data_4ESR
# 
_entry.id   4ESR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ESR         
RCSB  RCSB072023   
WWPDB D_1000072023 
# 
_pdbx_database_status.entry_id                        4ESR 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-04-23 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Van Petegem, X.F.' 1 
'Liu, P.X.'         2 
'Lobo, P.'          3 
'Jiang, X.'         4 
# 
_citation.id                        primary 
_citation.title                     
;Molecular and structural characterization of the SH3 domain of AHI-1 in regulation of cellular resistance of BCR-ABL(+) chronic myeloid leukemia cells to tyrosine kinase inhibitors.
;
_citation.journal_abbrev            Proteomics 
_citation.journal_volume            12 
_citation.page_first                2094 
_citation.page_last                 2106 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1615-9861 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22623184 
_citation.pdbx_database_id_DOI      10.1002/pmic.201100553 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, X.'           1 
primary 'Chen, M.'          2 
primary 'Lobo, P.'          3 
primary 'An, J.'            4 
primary 'Grace Cheng, S.W.' 5 
primary 'Moradian, A.'      6 
primary 'Morin, G.B.'       7 
primary 'Van Petegem, F.'   8 
primary 'Jiang, X.'         9 
# 
_cell.entry_id           4ESR 
_cell.length_a           68.142 
_cell.length_b           68.142 
_cell.length_c           98.489 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ESR 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Jouberin                7954.657 2   ? ? 'Ahi-1 SH3 domain (unp residues 1048-1116)' ? 
2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120  3   ? ? ?                                           ? 
3 water       nat water                   18.015   166 ? ? ?                                           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Abelson helper integration site 1 protein homolog, AHI-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       HQVDTAPTVVALYDYTANRSDELTIHRGDIIRVFFKDNEDWWYGSIGKGQEGYFPANHVASETLYQELP 
_entity_poly.pdbx_seq_one_letter_code_can   HQVDTAPTVVALYDYTANRSDELTIHRGDIIRVFFKDNEDWWYGSIGKGQEGYFPANHVASETLYQELP 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  HIS n 
1 2  GLN n 
1 3  VAL n 
1 4  ASP n 
1 5  THR n 
1 6  ALA n 
1 7  PRO n 
1 8  THR n 
1 9  VAL n 
1 10 VAL n 
1 11 ALA n 
1 12 LEU n 
1 13 TYR n 
1 14 ASP n 
1 15 TYR n 
1 16 THR n 
1 17 ALA n 
1 18 ASN n 
1 19 ARG n 
1 20 SER n 
1 21 ASP n 
1 22 GLU n 
1 23 LEU n 
1 24 THR n 
1 25 ILE n 
1 26 HIS n 
1 27 ARG n 
1 28 GLY n 
1 29 ASP n 
1 30 ILE n 
1 31 ILE n 
1 32 ARG n 
1 33 VAL n 
1 34 PHE n 
1 35 PHE n 
1 36 LYS n 
1 37 ASP n 
1 38 ASN n 
1 39 GLU n 
1 40 ASP n 
1 41 TRP n 
1 42 TRP n 
1 43 TYR n 
1 44 GLY n 
1 45 SER n 
1 46 ILE n 
1 47 GLY n 
1 48 LYS n 
1 49 GLY n 
1 50 GLN n 
1 51 GLU n 
1 52 GLY n 
1 53 TYR n 
1 54 PHE n 
1 55 PRO n 
1 56 ALA n 
1 57 ASN n 
1 58 HIS n 
1 59 VAL n 
1 60 ALA n 
1 61 SER n 
1 62 GLU n 
1 63 THR n 
1 64 LEU n 
1 65 TYR n 
1 66 GLN n 
1 67 GLU n 
1 68 LEU n 
1 69 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 AHI1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AHI1_HUMAN 
_struct_ref.pdbx_db_accession          Q8N157 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   HQVDTAPTVVALYDYTANRSDELTIHRGDIIRVFFKDNEDWWYGSIGKGQEGYFPANHVASETLYQELP 
_struct_ref.pdbx_align_begin           1048 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ESR A 1 ? 69 ? Q8N157 1048 ? 1116 ? 1048 1116 
2 1 4ESR B 1 ? 69 ? Q8N157 1048 ? 1116 ? 1048 1116 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4ESR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.59 
_exptl_crystal.density_percent_sol   65.77 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              3.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;0.2M ammonium sulphate, 10mM sodium bromide, 0.1M sodium acetate and 7% PEG200 MME, pH 3.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-12-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double Crystal Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.pdbx_synchrotron_site       CLSI 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4ESR 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.530 
_reflns.number_obs                   34864 
_reflns.number_all                   35758 
_reflns.percent_possible_obs         97.500 
_reflns.pdbx_Rmerge_I_obs            0.051 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.200 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14.300 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1  1.530 1.560  91.800 0.208 ? ? 13.300 ? ? ? ? ? ? 
1 2  1.560 1.580  96.800 0.187 ? ? 14.900 ? ? ? ? ? ? 
1 3  1.580 1.620  97.000 0.163 ? ? 14.900 ? ? ? ? ? ? 
1 4  1.620 1.650  97.400 0.142 ? ? 14.900 ? ? ? ? ? ? 
1 5  1.650 1.680  97.500 0.124 ? ? 14.900 ? ? ? ? ? ? 
1 6  1.680 1.720  97.400 0.104 ? ? 14.900 ? ? ? ? ? ? 
1 7  1.720 1.770  97.600 0.093 ? ? 14.900 ? ? ? ? ? ? 
1 8  1.770 1.810  97.800 0.085 ? ? 14.900 ? ? ? ? ? ? 
1 9  1.810 1.870  98.000 0.075 ? ? 14.800 ? ? ? ? ? ? 
1 10 1.870 1.930  97.900 0.071 ? ? 14.800 ? ? ? ? ? ? 
1 11 1.930 2.000  98.300 0.067 ? ? 14.700 ? ? ? ? ? ? 
1 12 2.000 2.080  98.500 0.062 ? ? 14.300 ? ? ? ? ? ? 
1 13 2.080 2.170  98.500 0.059 ? ? 14.400 ? ? ? ? ? ? 
1 14 2.170 2.290  98.500 0.053 ? ? 14.500 ? ? ? ? ? ? 
1 15 2.290 2.430  98.900 0.048 ? ? 14.500 ? ? ? ? ? ? 
1 16 2.430 2.620  99.000 0.049 ? ? 14.300 ? ? ? ? ? ? 
1 17 2.620 2.880  99.300 0.049 ? ? 13.900 ? ? ? ? ? ? 
1 18 2.880 3.300  99.000 0.045 ? ? 13.800 ? ? ? ? ? ? 
1 19 3.300 4.150  97.800 0.045 ? ? 13.300 ? ? ? ? ? ? 
