.769 1.00 60.62  ? 34  GLU B OE2 1 
ATOM   2639 N  N   . ILE B  1 35  ? 16.096  8.736   25.827 1.00 35.69  ? 35  ILE B N   1 
ATOM   2640 C  CA  . ILE B  1 35  ? 16.523  10.125  25.739 1.00 34.95  ? 35  ILE B CA  1 
ATOM   2641 C  C   . ILE B  1 35  ? 17.693  10.468  26.643 1.00 34.99  ? 35  ILE B C   1 
ATOM   2642 O  O   . ILE B  1 35  ? 17.657  10.241  27.858 1.00 36.80  ? 35  ILE B O   1 
ATOM   2643 C  CB  . ILE B  1 35  ? 15.366  11.105  26.029 1.00 39.17  ? 35  ILE B CB  1 
ATOM   2644 C  CG1 . ILE B  1 35  ? 15.921  12.533  26.131 1.00 30.29  ? 35  ILE B CG1 1 
ATOM   2645 C  CG2 . ILE B  1 35  ? 14.631  10.689  27.288 1.00 28.61  ? 35  ILE B CG2 1 
ATOM   2646 C  CD1 . ILE B  1 35  ? 14.870  13.615  26.061 1.00 27.33  ? 35  ILE B CD1 1 
ATOM   2647 N  N   . ASP B  1 36  ? 18.733  11.005  26.018 1.00 31.34  ? 36  ASP B N   1 
ATOM   2648 C  CA  . ASP B  1 36  ? 19.950  11.420  26.696 1.00 35.21  ? 36  ASP B CA  1 
ATOM   2649 C  C   . ASP B  1 36  ? 19.824  12.924  26.850 1.00 35.97  ? 36  ASP B C   1 
ATOM   2650 O  O   . ASP B  1 36  ? 19.515  13.630  25.886 1.00 35.90  ? 36  ASP B O   1 
ATOM   2651 C  CB  . ASP B  1 36  ? 21.186  11.074  25.849 1.00 29.40  ? 36  ASP B CB  1 
ATOM   2652 C  CG  . ASP B  1 36  ? 21.375  9.570   25.669 1.00 37.92  ? 36  ASP B CG  1 
ATOM   2653 O  OD1 . ASP B  1 36  ? 20.748  8.788   26.411 1.00 41.67  ? 36  ASP B OD1 1 
ATOM   2654 O  OD2 . ASP B  1 36  ? 22.159  9.165   24.790 1.00 39.23  ? 36  ASP B OD2 1 
ATOM   2655 N  N   . ALA B  1 37  ? 20.060  13.421  28.056 1.00 36.36  ? 37  ALA B N   1 
ATOM   2656 C  CA  . ALA B  1 37  ? 19.922  14.844  28.309 1.00 30.40  ? 37  ALA B CA  1 
ATOM   2657 C  C   . ALA B  1 37  ? 21.215  15.607  28.576 1.00 38.41  ? 37  ALA B C   1 
ATOM   2658 O  O   . ALA B  1 37  ? 21.922  15.329  29.545 1.00 39.69  ? 37  ALA B O   1 
ATOM   2659 C  CB  . ALA B  1 37  ? 18.962  15.051  29.468 1.00 30.06  ? 37  ALA B CB  1 
ATOM   2660 N  N   . VAL B  1 38  ? 21.521  16.561  27.702 1.00 33.87  ? 38  VAL B N   1 
ATOM   2661 C  CA  . VAL B  1 38  ? 22.685  17.420  27.880 1.00 35.05  ? 38  VAL B CA  1 
ATOM   2662 C  C   . VAL B  1 38  ? 22.100  18.694  28.485 1.00 39.51  ? 38  VAL B C   1 
ATOM   2663 O  O   . VAL B  1 38  ? 21.320  19.399  27.838 1.00 40.83  ? 38  VAL B O   1 
ATOM   2664 C  CB  . VAL B  1 38  ? 23.370  17.761  26.542 1.00 33.16  ? 38  VAL B CB  1 
ATOM   2665 C  CG1 . VAL B  1 38  ? 24.493  18.754  26.775 1.00 36.54  ? 38  VAL B CG1 1 
ATOM   2666 C  CG2 . VAL B  1 38  ? 23.922  16.509  25.906 1.00 34.50  ? 38  VAL B CG2 1 
ATOM   2667 N  N   . ASN B  1 39  ? 22.451  18.981  29.733 1.00 33.79  ? 39  ASN B N   1 
ATOM   2668 C  CA  . ASN B  1 39  ? 21.923  20.166  30.397 1.00 30.04  ? 39  ASN B CA  1 
ATOM   2669 C  C   . ASN B  1 39  ? 22.735  21.410  30.045 1.00 36.57  ? 39  ASN B C   1 
ATOM   2670 O  O   . ASN B  1 39  ? 23.896  21.523  30.418 1.00 37.15  ? 39  ASN B O   1 
ATOM   2671 C  CB  . ASN B  1 39  ? 21.889  19.930  31.909 1.00 35.10  ? 39  ASN B CB  1 
ATOM   2672 C  CG  . ASN B  1 39  ? 21.039  18.729  32.283 1.00 46.76  ? 39  ASN B CG  1 
ATOM   2673 O  OD1 . ASN B  1 39  ? 19.935  18.552  31.758 1.00 37.47  ? 39  ASN B OD1 1 
ATOM   2674 N  ND2 . ASN B  1 39  ? 21.544  17.897  33.191 1.00 32.00  ? 39  ASN B ND2 1 
ATOM   2675 N  N   . SER B  1 40  ? 22.114  22.326  29.302 1.00 37.56  ? 40  SER B N   1 
ATOM   2676 C  CA  . SER B  1 40  ? 22.766  23.556  28.862 1.00 37.96  ? 40  SER B CA  1 
ATOM   2677 C  C   . SER B  1 40  ? 22.900  24.585  29.982 1.00 33.63  ? 40  SER B C   1 
ATOM   2678 O  O   . SER B  1 40  ? 23.640  25.557  29.850 1.00 38.78  ? 40  SER B O   1 
ATOM   2679 C  CB  . SER B  1 40  ? 22.006  24.163  27.675 1.00 31.25  ? 40  SER B CB  1 
ATOM   2680 O  OG  . SER B  1 40  ? 20.676  24.483  28.034 1.00 34.92  ? 40  SER B OG  1 
ATOM   2681 N  N   . VAL B  1 41  ? 22.150  24.379  31.061 1.00 31.30  ? 41  VAL B N   1 
ATOM   2682 C  CA  . VAL B  1 41  ? 22.209  25.228  32.249 1.00 35.18  ? 41  VAL B CA  1 
ATOM   2683 C  C   . VAL B  1 41  ? 21.638  24.451  33.435 1.00 40.95  ? 41  VAL B C   1 
ATOM   2684 O  O   . VAL B  1 41  ? 20.809  23.555  33.261 1.00 40.31  ? 41  VAL B O   1 
ATOM   2685 C  CB  . VAL B  1 41  ? 21.370  26.540  32.135 1.00 43.36  ? 41  VAL B CB  1 
ATOM   2686 C  CG1 . VAL B  1 41  ? 21.612  27.219  30.808 1.00 47.71  ? 41  VAL B CG1 1 
ATOM   2687 C  CG2 . VAL B  1 41  ? 19.893  26.245  32.352 1.00 41.60  ? 41  VAL B CG2 1 
ATOM   2688 N  N   . GLN B  1 42  ? 22.095  24.779  34.639 1.00 36.62  ? 42  GLN B N   1 
ATOM   2689 C  CA  . GLN B  1 42  ? 21.558  24.149  35.835 1.00 35.12  ? 42  GLN B CA  1 
ATOM   2690 C  C   . GLN B  1 42  ? 21.205  25.261  36.813 1.00 37.49  ? 42  GLN B C   1 
ATOM   2691 O  O   . GLN B  1 42  ? 22.072  25.871  37.440 1.00 39.25  ? 42  GLN B O   1 
ATOM   2692 C  CB  . GLN B  1 42  ? 22.543  23.154  36.478 1.00 31.38  ? 42  GLN B CB  1 
ATOM   2693 C  CG  . GLN B  1 42  ? 21.975  22.566  37.779 1.00 29.99  ? 42  GLN B CG  1 
ATOM   2694 C  CD  . GLN B  1 42  ? 22.652  21.283  38.221 1.00 38.64  ? 42  GLN B CD  1 
ATOM   2695 O  OE1 . GLN B  1 42  ? 21.987  20.363  38.696 1.00 34.66  ? 42  GLN B OE1 1 
ATOM   2696 N  NE2 . GLN B  1 42  ? 23.974  21.214  38.076 1.00 36.95  ? 42  GLN B NE2 1 
ATOM   2697 N  N   . PHE B  1 43  ? 19.913  25.526  36.917 1.00 31.57  ? 43  PHE B N   1 
ATOM   2698 C  CA  . PHE B  1 43  ? 19.400  26.564  37.784 1.00 29.00  ? 43  PHE B CA  1 
ATOM   2699 C  C   . PHE B  1 43  ? 18.514  25.960  38.838 1.00 33.56  ? 43  PHE B C   1 
ATOM   2700 O  O   . PHE B  1 43  ? 18.009  24.842  38.683 1.00 33.70  ? 43  PHE B O   1 
ATOM   2701 C  CB  . PHE B  1 43  ? 18.612  27.588  36.958 1.00 36.09  ? 43  PHE B CB  1 
ATOM   2702 C  CG  . PHE B  1 43  ? 19.479  28.593  36.264 1.00 34.05  ? 43  PHE B CG  1 
ATOM   2703 C  CD1 . PHE B  1 43  ? 20.632  28.195  35.600 1.00 34.45  ? 43  PHE B CD1 1 
ATOM   2704 C  CD2 . PHE B  1 43  ? 19.169  29.949  36.314 1.00 52.76  ? 43  PHE B CD2 1 
ATOM   2705 C  CE1 . PHE B  1 43  ? 21.471  29.132  35.001 1.00 44.17  ? 43  PHE B CE1 1 
ATOM   2706 C  CE2 . PHE B  1 43  ? 20.000  30.894  35.719 1.00 58.82  ? 43  PHE B CE2 1 
ATOM   2707 C  CZ  . PHE B  1 43  ? 21.154  30.484  35.063 1.00 49.86  ? 43  PHE B CZ  1 
ATOM   2708 N  N   . SER B  1 44  ? 18.314  26.716  39.909 1.00 36.77  ? 44  SER B N   1 
ATOM   2709 C  CA  . SER B  1 44  ? 17.495  26.264  41.020 1.00 38.76  ? 44  SER B CA  1 
ATOM   2710 C  C   . SER B  1 44  ? 16.045  26.091  40.611 1.00 34.77  ? 44  SER B C   1 
ATOM   2711 O  O   . SER B  1 44  ? 15.345  25.209  41.119 1.00 33.44  ? 44  SER B O   1 
ATOM   2712 C  CB  . SER B  1 44  ? 17.583  27.272  42.169 1.00 41.25  ? 44  SER B CB  1 
ATOM   2713 O  OG  . SER B  1 44  ? 17.215  28.570  41.733 1.00 40.65  ? 44  SER B OG  1 
ATOM   2714 N  N   . ASN B  1 45  ? 15.608  26.940  39.686 1.00 33.77  ? 45  ASN B N   1 
ATOM   2715 C  CA  . ASN B  1 45  ? 14.234  26.950  39.201 1.00 37.19  ? 45  ASN B CA  1 
ATOM   2716 C  C   . ASN B  1 45  ? 14.195  27.856  37.967 1.00 35.14  ? 45  ASN B C   1 
ATOM   2717 O  O   . ASN B  1 45  ? 15.198  28.481  37.642 1.00 31.15  ? 45  ASN B O   1 
ATOM   2718 C  CB  . ASN B  1 45  ? 13.336  27.521  40.293 1.00 36.15  ? 45  ASN B CB  1 
ATOM   2719 C  CG  . ASN B  1 45  ? 13.940  28.763  40.939 1.00 45.38  ? 45  ASN B CG  1 
ATOM   2720 O  OD1 . ASN B  1 45  ? 14.615  28.681  41.968 1.00 40.15  ? 45  ASN B OD1 1 
ATOM   2721 N  ND2 . ASN B  1 45  ? 13.726  29.914  40.315 1.00 36.11  ? 45  ASN B ND2 1 
ATOM   2722 N  N   . HIS B  1 46  ? 13.056  27.955  37.283 1.00 35.17  ? 46  HIS B N   1 
ATOM   2723 C  CA  . HIS B  1 46  ? 13.024  28.810  36.091 1.00 32.47  ? 46  HIS B CA  1 
ATOM   2724 C  C   . HIS B  1 46  ? 13.062  30.306  36.433 1.00 40.56  ? 46  HIS B C   1 
ATOM   2725 O  O   . HIS B  1 46  ? 12.664  30.718  37.528 1.00 41.91  ? 46  HIS B O   1 
ATOM   2726 C  CB  . HIS B  1 46  ? 11.823  28.457  35.181 1.00 34.38  ? 46  HIS B CB  1 
ATOM   2727 C  CG  . HIS B  1 46  ? 10.481  28.838  35.726 1.00 23.01  ? 46  HIS B CG  1 
ATOM   2728 N  ND1 . HIS B  1 46  ? 10.098  30.148  35.920 1.00 29.13  ? 46  HIS B ND1 1 
ATOM   2729 C  CD2 . HIS B  1 46  ? 9.407   28.081  36.056 1.00 28.07  ? 46  HIS B CD2 1 
ATOM   2730 C  CE1 . HIS B  1 46  ? 8.847   30.182  36.345 1.00 29.29  ? 46  HIS B CE1 1 
ATOM   2731 N  NE2 . HIS B  1 46  ? 8.404   28.941  36.436 1.00 31.94  ? 46  HIS B NE2 1 
ATOM   2732 N  N   . THR B  1 47  ? 13.557  31.112  35.496 1.00 41.98  ? 47  THR B N   1 
ATOM   2733 C  CA  . THR B  1 47  ? 13.694  32.554  35.703 1.00 39.25  ? 47  THR B CA  1 
ATOM   2734 C  C   . THR B  1 47  ? 12.399  33.334  35.898 1.00 45.46  ? 47  THR B C   1 
ATOM   2735 O  O   . THR B  1 47  ? 12.429  34.555  36.008 1.00 40.53  ? 47  THR B O   1 
ATOM   2736 C  CB  . THR B  1 47  ? 14.482  33.209  34.555 1.00 37.37  ? 47  THR B CB  1 
ATOM   2737 O  OG1 . THR B  1 47  ? 13.754  33.068  33.330 1.00 48.25  ? 47  THR B OG1 1 
ATOM   2738 C  CG2 . THR B  1 47  ? 15.851  32.546  34.406 1.00 36.05  ? 47  THR B CG2 1 
ATOM   2739 N  N   . GLY B  1 48  ? 11.269  32.635  35.949 1.00 47.94  ? 48  GLY B N   1 
ATOM   2740 C  CA  . GLY B  1 48  ? 9.994   33.305  36.150 1.00 43.49  ? 48  GLY B CA  1 
ATOM   2741 C  C   . GLY B  1 48  ? 9.702   33.571  37.619 1.00 49.61  ? 48  GLY B C   1 
ATOM   2742 O  O   . GLY B  1 48  ? 8.800   34.337  37.955 1.00 53.75  ? 48  GLY B O   1 
ATOM   2743 N  N   . TYR B  1 49  ? 10.457  32.924  38.502 1.00 43.66  ? 49  TYR B N   1 
ATOM   2744 C  CA  . TYR B  1 49  ? 10.280  33.109  39.939 1.00 42.84  ? 49  TYR B CA  1 
ATOM   2745 C  C   . TYR B  1 49  ? 10.932  34.416  40.356 1.00 36.80  ? 49  TYR B C   1 
ATOM   2746 O  O   . TYR B  1 49  ? 11.703  34.997  39.605 1.00 38.06  ? 49  TYR B O   1 
ATOM   2747 C  CB  . TYR B  1 49  ? 10.946  31.979  40.729 1.00 44.97  ? 49  TYR B CB  1 
ATOM   2748 C  CG  . TYR B  1 49  ? 10.230  30.651  40.699 1.00 45.70  ? 49  TYR B CG  1 
ATOM   2749 C  CD1 . TYR B  1 49  ? 10.328  29.802  39.596 1.00 40.93  ? 49  TYR B CD1 1 
ATOM   2750 C  CD2 . TYR B  1 49  ? 9.490   30.222  41.797 1.00 43.51  ? 49  TYR B CD2 1 
ATOM   2751 C  CE1 . TYR B  1 49  ? 9.714   28.555  39.595 1.00 36.04  ? 49  TYR B CE1 1 
ATOM   2752 C  CE2 . TYR B  1 49  ? 8.869   28.976  41.806 1.00 49.66  ? 49  TYR B CE2 1 
ATOM   2753 C  CZ  . TYR B  1 49  ? 8.988   28.149  40.704 1.00 46.88  ? 49  TYR B CZ  1 
ATOM   2754 O  OH  . TYR B  1 49  ? 8.389   26.916  40.721 1.00 42.89  ? 49  TYR B OH  1 
ATOM   2755 N  N   . ALA B  1 50  ? 10.632  34.867  41.566 1.00 42.86  ? 50  ALA B N   1 
ATOM   2756 C  CA  . ALA B  1 50  ? 11.216  36.096  42.072 1.00 44.87  ? 50  ALA B CA  1 
ATOM   2757 C  C   . ALA B  1 50  ? 12.728  35.927  42.202 1.00 44.93  ? 50  ALA B C   1 
ATOM   2758 O  O   . ALA B  1 50  ? 13.478  36.878  42.010 1.00 48.35  ? 50  ALA B O   1 
ATOM   2759 C  CB  . ALA B  1 50  ? 10.608  36.442  43.426 1.00 39.39  ? 50  ALA B CB  1 
ATOM   2760 N  N   . HIS B  1 51  ? 13.170  34.709  42.512 1.00 39.87  ? 51  HIS B N   1 
ATOM   2761 C  CA  . HIS B  1 51  ? 14.597  34.428  42.682 1.00 43.25  ? 51  HIS B CA  1 
ATOM   2762 C  C   . HIS B  1 51  ? 15.062  33.218  41.878 1.00 45.32  ? 51  HIS B C   1 
ATOM   2763 O  O   . HIS B  1 51  ? 14.284  32.310  41.587 1.00 46.38  ? 51  HIS B O   1 
ATOM   2764 C  CB  . HIS B  1 51  ? 14.911  34.163  44.157 1.00 43.50  ? 51  HIS B CB  1 
ATOM   2765 C  CG  . HIS B  1 51  ? 14.407  35.220  45.090 1.00 47.42  ? 51  HIS B CG  1 
ATOM   2766 N  ND1 . HIS B  1 51  ? 15.088  36.396  45.323 1.00 47.13  ? 51  HIS B ND1 1 
ATOM   2767 C  CD2 . HIS B  1 51  ? 13.291  35.273  45.854 1.00 51.12  ? 51  HIS B CD2 1 
ATOM   2768 C  CE1 . HIS B  1 51  ? 14.413  37.127  46.192 1.00 45.68  ? 51  HIS B CE1 1 
ATOM   2769 N  NE2 . HIS B  1 51  ? 13.318  36.469  46.530 1.00 50.92  ? 51  HIS B NE2 1 
ATOM   2770 N  N   . TRP B  1 52  ? 16.346  33.214  41.536 1.00 39.31  ? 52  TRP B N   1 
ATOM   2771 C  CA  . TRP B  1 52  ? 16.953  32.119  40.796 1.00 42.06  ? 52  TRP B CA  1 
ATOM   2772 C  C   . TRP B  1 52  ? 18.463  32.266  40.753 1.00 40.05  ? 52  TRP B C   1 
ATOM   2773 O  O   . TRP B  1 52  ? 18.989  33.375  40.701 1.00 41.80  ? 52  TRP B O   1 
ATOM   2774 C  CB  . TRP B  1 52  ? 16.407  32.036  39.363 1.00 37.30  ? 52  TRP B CB  1 
ATOM   2775 C  CG  . TRP B  1 52  ? 16.287  33.362  38.656 1.00 33.79  ? 52  TRP B CG  1 
ATOM   2776 C  CD1 . TRP B  1 52  ? 15.206  34.191  38.654 1.00 39.06  ? 52  TRP B CD1 1 
ATOM   2777 C  CD2 . TRP B  1 52  ? 17.286  34.006  37.859 1.00 30.33  ? 52  TRP B CD2 1 
ATOM   2778 N  NE1 . TRP B  1 52  ? 15.465  35.312  37.903 1.00 42.69  ? 52  TRP B NE1 1 
ATOM   2779 C  CE2 . TRP B  1 52  ? 16.738  35.225  37.405 1.00 29.99  ? 52  TRP B CE2 1 
ATOM   2780 C  CE3 . TRP B  1 52  ? 18.594  33.673  37.485 1.00 44.02  ? 52  TRP B CE3 1 
ATOM   2781 C  CZ2 . TRP B  1 52  ? 17.451  36.115  36.597 1.00 42.50  ? 52  TRP B CZ2 1 
ATOM   2782 C  CZ3 . TRP B  1 52  ? 19.306  34.561  36.679 1.00 40.53  ? 52  TRP B CZ3 1 
ATOM   2783 C  CH2 . TRP B  1 52  ? 18.731  35.765  36.246 1.00 51.11  ? 52  TRP B CH2 1 
ATOM   2784 N  N   . LYS B  1 53  ? 19.149  31.128  40.776 1.00 36.30  ? 53  LYS B N   1 
ATOM   2785 C  CA  . LYS B  1 53  ? 20.602  31.079  40.726 1.00 31.46  ? 53  LYS B CA  1 
ATOM   2786 C  C   . LYS B  1 53  ? 20.988  29.790  40.026 1.00 34.00  ? 53  LYS B C   1 
ATOM   2787 O  O   . LYS B  1 53  ? 20.215  28.831  40.019 1.00 33.74  ? 53  LYS B O   1 
ATOM   2788 C  CB  . LYS B  1 53  ? 21.199  31.081  42.140 1.00 44.26  ? 53  LYS B CB  1 
ATOM   2789 C  CG  . LYS B  1 53  ? 20.971  32.355  42.936 1.00 41.96  ? 53  LYS B CG  1 
ATOM   2790 C  CD  . LYS B  1 53  ? 21.831  32.355  44.194 1.00 69.36  ? 53  LYS B CD  1 
ATOM   2791 C  CE  . LYS B  1 53  ? 21.695  33.648  44.989 1.00 67.89  ? 53  LYS B CE  1 
ATOM   2792 N  NZ  . LYS B  1 53  ? 22.191  34.828  44.233 1.00 73.33  ? 53  LYS B NZ  1 
ATOM   2793 N  N   . GLY B  1 54  ? 22.175  29.764  39.429 1.00 24.60  ? 54  GLY B N   1 
ATOM   2794 C  CA  . GLY B  1 54  ? 22.615  28.561  38.755 1.00 28.15  ? 54  GLY B CA  1 
ATOM   2795 C  C   . GLY B  1 54  ? 23.802  28.800  37.853 1.00 40.63  ? 54  GLY B C   1 
ATOM   2796 O  O   . GLY B  1 54  ? 24.296  29.923  37.740 1.00 36.76  ? 54  GLY B O   1 
ATOM   2797 N  N   . GLN B  1 55  ? 24.262  27.732  37.211 1.00 37.30  ? 55  GLN B N   1 
ATOM   2798 C  CA  . GLN B  1 55  ? 25.397  27.803  36.304 1.00 41.75  ? 55  GLN B CA  1 
ATOM   2799 C  C   . GLN B  1 55  ? 24.940  27.532  34.877 1.00 42.92  ? 55  GLN B C   1 
ATOM   2800 O  O   . GLN B  1 55  ? 23.876  26.955  34.656 1.00 49.34  ? 55  GLN B O   1 
ATOM   2801 C  CB  . GLN B  1 55  ? 26.456  26.766  36.691 1.00 40.79  ? 55  GLN B CB  1 
ATOM   2802 C  CG  . GLN B  1 55  ? 26.931  26.832  38.147 1.00 52.53  ? 55  GLN B CG  1 
ATOM   2803 C  CD  . GLN B  1 55  ? 25.924  26.252  39.126 1.00 52.88  ? 55  GLN B CD  1 
ATOM   2804 O  OE1 . GLN B  1 55  ? 25.434  25.134  38.944 1.00 45.94  ? 55  GLN B OE1 1 
ATOM   2805 N  NE2 . GLN B  1 55  ? 25.619  27.006  40.177 1.00 44.97  ? 55  GLN B NE2 1 
ATOM   2806 N  N   . VAL B  1 56  ? 25.743  27.960  33.912 1.00 42.20  ? 56  VAL B N   1 
ATOM   2807 C  CA  . VAL B  1 56  ? 25.428  27.740  32.512 1.00 47.82  ? 56  VAL B CA  1 
ATOM   2808 C  C   . VAL B  1 56  ? 26.573  26.973  31.873 1.00 47.91  ? 56  VAL B C   1 
ATOM   2809 O  O   . VAL B  1 56  ? 27.733  27.145  32.247 1.00 52.33  ? 56  VAL B O   1 
ATOM   2810 C  CB  . VAL B  1 56  ? 25.238  29.074  31.738 1.00 46.69  ? 56  VAL B CB  1 
ATOM   2811 C  CG1 . VAL B  1 56  ? 24.175  29.916  32.407 1.00 44.19  ? 56  VAL B CG1 1 
ATOM   2812 C  CG2 . VAL B  1 56  ? 26.549  29.826  31.658 1.00 46.93  ? 56  VAL B CG2 1 
ATOM   2813 N  N   . LEU B  1 57  ? 26.240  26.123  30.912 1.00 34.45  ? 57  LEU B N   1 
ATOM   2814 C  CA  . LEU B  1 57  ? 27.235  25.337  30.199 1.00 36.96  ? 57  LEU B CA  1 
ATOM   2815 C  C   . LEU B  1 57  ? 27.729  26.196  29.030 1.00 45.94  ? 57  LEU B C   1 
ATOM   2816 O  O   . LEU B  1 57  ? 26.925  26.863  28.383 1.00 47.80  ? 57  LEU B O   1 
ATOM   2817 C  CB  . LEU B  1 57  ? 26.582  24.059  29.666 1.00 34.67  ? 57  LEU B CB  1 
ATOM   2818 C  CG  . LEU B  1 57  ? 27.469  22.955  29.098 1.00 36.27  ? 57  LEU B CG  1 
ATOM   2819 C  CD1 . LEU B  1 57  ? 28.221  22.284  30.246 1.00 42.39  ? 57  LEU B CD1 1 
ATOM   2820 C  CD2 . LEU B  1 57  ? 26.607  21.929  28.359 1.00 40.74  ? 57  LEU B CD2 1 
ATOM   2821 N  N   . ASN B  1 58  ? 29.033  26.200  28.760 1.00 36.51  ? 58  ASN B N   1 
ATOM   2822 C  CA  . ASN B  1 58  ? 29.534  26.992  27.643 1.00 40.56  ? 58  ASN B CA  1 
ATOM   2823 C  C   . ASN B  1 58  ? 29.839  26.087  26.462 1.00 39.01  ? 58  ASN B C   1 
ATOM   2824 O  O   . ASN B  1 58  ? 29.926  24.868  26.610 1.00 47.96  ? 58  ASN B O   1 
ATOM   2825 C  CB  . ASN B  1 58  ? 30.773  27.831  28.037 1.00 40.81  ? 58  ASN B CB  1 
ATOM   2826 C  CG  . ASN B  1 58  ? 32.015  26.993  28.316 1.00 49.18  ? 58  ASN B CG  1 
ATOM   2827 O  OD1 . ASN B  1 58  ? 32.454  26.194  27.483 1.00 56.25  ? 58  ASN B OD1 1 
ATOM   2828 N  ND2 . ASN B  1 58  ? 32.601  27.194  29.489 1.00 51.19  ? 58  ASN B ND2 1 
ATOM   2829 N  N   . SER B  1 59  ? 30.001  26.691  25.290 1.00 42.03  ? 59  SER B N   1 
ATOM   2830 C  CA  . SER B  1 59  ? 30.258  25.943  24.068 1.00 39.91  ? 59  SER B CA  1 
ATOM   2831 C  C   . SER B  1 59  ? 31.447  24.986  24.106 1.00 45.85  ? 59  SER B C   1 
ATOM   2832 O  O   . SER B  1 59  ? 31.434  23.965  23.415 1.00 44.04  ? 59  SER B O   1 
ATOM   2833 C  CB  . SER B  1 59  ? 30.397  26.910  22.883 1.00 46.46  ? 59  SER B CB  1 
ATOM   2834 O  OG  . SER B  1 59  ? 31.363  27.916  23.133 1.00 51.96  ? 59  SER B OG  1 
ATOM   2835 N  N   . ASP B  1 60  ? 32.469  25.299  24.899 1.00 48.86  ? 60  ASP B N   1 
ATOM   2836 C  CA  . ASP B  1 60  ? 33.639  24.421  24.988 1.00 43.67  ? 60  ASP B CA  1 
ATOM   2837 C  C   . ASP B  1 60  ? 33.314  23.175  25.801 1.00 41.76  ? 60  ASP B C   1 
ATOM   2838 O  O   . ASP B  1 60  ? 33.763  22.073  25.483 1.00 47.90  ? 60  ASP B O   1 
ATOM   2839 C  CB  . ASP B  1 60  ? 34.817  25.156  25.627 1.00 56.53  ? 60  ASP B CB  1 
ATOM   2840 C  CG  . ASP B  1 60  ? 35.426  26.183  24.702 1.00 66.38  ? 60  ASP B CG  1 
ATOM   2841 O  OD1 . ASP B  1 60  ? 35.882  25.789  23.608 1.00 64.49  ? 60  ASP B OD1 1 
ATOM   2842 O  OD2 . ASP B  1 60  ? 35.447  27.378  25.065 1.00 67.58  ? 60  ASP B OD2 1 
ATOM   2843 N  N   . GLU B  1 61  ? 32.526  23.363  26.852 1.00 42.69  ? 61  GLU B N   1 
ATOM   2844 C  CA  . GLU B  1 61  ? 32.122  22.265  27.716 1.00 44.38  ? 61  GLU B CA  1 
ATOM   2845 C  C   . GLU B  1 61  ? 31.151  21.343  26.982 1.00 40.16  ? 61  GLU B C   1 
ATOM   2846 O  O   . GLU B  1 61  ? 31.137  20.135  27.210 1.00 45.52  ? 61  GLU B O   1 
ATOM   2847 C  CB  . GLU B  1 61  ? 31.484  22.832  28.979 1.00 43.73  ? 61  GLU B CB  1 
ATOM   2848 C  CG  . GLU B  1 61  ? 32.364  23.878  29.624 1.00 41.33  ? 61  GLU B CG  1 
ATOM   2849 C  CD  . GLU B  1 61  ? 31.826  24.387  30.933 1.00 46.43  ? 61  GLU B CD  1 
ATOM   2850 O  OE1 . GLU B  1 61  ? 30.717  24.964  30.943 1.00 48.83  ? 61  GLU B OE1 1 
ATOM   2851 O  OE2 . GLU B  1 61  ? 32.522  24.212  31.955 1.00 57.24  ? 61  GLU B OE2 1 
ATOM   2852 N  N   . LEU B  1 62  ? 30.339  21.919  26.100 1.00 41.07  ? 62  LEU B N   1 
ATOM   2853 C  CA  . LEU B  1 62  ? 29.388  21.137  25.316 1.00 37.92  ? 62  LEU B CA  1 
ATOM   2854 C  C   . LEU B  1 62  ? 30.206  20.256  24.392 1.00 41.74  ? 62  LEU B C   1 
ATOM   2855 O  O   . LEU B  1 62  ? 30.005  19.044  24.314 1.00 42.42  ? 62  LEU B O   1 
ATOM   2856 C  CB  . LEU B  1 62  ? 28.489  22.057  24.482 1.00 41.08  ? 62  LEU B CB  1 
ATOM   2857 C  CG  . LEU B  1 62  ? 27.602  21.369  23.430 1.00 46.25  ? 62  LEU B CG  1 
ATOM   2858 C  CD1 . LEU B  1 62  ? 26.599  20.439  24.111 1.00 43.69  ? 62  LEU B CD1 1 
ATOM   2859 C  CD2 . LEU B  1 62  ? 26.867  22.424  22.613 1.00 42.77  ? 62  LEU B CD2 1 
ATOM   2860 N  N   . GLN B  1 63  ? 31.142  20.885  23.690 1.00 47.24  ? 63  GLN B N   1 
ATOM   2861 C  CA  . GLN B  1 63  ? 32.011  20.176  22.769 1.00 45.64  ? 63  GLN B CA  1 
ATOM   2862 C  C   . GLN B  1 63  ? 32.769  19.064  23.490 1.00 46.87  ? 63  GLN B C   1 
ATOM   2863 O  O   . GLN B  1 63  ? 32.896  17.960  22.968 1.00 46.81  ? 63  GLN B O   1 
ATOM   2864 C  CB  . GLN B  1 63  ? 32.988  21.158  22.125 1.00 50.83  ? 63  GLN B CB  1 
ATOM   2865 C  CG  . GLN B  1 63  ? 34.154  20.502  21.428 1.00 46.15  ? 63  GLN B CG  1 
ATOM   2866 C  CD  . GLN B  1 63  ? 35.015  21.498  20.682 1.00 57.54  ? 63  GLN B CD  1 
ATOM   2867 O  OE1 . GLN B  1 63  ? 35.204  22.632  21.127 1.00 60.50  ? 63  GLN B OE1 1 
ATOM   2868 N  NE2 . GLN B  1 63  ? 35.556  21.075  19.546 1.00 57.77  ? 63  GLN B NE2 1 
ATOM   2869 N  N   . GLU B  1 64  ? 33.268  19.356  24.690 1.00 49.96  ? 64  GLU B N   1 
ATOM   2870 C  CA  . GLU B  1 64  ? 33.999  18.357  25.467 1.00 52.48  ? 64  GLU B CA  1 
ATOM   2871 C  C   . GLU B  1 64  ? 33.110  17.145  25.742 1.00 47.12  ? 64  GLU B C   1 
ATOM   2872 O  O   . GLU B  1 64  ? 33.537  16.001  25.570 1.00 48.54  ? 64  GLU B O   1 
ATOM   2873 C  CB  . GLU B  1 64  ? 34.489  18.950  26.796 1.00 52.35  ? 64  GLU B CB  1 
ATOM   2874 C  CG  . GLU B  1 64  ? 35.340  17.986  27.613 1.00 71.74  ? 64  GLU B CG  1 
ATOM   2875 C  CD  . GLU B  1 64  ? 35.827  18.573  28.928 1.00 86.28  ? 64  GLU B CD  1 
ATOM   2876 O  OE1 . GLU B  1 64  ? 36.503  17.844  29.688 1.00 85.14  ? 64  GLU B OE1 1 
ATOM   2877 O  OE2 . GLU B  1 64  ? 35.540  19.758  29.203 1.00 90.32  ? 64  GLU B OE2 1 
ATOM   2878 N  N   . LEU B  1 65  ? 31.873  17.399  26.166 1.00 45.06  ? 65  LEU B N   1 
ATOM   2879 C  CA  . LEU B  1 65  ? 30.928  16.325  26.449 1.00 37.98  ? 65  LEU B CA  1 
ATOM   2880 C  C   . LEU B  1 65  ? 30.688  15.479  25.202 1.00 47.08  ? 65  LEU B C   1 
ATOM   2881 O  O   . LEU B  1 65  ? 30.626  14.253  25.276 1.00 46.81  ? 65  LEU B O   1 
ATOM   2882 C  CB  . LEU B  1 65  ? 29.596  16.899  26.937 1.00 32.89  ? 65  LEU B CB  1 
ATOM   2883 C  CG  . LEU B  1 65  ? 29.553  17.549  28.319 1.00 45.36  ? 65  LEU B CG  1 
ATOM   2884 C  CD1 . LEU B  1 65  ? 28.207  18.248  28.505 1.00 34.88  ? 65  LEU B CD1 1 
ATOM   2885 C  CD2 . LEU B  1 65  ? 29.765  16.489  29.398 1.00 42.51  ? 65  LEU B CD2 1 
ATOM   2886 N  N   . TYR B  1 66  ? 30.552  16.134  24.054 1.00 42.82  ? 66  TYR B N   1 
ATOM   2887 C  CA  . TYR B  1 66  ? 30.327  15.409  22.814 1.00 46.56  ? 66  TYR B CA  1 
ATOM   2888 C  C   . TYR B  1 66  ? 31.549  14.557  22.471 1.00 43.47  ? 66  TYR B C   1 
ATOM   2889 O  O   . TYR B  1 66  ? 31.427  13.478  21.889 1.00 39.48  ? 66  TYR B O   1 
ATOM   2890 C  CB  . TYR B  1 66  ? 30.034  16.380  21.668 1.00 49.09  ? 66  TYR B CB  1 
ATOM   2891 C  CG  . TYR B  1 66  ? 29.835  15.680  20.349 1.00 50.16  ? 66  TYR B CG  1 
ATOM   2892 C  CD1 . TYR B  1 66  ? 28.709  14.892  20.120 1.00 50.66  ? 66  TYR B CD1 1 
ATOM   2893 C  CD2 . TYR B  1 66  ? 30.796  15.766  19.344 1.00 55.25  ? 66  TYR B CD2 1 
ATOM   2894 C  CE1 . TYR B  1 66  ? 28.543  14.204  18.922 1.00 47.43  ? 66  TYR B CE1 1 
ATOM   2895 C  CE2 . TYR B  1 66  ? 30.642  15.078  18.141 1.00 58.88  ? 66  TYR B CE2 1 
ATOM   2896 C  CZ  . TYR B  1 66  ? 29.515  14.301  17.938 1.00 53.02  ? 66  TYR B CZ  1 
ATOM   2897 O  OH  . TYR B  1 66  ? 29.360  13.623  16.755 1.00 59.02  ? 66  TYR B OH  1 
ATOM   2898 N  N   . GLU B  1 67  ? 32.726  15.050  22.839 1.00 51.51  ? 67  GLU B N   1 
ATOM   2899 C  CA  . GLU B  1 67  ? 33.974  14.341  22.581 1.00 44.77  ? 67  GLU B CA  1 
ATOM   2900 C  C   . GLU B  1 67  ? 33.929  12.994  23.295 1.00 40.07  ? 67  GLU B C   1 
ATOM   2901 O  O   . GLU B  1 67  ? 34.295  11.964  22.728 1.00 43.97  ? 67  GLU B O   1 
ATOM   2902 C  CB  . GLU B  1 67  ? 35.153  15.168  23.093 1.00 60.98  ? 67  GLU B CB  1 
ATOM   2903 C  CG  . GLU B  1 67  ? 36.496  14.740  22.542 1.00 68.35  ? 67  GLU B CG  1 
ATOM   2904 C  CD  . GLU B  1 67  ? 36.495  14.667  21.029 1.00 73.85  ? 67  GLU B CD  1 
ATOM   2905 O  OE1 . GLU B  1 67  ? 35.847  15.528  20.391 1.00 76.47  ? 67  GLU B OE1 1 
ATOM   2906 O  OE2 . GLU B  1 67  ? 37.148  13.755  20.481 1.00 69.87  ? 67  GLU B OE2 1 
ATOM   2907 N  N   . GLY B  1 68  ? 33.468  13.011  24.542 1.00 43.80  ? 68  GLY B N   1 
ATOM   2908 C  CA  . GLY B  1 68  ? 33.359  11.782  25.305 1.00 41.19  ? 68  GLY B CA  1 
ATOM   2909 C  C   . GLY B  1 68  ? 32.465  10.786  24.589 1.00 45.61  ? 68  GLY B C   1 
ATOM   2910 O  O   . GLY B  1 68  ? 32.772  9.594   24.521 1.00 46.13  ? 68  GLY B O   1 
ATOM   2911 N  N   . LEU B  1 69  ? 31.351  11.272  24.051 1.00 43.05  ? 69  LEU B N   1 
ATOM   2912 C  CA  . LEU B  1 69  ? 30.425  10.408  23.330 1.00 39.55  ? 69  LEU B CA  1 
ATOM   2913 C  C   . LEU B  1 69  ? 31.094  9.881   22.069 1.00 36.92  ? 69  LEU B C   1 
ATOM   2914 O  O   . LEU B  1 69  ? 31.041  8.686   21.780 1.00 44.88  ? 69  LEU B O   1 
ATOM   2915 C  CB  . LEU B  1 69  ? 29.155  11.177  22.958 1.00 42.16  ? 69  LEU B CB  1 
ATOM   2916 C  CG  . LEU B  1 69  ? 28.239  11.597  24.110 1.00 38.96  ? 69  LEU B CG  1 
ATOM   2917 C  CD1 . LEU B  1 69  ? 27.064  12.394  23.565 1.00 39.60  ? 69  LEU B CD1 1 
ATOM   2918 C  CD2 . LEU B  1 69  ? 27.750  10.365  24.842 1.00 34.21  ? 69  LEU B CD2 1 
ATOM   2919 N  N   . ARG B  1 70  ? 31.729  10.786  21.328 1.00 44.42  ? 70  ARG B N   1 
ATOM   2920 C  CA  . ARG B  1 70  ? 32.415  10.434  20.091 1.00 49.37  ? 70  ARG B CA  1 
ATOM   2921 C  C   . ARG B  1 70  ? 33.500  9.388   20.346 1.00 56.77  ? 70  ARG B C   1 
ATOM   2922 O  O   . ARG B  1 70  ? 33.534  8.349   19.686 1.00 56.08  ? 70  ARG B O   1 
ATOM   2923 C  CB  . ARG B  1 70  ? 33.042  11.684  19.463 1.00 47.63  ? 70  ARG B CB  1 
ATOM   2924 C  CG  . ARG B  1 70  ? 33.495  11.497  18.016 1.00 56.33  ? 70  ARG B CG  1 
ATOM   2925 C  CD  . ARG B  1 70  ? 34.405  12.633  17.549 1.00 57.42  ? 70  ARG B CD  1 
ATOM   2926 N  NE  . ARG B  1 70  ? 35.703  12.602  18.226 1.00 79.77  ? 70  ARG B NE  1 
ATOM   2927 C  CZ  . ARG B  1 70  ? 36.576  11.599  18.136 1.00 84.00  ? 70  ARG B CZ  1 
ATOM   2928 N  NH1 . ARG B  1 70  ? 36.299  10.535  17.395 1.00 92.05  ? 70  ARG B NH1 1 
ATOM   2929 N  NH2 . ARG B  1 70  ? 37.729  11.657  18.789 1.00 83.47  ? 70  ARG B NH2 1 
ATOM   2930 N  N   . LEU B  1 71  ? 34.381  9.665   21.308 1.00 51.17  ? 71  LEU B N   1 
ATOM   2931 C  CA  . LEU B  1 71  ? 35.466  8.744   21.644 1.00 50.16  ? 71  LEU B CA  1 
ATOM   2932 C  C   . LEU B  1 71  ? 34.965  7.340   21.942 1.00 49.33  ? 71  LEU B C   1 
ATOM   2933 O  O   . LEU B  1 71  ? 35.629  6.358   21.619 1.00 54.82  ? 71  LEU B O   1 
ATOM   2934 C  CB  . LEU B  1 71  ? 36.266  9.267   22.845 1.00 48.96  ? 71  LEU B CB  1 
ATOM   2935 C  CG  . LEU B  1 71  ? 37.147  10.498  22.595 1.00 57.92  ? 71  LEU B CG  1 
ATOM   2936 C  CD1 . LEU B  1 71  ? 37.699  11.017  23.907 1.00 52.31  ? 71  LEU B CD1 1 
ATOM   2937 C  CD2 . LEU B  1 71  ? 38.278  10.135  21.643 1.00 58.49  ? 71  LEU B CD2 1 
ATOM   2938 N  N   . ASN B  1 72  ? 33.792  7.243   22.556 1.00 46.79  ? 72  ASN B N   1 
ATOM   2939 C  CA  . ASN B  1 72  ? 33.221  5.945   22.887 1.00 38.63  ? 72  ASN B CA  1 
ATOM   2940 C  C   . ASN B  1 72  ? 32.356  5.396   21.771 1.00 47.61  ? 72  ASN B C   1 
ATOM   2941 O  O   . ASN B  1 72  ? 31.676  4.378   21.941 1.00 42.67  ? 72  ASN B O   1 
ATOM   2942 C  CB  . ASN B  1 72  ? 32.401  6.042   24.171 1.00 47.06  ? 72  ASN B CB  1 
ATOM   2943 C  CG  . ASN B  1 72  ? 33.270  6.145   25.396 1.00 53.28  ? 72  ASN B CG  1 
ATOM   2944 O  OD1 . ASN B  1 72  ? 34.095  5.268   25.651 1.00 50.49  ? 72  ASN B OD1 1 
ATOM   2945 N  ND2 . ASN B  1 72  ? 33.100  7.215   26.160 1.00 51.01  ? 72  ASN B ND2 1 
ATOM   2946 N  N   . ASN B  1 73  ? 32.376  6.081   20.633 1.00 42.60  ? 73  ASN B N   1 
ATOM   2947 C  CA  . ASN B  1 73  ? 31.595  5.651   19.484 1.00 53.91  ? 73  ASN B CA  1 
ATOM   2948 C  C   . ASN B  1 73  ? 30.104  5.633   19.842 1.00 50.44  ? 73  ASN B C   1 
ATOM   2949 O  O   . ASN B  1 73  ? 29.361  4.764   19.386 1.00 45.48  ? 73  ASN B O   1 
ATOM   2950 C  CB  . ASN B  1 73  ? 32.043  4.249   19.058 1.00 54.51  ? 73  ASN B CB  1 
ATOM   2951 C  CG  . ASN B  1 73  ? 31.640  3.913   17.644 1.00 76.57  ? 73  ASN B CG  1 
ATOM   2952 O  OD1 . ASN B  1 73  ? 31.528  2.742   17.278 1.00 85.62  ? 73  ASN B OD1 1 
ATOM   2953 N  ND2 . ASN B  1 73  ? 31.434  4.943   16.828 1.00 78.45  ? 73  ASN B ND2 1 
ATOM   2954 N  N   . MET B  1 74  ? 29.678  6.587   20.666 1.00 47.43  ? 74  MET B N   1 
ATOM   2955 C  CA  . MET B  1 74  ? 28.282  6.669   21.086 1.00 52.21  ? 74  MET B CA  1 
ATOM   2956 C  C   . MET B  1 74  ? 27.589  7.902   20.516 1.00 51.19  ? 74  MET B C   1 
ATOM   2957 O  O   . MET B  1 74  ? 26.643  8.419   21.108 1.00 52.27  ? 74  MET B O   1 
ATOM   2958 C  CB  . MET B  1 74  ? 28.186  6.709   22.612 1.00 49.64  ? 74  MET B CB  1 
ATOM   2959 C  CG  . MET B  1 74  ? 28.893  5.569   23.307 1.00 58.60  ? 74  MET B CG  1 
ATOM   2960 S  SD  . MET B  1 74  ? 28.653  5.618   25.088 1.00 68.48  ? 74  MET B SD  1 
ATOM   2961 C  CE  . MET B  1 74  ? 29.304  7.177   25.421 1.00 31.50  ? 74  MET B CE  1 
ATOM   2962 N  N   . ASN B  1 75  ? 28.071  8.376   19.373 1.00 48.12  ? 75  ASN B N   1 
ATOM   2963 C  CA  . ASN B  1 75  ? 27.484  9.540   18.728 1.00 47.82  ? 75  ASN B CA  1 
ATOM   2964 C  C   . ASN B  1 75  ? 26.618  9.086   17.565 1.00 47.94  ? 75  ASN B C   1 
ATOM   2965 O  O   . ASN B  1 75  ? 26.857  9.433   16.411 1.00 57.35  ? 75  ASN B O   1 
ATOM   2966 C  CB  . ASN B  1 75  ? 28.579  10.504  18.253 1.00 49.52  ? 75  ASN B CB  1 
ATOM   2967 C  CG  . ASN B  1 75  ? 29.531  9.872   17.253 1.00 60.01  ? 75  ASN B CG  1 
ATOM   2968 O  OD1 . ASN B  1 75  ? 29.858  8.687   17.342 1.00 60.86  ? 75  ASN B OD1 1 
ATOM   2969 N  ND2 . ASN B  1 75  ? 30.000  10.674  16.303 1.00 63.75  ? 75  ASN B ND2 1 
ATOM   2970 N  N   . LYS B  1 76  ? 25.607  8.291   17.894 1.00 43.00  ? 76  LYS B N   1 
ATOM   2971 C  CA  . LYS B  1 76  ? 24.675  7.764   16.915 1.00 45.50  ? 76  LYS B CA  1 
ATOM   2972 C  C   . LYS B  1 76  ? 23.269  7.962   17.468 1.00 47.86  ? 76  LYS B C   1 
ATOM   2973 O  O   . LYS B  1 76  ? 22.847  7.273   18.398 1.00 48.28  ? 76  LYS B O   1 
ATOM   2974 C  CB  . LYS B  1 76  ? 24.964  6.282   16.677 1.00 52.13  ? 76  LYS B CB  1 
ATOM   2975 C  CG  . LYS B  1 76  ? 26.316  6.037   16.023 1.00 60.57  ? 76  LYS B CG  1 
ATOM   2976 C  CD  . LYS B  1 76  ? 26.742  4.584   16.119 1.00 68.01  ? 76  LYS B CD  1 
ATOM   2977 C  CE  . LYS B  1 76  ? 28.029  4.354   15.347 1.00 80.92  ? 76  LYS B CE  1 
ATOM   2978 N  NZ  . LYS B  1 76  ? 29.071  5.356   15.710 1.00 89.76  ? 76  LYS B NZ  1 
ATOM   2979 N  N   . TYR B  1 77  ? 22.552  8.922   16.898 1.00 44.11  ? 77  TYR B N   1 
ATOM   2980 C  CA  . TYR B  1 77  ? 21.207  9.223   17.352 1.00 35.36  ? 77  TYR B CA  1 
ATOM   2981 C  C   . TYR B  1 77  ? 20.182  9.202   16.236 1.00 39.99  ? 77  TYR B C   1 
ATOM   2982 O  O   . TYR B  1 77  ? 20.515  9.343   15.061 1.00 35.16  ? 77  TYR B O   1 
ATOM   2983 C  CB  . TYR B  1 77  ? 21.172  10.588  18.045 1.00 34.49  ? 77  TYR B CB  1 
ATOM   2984 C  CG  . TYR B  1 77  ? 21.849  10.593  19.394 1.00 36.14  ? 77  TYR B CG  1 
ATOM   2985 C  CD1 . TYR B  1 77  ? 23.226  10.778  19.507 1.00 44.44  ? 77  TYR B CD1 1 
ATOM   2986 C  CD2 . TYR B  1 77  ? 21.117  10.347  20.558 1.00 40.46  ? 77  TYR B CD2 1 
ATOM   2987 C  CE1 . TYR B  1 77  ? 23.862  10.715  20.750 1.00 48.97  ? 77  TYR B CE1 1 
ATOM   2988 C  CE2 . TYR B  1 77  ? 21.740  10.276  21.801 1.00 37.27  ? 77  TYR B CE2 1 
ATOM   2989 C  CZ  . TYR B  1 77  ? 23.113  10.460  21.888 1.00 43.95  ? 77  TYR B CZ  1 
ATOM   2990 O  OH  . TYR B  1 77  ? 23.732  10.365  23.106 1.00 43.65  ? 77  TYR B OH  1 
ATOM   2991 N  N   . ASP B  1 78  ? 18.927  9.030   16.630 1.00 33.09  ? 78  ASP B N   1 
ATOM   2992 C  CA  . ASP B  1 78  ? 17.816  8.990   15.700 1.00 33.88  ? 78  ASP B CA  1 
ATOM   2993 C  C   . ASP B  1 78  ? 17.188  10.377  15.678 1.00 39.35  ? 78  ASP B C   1 
ATOM   2994 O  O   . ASP B  1 78  ? 16.677  10.817  14.654 1.00 43.34  ? 78  ASP B O   1 
ATOM   2995 C  CB  . ASP B  1 78  ? 16.804  7.942   16.162 1.00 36.42  ? 78  ASP B CB  1 
ATOM   2996 C  CG  . ASP B  1 78  ? 17.398  6.546   16.199 1.00 40.99  ? 78  ASP B CG  1 
ATOM   2997 O  OD1 . ASP B  1 78  ? 17.767  6.034   15.125 1.00 46.39  ? 78  ASP B OD1 1 
ATOM   2998 O  OD2 . ASP B  1 78  ? 17.508  5.965   17.298 1.00 38.34  ? 78  ASP B OD2 1 
ATOM   2999 N  N   . TYR B  1 79  ? 17.240  11.056  16.821 1.00 39.10  ? 79  TYR B N   1 
ATOM   3000 C  CA  . TYR B  1 79  ? 16.702  12.403  16.959 1.00 30.16  ? 79  TYR B CA  1 
ATOM   3001 C  C   . TYR B  1 79  ? 17.614  13.269  17.806 1.00 40.46  ? 79  TYR B C   1 
ATOM   3002 O  O   . TYR B  1 79  ? 18.365  12.772  18.653 1.00 34.26  ? 79  TYR B O   1 
ATOM   3003 C  CB  . TYR B  1 79  ? 15.345  12.412  17.669 1.00 27.91  ? 79  TYR B CB  1 
ATOM   3004 C  CG  . TYR B  1 79  ? 14.193  11.776  16.937 1.00 37.12  ? 79  TYR B CG  1 
ATOM   3005 C  CD1 . TYR B  1 79  ? 13.988  10.399  16.986 1.00 30.72  ? 79  TYR B CD1 1 
ATOM   3006 C  CD2 . TYR B  1 79  ? 13.282  12.560  16.219 1.00 35.70  ? 79  TYR B CD2 1 
ATOM   3007 C  CE1 . TYR B  1 79  ? 12.907  9.814   16.343 1.00 42.13  ? 79  TYR B CE1 1 
ATOM   3008 C  CE2 . TYR B  1 79  ? 12.190  11.983  15.567 1.00 32.92  ? 79  TYR B CE2 1 
ATOM   3009 C  CZ  . TYR B  1 79  ? 12.011  10.610  15.635 1.00 32.15  ? 79  TYR B CZ  1 
ATOM   3010 O  OH  . TYR B  1 79  ? 10.945  10.022  15.006 1.00 40.77  ? 79  TYR B OH  1 
ATOM   3011 N  N   . VAL B  1 80  ? 17.526  14.572  17.563 1.00 36.07  ? 80  VAL B N   1 
ATOM   3012 C  CA  . VAL B  1 80  ? 18.235  15.582  18.333 1.00 35.49  ? 80  VAL B CA  1 
ATOM   3013 C  C   . VAL B  1 80  ? 17.089  16.540  18.634 1.00 39.02  ? 80  VAL B C   1 
ATOM   3014 O  O   . VAL B  1 80  ? 16.223  16.760  17.781 1.00 33.75  ? 80  VAL B O   1 
ATOM   3015 C  CB  . VAL B  1 80  ? 19.326  16.311  17.522 1.00 23.75  ? 80  VAL B CB  1 
ATOM   3016 C  CG1 . VAL B  1 80  ? 19.811  17.531  18.300 1.00 28.22  ? 80  VAL B CG1 1 
ATOM   3017 C  CG2 . VAL B  1 80  ? 20.488  15.373  17.254 1.00 32.34  ? 80  VAL B CG2 1 
ATOM   3018 N  N   . LEU B  1 81  ? 17.068  17.089  19.841 1.00 35.51  ? 81  LEU B N   1 
ATOM   3019 C  CA  . LEU B  1 81  ? 15.995  17.987  20.256 1.00 30.66  ? 81  LEU B CA  1 