1 20 4.150 50.000 93.800 0.045 ? ? 11.900 ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4ESR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     33024 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.000 
_refine.ls_d_res_high                            1.53 
_refine.ls_percent_reflns_obs                    97.42 
_refine.ls_R_factor_obs                          0.12503 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.12432 
_refine.ls_R_factor_R_free                       0.13907 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1733 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.300 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               0.977 
_refine.correlation_coeff_Fo_to_Fc_free          0.972 
_refine.B_iso_mean                               17.679 
_refine.aniso_B[1][1]                            0.84 
_refine.aniso_B[2][2]                            0.84 
_refine.aniso_B[3][3]                            -1.68 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.048 
_refine.pdbx_overall_ESU_R_Free                  0.044 
_refine.overall_SU_ML                            0.018 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.023 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1044 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             166 
_refine_hist.number_atoms_total               1231 
_refine_hist.d_res_high                       1.53 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.028  0.022  ? 1182 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.004  0.020  ? 777  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.096  1.943  ? 1619 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.295  3.000  ? 1890 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.633  5.000  ? 147  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.332 24.603 ? 63   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       11.346 15.000 ? 168  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.940 15.000 ? 5    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.149  0.200  ? 166  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.014  0.021  ? 1363 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 254  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.083  1.500  ? 698  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.040  1.500  ? 278  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.393  2.000  ? 1133 'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.167  3.000  ? 484  'X-RAY DIFFRACTION' ? 
r_scangle_it                 8.793  4.500  ? 482  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           2.662  3.000  ? 1959 'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.531 
_refine_ls_shell.d_res_low                        1.570 
_refine_ls_shell.number_reflns_R_work             2295 
_refine_ls_shell.R_factor_R_work                  0.101 
_refine_ls_shell.percent_reflns_obs               93.07 
_refine_ls_shell.R_factor_R_free                  0.116 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             110 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  4ESR 
_struct.title                     
;Molecular and Structural Characterization of the SH3 Domain of AHI-1 in Regulation of Cellular Resistance of BCR-ABL+ Chronic Myeloid Leukemia Cells to Tyrosine Kinase Inhibitors
;
_struct.pdbx_descriptor           Jouberin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ESR 
_struct_keywords.text            'AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, Dynamin-2, Protein binding, Chronic myeloid leukemia' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 62 ? LEU A 68 ? GLU A 1109 LEU A 1115 1 ? 7 
HELX_P HELX_P2 2 GLU B 62 ? GLU B 67 ? GLU B 1109 GLU B 1114 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 50 ? PRO A 55 ? GLN A 1097 PRO A 1102 
A 2 TRP A 41 ? GLY A 47 ? TRP A 1088 GLY A 1094 
A 3 ILE A 30 ? LYS A 36 ? ILE A 1077 LYS A 1083 
A 4 THR A 8  ? ALA A 11 ? THR A 1055 ALA A 1058 
A 5 VAL A 59 ? SER A 61 ? VAL A 1106 SER A 1108 
B 1 GLN B 50 ? PRO B 55 ? GLN B 1097 PRO B 1102 
B 2 TRP B 41 ? GLY B 47 ? TRP B 1088 GLY B 1094 
B 3 ILE B 30 ? LYS B 36 ? ILE B 1077 LYS B 1083 
B 4 THR B 8  ? ALA B 11 ? THR B 1055 ALA B 1058 
B 5 VAL B 59 ? SER B 61 ? VAL B 1106 SER B 1108 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 50 ? O GLN A 1097 N GLY A 47 ? N GLY A 1094 
A 2 3 O TYR A 43 ? O TYR A 1090 N PHE A 34 ? N PHE A 1081 
A 3 4 O ILE A 31 ? O ILE A 1078 N VAL A 9  ? N VAL A 1056 
A 4 5 N VAL A 10 ? N VAL A 1057 O ALA A 60 ? O ALA A 1107 
B 1 2 O PHE B 54 ? O PHE B 1101 N TRP B 42 ? N TRP B 1089 
B 2 3 O SER B 45 ? O SER B 1092 N ARG B 32 ? N ARG B 1079 
B 3 4 O ILE B 31 ? O ILE B 1078 N VAL B 9  ? N VAL B 1056 
B 4 5 N VAL B 10 ? N VAL B 1057 O ALA B 60 ? O ALA B 1107 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PEG B 1201' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE PEG B 1202' 
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PEG B 1203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 ASN A 57 ? ASN A 1104 . ? 5_545 ? 
2  AC1 11 HIS A 58 ? HIS A 1105 . ? 5_545 ? 
3  AC1 11 HOH F .  ? HOH A 1258 . ? 5_545 ? 
4  AC1 11 HOH F .  ? HOH A 1281 . ? 5_545 ? 
5  AC1 11 HOH F .  ? HOH A 1294 . ? 5_545 ? 
6  AC1 11 TYR B 13 ? TYR B 1060 . ? 1_555 ? 
7  AC1 11 ASN B 57 ? ASN B 1104 . ? 1_555 ? 
8  AC1 11 HIS B 58 ? HIS B 1105 . ? 1_555 ? 
9  AC1 11 PEG D .  ? PEG B 1202 . ? 1_555 ? 
10 AC1 11 PEG E .  ? PEG B 1203 . ? 1_555 ? 
11 AC1 11 HOH G .  ? HOH B 1337 . ? 1_555 ? 
12 AC2 7  HOH F .  ? HOH A 1258 . ? 5_545 ? 
13 AC2 7  HIS B 58 ? HIS B 1105 . ? 1_555 ? 
14 AC2 7  GLU B 67 ? GLU B 1114 . ? 4_554 ? 
15 AC2 7  PEG C .  ? PEG B 1201 . ? 1_555 ? 
16 AC2 7  HOH G .  ? HOH B 1318 . ? 1_555 ? 
17 AC2 7  HOH G .  ? HOH B 1341 . ? 1_555 ? 
18 AC2 7  HOH G .  ? HOH B 1366 . ? 4_554 ? 
19 AC3 9  ASN A 57 ? ASN A 1104 . ? 5_545 ? 
20 AC3 9  HOH F .  ? HOH A 1238 . ? 8_655 ? 
21 AC3 9  HOH F .  ? HOH A 1243 . ? 5_545 ? 
22 AC3 9  HOH F .  ? HOH A 1284 . ? 5_545 ? 
23 AC3 9  LEU B 12 ? LEU B 1059 . ? 1_555 ? 
24 AC3 9  TYR B 13 ? TYR B 1060 . ? 1_555 ? 
25 AC3 9  LEU B 64 ? LEU B 1111 . ? 1_555 ? 
26 AC3 9  PEG C .  ? PEG B 1201 . ? 1_555 ? 
27 AC3 9  HOH G .  ? HOH B 1365 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ESR 
_atom_sites.fract_transf_matrix[1][1]   0.014675 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014675 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010153 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   A THR A 1 5  ? 21.554 25.089 9.072  0.70 34.69  ? 1052 THR A N   1 
ATOM   2    N N   B THR A 1 5  ? 23.442 19.616 16.670 0.30 22.24  ? 1052 THR A N   1 
ATOM   3    C CA  A THR A 1 5  ? 20.962 24.742 7.777  0.70 34.19  ? 1052 THR A CA  1 
ATOM   4    C CA  B THR A 1 5  ? 22.420 19.488 15.554 0.30 20.56  ? 1052 THR A CA  1 
ATOM   5    C C   A THR A 1 5  ? 20.060 23.553 7.893  0.70 31.73  ? 1052 THR A C   1 
ATOM   6    C C   B THR A 1 5  ? 21.449 20.660 15.615 0.30 20.54  ? 1052 THR A C   1 
ATOM   7    O O   A THR A 1 5  ? 19.519 23.180 6.868  0.70 32.95  ? 1052 THR A O   1 
ATOM   8    O O   B THR A 1 5  ? 20.960 20.942 16.686 0.30 22.15  ? 1052 THR A O   1 
ATOM   9    C CB  A THR A 1 5  ? 21.995 24.326 6.649  0.70 37.95  ? 1052 THR A CB  1 
ATOM   10   C CB  B THR A 1 5  ? 21.613 18.166 15.722 0.30 20.90  ? 1052 THR A CB  1 
ATOM   11   N N   A ALA A 1 6  ? 19.991 22.861 9.076  0.70 27.38  ? 1053 ALA A N   1 
ATOM   12   N N   B ALA A 1 6  ? 21.131 21.284 14.467 0.30 17.10  ? 1053 ALA A N   1 
ATOM   13   C CA  A ALA A 1 6  ? 19.113 21.629 9.191  0.70 23.31  ? 1053 ALA A CA  1 
ATOM   14   C CA  B ALA A 1 6  ? 20.106 22.272 14.417 0.30 17.05  ? 1053 ALA A CA  1 
ATOM   15   C C   A ALA A 1 6  ? 18.370 21.628 10.541 0.70 23.54  ? 1053 ALA A C   1 
ATOM   16   C C   B ALA A 1 6  ? 18.711 21.729 14.780 0.30 17.30  ? 1053 ALA A C   1 
ATOM   17   O O   A ALA A 1 6  ? 18.475 20.702 11.369 0.70 25.35  ? 1053 ALA A O   1 
ATOM   18   O O   B ALA A 1 6  ? 18.317 20.464 14.460 0.30 17.94  ? 1053 ALA A O   1 
ATOM   19   C CB  A ALA A 1 6  ? 19.903 20.418 8.975  0.70 23.38  ? 1053 ALA A CB  1 
ATOM   20   C CB  B ALA A 1 6  ? 20.053 22.931 13.056 0.30 18.33  ? 1053 ALA A CB  1 
ATOM   21   N N   A PRO A 1 7  ? 17.714 22.799 10.874 0.70 20.91  ? 1054 PRO A N   1 
ATOM   22   N N   B PRO A 1 7  ? 17.990 22.623 15.495 0.30 18.46  ? 1054 PRO A N   1 
ATOM   23   C CA  A PRO A 1 7  ? 17.053 22.922 12.192 0.70 19.82  ? 1054 PRO A CA  1 
ATOM   24   C CA  B PRO A 1 7  ? 16.667 22.352 15.970 0.30 15.00  ? 1054 PRO A CA  1 
ATOM   25   C C   A PRO A 1 7  ? 15.776 21.951 12.314 0.70 19.02  ? 1054 PRO A C   1 
ATOM   26   C C   B PRO A 1 7  ? 15.618 22.114 14.937 0.30 16.17  ? 1054 PRO A C   1 
ATOM   27   O O   A PRO A 1 7  ? 15.372 21.316 11.396 0.70 17.08  ? 1054 PRO A O   1 
ATOM   28   O O   B PRO A 1 7  ? 15.699 22.666 13.866 0.30 15.65  ? 1054 PRO A O   1 
ATOM   29   C CB  A PRO A 1 7  ? 16.634 24.418 12.229 0.70 21.88  ? 1054 PRO A CB  1 
ATOM   30   C CB  B PRO A 1 7  ? 16.340 23.435 16.825 0.30 20.37  ? 1054 PRO A CB  1 
ATOM   31   C CG  A PRO A 1 7  ? 16.280 24.626 10.642 0.70 21.37  ? 1054 PRO A CG  1 
ATOM   32   C CG  B PRO A 1 7  ? 17.237 24.515 16.609 0.30 21.06  ? 1054 PRO A CG  1 
ATOM   33   C CD  A PRO A 1 7  ? 17.463 23.903 9.970  0.70 22.06  ? 1054 PRO A CD  1 
ATOM   34   C CD  B PRO A 1 7  ? 18.490 23.939 15.948 0.30 19.58  ? 1054 PRO A CD  1 
ATOM   35   N N   A THR A 1 8  ? 15.247 21.879 13.532 0.70 19.39  ? 1055 THR A N   1 
ATOM   36   N N   B THR A 1 8  ? 14.644 21.256 15.262 0.30 15.17  ? 1055 THR A N   1 
ATOM   37   C CA  A THR A 1 8  ? 13.883 21.372 13.752 0.70 18.82  ? 1055 THR A CA  1 