ATOM   3020 C  C   . LEU B  1 81  ? 16.551  19.195  21.002 1.00 40.20  ? 81  LEU B C   1 
ATOM   3021 O  O   . LEU B  1 81  ? 17.249  19.049  22.011 1.00 35.95  ? 81  LEU B O   1 
ATOM   3022 C  CB  . LEU B  1 81  ? 15.028  17.220  21.163 1.00 26.37  ? 81  LEU B CB  1 
ATOM   3023 C  CG  . LEU B  1 81  ? 13.898  17.945  21.890 1.00 31.64  ? 81  LEU B CG  1 
ATOM   3024 C  CD1 . LEU B  1 81  ? 12.808  18.382  20.896 1.00 31.56  ? 81  LEU B CD1 1 
ATOM   3025 C  CD2 . LEU B  1 81  ? 13.323  17.006  22.926 1.00 22.43  ? 81  LEU B CD2 1 
ATOM   3026 N  N   . THR B  1 82  ? 16.246  20.387  20.502 1.00 29.98  ? 82  THR B N   1 
ATOM   3027 C  CA  . THR B  1 82  ? 16.715  21.612  21.137 1.00 33.49  ? 82  THR B CA  1 
ATOM   3028 C  C   . THR B  1 82  ? 15.581  22.604  21.289 1.00 36.47  ? 82  THR B C   1 
ATOM   3029 O  O   . THR B  1 82  ? 14.534  22.488  20.641 1.00 34.96  ? 82  THR B O   1 
ATOM   3030 C  CB  . THR B  1 82  ? 17.845  22.293  20.326 1.00 27.80  ? 82  THR B CB  1 
ATOM   3031 O  OG1 . THR B  1 82  ? 17.337  22.716  19.052 1.00 42.83  ? 82  THR B OG1 1 
ATOM   3032 C  CG2 . THR B  1 82  ? 19.016  21.326  20.117 1.00 28.23  ? 82  THR B CG2 1 
ATOM   3033 N  N   . GLY B  1 83  ? 15.800  23.582  22.157 1.00 30.79  ? 83  GLY B N   1 
ATOM   3034 C  CA  . GLY B  1 83  ? 14.804  24.606  22.392 1.00 34.24  ? 83  GLY B CA  1 
ATOM   3035 C  C   . GLY B  1 83  ? 15.489  25.906  22.751 1.00 31.09  ? 83  GLY B C   1 
ATOM   3036 O  O   . GLY B  1 83  ? 16.308  26.414  21.986 1.00 29.78  ? 83  GLY B O   1 
ATOM   3037 N  N   . TYR B  1 84  ? 15.162  26.440  23.922 1.00 33.67  ? 84  TYR B N   1 
ATOM   3038 C  CA  . TYR B  1 84  ? 15.754  27.690  24.373 1.00 37.96  ? 84  TYR B CA  1 
ATOM   3039 C  C   . TYR B  1 84  ? 17.272  27.619  24.419 1.00 44.51  ? 84  TYR B C   1 
ATOM   3040 O  O   . TYR B  1 84  ? 17.844  26.765  25.100 1.00 40.94  ? 84  TYR B O   1 
ATOM   3041 C  CB  . TYR B  1 84  ? 15.236  28.062  25.761 1.00 36.87  ? 84  TYR B CB  1 
ATOM   3042 C  CG  . TYR B  1 84  ? 15.982  29.223  26.378 1.00 47.14  ? 84  TYR B CG  1 
ATOM   3043 C  CD1 . TYR B  1 84  ? 15.683  30.538  26.026 1.00 47.57  ? 84  TYR B CD1 1 
ATOM   3044 C  CD2 . TYR B  1 84  ? 17.016  29.002  27.290 1.00 39.57  ? 84  TYR B CD2 1 
ATOM   3045 C  CE1 . TYR B  1 84  ? 16.394  31.607  26.569 1.00 50.24  ? 84  TYR B CE1 1 
ATOM   3046 C  CE2 . TYR B  1 84  ? 17.734  30.058  27.836 1.00 51.03  ? 84  TYR B CE2 1 
ATOM   3047 C  CZ  . TYR B  1 84  ? 17.419  31.356  27.473 1.00 53.71  ? 84  TYR B CZ  1 
ATOM   3048 O  OH  . TYR B  1 84  ? 18.127  32.399  28.018 1.00 55.68  ? 84  TYR B OH  1 
ATOM   3049 N  N   . THR B  1 85  ? 17.911  28.521  23.683 1.00 35.63  ? 85  THR B N   1 
ATOM   3050 C  CA  . THR B  1 85  ? 19.362  28.610  23.642 1.00 40.47  ? 85  THR B CA  1 
ATOM   3051 C  C   . THR B  1 85  ? 19.677  30.091  23.854 1.00 45.86  ? 85  THR B C   1 
ATOM   3052 O  O   . THR B  1 85  ? 19.105  30.956  23.196 1.00 45.77  ? 85  THR B O   1 
ATOM   3053 C  CB  . THR B  1 85  ? 19.903  28.129  22.296 1.00 47.77  ? 85  THR B CB  1 
ATOM   3054 O  OG1 . THR B  1 85  ? 19.353  26.837  22.008 1.00 50.97  ? 85  THR B OG1 1 
ATOM   3055 C  CG2 . THR B  1 85  ? 21.418  28.022  22.335 1.00 44.46  ? 85  THR B CG2 1 
ATOM   3056 N  N   . ARG B  1 86  ? 20.588  30.377  24.777 1.00 48.32  ? 86  ARG B N   1 
ATOM   3057 C  CA  . ARG B  1 86  ? 20.922  31.755  25.127 1.00 49.73  ? 86  ARG B CA  1 
ATOM   3058 C  C   . ARG B  1 86  ? 22.174  32.363  24.510 1.00 44.91  ? 86  ARG B C   1 
ATOM   3059 O  O   . ARG B  1 86  ? 22.323  33.582  24.495 1.00 60.65  ? 86  ARG B O   1 
ATOM   3060 C  CB  . ARG B  1 86  ? 21.055  31.853  26.648 1.00 59.11  ? 86  ARG B CB  1 
ATOM   3061 C  CG  . ARG B  1 86  ? 22.181  30.975  27.210 1.00 68.23  ? 86  ARG B CG  1 
ATOM   3062 C  CD  . ARG B  1 86  ? 22.293  31.074  28.729 1.00 78.16  ? 86  ARG B CD  1 
ATOM   3063 N  NE  . ARG B  1 86  ? 22.691  32.408  29.185 1.00 83.59  ? 86  ARG B NE  1 
ATOM   3064 C  CZ  . ARG B  1 86  ? 23.921  32.906  29.087 1.00 66.68  ? 86  ARG B CZ  1 
ATOM   3065 N  NH1 . ARG B  1 86  ? 24.900  32.189  28.549 1.00 71.38  ? 86  ARG B NH1 1 
ATOM   3066 N  NH2 . ARG B  1 86  ? 24.172  34.129  29.527 1.00 73.66  ? 86  ARG B NH2 1 
ATOM   3067 N  N   . ASP B  1 87  ? 23.063  31.528  23.993 1.00 47.51  ? 87  ASP B N   1 
ATOM   3068 C  CA  . ASP B  1 87  ? 24.330  32.019  23.473 1.00 43.94  ? 87  ASP B CA  1 
ATOM   3069 C  C   . ASP B  1 87  ? 24.695  31.561  22.059 1.00 43.15  ? 87  ASP B C   1 
ATOM   3070 O  O   . ASP B  1 87  ? 24.593  30.382  21.724 1.00 47.62  ? 87  ASP B O   1 
ATOM   3071 C  CB  . ASP B  1 87  ? 25.414  31.607  24.476 1.00 53.24  ? 87  ASP B CB  1 
ATOM   3072 C  CG  . ASP B  1 87  ? 26.790  31.965  24.027 1.00 52.57  ? 87  ASP B CG  1 
ATOM   3073 O  OD1 . ASP B  1 87  ? 27.135  33.167  24.066 1.00 70.40  ? 87  ASP B OD1 1 
ATOM   3074 O  OD2 . ASP B  1 87  ? 27.525  31.037  23.632 1.00 56.11  ? 87  ASP B OD2 1 
ATOM   3075 N  N   . LYS B  1 88  ? 25.149  32.510  21.248 1.00 38.76  ? 88  LYS B N   1 
ATOM   3076 C  CA  . LYS B  1 88  ? 25.522  32.258  19.859 1.00 42.09  ? 88  LYS B CA  1 
ATOM   3077 C  C   . LYS B  1 88  ? 26.593  31.189  19.638 1.00 46.26  ? 88  LYS B C   1 
ATOM   3078 O  O   . LYS B  1 88  ? 26.432  30.324  18.775 1.00 43.08  ? 88  LYS B O   1 
ATOM   3079 C  CB  . LYS B  1 88  ? 25.954  33.574  19.205 1.00 44.73  ? 88  LYS B CB  1 
ATOM   3080 C  CG  . LYS B  1 88  ? 26.460  33.436  17.781 1.00 48.53  ? 88  LYS B CG  1 
ATOM   3081 C  CD  . LYS B  1 88  ? 26.773  34.803  17.177 1.00 52.45  ? 88  LYS B CD  1 
ATOM   3082 C  CE  . LYS B  1 88  ? 27.286  34.671  15.750 1.00 50.25  ? 88  LYS B CE  1 
ATOM   3083 N  NZ  . LYS B  1 88  ? 27.624  35.999  15.165 1.00 62.77  ? 88  LYS B NZ  1 
ATOM   3084 N  N   . SER B  1 89  ? 27.685  31.237  20.398 1.00 39.79  ? 89  SER B N   1 
ATOM   3085 C  CA  . SER B  1 89  ? 28.741  30.240  20.227 1.00 44.42  ? 89  SER B CA  1 
ATOM   3086 C  C   . SER B  1 89  ? 28.232  28.862  20.635 1.00 47.80  ? 89  SER B C   1 
ATOM   3087 O  O   . SER B  1 89  ? 28.698  27.841  20.126 1.00 44.26  ? 89  SER B O   1 
ATOM   3088 C  CB  . SER B  1 89  ? 29.975  30.602  21.055 1.00 41.17  ? 89  SER B CB  1 
ATOM   3089 O  OG  . SER B  1 89  ? 29.637  30.772  22.416 1.00 53.41  ? 89  SER B OG  1 
ATOM   3090 N  N   . PHE B  1 90  ? 27.276  28.841  21.560 1.00 34.44  ? 90  PHE B N   1 
ATOM   3091 C  CA  . PHE B  1 90  ? 26.695  27.589  22.019 1.00 38.70  ? 90  PHE B CA  1 
ATOM   3092 C  C   . PHE B  1 90  ? 25.825  27.070  20.882 1.00 34.71  ? 90  PHE B C   1 
ATOM   3093 O  O   . PHE B  1 90  ? 25.917  25.904  20.495 1.00 40.74  ? 90  PHE B O   1 
ATOM   3094 C  CB  . PHE B  1 90  ? 25.824  27.812  23.262 1.00 39.02  ? 90  PHE B CB  1 
ATOM   3095 C  CG  . PHE B  1 90  ? 25.447  26.539  23.969 1.00 47.59  ? 90  PHE B CG  1 
ATOM   3096 C  CD1 . PHE B  1 90  ? 26.252  26.028  24.987 1.00 44.06  ? 90  PHE B CD1 1 
ATOM   3097 C  CD2 . PHE B  1 90  ? 24.299  25.836  23.603 1.00 37.07  ? 90  PHE B CD2 1 
ATOM   3098 C  CE1 . PHE B  1 90  ? 25.922  24.837  25.633 1.00 37.85  ? 90  PHE B CE1 1 
ATOM   3099 C  CE2 . PHE B  1 90  ? 23.960  24.644  24.244 1.00 44.20  ? 90  PHE B CE2 1 
ATOM   3100 C  CZ  . PHE B  1 90  ? 24.774  24.144  25.262 1.00 37.44  ? 90  PHE B CZ  1 
ATOM   3101 N  N   . LEU B  1 91  ? 24.980  27.949  20.350 1.00 34.80  ? 91  LEU B N   1 
ATOM   3102 C  CA  . LEU B  1 91  ? 24.099  27.580  19.249 1.00 34.57  ? 91  LEU B CA  1 
ATOM   3103 C  C   . LEU B  1 91  ? 24.941  27.110  18.064 1.00 43.22  ? 91  LEU B C   1 
ATOM   3104 O  O   . LEU B  1 91  ? 24.591  26.147  17.379 1.00 41.80  ? 91  LEU B O   1 
ATOM   3105 C  CB  . LEU B  1 91  ? 23.226  28.771  18.845 1.00 37.49  ? 91  LEU B CB  1 
ATOM   3106 C  CG  . LEU B  1 91  ? 22.160  28.489  17.777 1.00 40.95  ? 91  LEU B CG  1 
ATOM   3107 C  CD1 . LEU B  1 91  ? 21.273  27.334  18.218 1.00 33.74  ? 91  LEU B CD1 1 
ATOM   3108 C  CD2 . LEU B  1 91  ? 21.329  29.737  17.544 1.00 37.86  ? 91  LEU B CD2 1 
ATOM   3109 N  N   . ALA B  1 92  ? 26.065  27.785  17.835 1.00 40.62  ? 92  ALA B N   1 
ATOM   3110 C  CA  . ALA B  1 92  ? 26.957  27.419  16.744 1.00 37.34  ? 92  ALA B CA  1 
ATOM   3111 C  C   . ALA B  1 92  ? 27.503  26.011  16.967 1.00 41.22  ? 92  ALA B C   1 
ATOM   3112 O  O   . ALA B  1 92  ? 27.630  25.225  16.024 1.00 43.52  ? 92  ALA B O   1 
ATOM   3113 C  CB  . ALA B  1 92  ? 28.107  28.421  16.645 1.00 37.05  ? 92  ALA B CB  1 
ATOM   3114 N  N   . MET B  1 93  ? 27.818  25.689  18.218 1.00 41.28  ? 93  MET B N   1 
ATOM   3115 C  CA  . MET B  1 93  ? 28.349  24.369  18.543 1.00 35.09  ? 93  MET B CA  1 
ATOM   3116 C  C   . MET B  1 93  ? 27.261  23.315  18.364 1.00 40.61  ? 93  MET B C   1 
ATOM   3117 O  O   . MET B  1 93  ? 27.527  22.201  17.904 1.00 42.25  ? 93  MET B O   1 
ATOM   3118 C  CB  . MET B  1 93  ? 28.875  24.345  19.982 1.00 39.84  ? 93  MET B CB  1 
ATOM   3119 C  CG  . MET B  1 93  ? 29.520  23.026  20.400 1.00 39.24  ? 93  MET B CG  1 
ATOM   3120 S  SD  . MET B  1 93  ? 30.888  22.516  19.330 1.00 47.04  ? 93  MET B SD  1 
ATOM   3121 C  CE  . MET B  1 93  ? 32.083  23.758  19.711 1.00 46.36  ? 93  MET B CE  1 
ATOM   3122 N  N   . VAL B  1 94  ? 26.037  23.662  18.744 1.00 37.02  ? 94  VAL B N   1 
ATOM   3123 C  CA  . VAL B  1 94  ? 24.921  22.741  18.590 1.00 42.86  ? 94  VAL B CA  1 
ATOM   3124 C  C   . VAL B  1 94  ? 24.800  22.404  17.102 1.00 38.93  ? 94  VAL B C   1 
ATOM   3125 O  O   . VAL B  1 94  ? 24.611  21.247  16.732 1.00 43.58  ? 94  VAL B O   1 
ATOM   3126 C  CB  . VAL B  1 94  ? 23.605  23.370  19.102 1.00 38.28  ? 94  VAL B CB  1 
ATOM   3127 C  CG1 . VAL B  1 94  ? 22.420  22.551  18.650 1.00 36.28  ? 94  VAL B CG1 1 
ATOM   3128 C  CG2 . VAL B  1 94  ? 23.625  23.439  20.616 1.00 32.87  ? 94  VAL B CG2 1 
ATOM   3129 N  N   . VAL B  1 95  ? 24.939  23.419  16.255 1.00 46.56  ? 95  VAL B N   1 
ATOM   3130 C  CA  . VAL B  1 95  ? 24.862  23.230  14.810 1.00 43.88  ? 95  VAL B CA  1 
ATOM   3131 C  C   . VAL B  1 95  ? 25.911  22.245  14.298 1.00 45.50  ? 95  VAL B C   1 
ATOM   3132 O  O   . VAL B  1 95  ? 25.595  21.362  13.498 1.00 43.99  ? 95  VAL B O   1 
ATOM   3133 C  CB  . VAL B  1 95  ? 25.022  24.578  14.068 1.00 40.85  ? 95  VAL B CB  1 
ATOM   3134 C  CG1 . VAL B  1 95  ? 25.270  24.342  12.582 1.00 36.62  ? 95  VAL B CG1 1 
ATOM   3135 C  CG2 . VAL B  1 95  ? 23.769  25.417  14.267 1.00 34.77  ? 95  VAL B CG2 1 
ATOM   3136 N  N   . ASP B  1 96  ? 27.153  22.393  14.757 1.00 43.68  ? 96  ASP B N   1 
ATOM   3137 C  CA  . ASP B  1 96  ? 28.235  21.504  14.333 1.00 39.42  ? 96  ASP B CA  1 
ATOM   3138 C  C   . ASP B  1 96  ? 28.000  20.074  14.799 1.00 46.88  ? 96  ASP B C   1 
ATOM   3139 O  O   . ASP B  1 96  ? 28.338  19.119  14.098 1.00 51.24  ? 96  ASP B O   1 
ATOM   3140 C  CB  . ASP B  1 96  ? 29.593  21.983  14.869 1.00 51.75  ? 96  ASP B CB  1 
ATOM   3141 C  CG  . ASP B  1 96  ? 30.008  23.335  14.309 1.00 57.42  ? 96  ASP B CG  1 
ATOM   3142 O  OD1 . ASP B  1 96  ? 29.661  23.640  13.149 1.00 56.45  ? 96  ASP B OD1 1 
ATOM   3143 O  OD2 . ASP B  1 96  ? 30.700  24.089  15.026 1.00 63.34  ? 96  ASP B OD2 1 
ATOM   3144 N  N   . ILE B  1 97  ? 27.430  19.925  15.989 1.00 44.78  ? 97  ILE B N   1 
ATOM   3145 C  CA  . ILE B  1 97  ? 27.163  18.598  16.524 1.00 38.51  ? 97  ILE B CA  1 
ATOM   3146 C  C   . ILE B  1 97  ? 26.068  17.913  15.709 1.00 38.45  ? 97  ILE B C   1 
ATOM   3147 O  O   . ILE B  1 97  ? 26.202  16.751  15.335 1.00 36.70  ? 97  ILE B O   1 
ATOM   3148 C  CB  . ILE B  1 97  ? 26.757  18.680  18.016 1.00 42.05  ? 97  ILE B CB  1 
ATOM   3149 C  CG1 . ILE B  1 97  ? 27.975  19.084  18.850 1.00 44.56  ? 97  ILE B CG1 1 
ATOM   3150 C  CG2 . ILE B  1 97  ? 26.215  17.344  18.499 1.00 34.27  ? 97  ILE B CG2 1 
ATOM   3151 C  CD1 . ILE B  1 97  ? 27.665  19.326  20.308 1.00 53.09  ? 97  ILE B CD1 1 
ATOM   3152 N  N   . VAL B  1 98  ? 24.989  18.634  15.424 1.00 36.28  ? 98  VAL B N   1 
ATOM   3153 C  CA  . VAL B  1 98  ? 23.900  18.060  14.641 1.00 42.38  ? 98  VAL B CA  1 
ATOM   3154 C  C   . VAL B  1 98  ? 24.398  17.671  13.251 1.00 38.97  ? 98  VAL B C   1 
ATOM   3155 O  O   . VAL B  1 98  ? 24.081  16.599  12.734 1.00 44.47  ? 98  VAL B O   1 
ATOM   3156 C  CB  . VAL B  1 98  ? 22.741  19.058  14.498 1.00 35.31  ? 98  VAL B CB  1 
ATOM   3157 C  CG1 . VAL B  1 98  ? 21.717  18.524  13.510 1.00 39.78  ? 98  VAL B CG1 1 
ATOM   3158 C  CG2 . VAL B  1 98  ? 22.102  19.293  15.860 1.00 28.71  ? 98  VAL B CG2 1 
ATOM   3159 N  N   . GLN B  1 99  ? 25.190  18.554  12.659 1.00 41.77  ? 99  GLN B N   1 
ATOM   3160 C  CA  . GLN B  1 99  ? 25.747  18.333  11.338 1.00 46.78  ? 99  GLN B CA  1 
ATOM   3161 C  C   . GLN B  1 99  ? 26.530  17.020  11.296 1.00 46.93  ? 99  GLN B C   1 
ATOM   3162 O  O   . GLN B  1 99  ? 26.405  16.248  10.350 1.00 45.29  ? 99  GLN B O   1 
ATOM   3163 C  CB  . GLN B  1 99  ? 26.654  19.506  10.976 1.00 51.39  ? 99  GLN B CB  1 
ATOM   3164 C  CG  . GLN B  1 99  ? 26.777  19.767  9.497  1.00 65.70  ? 99  GLN B CG  1 
ATOM   3165 C  CD  . GLN B  1 99  ? 27.305  21.159  9.217  1.00 84.92  ? 99  GLN B CD  1 
ATOM   3166 O  OE1 . GLN B  1 99  ? 26.726  22.155  9.658  1.00 80.40  ? 99  GLN B OE1 1 
ATOM   3167 N  NE2 . GLN B  1 99  ? 28.410  21.238  8.483  1.00 88.25  ? 99  GLN B NE2 1 
ATOM   3168 N  N   . GLU B  1 100 ? 27.329  16.763  12.328 1.00 46.39  ? 100 GLU B N   1 
ATOM   3169 C  CA  . GLU B  1 100 ? 28.116  15.534  12.386 1.00 42.44  ? 100 GLU B CA  1 
ATOM   3170 C  C   . GLU B  1 100 ? 27.244  14.315  12.660 1.00 47.88  ? 100 GLU B C   1 
ATOM   3171 O  O   . GLU B  1 100 ? 27.455  13.249  12.077 1.00 47.64  ? 100 GLU B O   1 
ATOM   3172 C  CB  . GLU B  1 100 ? 29.203  15.640  13.458 1.00 48.47  ? 100 GLU B CB  1 
ATOM   3173 C  CG  . GLU B  1 100 ? 30.131  14.433  13.498 1.00 73.68  ? 100 GLU B CG  1 
ATOM   3174 C  CD  . GLU B  1 100 ? 31.363  14.667  14.350 1.00 81.34  ? 100 GLU B CD  1 
ATOM   3175 O  OE1 . GLU B  1 100 ? 32.120  15.613  14.046 1.00 86.73  ? 100 GLU B OE1 1 
ATOM   3176 O  OE2 . GLU B  1 100 ? 31.576  13.906  15.319 1.00 76.55  ? 100 GLU B OE2 1 
ATOM   3177 N  N   . LEU B  1 101 ? 26.266  14.466  13.549 1.00 46.73  ? 101 LEU B N   1 
ATOM   3178 C  CA  . LEU B  1 101 ? 25.373  13.358  13.861 1.00 42.36  ? 101 LEU B CA  1 
ATOM   3179 C  C   . LEU B  1 101 ? 24.570  12.968  12.615 1.00 45.19  ? 101 LEU B C   1 
ATOM   3180 O  O   . LEU B  1 101 ? 24.245  11.792  12.423 1.00 36.73  ? 101 LEU B O   1 
ATOM   3181 C  CB  . LEU B  1 101 ? 24.432  13.732  15.013 1.00 50.76  ? 101 LEU B CB  1 
ATOM   3182 C  CG  . LEU B  1 101 ? 25.088  13.937  16.387 1.00 46.03  ? 101 LEU B CG  1 
ATOM   3183 C  CD1 . LEU B  1 101 ? 24.046  14.356  17.406 1.00 40.26  ? 101 LEU B CD1 1 
ATOM   3184 C  CD2 . LEU B  1 101 ? 25.761  12.649  16.830 1.00 48.83  ? 101 LEU B CD2 1 
ATOM   3185 N  N   . LYS B  1 102 ? 24.265  13.948  11.765 1.00 31.78  ? 102 LYS B N   1 
ATOM   3186 C  CA  . LYS B  1 102 ? 23.516  13.672  10.538 1.00 50.19  ? 102 LYS B CA  1 
ATOM   3187 C  C   . LYS B  1 102 ? 24.385  12.968  9.502  1.00 55.31  ? 102 LYS B C   1 
ATOM   3188 O  O   . LYS B  1 102 ? 23.875  12.361  8.563  1.00 53.50  ? 102 LYS B O   1 
ATOM   3189 C  CB  . LYS B  1 102 ? 22.937  14.955  9.938  1.00 41.59  ? 102 LYS B CB  1 
ATOM   3190 C  CG  . LYS B  1 102 ? 21.704  15.455  10.662 1.00 52.34  ? 102 LYS B CG  1 
ATOM   3191 C  CD  . LYS B  1 102 ? 20.843  16.307  9.751  1.00 52.25  ? 102 LYS B CD  1 
ATOM   3192 C  CE  . LYS B  1 102 ? 19.475  16.545  10.352 1.00 46.73  ? 102 LYS B CE  1 
ATOM   3193 N  NZ  . LYS B  1 102 ? 18.529  17.065  9.333  1.00 50.31  ? 102 LYS B NZ  1 
ATOM   3194 N  N   . GLN B  1 103 ? 25.701  13.061  9.672  1.00 58.83  ? 103 GLN B N   1 
ATOM   3195 C  CA  . GLN B  1 103 ? 26.630  12.390  8.775  1.00 51.40  ? 103 GLN B CA  1 
ATOM   3196 C  C   . GLN B  1 103 ? 26.634  10.923  9.194  1.00 53.35  ? 103 GLN B C   1 
ATOM   3197 O  O   . GLN B  1 103 ? 26.587  10.028  8.357  1.00 55.31  ? 103 GLN B O   1 
ATOM   3198 C  CB  . GLN B  1 103 ? 28.030  12.983  8.917  1.00 64.16  ? 103 GLN B CB  1 
ATOM   3199 C  CG  . GLN B  1 103 ? 28.173  14.381  8.345  1.00 73.51  ? 103 GLN B CG  1 
ATOM   3200 C  CD  . GLN B  1 103 ? 29.431  15.077  8.825  1.00 85.14  ? 103 GLN B CD  1 
ATOM   3201 O  OE1 . GLN B  1 103 ? 30.524  14.510  8.780  1.00 97.85  ? 103 GLN B OE1 1 
ATOM   3202 N  NE2 . GLN B  1 103 ? 29.284  16.315  9.284  1.00 84.42  ? 103 GLN B NE2 1 
ATOM   3203 N  N   . GLN B  1 104 ? 26.685  10.684  10.501 1.00 47.65  ? 104 GLN B N   1 
ATOM   3204 C  CA  . GLN B  1 104 ? 26.666  9.321   11.021 1.00 58.11  ? 104 GLN B CA  1 
ATOM   3205 C  C   . GLN B  1 104 ? 25.341  8.680   10.625 1.00 58.40  ? 104 GLN B C   1 
ATOM   3206 O  O   . GLN B  1 104 ? 25.306  7.552   10.139 1.00 68.02  ? 104 GLN B O   1 
ATOM   3207 C  CB  . GLN B  1 104 ? 26.776  9.310   12.551 1.00 59.41  ? 104 GLN B CB  1 
ATOM   3208 C  CG  . GLN B  1 104 ? 28.025  9.954   13.125 1.00 71.08  ? 104 GLN B CG  1 
ATOM   3209 C  CD  . GLN B  1 104 ? 29.299  9.295   12.643 1.00 82.57  ? 104 GLN B CD  1 
ATOM   3210 O  OE1 . GLN B  1 104 ? 29.437  8.072   12.693 1.00 81.99  ? 104 GLN B OE1 1 
ATOM   3211 N  NE2 . GLN B  1 104 ? 30.244  10.105  12.179 1.00 86.81  ? 104 GLN B NE2 1 
ATOM   3212 N  N   . ASN B  1 105 ? 24.252  9.415   10.838 1.00 54.38  ? 105 ASN B N   1 
ATOM   3213 C  CA  . ASN B  1 105 ? 22.916  8.928   10.521 1.00 47.63  ? 105 ASN B CA  1 
ATOM   3214 C  C   . ASN B  1 105 ? 22.131  9.955   9.710  1.00 52.94  ? 105 ASN B C   1 
ATOM   3215 O  O   . ASN B  1 105 ? 21.537  10.876  10.266 1.00 51.57  ? 105 ASN B O   1 
ATOM   3216 C  CB  . ASN B  1 105 ? 22.168  8.596   11.817 1.00 45.15  ? 105 ASN B CB  1 
ATOM   3217 C  CG  . ASN B  1 105 ? 20.739  8.161   11.573 1.00 45.80  ? 105 ASN B CG  1 
ATOM   3218 O  OD1 . ASN B  1 105 ? 20.348  7.874   10.443 1.00 45.66  ? 105 ASN B OD1 1 
ATOM   3219 N  ND2 . ASN B  1 105 ? 19.950  8.099   12.640 1.00 44.57  ? 105 ASN B ND2 1 
ATOM   3220 N  N   . PRO B  1 106 ? 22.113  9.798   8.376  1.00 53.95  ? 106 PRO B N   1 
ATOM   3221 C  CA  . PRO B  1 106 ? 21.405  10.705  7.462  1.00 48.45  ? 106 PRO B CA  1 
ATOM   3222 C  C   . PRO B  1 106 ? 19.896  10.715  7.685  1.00 44.73  ? 106 PRO B C   1 
ATOM   3223 O  O   . PRO B  1 106 ? 19.197  11.617  7.225  1.00 49.12  ? 106 PRO B O   1 
ATOM   3224 C  CB  . PRO B  1 106 ? 21.772  10.164  6.078  1.00 46.85  ? 106 PRO B CB  1 
ATOM   3225 C  CG  . PRO B  1 106 ? 23.086  9.476   6.307  1.00 51.19  ? 106 PRO B CG  1 
ATOM   3226 C  CD  . PRO B  1 106 ? 22.842  8.770   7.617  1.00 47.71  ? 106 PRO B CD  1 
ATOM   3227 N  N   . ARG B  1 107 ? 19.398  9.705   8.389  1.00 43.61  ? 107 ARG B N   1 
ATOM   3228 C  CA  . ARG B  1 107 ? 17.973  9.605   8.661  1.00 42.53  ? 107 ARG B CA  1 
ATOM   3229 C  C   . ARG B  1 107 ? 17.634  10.308  9.966  1.00 48.46  ? 107 ARG B C   1 
ATOM   3230 O  O   . ARG B  1 107 ? 16.482  10.317  10.398 1.00 40.24  ? 107 ARG B O   1 
ATOM   3231 C  CB  . ARG B  1 107 ? 17.557  8.136   8.746  1.00 46.08  ? 107 ARG B CB  1 
ATOM   3232 C  CG  . ARG B  1 107 ? 17.844  7.322   7.488  1.00 50.83  ? 107 ARG B CG  1 
ATOM   3233 C  CD  . ARG B  1 107 ? 17.510  5.851   7.712  1.00 68.57  ? 107 ARG B CD  1 
ATOM   3234 N  NE  . ARG B  1 107 ? 17.881  5.000   6.581  1.00 91.40  ? 107 ARG B NE  1 
ATOM   3235 C  CZ  . ARG B  1 107 ? 17.292  5.031   5.389  1.00 95.76  ? 107 ARG B CZ  1 
ATOM   3236 N  NH1 . ARG B  1 107 ? 16.294  5.873   5.155  1.00 100.00 ? 107 ARG B NH1 1 
ATOM   3237 N  NH2 . ARG B  1 107 ? 17.699  4.213   4.427  1.00 96.61  ? 107 ARG B NH2 1 
ATOM   3238 N  N   . LEU B  1 108 ? 18.643  10.898  10.597 1.00 41.90  ? 108 LEU B N   1 
ATOM   3239 C  CA  . LEU B  1 108 ? 18.428  11.595  11.855 1.00 45.19  ? 108 LEU B CA  1 
ATOM   3240 C  C   . LEU B  1 108 ? 17.447  12.756  11.708 1.00 34.41  ? 108 LEU B C   1 
ATOM   3241 O  O   . LEU B  1 108 ? 17.550  13.559  10.783 1.00 41.60  ? 108 LEU B O   1 
ATOM   3242 C  CB  . LEU B  1 108 ? 19.766  12.097  12.404 1.00 38.10  ? 108 LEU B CB  1 
ATOM   3243 C  CG  . LEU B  1 108 ? 19.751  12.814  13.754 1.00 41.45  ? 108 LEU B CG  1 
ATOM   3244 C  CD1 . LEU B  1 108 ? 21.074  12.597  14.438 1.00 36.84  ? 108 LEU B CD1 1 
ATOM   3245 C  CD2 . LEU B  1 108 ? 19.467  14.292  13.569 1.00 37.11  ? 108 LEU B CD2 1 
ATOM   3246 N  N   . VAL B  1 109 ? 16.492  12.831  12.629 1.00 31.06  ? 109 VAL B N   1 
ATOM   3247 C  CA  . VAL B  1 109 ? 15.493  13.892  12.632 1.00 32.18  ? 109 VAL B CA  1 
ATOM   3248 C  C   . VAL B  1 109 ? 15.817  14.929  13.711 1.00 38.67  ? 109 VAL B C   1 
ATOM   3249 O  O   . VAL B  1 109 ? 15.837  14.611  14.899 1.00 34.70  ? 109 VAL B O   1 
ATOM   3250 C  CB  . VAL B  1 109 ? 14.078  13.327  12.906 1.00 39.44  ? 109 VAL B CB  1 
ATOM   3251 C  CG1 . VAL B  1 109 ? 13.082  14.468  13.050 1.00 28.80  ? 109 VAL B CG1 1 
ATOM   3252 C  CG2 . VAL B  1 109 ? 13.658  12.384  11.773 1.00 38.36  ? 109 VAL B CG2 1 
ATOM   3253 N  N   . TYR B  1 110 ? 16.071  16.165  13.291 1.00 33.71  ? 110 TYR B N   1 
ATOM   3254 C  CA  . TYR B  1 110 ? 16.381  17.244  14.225 1.00 33.07  ? 110 TYR B CA  1 
ATOM   3255 C  C   . TYR B  1 110 ? 15.117  18.065  14.500 1.00 39.84  ? 110 TYR B C   1 
ATOM   3256 O  O   . TYR B  1 110 ? 14.617  18.771  13.622 1.00 39.44  ? 110 TYR B O   1 
ATOM   3257 C  CB  . TYR B  1 110 ? 17.491  18.150  13.649 1.00 31.06  ? 110 TYR B CB  1 
ATOM   3258 C  CG  . TYR B  1 110 ? 17.828  19.382  14.483 1.00 32.35  ? 110 TYR B CG  1 
ATOM   3259 C  CD1 . TYR B  1 110 ? 18.480  20.476  13.910 1.00 32.07  ? 110 TYR B CD1 1 
ATOM   3260 C  CD2 . TYR B  1 110 ? 17.489  19.457  15.836 1.00 29.26  ? 110 TYR B CD2 1 
ATOM   3261 C  CE1 . TYR B  1 110 ? 18.780  21.614  14.660 1.00 38.22  ? 110 TYR B CE1 1 
ATOM   3262 C  CE2 . TYR B  1 110 ? 17.785  20.588  16.595 1.00 29.17  ? 110 TYR B CE2 1 
ATOM   3263 C  CZ  . TYR B  1 110 ? 18.427  21.664  15.999 1.00 31.49  ? 110 TYR B CZ  1 
ATOM   3264 O  OH  . TYR B  1 110 ? 18.691  22.796  16.737 1.00 33.45  ? 110 TYR B OH  1 
ATOM   3265 N  N   . VAL B  1 111 ? 14.597  17.939  15.718 1.00 32.43  ? 111 VAL B N   1 
ATOM   3266 C  CA  . VAL B  1 111 ? 13.412  18.675  16.151 1.00 25.57  ? 111 VAL B CA  1 
ATOM   3267 C  C   . VAL B  1 111 ? 13.924  19.954  16.806 1.00 39.33  ? 111 VAL B C   1 
ATOM   3268 O  O   . VAL B  1 111 ? 14.692  19.911  17.775 1.00 34.34  ? 111 VAL B O   1 
ATOM   3269 C  CB  . VAL B  1 111 ? 12.594  17.860  17.174 1.00 28.81  ? 111 VAL B CB  1 
ATOM   3270 C  CG1 . VAL B  1 111 ? 11.370  18.649  17.611 1.00 31.23  ? 111 VAL B CG1 1 
ATOM   3271 C  CG2 . VAL B  1 111 ? 12.192  16.505  16.556 1.00 25.65  ? 111 VAL B CG2 1 
ATOM   3272 N  N   . CYS B  1 112 ? 13.505  21.095  16.277 1.00 31.62  ? 112 CYS B N   1 
ATOM   3273 C  CA  . CYS B  1 112 ? 13.975  22.368  16.795 1.00 30.33  ? 112 CYS B CA  1 
ATOM   3274 C  C   . CYS B  1 112 ? 12.899  23.370  17.166 1.00 39.68  ? 112 CYS B C   1 
ATOM   3275 O  O   . CYS B  1 112 ? 12.083  23.765  16.333 1.00 33.49  ? 112 CYS B O   1 
ATOM   3276 C  CB  . CYS B  1 112 ? 14.930  23.012  15.775 1.00 30.83  ? 112 CYS B CB  1 
ATOM   3277 S  SG  . CYS B  1 112 ? 15.384  24.749  16.112 1.00 39.18  ? 112 CYS B SG  1 
ATOM   3278 N  N   . ASP B  1 113 ? 12.896  23.765  18.433 1.00 35.49  ? 113 ASP B N   1 
ATOM   3279 C  CA  . ASP B  1 113 ? 11.972  24.783  18.909 1.00 30.57  ? 113 ASP B CA  1 
ATOM   3280 C  C   . ASP B  1 113 ? 12.846  26.044  18.831 1.00 34.45  ? 113 ASP B C   1 
ATOM   3281 O  O   . ASP B  1 113 ? 13.721  26.255  19.676 1.00 34.62  ? 113 ASP B O   1 
ATOM   3282 C  CB  . ASP B  1 113 ? 11.553  24.489  20.349 1.00 26.11  ? 113 ASP B CB  1 
ATOM   3283 C  CG  . ASP B  1 113 ? 10.498  25.444  20.843 1.00 34.87  ? 113 ASP B CG  1 
ATOM   3284 O  OD1 . ASP B  1 113 ? 10.053  25.297  21.995 1.00 38.53  ? 113 ASP B OD1 1 
ATOM   3285 O  OD2 . ASP B  1 113 ? 10.117  26.345  20.070 1.00 37.86  ? 113 ASP B OD2 1 
ATOM   3286 N  N   . PRO B  1 114 ? 12.636  26.885  17.801 1.00 33.94  ? 114 PRO B N   1 
ATOM   3287 C  CA  . PRO B  1 114 ? 13.422  28.113  17.610 1.00 39.12  ? 114 PRO B CA  1 
ATOM   3288 C  C   . PRO B  1 114 ? 13.021  29.272  18.516 1.00 40.35  ? 114 PRO B C   1 
ATOM   3289 O  O   . PRO B  1 114 ? 12.479  30.277  18.051 1.00 33.98  ? 114 PRO B O   1 
ATOM   3290 C  CB  . PRO B  1 114 ? 13.198  28.420  16.131 1.00 40.14  ? 114 PRO B CB  1 
ATOM   3291 C  CG  . PRO B  1 114 ? 11.754  28.087  15.969 1.00 38.04  ? 114 PRO B CG  1 
ATOM   3292 C  CD  . PRO B  1 114 ? 11.606  26.762  16.752 1.00 41.53  ? 114 PRO B CD  1 
ATOM   3293 N  N   . VAL B  1 115 ? 13.318  29.138  19.804 1.00 37.02  ? 115 VAL B N   1 
ATOM   3294 C  CA  . VAL B  1 115 ? 12.957  30.160  20.780 1.00 39.91  ? 115 VAL B CA  1 
ATOM   3295 C  C   . VAL B  1 115 ? 13.675  31.483  20.531 1.00 31.00  ? 115 VAL B C   1 
ATOM   3296 O  O   . VAL B  1 115 ? 14.902  31.550  20.538 1.00 41.53  ? 115 VAL B O   1 
ATOM   3297 C  CB  . VAL B  1 115 ? 13.250  29.664  22.212 1.00 28.49  ? 115 VAL B CB  1 
ATOM   3298 C  CG1 . VAL B  1 115 ? 12.795  30.691  23.215 1.00 28.16  ? 115 VAL B CG1 1 
ATOM   3299 C  CG2 . VAL B  1 115 ? 12.537  28.328  22.454 1.00 33.28  ? 115 VAL B CG2 1 
ATOM   3300 N  N   . LEU B  1 116 ? 12.894  32.531  20.297 1.00 37.86  ? 116 LEU B N   1 
ATOM   3301 C  CA  . LEU B  1 116 ? 13.441  33.858  20.027 1.00 41.83  ? 116 LEU B CA  1 
ATOM   3302 C  C   . LEU B  1 116 ? 12.704  34.927  20.830 1.00 33.88  ? 116 LEU B C   1 
ATOM   3303 O  O   . LEU B  1 116 ? 13.297  35.918  21.246 1.00 39.43  ? 116 LEU B O   1 
ATOM   3304 C  CB  . LEU B  1 116 ? 13.333  34.183  18.534 1.00 33.56  ? 116 LEU B CB  1 
ATOM   3305 C  CG  . LEU B  1 116 ? 14.095  33.284  17.556 1.00 38.90  ? 116 LEU B CG  1 
ATOM   3306 C  CD1 . LEU B  1 116 ? 13.604  33.527  16.138 1.00 33.73  ? 116 LEU B CD1 1 
ATOM   3307 C  CD2 . LEU B  1 116 ? 15.582  33.557  17.665 1.00 41.19  ? 116 LEU B CD2 1 
ATOM   3308 N  N   . GLY B  1 117 ? 11.411  34.720  21.046 1.00 39.75  ? 117 GLY B N   1 
ATOM   3309 C  CA  . GLY B  1 117 ? 10.628  35.690  21.790 1.00 38.11  ? 117 GLY B CA  1 
ATOM   3310 C  C   . GLY B  1 117 ? 9.139   35.501  21.575 1.00 52.27  ? 117 GLY B C   1 
ATOM   3311 O  O   . GLY B  1 117 ? 8.706   34.449  21.101 1.00 48.37  ? 117 GLY B O   1 
ATOM   3312 N  N   . ASP B  1 118 ? 8.357   36.521  21.915 1.00 47.23  ? 118 ASP B N   1 
ATOM   3313 C  CA  . ASP B  1 118 ? 6.909   36.458  21.772 1.00 47.03  ? 118 ASP B CA  1 
ATOM   3314 C  C   . ASP B  1 118 ? 6.305   37.860  21.681 1.00 55.92  ? 118 ASP B C   1 
ATOM   3315 O  O   . ASP B  1 118 ? 7.026   38.852  21.560 1.00 49.99  ? 118 ASP B O   1 
ATOM   3316 C  CB  . ASP B  1 118 ? 6.304   35.724  22.967 1.00 45.69  ? 118 ASP B CB  1 
ATOM   3317 C  CG  . ASP B  1 118 ? 5.020   35.007  22.621 1.00 58.93  ? 118 ASP B CG  1 
ATOM   3318 O  OD1 . ASP B  1 118 ? 4.282   35.494  21.740 1.00 57.68  ? 118 ASP B OD1 1 
ATOM   3319 O  OD2 . ASP B  1 118 ? 4.742   33.958  23.239 1.00 60.23  ? 118 ASP B OD2 1 
ATOM   3320 N  N   . LYS B  1 119 ? 4.978   37.928  21.751 1.00 64.19  ? 119 LYS B N   1 
ATOM   3321 C  CA  . LYS B  1 119 ? 4.242   39.190  21.678 1.00 71.39  ? 119 LYS B CA  1 
ATOM   3322 C  C   . LYS B  1 119 ? 3.378   39.360  22.931 1.00 72.72  ? 119 LYS B C   1 
ATOM   3323 O  O   . LYS B  1 119 ? 2.994   38.373  23.559 1.00 65.84  ? 119 LYS B O   1 
ATOM   3324 C  CB  . LYS B  1 119 ? 3.319   39.197  20.456 1.00 77.04  ? 119 LYS B CB  1 
ATOM   3325 C  CG  . LYS B  1 119 ? 3.959   38.824  19.126 1.00 68.87  ? 119 LYS B CG  1 
ATOM   3326 C  CD  . LYS B  1 119 ? 2.873   38.346  18.159 1.00 82.08  ? 119 LYS B CD  1 
ATOM   3327 C  CE  . LYS B  1 119 ? 3.400   38.071  16.758 1.00 85.24  ? 119 LYS B CE  1 
ATOM   3328 N  NZ  . LYS B  1 119 ? 3.743   39.320  16.020 1.00 82.44  ? 119 LYS B NZ  1 
ATOM   3329 N  N   . TRP B  1 120 ? 3.075   40.610  23.281 1.00 80.26  ? 120 TRP B N   1 
ATOM   3330 C  CA  . TRP B  1 120 ? 2.234   40.939  24.440 1.00 89.98  ? 120 TRP B CA  1 
ATOM   3331 C  C   . TRP B  1 120 ? 1.609   42.312  24.251 1.00 95.52  ? 120 TRP B C   1 
ATOM   3332 O  O   . TRP B  1 120 ? 1.243   42.986  25.214 1.00 100.00 ? 120 TRP B O   1 
ATOM   3333 C  CB  . TRP B  1 120 ? 3.047   40.948  25.730 1.00 92.38  ? 120 TRP B CB  1 
ATOM   3334 C  CG  . TRP B  1 120 ? 3.530   39.614  26.134 1.00 97.70  ? 120 TRP B CG  1 
ATOM   3335 C  CD1 . TRP B  1 120 ? 2.794   38.589  26.658 1.00 100.00 ? 120 TRP B CD1 1 
ATOM   3336 C  CD2 . TRP B  1 120 ? 4.871   39.142  26.042 1.00 99.23  ? 120 TRP B CD2 1 
ATOM   3337 N  NE1 . TRP B  1 120 ? 3.603   37.504  26.901 1.00 100.00 ? 120 TRP B NE1 1 
ATOM   3338 C  CE2 . TRP B  1 120 ? 4.882   37.820  26.532 1.00 98.49  ? 120 TRP B CE2 1 
ATOM   3339 C  CE3 . TRP B  1 120 ? 6.068   39.712  25.592 1.00 95.79  ? 120 TRP B CE3 1 
ATOM   3340 C  CZ2 . TRP B  1 120 ? 6.045   37.060  26.584 1.00 100.00 ? 120 TRP B CZ2 1 
ATOM   3341 C  CZ3 . TRP B  1 120 ? 7.220   38.957  25.644 1.00 96.16  ? 120 TRP B CZ3 1 
ATOM   3342 C  CH2 . TRP B  1 120 ? 7.200   37.647  26.138 1.00 96.78  ? 120 TRP B CH2 1 
ATOM   3343 N  N   . ASP B  1 121 ? 1.511   42.719  22.993 1.00 100.00 ? 121 ASP B N   1 
ATOM   3344 C  CA  . ASP B  1 121 ? 0.931   43.997  22.609 1.00 100.00 ? 121 ASP B CA  1 
ATOM   3345 C  C   . ASP B  1 121 ? 0.540   43.828  21.155 1.00 100.00 ? 121 ASP B C   1 
ATOM   3346 O  O   . ASP B  1 121 ? -0.610  43.535  20.833 1.00 100.00 ? 121 ASP B O   1 
ATOM   3347 C  CB  . ASP B  1 121 ? 1.962   45.124  22.733 1.00 98.94  ? 121 ASP B CB  1 
ATOM   3348 C  CG  . ASP B  1 121 ? 2.221   45.525  24.171 1.00 100.00 ? 121 ASP B CG  1 
ATOM   3349 O  OD1 . ASP B  1 121 ? 1.259   45.939  24.852 1.00 100.00 ? 121 ASP B OD1 1 
ATOM   3350 O  OD2 . ASP B  1 121 ? 3.383   45.431  24.620 1.00 100.00 ? 121 ASP B OD2 1 
ATOM   3351 N  N   . GLY B  1 122 ? 1.525   44.003  20.286 1.00 99.92  ? 122 GLY B N   1 
ATOM   3352 C  CA  . GLY B  1 122 ? 1.320   43.853  18.861 1.00 100.00 ? 122 GLY B CA  1 
ATOM   3353 C  C   . GLY B  1 122 ? 2.653   43.410  18.304 1.00 100.00 ? 122 GLY B C   1 
ATOM   3354 O  O   . GLY B  1 122 ? 2.758   42.388  17.625 1.00 100.00 ? 122 GLY B O   1 
ATOM   3355 N  N   . GLU B  1 123 ? 3.679   44.193  18.616 1.00 100.00 ? 123 GLU B N   1 
ATOM   3356 C  CA  . GLU B  1 123 ? 5.040   43.910  18.184 1.00 100.00 ? 123 GLU B CA  1 
ATOM   3357 C  C   . GLU B  1 123 ? 5.812   43.458  19.421 1.00 97.61  ? 123 GLU B C   1 
ATOM   3358 O  O   . GLU B  1 123 ? 6.349   44.276  20.167 1.00 100.00 ? 123 GLU B O   1 
ATOM   3359 C  CB  . GLU B  1 123 ? 5.672   45.166  17.575 1.00 100.00 ? 123 GLU B CB  1 
ATOM   3360 C  CG  . GLU B  1 123 ? 4.920   45.696  16.355 1.00 100.00 ? 123 GLU B CG  1 
ATOM   3361 C  CD  . GLU B  1 123 ? 3.553   46.266  16.703 1.00 100.00 ? 123 GLU B CD  1 
ATOM   3362 O  OE1 . GLU B  1 123 ? 2.671   46.288  15.816 1.00 100.00 ? 123 GLU B OE1 1 
ATOM   3363 O  OE2 . GLU B  1 123 ? 3.364   46.703  17.860 1.00 100.00 ? 123 GLU B OE2 1 
ATOM   3364 N  N   . GLY B  1 124 ? 5.844   42.146  19.631 1.00 89.10  ? 124 GLY B N   1 
ATOM   3365 C  CA  . GLY B  1 124 ? 6.519   41.579  20.782 1.00 80.78  ? 124 GLY B CA  1 
ATOM   3366 C  C   . GLY B  1 124 ? 7.980   41.942  20.952 1.00 71.97  ? 124 GLY B C   1 
ATOM   3367 O  O   . GLY B  1 124 ? 8.471   42.904  20.366 1.00 69.28  ? 124 GLY B O   1 
ATOM   3368 N  N   . SER B  1 125 ? 8.675   41.156  21.767 1.00 63.38  ? 125 SER B N   1 
ATOM   3369 C  CA  . SER B  1 125 ? 10.088  41.378  22.046 1.00 61.69  ? 125 SER B CA  1 
ATOM   3370 C  C   . SER B  1 125 ? 10.825  40.046  22.128 1.00 56.59  ? 125 SER B C   1 
ATOM   3371 O  O   . SER B  1 125 ? 10.205  38.999  22.293 1.00 53.86  ? 125 SER B O   1 
ATOM   3372 C  CB  . SER B  1 125 ? 10.240  42.136  23.364 1.00 64.43  ? 125 SER B CB  1 
ATOM   3373 O  OG  . SER B  1 125 ? 9.644   41.411  24.423 1.00 61.78  ? 125 SER B OG  1 
ATOM   3374 N  N   . MET B  1 126 ? 12.150  40.090  22.033 1.00 50.70  ? 126 MET B N   1 
ATOM   3375 C  CA  . MET B  1 126 ? 12.951  38.877  22.072 1.00 55.09  ? 126 MET B CA  1 
ATOM   3376 C  C   . MET B  1 126 ? 13.411  38.418  23.460 1.00 59.28  ? 126 MET B C   1 
ATOM   3377 O  O   . MET B  1 126 ? 13.589  39.230  24.367 1.00 56.82  ? 126 MET B O   1 
ATOM   3378 C  CB  . MET B  1 126 ? 14.144  39.033  21.116 1.00 48.86  ? 126 MET B CB  1 
ATOM   3379 C  CG  . MET B  1 126 ? 13.746  38.801  19.645 1.00 30.52  ? 126 MET B CG  1 
ATOM   3380 S  SD  . MET B  1 126 ? 15.048  39.009  18.443 1.00 49.68  ? 126 MET B SD  1 
ATOM   3381 C  CE  . MET B  1 126 ? 16.045  37.587  18.762 1.00 38.74  ? 126 MET B CE  1 
ATOM   3382 N  N   . TYR B  1 127 ? 13.571  37.101  23.611 1.00 50.65  ? 127 TYR B N   1 
ATOM   3383 C  CA  . TYR B  1 127 ? 14.005  36.476  24.865 1.00 48.82  ? 127 TYR B CA  1 
ATOM   3384 C  C   . TYR B  1 127 ? 15.466  36.081  24.801 1.00 44.98  ? 127 TYR B C   1 
ATOM   3385 O  O   . TYR B  1 127 ? 16.026  35.612  25.787 1.00 53.26  ? 127 TYR B O   1 
ATOM   3386 C  CB  . TYR B  1 127 ? 13.277  35.161  25.138 1.00 52.99  ? 127 TYR B CB  1 
ATOM   3387 C  CG  . TYR B  1 127 ? 11.780  35.175  25.134 1.00 58.93  ? 127 TYR B CG  1 
ATOM   3388 C  CD1 . TYR B  1 127 ? 11.068  36.231  25.684 1.00 43.52  ? 127 TYR B CD1 1 
ATOM   3389 C  CD2 . TYR B  1 127 ? 11.074  34.062  24.672 1.00 54.92  ? 127 TYR B CD2 1 
ATOM   3390 C  CE1 . TYR B  1 127 ? 9.699   36.176  25.785 1.00 58.78  ? 127 TYR B CE1 1 
ATOM   3391 C  CE2 . TYR B  1 127 ? 9.702   33.996  24.770 1.00 61.16  ? 127 TYR B CE2 1 
ATOM   3392 C  CZ  . TYR B  1 127 ? 9.017   35.054  25.330 1.00 68.99  ? 127 TYR B CZ  1 
ATOM   3393 O  OH  . TYR B  1 127 ? 7.650   34.969  25.461 1.00 78.65  ? 127 TYR B OH  1 
ATOM   3394 N  N   . VAL B  1 128 ? 16.069  36.213  23.631 1.00 38.34  ? 128 VAL B N   1 
ATOM   3395 C  CA  . VAL B  1 128 ? 17.453  35.815  23.462 1.00 31.80  ? 128 VAL B CA  1 
ATOM   3396 C  C   . VAL B  1 128 ? 18.213  36.878  22.686 1.00 36.11  ? 128 VAL B C   1 
ATOM   3397 O  O   . VAL B  1 128 ? 17.613  37.742  22.055 1.00 42.38  ? 128 VAL B O   1 
ATOM   3398 C  CB  . VAL B  1 128 ? 17.537  34.459  22.702 1.00 47.71  ? 128 VAL B CB  1 
ATOM   3399 C  CG1 . VAL B  1 128 ? 16.623  33.429  23.367 1.00 42.86  ? 128 VAL B CG1 1 
ATOM   3400 C  CG2 . VAL B  1 128 ? 17.137  34.646  21.242 1.00 38.32  ? 128 VAL B CG2 1 
ATOM   3401 N  N   . PRO B  1 129 ? 19.552  36.845  22.746 1.00 44.91  ? 129 PRO B N   1 
ATOM   3402 C  CA  . PRO B  1 129 ? 20.356  37.831  22.021 1.00 42.13  ? 129 PRO B CA  1 
ATOM   3403 C  C   . PRO B  1 129 ? 19.931  37.888  20.551 1.00 51.84  ? 129 PRO B C   1 
ATOM   3404 O  O   . PRO B  1 129 ? 19.640  36.858  19.947 1.00 59.78  ? 129 PRO B O   1 
ATOM   3405 C  CB  . PRO B  1 129 ? 21.773  37.302  22.198 1.00 42.27  ? 129 PRO B CB  1 
ATOM   3406 C  CG  . PRO B  1 129 ? 21.725  36.720  23.580 1.00 37.40  ? 129 PRO B CG  1 
ATOM   3407 C  CD  . PRO B  1 129 ? 20.402  35.987  23.595 1.00 43.22  ? 129 PRO B CD  1 
ATOM   3408 N  N   . GLU B  1 130 ? 19.895  39.087  19.981 1.00 49.23  ? 130 GLU B N   1 
ATOM   3409 C  CA  . GLU B  1 130 ? 19.495  39.246  18.588 1.00 44.27  ? 130 GLU B CA  1 
ATOM   3410 C  C   . GLU B  1 130 ? 20.476  38.587  17.628 1.00 47.38  ? 130 GLU B C   1 
ATOM   3411 O  O   . GLU B  1 130 ? 20.110  38.235  16.505 1.00 44.39  ? 130 GLU B O   1 
ATOM   3412 C  CB  . GLU B  1 130 ? 19.351  40.735  18.235 1.00 37.39  ? 130 GLU B CB  1 
ATOM   3413 C  CG  . GLU B  1 130 ? 18.309  41.459  19.075 1.00 32.66  ? 130 GLU B CG  1 
ATOM   3414 C  CD  . GLU B  1 130 ? 18.086  42.895  18.640 1.00 30.66  ? 130 GLU B CD  1 
ATOM   3415 O  OE1 . GLU B  1 130 ? 18.884  43.416  17.826 1.00 43.42  ? 130 GLU B OE1 1 
ATOM   3416 O  OE2 . GLU B  1 130 ? 17.116  43.511  19.130 1.00 33.89  ? 130 GLU B OE2 1 
ATOM   3417 N  N   . ASP B  1 131 ? 21.716  38.397  18.063 1.00 36.01  ? 131 ASP B N   1 
ATOM   3418 C  CA  . ASP B  1 131 ? 22.705  37.791  17.181 1.00 40.55  ? 131 ASP B CA  1 
ATOM   3419 C  C   . ASP B  1 131 ? 22.481  36.294  16.948 1.00 42.77  ? 131 ASP B C   1 
ATOM   3420 O  O   . ASP B  1 131 ? 23.249  35.649  16.235 1.00 40.67  ? 131 ASP B O   1 
ATOM   3421 C  CB  . ASP B  1 131 ? 24.129  38.078  17.692 1.00 34.51  ? 131 ASP B CB  1 
ATOM   3422 C  CG  . ASP B  1 131 ? 24.470  37.332  18.967 1.00 42.82  ? 131 ASP B CG  1 
ATOM   3423 O  OD1 . ASP B  1 131 ? 23.561  37.026  19.766 1.00 44.83  ? 131 ASP B OD1 1 
ATOM   3424 O  OD2 . ASP B  1 131 ? 25.670  37.067  19.179 1.00 55.71  ? 131 ASP B OD2 1 
ATOM   3425 N  N   . LEU B  1 132 ? 21.429  35.743  17.548 1.00 36.30  ? 132 LEU B N   1 
ATOM   3426 C  CA  . LEU B  1 132 ? 21.105  34.332  17.343 1.00 42.56  ? 132 LEU B CA  1 
ATOM   3427 C  C   . LEU B  1 132 ? 20.215  34.189  16.102 1.00 39.15  ? 132 LEU B C   1 
ATOM   3428 O  O   . LEU B  1 132 ? 20.241  33.159  15.433 1.00 39.02  ? 132 LEU B O   1 
ATOM   3429 C  CB  . LEU B  1 132 ? 20.357  33.743  18.547 1.00 32.86  ? 132 LEU B CB  1 
ATOM   3430 C  CG  . LEU B  1 132 ? 21.116  33.145  19.735 1.00 50.45  ? 132 LEU B CG  1 
ATOM   3431 C  CD1 . LEU B  1 132 ? 22.010  34.184  20.376 1.00 45.62  ? 132 LEU B CD1 1 
ATOM   3432 C  CD2 . LEU B  1 132 ? 20.104  32.618  20.751 1.00 43.68  ? 132 LEU B CD2 1 
ATOM   3433 N  N   . LEU B  1 133 ? 19.436  35.223  15.794 1.00 39.18  ? 133 LEU B N   1 
ATOM   3434 C  CA  . LEU B  1 133 ? 18.533  35.164  14.644 1.00 44.78  ? 133 LEU B CA  1 
ATOM   3435 C  C   . LEU B  1 133 ? 19.223  34.798  13.328 1.00 45.78  ? 133 LEU B C   1 
ATOM   3436 O  O   . LEU B  1 133 ? 18.764  33.907  12.615 1.00 46.20  ? 133 LEU B O   1 
ATOM   3437 C  CB  . LEU B  1 133 ? 17.766  36.482  14.482 1.00 38.29  ? 133 LEU B CB  1 
ATOM   3438 C  CG  . LEU B  1 133 ? 16.768  36.495  13.315 1.00 46.03  ? 133 LEU B CG  1 
ATOM   3439 C  CD1 . LEU B  1 133 ? 15.801  35.331  13.460 1.00 42.85  ? 133 LEU B CD1 1 
ATOM   3440 C  CD2 . LEU B  1 133 ? 16.018  37.820  13.273 1.00 37.46  ? 133 LEU B CD2 1 
ATOM   3441 N  N   . PRO B  1 134 ? 20.327  35.484  12.978 1.00 46.67  ? 134 PRO B N   1 
ATOM   3442 C  CA  . PRO B  1 134 ? 20.986  35.124  11.717 1.00 40.11  ? 134 PRO B CA  1 
ATOM   3443 C  C   . PRO B  1 134 ? 21.486  33.681  11.745 1.00 45.93  ? 134 PRO B C   1 
ATOM   3444 O  O   . PRO B  1 134 ? 21.501  32.999  10.719 1.00 42.83  ? 134 PRO B O   1 
ATOM   3445 C  CB  . PRO B  1 134 ? 22.128  36.134  11.618 1.00 42.40  ? 134 PRO B CB  1 
ATOM   3446 C  CG  . PRO B  1 134 ? 21.555  37.346  12.295 1.00 45.67  ? 134 PRO B CG  1 
ATOM   3447 C  CD  . PRO B  1 134 ? 20.875  36.740  13.518 1.00 42.72  ? 134 PRO B CD  1 
ATOM   3448 N  N   . VAL B  1 135 ? 21.895  33.218  12.924 1.00 42.33  ? 135 VAL B N   1 
ATOM   3449 C  CA  . VAL B  1 135 ? 22.383  31.854  13.063 1.00 40.62  ? 135 VAL B CA  1 
ATOM   3450 C  C   . VAL B  1 135 ? 21.217  30.879  12.882 1.00 39.72  ? 135 VAL B C   1 
ATOM   3451 O  O   . VAL B  1 135 ? 21.367  29.836  12.249 1.00 39.68  ? 135 VAL B O   1 
ATOM   3452 C  CB  . VAL B  1 135 ? 23.051  31.629  14.442 1.00 51.80  ? 135 VAL B CB  1 
ATOM   3453 C  CG1 . VAL B  1 135 ? 23.507  30.185  14.571 1.00 35.56  ? 135 VAL B CG1 1 
ATOM   3454 C  CG2 . VAL B  1 135 ? 24.249  32.574  14.603 1.00 38.68  ? 135 VAL B CG2 1 
ATOM   3455 N  N   . TYR B  1 136 ? 20.054  31.214  13.435 1.00 32.93  ? 136 TYR B N   1 
ATOM   3456 C  CA  . TYR B  1 136 ? 18.897  30.344  13.276 1.00 36.03  ? 136 TYR B CA  1 
ATOM   3457 C  C   . TYR B  1 136 ? 18.520  30.290  11.796 1.00 39.51  ? 136 TYR B C   1 
ATOM   3458 O  O   . TYR B  1 136 ? 18.314  29.213  11.241 1.00 39.17  ? 136 TYR B O   1 
ATOM   3459 C  CB  . TYR B  1 136 ? 17.704  30.850  14.097 1.00 34.37  ? 136 TYR B CB  1 
ATOM   3460 C  CG  . TYR B  1 136 ? 17.581  30.206  15.468 1.00 39.21  ? 136 TYR B CG  1 
ATOM   3461 C  CD1 . TYR B  1 136 ? 17.693  30.967  16.635 1.00 37.81  ? 136 TYR B CD1 1 
ATOM   3462 C  CD2 . TYR B  1 136 ? 17.348  28.836  15.597 1.00 42.00  ? 136 TYR B CD2 1 
ATOM   3463 C  CE1 . TYR B  1 136 ? 17.576  30.378  17.899 1.00 32.01  ? 136 TYR B CE1 1 
ATOM   3464 C  CE2 . TYR B  1 136 ? 17.230  28.233  16.855 1.00 30.30  ? 136 TYR B CE2 1 
ATOM   3465 C  CZ  . TYR B  1 136 ? 17.345  29.012  17.998 1.00 40.23  ? 136 TYR B CZ  1 
ATOM   3466 O  OH  . TYR B  1 136 ? 17.239  28.426  19.236 1.00 38.45  ? 136 TYR B OH  1 
ATOM   3467 N  N   . LYS B  1 137 ? 18.464  31.454  11.155 1.00 30.78  ? 137 LYS B N   1 
ATOM   3468 C  CA  . LYS B  1 137 ? 18.100  31.530  9.744  1.00 38.19  ? 137 LYS B CA  1 
ATOM   3469 C  C   . LYS B  1 137 ? 19.030  30.790  8.794  1.00 38.65  ? 137 LYS B C   1 
ATOM   3470 O  O   . LYS B  1 137 ? 18.580  29.997  7.971  1.00 40.47  ? 137 LYS B O   1 
ATOM   3471 C  CB  . LYS B  1 137 ? 18.029  32.989  9.278  1.00 35.93  ? 137 LYS B CB  1 
ATOM   3472 C  CG  . LYS B  1 137 ? 16.853  33.803  9.786  1.00 46.00  ? 137 LYS B CG  1 
ATOM   3473 C  CD  . LYS B  1 137 ? 16.932  35.216  9.202  1.00 45.66  ? 137 LYS B CD  1 
ATOM   3474 C  CE  . LYS B  1 137 ? 15.788  36.096  9.659  1.00 50.56  ? 137 LYS B CE  1 
ATOM   3475 N  NZ  . LYS B  1 137 ? 15.937  37.477  9.133  1.00 46.95  ? 137 LYS B NZ  1 
ATOM   3476 N  N   . GLU B  1 138 ? 20.328  31.053  8.910  1.00 39.72  ? 138 GLU B N   1 
ATOM   3477 C  CA  . GLU B  1 138 ? 21.314  30.468  8.005  1.00 41.21  ? 138 GLU B CA  1 
ATOM   3478 C  C   . GLU B  1 138 ? 21.922  29.131  8.394  1.00 44.15  ? 138 GLU B C   1 
ATOM   3479 O  O   . GLU B  1 138 ? 22.415  28.404  7.532  1.00 46.57  ? 138 GLU B O   1 
ATOM   3480 C  CB  . GLU B  1 138 ? 22.457  31.464  7.790  1.00 39.25  ? 138 GLU B CB  1 
ATOM   3481 C  CG  . GLU B  1 138 ? 22.009  32.900  7.566  1.00 45.42  ? 138 GLU B CG  1 
ATOM   3482 C  CD  . GLU B  1 138 ? 23.159  33.892  7.659  1.00 60.62  ? 138 GLU B CD  1 
ATOM   3483 O  OE1 . GLU B  1 138 ? 22.894  35.112  7.664  1.00 71.01  ? 138 GLU B OE1 1 
ATOM   3484 O  OE2 . GLU B  1 138 ? 24.328  33.453  7.728  1.00 58.93  ? 138 GLU B OE2 1 
ATOM   3485 N  N   . LYS B  1 139 ? 21.891  28.800  9.678  1.00 39.04  ? 139 LYS B N   1 
ATOM   3486 C  CA  . LYS B  1 139 ? 22.503  27.563  10.135 1.00 42.23  ? 139 LYS B CA  1 
ATOM   3487 C  C   . LYS B  1 139 ? 21.575  26.517  10.739 1.00 41.74  ? 139 LYS B C   1 
ATOM   3488 O  O   . LYS B  1 139 ? 21.607  25.351  10.346 1.00 45.37  ? 139 LYS B O   1 
ATOM   3489 C  CB  . LYS B  1 139 ? 23.603  27.899  11.148 1.00 49.47  ? 139 LYS B CB  1 
ATOM   3490 C  CG  . LYS B  1 139 ? 24.730  28.749  10.578 1.00 55.57  ? 139 LYS B CG  1 
ATOM   3491 C  CD  . LYS B  1 139 ? 25.700  27.908  9.760  1.00 74.80  ? 139 LYS B CD  1 
ATOM   3492 C  CE  . LYS B  1 139 ? 26.474  26.943  10.657 1.00 84.97  ? 139 LYS B CE  1 
ATOM   3493 N  NZ  . LYS B  1 139 ? 27.393  26.040  9.906  1.00 77.47  ? 139 LYS B NZ  1 
ATOM   3494 N  N   . VAL B  1 140 ? 20.754  26.931  11.698 1.00 39.31  ? 140 VAL B N   1 
ATOM   3495 C  CA  . VAL B  1 140 ? 19.870  26.000  12.381 1.00 30.17  ? 140 VAL B CA  1 
ATOM   3496 C  C   . VAL B  1 140 ? 18.671  25.500  11.582 1.00 30.34  ? 140 VAL B C   1 
ATOM   3497 O  O   . VAL B  1 140 ? 18.529  24.293  11.366 1.00 37.47  ? 140 VAL B O   1 
ATOM   3498 C  CB  . VAL B  1 140 ? 19.350  26.602  13.707 1.00 29.91  ? 140 VAL B CB  1 
ATOM   3499 C  CG1 . VAL B  1 140 ? 18.694  25.510  14.552 1.00 33.01  ? 140 VAL B CG1 1 
ATOM   3500 C  CG2 . VAL B  1 140 ? 20.495  27.244  14.472 1.00 43.96  ? 140 VAL B CG2 1 
ATOM   3501 N  N   . VAL B  1 141 ? 17.795  26.411  11.165 1.00 36.08  ? 141 VAL B N   1 
ATOM   3502 C  CA  . VAL B  1 141 ? 16.606  26.009  10.420 1.00 34.14  ? 141 VAL B CA  1 
ATOM   3503 C  C   . VAL B  1 141 ? 16.947  25.138  9.209  1.00 32.15  ? 141 VAL B C   1 
ATOM   3504 O  O   . VAL B  1 141 ? 16.269  24.151  8.950  1.00 45.01  ? 141 VAL B O   1 
ATOM   3505 C  CB  . VAL B  1 141 ? 15.768  27.236  9.994  1.00 39.34  ? 141 VAL B CB  1 
ATOM   3506 C  CG1 . VAL B  1 141 ? 14.595  26.798  9.128  1.00 47.12  ? 141 VAL B CG1 1 
ATOM   3507 C  CG2 . VAL B  1 141 ? 15.241  27.944  11.232 1.00 29.50  ? 141 VAL B CG2 1 
ATOM   3508 N  N   . PRO B  1 142 ? 17.994  25.495  8.447  1.00 31.38  ? 142 PRO B N   1 
ATOM   3509 C  CA  . PRO B  1 142 ? 18.341  24.666  7.290  1.00 29.66  ? 142 PRO B CA  1 
ATOM   3510 C  C   . PRO B  1 142 ? 18.638  23.210  7.660  1.00 40.39  ? 142 PRO B C   1 
ATOM   3511 O  O   . PRO B  1 142 ? 18.478  22.311  6.836  1.00 36.84  ? 142 PRO B O   1 
ATOM   3512 C  CB  . PRO B  1 142 ? 19.554  25.389  6.713  1.00 32.81  ? 142 PRO B CB  1 
ATOM   3513 C  CG  . PRO B  1 142 ? 19.175  26.831  6.926  1.00 32.04  ? 142 PRO B CG  1 
ATOM   3514 C  CD  . PRO B  1 142 ? 18.639  26.820  8.349  1.00 31.11  ? 142 PRO B CD  1 
ATOM   3515 N  N   . LEU B  1 143 ? 19.070  22.984  8.898  1.00 33.89  ? 143 LEU B N   1 
ATOM   3516 C  CA  . LEU B  1 143 ? 19.377  21.636  9.379  1.00 36.64  ? 143 LEU B CA  1 
ATOM   3517 C  C   . LEU B  1 143 ? 18.166  20.980  10.028 1.00 30.03  ? 143 LEU B C   1 
ATOM   3518 O  O   . LEU B  1 143 ? 18.077  19.758  10.105 1.00 39.25  ? 143 LEU B O   1 
ATOM   3519 C  CB  . LEU B  1 143 ? 20.508  21.672  10.418 1.00 46.46  ? 143 LEU B CB  1 
ATOM   3520 C  CG  . LEU B  1 143 ? 21.960  21.652  9.943  1.00 59.66  ? 143 LEU B CG  1 
ATOM   3521 C  CD1 . LEU B  1 143 ? 22.891  21.812  11.138 1.00 53.89  ? 143 LEU B CD1 1 
ATOM   3522 C  CD2 . LEU B  1 143 ? 22.238  20.340  9.218  1.00 54.19  ? 143 LEU B CD2 1 
ATOM   3523 N  N   . ALA B  1 144 ? 17.247  21.801  10.517 1.00 28.64  ? 144 ALA B N   1 
ATOM   3524 C  CA  . ALA B  1 144 ? 16.054  21.297  11.184 1.00 29.84  ? 144 ALA B CA  1 
ATOM   3525 C  C   . ALA B  1 144 ? 15.114  20.534  10.250 1.00 39.47  ? 144 ALA B C   1 
ATOM   3526 O  O   . ALA B  1 144 ? 15.048  20.804  9.042  1.00 34.13  ? 144 ALA B O   1 
ATOM   3527 C  CB  . ALA B  1 144 ? 15.312  22.447  11.838 1.00 30.82  ? 144 ALA B CB  1 
ATOM   3528 N  N   . ASP B  1 145 ? 14.392  19.578  10.828 1.00 34.08  ? 145 ASP B N   1 
ATOM   3529 C  CA  . ASP B  1 145 ? 13.433  18.764  10.091 1.00 36.36  ? 145 ASP B CA  1 
ATOM   3530 C  C   . ASP B  1 145 ? 12.029  19.072  10.583 1.00 39.94  ? 145 ASP B C   1 
ATOM   3531 O  O   . ASP B  1 145 ? 11.062  18.970  9.830  1.00 40.73  ? 145 ASP B O   1 
ATOM   3532 C  CB  . ASP B  1 145 ? 13.751  17.285  10.280 1.00 30.65  ? 145 ASP B CB  1 
ATOM   3533 C  CG  . ASP B  1 145 ? 15.091  16.918  9.692  1.00 48.15  ? 145 ASP B CG  1 
ATOM   3534 O  OD1 . ASP B  1 145 ? 15.205  16.981  8.453  1.00 42.87  ? 145 ASP B OD1 1 
ATOM   3535 O  OD2 . ASP B  1 145 ? 16.030  16.586  10.457 1.00 35.58  ? 145 ASP B OD2 1 
ATOM   3536 N  N   . ILE B  1 146 ? 11.933  19.456  11.852 1.00 30.25  ? 146 ILE B N   1 
ATOM   3537 C  CA  . ILE B  1 146 ? 10.662  19.804  12.472 1.00 28.08  ? 146 ILE B CA  1 
ATOM   3538 C  C   . ILE B  1 146 ? 10.875  21.041  13.339 1.00 34.81  ? 146 ILE B C   1 
ATOM   3539 O  O   . ILE B  1 146 ? 11.729  21.030  14.226 1.00 30.22  ? 146 ILE B O   1 
ATOM   3540 C  CB  . ILE B  1 146 ? 10.142  18.670  13.395 1.00 28.43  ? 146 ILE B CB  1 
ATOM   3541 C  CG1 . ILE B  1 146 ? 9.941   17.374  12.599 1.00 34.37  ? 146 ILE B CG1 1 
ATOM   3542 C  CG2 . ILE B  1 146 ? 8.843   19.108  14.068 1.00 24.68  ? 146 ILE B CG2 1 
ATOM   3543 C  CD1 . ILE B  1 146 ? 9.382   16.233  13.438 1.00 29.33  ? 146 ILE B CD1 1 
ATOM   3544 N  N   . ILE B  1 147 ? 10.117  22.107  13.086 1.00 30.91  ? 147 ILE B N   1 
ATOM   3545 C  CA  . ILE B  1 147 ? 10.247  23.313  13.897 1.00 30.18  ? 147 ILE B CA  1 
ATOM   3546 C  C   . ILE B  1 147 ? 8.907   23.696  14.496 1.00 31.99  ? 147 ILE B C   1 
ATOM   3547 O  O   . ILE B  1 147 ? 7.853   23.397  13.931 1.00 37.32  ? 147 ILE B O   1 
ATOM   3548 C  CB  . ILE B  1 147 ? 10.810  24.508  13.099 1.00 32.24  ? 147 ILE B CB  1 
ATOM   3549 C  CG1 . ILE B  1 147 ? 9.901   24.847  11.915 1.00 36.42  ? 147 ILE B CG1 1 
ATOM   3550 C  CG2 . ILE B  1 147 ? 12.210  24.189  12.633 1.00 26.28  ? 147 ILE B CG2 1 
ATOM   3551 C  CD1 . ILE B  1 147 ? 10.295  26.144  11.227 1.00 40.64  ? 147 ILE B CD1 1 
ATOM   3552 N  N   . THR B  1 148 ? 8.953   24.356  15.648 1.00 29.50  ? 148 THR B N   1 
ATOM   3553 C  CA  . THR B  1 148 ? 7.738   24.754  16.351 1.00 25.22  ? 148 THR B CA  1 
ATOM   3554 C  C   . THR B  1 148 ? 7.745   26.213  16.773 1.00 36.46  ? 148 THR B C   1 
ATOM   3555 O  O   . THR B  1 148 ? 7.574   26.525  17.948 1.00 30.26  ? 148 THR B O   1 
ATOM   3556 C  CB  . THR B  1 148 ? 7.533   23.890  17.601 1.00 28.07  ? 148 THR B CB  1 
ATOM   3557 O  OG1 . THR B  1 148 ? 8.666   24.033  18.475 1.00 36.51  ? 148 THR B OG1 1 
ATOM   3558 C  CG2 . THR B  1 148 ? 7.395   22.416  17.199 1.00 28.53  ? 148 THR B CG2 1 
ATOM   3559 N  N   . PRO B  1 149 ? 7.926   27.130  15.812 1.00 40.00  ? 149 PRO B N   1 
ATOM   3560 C  CA  . PRO B  1 149 ? 7.943   28.556  16.145 1.00 38.97  ? 149 PRO B CA  1 
ATOM   3561 C  C   . PRO B  1 149 ? 6.541   29.077  16.419 1.00 40.74  ? 149 PRO B C   1 
ATOM   3562 O  O   . PRO B  1 149 ? 5.563   28.524  15.924 1.00 43.26  ? 149 PRO B O   1 
ATOM   3563 C  CB  . PRO B  1 149 ? 8.525   29.187  14.886 1.00 33.21  ? 149 PRO B CB  1 
ATOM   3564 C  CG  . PRO B  1 149 ? 7.895   28.332  13.800 1.00 34.60  ? 149 PRO B CG  1 
ATOM   3565 C  CD  . PRO B  1 149 ? 8.067   26.925  14.355 1.00 32.03  ? 149 PRO B CD  1 
ATOM   3566 N  N   . ASN B  1 150 ? 6.437   30.125  17.226 1.00 32.37  ? 150 ASN B N   1 
ATOM   3567 C  CA  . ASN B  1 150 ? 5.135   30.728  17.463 1.00 33.26  ? 150 ASN B CA  1 
ATOM   3568 C  C   . ASN B  1 150 ? 4.995   31.754  16.333 1.00 26.61  ? 150 ASN B C   1 
ATOM   3569 O  O   . ASN B  1 150 ? 5.880   31.857  15.478 1.00 28.05  ? 150 ASN B O   1 
ATOM   3570 C  CB  . ASN B  1 150 ? 5.069   31.417  18.832 1.00 38.53  ? 150 ASN B CB  1 
ATOM   3571 C  CG  . ASN B  1 150 ? 6.198   32.413  19.060 1.00 41.79  ? 150 ASN B CG  1 
ATOM   3572 O  OD1 . ASN B  1 150 ? 6.715   33.024  18.124 1.00 46.26  ? 150 ASN B OD1 1 
ATOM   3573 N  ND2 . ASN B  1 150 ? 6.566   32.595  20.321 1.00 39.00  ? 150 ASN B ND2 1 
ATOM   3574 N  N   . GLN B  1 151 ? 3.912   32.516  16.309 1.00 36.12  ? 151 GLN B N   1 
ATOM   3575 C  CA  . GLN B  1 151 ? 3.750   33.488  15.228 1.00 38.12  ? 151 GLN B CA  1 
ATOM   3576 C  C   . GLN B  1 151 ? 4.921   34.460  15.131 1.00 38.72  ? 151 GLN B C   1 
ATOM   3577 O  O   . GLN B  1 151 ? 5.491   34.667  14.055 1.00 40.96  ? 151 GLN B O   1 
ATOM   3578 C  CB  . GLN B  1 151 ? 2.461   34.288  15.402 1.00 40.01  ? 151 GLN B CB  1 
ATOM   3579 C  CG  . GLN B  1 151 ? 2.076   35.058  14.145 1.00 44.72  ? 151 GLN B CG  1 
ATOM   3580 C  CD  . GLN B  1 151 ? 0.914   36.003  14.370 1.00 52.62  ? 151 GLN B CD  1 
ATOM   3581 O  OE1 . GLN B  1 151 ? 0.019   35.724  15.168 1.00 44.49  ? 151 GLN B OE1 1 
ATOM   3582 N  NE2 . GLN B  1 151 ? 0.916   37.124  13.658 1.00 43.46  ? 151 GLN B NE2 1 
ATOM   3583 N  N   . PHE B  1 152 ? 5.278   35.055  16.264 1.00 41.08  ? 152 PHE B N   1 
ATOM   3584 C  CA  . PHE B  1 152 ? 6.367   36.020  16.319 1.00 29.51  ? 152 PHE B CA  1 
ATOM   3585 C  C   . PHE B  1 152 ? 7.649   35.445  15.714 1.00 30.14  ? 152 PHE B C   1 
ATOM   3586 O  O   . PHE B  1 152 ? 8.335   36.100  14.925 1.00 37.13  ? 152 PHE B O   1 
ATOM   3587 C  CB  . PHE B  1 152 ? 6.609   36.423  17.780 1.00 42.76  ? 152 PHE B CB  1 
ATOM   3588 C  CG  . PHE B  1 152 ? 7.756   37.374  17.973 1.00 54.22  ? 152 PHE B CG  1 
ATOM   3589 C  CD1 . PHE B  1 152 ? 7.655   38.702  17.572 1.00 54.46  ? 152 PHE B CD1 1 
ATOM   3590 C  CD2 . PHE B  1 152 ? 8.937   36.943  18.569 1.00 58.72  ? 152 PHE B CD2 1 
ATOM   3591 C  CE1 . PHE B  1 152 ? 8.713   39.587  17.765 1.00 57.21  ? 152 PHE B CE1 1 
ATOM   3592 C  CE2 . PHE B  1 152 ? 10.000  37.821  18.764 1.00 58.39  ? 152 PHE B CE2 1 
ATOM   3593 C  CZ  . PHE B  1 152 ? 9.888   39.145  18.362 1.00 49.25  ? 152 PHE B CZ  1 
ATOM   3594 N  N   . GLU B  1 153 ? 7.968   34.214  16.094 1.00 30.88  ? 153 GLU B N   1 
ATOM   3595 C  CA  . GLU B  1 153 ? 9.165   33.547  15.610 1.00 29.41  ? 153 GLU B CA  1 
ATOM   3596 C  C   . GLU B  1 153 ? 9.069   33.203  14.128 1.00 31.09  ? 153 GLU B C   1 
ATOM   3597 O  O   . GLU B  1 153 ? 10.058  33.299  13.398 1.00 32.94  ? 153 GLU B O   1 
ATOM   3598 C  CB  . GLU B  1 153 ? 9.422   32.296  16.464 1.00 32.68  ? 153 GLU B CB  1 
ATOM   3599 C  CG  . GLU B  1 153 ? 9.426   32.648  17.954 1.00 55.21  ? 153 GLU B CG  1 
ATOM   3600 C  CD  . GLU B  1 153 ? 9.559   31.460  18.886 1.00 50.43  ? 153 GLU B CD  1 
ATOM   3601 O  OE1 . GLU B  1 153 ? 8.862   30.441  18.683 1.00 40.88  ? 153 GLU B OE1 1 
ATOM   3602 O  OE2 . GLU B  1 153 ? 10.356  31.561  19.843 1.00 49.66  ? 153 GLU B OE2 1 
ATOM   3603 N  N   . ALA B  1 154 ? 7.882   32.807  13.675 1.00 33.47  ? 154 ALA B N   1 
ATOM   3604 C  CA  . ALA B  1 154 ? 7.704   32.485  12.261 1.00 34.96  ? 154 ALA B CA  1 
ATOM   3605 C  C   . ALA B  1 154 ? 7.968   33.749  11.433 1.00 30.83  ? 154 ALA B C   1 
ATOM   3606 O  O   . ALA B  1 154 ? 8.591   33.692  10.371 1.00 36.01  ? 154 ALA B O   1 
ATOM   3607 C  CB  . ALA B  1 154 ? 6.294   31.972  12.012 1.00 31.11  ? 154 ALA B CB  1 
ATOM   3608 N  N   . GLU B  1 155 ? 7.510   34.890  11.940 1.00 36.22  ? 155 GLU B N   1 
ATOM   3609 C  CA  . GLU B  1 155 ? 7.701   36.166  11.255 1.00 35.51  ? 155 GLU B CA  1 
ATOM   3610 C  C   . GLU B  1 155 ? 9.183   36.553  11.196 1.00 45.97  ? 155 GLU B C   1 
ATOM   3611 O  O   . GLU B  1 155 ? 9.685   36.945  10.141 1.00 38.21  ? 155 GLU B O   1 
ATOM   3612 C  CB  . GLU B  1 155 ? 6.894   37.264  11.959 1.00 37.43  ? 155 GLU B CB  1 
ATOM   3613 C  CG  . GLU B  1 155 ? 5.402   36.954  12.044 1.00 46.32  ? 155 GLU B CG  1 
ATOM   3614 C  CD  . GLU B  1 155 ? 4.586   38.064  12.695 1.00 51.74  ? 155 GLU B CD  1 
ATOM   3615 O  OE1 . GLU B  1 155 ? 5.007   38.587  13.750 1.00 49.18  ? 155 GLU B OE1 1 
ATOM   3616 O  OE2 . GLU B  1 155 ? 3.508   38.400  12.161 1.00 50.72  ? 155 GLU B OE2 1 
ATOM   3617 N  N   . LEU B  1 156 ? 9.887   36.434  12.320 1.00 37.60  ? 156 LEU B N   1 
ATOM   3618 C  CA  . LEU B  1 156 ? 11.305  36.779  12.350 1.00 35.41  ? 156 LEU B CA  1 
ATOM   3619 C  C   . LEU B  1 156 ? 12.101  35.886  11.416 1.00 35.50  ? 156 LEU B C   1 
ATOM   3620 O  O   . LEU B  1 156 ? 12.965  36.356  10.679 1.00 39.40  ? 156 LEU B O   1 
ATOM   3621 C  CB  . LEU B  1 156 ? 11.868  36.644  13.766 1.00 38.50  ? 156 LEU B CB  1 
ATOM   3622 C  CG  . LEU B  1 156 ? 11.459  37.694  14.799 1.00 42.50  ? 156 LEU B CG  1 
ATOM   3623 C  CD1 . LEU B  1 156 ? 12.108  37.371  16.140 1.00 48.44  ? 156 LEU B CD1 1 
ATOM   3624 C  CD2 . LEU B  1 156 ? 11.894  39.075  14.312 1.00 38.15  ? 156 LEU B CD2 1 
ATOM   3625 N  N   . LEU B  1 157 ? 11.810  34.590  11.456 1.00 37.27  ? 157 LEU B N   1 
ATOM   3626 C  CA  . LEU B  1 157 ? 12.514  33.633  10.619 1.00 31.99  ? 157 LEU B CA  1 
ATOM   3627 C  C   . LEU B  1 157 ? 12.251  33.838  9.131  1.00 36.45  ? 157 LEU B C   1 
ATOM   3628 O  O   . LEU B  1 157 ? 13.182  33.792  8.326  1.00 32.19  ? 157 LEU B O   1 
ATOM   3629 C  CB  . LEU B  1 157 ? 12.142  32.208  11.036 1.00 30.74  ? 157 LEU B CB  1 
ATOM   3630 C  CG  . LEU B  1 157 ? 12.655  31.806  12.428 1.00 40.18  ? 157 LEU B CG  1 
ATOM   3631 C  CD1 . LEU B  1 157 ? 12.118  30.439  12.804 1.00 27.44  ? 157 LEU B CD1 1 
ATOM   3632 C  CD2 . LEU B  1 157 ? 14.183  31.788  12.435 1.00 28.36  ? 157 LEU B CD2 1 
ATOM   3633 N  N   . SER B  1 158 ? 10.990  34.073  8.770  1.00 38.37  ? 158 SER B N   1 
ATOM   3634 C  CA  . SER B  1 158 ? 10.622  34.276  7.370  1.00 41.21  ? 158 SER B CA  1 
ATOM   3635 C  C   . SER B  1 158 ? 10.935  35.694  6.906  1.00 51.09  ? 158 SER B C   1 
ATOM   3636 O  O   . SER B  1 158 ? 11.262  35.916  5.738  1.00 50.08  ? 158 SER B O   1 
ATOM   3637 C  CB  . SER B  1 158 ? 9.130   34.002  7.157  1.00 33.94  ? 158 SER B CB  1 
ATOM   3638 O  OG  . SER B  1 158 ? 8.326   34.944  7.854  1.00 36.21  ? 158 SER B OG  1 
ATOM   3639 N  N   . GLY B  1 159 ? 10.833  36.649  7.824  1.00 50.87  ? 159 GLY B N   1 
ATOM   3640 C  CA  . GLY B  1 159 ? 11.093  38.033  7.478  1.00 45.84  ? 159 GLY B CA  1 
ATOM   3641 C  C   . GLY B  1 159 ? 9.859   38.649  6.855  1.00 42.02  ? 159 GLY B C   1 
ATOM   3642 O  O   . GLY B  1 159 ? 9.944   39.577  6.055  1.00 57.33  ? 159 GLY B O   1 
ATOM   3643 N  N   . ARG B  1 160 ? 8.701   38.121  7.226  1.00 45.89  ? 160 ARG B N   1 
ATOM   3644 C  CA  . ARG B  1 160 ? 7.427   38.595  6.706  1.00 44.73  ? 160 ARG B CA  1 
ATOM   3645 C  C   . ARG B  1 160 ? 6.418   38.573  7.840  1.00 45.82  ? 160 ARG B C   1 
ATOM   3646 O  O   . ARG B  1 160 ? 6.444   37.674  8.678  1.00 55.56  ? 160 ARG B O   1 
ATOM   3647 C  CB  . ARG B  1 160 ? 6.954   37.680  5.570  1.00 45.51  ? 160 ARG B CB  1 
ATOM   3648 C  CG  . ARG B  1 160 ? 5.635   38.089  4.946  1.00 67.07  ? 160 ARG B CG  1 
ATOM   3649 C  CD  . ARG B  1 160 ? 5.212   37.150  3.822  1.00 71.96  ? 160 ARG B CD  1 
ATOM   3650 N  NE  . ARG B  1 160 ? 6.255   36.983  2.811  1.00 82.46  ? 160 ARG B NE  1 
ATOM   3651 C  CZ  . ARG B  1 160 ? 6.054   36.447  1.608  1.00 78.16  ? 160 ARG B CZ  1 
ATOM   3652 N  NH1 . ARG B  1 160 ? 7.063   36.330  0.752  1.00 62.71  ? 160 ARG B NH1 1 
ATOM   3653 N  NH2 . ARG B  1 160 ? 4.842   36.041  1.254  1.00 71.73  ? 160 ARG B NH2 1 
ATOM   3654 N  N   . LYS B  1 161 ? 5.527   39.557  7.878  1.00 50.68  ? 161 LYS B N   1 
ATOM   3655 C  CA  . LYS B  1 161 ? 4.534   39.597  8.940  1.00 45.01  ? 161 LYS B CA  1 
ATOM   3656 C  C   . LYS B  1 161 ? 3.316   38.750  8.581  1.00 49.11  ? 161 LYS B C   1 
ATOM   3657 O  O   . LYS B  1 161 ? 3.039   38.515  7.404  1.00 56.90  ? 161 LYS B O   1 
ATOM   3658 C  CB  . LYS B  1 161 ? 4.115   41.040  9.228  1.00 48.94  ? 161 LYS B CB  1 
ATOM   3659 C  CG  . LYS B  1 161 ? 3.553   41.217  10.632 1.00 71.54  ? 161 LYS B CG  1 
ATOM   3660 C  CD  . LYS B  1 161 ? 3.212   42.664  10.955 1.00 76.30  ? 161 LYS B CD  1 
ATOM   3661 C  CE  . LYS B  1 161 ? 2.714   42.783  12.389 1.00 76.30  ? 161 LYS B CE  1 
ATOM   3662 N  NZ  . LYS B  1 161 ? 2.266   44.159  12.723 1.00 85.60  ? 161 LYS B NZ  1 
ATOM   3663 N  N   . ILE B  1 162 ? 2.593   38.298  9.600  1.00 44.29  ? 162 ILE B N   1 
ATOM   3664 C  CA  . ILE B  1 162 ? 1.418   37.453  9.410  1.00 42.65  ? 162 ILE B CA  1 
ATOM   3665 C  C   . ILE B  1 162 ? 0.150   38.108  9.951  1.00 49.71  ? 162 ILE B C   1 
ATOM   3666 O  O   . ILE B  1 162 ? 0.040   38.355  11.152 1.00 45.11  ? 162 ILE B O   1 
ATOM   3667 C  CB  . ILE B  1 162 ? 1.606   36.102  10.132 1.00 44.55  ? 162 ILE B CB  1 
ATOM   3668 C  CG1 . ILE B  1 162 ? 2.795   35.357  9.528  1.00 35.37  ? 162 ILE B CG1 1 
ATOM   3669 C  CG2 . ILE B  1 162 ? 0.324   35.280  10.064 1.00 41.57  ? 162 ILE B CG2 1 
ATOM   3670 C  CD1 . ILE B  1 162 ? 3.111   34.037  10.219 1.00 46.34  ? 162 ILE B CD1 1 
ATOM   3671 N  N   . HIS B  1 163 ? -0.812  38.372  9.069  1.00 50.04  ? 163 HIS B N   1 
ATOM   3672 C  CA  . HIS B  1 163 ? -2.065  38.999  9.482  1.00 50.65  ? 163 HIS B CA  1 
ATOM   3673 C  C   . HIS B  1 163 ? -3.269  38.085  9.287  1.00 50.43  ? 163 HIS B C   1 
ATOM   3674 O  O   . HIS B  1 163 ? -4.384  38.439  9.673  1.00 48.98  ? 163 HIS B O   1 
ATOM   3675 C  CB  . HIS B  1 163 ? -2.313  40.290  8.694  1.00 55.09  ? 163 HIS B CB  1 
ATOM   3676 C  CG  . HIS B  1 163 ? -1.153  41.235  8.681  1.00 58.38  ? 163 HIS B CG  1 
ATOM   3677 N  ND1 . HIS B  1 163 ? -0.169  41.193  7.715  1.00 66.59  ? 163 HIS B ND1 1 
ATOM   3678 C  CD2 . HIS B  1 163 ? -0.829  42.262  9.503  1.00 57.54  ? 163 HIS B CD2 1 
ATOM   3679 C  CE1 . HIS B  1 163 ? 0.709   42.156  7.941  1.00 61.57  ? 163 HIS B CE1 1 
ATOM   3680 N  NE2 . HIS B  1 163 ? 0.330   42.818  9.020  1.00 67.47  ? 163 HIS B NE2 1 
ATOM   3681 N  N   . SER B  1 164 ? -3.050  36.918  8.685  1.00 40.13  ? 164 SER B N   1 
ATOM   3682 C  CA  . SER B  1 164 ? -4.145  35.980  8.435  1.00 45.98  ? 164 SER B CA  1 
ATOM   3683 C  C   . SER B  1 164 ? -3.650  34.557  8.260  1.00 37.02  ? 164 SER B C   1 
ATOM   3684 O  O   . SER B  1 164 ? -2.448  34.309  8.185  1.00 46.00  ? 164 SER B O   1 
ATOM   3685 C  CB  . SER B  1 164 ? -4.914  36.380  7.170  1.00 35.37  ? 164 SER B CB  1 
ATOM   3686 O  OG  . SER B  1 164 ? -4.066  36.319  6.033  1.00 41.84  ? 164 SER B OG  1 
ATOM   3687 N  N   . GLN B  1 165 ? -4.594  33.628  8.172  1.00 40.75  ? 165 GLN B N   1 
ATOM   3688 C  CA  . GLN B  1 165 ? -4.268  32.223  7.996  1.00 42.56  ? 165 GLN B CA  1 
ATOM   3689 C  C   . GLN B  1 165 ? -3.526  31.975  6.684  1.00 38.87  ? 165 GLN B C   1 
ATOM   3690 O  O   . GLN B  1 165 ? -2.531  31.247  6.659  1.00 39.57  ? 165 GLN B O   1 
ATOM   3691 C  CB  . GLN B  1 165 ? -5.540  31.377  8.046  1.00 38.18  ? 165 GLN B CB  1 
ATOM   3692 C  CG  . GLN B  1 165 ? -5.310  29.906  7.751  1.00 46.07  ? 165 GLN B CG  1 
ATOM   3693 C  CD  . GLN B  1 165 ? -6.584  29.085  7.828  1.00 44.71  ? 165 GLN B CD  1 
ATOM   3694 O  OE1 . GLN B  1 165 ? -7.142  28.879  8.905  1.00 47.31  ? 165 GLN B OE1 1 
ATOM   3695 N  NE2 . GLN B  1 165 ? -7.053  28.618  6.680  1.00 44.21  ? 165 GLN B NE2 1 
ATOM   3696 N  N   . GLU B  1 166 ? -3.997  32.584  5.598  1.00 40.75  ? 166 GLU B N   1 
ATOM   3697 C  CA  . GLU B  1 166 ? -3.347  32.399  4.303  1.00 39.44  ? 166 GLU B CA  1 
ATOM   3698 C  C   . GLU B  1 166 ? -1.928  32.950  4.322  1.00 29.16  ? 166 GLU B C   1 
ATOM   3699 O  O   . GLU B  1 166 ? -1.038  32.406  3.677  1.00 37.89  ? 166 GLU B O   1 
ATOM   3700 C  CB  . GLU B  1 166 ? -4.146  33.068  3.172  1.00 48.92  ? 166 GLU B CB  1 
ATOM   3701 C  CG  . GLU B  1 166 ? -4.322  34.567  3.310  1.00 59.01  ? 166 GLU B CG  1 
ATOM   3702 C  CD  . GLU B  1 166 ? -4.184  35.295  1.983  1.00 73.49  ? 166 GLU B CD  1 
ATOM   3703 O  OE1 . GLU B  1 166 ? -4.541  36.490  1.913  1.00 86.01  ? 166 GLU B OE1 1 
ATOM   3704 O  OE2 . GLU B  1 166 ? -3.705  34.679  1.011  1.00 72.02  ? 166 GLU B OE2 1 
ATOM   3705 N  N   . GLU B  1 167 ? -1.714  34.038  5.049  1.00 41.79  ? 167 GLU B N   1 
ATOM   3706 C  CA  . GLU B  1 167 ? -0.374  34.611  5.136  1.00 39.76  ? 167 GLU B CA  1 
ATOM   3707 C  C   . GLU B  1 167 ? 0.505   33.674  5.975  1.00 26.67  ? 167 GLU B C   1 
ATOM   3708 O  O   . GLU B  1 167 ? 1.682   33.473  5.677  1.00 35.28  ? 167 GLU B O   1 
ATOM   3709 C  CB  . GLU B  1 167 ? -0.441  36.005  5.759  1.00 45.02  ? 167 GLU B CB  1 
ATOM   3710 C  CG  . GLU B  1 167 ? -0.018  37.124  4.815  1.00 57.67  ? 167 GLU B CG  1 
ATOM   3711 C  CD  . GLU B  1 167 ? -0.490  38.492  5.277  1.00 57.65  ? 167 GLU B CD  1 
ATOM   3712 O  OE1 . GLU B  1 167 ? -0.291  38.831  6.462  1.00 60.01  ? 167 GLU B OE1 1 
ATOM   3713 O  OE2 . GLU B  1 167 ? -1.060  39.232  4.452  1.00 67.60  ? 167 GLU B OE2 1 
ATOM   3714 N  N   . ALA B  1 168 ? -0.080  33.087  7.013  1.00 33.68  ? 168 ALA B N   1 
ATOM   3715 C  CA  . ALA B  1 168 ? 0.651   32.152  7.861  1.00 39.65  ? 168 ALA B CA  1 
ATOM   3716 C  C   . ALA B  1 168 ? 1.091   30.956  7.018  1.00 44.13  ? 168 ALA B C   1 
ATOM   3717 O  O   . ALA B  1 168 ? 2.255   30.550  7.077  1.00 42.28  ? 168 ALA B O   1 
ATOM   3718 C  CB  . ALA B  1 168 ? -0.230  31.686  9.014  1.00 31.09  ? 168 ALA B CB  1 
ATOM   3719 N  N   . LEU B  1 169 ? 0.169   30.405  6.223  1.00 43.85  ? 169 LEU B N   1 
ATOM   3720 C  CA  . LEU B  1 169 ? 0.489   29.254  5.364  1.00 38.92  ? 169 LEU B CA  1 
ATOM   3721 C  C   . LEU B  1 169 ? 1.599   29.606  4.382  1.00 39.39  ? 169 LEU B C   1 
ATOM   3722 O  O   . LEU B  1 169 ? 2.467   28.782  4.088  1.00 41.84  ? 169 LEU B O   1 
ATOM   3723 C  CB  . LEU B  1 169 ? -0.750  28.777  4.592  1.00 37.05  ? 169 LEU B CB  1 
ATOM   3724 C  CG  . LEU B  1 169 ? -1.930  28.265  5.422  1.00 32.44  ? 169 LEU B CG  1 
ATOM   3725 C  CD1 . LEU B  1 169 ? -3.030  27.759  4.490  1.00 37.90  ? 169 LEU B CD1 1 
ATOM   3726 C  CD2 . LEU B  1 169 ? -1.471  27.150  6.357  1.00 37.25  ? 169 LEU B CD2 1 
ATOM   3727 N  N   . ARG B  1 170 ? 1.571   30.833  3.872  1.00 34.50  ? 170 ARG B N   1 
ATOM   3728 C  CA  . ARG B  1 170 ? 2.608   31.279  2.951  1.00 30.42  ? 170 ARG B CA  1 
ATOM   3729 C  C   . ARG B  1 170 ? 3.951   31.309  3.681  1.00 34.12  ? 170 ARG B C   1 
ATOM   3730 O  O   . ARG B  1 170 ? 4.993   30.971  3.112  1.00 37.63  ? 170 ARG B O   1 
ATOM   3731 C  CB  . ARG B  1 170 ? 2.278   32.673  2.406  1.00 35.19  ? 170 ARG B CB  1 
ATOM   3732 C  CG  . ARG B  1 170 ? 3.451   33.365  1.724  1.00 41.22  ? 170 ARG B CG  1 
ATOM   3733 C  CD  . ARG B  1 170 ? 4.212   32.411  0.800  1.00 59.95  ? 170 ARG B CD  1 
ATOM   3734 N  NE  . ARG B  1 170 ? 5.417   33.018  0.236  1.00 58.97  ? 170 ARG B NE  1 
ATOM   3735 C  CZ  . ARG B  1 170 ? 6.375   32.332  -0.378 1.00 68.26  ? 170 ARG B CZ  1 
ATOM   3736 N  NH1 . ARG B  1 170 ? 7.437   32.960  -0.869 1.00 54.53  ? 170 ARG B NH1 1 
ATOM   3737 N  NH2 . ARG B  1 170 ? 6.274   31.012  -0.489 1.00 60.85  ? 170 ARG B NH2 1 
ATOM   3738 N  N   . VAL B  1 171 ? 3.923   31.730  4.939  1.00 33.22  ? 171 VAL B N   1 
ATOM   3739 C  CA  . VAL B  1 171 ? 5.137   31.772  5.746  1.00 38.89  ? 171 VAL B CA  1 
ATOM   3740 C  C   . VAL B  1 171 ? 5.611   30.338  5.957  1.00 37.62  ? 171 VAL B C   1 
ATOM   3741 O  O   . VAL B  1 171 ? 6.799   30.042  5.811  1.00 38.96  ? 171 VAL B O   1 
ATOM   3742 C  CB  . VAL B  1 171 ? 4.878   32.448  7.112  1.00 39.35  ? 171 VAL B CB  1 
ATOM   3743 C  CG1 . VAL B  1 171 ? 6.069   32.223  8.049  1.00 33.81  ? 171 VAL B CG1 1 
ATOM   3744 C  CG2 . VAL B  1 171 ? 4.643   33.938  6.901  1.00 37.33  ? 171 VAL B CG2 1 
ATOM   3745 N  N   . MET B  1 172 ? 4.680   29.443  6.286  1.00 31.11  ? 172 MET B N   1 
ATOM   3746 C  CA  . MET B  1 172 ? 5.046   28.042  6.474  1.00 35.57  ? 172 MET B CA  1 
ATOM   3747 C  C   . MET B  1 172 ? 5.714   27.462  5.224  1.00 40.10  ? 172 MET B C   1 
ATOM   3748 O  O   . MET B  1 172 ? 6.655   26.665  5.336  1.00 37.70  ? 172 MET B O   1 
ATOM   3749 C  CB  . MET B  1 172 ? 3.822   27.227  6.889  1.00 34.04  ? 172 MET B CB  1 
ATOM   3750 C  CG  . MET B  1 172 ? 3.349   27.623  8.291  1.00 28.61  ? 172 MET B CG  1 
ATOM   3751 S  SD  . MET B  1 172 ? 1.933   26.758  8.932  1.00 50.28  ? 172 MET B SD  1 
ATOM   3752 C  CE  . MET B  1 172 ? 0.841   28.104  9.088  1.00 54.22  ? 172 MET B CE  1 
ATOM   3753 N  N   . ASP B  1 173 ? 5.258   27.863  4.037  1.00 27.39  ? 173 ASP B N   1 
ATOM   3754 C  CA  . ASP B  1 173 ? 5.892   27.372  2.811  1.00 27.56  ? 173 ASP B CA  1 
ATOM   3755 C  C   . ASP B  1 173 ? 7.316   27.925  2.725  1.00 33.14  ? 173 ASP B C   1 
ATOM   3756 O  O   . ASP B  1 173 ? 8.226   27.255  2.233  1.00 34.48  ? 173 ASP B O   1 
ATOM   3757 C  CB  . ASP B  1 173 ? 5.131   27.813  1.548  1.00 38.32  ? 173 ASP B CB  1 
ATOM   3758 C  CG  . ASP B  1 173 ? 3.810   27.084  1.362  1.00 44.86  ? 173 ASP B CG  1 
ATOM   3759 O  OD1 . ASP B  1 173 ? 3.656   25.965  1.898  1.00 37.34  ? 173 ASP B OD1 1 
ATOM   3760 O  OD2 . ASP B  1 173 ? 2.933   27.629  0.656  1.00 47.48  ? 173 ASP B OD2 1 
ATOM   3761 N  N   . MET B  1 174 ? 7.499   29.160  3.189  1.00 34.30  ? 174 MET B N   1 
ATOM   3762 C  CA  . MET B  1 174 ? 8.815   29.797  3.154  1.00 41.57  ? 174 MET B CA  1 
ATOM   3763 C  C   . MET B  1 174 ? 9.751   29.060  4.097  1.00 38.12  ? 174 MET B C   1 
ATOM   3764 O  O   . MET B  1 174 ? 10.916  28.814  3.774  1.00 35.18  ? 174 MET B O   1 
ATOM   3765 C  CB  . MET B  1 174 ? 8.710   31.268  3.568  1.00 39.21  ? 174 MET B CB  1 
ATOM   3766 C  CG  . MET B  1 174 ? 7.904   32.122  2.592  1.00 45.55  ? 174 MET B CG  1 
ATOM   3767 S  SD  . MET B  1 174 ? 7.700   33.831  3.145  1.00 45.53  ? 174 MET B SD  1 
ATOM   3768 C  CE  . MET B  1 174 ? 9.358   34.473  2.820  1.00 36.95  ? 174 MET B CE  1 
ATOM   3769 N  N   . LEU B  1 175 ? 9.226   28.704  5.263  1.00 30.09  ? 175 LEU B N   1 
ATOM   3770 C  CA  . LEU B  1 175 ? 10.000  27.978  6.260  1.00 31.70  ? 175 LEU B CA  1 
ATOM   3771 C  C   . LEU B  1 175 ? 10.348  26.585  5.720  1.00 29.27  ? 175 LEU B C   1 
ATOM   3772 O  O   . LEU B  1 175 ? 11.447  26.085  5.959  1.00 36.20  ? 175 LEU B O   1 
ATOM   3773 C  CB  . LEU B  1 175 ? 9.205   27.897  7.570  1.00 30.45  ? 175 LEU B CB  1 
ATOM   3774 C  CG  . LEU B  1 175 ? 9.024   29.255  8.263  1.00 38.59  ? 175 LEU B CG  1 
ATOM   3775 C  CD1 . LEU B  1 175 ? 8.036   29.152  9.426  1.00 28.31  ? 175 LEU B CD1 1 
ATOM   3776 C  CD2 . LEU B  1 175 ? 10.383  29.747  8.749  1.00 31.01  ? 175 LEU B CD2 1 
ATOM   3777 N  N   . HIS B  1 176 ? 9.424   25.967  4.980  1.00 35.65  ? 176 HIS B N   1 
ATOM   3778 C  CA  . HIS B  1 176 ? 9.685   24.654  4.379  1.00 31.40  ? 176 HIS B CA  1 
ATOM   3779 C  C   . HIS B  1 176 ? 10.859  24.791  3.406  1.00 36.37  ? 176 HIS B C   1 
ATOM   3780 O  O   . HIS B  1 176 ? 11.775  23.965  3.398  1.00 34.88  ? 176 HIS B O   1 
ATOM   3781 C  CB  . HIS B  1 176 ? 8.469   24.141  3.582  1.00 36.81  ? 176 HIS B CB  1 
ATOM   3782 C  CG  . HIS B  1 176 ? 7.387   23.524  4.421  1.00 24.19  ? 176 HIS B CG  1 
ATOM   3783 N  ND1 . HIS B  1 176 ? 7.617   22.464  5.273  1.00 28.47  ? 176 HIS B ND1 1 