ATOM   38   C CA  B THR A 1 8  ? 13.458 21.180 14.439 0.30 14.61  ? 1055 THR A CA  1 
ATOM   39   C C   A THR A 1 8  ? 12.954 22.550 13.992 0.70 18.72  ? 1055 THR A C   1 
ATOM   40   C C   B THR A 1 8  ? 12.847 22.587 14.131 0.30 15.55  ? 1055 THR A C   1 
ATOM   41   O O   A THR A 1 8  ? 13.143 23.307 14.977 0.70 22.23  ? 1055 THR A O   1 
ATOM   42   O O   B THR A 1 8  ? 13.299 23.623 14.671 0.30 19.48  ? 1055 THR A O   1 
ATOM   43   C CB  A THR A 1 8  ? 13.797 20.450 14.933 0.70 21.01  ? 1055 THR A CB  1 
ATOM   44   C CB  B THR A 1 8  ? 12.472 20.164 15.033 0.30 14.38  ? 1055 THR A CB  1 
ATOM   45   O OG1 A THR A 1 8  ? 14.743 19.373 14.722 0.70 25.17  ? 1055 THR A OG1 1 
ATOM   46   O OG1 B THR A 1 8  ? 12.229 20.474 16.407 0.30 17.44  ? 1055 THR A OG1 1 
ATOM   47   C CG2 A THR A 1 8  ? 12.459 19.756 15.054 0.70 24.12  ? 1055 THR A CG2 1 
ATOM   48   C CG2 B THR A 1 8  ? 13.069 18.725 14.919 0.30 15.94  ? 1055 THR A CG2 1 
ATOM   49   N N   . VAL A 1 9  ? 11.948 22.668 13.161 1.00 15.62  ? 1056 VAL A N   1 
ATOM   50   C CA  . VAL A 1 9  ? 11.051 23.824 13.049 1.00 15.10  ? 1056 VAL A CA  1 
ATOM   51   C C   . VAL A 1 9  ? 9.623  23.360 13.236 1.00 14.27  ? 1056 VAL A C   1 
ATOM   52   O O   . VAL A 1 9  ? 9.338  22.149 13.325 1.00 16.46  ? 1056 VAL A O   1 
ATOM   53   C CB  . VAL A 1 9  ? 11.259 24.594 11.747 1.00 15.10  ? 1056 VAL A CB  1 
ATOM   54   C CG1 . VAL A 1 9  ? 12.716 25.069 11.631 1.00 17.86  ? 1056 VAL A CG1 1 
ATOM   55   C CG2 . VAL A 1 9  ? 10.852 23.741 10.515 1.00 16.28  ? 1056 VAL A CG2 1 
ATOM   56   N N   . VAL A 1 10 ? 8.664  24.305 13.286 1.00 14.06  ? 1057 VAL A N   1 
ATOM   57   C CA  . VAL A 1 10 ? 7.265  23.968 13.443 1.00 14.20  ? 1057 VAL A CA  1 
ATOM   58   C C   . VAL A 1 10 ? 6.459  24.629 12.342 1.00 14.10  ? 1057 VAL A C   1 
ATOM   59   O O   . VAL A 1 10 ? 6.704  25.819 12.033 1.00 15.39  ? 1057 VAL A O   1 
ATOM   60   C CB  . VAL A 1 10 ? 6.713  24.369 14.850 1.00 15.60  ? 1057 VAL A CB  1 
ATOM   61   C CG1 . VAL A 1 10 ? 5.291  23.841 15.053 1.00 18.27  ? 1057 VAL A CG1 1 
ATOM   62   C CG2 . VAL A 1 10 ? 7.672  23.996 15.959 1.00 18.91  ? 1057 VAL A CG2 1 
ATOM   63   N N   . ALA A 1 11 ? 5.514  23.940 11.742 1.00 14.79  ? 1058 ALA A N   1 
ATOM   64   C CA  . ALA A 1 11 ? 4.632  24.571 10.795 1.00 14.83  ? 1058 ALA A CA  1 
ATOM   65   C C   . ALA A 1 11 ? 3.767  25.584 11.491 1.00 15.56  ? 1058 ALA A C   1 
ATOM   66   O O   . ALA A 1 11 ? 3.091  25.269 12.497 1.00 17.08  ? 1058 ALA A O   1 
ATOM   67   C CB  . ALA A 1 11 ? 3.757  23.526 10.090 1.00 16.55  ? 1058 ALA A CB  1 
ATOM   68   N N   . LEU A 1 12 ? 3.697  26.811 10.987 1.00 15.90  ? 1059 LEU A N   1 
ATOM   69   C CA  . LEU A 1 12 ? 2.809  27.843 11.463 1.00 17.33  ? 1059 LEU A CA  1 
ATOM   70   C C   . LEU A 1 12 ? 1.555  27.905 10.583 1.00 17.09  ? 1059 LEU A C   1 
ATOM   71   O O   . LEU A 1 12 ? 0.481  28.310 11.072 1.00 20.33  ? 1059 LEU A O   1 
ATOM   72   C CB  . LEU A 1 12 ? 3.524  29.155 11.441 1.00 22.36  ? 1059 LEU A CB  1 
ATOM   73   C CG  . LEU A 1 12 ? 3.284  30.214 12.268 1.00 26.86  ? 1059 LEU A CG  1 
ATOM   74   C CD1 . LEU A 1 12 ? 2.985  29.828 13.765 1.00 28.45  ? 1059 LEU A CD1 1 
ATOM   75   C CD2 . LEU A 1 12 ? 4.258  31.392 12.164 1.00 22.39  ? 1059 LEU A CD2 1 
ATOM   76   N N   . TYR A 1 13 ? 1.648  27.545 9.308  1.00 15.96  ? 1060 TYR A N   1 
ATOM   77   C CA  . TYR A 1 13 ? 0.587  27.622 8.336  1.00 16.79  ? 1060 TYR A CA  1 
ATOM   78   C C   . TYR A 1 13 ? 0.486  26.326 7.575  1.00 16.31  ? 1060 TYR A C   1 
ATOM   79   O O   . TYR A 1 13 ? 1.464  25.705 7.226  1.00 17.57  ? 1060 TYR A O   1 
ATOM   80   C CB  . TYR A 1 13 ? 0.792  28.839 7.390  1.00 17.10  ? 1060 TYR A CB  1 
ATOM   81   C CG  . TYR A 1 13 ? 0.935  30.128 8.143  1.00 17.62  ? 1060 TYR A CG  1 
ATOM   82   C CD1 . TYR A 1 13 ? -0.127 30.655 8.817  1.00 24.02  ? 1060 TYR A CD1 1 
ATOM   83   C CD2 . TYR A 1 13 ? 2.101  30.757 8.279  1.00 17.73  ? 1060 TYR A CD2 1 
ATOM   84   C CE1 . TYR A 1 13 ? 0.007  31.817 9.594  1.00 24.77  ? 1060 TYR A CE1 1 
ATOM   85   C CE2 . TYR A 1 13 ? 2.237  31.920 8.973  1.00 19.40  ? 1060 TYR A CE2 1 
ATOM   86   C CZ  . TYR A 1 13 ? 1.223  32.470 9.640  1.00 22.38  ? 1060 TYR A CZ  1 
ATOM   87   O OH  . TYR A 1 13 ? 1.389  33.579 10.456 1.00 29.58  ? 1060 TYR A OH  1 
ATOM   88   N N   . ASP A 1 14 ? -0.739 25.959 7.267  1.00 17.05  ? 1061 ASP A N   1 
ATOM   89   C CA  . ASP A 1 14 ? -1.010 24.699 6.560  1.00 17.07  ? 1061 ASP A CA  1 
ATOM   90   C C   . ASP A 1 14 ? -0.535 24.803 5.119  1.00 15.92  ? 1061 ASP A C   1 
ATOM   91   O O   . ASP A 1 14 ? -0.667 25.827 4.450  1.00 17.40  ? 1061 ASP A O   1 