ATOM   3784 C  CD2 . HIS B  1 176 ? 6.061   23.784  4.495  1.00 31.21  ? 176 HIS B CD2 1 
ATOM   3785 C  CE1 . HIS B  1 176 ? 6.477   22.101  5.836  1.00 31.10  ? 176 HIS B CE1 1 
ATOM   3786 N  NE2 . HIS B  1 176 ? 5.517   22.886  5.380  1.00 31.61  ? 176 HIS B NE2 1 
ATOM   3787 N  N   . SER B  1 177 ? 10.831  25.840  2.583  1.00 32.88  ? 177 SER B N   1 
ATOM   3788 C  CA  . SER B  1 177 ? 11.896  26.044  1.607  1.00 36.82  ? 177 SER B CA  1 
ATOM   3789 C  C   . SER B  1 177 ? 13.232  26.275  2.305  1.00 39.97  ? 177 SER B C   1 
ATOM   3790 O  O   . SER B  1 177 ? 14.294  25.973  1.760  1.00 37.17  ? 177 SER B O   1 
ATOM   3791 C  CB  . SER B  1 177 ? 11.570  27.222  0.673  1.00 39.04  ? 177 SER B CB  1 
ATOM   3792 O  OG  . SER B  1 177 ? 11.656  28.468  1.339  1.00 53.81  ? 177 SER B OG  1 
ATOM   3793 N  N   . MET B  1 178 ? 13.187  26.806  3.518  1.00 41.87  ? 178 MET B N   1 
ATOM   3794 C  CA  . MET B  1 178 ? 14.425  27.030  4.247  1.00 40.85  ? 178 MET B CA  1 
ATOM   3795 C  C   . MET B  1 178 ? 14.998  25.702  4.735  1.00 43.94  ? 178 MET B C   1 
ATOM   3796 O  O   . MET B  1 178 ? 16.198  25.600  4.991  1.00 50.06  ? 178 MET B O   1 
ATOM   3797 C  CB  . MET B  1 178 ? 14.187  27.981  5.419  1.00 38.22  ? 178 MET B CB  1 
ATOM   3798 C  CG  . MET B  1 178 ? 13.946  29.420  4.981  1.00 39.40  ? 178 MET B CG  1 
ATOM   3799 S  SD  . MET B  1 178 ? 13.465  30.489  6.350  1.00 46.99  ? 178 MET B SD  1 
ATOM   3800 C  CE  . MET B  1 178 ? 15.006  30.531  7.310  1.00 36.92  ? 178 MET B CE  1 
ATOM   3801 N  N   . GLY B  1 179 ? 14.152  24.679  4.858  1.00 37.51  ? 179 GLY B N   1 
ATOM   3802 C  CA  . GLY B  1 179 ? 14.667  23.397  5.309  1.00 38.16  ? 179 GLY B CA  1 
ATOM   3803 C  C   . GLY B  1 179 ? 13.742  22.341  5.896  1.00 34.35  ? 179 GLY B C   1 
ATOM   3804 O  O   . GLY B  1 179 ? 13.621  21.261  5.326  1.00 35.96  ? 179 GLY B O   1 
ATOM   3805 N  N   . PRO B  1 180 ? 13.081  22.602  7.035  1.00 35.86  ? 180 PRO B N   1 
ATOM   3806 C  CA  . PRO B  1 180 ? 12.187  21.603  7.644  1.00 37.29  ? 180 PRO B CA  1 
ATOM   3807 C  C   . PRO B  1 180 ? 10.952  21.160  6.865  1.00 39.15  ? 180 PRO B C   1 
ATOM   3808 O  O   . PRO B  1 180 ? 10.225  21.990  6.319  1.00 36.62  ? 180 PRO B O   1 
ATOM   3809 C  CB  . PRO B  1 180 ? 11.808  22.243  8.977  1.00 26.62  ? 180 PRO B CB  1 
ATOM   3810 C  CG  . PRO B  1 180 ? 11.854  23.719  8.664  1.00 28.74  ? 180 PRO B CG  1 
ATOM   3811 C  CD  . PRO B  1 180 ? 13.116  23.840  7.836  1.00 35.16  ? 180 PRO B CD  1 
ATOM   3812 N  N   . ASP B  1 181 ? 10.714  19.846  6.845  1.00 29.71  ? 181 ASP B N   1 
ATOM   3813 C  CA  . ASP B  1 181 ? 9.551   19.275  6.168  1.00 38.24  ? 181 ASP B CA  1 
ATOM   3814 C  C   . ASP B  1 181 ? 8.298   19.383  7.035  1.00 35.85  ? 181 ASP B C   1 
ATOM   3815 O  O   . ASP B  1 181 ? 7.181   19.253  6.541  1.00 38.65  ? 181 ASP B O   1 
ATOM   3816 C  CB  . ASP B  1 181 ? 9.784   17.805  5.801  1.00 36.17  ? 181 ASP B CB  1 
ATOM   3817 C  CG  . ASP B  1 181 ? 10.797  17.639  4.685  1.00 37.05  ? 181 ASP B CG  1 
ATOM   3818 O  OD1 . ASP B  1 181 ? 10.943  18.575  3.871  1.00 39.01  ? 181 ASP B OD1 1 
ATOM   3819 O  OD2 . ASP B  1 181 ? 11.436  16.571  4.614  1.00 47.12  ? 181 ASP B OD2 1 
ATOM   3820 N  N   . THR B  1 182 ? 8.487   19.612  8.329  1.00 27.00  ? 182 THR B N   1 
ATOM   3821 C  CA  . THR B  1 182 ? 7.356   19.764  9.240  1.00 26.28  ? 182 THR B CA  1 
ATOM   3822 C  C   . THR B  1 182 ? 7.448   21.088  9.999  1.00 36.70  ? 182 THR B C   1 
ATOM   3823 O  O   . THR B  1 182 ? 8.388   21.328  10.765 1.00 35.18  ? 182 THR B O   1 
ATOM   3824 C  CB  . THR B  1 182 ? 7.265   18.613  10.270 1.00 24.49  ? 182 THR B CB  1 
ATOM   3825 O  OG1 . THR B  1 182 ? 7.078   17.360  9.594  1.00 32.34  ? 182 THR B OG1 1 
ATOM   3826 C  CG2 . THR B  1 182 ? 6.094   18.848  11.212 1.00 30.83  ? 182 THR B CG2 1 
ATOM   3827 N  N   . VAL B  1 183 ? 6.457   21.940  9.778  1.00 30.66  ? 183 VAL B N   1 
ATOM   3828 C  CA  . VAL B  1 183 ? 6.397   23.243  10.420 1.00 33.16  ? 183 VAL B CA  1 
ATOM   3829 C  C   . VAL B  1 183 ? 5.098   23.371  11.202 1.00 32.91  ? 183 VAL B C   1 
ATOM   3830 O  O   . VAL B  1 183 ? 4.022   23.107  10.676 1.00 31.17  ? 183 VAL B O   1 
ATOM   3831 C  CB  . VAL B  1 183 ? 6.440   24.392  9.383  1.00 31.80  ? 183 VAL B CB  1 
ATOM   3832 C  CG1 . VAL B  1 183 ? 6.388   25.738  10.098 1.00 29.88  ? 183 VAL B CG1 1 
ATOM   3833 C  CG2 . VAL B  1 183 ? 7.686   24.280  8.527  1.00 25.60  ? 183 VAL B CG2 1 
ATOM   3834 N  N   . VAL B  1 184 ? 5.205   23.763  12.464 1.00 32.49  ? 184 VAL B N   1 
ATOM   3835 C  CA  . VAL B  1 184 ? 4.030   23.948  13.299 1.00 35.30  ? 184 VAL B CA  1 
ATOM   3836 C  C   . VAL B  1 184 ? 4.132   25.308  13.985 1.00 39.20  ? 184 VAL B C   1 
ATOM   3837 O  O   . VAL B  1 184 ? 5.013   25.524  14.812 1.00 38.30  ? 184 VAL B O   1 
ATOM   3838 C  CB  . VAL B  1 184 ? 3.920   22.856  14.396 1.00 28.85  ? 184 VAL B CB  1 
ATOM   3839 C  CG1 . VAL B  1 184 ? 2.805   23.211  15.373 1.00 27.65  ? 184 VAL B CG1 1 
ATOM   3840 C  CG2 . VAL B  1 184 ? 3.655   21.488  13.771 1.00 29.22  ? 184 VAL B CG2 1 
ATOM   3841 N  N   . ILE B  1 185 ? 3.263   26.239  13.612 1.00 30.18  ? 185 ILE B N   1 
ATOM   3842 C  CA  . ILE B  1 185 ? 3.260   27.542  14.261 1.00 39.55  ? 185 ILE B CA  1 
ATOM   3843 C  C   . ILE B  1 185 ? 2.400   27.282  15.500 1.00 49.34  ? 185 ILE B C   1 
ATOM   3844 O  O   . ILE B  1 185 ? 1.175   27.288  15.424 1.00 38.73  ? 185 ILE B O   1 
ATOM   3845 C  CB  . ILE B  1 185 ? 2.630   28.631  13.363 1.00 33.99  ? 185 ILE B CB  1 
ATOM   3846 C  CG1 . ILE B  1 185 ? 3.448   28.778  12.080 1.00 34.96  ? 185 ILE B CG1 1 
ATOM   3847 C  CG2 . ILE B  1 185 ? 2.617   29.962  14.092 1.00 39.83  ? 185 ILE B CG2 1 
ATOM   3848 C  CD1 . ILE B  1 185 ? 2.992   29.920  11.186 1.00 41.58  ? 185 ILE B CD1 1 
ATOM   3849 N  N   . THR B  1 186 ? 3.078   27.014  16.620 1.00 50.62  ? 186 THR B N   1 
ATOM   3850 C  CA  . THR B  1 186 ? 2.468   26.669  17.908 1.00 48.36  ? 186 THR B CA  1 
ATOM   3851 C  C   . THR B  1 186 ? 1.421   27.606  18.497 1.00 48.66  ? 186 THR B C   1 
ATOM   3852 O  O   . THR B  1 186 ? 0.363   27.156  18.928 1.00 59.11  ? 186 THR B O   1 
ATOM   3853 C  CB  . THR B  1 186 ? 3.558   26.444  18.974 1.00 61.58  ? 186 THR B CB  1 
ATOM   3854 O  OG1 . THR B  1 186 ? 4.117   27.703  19.372 1.00 65.24  ? 186 THR B OG1 1 
ATOM   3855 C  CG2 . THR B  1 186 ? 4.667   25.569  18.407 1.00 63.76  ? 186 THR B CG2 1 
ATOM   3856 N  N   . SER B  1 187 ? 1.719   28.896  18.558 1.00 57.59  ? 187 SER B N   1 
ATOM   3857 C  CA  . SER B  1 187 ? 0.756   29.850  19.098 1.00 69.33  ? 187 SER B CA  1 
ATOM   3858 C  C   . SER B  1 187 ? 0.381   30.801  17.973 1.00 66.51  ? 187 SER B C   1 
ATOM   3859 O  O   . SER B  1 187 ? 1.179   31.048  17.072 1.00 58.93  ? 187 SER B O   1 
ATOM   3860 C  CB  . SER B  1 187 ? 1.332   30.608  20.308 1.00 64.91  ? 187 SER B CB  1 
ATOM   3861 O  OG  . SER B  1 187 ? 2.458   31.394  19.967 1.00 66.43  ? 187 SER B OG  1 
ATOM   3862 N  N   . SER B  1 188 ? -0.823  31.353  18.054 1.00 77.55  ? 188 SER B N   1 
ATOM   3863 C  CA  . SER B  1 188 ? -1.359  32.210  17.006 1.00 83.33  ? 188 SER B CA  1 
ATOM   3864 C  C   . SER B  1 188 ? -1.717  33.653  17.321 1.00 91.79  ? 188 SER B C   1 
ATOM   3865 O  O   . SER B  1 188 ? -0.885  34.557  17.324 1.00 100.00 ? 188 SER B O   1 
ATOM   3866 C  CB  . SER B  1 188 ? -2.625  31.564  16.478 1.00 96.15  ? 188 SER B CB  1 
ATOM   3867 O  OG  . SER B  1 188 ? -3.586  31.535  17.525 1.00 100.00 ? 188 SER B OG  1 
ATOM   3868 N  N   . ASP B  1 189 ? -3.018  33.815  17.539 1.00 92.78  ? 189 ASP B N   1 
ATOM   3869 C  CA  . ASP B  1 189 ? -3.723  35.056  17.803 1.00 89.35  ? 189 ASP B CA  1 
ATOM   3870 C  C   . ASP B  1 189 ? -4.125  35.640  16.461 1.00 82.11  ? 189 ASP B C   1 
ATOM   3871 O  O   . ASP B  1 189 ? -3.810  36.776  16.096 1.00 76.93  ? 189 ASP B O   1 
ATOM   3872 C  CB  . ASP B  1 189 ? -2.916  36.034  18.645 1.00 94.18  ? 189 ASP B CB  1 
ATOM   3873 C  CG  . ASP B  1 189 ? -3.705  36.508  19.853 1.00 100.00 ? 189 ASP B CG  1 
ATOM   3874 O  OD1 . ASP B  1 189 ? -4.722  37.209  19.657 1.00 100.00 ? 189 ASP B OD1 1 
ATOM   3875 O  OD2 . ASP B  1 189 ? -3.329  36.157  20.992 1.00 100.00 ? 189 ASP B OD2 1 
ATOM   3876 N  N   . LEU B  1 190 ? -4.817  34.775  15.732 1.00 64.40  ? 190 LEU B N   1 
ATOM   3877 C  CA  . LEU B  1 190 ? -5.379  35.035  14.426 1.00 56.59  ? 190 LEU B CA  1 
ATOM   3878 C  C   . LEU B  1 190 ? -6.858  34.850  14.722 1.00 61.82  ? 190 LEU B C   1 
ATOM   3879 O  O   . LEU B  1 190 ? -7.220  34.202  15.706 1.00 54.28  ? 190 LEU B O   1 
ATOM   3880 C  CB  . LEU B  1 190 ? -4.918  33.974  13.423 1.00 57.26  ? 190 LEU B CB  1 
ATOM   3881 C  CG  . LEU B  1 190 ? -3.551  34.128  12.759 1.00 54.36  ? 190 LEU B CG  1 
ATOM   3882 C  CD1 . LEU B  1 190 ? -3.179  32.838  12.048 1.00 58.16  ? 190 LEU B CD1 1 
ATOM   3883 C  CD2 . LEU B  1 190 ? -3.599  35.289  11.774 1.00 52.04  ? 190 LEU B CD2 1 
ATOM   3884 N  N   . PRO B  1 191 ? -7.736  35.418  13.889 1.00 58.49  ? 191 PRO B N   1 
ATOM   3885 C  CA  . PRO B  1 191 ? -9.168  35.259  14.145 1.00 59.14  ? 191 PRO B CA  1 
ATOM   3886 C  C   . PRO B  1 191 ? -9.573  33.794  14.311 1.00 59.44  ? 191 PRO B C   1 
ATOM   3887 O  O   . PRO B  1 191 ? -9.038  32.913  13.640 1.00 60.93  ? 191 PRO B O   1 
ATOM   3888 C  CB  . PRO B  1 191 ? -9.801  35.891  12.912 1.00 63.87  ? 191 PRO B CB  1 
ATOM   3889 C  CG  . PRO B  1 191 ? -8.812  36.962  12.547 1.00 61.97  ? 191 PRO B CG  1 
ATOM   3890 C  CD  . PRO B  1 191 ? -7.499  36.246  12.695 1.00 51.84  ? 191 PRO B CD  1 
ATOM   3891 N  N   . SER B  1 192 ? -10.517 33.541  15.211 1.00 59.37  ? 192 SER B N   1 
ATOM   3892 C  CA  . SER B  1 192 ? -11.015 32.191  15.446 1.00 53.07  ? 192 SER B CA  1 
ATOM   3893 C  C   . SER B  1 192 ? -12.539 32.181  15.461 1.00 55.67  ? 192 SER B C   1 
ATOM   3894 O  O   . SER B  1 192 ? -13.165 32.952  16.189 1.00 57.51  ? 192 SER B O   1 
ATOM   3895 C  CB  . SER B  1 192 ? -10.505 31.643  16.776 1.00 47.96  ? 192 SER B CB  1 
ATOM   3896 O  OG  . SER B  1 192 ? -11.173 30.436  17.085 1.00 48.70  ? 192 SER B OG  1 
ATOM   3897 N  N   . PRO B  1 193 ? -13.156 31.292  14.666 1.00 54.51  ? 193 PRO B N   1 
ATOM   3898 C  CA  . PRO B  1 193 ? -14.615 31.176  14.584 1.00 55.60  ? 193 PRO B CA  1 
ATOM   3899 C  C   . PRO B  1 193 ? -15.252 31.047  15.961 1.00 57.75  ? 193 PRO B C   1 
ATOM   3900 O  O   . PRO B  1 193 ? -16.442 31.304  16.126 1.00 68.54  ? 193 PRO B O   1 
ATOM   3901 C  CB  . PRO B  1 193 ? -14.818 29.908  13.758 1.00 45.55  ? 193 PRO B CB  1 
ATOM   3902 C  CG  . PRO B  1 193 ? -13.614 29.856  12.910 1.00 51.63  ? 193 PRO B CG  1 
ATOM   3903 C  CD  . PRO B  1 193 ? -12.508 30.251  13.851 1.00 46.64  ? 193 PRO B CD  1 
ATOM   3904 N  N   . GLN B  1 194 ? -14.453 30.640  16.944 1.00 62.40  ? 194 GLN B N   1 
ATOM   3905 C  CA  . GLN B  1 194 ? -14.942 30.455  18.304 1.00 53.89  ? 194 GLN B CA  1 
ATOM   3906 C  C   . GLN B  1 194 ? -14.677 31.617  19.253 1.00 53.01  ? 194 GLN B C   1 
ATOM   3907 O  O   . GLN B  1 194 ? -14.992 31.530  20.441 1.00 58.88  ? 194 GLN B O   1 
ATOM   3908 C  CB  . GLN B  1 194 ? -14.359 29.173  18.892 1.00 58.62  ? 194 GLN B CB  1 
ATOM   3909 C  CG  . GLN B  1 194 ? -14.982 27.915  18.328 1.00 64.14  ? 194 GLN B CG  1 
ATOM   3910 C  CD  . GLN B  1 194 ? -14.311 26.661  18.835 1.00 71.35  ? 194 GLN B CD  1 
ATOM   3911 O  OE1 . GLN B  1 194 ? -13.256 26.266  18.338 1.00 85.96  ? 194 GLN B OE1 1 
ATOM   3912 N  NE2 . GLN B  1 194 ? -14.911 26.032  19.842 1.00 76.79  ? 194 GLN B NE2 1 
ATOM   3913 N  N   . GLY B  1 195 ? -14.088 32.695  18.747 1.00 50.34  ? 195 GLY B N   1 
ATOM   3914 C  CA  . GLY B  1 195 ? -13.843 33.842  19.602 1.00 63.25  ? 195 GLY B CA  1 
ATOM   3915 C  C   . GLY B  1 195 ? -12.409 34.181  19.965 1.00 63.71  ? 195 GLY B C   1 
ATOM   3916 O  O   . GLY B  1 195 ? -11.459 33.545  19.507 1.00 66.83  ? 195 GLY B O   1 
ATOM   3917 N  N   . SER B  1 196 ? -12.271 35.200  20.808 1.00 63.22  ? 196 SER B N   1 
ATOM   3918 C  CA  . SER B  1 196 ? -10.972 35.684  21.263 1.00 74.24  ? 196 SER B CA  1 
ATOM   3919 C  C   . SER B  1 196 ? -10.397 34.827  22.386 1.00 68.27  ? 196 SER B C   1 
ATOM   3920 O  O   . SER B  1 196 ? -9.230  34.973  22.754 1.00 67.41  ? 196 SER B O   1 
ATOM   3921 C  CB  . SER B  1 196 ? -11.100 37.132  21.741 1.00 78.79  ? 196 SER B CB  1 
ATOM   3922 O  OG  . SER B  1 196 ? -11.645 37.956  20.725 1.00 96.12  ? 196 SER B OG  1 
ATOM   3923 N  N   . ASN B  1 197 ? -11.221 33.940  22.931 1.00 63.25  ? 197 ASN B N   1 
ATOM   3924 C  CA  . ASN B  1 197 ? -10.787 33.057  24.005 1.00 66.26  ? 197 ASN B CA  1 
ATOM   3925 C  C   . ASN B  1 197 ? -10.043 31.839  23.452 1.00 58.78  ? 197 ASN B C   1 
ATOM   3926 O  O   . ASN B  1 197 ? -9.654  30.948  24.203 1.00 53.24  ? 197 ASN B O   1 
ATOM   3927 C  CB  . ASN B  1 197 ? -11.995 32.602  24.831 1.00 77.97  ? 197 ASN B CB  1 
ATOM   3928 C  CG  . ASN B  1 197 ? -12.681 33.756  25.549 1.00 89.32  ? 197 ASN B CG  1 
ATOM   3929 O  OD1 . ASN B  1 197 ? -13.165 34.696  24.919 1.00 99.72  ? 197 ASN B OD1 1 
ATOM   3930 N  ND2 . ASN B  1 197 ? -12.722 33.688  26.875 1.00 92.85  ? 197 ASN B ND2 1 
ATOM   3931 N  N   . TYR B  1 198 ? -9.846  31.809  22.136 1.00 57.64  ? 198 TYR B N   1 
ATOM   3932 C  CA  . TYR B  1 198 ? -9.146  30.702  21.488 1.00 52.79  ? 198 TYR B CA  1 
ATOM   3933 C  C   . TYR B  1 198 ? -7.928  31.140  20.686 1.00 51.80  ? 198 TYR B C   1 
ATOM   3934 O  O   . TYR B  1 198 ? -7.899  32.233  20.120 1.00 56.26  ? 198 TYR B O   1 
ATOM   3935 C  CB  . TYR B  1 198 ? -10.093 29.935  20.559 1.00 43.34  ? 198 TYR B CB  1 
ATOM   3936 C  CG  . TYR B  1 198 ? -11.179 29.175  21.284 1.00 52.02  ? 198 TYR B CG  1 
ATOM   3937 C  CD1 . TYR B  1 198 ? -12.207 29.847  21.944 1.00 56.12  ? 198 TYR B CD1 1 
ATOM   3938 C  CD2 . TYR B  1 198 ? -11.157 27.780  21.340 1.00 49.15  ? 198 TYR B CD2 1 
ATOM   3939 C  CE1 . TYR B  1 198 ? -13.186 29.148  22.646 1.00 50.23  ? 198 TYR B CE1 1 
ATOM   3940 C  CE2 . TYR B  1 198 ? -12.128 27.074  22.037 1.00 41.85  ? 198 TYR B CE2 1 
ATOM   3941 C  CZ  . TYR B  1 198 ? -13.137 27.763  22.688 1.00 56.95  ? 198 TYR B CZ  1 
ATOM   3942 O  OH  . TYR B  1 198 ? -14.088 27.068  23.395 1.00 72.70  ? 198 TYR B OH  1 
ATOM   3943 N  N   . LEU B  1 199 ? -6.919  30.276  20.655 1.00 53.20  ? 199 LEU B N   1 
ATOM   3944 C  CA  . LEU B  1 199 ? -5.702  30.534  19.898 1.00 45.70  ? 199 LEU B CA  1 
ATOM   3945 C  C   . LEU B  1 199 ? -5.660  29.496  18.783 1.00 45.32  ? 199 LEU B C   1 
ATOM   3946 O  O   . LEU B  1 199 ? -6.275  28.433  18.879 1.00 37.68  ? 199 LEU B O   1 
ATOM   3947 C  CB  . LEU B  1 199 ? -4.460  30.422  20.788 1.00 41.80  ? 199 LEU B CB  1 
ATOM   3948 C  CG  . LEU B  1 199 ? -4.041  29.061  21.348 1.00 46.86  ? 199 LEU B CG  1 
ATOM   3949 C  CD1 . LEU B  1 199 ? -3.165  28.331  20.352 1.00 49.36  ? 199 LEU B CD1 1 
ATOM   3950 C  CD2 . LEU B  1 199 ? -3.262  29.272  22.638 1.00 51.40  ? 199 LEU B CD2 1 
ATOM   3951 N  N   . ILE B  1 200 ? -4.926  29.813  17.731 1.00 41.16  ? 200 ILE B N   1 
ATOM   3952 C  CA  . ILE B  1 200 ? -4.824  28.959  16.568 1.00 40.79  ? 200 ILE B CA  1 
ATOM   3953 C  C   . ILE B  1 200 ? -3.491  28.259  16.424 1.00 46.63  ? 200 ILE B C   1 
ATOM   3954 O  O   . ILE B  1 200 ? -2.430  28.852  16.612 1.00 43.70  ? 200 ILE B O   1 
ATOM   3955 C  CB  . ILE B  1 200 ? -5.070  29.781  15.267 1.00 45.76  ? 200 ILE B CB  1 
ATOM   3956 C  CG1 . ILE B  1 200 ? -6.441  30.461  15.327 1.00 39.29  ? 200 ILE B CG1 1 
ATOM   3957 C  CG2 . ILE B  1 200 ? -4.942  28.893  14.046 1.00 37.64  ? 200 ILE B CG2 1 
ATOM   3958 C  CD1 . ILE B  1 200 ? -7.577  29.522  15.561 1.00 63.32  ? 200 ILE B CD1 1 
ATOM   3959 N  N   . VAL B  1 201 ? -3.563  26.980  16.082 1.00 35.12  ? 201 VAL B N   1 
ATOM   3960 C  CA  . VAL B  1 201 ? -2.376  26.191  15.844 1.00 35.27  ? 201 VAL B CA  1 
ATOM   3961 C  C   . VAL B  1 201 ? -2.467  25.756  14.391 1.00 38.73  ? 201 VAL B C   1 
ATOM   3962 O  O   . VAL B  1 201 ? -3.505  25.281  13.943 1.00 39.78  ? 201 VAL B O   1 
ATOM   3963 C  CB  . VAL B  1 201 ? -2.323  24.948  16.743 1.00 44.57  ? 201 VAL B CB  1 
ATOM   3964 C  CG1 . VAL B  1 201 ? -1.257  23.988  16.227 1.00 26.44  ? 201 VAL B CG1 1 
ATOM   3965 C  CG2 . VAL B  1 201 ? -2.020  25.367  18.183 1.00 35.96  ? 201 VAL B CG2 1 
ATOM   3966 N  N   . LEU B  1 202 ? -1.384  25.950  13.656 1.00 33.14  ? 202 LEU B N   1 
ATOM   3967 C  CA  . LEU B  1 202 ? -1.331  25.581  12.256 1.00 30.94  ? 202 LEU B CA  1 
ATOM   3968 C  C   . LEU B  1 202 ? -0.151  24.655  12.055 1.00 35.69  ? 202 LEU B C   1 
ATOM   3969 O  O   . LEU B  1 202 ? 0.928   24.876  12.609 1.00 36.49  ? 202 LEU B O   1 
ATOM   3970 C  CB  . LEU B  1 202 ? -1.163  26.828  11.382 1.00 27.42  ? 202 LEU B CB  1 
ATOM   3971 C  CG  . LEU B  1 202 ? -2.340  27.807  11.395 1.00 41.34  ? 202 LEU B CG  1 
ATOM   3972 C  CD1 . LEU B  1 202 ? -1.947  29.096  10.685 1.00 39.54  ? 202 LEU B CD1 1 
ATOM   3973 C  CD2 . LEU B  1 202 ? -3.551  27.160  10.720 1.00 32.23  ? 202 LEU B CD2 1 
ATOM   3974 N  N   . GLY B  1 203 ? -0.365  23.614  11.265 1.00 35.17  ? 203 GLY B N   1 
ATOM   3975 C  CA  . GLY B  1 203 ? 0.691   22.667  10.999 1.00 32.52  ? 203 GLY B CA  1 
ATOM   3976 C  C   . GLY B  1 203 ? 0.748   22.324  9.529  1.00 33.01  ? 203 GLY B C   1 
ATOM   3977 O  O   . GLY B  1 203 ? -0.276  22.260  8.849  1.00 36.56  ? 203 GLY B O   1 
ATOM   3978 N  N   . SER B  1 204 ? 1.957   22.106  9.038  1.00 27.74  ? 204 SER B N   1 
ATOM   3979 C  CA  . SER B  1 204 ? 2.163   21.760  7.648  1.00 30.26  ? 204 SER B CA  1 
ATOM   3980 C  C   . SER B  1 204 ? 3.294   20.751  7.566  1.00 32.75  ? 204 SER B C   1 
ATOM   3981 O  O   . SER B  1 204 ? 4.360   20.961  8.150  1.00 32.98  ? 204 SER B O   1 
ATOM   3982 C  CB  . SER B  1 204 ? 2.521   23.013  6.843  1.00 34.05  ? 204 SER B CB  1 
ATOM   3983 O  OG  . SER B  1 204 ? 2.820   22.677  5.505  1.00 36.90  ? 204 SER B OG  1 
ATOM   3984 N  N   . GLN B  1 205 ? 3.069   19.665  6.831  1.00 29.42  ? 205 GLN B N   1 
ATOM   3985 C  CA  . GLN B  1 205 ? 4.081   18.627  6.677  1.00 28.13  ? 205 GLN B CA  1 
ATOM   3986 C  C   . GLN B  1 205 ? 4.231   18.175  5.231  1.00 38.08  ? 205 GLN B C   1 
ATOM   3987 O  O   . GLN B  1 205 ? 3.253   17.817  4.578  1.00 36.49  ? 205 GLN B O   1 
ATOM   3988 C  CB  . GLN B  1 205 ? 3.731   17.417  7.550  1.00 30.79  ? 205 GLN B CB  1 
ATOM   3989 C  CG  . GLN B  1 205 ? 4.783   16.324  7.541  1.00 31.77  ? 205 GLN B CG  1 
ATOM   3990 C  CD  . GLN B  1 205 ? 4.495   15.229  8.553  1.00 37.05  ? 205 GLN B CD  1 
ATOM   3991 O  OE1 . GLN B  1 205 ? 3.695   14.337  8.297  1.00 37.18  ? 205 GLN B OE1 1 
ATOM   3992 N  NE2 . GLN B  1 205 ? 5.142   15.306  9.721  1.00 37.74  ? 205 GLN B NE2 1 
ATOM   3993 N  N   . ARG B  1 206 ? 5.463   18.201  4.738  1.00 30.49  ? 206 ARG B N   1 
ATOM   3994 C  CA  . ARG B  1 206 ? 5.757   17.770  3.378  1.00 32.12  ? 206 ARG B CA  1 
ATOM   3995 C  C   . ARG B  1 206 ? 6.462   16.433  3.478  1.00 40.16  ? 206 ARG B C   1 
ATOM   3996 O  O   . ARG B  1 206 ? 7.332   16.249  4.329  1.00 37.20  ? 206 ARG B O   1 
ATOM   3997 C  CB  . ARG B  1 206 ? 6.673   18.776  2.670  1.00 32.68  ? 206 ARG B CB  1 
ATOM   3998 C  CG  . ARG B  1 206 ? 6.148   20.205  2.723  1.00 35.11  ? 206 ARG B CG  1 
ATOM   3999 C  CD  . ARG B  1 206 ? 7.006   21.154  1.921  1.00 30.91  ? 206 ARG B CD  1 
ATOM   4000 N  NE  . ARG B  1 206 ? 6.909   20.880  0.493  1.00 49.61  ? 206 ARG B NE  1 
ATOM   4001 C  CZ  . ARG B  1 206 ? 7.942   20.589  -0.283 1.00 47.58  ? 206 ARG B CZ  1 
ATOM   4002 N  NH1 . ARG B  1 206 ? 9.163   20.530  0.233  1.00 43.57  ? 206 ARG B NH1 1 
ATOM   4003 N  NH2 . ARG B  1 206 ? 7.754   20.358  -1.573 1.00 41.02  ? 206 ARG B NH2 1 
ATOM   4004 N  N   . ARG B  1 207 ? 6.087   15.499  2.612  1.00 38.82  ? 207 ARG B N   1 
ATOM   4005 C  CA  . ARG B  1 207 ? 6.697   14.182  2.627  1.00 44.64  ? 207 ARG B CA  1 
ATOM   4006 C  C   . ARG B  1 207 ? 6.545   13.499  1.276  1.00 49.17  ? 207 ARG B C   1 
ATOM   4007 O  O   . ARG B  1 207 ? 5.642   13.815  0.501  1.00 43.24  ? 207 ARG B O   1 
ATOM   4008 C  CB  . ARG B  1 207 ? 6.057   13.327  3.730  1.00 37.45  ? 207 ARG B CB  1 
ATOM   4009 C  CG  . ARG B  1 207 ? 4.593   13.028  3.511  1.00 39.37  ? 207 ARG B CG  1 
ATOM   4010 C  CD  . ARG B  1 207 ? 3.847   12.848  4.831  1.00 39.24  ? 207 ARG B CD  1 
ATOM   4011 N  NE  . ARG B  1 207 ? 2.437   12.549  4.599  1.00 41.80  ? 207 ARG B NE  1 
ATOM   4012 C  CZ  . ARG B  1 207 ? 1.433   13.008  5.341  1.00 42.22  ? 207 ARG B CZ  1 
ATOM   4013 N  NH1 . ARG B  1 207 ? 1.668   13.797  6.383  1.00 29.25  ? 207 ARG B NH1 1 
ATOM   4014 N  NH2 . ARG B  1 207 ? 0.184   12.691  5.025  1.00 41.88  ? 207 ARG B NH2 1 
ATOM   4015 N  N   . ARG B  1 208 ? 7.456   12.578  0.993  1.00 46.83  ? 208 ARG B N   1 
ATOM   4016 C  CA  . ARG B  1 208 ? 7.425   11.823  -0.248 1.00 55.64  ? 208 ARG B CA  1 
ATOM   4017 C  C   . ARG B  1 208 ? 6.714   10.512  0.072  1.00 50.25  ? 208 ARG B C   1 
ATOM   4018 O  O   . ARG B  1 208 ? 7.192   9.740   0.899  1.00 57.59  ? 208 ARG B O   1 
ATOM   4019 C  CB  . ARG B  1 208 ? 8.853   11.552  -0.732 1.00 45.60  ? 208 ARG B CB  1 
ATOM   4020 C  CG  . ARG B  1 208 ? 8.930   10.856  -2.080 1.00 50.14  ? 208 ARG B CG  1 
ATOM   4021 C  CD  . ARG B  1 208 ? 10.369  10.602  -2.478 1.00 51.65  ? 208 ARG B CD  1 
ATOM   4022 N  NE  . ARG B  1 208 ? 11.115  11.830  -2.743 1.00 52.87  ? 208 ARG B NE  1 
ATOM   4023 C  CZ  . ARG B  1 208 ? 10.953  12.588  -3.823 1.00 60.57  ? 208 ARG B CZ  1 
ATOM   4024 N  NH1 . ARG B  1 208 ? 10.064  12.252  -4.751 1.00 54.80  ? 208 ARG B NH1 1 
ATOM   4025 N  NH2 . ARG B  1 208 ? 11.698  13.673  -3.988 1.00 57.97  ? 208 ARG B NH2 1 
ATOM   4026 N  N   . ASN B  1 209 ? 5.569   10.265  -0.562 1.00 50.06  ? 209 ASN B N   1 
ATOM   4027 C  CA  . ASN B  1 209 ? 4.820   9.036   -0.301 1.00 47.99  ? 209 ASN B CA  1 
ATOM   4028 C  C   . ASN B  1 209 ? 5.431   7.807   -0.988 1.00 57.45  ? 209 ASN B C   1 
ATOM   4029 O  O   . ASN B  1 209 ? 6.351   7.930   -1.802 1.00 51.39  ? 209 ASN B O   1 
ATOM   4030 C  CB  . ASN B  1 209 ? 3.354   9.195   -0.730 1.00 51.52  ? 209 ASN B CB  1 
ATOM   4031 C  CG  . ASN B  1 209 ? 3.182   9.303   -2.236 1.00 50.54  ? 209 ASN B CG  1 
ATOM   4032 O  OD1 . ASN B  1 209 ? 4.075   8.958   -3.015 1.00 48.01  ? 209 ASN B OD1 1 
ATOM   4033 N  ND2 . ASN B  1 209 ? 2.014   9.774   -2.654 1.00 53.80  ? 209 ASN B ND2 1 
ATOM   4034 N  N   . PRO B  1 210 ? 4.921   6.603   -0.666 1.00 59.89  ? 210 PRO B N   1 
ATOM   4035 C  CA  . PRO B  1 210 ? 5.427   5.360   -1.258 1.00 57.98  ? 210 PRO B CA  1 
ATOM   4036 C  C   . PRO B  1 210 ? 5.621   5.439   -2.767 1.00 64.97  ? 210 PRO B C   1 
ATOM   4037 O  O   . PRO B  1 210 ? 6.655   5.019   -3.286 1.00 64.59  ? 210 PRO B O   1 
ATOM   4038 C  CB  . PRO B  1 210 ? 4.367   4.341   -0.861 1.00 61.90  ? 210 PRO B CB  1 
ATOM   4039 C  CG  . PRO B  1 210 ? 3.962   4.817   0.492  1.00 61.40  ? 210 PRO B CG  1 
ATOM   4040 C  CD  . PRO B  1 210 ? 3.834   6.314   0.290  1.00 62.72  ? 210 PRO B CD  1 
ATOM   4041 N  N   . ALA B  1 211 ? 4.627   5.982   -3.466 1.00 64.81  ? 211 ALA B N   1 
ATOM   4042 C  CA  . ALA B  1 211 ? 4.695   6.109   -4.918 1.00 57.68  ? 211 ALA B CA  1 
ATOM   4043 C  C   . ALA B  1 211 ? 5.810   7.056   -5.344 1.00 62.87  ? 211 ALA B C   1 
ATOM   4044 O  O   . ALA B  1 211 ? 6.165   7.119   -6.521 1.00 70.45  ? 211 ALA B O   1 
ATOM   4045 C  CB  . ALA B  1 211 ? 3.362   6.595   -5.462 1.00 53.07  ? 211 ALA B CB  1 
ATOM   4046 N  N   . GLY B  1 212 ? 6.358   7.797   -4.386 1.00 59.72  ? 212 GLY B N   1 
ATOM   4047 C  CA  . GLY B  1 212 ? 7.431   8.721   -4.705 1.00 60.47  ? 212 GLY B CA  1 
ATOM   4048 C  C   . GLY B  1 212 ? 6.963   10.140  -4.973 1.00 59.63  ? 212 GLY B C   1 
ATOM   4049 O  O   . GLY B  1 212 ? 7.746   10.987  -5.411 1.00 55.84  ? 212 GLY B O   1 
ATOM   4050 N  N   . SER B  1 213 ? 5.687   10.408  -4.717 1.00 47.29  ? 213 SER B N   1 
ATOM   4051 C  CA  . SER B  1 213 ? 5.150   11.743  -4.931 1.00 50.09  ? 213 SER B CA  1 
ATOM   4052 C  C   . SER B  1 213 ? 5.341   12.597  -3.685 1.00 49.31  ? 213 SER B C   1 
ATOM   4053 O  O   . SER B  1 213 ? 5.102   12.138  -2.567 1.00 50.13  ? 213 SER B O   1 
ATOM   4054 C  CB  . SER B  1 213 ? 3.660   11.673  -5.269 1.00 47.32  ? 213 SER B CB  1 
ATOM   4055 O  OG  . SER B  1 213 ? 3.452   11.091  -6.539 1.00 55.60  ? 213 SER B OG  1 
ATOM   4056 N  N   . VAL B  1 214 ? 5.784   13.834  -3.882 1.00 47.65  ? 214 VAL B N   1 
ATOM   4057 C  CA  . VAL B  1 214 ? 5.979   14.758  -2.770 1.00 45.99  ? 214 VAL B CA  1 
ATOM   4058 C  C   . VAL B  1 214 ? 4.666   15.491  -2.522 1.00 46.47  ? 214 VAL B C   1 
ATOM   4059 O  O   . VAL B  1 214 ? 4.223   16.284  -3.358 1.00 47.06  ? 214 VAL B O   1 
ATOM   4060 C  CB  . VAL B  1 214 ? 7.078   15.792  -3.082 1.00 46.49  ? 214 VAL B CB  1 
ATOM   4061 C  CG1 . VAL B  1 214 ? 7.182   16.802  -1.951 1.00 45.49  ? 214 VAL B CG1 1 
ATOM   4062 C  CG2 . VAL B  1 214 ? 8.408   15.086  -3.279 1.00 41.09  ? 214 VAL B CG2 1 
ATOM   4063 N  N   . VAL B  1 215 ? 4.040   15.206  -1.383 1.00 39.22  ? 215 VAL B N   1 
ATOM   4064 C  CA  . VAL B  1 215 ? 2.776   15.836  -1.018 1.00 35.70  ? 215 VAL B CA  1 
ATOM   4065 C  C   . VAL B  1 215 ? 2.894   16.643  0.278  1.00 44.60  ? 215 VAL B C   1 
ATOM   4066 O  O   . VAL B  1 215 ? 3.896   16.559  0.995  1.00 35.45  ? 215 VAL B O   1 
ATOM   4067 C  CB  . VAL B  1 215 ? 1.661   14.780  -0.857 1.00 40.69  ? 215 VAL B CB  1 
ATOM   4068 C  CG1 . VAL B  1 215 ? 1.517   13.989  -2.155 1.00 45.78  ? 215 VAL B CG1 1 
ATOM   4069 C  CG2 . VAL B  1 215 ? 1.984   13.842  0.287  1.00 38.47  ? 215 VAL B CG2 1 
ATOM   4070 N  N   . MET B  1 216 ? 1.861   17.418  0.582  1.00 37.76  ? 216 MET B N   1 
ATOM   4071 C  CA  . MET B  1 216 ? 1.868   18.243  1.778  1.00 43.28  ? 216 MET B CA  1 
ATOM   4072 C  C   . MET B  1 216 ? 0.531   18.169  2.476  1.00 39.80  ? 216 MET B C   1 
ATOM   4073 O  O   . MET B  1 216 ? -0.513  18.276  1.835  1.00 32.74  ? 216 MET B O   1 
ATOM   4074 C  CB  . MET B  1 216 ? 2.165   19.703  1.414  1.00 39.55  ? 216 MET B CB  1 
ATOM   4075 C  CG  . MET B  1 216 ? 2.166   20.652  2.609  1.00 37.96  ? 216 MET B CG  1 
ATOM   4076 S  SD  . MET B  1 216 ? 2.308   22.386  2.145  1.00 44.74  ? 216 MET B SD  1 
ATOM   4077 C  CE  . MET B  1 216 ? 3.977   22.520  1.909  1.00 30.17  ? 216 MET B CE  1 
ATOM   4078 N  N   . GLU B  1 217 ? 0.565   17.982  3.792  1.00 33.33  ? 217 GLU B N   1 
ATOM   4079 C  CA  . GLU B  1 217 ? -0.654  17.920  4.592  1.00 30.99  ? 217 GLU B CA  1 
ATOM   4080 C  C   . GLU B  1 217 ? -0.684  19.163  5.490  1.00 35.98  ? 217 GLU B C   1 
ATOM   4081 O  O   . GLU B  1 217 ? 0.322   19.511  6.099  1.00 36.81  ? 217 GLU B O   1 
ATOM   4082 C  CB  . GLU B  1 217 ? -0.663  16.638  5.442  1.00 30.84  ? 217 GLU B CB  1 
ATOM   4083 C  CG  . GLU B  1 217 ? -1.891  16.474  6.343  1.00 26.46  ? 217 GLU B CG  1 
ATOM   4084 C  CD  . GLU B  1 217 ? -1.790  15.268  7.282  1.00 39.17  ? 217 GLU B CD  1 
ATOM   4085 O  OE1 . GLU B  1 217 ? -0.826  14.483  7.170  1.00 34.18  ? 217 GLU B OE1 1 
ATOM   4086 O  OE2 . GLU B  1 217 ? -2.683  15.095  8.135  1.00 32.68  ? 217 GLU B OE2 1 
ATOM   4087 N  N   . ARG B  1 218 ? -1.827  19.838  5.558  1.00 30.93  ? 218 ARG B N   1 
ATOM   4088 C  CA  . ARG B  1 218 ? -1.966  21.040  6.379  1.00 28.39  ? 218 ARG B CA  1 
ATOM   4089 C  C   . ARG B  1 218 ? -3.138  20.887  7.330  1.00 37.45  ? 218 ARG B C   1 
ATOM   4090 O  O   . ARG B  1 218 ? -4.203  20.427  6.931  1.00 29.11  ? 218 ARG B O   1 
ATOM   4091 C  CB  . ARG B  1 218 ? -2.229  22.272  5.512  1.00 27.98  ? 218 ARG B CB  1 
ATOM   4092 C  CG  . ARG B  1 218 ? -1.075  22.769  4.668  1.00 35.64  ? 218 ARG B CG  1 
ATOM   4093 C  CD  . ARG B  1 218 ? -1.562  23.890  3.742  1.00 30.13  ? 218 ARG B CD  1 
ATOM   4094 N  NE  . ARG B  1 218 ? -0.461  24.639  3.148  1.00 54.24  ? 218 ARG B NE  1 
ATOM   4095 C  CZ  . ARG B  1 218 ? -0.600  25.521  2.161  1.00 47.28  ? 218 ARG B CZ  1 
ATOM   4096 N  NH1 . ARG B  1 218 ? -1.800  25.764  1.645  1.00 45.32  ? 218 ARG B NH1 1 
ATOM   4097 N  NH2 . ARG B  1 218 ? 0.461   26.172  1.699  1.00 44.30  ? 218 ARG B NH2 1 
ATOM   4098 N  N   . ILE B  1 219 ? -2.955  21.293  8.582  1.00 31.12  ? 219 ILE B N   1 
ATOM   4099 C  CA  . ILE B  1 219 ? -4.038  21.192  9.549  1.00 31.80  ? 219 ILE B CA  1 
ATOM   4100 C  C   . ILE B  1 219 ? -4.159  22.451  10.376 1.00 28.97  ? 219 ILE B C   1 
ATOM   4101 O  O   . ILE B  1 219 ? -3.273  23.303  10.372 1.00 40.44  ? 219 ILE B O   1 
ATOM   4102 C  CB  . ILE B  1 219 ? -3.845  19.989  10.510 1.00 29.21  ? 219 ILE B CB  1 
ATOM   4103 C  CG1 . ILE B  1 219 ? -2.544  20.142  11.309 1.00 37.37  ? 219 ILE B CG1 1 
ATOM   4104 C  CG2 . ILE B  1 219 ? -3.830  18.690  9.719  1.00 24.70  ? 219 ILE B CG2 1 
ATOM   4105 C  CD1 . ILE B  1 219 ? -2.674  21.006  12.557 1.00 35.17  ? 219 ILE B CD1 1 
ATOM   4106 N  N   . ARG B  1 220 ? -5.267  22.555  11.091 1.00 38.08  ? 220 ARG B N   1 
ATOM   4107 C  CA  . ARG B  1 220 ? -5.513  23.693  11.948 1.00 36.10  ? 220 ARG B CA  1 
ATOM   4108 C  C   . ARG B  1 220 ? -6.284  23.245  13.166 1.00 35.72  ? 220 ARG B C   1 
ATOM   4109 O  O   . ARG B  1 220 ? -7.116  22.343  13.090 1.00 39.68  ? 220 ARG B O   1 
ATOM   4110 C  CB  . ARG B  1 220 ? -6.320  24.767  11.224 1.00 37.57  ? 220 ARG B CB  1 
ATOM   4111 C  CG  . ARG B  1 220 ? -6.808  25.862  12.157 1.00 37.86  ? 220 ARG B CG  1 
ATOM   4112 C  CD  . ARG B  1 220 ? -7.568  26.952  11.424 1.00 51.75  ? 220 ARG B CD  1 
ATOM   4113 N  NE  . ARG B  1 220 ? -8.317  27.802  12.347 1.00 41.51  ? 220 ARG B NE  1 
ATOM   4114 C  CZ  . ARG B  1 220 ? -8.448  29.118  12.207 1.00 44.85  ? 220 ARG B CZ  1 
ATOM   4115 N  NH1 . ARG B  1 220 ? -7.874  29.741  11.184 1.00 42.85  ? 220 ARG B NH1 1 
ATOM   4116 N  NH2 . ARG B  1 220 ? -9.161  29.811  13.083 1.00 40.53  ? 220 ARG B NH2 1 
ATOM   4117 N  N   . MET B  1 221 ? -5.995  23.885  14.290 1.00 34.14  ? 221 MET B N   1 
ATOM   4118 C  CA  . MET B  1 221 ? -6.670  23.592  15.538 1.00 42.24  ? 221 MET B CA  1 
ATOM   4119 C  C   . MET B  1 221 ? -6.959  24.921  16.224 1.00 38.28  ? 221 MET B C   1 
ATOM   4120 O  O   . MET B  1 221 ? -6.168  25.861  16.140 1.00 35.68  ? 221 MET B O   1 
ATOM   4121 C  CB  . MET B  1 221 ? -5.782  22.717  16.429 1.00 35.79  ? 221 MET B CB  1 
ATOM   4122 C  CG  . MET B  1 221 ? -5.362  21.406  15.782 1.00 41.01  ? 221 MET B CG  1 
ATOM   4123 S  SD  . MET B  1 221 ? -4.232  20.432  16.809 1.00 45.30  ? 221 MET B SD  1 
ATOM   4124 C  CE  . MET B  1 221 ? -5.359  19.768  17.961 1.00 30.01  ? 221 MET B CE  1 
ATOM   4125 N  N   . ASP B  1 222 ? -8.115  25.002  16.866 1.00 40.75  ? 222 ASP B N   1 
ATOM   4126 C  CA  . ASP B  1 222 ? -8.519  26.193  17.594 1.00 41.84  ? 222 ASP B CA  1 
ATOM   4127 C  C   . ASP B  1 222 ? -8.537  25.760  19.060 1.00 46.80  ? 222 ASP B C   1 
ATOM   4128 O  O   . ASP B  1 222 ? -9.428  25.027  19.493 1.00 48.21  ? 222 ASP B O   1 
ATOM   4129 C  CB  . ASP B  1 222 ? -9.912  26.657  17.131 1.00 39.87  ? 222 ASP B CB  1 
ATOM   4130 C  CG  . ASP B  1 222 ? -9.891  27.287  15.734 1.00 38.26  ? 222 ASP B CG  1 
ATOM   4131 O  OD1 . ASP B  1 222 ? -9.587  26.585  14.746 1.00 40.78  ? 222 ASP B OD1 1 
ATOM   4132 O  OD2 . ASP B  1 222 ? -10.174 28.498  15.624 1.00 49.19  ? 222 ASP B OD2 1 
ATOM   4133 N  N   . ILE B  1 223 ? -7.538  26.204  19.815 1.00 49.09  ? 223 ILE B N   1 
ATOM   4134 C  CA  . ILE B  1 223 ? -7.408  25.822  21.219 1.00 49.20  ? 223 ILE B CA  1 
ATOM   4135 C  C   . ILE B  1 223 ? -7.811  26.911  22.212 1.00 50.68  ? 223 ILE B C   1 
ATOM   4136 O  O   . ILE B  1 223 ? -7.437  28.073  22.066 1.00 45.71  ? 223 ILE B O   1 
ATOM   4137 C  CB  . ILE B  1 223 ? -5.946  25.386  21.540 1.00 49.96  ? 223 ILE B CB  1 
ATOM   4138 C  CG1 . ILE B  1 223 ? -5.585  24.118  20.768 1.00 50.23  ? 223 ILE B CG1 1 
ATOM   4139 C  CG2 . ILE B  1 223 ? -5.790  25.108  23.019 1.00 46.30  ? 223 ILE B CG2 1 
ATOM   4140 C  CD1 . ILE B  1 223 ? -5.382  24.321  19.308 1.00 53.38  ? 223 ILE B CD1 1 
ATOM   4141 N  N   . ARG B  1 224 ? -8.567  26.511  23.230 1.00 41.50  ? 224 ARG B N   1 
ATOM   4142 C  CA  . ARG B  1 224 ? -9.028  27.419  24.279 1.00 52.16  ? 224 ARG B CA  1 
ATOM   4143 C  C   . ARG B  1 224 ? -7.833  27.992  25.049 1.00 46.73  ? 224 ARG B C   1 
ATOM   4144 O  O   . ARG B  1 224 ? -6.992  27.243  25.537 1.00 49.07  ? 224 ARG B O   1 
ATOM   4145 C  CB  . ARG B  1 224 ? -9.929  26.652  25.252 1.00 54.71  ? 224 ARG B CB  1 
ATOM   4146 C  CG  . ARG B  1 224 ? -10.677 27.506  26.260 1.00 70.53  ? 224 ARG B CG  1 
ATOM   4147 C  CD  . ARG B  1 224 ? -12.003 27.967  25.682 1.00 79.37  ? 224 ARG B CD  1 
ATOM   4148 N  NE  . ARG B  1 224 ? -12.799 28.746  26.626 1.00 92.48  ? 224 ARG B NE  1 
ATOM   4149 C  CZ  . ARG B  1 224 ? -12.426 29.917  27.136 1.00 98.55  ? 224 ARG B CZ  1 
ATOM   4150 N  NH1 . ARG B  1 224 ? -13.221 30.553  27.987 1.00 97.77  ? 224 ARG B NH1 1 
ATOM   4151 N  NH2 . ARG B  1 224 ? -11.259 30.452  26.799 1.00 97.47  ? 224 ARG B NH2 1 
ATOM   4152 N  N   . LYS B  1 225 ? -7.755  29.314  25.164 1.00 52.04  ? 225 LYS B N   1 
ATOM   4153 C  CA  . LYS B  1 225 ? -6.656  29.942  25.895 1.00 52.17  ? 225 LYS B CA  1 
ATOM   4154 C  C   . LYS B  1 225 ? -6.820  29.713  27.396 1.00 63.74  ? 225 LYS B C   1 
ATOM   4155 O  O   . LYS B  1 225 ? -7.858  29.233  27.851 1.00 72.10  ? 225 LYS B O   1 
ATOM   4156 C  CB  . LYS B  1 225 ? -6.614  31.446  25.625 1.00 48.79  ? 225 LYS B CB  1 
ATOM   4157 C  CG  . LYS B  1 225 ? -6.282  31.833  24.200 1.00 57.58  ? 225 LYS B CG  1 
ATOM   4158 C  CD  . LYS B  1 225 ? -6.381  33.342  24.025 1.00 61.70  ? 225 LYS B CD  1 
ATOM   4159 C  CE  . LYS B  1 225 ? -6.178  33.765  22.578 1.00 53.10  ? 225 LYS B CE  1 
ATOM   4160 N  NZ  . LYS B  1 225 ? -6.457  35.216  22.386 1.00 58.41  ? 225 LYS B NZ  1 
ATOM   4161 N  N   . VAL B  1 226 ? -5.791  30.059  28.162 1.00 70.41  ? 226 VAL B N   1 
ATOM   4162 C  CA  . VAL B  1 226 ? -5.834  29.901  29.611 1.00 69.97  ? 226 VAL B CA  1 
ATOM   4163 C  C   . VAL B  1 226 ? -5.396  31.190  30.287 1.00 60.95  ? 226 VAL B C   1 
ATOM   4164 O  O   . VAL B  1 226 ? -4.471  31.857  29.830 1.00 64.88  ? 226 VAL B O   1 
ATOM   4165 C  CB  . VAL B  1 226 ? -4.922  28.759  30.075 1.00 76.22  ? 226 VAL B CB  1 
ATOM   4166 C  CG1 . VAL B  1 226 ? -4.996  28.614  31.588 1.00 79.17  ? 226 VAL B CG1 1 
ATOM   4167 C  CG2 . VAL B  1 226 ? -5.340  27.472  29.401 1.00 75.66  ? 226 VAL B CG2 1 
ATOM   4168 N  N   . ASP B  1 227 ? -6.062  31.534  31.383 1.00 65.83  ? 227 ASP B N   1 
ATOM   4169 C  CA  . ASP B  1 227 ? -5.756  32.760  32.107 1.00 69.69  ? 227 ASP B CA  1 
ATOM   4170 C  C   . ASP B  1 227 ? -4.644  32.587  33.139 1.00 73.05  ? 227 ASP B C   1 
ATOM   4171 O  O   . ASP B  1 227 ? -4.831  32.858  34.327 1.00 74.64  ? 227 ASP B O   1 
ATOM   4172 C  CB  . ASP B  1 227 ? -7.029  33.286  32.778 1.00 72.09  ? 227 ASP B CB  1 
ATOM   4173 C  CG  . ASP B  1 227 ? -6.813  34.607  33.487 1.00 81.52  ? 227 ASP B CG  1 
ATOM   4174 O  OD1 . ASP B  1 227 ? -6.060  35.453  32.953 1.00 68.08  ? 227 ASP B OD1 1 
ATOM   4175 O  OD2 . ASP B  1 227 ? -7.407  34.800  34.572 1.00 87.95  ? 227 ASP B OD2 1 
ATOM   4176 N  N   . ALA B  1 228 ? -3.483  32.137  32.673 1.00 60.86  ? 228 ALA B N   1 
ATOM   4177 C  CA  . ALA B  1 228 ? -2.331  31.937  33.545 1.00 55.17  ? 228 ALA B CA  1 
ATOM   4178 C  C   . ALA B  1 228 ? -1.067  31.820  32.711 1.00 57.92  ? 228 ALA B C   1 
ATOM   4179 O  O   . ALA B  1 228 ? -1.122  31.502  31.522 1.00 54.70  ? 228 ALA B O   1 
ATOM   4180 C  CB  . ALA B  1 228 ? -2.517  30.681  34.388 1.00 54.21  ? 228 ALA B CB  1 
ATOM   4181 N  N   . VAL B  1 229 ? 0.074   32.094  33.334 1.00 59.05  ? 229 VAL B N   1 
ATOM   4182 C  CA  . VAL B  1 229 ? 1.349   31.998  32.643 1.00 44.66  ? 229 VAL B CA  1 
ATOM   4183 C  C   . VAL B  1 229 ? 2.047   30.716  33.059 1.00 49.96  ? 229 VAL B C   1 
ATOM   4184 O  O   . VAL B  1 229 ? 2.450   30.553  34.213 1.00 43.97  ? 229 VAL B O   1 
ATOM   4185 C  CB  . VAL B  1 229 ? 2.270   33.187  32.965 1.00 59.88  ? 229 VAL B CB  1 
ATOM   4186 C  CG1 . VAL B  1 229 ? 3.597   33.026  32.235 1.00 57.30  ? 229 VAL B CG1 1 
ATOM   4187 C  CG2 . VAL B  1 229 ? 1.602   34.486  32.551 1.00 59.75  ? 229 VAL B CG2 1 
ATOM   4188 N  N   . PHE B  1 230 ? 2.168   29.802  32.108 1.00 37.33  ? 230 PHE B N   1 
ATOM   4189 C  CA  . PHE B  1 230 ? 2.823   28.532  32.346 1.00 43.24  ? 230 PHE B CA  1 
ATOM   4190 C  C   . PHE B  1 230 ? 4.192   28.581  31.689 1.00 49.79  ? 230 PHE B C   1 
ATOM   4191 O  O   . PHE B  1 230 ? 4.398   29.280  30.695 1.00 44.31  ? 230 PHE B O   1 
ATOM   4192 C  CB  . PHE B  1 230 ? 2.009   27.393  31.734 1.00 45.79  ? 230 PHE B CB  1 
ATOM   4193 C  CG  . PHE B  1 230 ? 0.710   27.132  32.434 1.00 54.53  ? 230 PHE B CG  1 
ATOM   4194 C  CD1 . PHE B  1 230 ? 0.684   26.441  33.637 1.00 43.82  ? 230 PHE B CD1 1 
ATOM   4195 C  CD2 . PHE B  1 230 ? -0.490  27.570  31.886 1.00 57.69  ? 230 PHE B CD2 1 
ATOM   4196 C  CE1 . PHE B  1 230 ? -0.509  26.187  34.279 1.00 43.24  ? 230 PHE B CE1 1 
ATOM   4197 C  CE2 . PHE B  1 230 ? -1.695  27.319  32.526 1.00 53.38  ? 230 PHE B CE2 1 
ATOM   4198 C  CZ  . PHE B  1 230 ? -1.704  26.626  33.724 1.00 55.35  ? 230 PHE B CZ  1 
ATOM   4199 N  N   . VAL B  1 231 ? 5.127   27.834  32.254 1.00 42.57  ? 231 VAL B N   1 
ATOM   4200 C  CA  . VAL B  1 231 ? 6.470   27.776  31.717 1.00 38.90  ? 231 VAL B CA  1 
ATOM   4201 C  C   . VAL B  1 231 ? 6.755   26.313  31.374 1.00 34.91  ? 231 VAL B C   1 
ATOM   4202 O  O   . VAL B  1 231 ? 6.310   25.407  32.076 1.00 35.84  ? 231 VAL B O   1 
ATOM   4203 C  CB  . VAL B  1 231 ? 7.494   28.292  32.760 1.00 45.96  ? 231 VAL B CB  1 
ATOM   4204 C  CG1 . VAL B  1 231 ? 8.902   28.277  32.173 1.00 39.66  ? 231 VAL B CG1 1 
ATOM   4205 C  CG2 . VAL B  1 231 ? 7.118   29.706  33.196 1.00 38.54  ? 231 VAL B CG2 1 
ATOM   4206 N  N   . GLY B  1 232 ? 7.481   26.088  30.286 1.00 35.07  ? 232 GLY B N   1 
ATOM   4207 C  CA  . GLY B  1 232 ? 7.809   24.732  29.885 1.00 34.36  ? 232 GLY B CA  1 
ATOM   4208 C  C   . GLY B  1 232 ? 6.814   24.068  28.944 1.00 34.00  ? 232 GLY B C   1 
ATOM   4209 O  O   . GLY B  1 232 ? 7.081   22.971  28.463 1.00 35.75  ? 232 GLY B O   1 
ATOM   4210 N  N   . THR B  1 233 ? 5.685   24.716  28.658 1.00 30.88  ? 233 THR B N   1 
ATOM   4211 C  CA  . THR B  1 233 ? 4.682   24.118  27.768 1.00 35.50  ? 233 THR B CA  1 
ATOM   4212 C  C   . THR B  1 233 ? 5.192   23.954  26.338 1.00 26.57  ? 233 THR B C   1 
ATOM   4213 O  O   . THR B  1 233 ? 4.863   22.980  25.663 1.00 34.42  ? 233 THR B O   1 
ATOM   4214 C  CB  . THR B  1 233 ? 3.382   24.944  27.725 1.00 36.45  ? 233 THR B CB  1 
ATOM   4215 O  OG1 . THR B  1 233 ? 3.676   26.270  27.284 1.00 44.21  ? 233 THR B OG1 1 
ATOM   4216 C  CG2 . THR B  1 233 ? 2.726   24.990  29.096 1.00 36.68  ? 233 THR B CG2 1 
ATOM   4217 N  N   . GLY B  1 234 ? 5.995   24.911  25.883 1.00 32.73  ? 234 GLY B N   1 
ATOM   4218 C  CA  . GLY B  1 234 ? 6.561   24.837  24.549 1.00 25.83  ? 234 GLY B CA  1 
ATOM   4219 C  C   . GLY B  1 234 ? 7.605   23.735  24.476 1.00 38.07  ? 234 GLY B C   1 
ATOM   4220 O  O   . GLY B  1 234 ? 7.772   23.099  23.433 1.00 33.21  ? 234 GLY B O   1 
ATOM   4221 N  N   . ASP B  1 235 ? 8.326   23.509  25.576 1.00 36.23  ? 235 ASP B N   1 
ATOM   4222 C  CA  . ASP B  1 235 ? 9.339   22.454  25.605 1.00 26.16  ? 235 ASP B CA  1 
ATOM   4223 C  C   . ASP B  1 235 ? 8.618   21.102  25.567 1.00 26.69  ? 235 ASP B C   1 
ATOM   4224 O  O   . ASP B  1 235 ? 9.047   20.169  24.891 1.00 31.50  ? 235 ASP B O   1 
ATOM   4225 C  CB  . ASP B  1 235 ? 10.182  22.536  26.886 1.00 32.83  ? 235 ASP B CB  1 
ATOM   4226 C  CG  . ASP B  1 235 ? 10.825  23.899  27.093 1.00 39.05  ? 235 ASP B CG  1 
ATOM   4227 O  OD1 . ASP B  1 235 ? 11.472  24.427  26.161 1.00 40.54  ? 235 ASP B OD1 1 
ATOM   4228 O  OD2 . ASP B  1 235 ? 10.696  24.437  28.207 1.00 32.04  ? 235 ASP B OD2 1 
ATOM   4229 N  N   . LEU B  1 236 ? 7.519   21.007  26.310 1.00 27.52  ? 236 LEU B N   1 
ATOM   4230 C  CA  . LEU B  1 236 ? 6.729   19.778  26.365 1.00 30.92  ? 236 LEU B CA  1 
ATOM   4231 C  C   . LEU B  1 236 ? 6.045   19.526  25.027 1.00 30.88  ? 236 LEU B C   1 
ATOM   4232 O  O   . LEU B  1 236 ? 5.945   18.380  24.583 1.00 29.72  ? 236 LEU B O   1 
ATOM   4233 C  CB  . LEU B  1 236 ? 5.671   19.878  27.471 1.00 24.75  ? 236 LEU B CB  1 
ATOM   4234 C  CG  . LEU B  1 236 ? 4.676   18.722  27.625 1.00 24.49  ? 236 LEU B CG  1 
ATOM   4235 C  CD1 . LEU B  1 236 ? 5.397   17.392  27.875 1.00 23.18  ? 236 LEU B CD1 1 
ATOM   4236 C  CD2 . LEU B  1 236 ? 3.756   19.028  28.781 1.00 28.77  ? 236 LEU B CD2 1 
ATOM   4237 N  N   . PHE B  1 237 ? 5.571   20.601  24.397 1.00 28.72  ? 237 PHE B N   1 
ATOM   4238 C  CA  . PHE B  1 237 ? 4.903   20.508  23.097 1.00 33.11  ? 237 PHE B CA  1 
ATOM   4239 C  C   . PHE B  1 237 ? 5.870   19.911  22.068 1.00 31.29  ? 237 PHE B C   1 
ATOM   4240 O  O   . PHE B  1 237 ? 5.523   18.988  21.332 1.00 37.01  ? 237 PHE B O   1 
ATOM   4241 C  CB  . PHE B  1 237 ? 4.461   21.901  22.623 1.00 33.05  ? 237 PHE B CB  1 
ATOM   4242 C  CG  . PHE B  1 237 ? 3.657   21.885  21.346 1.00 39.27  ? 237 PHE B CG  1 
ATOM   4243 C  CD1 . PHE B  1 237 ? 2.267   21.782  21.384 1.00 30.07  ? 237 PHE B CD1 1 
ATOM   4244 C  CD2 . PHE B  1 237 ? 4.293   21.924  20.105 1.00 33.34  ? 237 PHE B CD2 1 
ATOM   4245 C  CE1 . PHE B  1 237 ? 1.517   21.712  20.196 1.00 40.82  ? 237 PHE B CE1 1 
ATOM   4246 C  CE2 . PHE B  1 237 ? 3.557   21.855  18.913 1.00 35.75  ? 237 PHE B CE2 1 
ATOM   4247 C  CZ  . PHE B  1 237 ? 2.165   21.748  18.961 1.00 37.63  ? 237 PHE B CZ  1 
ATOM   4248 N  N   . ALA B  1 238 ? 7.092   20.432  22.029 1.00 27.99  ? 238 ALA B N   1 
ATOM   4249 C  CA  . ALA B  1 238 ? 8.081   19.940  21.075 1.00 33.09  ? 238 ALA B CA  1 
ATOM   4250 C  C   . ALA B  1 238 ? 8.467   18.479  21.323 1.00 41.12  ? 238 ALA B C   1 
ATOM   4251 O  O   . ALA B  1 238 ? 8.644   17.700  20.378 1.00 31.82  ? 238 ALA B O   1 
ATOM   4252 C  CB  . ALA B  1 238 ? 9.320   20.825  21.110 1.00 31.99  ? 238 ALA B CB  1 
ATOM   4253 N  N   . ALA B  1 239 ? 8.605   18.103  22.592 1.00 35.61  ? 239 ALA B N   1 
ATOM   4254 C  CA  . ALA B  1 239 ? 8.974   16.727  22.920 1.00 28.56  ? 239 ALA B CA  1 
ATOM   4255 C  C   . ALA B  1 239 ? 7.875   15.753  22.498 1.00 29.54  ? 239 ALA B C   1 
ATOM   4256 O  O   . ALA B  1 239 ? 8.152   14.690  21.947 1.00 33.44  ? 239 ALA B O   1 
ATOM   4257 C  CB  . ALA B  1 239 ? 9.241   16.595  24.416 1.00 27.78  ? 239 ALA B CB  1 
ATOM   4258 N  N   . MET B  1 240 ? 6.626   16.121  22.765 1.00 32.39  ? 240 MET B N   1 
ATOM   4259 C  CA  . MET B  1 240 ? 5.501   15.272  22.407 1.00 37.54  ? 240 MET B CA  1 
ATOM   4260 C  C   . MET B  1 240 ? 5.261   15.227  20.893 1.00 34.27  ? 240 MET B C   1 
ATOM   4261 O  O   . MET B  1 240 ? 4.852   14.192  20.361 1.00 37.24  ? 240 MET B O   1 
ATOM   4262 C  CB  . MET B  1 240 ? 4.258   15.735  23.155 1.00 28.40  ? 240 MET B CB  1 
ATOM   4263 C  CG  . MET B  1 240 ? 4.397   15.589  24.668 1.00 36.04  ? 240 MET B CG  1 
ATOM   4264 S  SD  . MET B  1 240 ? 4.665   13.881  25.190 1.00 34.84  ? 240 MET B SD  1 
ATOM   4265 C  CE  . MET B  1 240 ? 6.452   13.722  25.018 1.00 38.10  ? 240 MET B CE  1 
ATOM   4266 N  N   . LEU B  1 241 ? 5.526   16.337  20.206 1.00 33.10  ? 241 LEU B N   1 
ATOM   4267 C  CA  . LEU B  1 241 ? 5.370   16.380  18.757 1.00 31.81  ? 241 LEU B CA  1 
ATOM   4268 C  C   . LEU B  1 241 ? 6.370   15.386  18.198 1.00 33.46  ? 241 LEU B C   1 
ATOM   4269 O  O   . LEU B  1 241 ? 6.070   14.623  17.277 1.00 31.41  ? 241 LEU B O   1 
ATOM   4270 C  CB  . LEU B  1 241 ? 5.662   17.786  18.208 1.00 31.00  ? 241 LEU B CB  1 
ATOM   4271 C  CG  . LEU B  1 241 ? 5.463   17.938  16.690 1.00 29.95  ? 241 LEU B CG  1 
ATOM   4272 C  CD1 . LEU B  1 241 ? 4.022   17.570  16.321 1.00 31.35  ? 241 LEU B CD1 1 
ATOM   4273 C  CD2 . LEU B  1 241 ? 5.774   19.370  16.257 1.00 29.99  ? 241 LEU B CD2 1 
ATOM   4274 N  N   . LEU B  1 242 ? 7.568   15.388  18.775 1.00 36.41  ? 242 LEU B N   1 
ATOM   4275 C  CA  . LEU B  1 242 ? 8.615   14.462  18.356 1.00 26.79  ? 242 LEU B CA  1 
ATOM   4276 C  C   . LEU B  1 242 ? 8.108   13.018  18.518 1.00 34.95  ? 242 LEU B C   1 
ATOM   4277 O  O   . LEU B  1 242 ? 8.205   12.202  17.602 1.00 31.95  ? 242 LEU B O   1 
ATOM   4278 C  CB  . LEU B  1 242 ? 9.874   14.670  19.219 1.00 32.72  ? 242 LEU B CB  1 
ATOM   4279 C  CG  . LEU B  1 242 ? 11.105  13.812  18.896 1.00 30.02  ? 242 LEU B CG  1 
ATOM   4280 C  CD1 . LEU B  1 242 ? 12.354  14.425  19.522 1.00 32.28  ? 242 LEU B CD1 1 
ATOM   4281 C  CD2 . LEU B  1 242 ? 10.885  12.382  19.390 1.00 29.97  ? 242 LEU B CD2 1 
ATOM   4282 N  N   . ALA B  1 243 ? 7.558   12.721  19.690 1.00 27.26  ? 243 ALA B N   1 
ATOM   4283 C  CA  . ALA B  1 243 ? 7.064   11.385  20.006 1.00 32.73  ? 243 ALA B CA  1 
ATOM   4284 C  C   . ALA B  1 243 ? 5.907   10.932  19.127 1.00 37.19  ? 243 ALA B C   1 
ATOM   4285 O  O   . ALA B  1 243 ? 5.906   9.808   18.623 1.00 32.43  ? 243 ALA B O   1 
ATOM   4286 C  CB  . ALA B  1 243 ? 6.642   11.322  21.478 1.00 26.47  ? 243 ALA B CB  1 
ATOM   4287 N  N   . TRP B  1 244 ? 4.921   11.804  18.947 1.00 32.31  ? 244 TRP B N   1 
ATOM   4288 C  CA  . TRP B  1 244 ? 3.760   11.448  18.152 1.00 33.35  ? 244 TRP B CA  1 
ATOM   4289 C  C   . TRP B  1 244 ? 3.952   11.476  16.637 1.00 35.21  ? 244 TRP B C   1 
ATOM   4290 O  O   . TRP B  1 244 ? 3.260   10.752  15.927 1.00 35.89  ? 244 TRP B O   1 
ATOM   4291 C  CB  . TRP B  1 244 ? 2.566   12.276  18.611 1.00 29.22  ? 244 TRP B CB  1 
ATOM   4292 C  CG  . TRP B  1 244 ? 2.182   11.888  20.014 1.00 27.33  ? 244 TRP B CG  1 
ATOM   4293 C  CD1 . TRP B  1 244 ? 2.078   12.714  21.099 1.00 29.53  ? 244 TRP B CD1 1 
ATOM   4294 C  CD2 . TRP B  1 244 ? 1.891   10.563  20.490 1.00 31.77  ? 244 TRP B CD2 1 
ATOM   4295 N  NE1 . TRP B  1 244 ? 1.744   11.985  22.218 1.00 36.14  ? 244 TRP B NE1 1 
ATOM   4296 C  CE2 . TRP B  1 244 ? 1.621   10.667  21.874 1.00 37.95  ? 244 TRP B CE2 1 
ATOM   4297 C  CE3 . TRP B  1 244 ? 1.831   9.303   19.880 1.00 38.53  ? 244 TRP B CE3 1 
ATOM   4298 C  CZ2 . TRP B  1 244 ? 1.294   9.555   22.661 1.00 35.22  ? 244 TRP B CZ2 1 
ATOM   4299 C  CZ3 . TRP B  1 244 ? 1.505   8.194   20.665 1.00 38.65  ? 244 TRP B CZ3 1 
ATOM   4300 C  CH2 . TRP B  1 244 ? 1.241   8.332   22.040 1.00 40.64  ? 244 TRP B CH2 1 
ATOM   4301 N  N   . THR B  1 245 ? 4.879   12.286  16.126 1.00 31.22  ? 245 THR B N   1 
ATOM   4302 C  CA  . THR B  1 245 ? 5.125   12.239  14.691 1.00 33.93  ? 245 THR B CA  1 
ATOM   4303 C  C   . THR B  1 245 ? 5.939   10.969  14.440 1.00 37.46  ? 245 THR B C   1 
ATOM   4304 O  O   . THR B  1 245 ? 5.883   10.390  13.358 1.00 35.63  ? 245 THR B O   1 
ATOM   4305 C  CB  . THR B  1 245 ? 5.921   13.456  14.165 1.00 36.69  ? 245 THR B CB  1 
ATOM   4306 O  OG1 . THR B  1 245 ? 7.122   13.622  14.930 1.00 35.56  ? 245 THR B OG1 1 
ATOM   4307 C  CG2 . THR B  1 245 ? 5.059   14.720  14.223 1.00 32.96  ? 245 THR B CG2 1 
ATOM   4308 N  N   . HIS B  1 246 ? 6.697   10.537  15.449 1.00 33.51  ? 246 HIS B N   1 
ATOM   4309 C  CA  . HIS B  1 246 ? 7.506   9.318   15.335 1.00 34.29  ? 246 HIS B CA  1 
ATOM   4310 C  C   . HIS B  1 246 ? 6.587   8.093   15.225 1.00 39.33  ? 246 HIS B C   1 
ATOM   4311 O  O   . HIS B  1 246 ? 6.891   7.134   14.521 1.00 37.12  ? 246 HIS B O   1 
ATOM   4312 C  CB  . HIS B  1 246 ? 8.414   9.154   16.568 1.00 38.35  ? 246 HIS B CB  1 
ATOM   4313 C  CG  . HIS B  1 246 ? 9.137   7.841   16.613 1.00 33.76  ? 246 HIS B CG  1 
ATOM   4314 N  ND1 . HIS B  1 246 ? 10.284  7.594   15.888 1.00 39.72  ? 246 HIS B ND1 1 
ATOM   4315 C  CD2 . HIS B  1 246 ? 8.843   6.683   17.253 1.00 33.60  ? 246 HIS B CD2 1 
ATOM   4316 C  CE1 . HIS B  1 246 ? 10.665  6.344   16.080 1.00 30.09  ? 246 HIS B CE1 1 
ATOM   4317 N  NE2 . HIS B  1 246 ? 9.807   5.769   16.904 1.00 39.00  ? 246 HIS B NE2 1 
ATOM   4318 N  N   . LYS B  1 247 ? 5.468   8.140   15.940 1.00 39.91  ? 247 LYS B N   1 
ATOM   4319 C  CA  . LYS B  1 247 ? 4.488   7.059   15.947 1.00 42.75  ? 247 LYS B CA  1 
ATOM   4320 C  C   . LYS B  1 247 ? 3.530   7.121   14.755 1.00 46.59  ? 247 LYS B C   1 
ATOM   4321 O  O   . LYS B  1 247 ? 3.026   6.096   14.305 1.00 49.48  ? 247 LYS B O   1 
ATOM   4322 C  CB  . LYS B  1 247 ? 3.674   7.110   17.245 1.00 43.90  ? 247 LYS B CB  1 
ATOM   4323 C  CG  . LYS B  1 247 ? 4.054   6.069   18.278 1.00 61.46  ? 247 LYS B CG  1 
ATOM   4324 C  CD  . LYS B  1 247 ? 5.493   6.212   18.744 1.00 76.57  ? 247 LYS B CD  1 
ATOM   4325 C  CE  . LYS B  1 247 ? 5.873   5.064   19.669 1.00 77.79  ? 247 LYS B CE  1 
ATOM   4326 N  NZ  . LYS B  1 247 ? 7.289   5.149   20.114 1.00 81.30  ? 247 LYS B NZ  1 
ATOM   4327 N  N   . HIS B  1 248 ? 3.284   8.329   14.256 1.00 48.18  ? 248 HIS B N   1 
ATOM   4328 C  CA  . HIS B  1 248 ? 2.378   8.561   13.128 1.00 38.51  ? 248 HIS B CA  1 
ATOM   4329 C  C   . HIS B  1 248 ? 3.121   9.471   12.160 1.00 38.86  ? 248 HIS B C   1 
ATOM   4330 O  O   . HIS B  1 248 ? 2.753   10.628  11.982 1.00 37.39  ? 248 HIS B O   1 
ATOM   4331 C  CB  . HIS B  1 248 ? 1.127   9.276   13.629 1.00 36.65  ? 248 HIS B CB  1 
ATOM   4332 C  CG  . HIS B  1 248 ? 0.441   8.573   14.761 1.00 42.13  ? 248 HIS B CG  1 
ATOM   4333 N  ND1 . HIS B  1 248 ? -0.321  7.439   14.582 1.00 39.72  ? 248 HIS B ND1 1 
ATOM   4334 C  CD2 . HIS B  1 248 ? 0.405   8.845   16.088 1.00 34.58  ? 248 HIS B CD2 1 
ATOM   4335 C  CE1 . HIS B  1 248 ? -0.799  7.041   15.748 1.00 42.09  ? 248 HIS B CE1 1 
ATOM   4336 N  NE2 . HIS B  1 248 ? -0.373  7.877   16.679 1.00 41.81  ? 248 HIS B NE2 1 
ATOM   4337 N  N   . PRO B  1 249 ? 4.175   8.951   11.514 1.00 31.92  ? 249 PRO B N   1 
ATOM   4338 C  CA  . PRO B  1 249 ? 4.988   9.726   10.572 1.00 34.38  ? 249 PRO B CA  1 
ATOM   4339 C  C   . PRO B  1 249 ? 4.302   10.315  9.349  1.00 51.91  ? 249 PRO B C   1 
ATOM   4340 O  O   . PRO B  1 249 ? 4.745   11.337  8.822  1.00 54.75  ? 249 PRO B O   1 
ATOM   4341 C  CB  . PRO B  1 249 ? 6.108   8.754   10.203 1.00 36.96  ? 249 PRO B CB  1 
ATOM   4342 C  CG  . PRO B  1 249 ? 5.440   7.428   10.276 1.00 29.62  ? 249 PRO B CG  1 
ATOM   4343 C  CD  . PRO B  1 249 ? 4.592   7.538   11.533 1.00 30.64  ? 249 PRO B CD  1 
ATOM   4344 N  N   . ASN B  1 250 ? 3.225   9.688   8.898  1.00 40.93  ? 250 ASN B N   1 
ATOM   4345 C  CA  . ASN B  1 250 ? 2.535   10.190  7.719  1.00 40.83  ? 250 ASN B CA  1 
ATOM   4346 C  C   . ASN B  1 250 ? 1.164   10.747  8.031  1.00 39.20  ? 250 ASN B C   1 
ATOM   4347 O  O   . ASN B  1 250 ? 0.339   10.891  7.141  1.00 38.17  ? 250 ASN B O   1 
ATOM   4348 C  CB  . ASN B  1 250 ? 2.413   9.077   6.680  1.00 38.28  ? 250 ASN B CB  1 
ATOM   4349 C  CG  . ASN B  1 250 ? 3.763   8.601   6.188  1.00 47.61  ? 250 ASN B CG  1 
ATOM   4350 O  OD1 . ASN B  1 250 ? 4.575   9.396   5.711  1.00 46.52  ? 250 ASN B OD1 1 
ATOM   4351 N  ND2 . ASN B  1 250 ? 4.014   7.302   6.305  1.00 51.59  ? 250 ASN B ND2 1 
ATOM   4352 N  N   . ASN B  1 251 ? 0.923   11.065  9.297  1.00 38.08  ? 251 ASN B N   1 
ATOM   4353 C  CA  . ASN B  1 251 ? -0.370  11.599  9.696  1.00 36.66  ? 251 ASN B CA  1 
ATOM   4354 C  C   . ASN B  1 251 ? -0.185  12.772  10.646 1.00 37.33  ? 251 ASN B C   1 
ATOM   4355 O  O   . ASN B  1 251 ? -0.250  12.606  11.863 1.00 41.69  ? 251 ASN B O   1 
ATOM   4356 C  CB  . ASN B  1 251 ? -1.192  10.515  10.379 1.00 33.48  ? 251 ASN B CB  1 
ATOM   4357 C  CG  . ASN B  1 251 ? -2.667  10.835  10.390 1.00 46.66  ? 251 ASN B CG  1 
ATOM   4358 O  OD1 . ASN B  1 251 ? -3.062  11.995  10.478 1.00 40.55  ? 251 ASN B OD1 1 
ATOM   4359 N  ND2 . ASN B  1 251 ? -3.493  9.803   10.315 1.00 46.74  ? 251 ASN B ND2 1 
ATOM   4360 N  N   . LEU B  1 252 ? 0.048   13.957  10.089 1.00 31.93  ? 252 LEU B N   1 
ATOM   4361 C  CA  . LEU B  1 252 ? 0.249   15.143  10.906 1.00 37.72  ? 252 LEU B CA  1 
ATOM   4362 C  C   . LEU B  1 252 ? -0.960  15.380  11.801 1.00 37.79  ? 252 LEU B C   1 
ATOM   4363 O  O   . LEU B  1 252 ? -0.823  15.717  12.972 1.00 42.19  ? 252 LEU B O   1 
ATOM   4364 C  CB  . LEU B  1 252 ? 0.473   16.368  10.022 1.00 29.18  ? 252 LEU B CB  1 
ATOM   4365 C  CG  . LEU B  1 252 ? 0.823   17.659  10.775 1.00 40.53  ? 252 LEU B CG  1 
ATOM   4366 C  CD1 . LEU B  1 252 ? 2.212   17.544  11.395 1.00 32.15  ? 252 LEU B CD1 1 
ATOM   4367 C  CD2 . LEU B  1 252 ? 0.783   18.833  9.816  1.00 35.68  ? 252 LEU B CD2 1 
ATOM   4368 N  N   . LYS B  1 253 ? -2.144  15.184  11.240 1.00 37.35  ? 253 LYS B N   1 
ATOM   4369 C  CA  . LYS B  1 253 ? -3.392  15.392  11.966 1.00 39.63  ? 253 LYS B CA  1 
ATOM   4370 C  C   . LYS B  1 253 ? -3.449  14.663  13.311 1.00 32.81  ? 253 LYS B C   1 
ATOM   4371 O  O   . LYS B  1 253 ? -3.673  15.283  14.352 1.00 31.25  ? 253 LYS B O   1 
ATOM   4372 C  CB  . LYS B  1 253 ? -4.577  14.970  11.081 1.00 34.17  ? 253 LYS B CB  1 
ATOM   4373 C  CG  . LYS B  1 253 ? -5.948  15.287  11.666 1.00 29.58  ? 253 LYS B CG  1 
ATOM   4374 C  CD  . LYS B  1 253 ? -7.057  14.927  10.682 1.00 37.26  ? 253 LYS B CD  1 
ATOM   4375 C  CE  . LYS B  1 253 ? -8.425  15.352  11.201 1.00 36.47  ? 253 LYS B CE  1 
ATOM   4376 N  NZ  . LYS B  1 253 ? -8.779  14.679  12.481 1.00 42.33  ? 253 LYS B NZ  1 
ATOM   4377 N  N   . VAL B  1 254 ? -3.253  13.349  13.286 1.00 36.32  ? 254 VAL B N   1 
ATOM   4378 C  CA  . VAL B  1 254 ? -3.283  12.539  14.503 1.00 38.61  ? 254 VAL B CA  1 
ATOM   4379 C  C   . VAL B  1 254 ? -2.134  12.915  15.450 1.00 28.48  ? 254 VAL B C   1 
ATOM   4380 O  O   . VAL B  1 254 ? -2.307  12.967  16.665 1.00 36.33  ? 254 VAL B O   1 
ATOM   4381 C  CB  . VAL B  1 254 ? -3.172  11.034  14.161 1.00 42.75  ? 254 VAL B CB  1 
ATOM   4382 C  CG1 . VAL B  1 254 ? -3.167  10.201  15.441 1.00 40.04  ? 254 VAL B CG1 1 
ATOM   4383 C  CG2 . VAL B  1 254 ? -4.328  10.623  13.257 1.00 46.73  ? 254 VAL B CG2 1 
ATOM   4384 N  N   . ALA B  1 255 ? -0.968  13.173  14.876 1.00 32.67  ? 255 ALA B N   1 
ATOM   4385 C  CA  . ALA B  1 255 ? 0.204   13.543  15.649 1.00 34.06  ? 255 ALA B CA  1 
ATOM   4386 C  C   . ALA B  1 255 ? -0.052  14.834  16.403 1.00 39.00  ? 255 ALA B C   1 
ATOM   4387 O  O   . ALA B  1 255 ? 0.264   14.936  17.590 1.00 36.81  ? 255 ALA B O   1 
ATOM   4388 C  CB  . ALA B  1 255 ? 1.410   13.701  14.728 1.00 34.05  ? 255 ALA B CB  1 
ATOM   4389 N  N   . CYS B  1 256 ? -0.632  15.819  15.720 1.00 33.87  ? 256 CYS B N   1 
ATOM   4390 C  CA  . CYS B  1 256 ? -0.906  17.090  16.365 1.00 31.64  ? 256 CYS B CA  1 
ATOM   4391 C  C   . CYS B  1 256 ? -2.059  17.004  17.356 1.00 35.68  ? 256 CYS B C   1 
ATOM   4392 O  O   . CYS B  1 256 ? -2.074  17.727  18.358 1.00 34.23  ? 256 CYS B O   1 
ATOM   4393 C  CB  . CYS B  1 256 ? -1.188  18.177  15.326 1.00 27.57  ? 256 CYS B CB  1 
ATOM   4394 S  SG  . CYS B  1 256 ? 0.275   18.728  14.420 1.00 35.29  ? 256 CYS B SG  1 
ATOM   4395 N  N   . GLU B  1 257 ? -3.021  16.126  17.092 1.00 29.02  ? 257 GLU B N   1 
ATOM   4396 C  CA  . GLU B  1 257 ? -4.157  15.993  17.999 1.00 37.83  ? 257 GLU B CA  1 
ATOM   4397 C  C   . GLU B  1 257 ? -3.736  15.338  19.319 1.00 39.75  ? 257 GLU B C   1 
ATOM   4398 O  O   . GLU B  1 257 ? -4.252  15.685  20.384 1.00 36.75  ? 257 GLU B O   1 
ATOM   4399 C  CB  . GLU B  1 257 ? -5.289  15.196  17.333 1.00 38.09  ? 257 GLU B CB  1 
ATOM   4400 C  CG  . GLU B  1 257 ? -5.837  15.875  16.077 1.00 38.15  ? 257 GLU B CG  1 
ATOM   4401 C  CD  . GLU B  1 257 ? -6.963  15.100  15.395 1.00 50.10  ? 257 GLU B CD  1 
ATOM   4402 O  OE1 . GLU B  1 257 ? -6.921  13.852  15.385 1.00 37.00  ? 257 GLU B OE1 1 
ATOM   4403 O  OE2 . GLU B  1 257 ? -7.883  15.746  14.846 1.00 41.16  ? 257 GLU B OE2 1 
ATOM   4404 N  N   . LYS B  1 258 ? -2.799  14.397  19.251 1.00 34.75  ? 258 LYS B N   1 
ATOM   4405 C  CA  . LYS B  1 258 ? -2.318  13.728  20.458 1.00 41.96  ? 258 LYS B CA  1 
ATOM   4406 C  C   . LYS B  1 258 ? -1.387  14.650  21.245 1.00 32.28  ? 258 LYS B C   1 
ATOM   4407 O  O   . LYS B  1 258 ? -1.442  14.700  22.474 1.00 29.51  ? 258 LYS B O   1 
ATOM   4408 C  CB  . LYS B  1 258 ? -1.598  12.431  20.099 1.00 44.21  ? 258 LYS B CB  1 
ATOM   4409 C  CG  . LYS B  1 258 ? -2.547  11.306  19.708 1.00 42.49  ? 258 LYS B CG  1 
ATOM   4410 C  CD  . LYS B  1 258 ? -1.784  10.037  19.371 1.00 56.33  ? 258 LYS B CD  1 
ATOM   4411 C  CE  . LYS B  1 258 ? -2.725  8.861   19.164 1.00 59.71  ? 258 LYS B CE  1 
ATOM   4412 N  NZ  . LYS B  1 258 ? -1.985  7.618   18.798 1.00 58.50  ? 258 LYS B NZ  1 
ATOM   4413 N  N   . THR B  1 259 ? -0.550  15.396  20.531 1.00 37.51  ? 259 THR B N   1 
ATOM   4414 C  CA  . THR B  1 259 ? 0.361   16.327  21.179 1.00 33.81  ? 259 THR B CA  1 
ATOM   4415 C  C   . THR B  1 259 ? -0.444  17.349  21.979 1.00 41.79  ? 259 THR B C   1 
ATOM   4416 O  O   . THR B  1 259 ? -0.217  17.534  23.177 1.00 39.00  ? 259 THR B O   1 
ATOM   4417 C  CB  . THR B  1 259 ? 1.215   17.090  20.150 1.00 36.91  ? 259 THR B CB  1 
ATOM   4418 O  OG1 . THR B  1 259 ? 2.072   16.176  19.448 1.00 31.54  ? 259 THR B OG1 1 
ATOM   4419 C  CG2 . THR B  1 259 ? 2.054   18.138  20.846 1.00 27.74  ? 259 THR B CG2 1 
ATOM   4420 N  N   . VAL B  1 260 ? -1.391  18.000  21.306 1.00 34.64  ? 260 VAL B N   1 
ATOM   4421 C  CA  . VAL B  1 260 ? -2.228  19.023  21.926 1.00 28.46  ? 260 VAL B CA  1 
ATOM   4422 C  C   . VAL B  1 260 ? -3.086  18.478  23.063 1.00 25.65  ? 260 VAL B C   1 
ATOM   4423 O  O   . VAL B  1 260 ? -3.237  19.132  24.091 1.00 39.27  ? 260 VAL B O   1 
ATOM   4424 C  CB  . VAL B  1 260 ? -3.146  19.729  20.869 1.00 32.07  ? 260 VAL B CB  1 
ATOM   4425 C  CG1 . VAL B  1 260 ? -4.165  20.606  21.562 1.00 24.99  ? 260 VAL B CG1 1 
ATOM   4426 C  CG2 . VAL B  1 260 ? -2.304  20.576  19.926 1.00 29.31  ? 260 VAL B CG2 1 
ATOM   4427 N  N   . SER B  1 261 ? -3.656  17.293  22.878 1.00 30.03  ? 261 SER B N   1 
ATOM   4428 C  CA  . SER B  1 261 ? -4.468  16.688  23.927 1.00 28.85  ? 261 SER B CA  1 
ATOM   4429 C  C   . SER B  1 261 ? -3.608  16.385  25.160 1.00 35.04  ? 261 SER B C   1 
ATOM   4430 O  O   . SER B  1 261 ? -4.052  16.561  26.298 1.00 30.17  ? 261 SER B O   1 
ATOM   4431 C  CB  . SER B  1 261 ? -5.136  15.403  23.428 1.00 43.48  ? 261 SER B CB  1 
ATOM   4432 O  OG  . SER B  1 261 ? -6.202  15.693  22.532 1.00 41.06  ? 261 SER B OG  1 
ATOM   4433 N  N   . THR B  1 262 ? -2.379  15.929  24.937 1.00 31.54  ? 262 THR B N   1 
ATOM   4434 C  CA  . THR B  1 262 ? -1.486  15.636  26.056 1.00 35.17  ? 262 THR B CA  1 
ATOM   4435 C  C   . THR B  1 262 ? -1.286  16.928  26.839 1.00 32.25  ? 262 THR B C   1 
ATOM   4436 O  O   . THR B  1 262 ? -1.401  16.951  28.061 1.00 41.77  ? 262 THR B O   1 
ATOM   4437 C  CB  . THR B  1 262 ? -0.127  15.128  25.571 1.00 30.27  ? 262 THR B CB  1 
ATOM   4438 O  OG1 . THR B  1 262 ? -0.310  13.903  24.856 1.00 33.38  ? 262 THR B OG1 1 
ATOM   4439 C  CG2 . THR B  1 262 ? 0.809   14.892  26.757 1.00 44.63  ? 262 THR B CG2 1 
ATOM   4440 N  N   . LEU B  1 263 ? -0.995  18.008  26.125 1.00 36.58  ? 263 LEU B N   1 
ATOM   4441 C  CA  . LEU B  1 263 ? -0.816  19.302  26.769 1.00 26.74  ? 263 LEU B CA  1 
ATOM   4442 C  C   . LEU B  1 263 ? -2.064  19.660  27.571 1.00 38.43  ? 263 LEU B C   1 
ATOM   4443 O  O   . LEU B  1 263 ? -1.973  20.113  28.710 1.00 30.60  ? 263 LEU B O   1 
ATOM   4444 C  CB  . LEU B  1 263 ? -0.561  20.393  25.726 1.00 35.16  ? 263 LEU B CB  1 
ATOM   4445 C  CG  . LEU B  1 263 ? 0.884   20.839  25.502 1.00 40.75  ? 263 LEU B CG  1 
ATOM   4446 C  CD1 . LEU B  1 263 ? 1.384   21.539  26.744 1.00 37.02  ? 263 LEU B CD1 1 
ATOM   4447 C  CD2 . LEU B  1 263 ? 1.755   19.644  25.166 1.00 34.38  ? 263 LEU B CD2 1 
ATOM   4448 N  N   . HIS B  1 264 ? -3.229  19.461  26.963 1.00 35.86  ? 264 HIS B N   1 
ATOM   4449 C  CA  . HIS B  1 264 ? -4.491  19.774  27.618 1.00 36.59  ? 264 HIS B CA  1 
ATOM   4450 C  C   . HIS B  1 264 ? -4.617  19.079  28.980 1.00 32.17  ? 264 HIS B C   1 
ATOM   4451 O  O   . HIS B  1 264 ? -4.940  19.710  29.980 1.00 36.53  ? 264 HIS B O   1 
ATOM   4452 C  CB  . HIS B  1 264 ? -5.663  19.359  26.719 1.00 34.62  ? 264 HIS B CB  1 
ATOM   4453 C  CG  . HIS B  1 264 ? -6.999  19.429  27.397 1.00 37.48  ? 264 HIS B CG  1 
ATOM   4454 N  ND1 . HIS B  1 264 ? -7.683  20.612  27.577 1.00 45.06  ? 264 HIS B ND1 1 
ATOM   4455 C  CD2 . HIS B  1 264 ? -7.755  18.468  27.977 1.00 41.82  ? 264 HIS B CD2 1 
ATOM   4456 C  CE1 . HIS B  1 264 ? -8.801  20.378  28.241 1.00 40.08  ? 264 HIS B CE1 1 
ATOM   4457 N  NE2 . HIS B  1 264 ? -8.869  19.085  28.496 1.00 48.38  ? 264 HIS B NE2 1 
ATOM   4458 N  N   . HIS B  1 265 ? -4.358  17.778  29.011 1.00 37.89  ? 265 HIS B N   1 
ATOM   4459 C  CA  . HIS B  1 265 ? -4.472  17.017  30.246 1.00 40.77  ? 265 HIS B CA  1 
ATOM   4460 C  C   . HIS B  1 265 ? -3.500  17.481  31.314 1.00 41.43  ? 265 HIS B C   1 
ATOM   4461 O  O   . HIS B  1 265 ? -3.862  17.585  32.484 1.00 37.19  ? 265 HIS B O   1 
ATOM   4462 C  CB  . HIS B  1 265 ? -4.272  15.536  29.958 1.00 37.25  ? 265 HIS B CB  1 
ATOM   4463 C  CG  . HIS B  1 265 ? -5.272  14.983  28.993 1.00 49.71  ? 265 HIS B CG  1 
ATOM   4464 N  ND1 . HIS B  1 265 ? -6.629  15.146  29.161 1.00 41.60  ? 265 HIS B ND1 1 
ATOM   4465 C  CD2 . HIS B  1 265 ? -5.115  14.278  27.850 1.00 37.57  ? 265 HIS B CD2 1 
ATOM   4466 C  CE1 . HIS B  1 265 ? -7.266  14.565  28.161 1.00 33.54  ? 265 HIS B CE1 1 
ATOM   4467 N  NE2 . HIS B  1 265 ? -6.369  14.031  27.351 1.00 38.09  ? 265 HIS B NE2 1 
ATOM   4468 N  N   . VAL B  1 266 ? -2.265  17.755  30.909 1.00 33.89  ? 266 VAL B N   1 
ATOM   4469 C  CA  . VAL B  1 266 ? -1.249  18.226  31.840 1.00 38.25  ? 266 VAL B CA  1 
ATOM   4470 C  C   . VAL B  1 266 ? -1.647  19.593  32.392 1.00 36.93  ? 266 VAL B C   1 
ATOM   4471 O  O   . VAL B  1 266 ? -1.597  19.812  33.600 1.00 35.53  ? 266 VAL B O   1 
ATOM   4472 C  CB  . VAL B  1 266 ? 0.142   18.335  31.152 1.00 31.35  ? 266 VAL B CB  1 
ATOM   4473 C  CG1 . VAL B  1 266 ? 1.130   19.057  32.063 1.00 37.25  ? 266 VAL B CG1 1 
ATOM   4474 C  CG2 . VAL B  1 266 ? 0.666   16.940  30.817 1.00 29.29  ? 266 VAL B CG2 1 
ATOM   4475 N  N   . LEU B  1 267 ? -2.053  20.503  31.504 1.00 43.01  ? 267 LEU B N   1 
ATOM   4476 C  CA  . LEU B  1 267 ? -2.446  21.850  31.908 1.00 34.27  ? 267 LEU B CA  1 
ATOM   4477 C  C   . LEU B  1 267 ? -3.714  21.884  32.753 1.00 34.21  ? 267 LEU B C   1 
ATOM   4478 O  O   . LEU B  1 267 ? -3.810  22.659  33.695 1.00 39.08  ? 267 LEU B O   1 
ATOM   4479 C  CB  . LEU B  1 267 ? -2.622  22.746  30.679 1.00 36.88  ? 267 LEU B CB  1 
ATOM   4480 C  CG  . LEU B  1 267 ? -1.320  23.167  29.996 1.00 45.69  ? 267 LEU B CG  1 
ATOM   4481 C  CD1 . LEU B  1 267 ? -1.619  23.948  28.721 1.00 41.70  ? 267 LEU B CD1 1 
ATOM   4482 C  CD2 . LEU B  1 267 ? -0.501  24.011  30.963 1.00 42.03  ? 267 LEU B CD2 1 
ATOM   4483 N  N   . GLN B  1 268 ? -4.689  21.051  32.414 1.00 36.68  ? 268 GLN B N   1 
ATOM   4484 C  CA  . GLN B  1 268 ? -5.930  21.007  33.176 1.00 37.72  ? 268 GLN B CA  1 
ATOM   4485 C  C   . GLN B  1 268 ? -5.636  20.500  34.583 1.00 45.46  ? 268 GLN B C   1 
ATOM   4486 O  O   . GLN B  1 268 ? -6.153  21.033  35.564 1.00 41.08  ? 268 GLN B O   1 
ATOM   4487 C  CB  . GLN B  1 268 ? -6.940  20.074  32.508 1.00 34.64  ? 268 GLN B CB  1 
ATOM   4488 C  CG  . GLN B  1 268 ? -8.257  19.959  33.264 1.00 61.47  ? 268 GLN B CG  1 
ATOM   4489 C  CD  . GLN B  1 268 ? -9.220  18.971  32.624 1.00 80.27  ? 268 GLN B CD  1 
ATOM   4490 O  OE1 . GLN B  1 268 ? -9.567  19.095  31.448 1.00 93.33  ? 268 GLN B OE1 1 
ATOM   4491 N  NE2 . GLN B  1 268 ? -9.658  17.983  33.400 1.00 79.79  ? 268 GLN B NE2 1 
ATOM   4492 N  N   . ARG B  1 269 ? -4.804  19.468  34.683 1.00 35.25  ? 269 ARG B N   1 
ATOM   4493 C  CA  . ARG B  1 269 ? -4.468  18.918  35.991 1.00 41.52  ? 269 ARG B CA  1 
ATOM   4494 C  C   . ARG B  1 269 ? -3.675  19.952  36.778 1.00 40.15  ? 269 ARG B C   1 
ATOM   4495 O  O   . ARG B  1 269 ? -3.888  20.128  37.978 1.00 37.19  ? 269 ARG B O   1 
ATOM   4496 C  CB  . ARG B  1 269 ? -3.656  17.626  35.845 1.00 35.93  ? 269 ARG B CB  1 
ATOM   4497 C  CG  . ARG B  1 269 ? -3.223  17.027  37.177 1.00 35.79  ? 269 ARG B CG  1 
ATOM   4498 C  CD  . ARG B  1 269 ? -2.654  15.622  37.011 1.00 37.37  ? 269 ARG B CD  1 
ATOM   4499 N  NE  . ARG B  1 269 ? -3.677  14.638  36.655 1.00 31.71  ? 269 ARG B NE  1 
ATOM   4500 C  CZ  . ARG B  1 269 ? -3.786  14.072  35.458 1.00 38.49  ? 269 ARG B CZ  1 
ATOM   4501 N  NH1 . ARG B  1 269 ? -2.937  14.386  34.486 1.00 33.65  ? 269 ARG B NH1 1 
ATOM   4502 N  NH2 . ARG B  1 269 ? -4.741  13.181  35.236 1.00 33.56  ? 269 ARG B NH2 1 
ATOM   4503 N  N   . THR B  1 270 ? -2.774  20.644  36.087 1.00 37.89  ? 270 THR B N   1 
ATOM   4504 C  CA  . THR B  1 270 ? -1.944  21.671  36.705 1.00 36.80  ? 270 THR B CA  1 
ATOM   4505 C  C   . THR B  1 270 ? -2.789  22.842  37.222 1.00 50.54  ? 270 THR B C   1 
ATOM   4506 O  O   . THR B  1 270 ? -2.550  23.363  38.312 1.00 56.82  ? 270 THR B O   1 
ATOM   4507 C  CB  . THR B  1 270 ? -0.903  22.202  35.707 1.00 35.19  ? 270 THR B CB  1 
ATOM   4508 O  OG1 . THR B  1 270 ? -0.086  21.115  35.248 1.00 38.02  ? 270 THR B OG1 1 
ATOM   4509 C  CG2 . THR B  1 270 ? -0.021  23.249  36.368 1.00 38.75  ? 270 THR B CG2 1 
ATOM   4510 N  N   . ILE B  1 271 ? -3.777  23.245  36.430 1.00 49.49  ? 271 ILE B N   1 
ATOM   4511 C  CA  . ILE B  1 271 ? -4.673  24.339  36.787 1.00 48.67  ? 271 ILE B CA  1 
ATOM   4512 C  C   . ILE B  1 271 ? -5.488  23.993  38.032 1.00 52.14  ? 271 ILE B C   1 
ATOM   4513 O  O   . ILE B  1 271 ? -5.617  24.806  38.950 1.00 48.73  ? 271 ILE B O   1 
ATOM   4514 C  CB  . ILE B  1 271 ? -5.637  24.655  35.614 1.00 49.36  ? 271 ILE B CB  1 
ATOM   4515 C  CG1 . ILE B  1 271 ? -4.912  25.511  34.576 1.00 53.00  ? 271 ILE B CG1 1 
ATOM   4516 C  CG2 . ILE B  1 271 ? -6.895  25.344  36.125 1.00 48.16  ? 271 ILE B CG2 1 
ATOM   4517 C  CD1 . ILE B  1 271 ? -5.743  25.820  33.346 1.00 63.83  ? 271 ILE B CD1 1 
ATOM   4518 N  N   . GLN B  1 272 ? -6.047  22.788  38.050 1.00 48.65  ? 272 GLN B N   1 
ATOM   4519 C  CA  . GLN B  1 272 ? -6.839  22.329  39.183 1.00 50.34  ? 272 GLN B CA  1 
ATOM   4520 C  C   . GLN B  1 272 ? -6.001  22.358  40.460 1.00 51.94  ? 272 GLN B C   1 
ATOM   4521 O  O   . GLN B  1 272 ? -6.344  23.052  41.415 1.00 56.79  ? 272 GLN B O   1 
ATOM   4522 C  CB  . GLN B  1 272 ? -7.345  20.910  38.923 1.00 47.62  ? 272 GLN B CB  1 
ATOM   4523 C  CG  . GLN B  1 272 ? -8.465  20.827  37.894 1.00 59.63  ? 272 GLN B CG  1 
ATOM   4524 C  CD  . GLN B  1 272 ? -8.705  19.407  37.400 1.00 79.03  ? 272 GLN B CD  1 
ATOM   4525 O  OE1 . GLN B  1 272 ? -8.261  18.436  38.015 1.00 80.07  ? 272 GLN B OE1 1 
ATOM   4526 N  NE2 . GLN B  1 272 ? -9.420  19.282  36.287 1.00 83.36  ? 272 GLN B NE2 1 
ATOM   4527 N  N   . CYS B  1 273 ? -4.899  21.611  40.467 1.00 54.93  ? 273 CYS B N   1 
ATOM   4528 C  CA  . CYS B  1 273 ? -4.010  21.559  41.626 1.00 55.25  ? 273 CYS B CA  1 
ATOM   4529 C  C   . CYS B  1 273 ? -3.535  22.953  42.020 1.00 52.30  ? 273 CYS B C   1 
ATOM   4530 O  O   . CYS B  1 273 ? -3.454  23.279  43.203 1.00 59.92  ? 273 CYS B O   1 
ATOM   4531 C  CB  . CYS B  1 273 ? -2.790  20.679  41.329 1.00 49.78  ? 273 CYS B CB  1 
ATOM   4532 S  SG  . CYS B  1 273 ? -3.166  18.942  40.974 1.00 87.97  ? 273 CYS B SG  1 
ATOM   4533 N  N   . ALA B  1 274 ? -3.218  23.772  41.023 1.00 59.73  ? 274 ALA B N   1 
ATOM   4534 C  CA  . ALA B  1 274 ? -2.754  25.133  41.273 1.00 61.64  ? 274 ALA B CA  1 
ATOM   4535 C  C   . ALA B  1 274 ? -3.792  25.905  42.077 1.00 63.05  ? 274 ALA B C   1 
ATOM   4536 O  O   . ALA B  1 274 ? -3.471  26.510  43.098 1.00 72.84  ? 274 ALA B O   1 
ATOM   4537 C  CB  . ALA B  1 274 ? -2.478  25.843  39.954 1.00 54.99  ? 274 ALA B CB  1 
ATOM   4538 N  N   . LYS B  1 275 ? -5.037  25.878  41.614 1.00 62.65  ? 275 LYS B N   1 
ATOM   4539 C  CA  . LYS B  1 275 ? -6.117  26.578  42.301 1.00 63.14  ? 275 LYS B CA  1 
ATOM   4540 C  C   . LYS B  1 275 ? -6.331  26.041  43.707 1.00 63.91  ? 275 LYS B C   1 
ATOM   4541 O  O   . LYS B  1 275 ? -6.396  26.806  44.666 1.00 71.73  ? 275 LYS B O   1 
ATOM   4542 C  CB  . LYS B  1 275 ? -7.427  26.458  41.518 1.00 56.64  ? 275 LYS B CB  1 
ATOM   4543 C  CG  . LYS B  1 275 ? -7.560  27.403  40.335 1.00 61.61  ? 275 LYS B CG  1 
ATOM   4544 C  CD  . LYS B  1 275 ? -8.955  27.291  39.736 1.00 69.03  ? 275 LYS B CD  1 
ATOM   4545 C  CE  . LYS B  1 275 ? -9.208  28.356  38.686 1.00 73.76  ? 275 LYS B CE  1 
ATOM   4546 N  NZ  . LYS B  1 275 ? -10.587 28.251  38.133 1.00 64.90  ? 275 LYS B NZ  1 