ATOM   92   C CB  . ASP A 1 14 ? -2.514 24.395 6.550  1.00 18.12  ? 1061 ASP A CB  1 
ATOM   93   C CG  . ASP A 1 14 ? -3.123 24.089 7.870  1.00 22.84  ? 1061 ASP A CG  1 
ATOM   94   O OD1 . ASP A 1 14 ? -2.472 24.034 8.891  1.00 23.72  ? 1061 ASP A OD1 1 
ATOM   95   O OD2 . ASP A 1 14 ? -4.423 23.955 7.862  1.00 32.61  ? 1061 ASP A OD2 1 
ATOM   96   N N   . TYR A 1 15 ? -0.033 23.684 4.573  1.00 15.98  ? 1062 TYR A N   1 
ATOM   97   C CA  . TYR A 1 15 ? 0.354  23.574 3.173  1.00 14.77  ? 1062 TYR A CA  1 
ATOM   98   C C   . TYR A 1 15 ? -0.021 22.185 2.693  1.00 14.51  ? 1062 TYR A C   1 
ATOM   99   O O   . TYR A 1 15 ? 0.342  21.202 3.334  1.00 15.97  ? 1062 TYR A O   1 
ATOM   100  C CB  . TYR A 1 15 ? 1.846  23.796 2.949  1.00 15.96  ? 1062 TYR A CB  1 
ATOM   101  C CG  . TYR A 1 15 ? 2.247  23.694 1.522  1.00 14.50  ? 1062 TYR A CG  1 
ATOM   102  C CD1 . TYR A 1 15 ? 2.023  24.692 0.608  1.00 15.15  ? 1062 TYR A CD1 1 
ATOM   103  C CD2 . TYR A 1 15 ? 2.882  22.527 1.060  1.00 15.02  ? 1062 TYR A CD2 1 
ATOM   104  C CE1 . TYR A 1 15 ? 2.377  24.563 -0.723 1.00 15.21  ? 1062 TYR A CE1 1 
ATOM   105  C CE2 . TYR A 1 15 ? 3.242  22.386 -0.261 1.00 14.57  ? 1062 TYR A CE2 1 
ATOM   106  C CZ  . TYR A 1 15 ? 2.968  23.403 -1.174 1.00 15.21  ? 1062 TYR A CZ  1 
ATOM   107  O OH  . TYR A 1 15 ? 3.264  23.314 -2.489 1.00 16.08  ? 1062 TYR A OH  1 
ATOM   108  N N   . THR A 1 16 ? -0.733 22.104 1.569  1.00 14.97  ? 1063 THR A N   1 
ATOM   109  C CA  . THR A 1 16 ? -1.098 20.833 0.951  1.00 14.75  ? 1063 THR A CA  1 
ATOM   110  C C   . THR A 1 16 ? -0.130 20.493 -0.169 1.00 14.54  ? 1063 THR A C   1 
ATOM   111  O O   . THR A 1 16 ? 0.050  21.287 -1.118 1.00 15.41  ? 1063 THR A O   1 
ATOM   112  C CB  . THR A 1 16 ? -2.551 20.836 0.475  1.00 16.62  ? 1063 THR A CB  1 
ATOM   113  O OG1 . THR A 1 16 ? -3.417 21.094 1.599  1.00 20.77  ? 1063 THR A OG1 1 
ATOM   114  C CG2 . THR A 1 16 ? -2.911 19.569 -0.273 1.00 18.47  ? 1063 THR A CG2 1 
ATOM   115  N N   . ALA A 1 17 ? 0.464  19.306 -0.141 1.00 15.27  ? 1064 ALA A N   1 
ATOM   116  C CA  . ALA A 1 17 ? 1.367  18.870 -1.193 1.00 14.66  ? 1064 ALA A CA  1 
ATOM   117  C C   . ALA A 1 17 ? 0.740  19.033 -2.553 1.00 15.74  ? 1064 ALA A C   1 
ATOM   118  O O   . ALA A 1 17 ? -0.413 18.611 -2.756 1.00 17.65  ? 1064 ALA A O   1 
ATOM   119  C CB  . ALA A 1 17 ? 1.813  17.420 -0.984 1.00 16.79  ? 1064 ALA A CB  1 
ATOM   120  N N   . ASN A 1 18 ? 1.496  19.589 -3.479 1.00 14.85  ? 1065 ASN A N   1 
ATOM   121  C CA  . ASN A 1 18 ? 1.104  19.728 -4.868 1.00 15.43  ? 1065 ASN A CA  1 
ATOM   122  C C   . ASN A 1 18 ? 2.138  19.241 -5.852 1.00 15.16  ? 1065 ASN A C   1 
ATOM   123  O O   . ASN A 1 18 ? 2.233  19.710 -6.958 1.00 17.45  ? 1065 ASN A O   1 
ATOM   124  C CB  . ASN A 1 18 ? 0.613  21.104 -5.240 1.00 17.83  ? 1065 ASN A CB  1 
ATOM   125  C CG  . ASN A 1 18 ? -0.293 21.067 -6.501 1.00 20.95  ? 1065 ASN A CG  1 
ATOM   126  O OD1 . ASN A 1 18 ? -1.200 20.178 -6.587 1.00 23.65  ? 1065 ASN A OD1 1 
ATOM   127  N ND2 . ASN A 1 18 ? -0.112 21.999 -7.343 1.00 19.49  ? 1065 ASN A ND2 1 
ATOM   128  N N   . ARG A 1 19 ? 2.941  18.283 -5.409 1.00 16.39  ? 1066 ARG A N   1 
ATOM   129  C CA  . ARG A 1 19 ? 3.849  17.546 -6.239 1.00 14.64  ? 1066 ARG A CA  1 
ATOM   130  C C   . ARG A 1 19 ? 4.208  16.294 -5.434 1.00 14.77  ? 1066 ARG A C   1 
ATOM   131  O O   . ARG A 1 19 ? 4.116  16.279 -4.203 1.00 15.62  ? 1066 ARG A O   1 
ATOM   132  C CB  . ARG A 1 19 ? 5.145  18.308 -6.588 1.00 15.51  ? 1066 ARG A CB  1 
ATOM   133  C CG  . ARG A 1 19 ? 5.216  18.753 -8.023 1.00 20.07  ? 1066 ARG A CG  1 
ATOM   134  C CD  . ARG A 1 19 ? 6.386  19.591 -8.367 1.00 20.77  ? 1066 ARG A CD  1 
ATOM   135  N NE  . ARG A 1 19 ? 6.256  20.915 -7.839 1.00 17.39  ? 1066 ARG A NE  1 
ATOM   136  C CZ  . ARG A 1 19 ? 7.126  21.910 -8.007 1.00 19.15  ? 1066 ARG A CZ  1 
ATOM   137  N NH1 . ARG A 1 19 ? 8.290  21.610 -8.587 1.00 22.78  ? 1066 ARG A NH1 1 
ATOM   138  N NH2 . ARG A 1 19 ? 6.923  23.079 -7.451 1.00 24.32  ? 1066 ARG A NH2 1 
ATOM   139  N N   . SER A 1 20 ? 4.649  15.224 -6.117 1.00 14.75  ? 1067 SER A N   1 
ATOM   140  C CA  . SER A 1 20 ? 4.939  13.972 -5.484 1.00 14.81  ? 1067 SER A CA  1 
ATOM   141  C C   . SER A 1 20 ? 6.113  13.955 -4.551 1.00 14.96  ? 1067 SER A C   1 
ATOM   142  O O   . SER A 1 20 ? 6.281  13.008 -3.796 1.00 17.43  ? 1067 SER A O   1 
ATOM   143  C CB  . SER A 1 20 ? 5.085  12.883 -6.558 1.00 16.00  ? 1067 SER A CB  1 
ATOM   144  O OG  . SER A 1 20 ? 3.845  12.608 -7.184 1.00 19.44  ? 1067 SER A OG  1 
ATOM   145  N N   . ASP A 1 21 ? 6.916  15.005 -4.591 1.00 13.96  ? 1068 ASP A N   1 
ATOM   146  C CA  . ASP A 1 21 ? 8.064  15.182 -3.706 1.00 13.90  ? 1068 ASP A CA  1 
ATOM   147  C C   . ASP A 1 21 ? 7.866  16.289 -2.699 1.00 13.45  ? 1068 ASP A C   1 
ATOM   148  O O   . ASP A 1 21 ? 8.842  16.806 -2.146 1.00 13.81  ? 1068 ASP A O   1 
ATOM   149  C CB  . ASP A 1 21 ? 9.327  15.391 -4.507 1.00 14.26  ? 1068 ASP A CB  1 
ATOM   150  C CG  . ASP A 1 21 ? 9.364  16.580 -5.363 1.00 13.30  ? 1068 ASP A CG  1 
ATOM   151  O OD1 . ASP A 1 21 ? 8.382  17.342 -5.452 1.00 14.62  ? 1068 ASP A OD1 1 
ATOM   152  O OD2 . ASP A 1 21 ? 10.476 16.789 -5.992 1.00 15.42  ? 1068 ASP A OD2 1 
ATOM   153  N N   . GLU A 1 22 ? 6.614  16.634 -2.393 1.00 13.63  ? 1069 GLU A N   1 
ATOM   154  C CA  . GLU A 1 22 ? 6.282  17.594 -1.369 1.00 13.28  ? 1069 GLU A CA  1 
ATOM   155  C C   . GLU A 1 22 ? 5.637  16.970 -0.163 1.00 14.05  ? 1069 GLU A C   1 
ATOM   156  O O   . GLU A 1 22 ? 5.013  15.887 -0.222 1.00 17.14  ? 1069 GLU A O   1 
ATOM   157  C CB  . GLU A 1 22 ? 5.309  18.651 -1.921 1.00 13.44  ? 1069 GLU A CB  1 
ATOM   158  C CG  . GLU A 1 22 ? 5.970  19.499 -2.978 1.00 14.28  ? 1069 GLU A CG  1 
ATOM   159  C CD  . GLU A 1 22 ? 5.131  20.601 -3.578 1.00 13.29  ? 1069 GLU A CD  1 
ATOM   160  O OE1 . GLU A 1 22 ? 4.006  20.832 -3.110 1.00 14.88  ? 1069 GLU A OE1 1 
ATOM   161  O OE2 . GLU A 1 22 ? 5.625  21.298 -4.515 1.00 14.96  ? 1069 GLU A OE2 1 
ATOM   162  N N   . LEU A 1 23 ? 5.738  17.683 0.978  1.00 14.13  ? 1070 LEU A N   1 
ATOM   163  C CA  . LEU A 1 23 ? 5.001  17.387 2.190  1.00 14.90  ? 1070 LEU A CA  1 
ATOM   164  C C   . LEU A 1 23 ? 3.657  18.095 2.257  1.00 15.76  ? 1070 LEU A C   1 
ATOM   165  O O   . LEU A 1 23 ? 3.510  19.205 1.732  1.00 17.75  ? 1070 LEU A O   1 
ATOM   166  C CB  . LEU A 1 23 ? 5.800  17.803 3.436  1.00 17.04  ? 1070 LEU A CB  1 
ATOM   167  C CG  . LEU A 1 23 ? 7.073  17.110 3.705  1.00 18.03  ? 1070 LEU A CG  1 
ATOM   168  C CD1 . LEU A 1 23 ? 7.723  17.779 4.962  1.00 21.87  ? 1070 LEU A CD1 1 
ATOM   169  C CD2 . LEU A 1 23 ? 6.876  15.612 3.852  1.00 21.91  ? 1070 LEU A CD2 1 
ATOM   170  N N   . THR A 1 24 ? 2.703  17.492 2.950  1.00 15.29  ? 1071 THR A N   1 
ATOM   171  C CA  . THR A 1 24 ? 1.540  18.188 3.511  1.00 14.89  ? 1071 THR A CA  1 
ATOM   172  C C   . THR A 1 24 ? 1.843  18.439 4.975  1.00 15.33  ? 1071 THR A C   1 
ATOM   173  O O   . THR A 1 24 ? 2.240  17.502 5.723  1.00 18.13  ? 1071 THR A O   1 
ATOM   174  C CB  . THR A 1 24 ? 0.256  17.391 3.337  1.00 15.69  ? 1071 THR A CB  1 
ATOM   175  O OG1 . THR A 1 24 ? -0.043 17.334 1.917  1.00 18.59  ? 1071 THR A OG1 1 
ATOM   176  C CG2 . THR A 1 24 ? -0.900 17.931 4.124  1.00 18.83  ? 1071 THR A CG2 1 
ATOM   177  N N   . ILE A 1 25 ? 1.697  19.678 5.391  1.00 15.69  ? 1072 ILE A N   1 
ATOM   178  C CA  . ILE A 1 25 ? 1.956  20.094 6.765  1.00 15.97  ? 1072 ILE A CA  1 
ATOM   179  C C   . ILE A 1 25 ? 0.748  20.844 7.302  1.00 17.23  ? 1072 ILE A C   1 
ATOM   180  O O   . ILE A 1 25 ? 0.053  21.534 6.569  1.00 17.66  ? 1072 ILE A O   1 
ATOM   181  C CB  . ILE A 1 25 ? 3.274  20.911 6.896  1.00 16.06  ? 1072 ILE A CB  1 
ATOM   182  C CG1 . ILE A 1 25 ? 3.229  22.192 6.100  1.00 17.10  ? 1072 ILE A CG1 1 
ATOM   183  C CG2 . ILE A 1 25 ? 4.487  20.018 6.508  1.00 18.42  ? 1072 ILE A CG2 1 
ATOM   184  C CD1 . ILE A 1 25 ? 4.475  23.107 6.226  1.00 17.20  ? 1072 ILE A CD1 1 
ATOM   185  N N   . HIS A 1 26 ? 0.523  20.723 8.588  1.00 17.62  ? 1073 HIS A N   1 
ATOM   186  C CA  . HIS A 1 26 ? -0.504 21.448 9.317  1.00 18.67  ? 1073 HIS A CA  1 
ATOM   187  C C   . HIS A 1 26 ? 0.132  22.204 10.483 1.00 18.13  ? 1073 HIS A C   1 
ATOM   188  O O   . HIS A 1 26 ? 1.120  21.744 11.042 1.00 17.84  ? 1073 HIS A O   1 
ATOM   189  C CB  . HIS A 1 26 ? -1.547 20.518 9.845  1.00 22.25  ? 1073 HIS A CB  1 
ATOM   190  C CG  . HIS A 1 26 ? -2.236 19.701 8.793  1.00 29.31  ? 1073 HIS A CG  1 
ATOM   191  N ND1 . HIS A 1 26 ? -3.258 20.198 8.020  1.00 41.24  ? 1073 HIS A ND1 1 
ATOM   192  C CD2 . HIS A 1 26 ? -1.963 18.477 8.306  1.00 35.19  ? 1073 HIS A CD2 1 
ATOM   193  C CE1 . HIS A 1 26 ? -3.648 19.275 7.138  1.00 40.71  ? 1073 HIS A CE1 1 
ATOM   194  N NE2 . HIS A 1 26 ? -2.880 18.205 7.294  1.00 38.48  ? 1073 HIS A NE2 1 
ATOM   195  N N   . ARG A 1 27 ? -0.466 23.342 10.848 1.00 18.93  ? 1074 ARG A N   1 
ATOM   196  C CA  . ARG A 1 27 ? 0.004  24.121 11.946 1.00 17.82  ? 1074 ARG A CA  1 
ATOM   197  C C   . ARG A 1 27 ? 0.247  23.230 13.153 1.00 17.51  ? 1074 ARG A C   1 
ATOM   198  O O   . ARG A 1 27 ? -0.616 22.445 13.554 1.00 20.61  ? 1074 ARG A O   1 
ATOM   199  C CB  . ARG A 1 27 ? -0.993 25.258 12.268 1.00 19.85  ? 1074 ARG A CB  1 