ATOM   4547 N  N   . ALA B  1 276 ? -6.445  24.724  43.824 1.00 64.41  ? 276 ALA B N   1 
ATOM   4548 C  CA  . ALA B  1 276 ? -6.660  24.090  45.119 1.00 65.70  ? 276 ALA B CA  1 
ATOM   4549 C  C   . ALA B  1 276 ? -5.631  24.535  46.157 1.00 72.08  ? 276 ALA B C   1 
ATOM   4550 O  O   . ALA B  1 276 ? -5.958  24.684  47.333 1.00 75.59  ? 276 ALA B O   1 
ATOM   4551 C  CB  . ALA B  1 276 ? -6.627  22.578  44.965 1.00 63.92  ? 276 ALA B CB  1 
ATOM   4552 N  N   . GLN B  1 277 ? -4.392  24.746  45.721 1.00 72.81  ? 277 GLN B N   1 
ATOM   4553 C  CA  . GLN B  1 277 ? -3.324  25.175  46.621 1.00 77.56  ? 277 GLN B CA  1 
ATOM   4554 C  C   . GLN B  1 277 ? -3.502  26.623  47.069 1.00 82.32  ? 277 GLN B C   1 
ATOM   4555 O  O   . GLN B  1 277 ? -2.552  27.268  47.514 1.00 81.56  ? 277 GLN B O   1 
ATOM   4556 C  CB  . GLN B  1 277 ? -1.958  25.003  45.946 1.00 75.48  ? 277 GLN B CB  1 
ATOM   4557 C  CG  . GLN B  1 277 ? -1.430  23.574  45.969 1.00 83.84  ? 277 GLN B CG  1 
ATOM   4558 C  CD  . GLN B  1 277 ? -0.145  23.406  45.177 1.00 90.49  ? 277 GLN B CD  1 
ATOM   4559 O  OE1 . GLN B  1 277 ? -0.147  23.480  43.948 1.00 96.00  ? 277 GLN B OE1 1 
ATOM   4560 N  NE2 . GLN B  1 277 ? 0.962   23.183  45.879 1.00 87.72  ? 277 GLN B NE2 1 
ATOM   4561 N  N   . ALA B  1 278 ? -4.731  27.117  46.949 1.00 87.97  ? 278 ALA B N   1 
ATOM   4562 C  CA  . ALA B  1 278 ? -5.093  28.479  47.336 1.00 87.13  ? 278 ALA B CA  1 
ATOM   4563 C  C   . ALA B  1 278 ? -6.450  28.791  46.719 1.00 89.93  ? 278 ALA B C   1 
ATOM   4564 O  O   . ALA B  1 278 ? -7.412  28.045  46.908 1.00 91.40  ? 278 ALA B O   1 
ATOM   4565 C  CB  . ALA B  1 278 ? -4.049  29.472  46.837 1.00 81.75  ? 278 ALA B CB  1 
ATOM   4566 N  N   . GLY B  1 279 ? -6.524  29.893  45.982 1.00 93.20  ? 279 GLY B N   1 
ATOM   4567 C  CA  . GLY B  1 279 ? -7.768  30.256  45.332 1.00 96.09  ? 279 GLY B CA  1 
ATOM   4568 C  C   . GLY B  1 279 ? -7.612  30.152  43.826 1.00 100.00 ? 279 GLY B C   1 
ATOM   4569 O  O   . GLY B  1 279 ? -6.863  29.261  43.370 1.00 100.00 ? 279 GLY B O   1 
ATOM   4570 N  N   . VAL B  1 282 ? -7.249  33.551  44.482 1.00 85.79  ? 282 VAL B N   1 
ATOM   4571 C  CA  . VAL B  1 282 ? -5.816  33.970  44.524 1.00 89.63  ? 282 VAL B CA  1 
ATOM   4572 C  C   . VAL B  1 282 ? -5.047  33.416  43.331 1.00 87.77  ? 282 VAL B C   1 
ATOM   4573 O  O   . VAL B  1 282 ? -5.043  32.206  43.100 1.00 89.66  ? 282 VAL B O   1 
ATOM   4574 C  CB  . VAL B  1 282 ? -5.119  33.466  45.809 1.00 90.51  ? 282 VAL B CB  1 
ATOM   4575 C  CG1 . VAL B  1 282 ? -3.661  33.902  45.812 1.00 86.71  ? 282 VAL B CG1 1 
ATOM   4576 C  CG2 . VAL B  1 282 ? -5.837  33.996  47.040 1.00 86.43  ? 282 VAL B CG2 1 
ATOM   4577 N  N   . ARG B  1 283 ? -4.399  34.297  42.573 1.00 84.52  ? 283 ARG B N   1 
ATOM   4578 C  CA  . ARG B  1 283 ? -3.615  33.860  41.423 1.00 81.81  ? 283 ARG B CA  1 
ATOM   4579 C  C   . ARG B  1 283 ? -2.497  32.955  41.920 1.00 78.65  ? 283 ARG B C   1 
ATOM   4580 O  O   . ARG B  1 283 ? -1.717  33.344  42.792 1.00 76.69  ? 283 ARG B O   1 
ATOM   4581 C  CB  . ARG B  1 283 ? -3.014  35.060  40.675 1.00 83.66  ? 283 ARG B CB  1 
ATOM   4582 C  CG  . ARG B  1 283 ? -1.906  34.675  39.685 1.00 99.77  ? 283 ARG B CG  1 
ATOM   4583 C  CD  . ARG B  1 283 ? -1.686  35.735  38.605 1.00 100.00 ? 283 ARG B CD  1 
ATOM   4584 N  NE  . ARG B  1 283 ? -1.125  36.986  39.111 1.00 100.00 ? 283 ARG B NE  1 
ATOM   4585 C  CZ  . ARG B  1 283 ? 0.164   37.310  39.057 1.00 100.00 ? 283 ARG B CZ  1 
ATOM   4586 N  NH1 . ARG B  1 283 ? 1.042   36.475  38.519 1.00 100.00 ? 283 ARG B NH1 1 
ATOM   4587 N  NH2 . ARG B  1 283 ? 0.575   38.479  39.533 1.00 100.00 ? 283 ARG B NH2 1 
ATOM   4588 N  N   . PRO B  1 284 ? -2.413  31.726  41.386 1.00 66.71  ? 284 PRO B N   1 
ATOM   4589 C  CA  . PRO B  1 284 ? -1.355  30.819  41.829 1.00 61.72  ? 284 PRO B CA  1 
ATOM   4590 C  C   . PRO B  1 284 ? 0.016   31.424  41.556 1.00 56.26  ? 284 PRO B C   1 
ATOM   4591 O  O   . PRO B  1 284 ? 0.174   32.238  40.645 1.00 50.46  ? 284 PRO B O   1 
ATOM   4592 C  CB  . PRO B  1 284 ? -1.611  29.562  41.000 1.00 68.75  ? 284 PRO B CB  1 
ATOM   4593 C  CG  . PRO B  1 284 ? -3.095  29.589  40.794 1.00 59.68  ? 284 PRO B CG  1 
ATOM   4594 C  CD  . PRO B  1 284 ? -3.332  31.043  40.459 1.00 68.20  ? 284 PRO B CD  1 
ATOM   4595 N  N   . SER B  1 285 ? 1.000   31.038  42.357 1.00 49.02  ? 285 SER B N   1 
ATOM   4596 C  CA  . SER B  1 285 ? 2.359   31.533  42.181 1.00 50.06  ? 285 SER B CA  1 
ATOM   4597 C  C   . SER B  1 285 ? 3.065   30.656  41.151 1.00 50.61  ? 285 SER B C   1 
ATOM   4598 O  O   . SER B  1 285 ? 2.578   29.578  40.807 1.00 57.67  ? 285 SER B O   1 
ATOM   4599 C  CB  . SER B  1 285 ? 3.113   31.475  43.510 1.00 57.83  ? 285 SER B CB  1 
ATOM   4600 O  OG  . SER B  1 285 ? 3.107   30.157  44.032 1.00 67.59  ? 285 SER B OG  1 
ATOM   4601 N  N   . PRO B  1 286 ? 4.212   31.112  40.629 1.00 50.85  ? 286 PRO B N   1 
ATOM   4602 C  CA  . PRO B  1 286 ? 4.923   30.297  39.642 1.00 45.26  ? 286 PRO B CA  1 
ATOM   4603 C  C   . PRO B  1 286 ? 5.144   28.869  40.145 1.00 54.92  ? 286 PRO B C   1 
ATOM   4604 O  O   . PRO B  1 286 ? 5.032   27.902  39.386 1.00 43.71  ? 286 PRO B O   1 
ATOM   4605 C  CB  . PRO B  1 286 ? 6.224   31.067  39.446 1.00 49.78  ? 286 PRO B CB  1 
ATOM   4606 C  CG  . PRO B  1 286 ? 5.764   32.494  39.559 1.00 44.61  ? 286 PRO B CG  1 
ATOM   4607 C  CD  . PRO B  1 286 ? 4.837   32.442  40.764 1.00 47.40  ? 286 PRO B CD  1 
ATOM   4608 N  N   . MET B  1 287 ? 5.441   28.743  41.435 1.00 55.20  ? 287 MET B N   1 
ATOM   4609 C  CA  . MET B  1 287 ? 5.679   27.440  42.049 1.00 59.17  ? 287 MET B CA  1 
ATOM   4610 C  C   . MET B  1 287 ? 4.472   26.518  41.919 1.00 49.37  ? 287 MET B C   1 
ATOM   4611 O  O   . MET B  1 287 ? 4.597   25.345  41.572 1.00 53.89  ? 287 MET B O   1 
ATOM   4612 C  CB  . MET B  1 287 ? 6.020   27.610  43.529 1.00 61.43  ? 287 MET B CB  1 
ATOM   4613 C  CG  . MET B  1 287 ? 6.218   26.299  44.268 1.00 73.83  ? 287 MET B CG  1 
ATOM   4614 S  SD  . MET B  1 287 ? 6.452   26.549  46.030 1.00 90.17  ? 287 MET B SD  1 
ATOM   4615 C  CE  . MET B  1 287 ? 4.749   26.509  46.600 1.00 89.49  ? 287 MET B CE  1 
ATOM   4616 N  N   . GLN B  1 288 ? 3.301   27.058  42.209 1.00 46.07  ? 288 GLN B N   1 
ATOM   4617 C  CA  . GLN B  1 288 ? 2.068   26.288  42.136 1.00 53.07  ? 288 GLN B CA  1 
ATOM   4618 C  C   . GLN B  1 288 ? 1.640   25.988  40.697 1.00 51.47  ? 288 GLN B C   1 
ATOM   4619 O  O   . GLN B  1 288 ? 0.894   25.036  40.446 1.00 47.10  ? 288 GLN B O   1 
ATOM   4620 C  CB  . GLN B  1 288 ? 0.963   27.052  42.862 1.00 56.02  ? 288 GLN B CB  1 
ATOM   4621 C  CG  . GLN B  1 288 ? 1.198   27.173  44.354 1.00 60.55  ? 288 GLN B CG  1 
ATOM   4622 C  CD  . GLN B  1 288 ? 0.440   28.332  44.968 1.00 68.16  ? 288 GLN B CD  1 
ATOM   4623 O  OE1 . GLN B  1 288 ? 0.205   28.362  46.174 1.00 61.23  ? 288 GLN B OE1 1 
ATOM   4624 N  NE2 . GLN B  1 288 ? 0.065   29.302  44.139 1.00 63.06  ? 288 GLN B NE2 1 
ATOM   4625 N  N   . LEU B  1 289 ? 2.112   26.802  39.759 1.00 41.92  ? 289 LEU B N   1 
ATOM   4626 C  CA  . LEU B  1 289 ? 1.775   26.620  38.354 1.00 46.52  ? 289 LEU B CA  1 
ATOM   4627 C  C   . LEU B  1 289 ? 2.767   25.716  37.641 1.00 45.99  ? 289 LEU B C   1 
ATOM   4628 O  O   . LEU B  1 289 ? 2.761   25.620  36.414 1.00 45.92  ? 289 LEU B O   1 
ATOM   4629 C  CB  . LEU B  1 289 ? 1.704   27.974  37.649 1.00 47.33  ? 289 LEU B CB  1 
ATOM   4630 C  CG  . LEU B  1 289 ? 0.545   28.867  38.104 1.00 61.01  ? 289 LEU B CG  1 
ATOM   4631 C  CD1 . LEU B  1 289 ? 0.698   30.262  37.514 1.00 51.31  ? 289 LEU B CD1 1 
ATOM   4632 C  CD2 . LEU B  1 289 ? -0.776  28.233  37.684 1.00 42.07  ? 289 LEU B CD2 1 
ATOM   4633 N  N   . GLU B  1 290 ? 3.635   25.067  38.410 1.00 41.90  ? 290 GLU B N   1 
ATOM   4634 C  CA  . GLU B  1 290 ? 4.602   24.153  37.821 1.00 47.18  ? 290 GLU B CA  1 
ATOM   4635 C  C   . GLU B  1 290 ? 3.797   22.990  37.235 1.00 47.64  ? 290 GLU B C   1 
ATOM   4636 O  O   . GLU B  1 290 ? 2.879   22.469  37.880 1.00 34.53  ? 290 GLU B O   1 
ATOM   4637 C  CB  . GLU B  1 290 ? 5.583   23.650  38.890 1.00 32.42  ? 290 GLU B CB  1 
ATOM   4638 C  CG  . GLU B  1 290 ? 6.639   24.678  39.309 1.00 35.81  ? 290 GLU B CG  1 
ATOM   4639 C  CD  . GLU B  1 290 ? 7.746   24.851  38.267 1.00 42.38  ? 290 GLU B CD  1 
ATOM   4640 O  OE1 . GLU B  1 290 ? 7.633   24.281  37.159 1.00 37.48  ? 290 GLU B OE1 1 
ATOM   4641 O  OE2 . GLU B  1 290 ? 8.735   25.555  38.558 1.00 38.29  ? 290 GLU B OE2 1 
ATOM   4642 N  N   . LEU B  1 291 ? 4.130   22.605  36.007 1.00 40.60  ? 291 LEU B N   1 
ATOM   4643 C  CA  . LEU B  1 291 ? 3.435   21.520  35.326 1.00 43.94  ? 291 LEU B CA  1 
ATOM   4644 C  C   . LEU B  1 291 ? 3.412   20.242  36.152 1.00 45.74  ? 291 LEU B C   1 
ATOM   4645 O  O   . LEU B  1 291 ? 4.446   19.789  36.647 1.00 39.27  ? 291 LEU B O   1 
ATOM   4646 C  CB  . LEU B  1 291 ? 4.096   21.234  33.977 1.00 38.89  ? 291 LEU B CB  1 
ATOM   4647 C  CG  . LEU B  1 291 ? 4.175   22.402  32.992 1.00 48.35  ? 291 LEU B CG  1 
ATOM   4648 C  CD1 . LEU B  1 291 ? 4.894   21.948  31.738 1.00 43.62  ? 291 LEU B CD1 1 
ATOM   4649 C  CD2 . LEU B  1 291 ? 2.784   22.898  32.653 1.00 39.22  ? 291 LEU B CD2 1 
ATOM   4650 N  N   . ARG B  1 292 ? 2.224   19.668  36.300 1.00 33.00  ? 292 ARG B N   1 
ATOM   4651 C  CA  . ARG B  1 292 ? 2.061   18.421  37.045 1.00 35.76  ? 292 ARG B CA  1 
ATOM   4652 C  C   . ARG B  1 292 ? 2.471   17.274  36.127 1.00 31.51  ? 292 ARG B C   1 
ATOM   4653 O  O   . ARG B  1 292 ? 1.636   16.499  35.661 1.00 36.09  ? 292 ARG B O   1 
ATOM   4654 C  CB  . ARG B  1 292 ? 0.601   18.262  37.470 1.00 38.40  ? 292 ARG B CB  1 
ATOM   4655 C  CG  . ARG B  1 292 ? 0.163   19.261  38.523 1.00 47.23  ? 292 ARG B CG  1 
ATOM   4656 C  CD  . ARG B  1 292 ? 0.776   18.920  39.869 1.00 47.37  ? 292 ARG B CD  1 
ATOM   4657 N  NE  . ARG B  1 292 ? 0.288   19.787  40.932 1.00 64.97  ? 292 ARG B NE  1 
ATOM   4658 C  CZ  . ARG B  1 292 ? 0.344   19.483  42.225 1.00 83.24  ? 292 ARG B CZ  1 
ATOM   4659 N  NH1 . ARG B  1 292 ? -0.124  20.334  43.129 1.00 92.44  ? 292 ARG B NH1 1 
ATOM   4660 N  NH2 . ARG B  1 292 ? 0.856   18.323  42.615 1.00 76.61  ? 292 ARG B NH2 1 
ATOM   4661 N  N   . MET B  1 293 ? 3.771   17.172  35.877 1.00 36.69  ? 293 MET B N   1 
ATOM   4662 C  CA  . MET B  1 293 ? 4.308   16.153  34.986 1.00 36.28  ? 293 MET B CA  1 
ATOM   4663 C  C   . MET B  1 293 ? 4.192   14.714  35.498 1.00 47.15  ? 293 MET B C   1 
ATOM   4664 O  O   . MET B  1 293 ? 3.615   13.846  34.830 1.00 39.87  ? 293 MET B O   1 
ATOM   4665 C  CB  . MET B  1 293 ? 5.775   16.473  34.681 1.00 37.13  ? 293 MET B CB  1 
ATOM   4666 C  CG  . MET B  1 293 ? 6.336   15.767  33.452 1.00 51.81  ? 293 MET B CG  1 
ATOM   4667 S  SD  . MET B  1 293 ? 5.516   16.271  31.922 1.00 64.06  ? 293 MET B SD  1 
ATOM   4668 C  CE  . MET B  1 293 ? 5.182   17.989  32.268 1.00 19.94  ? 293 MET B CE  1 
ATOM   4669 N  N   . VAL B  1 294 ? 4.744   14.467  36.681 1.00 36.31  ? 294 VAL B N   1 
ATOM   4670 C  CA  . VAL B  1 294 ? 4.733   13.131  37.268 1.00 42.17  ? 294 VAL B CA  1 
ATOM   4671 C  C   . VAL B  1 294 ? 3.324   12.562  37.372 1.00 38.79  ? 294 VAL B C   1 
ATOM   4672 O  O   . VAL B  1 294 ? 3.084   11.385  37.081 1.00 33.66  ? 294 VAL B O   1 
ATOM   4673 C  CB  . VAL B  1 294 ? 5.392   13.146  38.678 1.00 41.52  ? 294 VAL B CB  1 
ATOM   4674 C  CG1 . VAL B  1 294 ? 5.276   11.786  39.328 1.00 51.62  ? 294 VAL B CG1 1 
ATOM   4675 C  CG2 . VAL B  1 294 ? 6.855   13.540  38.554 1.00 46.85  ? 294 VAL B CG2 1 
ATOM   4676 N  N   . GLN B  1 295 ? 2.397   13.412  37.788 1.00 35.67  ? 295 GLN B N   1 
ATOM   4677 C  CA  . GLN B  1 295 ? 1.014   13.013  37.958 1.00 32.01  ? 295 GLN B CA  1 
ATOM   4678 C  C   . GLN B  1 295 ? 0.269   12.789  36.630 1.00 40.61  ? 295 GLN B C   1 
ATOM   4679 O  O   . GLN B  1 295 ? -0.820  12.226  36.616 1.00 32.68  ? 295 GLN B O   1 
ATOM   4680 C  CB  . GLN B  1 295 ? 0.286   14.071  38.796 1.00 42.72  ? 295 GLN B CB  1 
ATOM   4681 C  CG  . GLN B  1 295 ? 0.902   14.354  40.184 1.00 42.74  ? 295 GLN B CG  1 
ATOM   4682 C  CD  . GLN B  1 295 ? 2.116   15.294  40.156 1.00 58.26  ? 295 GLN B CD  1 
ATOM   4683 O  OE1 . GLN B  1 295 ? 2.434   15.903  39.133 1.00 48.07  ? 295 GLN B OE1 1 
ATOM   4684 N  NE2 . GLN B  1 295 ? 2.786   15.420  41.296 1.00 38.36  ? 295 GLN B NE2 1 
ATOM   4685 N  N   . SER B  1 296 ? 0.862   13.208  35.515 1.00 37.01  ? 296 SER B N   1 
ATOM   4686 C  CA  . SER B  1 296 ? 0.212   13.054  34.215 1.00 40.58  ? 296 SER B CA  1 
ATOM   4687 C  C   . SER B  1 296 ? 0.727   11.858  33.433 1.00 40.06  ? 296 SER B C   1 
ATOM   4688 O  O   . SER B  1 296 ? 0.473   11.746  32.241 1.00 40.29  ? 296 SER B O   1 
ATOM   4689 C  CB  . SER B  1 296 ? 0.408   14.320  33.367 1.00 29.90  ? 296 SER B CB  1 
ATOM   4690 O  OG  . SER B  1 296 ? -0.150  15.456  34.005 1.00 36.64  ? 296 SER B OG  1 
ATOM   4691 N  N   . LYS B  1 297 ? 1.445   10.965  34.104 1.00 37.49  ? 297 LYS B N   1 
ATOM   4692 C  CA  . LYS B  1 297 ? 2.005   9.791   33.449 1.00 31.16  ? 297 LYS B CA  1 
ATOM   4693 C  C   . LYS B  1 297 ? 1.008   9.052   32.548 1.00 35.06  ? 297 LYS B C   1 
ATOM   4694 O  O   . LYS B  1 297 ? 1.316   8.746   31.400 1.00 34.73  ? 297 LYS B O   1 
ATOM   4695 C  CB  . LYS B  1 297 ? 2.566   8.826   34.505 1.00 34.43  ? 297 LYS B CB  1 
ATOM   4696 C  CG  . LYS B  1 297 ? 3.192   7.569   33.921 1.00 31.86  ? 297 LYS B CG  1 
ATOM   4697 C  CD  . LYS B  1 297 ? 3.746   6.634   34.999 1.00 39.29  ? 297 LYS B CD  1 
ATOM   4698 C  CE  . LYS B  1 297 ? 2.672   6.206   35.994 1.00 39.77  ? 297 LYS B CE  1 
ATOM   4699 N  NZ  . LYS B  1 297 ? 3.171   5.222   37.006 1.00 35.77  ? 297 LYS B NZ  1 
ATOM   4700 N  N   . ARG B  1 298 ? -0.182  8.765   33.065 1.00 33.34  ? 298 ARG B N   1 
ATOM   4701 C  CA  . ARG B  1 298 ? -1.188  8.047   32.286 1.00 39.44  ? 298 ARG B CA  1 
ATOM   4702 C  C   . ARG B  1 298 ? -1.633  8.808   31.041 1.00 37.28  ? 298 ARG B C   1 
ATOM   4703 O  O   . ARG B  1 298 ? -1.782  8.219   29.971 1.00 46.05  ? 298 ARG B O   1 
ATOM   4704 C  CB  . ARG B  1 298 ? -2.415  7.724   33.149 1.00 45.18  ? 298 ARG B CB  1 
ATOM   4705 C  CG  . ARG B  1 298 ? -2.125  6.869   34.381 1.00 53.81  ? 298 ARG B CG  1 
ATOM   4706 C  CD  . ARG B  1 298 ? -1.319  5.624   34.032 1.00 56.51  ? 298 ARG B CD  1 
ATOM   4707 N  NE  . ARG B  1 298 ? -0.917  4.886   35.227 1.00 67.15  ? 298 ARG B NE  1 
ATOM   4708 C  CZ  . ARG B  1 298 ? 0.110   4.040   35.280 1.00 80.05  ? 298 ARG B CZ  1 
ATOM   4709 N  NH1 . ARG B  1 298 ? 0.857   3.817   34.203 1.00 66.35  ? 298 ARG B NH1 1 
ATOM   4710 N  NH2 . ARG B  1 298 ? 0.396   3.414   36.416 1.00 73.77  ? 298 ARG B NH2 1 
ATOM   4711 N  N   . ASP B  1 299 ? -1.842  10.113  31.173 1.00 37.62  ? 299 ASP B N   1 
ATOM   4712 C  CA  . ASP B  1 299 ? -2.269  10.914  30.029 1.00 33.78  ? 299 ASP B CA  1 
ATOM   4713 C  C   . ASP B  1 299 ? -1.190  10.981  28.959 1.00 45.65  ? 299 ASP B C   1 
ATOM   4714 O  O   . ASP B  1 299 ? -1.493  11.035  27.771 1.00 42.53  ? 299 ASP B O   1 
ATOM   4715 C  CB  . ASP B  1 299 ? -2.661  12.318  30.475 1.00 37.10  ? 299 ASP B CB  1 
ATOM   4716 C  CG  . ASP B  1 299 ? -3.882  12.314  31.375 1.00 30.23  ? 299 ASP B CG  1 
ATOM   4717 O  OD1 . ASP B  1 299 ? -4.821  11.548  31.086 1.00 41.03  ? 299 ASP B OD1 1 
ATOM   4718 O  OD2 . ASP B  1 299 ? -3.910  13.075  32.357 1.00 42.90  ? 299 ASP B OD2 1 
ATOM   4719 N  N   . ILE B  1 300 ? 0.070   10.961  29.382 1.00 40.44  ? 300 ILE B N   1 
ATOM   4720 C  CA  . ILE B  1 300 ? 1.182   11.000  28.440 1.00 36.68  ? 300 ILE B CA  1 
ATOM   4721 C  C   . ILE B  1 300 ? 1.254   9.690   27.656 1.00 30.11  ? 300 ILE B C   1 
ATOM   4722 O  O   . ILE B  1 300 ? 1.508   9.693   26.455 1.00 33.37  ? 300 ILE B O   1 
ATOM   4723 C  CB  . ILE B  1 300 ? 2.521   11.228  29.177 1.00 27.25  ? 300 ILE B CB  1 
ATOM   4724 C  CG1 . ILE B  1 300 ? 2.570   12.654  29.728 1.00 39.49  ? 300 ILE B CG1 1 
ATOM   4725 C  CG2 . ILE B  1 300 ? 3.683   10.962  28.237 1.00 29.13  ? 300 ILE B CG2 1 
ATOM   4726 C  CD1 . ILE B  1 300 ? 3.669   12.886  30.750 1.00 34.11  ? 300 ILE B CD1 1 
ATOM   4727 N  N   . GLU B  1 301 ? 1.016   8.571   28.337 1.00 37.71  ? 301 GLU B N   1 
ATOM   4728 C  CA  . GLU B  1 301 ? 1.060   7.256   27.694 1.00 47.40  ? 301 GLU B CA  1 
ATOM   4729 C  C   . GLU B  1 301 ? -0.035  7.052   26.645 1.00 35.93  ? 301 GLU B C   1 
ATOM   4730 O  O   . GLU B  1 301 ? 0.233   6.592   25.544 1.00 38.01  ? 301 GLU B O   1 
ATOM   4731 C  CB  . GLU B  1 301 ? 0.961   6.148   28.748 1.00 33.50  ? 301 GLU B CB  1 
ATOM   4732 C  CG  . GLU B  1 301 ? 2.100   6.163   29.747 1.00 37.69  ? 301 GLU B CG  1 
ATOM   4733 C  CD  . GLU B  1 301 ? 1.949   5.121   30.843 1.00 44.52  ? 301 GLU B CD  1 
ATOM   4734 O  OE1 . GLU B  1 301 ? 0.824   4.943   31.351 1.00 40.07  ? 301 GLU B OE1 1 
ATOM   4735 O  OE2 . GLU B  1 301 ? 2.960   4.490   31.209 1.00 46.38  ? 301 GLU B OE2 1 
ATOM   4736 N  N   . ASP B  1 302 ? -1.268  7.392   26.994 1.00 44.74  ? 302 ASP B N   1 
ATOM   4737 C  CA  . ASP B  1 302 ? -2.389  7.225   26.075 1.00 45.74  ? 302 ASP B CA  1 
ATOM   4738 C  C   . ASP B  1 302 ? -3.343  8.382   26.316 1.00 30.43  ? 302 ASP B C   1 
ATOM   4739 O  O   . ASP B  1 302 ? -4.301  8.261   27.081 1.00 37.90  ? 302 ASP B O   1 
ATOM   4740 C  CB  . ASP B  1 302 ? -3.073  5.885   26.348 1.00 57.40  ? 302 ASP B CB  1 
ATOM   4741 C  CG  . ASP B  1 302 ? -4.205  5.602   25.387 1.00 64.89  ? 302 ASP B CG  1 
ATOM   4742 O  OD1 . ASP B  1 302 ? -4.041  5.868   24.175 1.00 62.76  ? 302 ASP B OD1 1 
ATOM   4743 O  OD2 . ASP B  1 302 ? -5.253  5.101   25.846 1.00 71.88  ? 302 ASP B OD2 1 
ATOM   4744 N  N   . PRO B  1 303 ? -3.075  9.534   25.675 1.00 30.51  ? 303 PRO B N   1 
ATOM   4745 C  CA  . PRO B  1 303 ? -3.910  10.720  25.839 1.00 32.56  ? 303 PRO B CA  1 
ATOM   4746 C  C   . PRO B  1 303 ? -5.262  10.640  25.143 1.00 42.93  ? 303 PRO B C   1 
ATOM   4747 O  O   . PRO B  1 303 ? -5.353  10.289  23.968 1.00 39.74  ? 303 PRO B O   1 
ATOM   4748 C  CB  . PRO B  1 303 ? -3.027  11.834  25.275 1.00 32.31  ? 303 PRO B CB  1 
ATOM   4749 C  CG  . PRO B  1 303 ? -2.347  11.155  24.155 1.00 31.13  ? 303 PRO B CG  1 
ATOM   4750 C  CD  . PRO B  1 303 ? -1.965  9.808   24.742 1.00 28.48  ? 303 PRO B CD  1 
ATOM   4751 N  N   . GLU B  1 304 ? -6.310  10.956  25.893 1.00 39.34  ? 304 GLU B N   1 
ATOM   4752 C  CA  . GLU B  1 304 ? -7.655  10.967  25.353 1.00 51.14  ? 304 GLU B CA  1 
ATOM   4753 C  C   . GLU B  1 304 ? -7.716  12.184  24.432 1.00 47.38  ? 304 GLU B C   1 
ATOM   4754 O  O   . GLU B  1 304 ? -7.405  13.297  24.856 1.00 39.92  ? 304 GLU B O   1 
ATOM   4755 C  CB  . GLU B  1 304 ? -8.669  11.134  26.482 1.00 48.37  ? 304 GLU B CB  1 
ATOM   4756 C  CG  . GLU B  1 304 ? -10.115 11.106  26.028 1.00 67.88  ? 304 GLU B CG  1 
ATOM   4757 C  CD  . GLU B  1 304 ? -11.025 11.871  26.966 1.00 73.02  ? 304 GLU B CD  1 
ATOM   4758 O  OE1 . GLU B  1 304 ? -10.977 11.616  28.188 1.00 78.37  ? 304 GLU B OE1 1 
ATOM   4759 O  OE2 . GLU B  1 304 ? -11.791 12.729  26.480 1.00 83.26  ? 304 GLU B OE2 1 
ATOM   4760 N  N   . ILE B  1 305 ? -8.101  11.976  23.176 1.00 52.85  ? 305 ILE B N   1 
ATOM   4761 C  CA  . ILE B  1 305 ? -8.194  13.080  22.227 1.00 47.11  ? 305 ILE B CA  1 
ATOM   4762 C  C   . ILE B  1 305 ? -9.379  13.965  22.594 1.00 49.19  ? 305 ILE B C   1 
ATOM   4763 O  O   . ILE B  1 305 ? -10.527 13.540  22.503 1.00 54.54  ? 305 ILE B O   1 
ATOM   4764 C  CB  . ILE B  1 305 ? -8.397  12.572  20.795 1.00 46.05  ? 305 ILE B CB  1 
ATOM   4765 C  CG1 . ILE B  1 305 ? -7.312  11.552  20.446 1.00 49.15  ? 305 ILE B CG1 1 
ATOM   4766 C  CG2 . ILE B  1 305 ? -8.376  13.745  19.825 1.00 40.60  ? 305 ILE B CG2 1 
ATOM   4767 C  CD1 . ILE B  1 305 ? -5.899  12.085  20.556 1.00 66.02  ? 305 ILE B CD1 1 
ATOM   4768 N  N   . VAL B  1 306 ? -9.100  15.197  23.006 1.00 45.02  ? 306 VAL B N   1 
ATOM   4769 C  CA  . VAL B  1 306 ? -10.163 16.116  23.395 1.00 45.48  ? 306 VAL B CA  1 
ATOM   4770 C  C   . VAL B  1 306 ? -10.337 17.259  22.404 1.00 45.50  ? 306 VAL B C   1 
ATOM   4771 O  O   . VAL B  1 306 ? -11.108 18.188  22.639 1.00 48.35  ? 306 VAL B O   1 
ATOM   4772 C  CB  . VAL B  1 306 ? -9.894  16.702  24.797 1.00 43.49  ? 306 VAL B CB  1 
ATOM   4773 C  CG1 . VAL B  1 306 ? -9.816  15.573  25.811 1.00 48.64  ? 306 VAL B CG1 1 
ATOM   4774 C  CG2 . VAL B  1 306 ? -8.602  17.504  24.793 1.00 44.41  ? 306 VAL B CG2 1 
ATOM   4775 N  N   . VAL B  1 307 ? -9.613  17.187  21.294 1.00 42.79  ? 307 VAL B N   1 
ATOM   4776 C  CA  . VAL B  1 307 ? -9.701  18.210  20.267 1.00 46.06  ? 307 VAL B CA  1 
ATOM   4777 C  C   . VAL B  1 307 ? -9.456  17.573  18.914 1.00 48.79  ? 307 VAL B C   1 
ATOM   4778 O  O   . VAL B  1 307 ? -8.688  16.622  18.796 1.00 58.21  ? 307 VAL B O   1 
ATOM   4779 C  CB  . VAL B  1 307 ? -8.656  19.319  20.477 1.00 58.68  ? 307 VAL B CB  1 
ATOM   4780 C  CG1 . VAL B  1 307 ? -7.251  18.729  20.424 1.00 63.30  ? 307 VAL B CG1 1 
ATOM   4781 C  CG2 . VAL B  1 307 ? -8.824  20.393  19.414 1.00 55.24  ? 307 VAL B CG2 1 
ATOM   4782 N  N   . GLN B  1 308 ? -10.118 18.088  17.888 1.00 54.77  ? 308 GLN B N   1 
ATOM   4783 C  CA  . GLN B  1 308 ? -9.930  17.545  16.557 1.00 46.32  ? 308 GLN B CA  1 
ATOM   4784 C  C   . GLN B  1 308 ? -9.475  18.654  15.629 1.00 48.29  ? 308 GLN B C   1 
ATOM   4785 O  O   . GLN B  1 308 ? -10.021 19.757  15.648 1.00 49.83  ? 308 GLN B O   1 
ATOM   4786 C  CB  . GLN B  1 308 ? -11.227 16.919  16.051 1.00 59.17  ? 308 GLN B CB  1 
ATOM   4787 C  CG  . GLN B  1 308 ? -11.039 16.065  14.821 1.00 80.88  ? 308 GLN B CG  1 
ATOM   4788 C  CD  . GLN B  1 308 ? -12.139 15.043  14.658 1.00 90.85  ? 308 GLN B CD  1 
ATOM   4789 O  OE1 . GLN B  1 308 ? -12.387 14.239  15.558 1.00 88.85  ? 308 GLN B OE1 1 
ATOM   4790 N  NE2 . GLN B  1 308 ? -12.803 15.062  13.508 1.00 89.14  ? 308 GLN B NE2 1 
ATOM   4791 N  N   . ALA B  1 309 ? -8.456  18.358  14.834 1.00 41.45  ? 309 ALA B N   1 
ATOM   4792 C  CA  . ALA B  1 309 ? -7.912  19.321  13.892 1.00 41.33  ? 309 ALA B CA  1 
ATOM   4793 C  C   . ALA B  1 309 ? -8.759  19.396  12.627 1.00 41.90  ? 309 ALA B C   1 
ATOM   4794 O  O   . ALA B  1 309 ? -9.350  18.399  12.203 1.00 38.19  ? 309 ALA B O   1 
ATOM   4795 C  CB  . ALA B  1 309 ? -6.485  18.929  13.523 1.00 31.29  ? 309 ALA B CB  1 
ATOM   4796 N  N   . THR B  1 310 ? -8.819  20.580  12.030 1.00 37.80  ? 310 THR B N   1 
ATOM   4797 C  CA  . THR B  1 310 ? -9.555  20.751  10.787 1.00 39.08  ? 310 THR B CA  1 
ATOM   4798 C  C   . THR B  1 310 ? -8.545  20.625  9.659  1.00 41.42  ? 310 THR B C   1 
ATOM   4799 O  O   . THR B  1 310 ? -7.400  21.057  9.785  1.00 39.90  ? 310 THR B O   1 
ATOM   4800 C  CB  . THR B  1 310 ? -10.258 22.125  10.703 1.00 45.27  ? 310 THR B CB  1 
ATOM   4801 O  OG1 . THR B  1 310 ? -9.320  23.169  10.966 1.00 47.00  ? 310 THR B OG1 1 
ATOM   4802 C  CG2 . THR B  1 310 ? -11.388 22.203  11.710 1.00 44.71  ? 310 THR B CG2 1 
ATOM   4803 N  N   . VAL B  1 311 ? -8.967  20.016  8.561  1.00 37.22  ? 311 VAL B N   1 
ATOM   4804 C  CA  . VAL B  1 311 ? -8.092  19.815  7.420  1.00 37.81  ? 311 VAL B CA  1 
ATOM   4805 C  C   . VAL B  1 311 ? -8.021  21.055  6.536  1.00 41.83  ? 311 VAL B C   1 
ATOM   4806 O  O   . VAL B  1 311 ? -9.034  21.680  6.251  1.00 50.05  ? 311 VAL B O   1 
ATOM   4807 C  CB  . VAL B  1 311 ? -8.581  18.597  6.594  1.00 40.60  ? 311 VAL B CB  1 
ATOM   4808 C  CG1 . VAL B  1 311 ? -7.733  18.410  5.356  1.00 40.08  ? 311 VAL B CG1 1 
ATOM   4809 C  CG2 . VAL B  1 311 ? -8.539  17.342  7.467  1.00 32.58  ? 311 VAL B CG2 1 
ATOM   4810 N  N   . LEU B  1 312 ? -6.814  21.422  6.120  1.00 41.70  ? 312 LEU B N   1 
ATOM   4811 C  CA  . LEU B  1 312 ? -6.630  22.575  5.248  1.00 40.89  ? 312 LEU B CA  1 
ATOM   4812 C  C   . LEU B  1 312 ? -5.967  22.078  3.974  1.00 39.97  ? 312 LEU B C   1 
ATOM   4813 O  O   . LEU B  1 312 ? -5.979  20.849  3.778  1.00 42.68  ? 312 LEU B O   1 
ATOM   4814 C  CB  . LEU B  1 312 ? -5.743  23.637  5.916  1.00 37.89  ? 312 LEU B CB  1 
ATOM   4815 C  CG  . LEU B  1 312 ? -6.309  24.370  7.139  1.00 48.23  ? 312 LEU B CG  1 
ATOM   4816 C  CD1 . LEU B  1 312 ? -5.256  25.309  7.731  1.00 38.32  ? 312 LEU B CD1 1 
ATOM   4817 C  CD2 . LEU B  1 312 ? -7.544  25.150  6.732  1.00 43.22  ? 312 LEU B CD2 1 
ATOM   4818 O  OXT . LEU B  1 312 ? -5.456  22.906  3.191  1.00 49.68  ? 312 LEU B OXT 1 
HETATM 4819 NA NA  . NA  C  2 .   ? 27.684  0.707   47.171 1.00 79.09  ? 401 NA  A NA  1 
HETATM 4820 C  C1  A TEP D  3 .   ? 28.374  3.630   40.577 0.50 58.12  ? 402 TEP A C1  1 
HETATM 4821 N  N1  A TEP D  3 .   ? 28.545  5.019   40.099 0.50 62.13  ? 402 TEP A N1  1 
HETATM 4822 C  C2  A TEP D  3 .   ? 27.641  6.012   40.499 0.50 63.27  ? 402 TEP A C2  1 
HETATM 4823 O  O2  A TEP D  3 .   ? 26.735  5.740   41.288 0.50 53.43  ? 402 TEP A O2  1 
HETATM 4824 N  N3  A TEP D  3 .   ? 27.793  7.320   40.027 0.50 66.16  ? 402 TEP A N3  1 
HETATM 4825 C  C3  A TEP D  3 .   ? 26.832  8.370   40.436 0.50 61.46  ? 402 TEP A C3  1 
HETATM 4826 C  C4  A TEP D  3 .   ? 28.846  7.631   39.157 0.50 71.21  ? 402 TEP A C4  1 
HETATM 4827 C  C5  A TEP D  3 .   ? 29.744  6.642   38.770 0.50 72.00  ? 402 TEP A C5  1 
HETATM 4828 C  C6  A TEP D  3 .   ? 29.596  5.341   39.232 0.50 69.63  ? 402 TEP A C6  1 
HETATM 4829 O  O6  A TEP D  3 .   ? 30.400  4.473   38.894 0.50 63.49  ? 402 TEP A O6  1 
HETATM 4830 N  N7  A TEP D  3 .   ? 30.630  7.217   37.961 0.50 74.41  ? 402 TEP A N7  1 
HETATM 4831 C  C8  A TEP D  3 .   ? 30.315  8.506   37.846 0.50 73.14  ? 402 TEP A C8  1 
HETATM 4832 N  N9  A TEP D  3 .   ? 29.230  8.759   38.574 0.50 72.55  ? 402 TEP A N9  1 
HETATM 4833 C  C1  B MPD E  4 .   ? 30.017  9.673   36.292 0.50 49.74  ? 403 MPD A C1  1 
HETATM 4834 C  C2  B MPD E  4 .   ? 30.488  8.798   37.456 0.50 55.19  ? 403 MPD A C2  1 
HETATM 4835 O  O2  B MPD E  4 .   ? 30.619  7.442   37.021 0.50 50.26  ? 403 MPD A O2  1 
HETATM 4836 C  CM  B MPD E  4 .   ? 31.840  9.303   37.963 0.50 55.29  ? 403 MPD A CM  1 
HETATM 4837 C  C3  B MPD E  4 .   ? 29.465  8.855   38.593 0.50 60.08  ? 403 MPD A C3  1 
HETATM 4838 C  C4  B MPD E  4 .   ? 28.850  7.473   38.823 0.50 68.78  ? 403 MPD A C4  1 
HETATM 4839 O  O4  B MPD E  4 .   ? 29.887  6.556   39.182 0.50 79.76  ? 403 MPD A O4  1 
HETATM 4840 C  C5  B MPD E  4 .   ? 27.785  7.528   39.919 0.50 70.93  ? 403 MPD A C5  1 
HETATM 4841 C  C1  . MPD F  4 .   ? 20.365  -6.454  45.424 0.90 56.39  ? 404 MPD A C1  1 
HETATM 4842 C  C2  . MPD F  4 .   ? 21.831  -6.107  45.154 0.90 56.37  ? 404 MPD A C2  1 
HETATM 4843 O  O2  . MPD F  4 .   ? 22.640  -6.617  46.216 0.90 58.52  ? 404 MPD A O2  1 
HETATM 4844 C  CM  . MPD F  4 .   ? 22.261  -6.723  43.821 0.90 57.69  ? 404 MPD A CM  1 
HETATM 4845 C  C3  . MPD F  4 .   ? 21.992  -4.585  45.116 0.90 51.88  ? 404 MPD A C3  1 
HETATM 4846 C  C4  . MPD F  4 .   ? 23.474  -4.204  45.120 0.90 55.32  ? 404 MPD A C4  1 
HETATM 4847 O  O4  . MPD F  4 .   ? 24.133  -4.821  44.011 0.90 67.37  ? 404 MPD A O4  1 
HETATM 4848 C  C5  . MPD F  4 .   ? 23.634  -2.684  45.047 0.90 53.96  ? 404 MPD A C5  1 
HETATM 4849 C  C1  . MPD G  4 .   ? 8.536   19.654  53.696 0.90 70.59  ? 405 MPD A C1  1 
HETATM 4850 C  C2  . MPD G  4 .   ? 7.221   19.909  54.436 0.90 72.24  ? 405 MPD A C2  1 
HETATM 4851 O  O2  . MPD G  4 .   ? 6.864   18.758  55.204 0.90 74.30  ? 405 MPD A O2  1 
HETATM 4852 C  CM  . MPD G  4 .   ? 7.387   21.109  55.371 0.90 76.90  ? 405 MPD A CM  1 
HETATM 4853 C  C3  . MPD G  4 .   ? 6.097   20.202  53.438 0.90 75.78  ? 405 MPD A C3  1 
HETATM 4854 C  C4  . MPD G  4 .   ? 5.817   18.998  52.535 0.90 75.69  ? 405 MPD A C4  1 
HETATM 4855 O  O4  . MPD G  4 .   ? 7.002   18.634  51.824 0.90 66.70  ? 405 MPD A O4  1 
HETATM 4856 C  C5  . MPD G  4 .   ? 5.266   17.809  53.325 0.90 60.44  ? 405 MPD A C5  1 
HETATM 4857 C  C1  . MPD H  4 .   ? 21.611  -11.519 39.604 0.90 68.98  ? 406 MPD A C1  1 
HETATM 4858 C  C2  . MPD H  4 .   ? 20.174  -11.376 39.096 0.90 63.00  ? 406 MPD A C2  1 
HETATM 4859 O  O2  . MPD H  4 .   ? 20.182  -11.038 37.707 0.90 68.24  ? 406 MPD A O2  1 
HETATM 4860 C  CM  . MPD H  4 .   ? 19.424  -12.697 39.282 0.90 62.38  ? 406 MPD A CM  1 
HETATM 4861 C  C3  . MPD H  4 .   ? 19.476  -10.240 39.848 0.90 55.79  ? 406 MPD A C3  1 
HETATM 4862 C  C4  . MPD H  4 .   ? 19.588  -10.420 41.363 0.90 56.85  ? 406 MPD A C4  1 
HETATM 4863 O  O4  . MPD H  4 .   ? 19.171  -9.209  42.000 0.90 62.34  ? 406 MPD A O4  1 
HETATM 4864 C  C5  . MPD H  4 .   ? 18.726  -11.583 41.855 0.90 61.27  ? 406 MPD A C5  1 
HETATM 4865 C  C1  . MPD I  4 .   ? 4.292   9.884   46.690 0.90 73.31  ? 407 MPD A C1  1 
HETATM 4866 C  C2  . MPD I  4 .   ? 3.220   8.866   46.299 0.90 75.14  ? 407 MPD A C2  1 
HETATM 4867 O  O2  . MPD I  4 .   ? 3.832   7.595   46.061 0.90 70.33  ? 407 MPD A O2  1 
HETATM 4868 C  CM  . MPD I  4 .   ? 2.197   8.744   47.430 0.90 86.28  ? 407 MPD A CM  1 
HETATM 4869 C  C3  . MPD I  4 .   ? 2.539   9.313   45.004 0.90 81.39  ? 407 MPD A C3  1 
HETATM 4870 C  C4  . MPD I  4 .   ? 1.488   8.291   44.563 0.90 79.55  ? 407 MPD A C4  1 
HETATM 4871 O  O4  . MPD I  4 .   ? 0.401   8.294   45.493 0.90 84.08  ? 407 MPD A O4  1 
HETATM 4872 C  C5  . MPD I  4 .   ? 0.986   8.592   43.150 0.90 68.51  ? 407 MPD A C5  1 
HETATM 4873 S  S   . SO4 J  5 .   ? 38.683  -2.690  58.619 0.90 100.00 ? 408 SO4 A S   1 
HETATM 4874 O  O1  . SO4 J  5 .   ? 38.419  -1.259  58.372 0.90 100.00 ? 408 SO4 A O1  1 
HETATM 4875 O  O2  . SO4 J  5 .   ? 38.297  -3.477  57.429 0.90 100.00 ? 408 SO4 A O2  1 
HETATM 4876 O  O3  . SO4 J  5 .   ? 37.898  -3.135  59.788 0.90 100.00 ? 408 SO4 A O3  1 
HETATM 4877 O  O4  . SO4 J  5 .   ? 40.121  -2.887  58.890 0.90 100.00 ? 408 SO4 A O4  1 
HETATM 4878 S  S   . SO4 K  5 .   ? 24.183  26.728  54.223 0.90 96.12  ? 409 SO4 A S   1 
HETATM 4879 O  O1  . SO4 K  5 .   ? 23.703  25.431  53.705 0.90 86.44  ? 409 SO4 A O1  1 
HETATM 4880 O  O2  . SO4 K  5 .   ? 24.205  27.723  53.133 0.90 88.18  ? 409 SO4 A O2  1 
HETATM 4881 O  O3  . SO4 K  5 .   ? 25.546  26.568  54.766 0.90 94.17  ? 409 SO4 A O3  1 
HETATM 4882 O  O4  . SO4 K  5 .   ? 23.276  27.189  55.291 0.90 92.68  ? 409 SO4 A O4  1 
HETATM 4883 S  S   . SO4 L  5 .   ? 31.447  15.232  43.733 0.90 100.00 ? 410 SO4 A S   1 
HETATM 4884 O  O1  . SO4 L  5 .   ? 32.666  15.528  42.954 0.90 100.00 ? 410 SO4 A O1  1 
HETATM 4885 O  O2  . SO4 L  5 .   ? 30.797  14.023  43.190 0.90 97.02  ? 410 SO4 A O2  1 
HETATM 4886 O  O3  . SO4 L  5 .   ? 30.517  16.376  43.649 0.90 97.39  ? 410 SO4 A O3  1 
HETATM 4887 O  O4  . SO4 L  5 .   ? 31.813  15.001  45.143 0.90 99.48  ? 410 SO4 A O4  1 
HETATM 4888 NA NA  . NA  M  2 .   ? 7.575   28.961  21.663 1.00 89.20  ? 401 NA  B NA  1 
HETATM 4889 C  C1  A TEP N  3 .   ? 10.720  28.414  29.004 0.50 58.47  ? 402 TEP B C1  1 
HETATM 4890 N  N1  A TEP N  3 .   ? 12.052  28.148  29.589 0.50 71.42  ? 402 TEP B N1  1 
HETATM 4891 C  C2  A TEP N  3 .   ? 12.938  27.292  28.927 0.50 64.95  ? 402 TEP B C2  1 
HETATM 4892 O  O2  A TEP N  3 .   ? 12.603  26.746  27.874 0.50 65.04  ? 402 TEP B O2  1 
HETATM 4893 N  N3  A TEP N  3 .   ? 14.207  27.058  29.468 0.50 61.69  ? 402 TEP B N3  1 
HETATM 4894 C  C3  A TEP N  3 .   ? 15.141  26.151  28.764 0.50 52.43  ? 402 TEP B C3  1 
HETATM 4895 C  C4  A TEP N  3 .   ? 14.583  27.677  30.667 0.50 58.78  ? 402 TEP B C4  1 
HETATM 4896 C  C5  A TEP N  3 .   ? 13.699  28.524  31.321 0.50 65.81  ? 402 TEP B C5  1 
HETATM 4897 C  C6  A TEP N  3 .   ? 12.432  28.760  30.788 0.50 65.69  ? 402 TEP B C6  1 
HETATM 4898 O  O6  A TEP N  3 .   ? 11.652  29.503  31.378 0.50 65.48  ? 402 TEP B O6  1 
HETATM 4899 N  N7  A TEP N  3 .   ? 14.313  28.968  32.411 0.50 64.67  ? 402 TEP B N7  1 
HETATM 4900 C  C8  A TEP N  3 .   ? 15.531  28.433  32.450 0.50 57.43  ? 402 TEP B C8  1 
HETATM 4901 N  N9  A TEP N  3 .   ? 15.698  27.647  31.388 0.50 62.65  ? 402 TEP B N9  1 
HETATM 4902 C  C1  B MPD O  4 .   ? 13.977  29.192  32.971 0.50 23.57  ? 403 MPD B C1  1 
HETATM 4903 C  C2  B MPD O  4 .   ? 15.335  29.019  32.288 0.50 39.07  ? 403 MPD B C2  1 
HETATM 4904 O  O2  B MPD O  4 .   ? 16.116  30.203  32.471 0.50 59.18  ? 403 MPD B O2  1 
HETATM 4905 C  CM  B MPD O  4 .   ? 16.079  27.831  32.901 0.50 38.16  ? 403 MPD B CM  1 
HETATM 4906 C  C3  B MPD O  4 .   ? 15.159  28.798  30.785 0.50 47.87  ? 403 MPD B C3  1 
HETATM 4907 C  C4  B MPD O  4 .   ? 14.154  27.678  30.513 0.50 41.22  ? 403 MPD B C4  1 
HETATM 4908 O  O4  B MPD O  4 .   ? 12.840  28.132  30.848 0.50 49.14  ? 403 MPD B O4  1 
HETATM 4909 C  C5  B MPD O  4 .   ? 14.211  27.226  29.053 0.50 49.06  ? 403 MPD B C5  1 
HETATM 4910 C  C1  . MPD P  4 .   ? 10.369  14.501  1.540  0.90 71.83  ? 404 MPD B C1  1 
HETATM 4911 C  C2  . MPD P  4 .   ? 11.267  15.692  1.202  0.90 64.02  ? 404 MPD B C2  1 
HETATM 4912 O  O2  . MPD P  4 .   ? 10.550  16.909  1.417  0.90 60.65  ? 404 MPD B O2  1 
HETATM 4913 C  CM  . MPD P  4 .   ? 12.514  15.662  2.089  0.90 61.78  ? 404 MPD B CM  1 
HETATM 4914 C  C3  . MPD P  4 .   ? 11.682  15.622  -0.269 0.90 74.39  ? 404 MPD B C3  1 
HETATM 4915 C  C4  . MPD P  4 .   ? 12.642  16.765  -0.609 0.90 77.47  ? 404 MPD B C4  1 
HETATM 4916 O  O4  . MPD P  4 .   ? 13.096  16.599  -1.954 0.90 79.36  ? 404 MPD B O4  1 
HETATM 4917 C  C5  . MPD P  4 .   ? 11.969  18.130  -0.444 0.90 83.73  ? 404 MPD B C5  1 
HETATM 4918 C  C1  . MPD Q  4 .   ? -11.926 31.772  11.137 0.90 86.71  ? 405 MPD B C1  1 
HETATM 4919 C  C2  . MPD Q  4 .   ? -12.037 32.238  9.683  0.90 85.97  ? 405 MPD B C2  1 
HETATM 4920 O  O2  . MPD Q  4 .   ? -11.375 33.490  9.478  0.90 96.14  ? 405 MPD B O2  1 
HETATM 4921 C  CM  . MPD Q  4 .   ? -13.313 31.913  8.907  0.90 84.58  ? 405 MPD B CM  1 
HETATM 4922 C  C3  . MPD Q  4 .   ? -11.044 31.282  9.014  0.90 78.99  ? 405 MPD B C3  1 
HETATM 4923 C  C4  . MPD Q  4 .   ? -10.557 31.808  7.660  0.90 72.60  ? 405 MPD B C4  1 
HETATM 4924 O  O4  . MPD Q  4 .   ? -11.664 32.272  6.882  0.90 79.80  ? 405 MPD B O4  1 
HETATM 4925 C  C5  . MPD Q  4 .   ? -9.492  32.894  7.814  0.90 74.03  ? 405 MPD B C5  1 
HETATM 4926 C  C1  . MPD R  4 .   ? 15.855  41.253  15.570 0.90 70.95  ? 406 MPD B C1  1 
HETATM 4927 C  C2  . MPD R  4 .   ? 14.925  42.345  16.099 0.90 83.35  ? 406 MPD B C2  1 
HETATM 4928 O  O2  . MPD R  4 .   ? 15.119  42.488  17.509 0.90 85.76  ? 406 MPD B O2  1 