ATOM   200  C CG  . ARG A 1 27 ? -0.531 26.227 13.371 1.00 22.51  ? 1074 ARG A CG  1 
ATOM   201  C CD  . ARG A 1 27 ? -1.471 27.372 13.534 1.00 24.06  ? 1074 ARG A CD  1 
ATOM   202  N NE  . ARG A 1 27 ? -1.057 28.362 14.526 1.00 27.21  ? 1074 ARG A NE  1 
ATOM   203  C CZ  . ARG A 1 27 ? -0.769 29.670 14.295 1.00 25.03  ? 1074 ARG A CZ  1 
ATOM   204  N NH1 . ARG A 1 27 ? -0.469 30.102 13.074 1.00 26.48  ? 1074 ARG A NH1 1 
ATOM   205  N NH2 . ARG A 1 27 ? -0.672 30.533 15.317 1.00 28.47  ? 1074 ARG A NH2 1 
ATOM   206  N N   . GLY A 1 28 ? 1.442  23.363 13.737 1.00 17.73  ? 1075 GLY A N   1 
ATOM   207  C CA  . GLY A 1 28 ? 1.869  22.606 14.890 1.00 17.85  ? 1075 GLY A CA  1 
ATOM   208  C C   . GLY A 1 28 ? 2.716  21.395 14.578 1.00 16.87  ? 1075 GLY A C   1 
ATOM   209  O O   . GLY A 1 28 ? 3.340  20.842 15.476 1.00 18.68  ? 1075 GLY A O   1 
ATOM   210  N N   . ASP A 1 29 ? 2.768  20.990 13.325 1.00 17.72  ? 1076 ASP A N   1 
ATOM   211  C CA  . ASP A 1 29 ? 3.604  19.858 12.951 1.00 16.59  ? 1076 ASP A CA  1 
ATOM   212  C C   . ASP A 1 29 ? 5.072  20.183 13.080 1.00 16.21  ? 1076 ASP A C   1 
ATOM   213  O O   . ASP A 1 29 ? 5.557  21.208 12.606 1.00 17.05  ? 1076 ASP A O   1 
ATOM   214  C CB  . ASP A 1 29 ? 3.385  19.437 11.488 1.00 17.69  ? 1076 ASP A CB  1 
ATOM   215  C CG  . ASP A 1 29 ? 2.056  18.719 11.190 1.00 21.06  ? 1076 ASP A CG  1 
ATOM   216  O OD1 . ASP A 1 29 ? 1.348  18.321 12.174 1.00 24.98  ? 1076 ASP A OD1 1 
ATOM   217  O OD2 . ASP A 1 29 ? 1.771  18.566 9.971  1.00 23.26  ? 1076 ASP A OD2 1 
ATOM   218  N N   . ILE A 1 30 ? 5.821  19.297 13.713 1.00 17.03  ? 1077 ILE A N   1 
ATOM   219  C CA  A ILE A 1 30 ? 7.274  19.391 13.867 0.50 16.45  ? 1077 ILE A CA  1 
ATOM   220  C CA  B ILE A 1 30 ? 7.270  19.410 13.864 0.50 16.05  ? 1077 ILE A CA  1 
ATOM   221  C C   . ILE A 1 30 ? 7.940  18.849 12.616 1.00 15.26  ? 1077 ILE A C   1 
ATOM   222  O O   . ILE A 1 30 ? 7.642  17.732 12.144 1.00 18.20  ? 1077 ILE A O   1 
ATOM   223  C CB  A ILE A 1 30 ? 7.787  18.644 15.092 0.50 17.97  ? 1077 ILE A CB  1 
ATOM   224  C CB  B ILE A 1 30 ? 7.773  18.727 15.134 0.50 17.27  ? 1077 ILE A CB  1 
ATOM   225  C CG1 A ILE A 1 30 ? 6.988  18.976 16.331 0.50 20.60  ? 1077 ILE A CG1 1 
ATOM   226  C CG1 B ILE A 1 30 ? 7.262  19.445 16.407 0.50 19.36  ? 1077 ILE A CG1 1 
ATOM   227  C CG2 A ILE A 1 30 ? 9.252  18.997 15.351 0.50 18.75  ? 1077 ILE A CG2 1 
ATOM   228  C CG2 B ILE A 1 30 ? 9.327  18.526 15.048 0.50 17.24  ? 1077 ILE A CG2 1 
ATOM   229  C CD1 A ILE A 1 30 ? 7.064  20.392 16.633 0.50 25.67  ? 1077 ILE A CD1 1 
ATOM   230  C CD1 B ILE A 1 30 ? 7.351  18.590 17.720 0.50 22.58  ? 1077 ILE A CD1 1 
ATOM   231  N N   . ILE A 1 31 ? 8.843  19.627 12.045 1.00 14.51  ? 1078 ILE A N   1 
ATOM   232  C CA  . ILE A 1 31 ? 9.547  19.314 10.818 1.00 14.01  ? 1078 ILE A CA  1 
ATOM   233  C C   . ILE A 1 31 ? 11.030 19.302 11.070 1.00 14.09  ? 1078 ILE A C   1 
ATOM   234  O O   . ILE A 1 31 ? 11.576 20.297 11.566 1.00 15.16  ? 1078 ILE A O   1 
ATOM   235  C CB  . ILE A 1 31 ? 9.223  20.308 9.678  1.00 14.49  ? 1078 ILE A CB  1 
ATOM   236  C CG1 . ILE A 1 31 ? 7.707  20.381 9.388  1.00 15.96  ? 1078 ILE A CG1 1 
ATOM   237  C CG2 . ILE A 1 31 ? 10.030 19.970 8.422  1.00 17.46  ? 1078 ILE A CG2 1 
ATOM   238  C CD1 . ILE A 1 31 ? 7.315  21.685 8.705  1.00 19.60  ? 1078 ILE A CD1 1 
ATOM   239  N N   . ARG A 1 32 ? 11.700 18.217 10.739 1.00 13.59  ? 1079 ARG A N   1 
ATOM   240  C CA  . ARG A 1 32 ? 13.154 18.148 10.782 1.00 13.22  ? 1079 ARG A CA  1 
ATOM   241  C C   . ARG A 1 32 ? 13.704 18.564 9.427  1.00 13.16  ? 1079 ARG A C   1 
ATOM   242  O O   . ARG A 1 32 ? 13.484 17.859 8.428  1.00 13.91  ? 1079 ARG A O   1 
ATOM   243  C CB  . ARG A 1 32 ? 13.623 16.764 11.186 1.00 13.95  ? 1079 ARG A CB  1 
ATOM   244  C CG  . ARG A 1 32 ? 15.121 16.572 11.130 1.00 14.86  ? 1079 ARG A CG  1 
ATOM   245  C CD  . ARG A 1 32 ? 15.895 17.521 12.050 1.00 15.39  ? 1079 ARG A CD  1 
ATOM   246  N NE  . ARG A 1 32 ? 17.207 17.024 12.401 1.00 15.15  ? 1079 ARG A NE  1 
ATOM   247  C CZ  . ARG A 1 32 ? 18.217 16.879 11.561 1.00 14.67  ? 1079 ARG A CZ  1 
ATOM   248  N NH1 . ARG A 1 32 ? 18.140 17.347 10.338 1.00 16.33  ? 1079 ARG A NH1 1 
ATOM   249  N NH2 . ARG A 1 32 ? 19.300 16.197 11.958 1.00 16.21  ? 1079 ARG A NH2 1 
ATOM   250  N N   . VAL A 1 33 ? 14.316 19.733 9.337  1.00 13.29  ? 1080 VAL A N   1 
ATOM   251  C CA  . VAL A 1 33 ? 14.835 20.217 8.071  1.00 13.17  ? 1080 VAL A CA  1 
ATOM   252  C C   . VAL A 1 33 ? 16.076 19.406 7.675  1.00 13.17  ? 1080 VAL A C   1 