HETATM 4929 C  CM  . MPD R  4 .   ? 15.241  43.663  15.389 0.90 77.73  ? 406 MPD B CM  1 
HETATM 4930 C  C3  . MPD R  4 .   ? 13.471  41.929  15.857 0.90 78.37  ? 406 MPD B C3  1 
HETATM 4931 C  C4  . MPD R  4 .   ? 12.488  42.896  16.524 0.90 74.64  ? 406 MPD B C4  1 
HETATM 4932 O  O4  . MPD R  4 .   ? 12.817  43.039  17.909 0.90 75.09  ? 406 MPD B O4  1 
HETATM 4933 C  C5  . MPD R  4 .   ? 12.440  44.257  15.826 0.90 75.29  ? 406 MPD B C5  1 
HETATM 4934 C  C1  . MPD S  4 .   ? 20.599  34.642  30.507 0.90 70.43  ? 407 MPD B C1  1 
HETATM 4935 C  C2  . MPD S  4 .   ? 19.736  34.592  31.770 0.90 69.71  ? 407 MPD B C2  1 
HETATM 4936 O  O2  . MPD S  4 .   ? 20.191  35.592  32.688 0.90 74.74  ? 407 MPD B O2  1 
HETATM 4937 C  CM  . MPD S  4 .   ? 18.271  34.852  31.411 0.90 65.88  ? 407 MPD B CM  1 
HETATM 4938 C  C3  . MPD S  4 .   ? 19.871  33.230  32.454 0.90 69.40  ? 407 MPD B C3  1 
HETATM 4939 C  C4  . MPD S  4 .   ? 19.310  32.120  31.562 0.90 64.45  ? 407 MPD B C4  1 
HETATM 4940 O  O4  . MPD S  4 .   ? 20.087  32.033  30.364 0.90 67.97  ? 407 MPD B O4  1 
HETATM 4941 C  C5  . MPD S  4 .   ? 19.310  30.778  32.296 0.90 68.58  ? 407 MPD B C5  1 
HETATM 4942 C  C1  . MPD T  4 .   ? -1.540  24.729  23.791 0.90 77.64  ? 408 MPD B C1  1 
HETATM 4943 C  C2  . MPD T  4 .   ? -0.406  25.436  23.045 0.90 77.49  ? 408 MPD B C2  1 
HETATM 4944 O  O2  . MPD T  4 .   ? -0.381  26.841  23.316 0.90 81.01  ? 408 MPD B O2  1 
HETATM 4945 C  CM  . MPD T  4 .   ? -0.016  24.923  21.659 0.90 76.26  ? 408 MPD B CM  1 
HETATM 4946 C  C3  . MPD T  4 .   ? 0.795   24.975  23.876 0.90 79.72  ? 408 MPD B C3  1 
HETATM 4947 C  C4  . MPD T  4 .   ? 2.044   25.827  23.629 0.90 69.48  ? 408 MPD B C4  1 
HETATM 4948 O  O4  . MPD T  4 .   ? 2.299   25.937  22.226 0.90 86.40  ? 408 MPD B O4  1 
HETATM 4949 C  C5  . MPD T  4 .   ? 1.944   27.207  24.280 0.90 79.26  ? 408 MPD B C5  1 
HETATM 4950 C  C1  . MPD U  4 .   ? 10.414  12.599  10.985 0.90 63.81  ? 409 MPD B C1  1 
HETATM 4951 C  C2  . MPD U  4 .   ? 9.084   12.089  10.427 0.90 78.29  ? 409 MPD B C2  1 
HETATM 4952 O  O2  . MPD U  4 .   ? 8.715   10.875  11.086 0.90 87.78  ? 409 MPD B O2  1 
HETATM 4953 C  CM  . MPD U  4 .   ? 8.001   13.145  10.665 0.90 73.97  ? 409 MPD B CM  1 
HETATM 4954 C  C3  . MPD U  4 .   ? 9.199   11.822  8.924  0.90 76.87  ? 409 MPD B C3  1 
HETATM 4955 C  C4  . MPD U  4 .   ? 10.182  10.690  8.614  0.90 84.26  ? 409 MPD B C4  1 
HETATM 4956 O  O4  . MPD U  4 .   ? 11.465  10.992  9.168  0.90 88.57  ? 409 MPD B O4  1 
HETATM 4957 C  C5  . MPD U  4 .   ? 9.676   9.336   9.113  0.90 81.93  ? 409 MPD B C5  1 
HETATM 4958 C  C1  . MPD V  4 .   ? -8.064  24.694  28.220 0.90 85.58  ? 410 MPD B C1  1 
HETATM 4959 C  C2  . MPD V  4 .   ? -6.705  24.058  27.916 0.90 84.20  ? 410 MPD B C2  1 
HETATM 4960 O  O2  . MPD V  4 .   ? -6.834  22.743  27.367 0.90 92.25  ? 410 MPD B O2  1 
HETATM 4961 C  CM  . MPD V  4 .   ? -5.531  24.373  28.842 0.90 88.47  ? 410 MPD B CM  1 
HETATM 4962 C  C3  . MPD V  4 .   ? -6.315  24.829  26.651 0.90 81.75  ? 410 MPD B C3  1 
HETATM 4963 C  C4  . MPD V  4 .   ? -5.002  24.349  26.027 0.90 84.60  ? 410 MPD B C4  1 
HETATM 4964 O  O4  . MPD V  4 .   ? -3.912  24.584  26.922 0.90 87.52  ? 410 MPD B O4  1 
HETATM 4965 C  C5  . MPD V  4 .   ? -5.051  22.878  25.609 0.90 89.21  ? 410 MPD B C5  1 
HETATM 4966 C  C1  . MPD W  4 .   ? -9.569  21.378  23.350 0.90 79.67  ? 411 MPD B C1  1 
HETATM 4967 C  C2  . MPD W  4 .   ? -9.801  22.856  23.673 0.90 78.91  ? 411 MPD B C2  1 
HETATM 4968 O  O2  . MPD W  4 .   ? -8.606  23.595  23.405 0.90 78.63  ? 411 MPD B O2  1 
HETATM 4969 C  CM  . MPD W  4 .   ? -10.938 23.403  22.808 0.90 69.21  ? 411 MPD B CM  1 
HETATM 4970 C  C3  . MPD W  4 .   ? -10.113 23.015  25.163 0.90 85.51  ? 411 MPD B C3  1 
HETATM 4971 C  C4  . MPD W  4 .   ? -11.362 22.223  25.563 0.90 86.37  ? 411 MPD B C4  1 
HETATM 4972 O  O4  . MPD W  4 .   ? -11.382 22.094  26.987 0.90 94.45  ? 411 MPD B O4  1 
HETATM 4973 C  C5  . MPD W  4 .   ? -12.638 22.933  25.104 0.90 98.46  ? 411 MPD B C5  1 
HETATM 4974 S  S   . SO4 X  5 .   ? 32.890  18.991  16.436 0.90 99.64  ? 412 SO4 B S   1 
HETATM 4975 O  O1  . SO4 X  5 .   ? 31.453  18.716  16.250 0.90 94.36  ? 412 SO4 B O1  1 
HETATM 4976 O  O2  . SO4 X  5 .   ? 33.594  18.801  15.153 0.90 96.44  ? 412 SO4 B O2  1 
HETATM 4977 O  O3  . SO4 X  5 .   ? 33.067  20.380  16.899 0.90 93.69  ? 412 SO4 B O3  1 
HETATM 4978 O  O4  . SO4 X  5 .   ? 33.444  18.064  17.442 0.90 97.72  ? 412 SO4 B O4  1 
HETATM 4979 S  S   . SO4 Y  5 .   ? 14.275  4.217   15.403 0.90 100.00 ? 413 SO4 B S   1 
HETATM 4980 O  O1  . SO4 Y  5 .   ? 13.138  3.296   15.604 0.90 96.47  ? 413 SO4 B O1  1 
HETATM 4981 O  O2  . SO4 Y  5 .   ? 14.762  4.099   14.015 0.90 100.00 ? 413 SO4 B O2  1 
HETATM 4982 O  O3  . SO4 Y  5 .   ? 15.364  3.868   16.336 0.90 99.34  ? 413 SO4 B O3  1 
HETATM 4983 O  O4  . SO4 Y  5 .   ? 13.837  5.604   15.654 0.90 93.41  ? 413 SO4 B O4  1 
HETATM 4984 S  S   . SO4 Z  5 .   ? 9.921   3.423   20.804 0.90 100.00 ? 414 SO4 B S   1 
HETATM 4985 O  O1  . SO4 Z  5 .   ? 11.320  2.964   20.697 0.90 93.88  ? 414 SO4 B O1  1 
HETATM 4986 O  O2  . SO4 Z  5 .   ? 9.323   3.464   19.455 0.90 100.00 ? 414 SO4 B O2  1 
HETATM 4987 O  O3  . SO4 Z  5 .   ? 9.153   2.491   21.655 0.90 97.93  ? 414 SO4 B O3  1 
HETATM 4988 O  O4  . SO4 Z  5 .   ? 9.886   4.772   21.400 0.90 92.24  ? 414 SO4 B O4  1 
HETATM 4989 S  S   . SO4 AA 5 .   ? 9.030   41.313  11.339 0.90 100.00 ? 415 SO4 B S   1 
HETATM 4990 O  O1  . SO4 AA 5 .   ? 9.897   42.457  10.998 0.90 93.74  ? 415 SO4 B O1  1 
HETATM 4991 O  O2  . SO4 AA 5 .   ? 8.928   40.421  10.169 0.90 94.70  ? 415 SO4 B O2  1 
HETATM 4992 O  O3  . SO4 AA 5 .   ? 9.610   40.573  12.476 0.90 98.85  ? 415 SO4 B O3  1 
HETATM 4993 O  O4  . SO4 AA 5 .   ? 7.686   41.796  11.712 0.90 95.22  ? 415 SO4 B O4  1 
HETATM 4994 O  O   . HOH BA 6 .   ? 23.565  19.232  34.975 1.00 35.50  ? 501 HOH A O   1 
HETATM 4995 O  O   . HOH BA 6 .   ? 2.757   1.922   32.423 1.00 56.69  ? 502 HOH A O   1 
HETATM 4996 O  O   . HOH BA 6 .   ? 19.885  6.802   44.544 1.00 31.08  ? 503 HOH A O   1 
HETATM 4997 O  O   . HOH BA 6 .   ? 26.983  5.914   31.613 1.00 39.61  ? 504 HOH A O   1 
HETATM 4998 O  O   . HOH BA 6 .   ? 16.265  8.942   34.879 1.00 35.02  ? 505 HOH A O   1 
HETATM 4999 O  O   . HOH BA 6 .   ? 19.429  15.998  34.657 1.00 37.20  ? 506 HOH A O   1 
HETATM 5000 O  O   . HOH BA 6 .   ? 26.031  9.470   49.977 1.00 44.12  ? 507 HOH A O   1 
HETATM 5001 O  O   . HOH BA 6 .   ? 30.965  8.902   48.491 1.00 36.40  ? 508 HOH A O   1 
HETATM 5002 O  O   . HOH BA 6 .   ? 23.855  5.741   45.498 1.00 43.58  ? 509 HOH A O   1 
HETATM 5003 O  O   . HOH BA 6 .   ? 20.506  10.020  62.246 1.00 48.44  ? 510 HOH A O   1 
HETATM 5004 O  O   . HOH BA 6 .   ? 24.742  -5.176  69.351 1.00 41.96  ? 511 HOH A O   1 
HETATM 5005 O  O   . HOH BA 6 .   ? 25.613  -1.021  33.757 1.00 36.57  ? 512 HOH A O   1 
HETATM 5006 O  O   . HOH BA 6 .   ? 8.059   -1.899  31.358 1.00 54.23  ? 513 HOH A O   1 
HETATM 5007 O  O   . HOH BA 6 .   ? 17.599  13.297  36.563 1.00 31.27  ? 514 HOH A O   1 
HETATM 5008 O  O   . HOH BA 6 .   ? 28.147  20.485  33.251 1.00 50.40  ? 515 HOH A O   1 
HETATM 5009 O  O   . HOH BA 6 .   ? 20.182  13.929  36.181 1.00 30.56  ? 516 HOH A O   1 
HETATM 5010 O  O   . HOH BA 6 .   ? 7.481   -7.637  37.198 1.00 30.11  ? 517 HOH A O   1 
HETATM 5011 O  O   . HOH BA 6 .   ? 10.248  18.581  44.896 1.00 45.63  ? 518 HOH A O   1 
HETATM 5012 O  O   . HOH BA 6 .   ? 21.189  11.909  30.087 1.00 36.77  ? 519 HOH A O   1 
HETATM 5013 O  O   . HOH BA 6 .   ? 29.734  20.197  57.239 1.00 52.40  ? 520 HOH A O   1 
HETATM 5014 O  O   . HOH BA 6 .   ? 13.069  -9.306  63.399 1.00 65.54  ? 521 HOH A O   1 
HETATM 5015 O  O   . HOH BA 6 .   ? 5.727   6.796   54.931 1.00 48.17  ? 522 HOH A O   1 
HETATM 5016 O  O   . HOH BA 6 .   ? 27.610  -0.361  32.152 1.00 43.83  ? 523 HOH A O   1 
HETATM 5017 O  O   . HOH BA 6 .   ? 24.726  -10.432 68.941 1.00 51.97  ? 524 HOH A O   1 
HETATM 5018 O  O   . HOH BA 6 .   ? 13.944  5.736   66.894 1.00 72.35  ? 525 HOH A O   1 
HETATM 5019 O  O   . HOH BA 6 .   ? 31.408  -7.767  64.327 1.00 62.94  ? 526 HOH A O   1 
HETATM 5020 O  O   . HOH BA 6 .   ? 32.371  -11.126 66.853 1.00 50.23  ? 527 HOH A O   1 
HETATM 5021 O  O   . HOH BA 6 .   ? 7.930   14.996  55.554 1.00 45.90  ? 528 HOH A O   1 
HETATM 5022 O  O   . HOH BA 6 .   ? 22.461  1.336   47.700 1.00 35.74  ? 529 HOH A O   1 
HETATM 5023 O  O   . HOH BA 6 .   ? 39.393  9.932   29.943 1.00 61.72  ? 530 HOH A O   1 
HETATM 5024 O  O   . HOH BA 6 .   ? 9.490   33.146  45.166 1.00 42.20  ? 531 HOH A O   1 
HETATM 5025 O  O   . HOH BA 6 .   ? 6.930   18.024  59.143 1.00 74.85  ? 532 HOH A O   1 
HETATM 5026 O  O   . HOH BA 6 .   ? 33.758  21.337  46.011 1.00 49.39  ? 533 HOH A O   1 
HETATM 5027 O  O   . HOH BA 6 .   ? 22.098  -0.065  68.579 1.00 63.25  ? 534 HOH A O   1 
HETATM 5028 O  O   . HOH BA 6 .   ? 14.393  4.514   59.322 1.00 60.05  ? 535 HOH A O   1 
HETATM 5029 O  O   . HOH BA 6 .   ? 27.370  -2.122  47.125 1.00 73.51  ? 536 HOH A O   1 
HETATM 5030 O  O   . HOH BA 6 .   ? 30.294  1.160   46.897 1.00 69.75  ? 537 HOH A O   1 
HETATM 5031 O  O   . HOH BA 6 .   ? 24.840  -0.373  47.659 1.00 50.88  ? 538 HOH A O   1 
HETATM 5032 O  O   . HOH BA 6 .   ? 26.108  2.426   45.554 1.00 58.37  ? 539 HOH A O   1 
HETATM 5033 O  O   . HOH BA 6 .   ? 28.728  -15.232 48.716 1.00 59.58  ? 540 HOH A O   1 
HETATM 5034 O  O   . HOH BA 6 .   ? 17.379  -13.791 43.190 1.00 56.65  ? 541 HOH A O   1 
HETATM 5035 O  O   . HOH BA 6 .   ? 4.120   -0.588  56.953 1.00 54.58  ? 542 HOH A O   1 
HETATM 5036 O  O   . HOH BA 6 .   ? 12.874  -8.690  33.470 1.00 40.04  ? 543 HOH A O   1 
HETATM 5037 O  O   . HOH BA 6 .   ? 4.447   1.056   27.720 1.00 54.11  ? 544 HOH A O   1 
HETATM 5038 O  O   . HOH BA 6 .   ? 5.858   2.318   24.859 1.00 60.08  ? 545 HOH A O   1 
HETATM 5039 O  O   . HOH BA 6 .   ? 26.851  10.279  42.421 1.00 42.22  ? 546 HOH A O   1 
HETATM 5040 O  O   . HOH BA 6 .   ? 25.848  1.845   41.967 1.00 49.65  ? 547 HOH A O   1 
HETATM 5041 O  O   . HOH BA 6 .   ? 25.413  7.979   43.220 1.00 39.67  ? 548 HOH A O   1 
HETATM 5042 O  O   . HOH BA 6 .   ? 16.590  11.679  34.564 1.00 33.03  ? 549 HOH A O   1 
HETATM 5043 O  O   . HOH BA 6 .   ? 21.786  6.793   46.432 1.00 41.40  ? 550 HOH A O   1 
HETATM 5044 O  O   . HOH BA 6 .   ? 19.598  7.622   67.461 1.00 63.87  ? 551 HOH A O   1 
HETATM 5045 O  O   . HOH BA 6 .   ? 26.770  -4.237  68.477 1.00 45.13  ? 552 HOH A O   1 
HETATM 5046 O  O   . HOH BA 6 .   ? 23.835  1.435   33.674 1.00 43.08  ? 553 HOH A O   1 
HETATM 5047 O  O   . HOH BA 6 .   ? 32.470  25.660  50.025 1.00 57.96  ? 554 HOH A O   1 
HETATM 5048 O  O   . HOH BA 6 .   ? 32.228  22.819  51.877 1.00 51.24  ? 555 HOH A O   1 
HETATM 5049 O  O   . HOH BA 6 .   ? 30.806  23.301  54.150 1.00 61.26  ? 556 HOH A O   1 
HETATM 5050 O  O   . HOH BA 6 .   ? 4.356   13.211  45.010 1.00 39.84  ? 557 HOH A O   1 
HETATM 5051 O  O   . HOH BA 6 .   ? 2.059   21.349  49.062 1.00 85.64  ? 558 HOH A O   1 
HETATM 5052 O  O   . HOH BA 6 .   ? 34.361  1.041   26.689 1.00 53.00  ? 559 HOH A O   1 
HETATM 5053 O  O   . HOH BA 6 .   ? 32.421  28.363  41.429 1.00 64.86  ? 560 HOH A O   1 
HETATM 5054 O  O   . HOH BA 6 .   ? 27.918  30.452  39.140 1.00 86.24  ? 561 HOH A O   1 
HETATM 5055 O  O   . HOH BA 6 .   ? 12.153  35.140  50.892 1.00 68.97  ? 562 HOH A O   1 
HETATM 5056 O  O   . HOH BA 6 .   ? 9.509   12.497  55.275 1.00 49.89  ? 563 HOH A O   1 
HETATM 5057 O  O   . HOH BA 6 .   ? 15.210  19.033  63.163 1.00 66.53  ? 564 HOH A O   1 
HETATM 5058 O  O   . HOH BA 6 .   ? 27.028  -1.207  44.022 1.00 79.32  ? 565 HOH A O   1 
HETATM 5059 O  O   . HOH BA 6 .   ? 28.713  22.292  36.917 1.00 53.59  ? 566 HOH A O   1 
HETATM 5060 O  O   . HOH BA 6 .   ? 12.950  20.711  54.270 1.00 46.42  ? 567 HOH A O   1 
HETATM 5061 O  O   . HOH BA 6 .   ? 9.681   22.556  49.055 1.00 47.69  ? 568 HOH A O   1 
HETATM 5062 O  O   . HOH BA 6 .   ? 31.439  -5.351  50.234 1.00 52.77  ? 569 HOH A O   1 
HETATM 5063 O  O   . HOH BA 6 .   ? 27.092  -16.441 59.209 1.00 59.71  ? 570 HOH A O   1 
HETATM 5064 O  O   . HOH BA 6 .   ? 23.223  -17.655 65.549 1.00 44.47  ? 571 HOH A O   1 
HETATM 5065 O  O   . HOH BA 6 .   ? 29.740  8.585   64.898 1.00 68.66  ? 572 HOH A O   1 
HETATM 5066 O  O   . HOH BA 6 .   ? 26.903  -18.574 49.068 1.00 49.60  ? 573 HOH A O   1 
HETATM 5067 O  O   . HOH BA 6 .   ? 15.235  -8.485  66.034 1.00 81.90  ? 574 HOH A O   1 
HETATM 5068 O  O   . HOH BA 6 .   ? 15.722  -14.975 50.768 1.00 53.05  ? 575 HOH A O   1 
HETATM 5069 O  O   . HOH BA 6 .   ? 30.890  -7.240  33.237 1.00 59.03  ? 576 HOH A O   1 
HETATM 5070 O  O   . HOH BA 6 .   ? 9.715   -0.102  56.133 1.00 52.26  ? 577 HOH A O   1 
HETATM 5071 O  O   . HOH BA 6 .   ? 8.687   2.731   61.216 1.00 80.70  ? 578 HOH A O   1 
HETATM 5072 O  O   . HOH BA 6 .   ? 7.403   -6.870  58.562 1.00 83.62  ? 579 HOH A O   1 
HETATM 5073 O  O   . HOH BA 6 .   ? 5.496   -10.075 53.399 1.00 67.10  ? 580 HOH A O   1 
HETATM 5074 O  O   . HOH BA 6 .   ? 14.929  -4.360  26.718 1.00 75.41  ? 581 HOH A O   1 
HETATM 5075 O  O   . HOH BA 6 .   ? 26.880  -12.635 25.499 1.00 85.47  ? 582 HOH A O   1 
HETATM 5076 O  O   . HOH BA 6 .   ? 33.720  -17.105 25.664 1.00 73.71  ? 583 HOH A O   1 
HETATM 5077 O  O   . HOH BA 6 .   ? 29.866  -1.941  33.098 1.00 57.23  ? 584 HOH A O   1 
HETATM 5078 O  O   . HOH BA 6 .   ? 19.990  1.336   28.588 1.00 41.76  ? 585 HOH A O   1 
HETATM 5079 O  O   . HOH BA 6 .   ? 3.049   2.059   41.412 1.00 56.55  ? 586 HOH A O   1 
HETATM 5080 O  O   . HOH BA 6 .   ? 4.853   -5.825  43.892 1.00 55.79  ? 587 HOH A O   1 
HETATM 5081 O  O   . HOH BA 6 .   ? 4.352   -10.439 43.231 1.00 49.39  ? 588 HOH A O   1 
HETATM 5082 O  O   . HOH BA 6 .   ? 7.802   19.955  41.648 1.00 50.20  ? 589 HOH A O   1 
HETATM 5083 O  O   . HOH BA 6 .   ? 28.983  -3.981  46.508 1.00 82.68  ? 590 HOH A O   1 
HETATM 5084 O  O   . HOH BA 6 .   ? 34.494  -2.645  68.227 1.00 65.89  ? 591 HOH A O   1 
HETATM 5085 O  O   . HOH BA 6 .   ? 34.111  18.613  56.848 1.00 56.20  ? 592 HOH A O   1 
HETATM 5086 O  O   . HOH BA 6 .   ? 38.048  14.576  48.780 1.00 53.94  ? 593 HOH A O   1 
HETATM 5087 O  O   . HOH BA 6 .   ? 37.628  18.899  48.696 1.00 68.91  ? 594 HOH A O   1 
HETATM 5088 O  O   . HOH BA 6 .   ? 31.902  -0.644  33.963 1.00 60.89  ? 595 HOH A O   1 
HETATM 5089 O  O   . HOH BA 6 .   ? 26.170  9.434   66.599 1.00 52.44  ? 596 HOH A O   1 
HETATM 5090 O  O   . HOH BA 6 .   ? 12.167  -10.651 35.177 1.00 50.53  ? 597 HOH A O   1 
HETATM 5091 O  O   . HOH BA 6 .   ? 31.389  0.104   25.929 1.00 59.70  ? 598 HOH A O   1 
HETATM 5092 O  O   . HOH BA 6 .   ? 9.714   -0.525  42.151 1.00 45.34  ? 599 HOH A O   1 
HETATM 5093 O  O   . HOH BA 6 .   ? 28.155  13.385  44.127 1.00 51.61  ? 600 HOH A O   1 
HETATM 5094 O  O   . HOH BA 6 .   ? 37.984  14.641  57.284 1.00 64.99  ? 601 HOH A O   1 
HETATM 5095 O  O   . HOH BA 6 .   ? 25.955  16.162  61.239 1.00 79.44  ? 602 HOH A O   1 
HETATM 5096 O  O   . HOH BA 6 .   ? 31.025  -8.591  67.082 1.00 61.05  ? 603 HOH A O   1 
HETATM 5097 O  O   . HOH BA 6 .   ? 24.226  -10.502 65.804 1.00 55.70  ? 604 HOH A O   1 
HETATM 5098 O  O   . HOH BA 6 .   ? 20.543  -5.365  63.704 1.00 48.67  ? 605 HOH A O   1 
HETATM 5099 O  O   . HOH BA 6 .   ? 16.299  -15.755 53.568 1.00 62.38  ? 606 HOH A O   1 
HETATM 5100 O  O   . HOH BA 6 .   ? 10.889  6.025   53.951 1.00 49.66  ? 607 HOH A O   1 
HETATM 5101 O  O   . HOH BA 6 .   ? 30.367  28.586  38.780 1.00 59.80  ? 608 HOH A O   1 
HETATM 5102 O  O   . HOH BA 6 .   ? 37.792  5.260   33.201 1.00 74.17  ? 609 HOH A O   1 
HETATM 5103 O  O   . HOH BA 6 .   ? -0.018  16.706  49.861 1.00 68.19  ? 610 HOH A O   1 
HETATM 5104 O  O   . HOH BA 6 .   ? 2.116   11.657  42.441 1.00 48.27  ? 611 HOH A O   1 
HETATM 5105 O  O   . HOH BA 6 .   ? 35.022  20.476  35.917 1.00 50.27  ? 612 HOH A O   1 
HETATM 5106 O  O   . HOH BA 6 .   ? 33.271  19.439  44.029 1.00 60.51  ? 613 HOH A O   1 
HETATM 5107 O  O   . HOH BA 6 .   ? 23.704  23.960  57.967 1.00 64.58  ? 614 HOH A O   1 
HETATM 5108 O  O   . HOH BA 6 .   ? 18.348  9.565   63.571 1.00 59.51  ? 615 HOH A O   1 
HETATM 5109 O  O   . HOH BA 6 .   ? 17.257  8.194   65.448 1.00 73.18  ? 616 HOH A O   1 
HETATM 5110 O  O   . HOH BA 6 .   ? 37.523  2.671   60.005 1.00 54.13  ? 617 HOH A O   1 
HETATM 5111 O  O   . HOH BA 6 .   ? 35.986  -9.475  56.259 1.00 68.08  ? 618 HOH A O   1 
HETATM 5112 O  O   . HOH BA 6 .   ? 25.644  -17.494 61.007 1.00 64.28  ? 619 HOH A O   1 
HETATM 5113 O  O   . HOH BA 6 .   ? 21.990  10.947  65.553 1.00 65.17  ? 620 HOH A O   1 
HETATM 5114 O  O   . HOH BA 6 .   ? 30.537  -7.872  48.388 1.00 86.79  ? 621 HOH A O   1 
HETATM 5115 O  O   . HOH BA 6 .   ? 20.998  -26.074 50.055 1.00 65.47  ? 622 HOH A O   1 
HETATM 5116 O  O   . HOH BA 6 .   ? 30.538  -18.075 46.599 1.00 61.56  ? 623 HOH A O   1 
HETATM 5117 O  O   . HOH BA 6 .   ? 29.237  -17.748 48.841 1.00 69.26  ? 624 HOH A O   1 
HETATM 5118 O  O   . HOH BA 6 .   ? 7.732   2.753   68.669 1.00 70.17  ? 625 HOH A O   1 
HETATM 5119 O  O   . HOH BA 6 .   ? 11.170  -17.735 54.055 1.00 73.79  ? 626 HOH A O   1 
HETATM 5120 O  O   . HOH BA 6 .   ? 5.754   -10.159 49.728 1.00 86.62  ? 627 HOH A O   1 
HETATM 5121 O  O   . HOH BA 6 .   ? 13.073  -12.509 30.870 1.00 64.83  ? 628 HOH A O   1 
HETATM 5122 O  O   . HOH BA 6 .   ? 7.406   -10.102 36.006 1.00 42.91  ? 629 HOH A O   1 
HETATM 5123 O  O   . HOH BA 6 .   ? 6.750   -0.362  28.939 1.00 76.31  ? 630 HOH A O   1 
HETATM 5124 O  O   . HOH BA 6 .   ? 26.823  4.085   43.680 1.00 54.84  ? 631 HOH A O   1 
HETATM 5125 O  O   . HOH BA 6 .   ? 1.868   -4.296  48.392 1.00 72.93  ? 632 HOH A O   1 
HETATM 5126 O  O   . HOH BA 6 .   ? 31.286  3.728   41.566 1.00 65.36  ? 633 HOH A O   1 
HETATM 5127 O  O   . HOH BA 6 .   ? 39.183  12.501  29.906 1.00 73.79  ? 634 HOH A O   1 
HETATM 5128 O  O   . HOH BA 6 .   ? 16.916  7.839   61.855 1.00 57.96  ? 635 HOH A O   1 
HETATM 5129 O  O   . HOH BA 6 .   ? 5.649   21.692  50.853 1.00 70.71  ? 636 HOH A O   1 
HETATM 5130 O  O   . HOH BA 6 .   ? 31.168  23.271  37.421 1.00 64.05  ? 637 HOH A O   1 
HETATM 5131 O  O   . HOH BA 6 .   ? 5.473   12.936  51.913 1.00 71.34  ? 638 HOH A O   1 
HETATM 5132 O  O   . HOH BA 6 .   ? 29.702  24.989  36.317 1.00 63.33  ? 639 HOH A O   1 
HETATM 5133 O  O   . HOH BA 6 .   ? 8.844   0.822   70.390 1.00 63.58  ? 640 HOH A O   1 
HETATM 5134 O  O   . HOH BA 6 .   ? 35.545  -11.952 57.217 1.00 80.17  ? 641 HOH A O   1 
HETATM 5135 O  O   . HOH BA 6 .   ? 16.755  -5.801  23.692 1.00 78.82  ? 642 HOH A O   1 
HETATM 5136 O  O   . HOH BA 6 .   ? 11.811  -12.469 65.637 1.00 79.49  ? 643 HOH A O   1 
HETATM 5137 O  O   . HOH BA 6 .   ? 32.862  4.476   63.881 1.00 66.18  ? 644 HOH A O   1 
HETATM 5138 O  O   . HOH BA 6 .   ? 26.333  1.060   49.317 1.00 43.48  ? 645 HOH A O   1 
HETATM 5139 O  O   . HOH BA 6 .   ? 30.908  -2.262  44.517 1.00 68.90  ? 646 HOH A O   1 
HETATM 5140 O  O   . HOH BA 6 .   ? 33.889  10.862  39.348 1.00 68.70  ? 647 HOH A O   1 
HETATM 5141 O  O   . HOH BA 6 .   ? 10.127  19.641  40.754 1.00 36.43  ? 648 HOH A O   1 
HETATM 5142 O  O   . HOH BA 6 .   ? 17.962  12.610  32.442 1.00 36.85  ? 649 HOH A O   1 
HETATM 5143 O  O   . HOH BA 6 .   ? 36.476  15.437  41.505 1.00 52.20  ? 650 HOH A O   1 
HETATM 5144 O  O   . HOH BA 6 .   ? 28.024  30.041  46.825 1.00 63.06  ? 651 HOH A O   1 
HETATM 5145 O  O   . HOH BA 6 .   ? 27.494  32.807  52.162 1.00 74.77  ? 652 HOH A O   1 
HETATM 5146 O  O   . HOH BA 6 .   ? 21.442  34.906  48.835 1.00 63.04  ? 653 HOH A O   1 
HETATM 5147 O  O   . HOH BA 6 .   ? 30.301  23.030  58.274 1.00 68.85  ? 654 HOH A O   1 
HETATM 5148 O  O   . HOH BA 6 .   ? 17.303  30.226  56.155 1.00 68.94  ? 655 HOH A O   1 
HETATM 5149 O  O   . HOH BA 6 .   ? 30.008  -15.374 64.649 1.00 43.04  ? 656 HOH A O   1 
HETATM 5150 O  O   . HOH BA 6 .   ? 13.128  -13.179 35.889 1.00 64.63  ? 657 HOH A O   1 
HETATM 5151 O  O   . HOH BA 6 .   ? 25.655  11.600  45.675 1.00 54.05  ? 658 HOH A O   1 
HETATM 5152 O  O   . HOH CA 6 .   ? -0.001  10.548  0.011  0.50 15.51  ? 501 HOH B O   1 
HETATM 5153 O  O   . HOH CA 6 .   ? 0.000   28.910  0.000  0.50 32.29  ? 502 HOH B O   1 
HETATM 5154 O  O   . HOH CA 6 .   ? -0.904  35.968  -0.157 1.00 53.68  ? 503 HOH B O   1 
HETATM 5155 O  O   . HOH CA 6 .   ? 13.819  11.773  34.033 1.00 29.67  ? 504 HOH B O   1 
HETATM 5156 O  O   . HOH CA 6 .   ? 11.759  15.043  33.532 1.00 27.24  ? 505 HOH B O   1 
HETATM 5157 O  O   . HOH CA 6 .   ? 16.313  8.138   28.989 1.00 34.85  ? 506 HOH B O   1 
HETATM 5158 O  O   . HOH CA 6 .   ? 8.890   3.744   29.559 1.00 34.01  ? 507 HOH B O   1 
HETATM 5159 O  O   . HOH CA 6 .   ? 13.915  3.391   22.918 1.00 44.78  ? 508 HOH B O   1 
HETATM 5160 O  O   . HOH CA 6 .   ? 17.164  7.095   12.732 1.00 44.87  ? 509 HOH B O   1 
HETATM 5161 O  O   . HOH CA 6 .   ? 15.327  9.235   12.813 1.00 40.61  ? 510 HOH B O   1 
HETATM 5162 O  O   . HOH CA 6 .   ? 16.483  25.403  19.305 1.00 34.50  ? 511 HOH B O   1 
HETATM 5163 O  O   . HOH CA 6 .   ? 24.953  36.383  14.491 1.00 51.71  ? 512 HOH B O   1 
HETATM 5164 O  O   . HOH CA 6 .   ? 1.955   25.282  4.315  1.00 35.03  ? 513 HOH B O   1 
HETATM 5165 O  O   . HOH CA 6 .   ? 9.449   12.356  13.843 1.00 36.58  ? 514 HOH B O   1 
HETATM 5166 O  O   . HOH CA 6 .   ? 3.463   13.423  11.175 1.00 46.85  ? 515 HOH B O   1 
HETATM 5167 O  O   . HOH CA 6 .   ? 4.100   8.912   37.554 1.00 38.55  ? 516 HOH B O   1 
HETATM 5168 O  O   . HOH CA 6 .   ? 21.257  6.771   27.857 1.00 32.16  ? 517 HOH B O   1 
HETATM 5169 O  O   . HOH CA 6 .   ? 14.418  14.563  33.951 1.00 32.03  ? 518 HOH B O   1 
HETATM 5170 O  O   . HOH CA 6 .   ? 17.149  30.212  21.457 1.00 36.00  ? 519 HOH B O   1 
HETATM 5171 O  O   . HOH CA 6 .   ? 24.585  35.149  21.948 1.00 48.33  ? 520 HOH B O   1 
HETATM 5172 O  O   . HOH CA 6 .   ? 8.413   14.396  6.567  1.00 40.62  ? 521 HOH B O   1 
HETATM 5173 O  O   . HOH CA 6 .   ? 15.570  15.543  36.353 1.00 30.78  ? 522 HOH B O   1 
HETATM 5174 O  O   . HOH CA 6 .   ? 17.734  17.485  32.818 1.00 29.00  ? 523 HOH B O   1 
HETATM 5175 O  O   . HOH CA 6 .   ? 24.034  10.101  14.812 1.00 50.13  ? 524 HOH B O   1 
HETATM 5176 O  O   . HOH CA 6 .   ? 10.585  21.138  3.031  1.00 42.79  ? 525 HOH B O   1 
HETATM 5177 O  O   . HOH CA 6 .   ? -9.129  34.450  18.307 1.00 52.77  ? 526 HOH B O   1 
HETATM 5178 O  O   . HOH CA 6 .   ? -9.689  22.486  16.155 1.00 41.93  ? 527 HOH B O   1 
HETATM 5179 O  O   . HOH CA 6 .   ? -6.412  10.886  28.981 1.00 46.61  ? 528 HOH B O   1 
HETATM 5180 O  O   . HOH CA 6 .   ? 1.504   22.109  40.174 1.00 56.49  ? 529 HOH B O   1 
HETATM 5181 O  O   . HOH CA 6 .   ? 25.981  23.221  37.203 1.00 48.42  ? 530 HOH B O   1 
HETATM 5182 O  O   . HOH CA 6 .   ? 5.671   28.154  36.840 1.00 36.24  ? 531 HOH B O   1 
HETATM 5183 O  O   . HOH CA 6 .   ? -6.102  16.395  33.211 1.00 36.35  ? 532 HOH B O   1 
HETATM 5184 O  O   . HOH CA 6 .   ? 15.258  18.433  39.032 1.00 31.71  ? 533 HOH B O   1 
HETATM 5185 O  O   . HOH CA 6 .   ? 10.372  14.783  39.132 1.00 32.23  ? 534 HOH B O   1 
HETATM 5186 O  O   . HOH CA 6 .   ? 13.911  24.640  25.942 1.00 31.37  ? 535 HOH B O   1 
HETATM 5187 O  O   . HOH CA 6 .   ? 11.606  19.749  24.111 1.00 30.57  ? 536 HOH B O   1 
HETATM 5188 O  O   . HOH CA 6 .   ? 11.256  25.767  37.509 1.00 34.66  ? 537 HOH B O   1 
HETATM 5189 O  O   . HOH CA 6 .   ? 7.998   33.774  42.873 1.00 38.57  ? 538 HOH B O   1 
HETATM 5190 O  O   . HOH CA 6 .   ? 29.459  29.374  25.094 1.00 49.35  ? 539 HOH B O   1 
HETATM 5191 O  O   . HOH CA 6 .   ? 36.101  21.948  24.203 1.00 64.86  ? 540 HOH B O   1 
HETATM 5192 O  O   . HOH CA 6 .   ? 23.763  27.782  27.469 1.00 57.86  ? 541 HOH B O   1 
HETATM 5193 O  O   . HOH CA 6 .   ? -7.340  34.767  9.075  1.00 37.45  ? 542 HOH B O   1 
HETATM 5194 O  O   . HOH CA 6 .   ? -9.812  27.720  8.703  1.00 59.21  ? 543 HOH B O   1 
HETATM 5195 O  O   . HOH CA 6 .   ? -5.745  30.107  4.204  1.00 47.05  ? 544 HOH B O   1 
HETATM 5196 O  O   . HOH CA 6 .   ? -7.042  33.835  5.601  1.00 40.53  ? 545 HOH B O   1 
HETATM 5197 O  O   . HOH CA 6 .   ? 13.185  21.974  1.958  1.00 62.33  ? 546 HOH B O   1 
HETATM 5198 O  O   . HOH CA 6 .   ? -7.010  38.320  16.386 1.00 74.89  ? 547 HOH B O   1 
HETATM 5199 O  O   . HOH CA 6 .   ? 1.227   10.607  2.554  1.00 40.61  ? 548 HOH B O   1 
HETATM 5200 O  O   . HOH CA 6 .   ? -1.704  38.979  22.920 1.00 75.28  ? 549 HOH B O   1 
HETATM 5201 O  O   . HOH CA 6 .   ? -7.532  16.359  35.897 1.00 65.95  ? 550 HOH B O   1 
HETATM 5202 O  O   . HOH CA 6 .   ? -12.989 20.389  21.186 1.00 56.24  ? 551 HOH B O   1 
HETATM 5203 O  O   . HOH CA 6 .   ? -12.124 19.994  18.524 1.00 55.70  ? 552 HOH B O   1 
HETATM 5204 O  O   . HOH CA 6 .   ? -12.067 19.232  8.681  1.00 54.00  ? 553 HOH B O   1 
HETATM 5205 O  O   . HOH CA 6 .   ? 12.444  8.663   12.862 1.00 78.30  ? 554 HOH B O   1 
HETATM 5206 O  O   . HOH CA 6 .   ? 6.182   32.821  25.062 1.00 69.67  ? 555 HOH B O   1 
HETATM 5207 O  O   . HOH CA 6 .   ? 34.346  2.762   24.646 1.00 61.46  ? 556 HOH B O   1 
HETATM 5208 O  O   . HOH CA 6 .   ? 26.156  19.530  36.250 1.00 69.04  ? 557 HOH B O   1 
HETATM 5209 O  O   . HOH CA 6 .   ? 25.834  23.690  34.491 1.00 48.33  ? 558 HOH B O   1 
HETATM 5210 O  O   . HOH CA 6 .   ? 16.588  2.367   29.330 1.00 43.25  ? 559 HOH B O   1 
HETATM 5211 O  O   . HOH CA 6 .   ? 4.858   26.365  34.925 1.00 42.40  ? 560 HOH B O   1 
HETATM 5212 O  O   . HOH CA 6 .   ? 12.301  37.209  36.700 1.00 68.55  ? 561 HOH B O   1 
HETATM 5213 O  O   . HOH CA 6 .   ? 4.600   30.560  35.955 1.00 41.22  ? 562 HOH B O   1 
HETATM 5214 O  O   . HOH CA 6 .   ? 32.052  10.583  14.751 1.00 63.24  ? 563 HOH B O   1 
HETATM 5215 O  O   . HOH CA 6 .   ? 20.336  4.461   17.818 1.00 50.90  ? 564 HOH B O   1 
HETATM 5216 O  O   . HOH CA 6 .   ? 20.203  25.579  25.448 1.00 47.31  ? 565 HOH B O   1 
HETATM 5217 O  O   . HOH CA 6 .   ? 23.719  23.995  8.648  1.00 60.83  ? 566 HOH B O   1 
HETATM 5218 O  O   . HOH CA 6 .   ? 23.874  4.910   10.768 1.00 75.71  ? 567 HOH B O   1 
HETATM 5219 O  O   . HOH CA 6 .   ? 18.917  38.189  10.170 1.00 59.88  ? 568 HOH B O   1 
HETATM 5220 O  O   . HOH CA 6 .   ? 13.968  38.732  10.204 1.00 45.80  ? 569 HOH B O   1 
HETATM 5221 O  O   . HOH CA 6 .   ? 11.503  37.475  3.296  1.00 48.00  ? 570 HOH B O   1 
HETATM 5222 O  O   . HOH CA 6 .   ? 14.584  34.634  5.859  1.00 51.91  ? 571 HOH B O   1 
HETATM 5223 O  O   . HOH CA 6 .   ? 6.696   11.999  7.505  1.00 62.84  ? 572 HOH B O   1 
HETATM 5224 O  O   . HOH CA 6 .   ? 4.200   12.822  -8.161 1.00 43.39  ? 573 HOH B O   1 
HETATM 5225 O  O   . HOH CA 6 .   ? -9.990  23.990  13.753 1.00 41.96  ? 574 HOH B O   1 
HETATM 5226 O  O   . HOH CA 6 .   ? -8.182  29.715  32.351 1.00 77.41  ? 575 HOH B O   1 
HETATM 5227 O  O   . HOH CA 6 .   ? 1.969   33.578  39.205 1.00 52.56  ? 576 HOH B O   1 
HETATM 5228 O  O   . HOH CA 6 .   ? -10.001 8.595   28.848 1.00 74.27  ? 577 HOH B O   1 
HETATM 5229 O  O   . HOH CA 6 .   ? -4.629  25.124  2.011  1.00 41.23  ? 578 HOH B O   1 
HETATM 5230 O  O   . HOH CA 6 .   ? 7.213   24.067  20.801 1.00 36.92  ? 579 HOH B O   1 
HETATM 5231 O  O   . HOH CA 6 .   ? 5.021   16.661  38.485 1.00 44.35  ? 580 HOH B O   1 
HETATM 5232 O  O   . HOH CA 6 .   ? 18.224  2.745   16.197 1.00 69.64  ? 581 HOH B O   1 
HETATM 5233 O  O   . HOH CA 6 .   ? 21.298  2.586   19.477 1.00 55.88  ? 582 HOH B O   1 
HETATM 5234 O  O   . HOH CA 6 .   ? 20.398  7.530   23.955 1.00 42.33  ? 583 HOH B O   1 
HETATM 5235 O  O   . HOH CA 6 .   ? 20.781  4.705   26.688 1.00 56.16  ? 584 HOH B O   1 
HETATM 5236 O  O   . HOH CA 6 .   ? 24.377  21.695  33.632 1.00 48.68  ? 585 HOH B O   1 
HETATM 5237 O  O   . HOH CA 6 .   ? 6.514   32.499  35.366 1.00 44.55  ? 586 HOH B O   1 
HETATM 5238 O  O   . HOH CA 6 .   ? 7.147   33.520  33.054 1.00 61.10  ? 587 HOH B O   1 
HETATM 5239 O  O   . HOH CA 6 .   ? 31.755  30.362  24.107 1.00 58.73  ? 588 HOH B O   1 
HETATM 5240 O  O   . HOH CA 6 .   ? 29.284  32.862  26.509 1.00 67.29  ? 589 HOH B O   1 
HETATM 5241 O  O   . HOH CA 6 .   ? 33.228  28.783  25.509 1.00 61.04  ? 590 HOH B O   1 
HETATM 5242 O  O   . HOH CA 6 .   ? 12.419  21.725  22.437 1.00 34.37  ? 591 HOH B O   1 
HETATM 5243 O  O   . HOH CA 6 .   ? 11.654  23.884  23.523 1.00 38.60  ? 592 HOH B O   1 
HETATM 5244 O  O   . HOH CA 6 .   ? 8.082   26.606  26.779 1.00 49.40  ? 593 HOH B O   1 
HETATM 5245 O  O   . HOH CA 6 .   ? 17.884  24.254  23.969 1.00 35.31  ? 594 HOH B O   1 
HETATM 5246 O  O   . HOH CA 6 .   ? 20.580  24.176  22.940 1.00 41.38  ? 595 HOH B O   1 
HETATM 5247 O  O   . HOH CA 6 .   ? 28.378  33.912  22.049 1.00 57.03  ? 596 HOH B O   1 
HETATM 5248 O  O   . HOH CA 6 .   ? 26.055  29.853  27.682 1.00 57.68  ? 597 HOH B O   1 
HETATM 5249 O  O   . HOH CA 6 .   ? 28.444  26.177  13.522 1.00 51.34  ? 598 HOH B O   1 
HETATM 5250 O  O   . HOH CA 6 .   ? 18.273  26.895  3.518  1.00 64.91  ? 599 HOH B O   1 
HETATM 5251 O  O   . HOH CA 6 .   ? 18.245  30.386  5.322  1.00 52.64  ? 600 HOH B O   1 
HETATM 5252 O  O   . HOH CA 6 .   ? 16.637  20.368  6.965  1.00 44.30  ? 601 HOH B O   1 
HETATM 5253 O  O   . HOH CA 6 .   ? 5.435   24.319  0.394  1.00 45.61  ? 602 HOH B O   1 
HETATM 5254 O  O   . HOH CA 6 .   ? 13.183  18.315  6.696  1.00 43.36  ? 603 HOH B O   1 
HETATM 5255 O  O   . HOH CA 6 .   ? 7.000   10.101  5.890  1.00 65.11  ? 604 HOH B O   1 
HETATM 5256 O  O   . HOH CA 6 .   ? 9.177   11.598  3.353  1.00 57.87  ? 605 HOH B O   1 
HETATM 5257 O  O   . HOH CA 6 .   ? -2.086  41.836  12.285 1.00 78.62  ? 606 HOH B O   1 
HETATM 5258 O  O   . HOH CA 6 .   ? -17.894 32.925  13.926 1.00 63.53  ? 607 HOH B O   1 
HETATM 5259 O  O   . HOH CA 6 .   ? 1.771   5.931   -2.044 1.00 74.22  ? 608 HOH B O   1 
HETATM 5260 O  O   . HOH CA 6 .   ? -2.355  20.382  2.083  1.00 43.00  ? 609 HOH B O   1 
HETATM 5261 O  O   . HOH CA 6 .   ? -4.117  19.217  3.737  1.00 48.04  ? 610 HOH B O   1 
HETATM 5262 O  O   . HOH CA 6 .   ? 6.623   24.127  34.570 1.00 34.91  ? 611 HOH B O   1 
HETATM 5263 O  O   . HOH CA 6 .   ? -8.049  16.471  31.417 1.00 54.70  ? 612 HOH B O   1 
HETATM 5264 O  O   . HOH CA 6 .   ? 1.891   12.134  24.946 1.00 42.75  ? 613 HOH B O   1 
HETATM 5265 O  O   . HOH CA 6 .   ? -4.571  8.447   22.326 1.00 58.48  ? 614 HOH B O   1 
HETATM 5266 O  O   . HOH CA 6 .   ? 8.909   31.225  22.173 1.00 62.66  ? 615 HOH B O   1 
HETATM 5267 O  O   . HOH CA 6 .   ? -1.849  38.971  14.274 1.00 60.68  ? 616 HOH B O   1 
HETATM 5268 O  O   . HOH CA 6 .   ? 2.263   5.875   41.100 1.00 69.25  ? 617 HOH B O   1 
HETATM 5269 O  O   . HOH CA 6 .   ? 36.205  22.936  28.514 1.00 64.12  ? 618 HOH B O   1 
HETATM 5270 O  O   . HOH CA 6 .   ? 6.483   30.933  43.429 1.00 52.69  ? 619 HOH B O   1 
HETATM 5271 O  O   . HOH CA 6 .   ? 3.752   34.942  18.611 1.00 47.39  ? 620 HOH B O   1 
HETATM 5272 O  O   . HOH CA 6 .   ? 9.509   37.537  1.095  1.00 72.07  ? 621 HOH B O   1 
HETATM 5273 O  O   . HOH CA 6 .   ? -1.462  30.582  1.587  1.00 53.99  ? 622 HOH B O   1 
HETATM 5274 O  O   . HOH CA 6 .   ? 15.055  19.087  5.359  1.00 47.69  ? 623 HOH B O   1 
HETATM 5275 O  O   . HOH CA 6 .   ? -6.093  37.326  31.041 1.00 81.60  ? 624 HOH B O   1 
HETATM 5276 O  O   . HOH CA 6 .   ? 0.590   25.719  48.078 1.00 86.48  ? 625 HOH B O   1 
HETATM 5277 O  O   . HOH CA 6 .   ? -9.140  9.248   22.201 1.00 51.29  ? 626 HOH B O   1 
HETATM 5278 O  O   . HOH CA 6 .   ? 4.356   31.339  22.632 1.00 76.69  ? 627 HOH B O   1 
HETATM 5279 O  O   . HOH CA 6 .   ? 5.955   26.687  21.047 1.00 85.87  ? 628 HOH B O   1 
HETATM 5280 O  O   . HOH CA 6 .   ? 26.051  35.903  24.500 1.00 81.93  ? 629 HOH B O   1 
HETATM 5281 O  O   . HOH CA 6 .   ? 11.022  31.649  29.285 1.00 82.51  ? 630 HOH B O   1 
HETATM 5282 O  O   . HOH CA 6 .   ? 11.021  37.223  47.590 1.00 78.60  ? 631 HOH B O   1 
HETATM 5283 O  O   . HOH CA 6 .   ? 17.286  17.232  6.759  1.00 71.41  ? 632 HOH B O   1 
HETATM 5284 O  O   . HOH CA 6 .   ? 16.115  20.568  3.277  1.00 60.81  ? 633 HOH B O   1 
HETATM 5285 O  O   . HOH CA 6 .   ? 18.091  22.359  3.837  1.00 51.93  ? 634 HOH B O   1 
HETATM 5286 O  O   . HOH CA 6 .   ? 9.315   16.468  8.749  1.00 46.23  ? 635 HOH B O   1 
HETATM 5287 O  O   . HOH CA 6 .   ? 9.828   43.607  17.532 1.00 91.02  ? 636 HOH B O   1 
HETATM 5288 O  O   . HOH CA 6 .   ? 17.378  40.549  22.614 1.00 42.87  ? 637 HOH B O   1 
HETATM 5289 O  O   . HOH CA 6 .   ? 13.557  42.775  21.705 1.00 53.66  ? 638 HOH B O   1 
HETATM 5290 O  O   . HOH CA 6 .   ? 12.468  41.315  26.125 1.00 80.86  ? 639 HOH B O   1 
HETATM 5291 O  O   . HOH CA 6 .   ? 18.336  34.642  26.953 1.00 55.48  ? 640 HOH B O   1 
HETATM 5292 O  O   . HOH CA 6 .   ? -6.909  37.741  10.058 1.00 66.14  ? 641 HOH B O   1 
HETATM 5293 O  O   . HOH CA 6 .   ? 3.875   29.567  -1.264 1.00 45.46  ? 642 HOH B O   1 
HETATM 5294 O  O   . HOH CA 6 .   ? 11.050  30.748  -0.480 1.00 62.20  ? 643 HOH B O   1 
HETATM 5295 O  O   . HOH CA 6 .   ? -14.108 32.910  22.499 1.00 58.91  ? 644 HOH B O   1 
HETATM 5296 O  O   . HOH CA 6 .   ? 4.814   21.297  -0.693 1.00 49.08  ? 645 HOH B O   1 
HETATM 5297 O  O   . HOH CA 6 .   ? 8.721   13.874  -6.946 1.00 60.94  ? 646 HOH B O   1 
HETATM 5298 O  O   . HOH CA 6 .   ? 1.450   30.037  29.112 1.00 47.37  ? 647 HOH B O   1 
HETATM 5299 O  O   . HOH CA 6 .   ? 5.739   27.989  27.895 1.00 51.88  ? 648 HOH B O   1 
HETATM 5300 O  O   . HOH CA 6 .   ? 8.510   6.959   12.510 1.00 62.20  ? 649 HOH B O   1 
HETATM 5301 O  O   . HOH CA 6 .   ? 7.453   4.207   13.971 1.00 71.81  ? 650 HOH B O   1 
HETATM 5302 O  O   . HOH CA 6 .   ? -0.735  6.961   11.596 1.00 42.06  ? 651 HOH B O   1 
HETATM 5303 O  O   . HOH CA 6 .   ? 1.187   7.350   10.111 1.00 26.42  ? 652 HOH B O   1 
HETATM 5304 O  O   . HOH CA 6 .   ? -4.742  16.655  7.237  1.00 55.64  ? 653 HOH B O   1 
HETATM 5305 O  O   . HOH CA 6 .   ? -6.276  14.662  6.522  1.00 56.84  ? 654 HOH B O   1 
HETATM 5306 O  O   . HOH CA 6 .   ? -0.901  29.884  49.116 1.00 85.82  ? 655 HOH B O   1 
HETATM 5307 O  O   . HOH CA 6 .   ? -0.697  9.410   35.845 1.00 59.06  ? 656 HOH B O   1 
HETATM 5308 O  O   . HOH CA 6 .   ? -2.200  6.669   22.022 1.00 58.52  ? 657 HOH B O   1 
HETATM 5309 O  O   . HOH CA 6 .   ? -6.552  11.657  17.448 1.00 84.73  ? 658 HOH B O   1 
HETATM 5310 O  O   . HOH CA 6 .   ? -11.809 17.610  11.152 1.00 63.62  ? 659 HOH B O   1 
HETATM 5311 O  O   . HOH CA 6 .   ? 16.612  25.021  27.139 1.00 39.69  ? 660 HOH B O   1 
HETATM 5312 O  O   . HOH CA 6 .   ? 3.089   32.661  37.068 1.00 48.55  ? 661 HOH B O   1 
HETATM 5313 O  O   . HOH CA 6 .   ? 4.965   19.706  39.674 1.00 54.49  ? 662 HOH B O   1 
HETATM 5314 O  O   . HOH CA 6 .   ? 17.247  3.046   13.709 1.00 78.40  ? 663 HOH B O   1 
HETATM 5315 O  O   . HOH CA 6 .   ? 27.690  36.420  20.897 1.00 54.10  ? 664 HOH B O   1 
HETATM 5316 O  O   . HOH CA 6 .   ? 27.554  38.588  17.586 1.00 60.10  ? 665 HOH B O   1 
HETATM 5317 O  O   . HOH CA 6 .   ? 21.413  43.377  17.180 1.00 65.24  ? 666 HOH B O   1 
HETATM 5318 O  O   . HOH CA 6 .   ? -9.243  37.461  32.937 1.00 76.64  ? 667 HOH B O   1 
HETATM 5319 O  O   . HOH CA 6 .   ? -2.421  10.824  34.291 1.00 49.92  ? 668 HOH B O   1 
HETATM 5320 O  O   . HOH CA 6 .   ? -0.073  4.785   38.569 1.00 73.79  ? 669 HOH B O   1 
HETATM 5321 O  O   . HOH CA 6 .   ? 15.308  37.109  6.303  1.00 62.35  ? 670 HOH B O   1 
HETATM 5322 O  O   . HOH CA 6 .   ? -14.318 35.565  15.448 1.00 78.36  ? 671 HOH B O   1 
HETATM 5323 O  O   . HOH CA 6 .   ? 2.364   8.269   39.535 1.00 56.23  ? 672 HOH B O   1 
HETATM 5324 O  O   . HOH CA 6 .   ? 16.491  14.886  32.168 1.00 34.14  ? 673 HOH B O   1 
HETATM 5325 O  O   . HOH CA 6 .   ? 1.944   14.721  44.083 1.00 72.58  ? 674 HOH B O   1 
HETATM 5326 O  O   . HOH CA 6 .   ? 17.216  37.186  44.348 1.00 58.19  ? 675 HOH B O   1 
HETATM 5327 O  O   . HOH CA 6 .   ? 24.321  5.707   20.105 1.00 64.56  ? 676 HOH B O   1 
HETATM 5328 O  O   . HOH CA 6 .   ? 29.429  22.307  10.804 1.00 66.03  ? 677 HOH B O   1 
HETATM 5329 O  O   . HOH CA 6 .   ? 14.072  10.055  8.657  1.00 55.08  ? 678 HOH B O   1 
HETATM 5330 O  O   . HOH CA 6 .   ? 13.454  19.045  2.867  1.00 54.71  ? 679 HOH B O   1 
HETATM 5331 O  O   . HOH CA 6 .   ? -7.794  32.818  10.935 1.00 72.09  ? 680 HOH B O   1 
HETATM 5332 O  O   . HOH CA 6 .   ? -6.971  13.867  32.448 1.00 62.74  ? 681 HOH B O   1 
HETATM 5333 O  O   . HOH CA 6 .   ? -3.603  18.940  43.807 1.00 63.08  ? 682 HOH B O   1 
HETATM 5334 O  O   . HOH CA 6 .   ? 10.392  26.778  25.316 1.00 53.76  ? 683 HOH B O   1 
HETATM 5335 O  O   . HOH CA 6 .   ? 10.967  15.181  9.907  1.00 70.49  ? 684 HOH B O   1 
HETATM 5336 O  O   . HOH CA 6 .   ? -7.459  5.219   24.266 1.00 71.15  ? 685 HOH B O   1 
HETATM 5337 O  O   . HOH CA 6 .   ? 25.467  36.889  29.020 1.00 62.68  ? 686 HOH B O   1 
HETATM 5338 O  O   . HOH CA 6 .   ? 15.420  17.087  3.796  1.00 76.50  ? 687 HOH B O   1 
HETATM 5339 O  O   . HOH CA 6 .   ? 8.520   29.624  -0.670 1.00 56.57  ? 688 HOH B O   1 
HETATM 5340 O  O   . HOH CA 6 .   ? 33.545  22.637  15.469 1.00 65.46  ? 689 HOH B O   1 
HETATM 5341 O  O   . HOH CA 6 .   ? 9.165   27.215  23.289 1.00 64.58  ? 690 HOH B O   1 
HETATM 5342 O  O   . HOH CA 6 .   ? 8.686   27.994  19.472 1.00 55.21  ? 691 HOH B O   1 
HETATM 5343 O  O   . HOH CA 6 .   ? 3.528   29.057  21.516 1.00 75.14  ? 692 HOH B O   1 
HETATM 5344 O  O   . HOH CA 6 .   ? 8.085   28.205  28.766 1.00 75.95  ? 693 HOH B O   1 
HETATM 5345 O  O   . HOH CA 6 .   ? 7.808   31.859  -3.991 1.00 45.16  ? 694 HOH B O   1 
HETATM 5346 O  O   . HOH CA 6 .   ? 22.250  2.637   27.136 1.00 71.33  ? 695 HOH B O   1 
HETATM 5347 O  O   . HOH CA 6 .   ? 24.018  34.996  42.536 1.00 63.42  ? 696 HOH B O   1 
HETATM 5348 O  O   . HOH CA 6 .   ? 27.728  29.880  35.254 1.00 61.53  ? 697 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   GLU 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   CYS 5   5   5   CYS CYS A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  PRO 27  27  27  PRO PRO A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  HIS 51  51  51  HIS HIS A . n 
A 1 52  TRP 52  52  52  TRP TRP A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  MET 74  74  74  MET MET A . n 
A 1 75  ASN 75  75  75  ASN ASN A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 GLN 103 103 103 GLN GLN A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 CYS 112 112 112 CYS CYS A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 MET 126 126 126 MET MET A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 PRO 134 134 134 PRO PRO A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 SER 158 158 158 SER SER A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 HIS 176 176 176 HIS HIS A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 MET 178 178 178 MET MET A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 ASN 197 197 197 ASN ASN A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 SER 204 204 204 SER SER A . n 
A 1 205 GLN 205 205 205 GLN GLN A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 ARG 208 208 ?   ?   ?   A . n 
A 1 209 ASN 209 209 ?   ?   ?   A . n 
A 1 210 PRO 210 210 ?   ?   ?   A . n 
A 1 211 ALA 211 211 ?   ?   ?   A . n 
A 1 212 GLY 212 212 ?   ?   ?   A . n 
A 1 213 SER 213 213 ?   ?   ?   A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 MET 216 216 216 MET MET A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 ASP 222 222 222 ASP ASP A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 PHE 237 237 237 PHE PHE A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 MET 240 240 240 MET MET A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 TRP 244 244 244 TRP TRP A . n 
A 1 245 THR 245 245 245 THR THR A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 CYS 256 256 256 CYS CYS A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 THR 259 259 259 THR THR A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 THR 262 262 262 THR THR A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 HIS 265 265 265 HIS HIS A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 GLN 268 268 268 GLN GLN A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 THR 270 270 270 THR THR A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 CYS 273 273 273 CYS CYS A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 GLN 277 277 277 GLN GLN A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 GLU 280 280 280 GLU GLU A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 SER 285 285 285 SER SER A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 MET 287 287 287 MET MET A . n 
A 1 288 GLN 288 288 288 GLN GLN A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 GLU 290 290 290 GLU GLU A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 ARG 292 292 292 ARG ARG A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 VAL 294 294 294 VAL VAL A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 ILE 300 300 300 ILE ILE A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 VAL 307 307 307 VAL VAL A . n 
A 1 308 GLN 308 308 308 GLN GLN A . n 
A 1 309 ALA 309 309 309 ALA ALA A . n 
A 1 310 THR 310 310 310 THR THR A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLU 2   2   ?   ?   ?   B . n 
B 1 3   GLU 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   CYS 5   5   5   CYS CYS B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  HIS 13  13  13  HIS HIS B . n 
B 1 14  VAL 14  14  14  VAL VAL B . n 
B 1 15  ILE 15  15  15  ILE ILE B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  TYR 18  18  18  TYR TYR B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  GLY 20  20  20  GLY GLY B . n 
B 1 21  ASN 21  21  21  ASN ASN B . n 
B 1 22  ARG 22  22  22  ARG ARG B . n 
B 1 23  ALA 23  23  23  ALA ALA B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  THR 25  25  25  THR THR B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  PRO 27  27  27  PRO PRO B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  GLN 29  29  29  GLN GLN B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  PHE 33  33  33  PHE PHE B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  VAL 38  38  38  VAL VAL B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLN 42  42  42  GLN GLN B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ASN 45  45  45  ASN ASN B . n 
B 1 46  HIS 46  46  46  HIS HIS B . n 
B 1 47  THR 47  47  47  THR THR B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  TYR 49  49  49  TYR TYR B . n 
B 1 50  ALA 50  50  50  ALA ALA B . n 
B 1 51  HIS 51  51  51  HIS HIS B . n 
B 1 52  TRP 52  52  52  TRP TRP B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  VAL 56  56  56  VAL VAL B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  GLN 63  63  63  GLN GLN B . n 
B 1 64  GLU 64  64  64  GLU GLU B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  TYR 66  66  66  TYR TYR B . n 
B 1 67  GLU 67  67  67  GLU GLU B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  ARG 70  70  70  ARG ARG B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  MET 74  74  74  MET MET B . n 
B 1 75  ASN 75  75  75  ASN ASN B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  TYR 79  79  79  TYR TYR B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  TYR 84  84  84  TYR TYR B . n 
B 1 85  THR 85  85  85  THR THR B . n 
B 1 86  ARG 86  86  86  ARG ARG B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  PHE 90  90  90  PHE PHE B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  ALA 92  92  92  ALA ALA B . n 
B 1 93  MET 93  93  93  MET MET B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  VAL 95  95  95  VAL VAL B . n 
B 1 96  ASP 96  96  96  ASP ASP B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 GLN 103 103 103 GLN GLN B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 ASN 105 105 105 ASN ASN B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 CYS 112 112 112 CYS CYS B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 LYS 119 119 119 LYS LYS B . n 
B 1 120 TRP 120 120 120 TRP TRP B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 GLY 124 124 124 GLY GLY B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 MET 126 126 126 MET MET B . n 
B 1 127 TYR 127 127 127 TYR TYR B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 PRO 129 129 129 PRO PRO B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 PRO 134 134 134 PRO PRO B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 TYR 136 136 136 TYR TYR B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 LYS 139 139 139 LYS LYS B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 PRO 142 142 142 PRO PRO B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ASP 145 145 145 ASP ASP B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 THR 148 148 148 THR THR B . n 
B 1 149 PRO 149 149 149 PRO PRO B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 GLN 151 151 151 GLN GLN B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 GLU 153 153 153 GLU GLU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 LEU 157 157 157 LEU LEU B . n 
B 1 158 SER 158 158 158 SER SER B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 LYS 161 161 161 LYS LYS B . n 
B 1 162 ILE 162 162 162 ILE ILE B . n 
B 1 163 HIS 163 163 163 HIS HIS B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 GLN 165 165 165 GLN GLN B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 GLU 167 167 167 GLU GLU B . n 
B 1 168 ALA 168 168 168 ALA ALA B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 ARG 170 170 170 ARG ARG B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 MET 172 172 172 MET MET B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 MET 174 174 174 MET MET B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 HIS 176 176 176 HIS HIS B . n 
B 1 177 SER 177 177 177 SER SER B . n 
B 1 178 MET 178 178 178 MET MET B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 THR 182 182 182 THR THR B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 VAL 184 184 184 VAL VAL B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 THR 186 186 186 THR THR B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 SER 188 188 188 SER SER B . n 
B 1 189 ASP 189 189 189 ASP ASP B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 SER 192 192 192 SER SER B . n 
B 1 193 PRO 193 193 193 PRO PRO B . n 
B 1 194 GLN 194 194 194 GLN GLN B . n 
B 1 195 GLY 195 195 195 GLY GLY B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 ASN 197 197 197 ASN ASN B . n 
B 1 198 TYR 198 198 198 TYR TYR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 ILE 200 200 200 ILE ILE B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 LEU 202 202 202 LEU LEU B . n 
B 1 203 GLY 203 203 203 GLY GLY B . n 
B 1 204 SER 204 204 204 SER SER B . n 
B 1 205 GLN 205 205 205 GLN GLN B . n 
B 1 206 ARG 206 206 206 ARG ARG B . n 
B 1 207 ARG 207 207 207 ARG ARG B . n 
B 1 208 ARG 208 208 208 ARG ARG B . n 
B 1 209 ASN 209 209 209 ASN ASN B . n 
B 1 210 PRO 210 210 210 PRO PRO B . n 
B 1 211 ALA 211 211 211 ALA ALA B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 MET 216 216 216 MET MET B . n 
B 1 217 GLU 217 217 217 GLU GLU B . n 
B 1 218 ARG 218 218 218 ARG ARG B . n 
B 1 219 ILE 219 219 219 ILE ILE B . n 
B 1 220 ARG 220 220 220 ARG ARG B . n 
B 1 221 MET 221 221 221 MET MET B . n 
B 1 222 ASP 222 222 222 ASP ASP B . n 
B 1 223 ILE 223 223 223 ILE ILE B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 LYS 225 225 225 LYS LYS B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 ASP 227 227 227 ASP ASP B . n 
B 1 228 ALA 228 228 228 ALA ALA B . n 
B 1 229 VAL 229 229 229 VAL VAL B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 VAL 231 231 231 VAL VAL B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 THR 233 233 233 THR THR B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 ASP 235 235 235 ASP ASP B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 PHE 237 237 237 PHE PHE B . n 
B 1 238 ALA 238 238 238 ALA ALA B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 MET 240 240 240 MET MET B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 ALA 243 243 243 ALA ALA B . n 
B 1 244 TRP 244 244 244 TRP TRP B . n 
B 1 245 THR 245 245 245 THR THR B . n 
B 1 246 HIS 246 246 246 HIS HIS B . n 
B 1 247 LYS 247 247 247 LYS LYS B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 PRO 249 249 249 PRO PRO B . n 
B 1 250 ASN 250 250 250 ASN ASN B . n 
B 1 251 ASN 251 251 251 ASN ASN B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 LYS 253 253 253 LYS LYS B . n 
B 1 254 VAL 254 254 254 VAL VAL B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 CYS 256 256 256 CYS CYS B . n 
B 1 257 GLU 257 257 257 GLU GLU B . n 
B 1 258 LYS 258 258 258 LYS LYS B . n 
B 1 259 THR 259 259 259 THR THR B . n 
B 1 260 VAL 260 260 260 VAL VAL B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 THR 262 262 262 THR THR B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 HIS 264 264 264 HIS HIS B . n 
B 1 265 HIS 265 265 265 HIS HIS B . n 
B 1 266 VAL 266 266 266 VAL VAL B . n 
B 1 267 LEU 267 267 267 LEU LEU B . n 
B 1 268 GLN 268 268 268 GLN GLN B . n 
B 1 269 ARG 269 269 269 ARG ARG B . n 
B 1 270 THR 270 270 270 THR THR B . n 
B 1 271 ILE 271 271 271 ILE ILE B . n 
B 1 272 GLN 272 272 272 GLN GLN B . n 
B 1 273 CYS 273 273 273 CYS CYS B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 LYS 275 275 275 LYS LYS B . n 
B 1 276 ALA 276 276 276 ALA ALA B . n 
B 1 277 GLN 277 277 277 GLN GLN B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 GLU 280 280 ?   ?   ?   B . n 
B 1 281 GLY 281 281 ?   ?   ?   B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ARG 283 283 283 ARG ARG B . n 
B 1 284 PRO 284 284 284 PRO PRO B . n 
B 1 285 SER 285 285 285 SER SER B . n 
B 1 286 PRO 286 286 286 PRO PRO B . n 
B 1 287 MET 287 287 287 MET MET B . n 
B 1 288 GLN 288 288 288 GLN GLN B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 GLU 290 290 290 GLU GLU B . n 
B 1 291 LEU 291 291 291 LEU LEU B . n 
B 1 292 ARG 292 292 292 ARG ARG B . n 
B 1 293 MET 293 293 293 MET MET B . n 
B 1 294 VAL 294 294 294 VAL VAL B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 SER 296 296 296 SER SER B . n 
B 1 297 LYS 297 297 297 LYS LYS B . n 
B 1 298 ARG 298 298 298 ARG ARG B . n 
B 1 299 ASP 299 299 299 ASP ASP B . n 
B 1 300 ILE 300 300 300 ILE ILE B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 ASP 302 302 302 ASP ASP B . n 
B 1 303 PRO 303 303 303 PRO PRO B . n 
B 1 304 GLU 304 304 304 GLU GLU B . n 
B 1 305 ILE 305 305 305 ILE ILE B . n 
B 1 306 VAL 306 306 306 VAL VAL B . n 
B 1 307 VAL 307 307 307 VAL VAL B . n 
B 1 308 GLN 308 308 308 GLN GLN B . n 
B 1 309 ALA 309 309 309 ALA ALA B . n 
B 1 310 THR 310 310 310 THR THR B . n 
B 1 311 VAL 311 311 311 VAL VAL B . n 
B 1 312 LEU 312 312 312 LEU LEU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C  2 NA  1   401 402  NA  NA  A . 
D  3 TEP 1   402 1    TEP THE A . 
E  4 MPD 1   403 1013 MPD MPD A . 
F  4 MPD 1   404 1015 MPD MPD A . 
G  4 MPD 1   405 1037 MPD MPD A . 
H  4 MPD 1   406 1039 MPD MPD A . 
I  4 MPD 1   407 1043 MPD MPD A . 
J  5 SO4 1   408 1054 SO4 SO4 A . 
K  5 SO4 1   409 1058 SO4 SO4 A . 
L  5 SO4 1   410 1060 SO4 SO4 A . 
M  2 NA  1   401 406  NA  NA  B . 
N  3 TEP 1   402 1    TEP THE B . 
O  4 MPD 1   403 1013 MPD MPD B . 
P  4 MPD 1   404 1021 MPD MPD B . 
Q  4 MPD 1   405 1023 MPD MPD B . 
R  4 MPD 1   406 1029 MPD MPD B . 
S  4 MPD 1   407 1033 MPD MPD B . 
T  4 MPD 1   408 1035 MPD MPD B . 
U  4 MPD 1   409 1041 MPD MPD B . 
V  4 MPD 1   410 1045 MPD MPD B . 
W  4 MPD 1   411 1047 MPD MPD B . 
X  5 SO4 1   412 1056 SO4 SO4 B . 
Y  5 SO4 1   413 1062 SO4 SO4 B . 
Z  5 SO4 1   414 1064 SO4 SO4 B . 
AA 5 SO4 1   415 1066 SO4 SO4 B . 
BA 6 HOH 1   501 608  HOH HOH A . 
BA 6 HOH 2   502 617  HOH HOH A . 
BA 6 HOH 3   503 618  HOH HOH A . 
BA 6 HOH 4   504 619  HOH HOH A . 
BA 6 HOH 5   505 620  HOH HOH A . 
BA 6 HOH 6   506 621  HOH HOH A . 
BA 6 HOH 7   507 622  HOH HOH A . 
BA 6 HOH 8   508 623  HOH HOH A . 
BA 6 HOH 9   509 624  HOH HOH A . 
BA 6 HOH 10  510 625  HOH HOH A . 
BA 6 HOH 11  511 626  HOH HOH A . 
BA 6 HOH 12  512 627  HOH HOH A . 
BA 6 HOH 13  513 628  HOH HOH A . 
BA 6 HOH 14  514 629  HOH HOH A . 
BA 6 HOH 15  515 632  HOH HOH A . 
BA 6 HOH 16  516 637  HOH HOH A . 
BA 6 HOH 17  517 638  HOH HOH A . 
BA 6 HOH 18  518 639  HOH HOH A . 
BA 6 HOH 19  519 640  HOH HOH A . 
BA 6 HOH 20  520 648  HOH HOH A . 
BA 6 HOH 21  521 650  HOH HOH A . 
BA 6 HOH 22  522 651  HOH HOH A . 
BA 6 HOH 23  523 652  HOH HOH A . 
BA 6 HOH 24  524 655  HOH HOH A . 
BA 6 HOH 25  525 656  HOH HOH A . 
BA 6 HOH 26  526 657  HOH HOH A . 
BA 6 HOH 27  527 658  HOH HOH A . 
BA 6 HOH 28  528 661  HOH HOH A . 
BA 6 HOH 29  529 662  HOH HOH A . 
BA 6 HOH 30  530 663  HOH HOH A . 
BA 6 HOH 31  531 664  HOH HOH A . 
BA 6 HOH 32  532 665  HOH HOH A . 
BA 6 HOH 33  533 666  HOH HOH A . 
BA 6 HOH 34  534 667  HOH HOH A . 
BA 6 HOH 35  535 668  HOH HOH A . 
BA 6 HOH 36  536 669  HOH HOH A . 
BA 6 HOH 37  537 670  HOH HOH A . 
BA 6 HOH 38  538 671  HOH HOH A . 
BA 6 HOH 39  539 672  HOH HOH A . 
BA 6 HOH 40  540 673  HOH HOH A . 
BA 6 HOH 41  541 674  HOH HOH A . 
BA 6 HOH 42  542 675  HOH HOH A . 
BA 6 HOH 43  543 676  HOH HOH A . 
BA 6 HOH 44  544 680  HOH HOH A . 
BA 6 HOH 45  545 681  HOH HOH A . 
BA 6 HOH 46  546 698  HOH HOH A . 
BA 6 HOH 47  547 699  HOH HOH A . 
BA 6 HOH 48  548 700  HOH HOH A . 
BA 6 HOH 49  549 701  HOH HOH A . 
BA 6 HOH 50  550 703  HOH HOH A . 
BA 6 HOH 51  551 704  HOH HOH A . 
BA 6 HOH 52  552 705  HOH HOH A . 
BA 6 HOH 53  553 706  HOH HOH A . 
BA 6 HOH 54  554 708  HOH HOH A . 
BA 6 HOH 55  555 709  HOH HOH A . 
BA 6 HOH 56  556 710  HOH HOH A . 
BA 6 HOH 57  557 711  HOH HOH A . 
BA 6 HOH 58  558 712  HOH HOH A . 
BA 6 HOH 59  559 714  HOH HOH A . 
BA 6 HOH 60  560 715  HOH HOH A . 
BA 6 HOH 61  561 716  HOH HOH A . 
BA 6 HOH 62  562 717  HOH HOH A . 
BA 6 HOH 63  563 718  HOH HOH A . 
BA 6 HOH 64  564 719  HOH HOH A . 
BA 6 HOH 65  565 720  HOH HOH A . 
BA 6 HOH 66  566 722  HOH HOH A . 
BA 6 HOH 67  567 724  HOH HOH A . 
BA 6 HOH 68  568 725  HOH HOH A . 
BA 6 HOH 69  569 726  HOH HOH A . 
BA 6 HOH 70  570 727  HOH HOH A . 
BA 6 HOH 71  571 728  HOH HOH A . 
BA 6 HOH 72  572 729  HOH HOH A . 
BA 6 HOH 73  573 730  HOH HOH A . 
BA 6 HOH 74  574 731  HOH HOH A . 
BA 6 HOH 75  575 732  HOH HOH A . 
BA 6 HOH 76  576 733  HOH HOH A . 
BA 6 HOH 77  577 734  HOH HOH A . 
BA 6 HOH 78  578 735  HOH HOH A . 
BA 6 HOH 79  579 736  HOH HOH A . 
BA 6 HOH 80  580 737  HOH HOH A . 
BA 6 HOH 81  581 738  HOH HOH A . 
BA 6 HOH 82  582 739  HOH HOH A . 
BA 6 HOH 83  583 740  HOH HOH A . 
BA 6 HOH 84  584 741  HOH HOH A . 
BA 6 HOH 85  585 742  HOH HOH A . 
BA 6 HOH 86  586 744  HOH HOH A . 
BA 6 HOH 87  587 745  HOH HOH A . 
BA 6 HOH 88  588 746  HOH HOH A . 
BA 6 HOH 89  589 747  HOH HOH A . 
BA 6 HOH 90  590 767  HOH HOH A . 
BA 6 HOH 91  591 769  HOH HOH A . 
BA 6 HOH 92  592 770  HOH HOH A . 
BA 6 HOH 93  593 771  HOH HOH A . 
BA 6 HOH 94  594 772  HOH HOH A . 
BA 6 HOH 95  595 773  HOH HOH A . 
BA 6 HOH 96  596 775  HOH HOH A . 
BA 6 HOH 97  597 776  HOH HOH A . 
BA 6 HOH 98  598 777  HOH HOH A . 
BA 6 HOH 99  599 778  HOH HOH A . 
BA 6 HOH 100 600 817  HOH HOH A . 
BA 6 HOH 101 601 819  HOH HOH A . 
BA 6 HOH 102 602 820  HOH HOH A . 
BA 6 HOH 103 603 821  HOH HOH A . 
BA 6 HOH 104 604 822  HOH HOH A . 
BA 6 HOH 105 605 823  HOH HOH A . 
BA 6 HOH 106 606 824  HOH HOH A . 
BA 6 HOH 107 607 825  HOH HOH A . 
BA 6 HOH 108 608 827  HOH HOH A . 
BA 6 HOH 109 609 836  HOH HOH A . 
BA 6 HOH 110 610 840  HOH HOH A . 
BA 6 HOH 111 611 841  HOH HOH A . 
BA 6 HOH 112 612 842  HOH HOH A . 
BA 6 HOH 113 613 843  HOH HOH A . 
BA 6 HOH 114 614 844  HOH HOH A . 
BA 6 HOH 115 615 845  HOH HOH A . 
BA 6 HOH 116 616 846  HOH HOH A . 
BA 6 HOH 117 617 847  HOH HOH A . 
BA 6 HOH 118 618 848  HOH HOH A . 
BA 6 HOH 119 619 849  HOH HOH A . 
BA 6 HOH 120 620 850  HOH HOH A . 
BA 6 HOH 121 621 851  HOH HOH A . 
BA 6 HOH 122 622 852  HOH HOH A . 
BA 6 HOH 123 623 853  HOH HOH A . 
BA 6 HOH 124 624 854  HOH HOH A . 
BA 6 HOH 125 625 855  HOH HOH A . 
BA 6 HOH 126 626 856  HOH HOH A . 
BA 6 HOH 127 627 857  HOH HOH A . 
BA 6 HOH 128 628 858  HOH HOH A . 
BA 6 HOH 129 629 859  HOH HOH A . 
BA 6 HOH 130 630 861  HOH HOH A . 
BA 6 HOH 131 631 892  HOH HOH A . 
BA 6 HOH 132 632 893  HOH HOH A . 
BA 6 HOH 133 633 895  HOH HOH A . 
BA 6 HOH 134 634 896  HOH HOH A . 
BA 6 HOH 135 635 897  HOH HOH A . 
BA 6 HOH 136 636 898  HOH HOH A . 
BA 6 HOH 137 637 904  HOH HOH A . 
BA 6 HOH 138 638 905  HOH HOH A . 
BA 6 HOH 139 639 906  HOH HOH A . 
BA 6 HOH 140 640 907  HOH HOH A . 
BA 6 HOH 141 641 917  HOH HOH A . 
BA 6 HOH 142 642 918  HOH HOH A . 
BA 6 HOH 143 643 919  HOH HOH A . 
BA 6 HOH 144 644 930  HOH HOH A . 
BA 6 HOH 145 645 939  HOH HOH A . 
BA 6 HOH 146 646 940  HOH HOH A . 
BA 6 HOH 147 647 941  HOH HOH A . 
BA 6 HOH 148 648 943  HOH HOH A . 
BA 6 HOH 149 649 944  HOH HOH A . 
BA 6 HOH 150 650 947  HOH HOH A . 
BA 6 HOH 151 651 948  HOH HOH A . 
BA 6 HOH 152 652 949  HOH HOH A . 
BA 6 HOH 153 653 950  HOH HOH A . 
BA 6 HOH 154 654 951  HOH HOH A . 
BA 6 HOH 155 655 952  HOH HOH A . 
BA 6 HOH 156 656 953  HOH HOH A . 
BA 6 HOH 157 657 954  HOH HOH A . 
BA 6 HOH 158 658 958  HOH HOH A . 
CA 6 HOH 1   501 600  HOH HOH B . 
CA 6 HOH 2   502 601  HOH HOH B . 
CA 6 HOH 3   503 602  HOH HOH B . 
CA 6 HOH 4   504 603  HOH HOH B . 
CA 6 HOH 5   505 604  HOH HOH B . 
CA 6 HOH 6   506 605  HOH HOH B . 
CA 6 HOH 7   507 606  HOH HOH B . 
CA 6 HOH 8   508 607  HOH HOH B . 
CA 6 HOH 9   509 609  HOH HOH B . 
CA 6 HOH 10  510 610  HOH HOH B . 
CA 6 HOH 11  511 611  HOH HOH B . 
CA 6 HOH 12  512 612  HOH HOH B . 
CA 6 HOH 13  513 613  HOH HOH B . 
CA 6 HOH 14  514 614  HOH HOH B . 
CA 6 HOH 15  515 615  HOH HOH B . 
CA 6 HOH 16  516 616  HOH HOH B . 
CA 6 HOH 17  517 630  HOH HOH B . 
CA 6 HOH 18  518 631  HOH HOH B . 
CA 6 HOH 19  519 633  HOH HOH B . 
CA 6 HOH 20  520 634  HOH HOH B . 
CA 6 HOH 21  521 635  HOH HOH B . 
CA 6 HOH 22  522 636  HOH HOH B . 
CA 6 HOH 23  523 641  HOH HOH B . 
CA 6 HOH 24  524 642  HOH HOH B . 
CA 6 HOH 25  525 643  HOH HOH B . 
CA 6 HOH 26  526 644  HOH HOH B . 
CA 6 HOH 27  527 645  HOH HOH B . 
CA 6 HOH 28  528 646  HOH HOH B . 
CA 6 HOH 29  529 647  HOH HOH B . 
CA 6 HOH 30  530 649  HOH HOH B . 
CA 6 HOH 31  531 653  HOH HOH B . 
CA 6 HOH 32  532 654  HOH HOH B . 
CA 6 HOH 33  533 659  HOH HOH B . 
CA 6 HOH 34  534 660  HOH HOH B . 
CA 6 HOH 35  535 677  HOH HOH B . 
CA 6 HOH 36  536 678  HOH HOH B . 
CA 6 HOH 37  537 679  HOH HOH B . 
CA 6 HOH 38  538 682  HOH HOH B . 
CA 6 HOH 39  539 683  HOH HOH B . 
CA 6 HOH 40  540 684  HOH HOH B . 
CA 6 HOH 41  541 685  HOH HOH B . 
CA 6 HOH 42  542 686  HOH HOH B . 
CA 6 HOH 43  543 687  HOH HOH B . 
CA 6 HOH 44  544 688  HOH HOH B . 
CA 6 HOH 45  545 689  HOH HOH B . 
CA 6 HOH 46  546 690  HOH HOH B . 
CA 6 HOH 47  547 691  HOH HOH B . 
CA 6 HOH 48  548 692  HOH HOH B . 
CA 6 HOH 49  549 693  HOH HOH B . 
CA 6 HOH 50  550 694  HOH HOH B . 
CA 6 HOH 51  551 695  HOH HOH B . 
CA 6 HOH 52  552 696  HOH HOH B . 
CA 6 HOH 53  553 697  HOH HOH B . 
CA 6 HOH 54  554 702  HOH HOH B . 
CA 6 HOH 55  555 707  HOH HOH B . 
CA 6 HOH 56  556 713  HOH HOH B . 
CA 6 HOH 57  557 721  HOH HOH B . 
CA 6 HOH 58  558 723  HOH HOH B . 
CA 6 HOH 59  559 743  HOH HOH B . 
CA 6 HOH 60  560 748  HOH HOH B . 
CA 6 HOH 61  561 749  HOH HOH B . 
CA 6 HOH 62  562 750  HOH HOH B . 
CA 6 HOH 63  563 751  HOH HOH B . 
CA 6 HOH 64  564 752  HOH HOH B . 
CA 6 HOH 65  565 753  HOH HOH B . 
CA 6 HOH 66  566 754  HOH HOH B . 
CA 6 HOH 67  567 755  HOH HOH B . 
CA 6 HOH 68  568 756  HOH HOH B . 
CA 6 HOH 69  569 757  HOH HOH B . 
CA 6 HOH 70  570 758  HOH HOH B . 
CA 6 HOH 71  571 759  HOH HOH B . 
CA 6 HOH 72  572 760  HOH HOH B . 
CA 6 HOH 73  573 761  HOH HOH B . 
CA 6 HOH 74  574 762  HOH HOH B . 
CA 6 HOH 75  575 763  HOH HOH B . 
CA 6 HOH 76  576 764  HOH HOH B . 
CA 6 HOH 77  577 765  HOH HOH B . 
CA 6 HOH 78  578 766  HOH HOH B . 
CA 6 HOH 79  579 768  HOH HOH B . 
CA 6 HOH 80  580 774  HOH HOH B . 
CA 6 HOH 81  581 779  HOH HOH B . 
CA 6 HOH 82  582 780  HOH HOH B . 
CA 6 HOH 83  583 781  HOH HOH B . 
CA 6 HOH 84  584 782  HOH HOH B . 
CA 6 HOH 85  585 783  HOH HOH B . 
CA 6 HOH 86  586 784  HOH HOH B . 
CA 6 HOH 87  587 785  HOH HOH B . 
CA 6 HOH 88  588 786  HOH HOH B . 
CA 6 HOH 89  589 787  HOH HOH B . 
CA 6 HOH 90  590 788  HOH HOH B . 
CA 6 HOH 91  591 789  HOH HOH B . 
CA 6 HOH 92  592 790  HOH HOH B . 
CA 6 HOH 93  593 791  HOH HOH B . 
CA 6 HOH 94  594 792  HOH HOH B . 
CA 6 HOH 95  595 793  HOH HOH B . 
CA 6 HOH 96  596 794  HOH HOH B . 
CA 6 HOH 97  597 795  HOH HOH B . 
CA 6 HOH 98  598 796  HOH HOH B . 
CA 6 HOH 99  599 797  HOH HOH B . 
CA 6 HOH 100 600 798  HOH HOH B . 
CA 6 HOH 101 601 799  HOH HOH B . 
CA 6 HOH 102 602 800  HOH HOH B . 
CA 6 HOH 103 603 801  HOH HOH B . 
CA 6 HOH 104 604 802  HOH HOH B . 
CA 6 HOH 105 605 803  HOH HOH B . 
CA 6 HOH 106 606 804  HOH HOH B . 
CA 6 HOH 107 607 805  HOH HOH B . 
CA 6 HOH 108 608 806  HOH HOH B . 
CA 6 HOH 109 609 807  HOH HOH B . 
CA 6 HOH 110 610 808  HOH HOH B . 
CA 6 HOH 111 611 809  HOH HOH B . 
CA 6 HOH 112 612 810  HOH HOH B . 
CA 6 HOH 113 613 812  HOH HOH B . 
CA 6 HOH 114 614 813  HOH HOH B . 
CA 6 HOH 115 615 814  HOH HOH B . 
CA 6 HOH 116 616 815  HOH HOH B . 
CA 6 HOH 117 617 816  HOH HOH B . 
CA 6 HOH 118 618 818  HOH HOH B . 
CA 6 HOH 119 619 826  HOH HOH B . 
CA 6 HOH 120 620 828  HOH HOH B . 
CA 6 HOH 121 621 829  HOH HOH B . 
CA 6 HOH 122 622 830  HOH HOH B . 
CA 6 HOH 123 623 831  HOH HOH B . 
CA 6 HOH 124 624 833  HOH HOH B . 
CA 6 HOH 125 625 834  HOH HOH B . 
CA 6 HOH 126 626 835  HOH HOH B . 
CA 6 HOH 127 627 837  HOH HOH B . 
CA 6 HOH 128 628 838  HOH HOH B . 
CA 6 HOH 129 629 839  HOH HOH B . 
CA 6 HOH 130 630 860  HOH HOH B . 
CA 6 HOH 131 631 862  HOH HOH B . 
CA 6 HOH 132 632 863  HOH HOH B . 
CA 6 HOH 133 633 864  HOH HOH B . 
CA 6 HOH 134 634 865  HOH HOH B . 
CA 6 HOH 135 635 866  HOH HOH B . 
CA 6 HOH 136 636 867  HOH HOH B . 
CA 6 HOH 137 637 868  HOH HOH B . 
CA 6 HOH 138 638 869  HOH HOH B . 
CA 6 HOH 139 639 870  HOH HOH B . 
CA 6 HOH 140 640 871  HOH HOH B . 
CA 6 HOH 141 641 872  HOH HOH B . 
CA 6 HOH 142 642 873  HOH HOH B . 
CA 6 HOH 143 643 874  HOH HOH B . 
CA 6 HOH 144 644 875  HOH HOH B . 
CA 6 HOH 145 645 876  HOH HOH B . 
CA 6 HOH 146 646 878  HOH HOH B . 
CA 6 HOH 147 647 879  HOH HOH B . 
CA 6 HOH 148 648 880  HOH HOH B . 
CA 6 HOH 149 649 881  HOH HOH B . 
CA 6 HOH 150 650 882  HOH HOH B . 
CA 6 HOH 151 651 883  HOH HOH B . 
CA 6 HOH 152 652 884  HOH HOH B . 
CA 6 HOH 153 653 885  HOH HOH B . 
CA 6 HOH 154 654 886  HOH HOH B . 
CA 6 HOH 155 655 887  HOH HOH B . 
CA 6 HOH 156 656 888  HOH HOH B . 
CA 6 HOH 157 657 889  HOH HOH B . 
CA 6 HOH 158 658 890  HOH HOH B . 
CA 6 HOH 159 659 891  HOH HOH B . 
CA 6 HOH 160 660 894  HOH HOH B . 
CA 6 HOH 161 661 899  HOH HOH B . 
CA 6 HOH 162 662 900  HOH HOH B . 
CA 6 HOH 163 663 901  HOH HOH B . 
CA 6 HOH 164 664 902  HOH HOH B . 
CA 6 HOH 165 665 903  HOH HOH B . 
CA 6 HOH 166 666 908  HOH HOH B . 
CA 6 HOH 167 667 909  HOH HOH B . 
CA 6 HOH 168 668 910  HOH HOH B . 
CA 6 HOH 169 669 911  HOH HOH B . 
CA 6 HOH 170 670 912  HOH HOH B . 
CA 6 HOH 171 671 913  HOH HOH B . 
CA 6 HOH 172 672 914  HOH HOH B . 
CA 6 HOH 173 673 915  HOH HOH B . 
CA 6 HOH 174 674 916  HOH HOH B . 
CA 6 HOH 175 675 920  HOH HOH B . 
CA 6 HOH 176 676 921  HOH HOH B . 
CA 6 HOH 177 677 922  HOH HOH B . 
CA 6 HOH 178 678 923  HOH HOH B . 
CA 6 HOH 179 679 924  HOH HOH B . 
CA 6 HOH 180 680 925  HOH HOH B . 
CA 6 HOH 181 681 926  HOH HOH B . 
CA 6 HOH 182 682 927  HOH HOH B . 
CA 6 HOH 183 683 928  HOH HOH B . 
CA 6 HOH 184 684 929  HOH HOH B . 
CA 6 HOH 185 685 931  HOH HOH B . 
CA 6 HOH 186 686 932  HOH HOH B . 
CA 6 HOH 187 687 933  HOH HOH B . 
CA 6 HOH 188 688 934  HOH HOH B . 
CA 6 HOH 189 689 935  HOH HOH B . 
CA 6 HOH 190 690 936  HOH HOH B . 
CA 6 HOH 191 691 937  HOH HOH B . 
CA 6 HOH 192 692 938  HOH HOH B . 
CA 6 HOH 193 693 942  HOH HOH B . 
CA 6 HOH 194 694 945  HOH HOH B . 
CA 6 HOH 195 695 946  HOH HOH B . 
CA 6 HOH 196 696 955  HOH HOH B . 
CA 6 HOH 197 697 956  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11440 ? 
1 MORE         -270  ? 
1 'SSA (A^2)'  23350 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B HOH 501 ? CA HOH . 
2 1 B HOH 502 ? CA HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? BA HOH . ? A HOH 645 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 537 ? 1_555 125.4 ? 
2  O ? BA HOH . ? A HOH 645 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 539 ? 1_555 95.8  ? 
3  O ? BA HOH . ? A HOH 537 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 539 ? 1_555 112.5 ? 
4  O ? BA HOH . ? A HOH 645 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 536 ? 1_555 95.3  ? 
5  O ? BA HOH . ? A HOH 537 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 536 ? 1_555 106.0 ? 
6  O ? BA HOH . ? A HOH 539 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 536 ? 1_555 122.1 ? 
7  O ? BA HOH . ? A HOH 645 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 538 ? 1_555 55.1  ? 
8  O ? BA HOH . ? A HOH 537 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 538 ? 1_555 168.7 ? 
9  O ? BA HOH . ? A HOH 539 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 538 ? 1_555 77.9  ? 
10 O ? BA HOH . ? A HOH 536 ? 1_555 NA ? C NA . ? A NA 401 ? 1_555 O ? BA HOH . ? A HOH 538 ? 1_555 63.4  ? 
11 O ? CA HOH . ? B HOH 691 ? 1_555 NA ? M NA . ? B NA 401 ? 1_555 O ? CA HOH . ? B HOH 615 ? 1_555 105.0 ? 
12 O ? CA HOH . ? B HOH 691 ? 1_555 NA ? M NA . ? B NA 401 ? 1_555 O ? CA HOH . ? B HOH 628 ? 1_555 76.6  ? 
13 O ? CA HOH . ? B HOH 615 ? 1_555 NA ? M NA . ? B NA 401 ? 1_555 O ? CA HOH . ? B HOH 628 ? 1_555 174.9 ? 
14 O ? CA HOH . ? B HOH 691 ? 1_555 NA ? M NA . ? B NA 401 ? 1_555 O ? CA HOH . ? B HOH 690 ? 1_555 90.8  ? 
15 O ? CA HOH . ? B HOH 615 ? 1_555 NA ? M NA . ? B NA 401 ? 1_555 O ? CA HOH . ? B HOH 690 ? 1_555 97.5  ? 
16 O ? CA HOH . ? B HOH 628 ? 1_555 NA ? M NA . ? B NA 401 ? 1_555 O ? CA HOH . ? B HOH 690 ? 1_555 87.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-05-02 
2 'Structure model' 1 1 2012-08-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 d*TREK       9.2SSI 'Nov  2 2004'    package 'Jim W. Pflugrath' Jim.Pflugrath@Rigaku.com 'data reduction'  
http://www.rigaku.com/software/dtrek.html ?          ? 
2 CNS          1.0    ?                package 'Axel T. Brunger'  axel.brunger@yale.edu    refinement        
http://cns-online.org/                    Fortran_77 ? 
3 PDB_EXTRACT  3.11   'April 22, 2011' package PDB                deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 
4 CrystalClear .      ?                ?       ?                  ?                        'data collection' ? ?          ? 
5 d*TREK       .      ?                ?       ?                  ?                        'data scaling'    ? ?          ? 
6 CNS          .      ?                ?       ?                  ?                        phasing           ? ?          ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    188 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   ILE 
_pdbx_validate_close_contact.auth_seq_id_2    200 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     503 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     503 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_555 
_pdbx_validate_symm_contact.dist              1.84 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TRP A 52  ? ? -173.18 143.53  
2  1 ASN A 75  ? ? -96.11  49.82   
3  1 LEU A 116 ? ? -132.69 -42.56  
4  1 TRP A 120 ? ? -73.00  -103.46 
5  1 ASP A 121 ? ? -54.93  -70.68  
6  1 VAL A 140 ? ? -70.39  -70.37  
7  1 THR B 47  ? ? -64.10  4.16    
8  1 TRP B 52  ? ? -170.25 145.85  
9  1 ASN B 75  ? ? -102.42 60.46   
10 1 LEU B 116 ? ? -134.41 -33.48  
11 1 TRP B 120 ? ? -156.49 23.28   
12 1 ASP B 121 ? ? -159.00 -82.36  
13 1 SER B 188 ? ? -119.02 -98.97  
14 1 ASP B 189 ? ? 88.50   54.45   
15 1 GLN B 277 ? ? -71.45  20.19   
16 1 ALA B 278 ? ? 165.15  -126.29 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLU 2   ? A GLU 2   
3  1 Y 1 A GLU 3   ? A GLU 3   
4  1 Y 1 A ARG 208 ? A ARG 208 
5  1 Y 1 A ASN 209 ? A ASN 209 
6  1 Y 1 A PRO 210 ? A PRO 210 
7  1 Y 1 A ALA 211 ? A ALA 211 
8  1 Y 1 A GLY 212 ? A GLY 212 
9  1 Y 1 A SER 213 ? A SER 213 
10 1 Y 1 B MET 1   ? B MET 1   
11 1 Y 1 B GLU 2   ? B GLU 2   
12 1 Y 1 B GLU 3   ? B GLU 3   
13 1 Y 1 B GLU 280 ? B GLU 280 
14 1 Y 1 B GLY 281 ? B GLY 281 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'                    NA  
3 THEOPHYLLINE                    TEP 
4 '(4S)-2-METHYL-2,4-PENTANEDIOL' MPD 
5 'SULFATE ION'                   SO4 
6 water                           HOH 
#