ATOM   253  O O   . VAL A 1 33 ? 16.952 19.207 8.529  1.00 15.18  ? 1080 VAL A O   1 
ATOM   254  C CB  . VAL A 1 33 ? 15.136 21.711 8.124  1.00 13.69  ? 1080 VAL A CB  1 
ATOM   255  C CG1 . VAL A 1 33 ? 15.658 22.231 6.772  1.00 16.56  ? 1080 VAL A CG1 1 
ATOM   256  C CG2 . VAL A 1 33 ? 13.890 22.499 8.552  1.00 17.02  ? 1080 VAL A CG2 1 
ATOM   257  N N   . PHE A 1 34 ? 16.155 18.974 6.418  1.00 13.16  ? 1081 PHE A N   1 
ATOM   258  C CA  . PHE A 1 34 ? 17.338 18.340 5.877  1.00 13.28  ? 1081 PHE A CA  1 
ATOM   259  C C   . PHE A 1 34 ? 18.149 19.306 5.048  1.00 14.45  ? 1081 PHE A C   1 
ATOM   260  O O   . PHE A 1 34 ? 19.386 19.348 5.119  1.00 17.78  ? 1081 PHE A O   1 
ATOM   261  C CB  . PHE A 1 34 ? 17.045 17.143 5.010  1.00 14.36  ? 1081 PHE A CB  1 
ATOM   262  C CG  . PHE A 1 34 ? 16.450 15.931 5.653  1.00 14.83  ? 1081 PHE A CG  1 
ATOM   263  C CD1 . PHE A 1 34 ? 16.184 15.830 6.992  1.00 15.42  ? 1081 PHE A CD1 1 
ATOM   264  C CD2 . PHE A 1 34 ? 16.200 14.802 4.880  1.00 17.79  ? 1081 PHE A CD2 1 
ATOM   265  C CE1 . PHE A 1 34 ? 15.637 14.692 7.561  1.00 17.08  ? 1081 PHE A CE1 1 
ATOM   266  C CE2 . PHE A 1 34 ? 15.694 13.641 5.445  1.00 18.96  ? 1081 PHE A CE2 1 
ATOM   267  C CZ  . PHE A 1 34 ? 15.413 13.589 6.773  1.00 17.51  ? 1081 PHE A CZ  1 
ATOM   268  N N   . PHE A 1 35 ? 17.469 20.112 4.213  1.00 13.50  ? 1082 PHE A N   1 
ATOM   269  C CA  . PHE A 1 35 ? 18.133 21.032 3.290  1.00 14.31  ? 1082 PHE A CA  1 
ATOM   270  C C   . PHE A 1 35 ? 17.348 22.321 3.169  1.00 13.79  ? 1082 PHE A C   1 
ATOM   271  O O   . PHE A 1 35 ? 16.112 22.301 3.130  1.00 15.76  ? 1082 PHE A O   1 
ATOM   272  C CB  . PHE A 1 35 ? 18.210 20.443 1.865  1.00 15.13  ? 1082 PHE A CB  1 
ATOM   273  C CG  . PHE A 1 35 ? 18.775 19.102 1.805  1.00 18.70  ? 1082 PHE A CG  1 
ATOM   274  C CD1 . PHE A 1 35 ? 20.136 18.941 1.882  1.00 22.84  ? 1082 PHE A CD1 1 
ATOM   275  C CD2 . PHE A 1 35 ? 18.009 17.984 1.644  1.00 18.61  ? 1082 PHE A CD2 1 
ATOM   276  C CE1 . PHE A 1 35 ? 20.695 17.718 1.886  1.00 26.22  ? 1082 PHE A CE1 1 
ATOM   277  C CE2 . PHE A 1 35 ? 18.564 16.721 1.605  1.00 24.01  ? 1082 PHE A CE2 1 
ATOM   278  C CZ  . PHE A 1 35 ? 19.914 16.578 1.737  1.00 25.10  ? 1082 PHE A CZ  1 
ATOM   279  N N   . LYS A 1 36 ? 18.041 23.443 3.031  1.00 14.65  ? 1083 LYS A N   1 
ATOM   280  C CA  . LYS A 1 36 ? 17.469 24.687 2.647  1.00 14.98  ? 1083 LYS A CA  1 
ATOM   281  C C   . LYS A 1 36 ? 17.859 24.896 1.198  1.00 15.63  ? 1083 LYS A C   1 
ATOM   282  O O   . LYS A 1 36 ? 19.011 25.232 0.886  1.00 20.67  ? 1083 LYS A O   1 
ATOM   283  C CB  . LYS A 1 36 ? 17.912 25.791 3.583  1.00 16.47  ? 1083 LYS A CB  1 
ATOM   284  C CG  . LYS A 1 36 ? 17.405 25.622 4.989  1.00 16.49  ? 1083 LYS A CG  1 
ATOM   285  C CD  . LYS A 1 36 ? 17.772 26.791 5.874  1.00 19.79  ? 1083 LYS A CD  1 
ATOM   286  C CE  . LYS A 1 36 ? 17.290 26.643 7.283  1.00 22.72  ? 1083 LYS A CE  1 
ATOM   287  N NZ  . LYS A 1 36 ? 17.715 27.835 8.118  1.00 29.12  ? 1083 LYS A NZ  1 
ATOM   288  N N   . ASP A 1 37 ? 16.956 24.582 0.285  1.00 16.07  ? 1084 ASP A N   1 
ATOM   289  C CA  . ASP A 1 37 ? 17.225 24.654 -1.150 1.00 17.05  ? 1084 ASP A CA  1 
ATOM   290  C C   . ASP A 1 37 ? 17.480 26.091 -1.550 1.00 17.77  ? 1084 ASP A C   1 
ATOM   291  O O   . ASP A 1 37 ? 18.564 26.433 -2.179 1.00 20.72  ? 1084 ASP A O   1 
ATOM   292  C CB  . ASP A 1 37 ? 16.073 24.022 -1.941 1.00 18.50  ? 1084 ASP A CB  1 
ATOM   293  C CG  . ASP A 1 37 ? 16.350 23.763 -3.374 1.00 18.67  ? 1084 ASP A CG  1 
ATOM   294  O OD1 . ASP A 1 37 ? 17.502 24.016 -3.860 1.00 26.14  ? 1084 ASP A OD1 1 
ATOM   295  O OD2 . ASP A 1 37 ? 15.514 23.254 -4.068 1.00 19.70  ? 1084 ASP A OD2 1 
ATOM   296  N N   . ASN A 1 38 ? 16.536 26.987 -1.240 1.00 17.82  ? 1085 ASN A N   1 
ATOM   297  C CA  . ASN A 1 38 ? 16.699 28.391 -1.483 1.00 17.13  ? 1085 ASN A CA  1 
ATOM   298  C C   . ASN A 1 38 ? 15.872 29.168 -0.480 1.00 17.83  ? 1085 ASN A C   1 
ATOM   299  O O   . ASN A 1 38 ? 15.441 28.583 0.514  1.00 19.91  ? 1085 ASN A O   1 
ATOM   300  C CB  . ASN A 1 38 ? 16.359 28.683 -2.961 1.00 18.38  ? 1085 ASN A CB  1 
ATOM   301  C CG  . ASN A 1 38 ? 15.016 28.230 -3.375 1.00 17.66  ? 1085 ASN A CG  1 
ATOM   302  O OD1 . ASN A 1 38 ? 14.059 28.360 -2.605 1.00 15.61  ? 1085 ASN A OD1 1 
ATOM   303  N ND2 . ASN A 1 38 ? 14.947 27.633 -4.559 1.00 21.73  ? 1085 ASN A ND2 1 
ATOM   304  N N   A GLU A 1 39 ? 15.614 30.458 -0.705 0.50 19.05  ? 1086 GLU A N   1 
ATOM   305  N N   B GLU A 1 39 ? 15.665 30.450 -0.792 0.50 18.75  ? 1086 GLU A N   1 
ATOM   306  C CA  A GLU A 1 39 ? 14.847 31.206 0.296  0.50 19.69  ? 1086 GLU A CA  1 
ATOM   307  C CA  B GLU A 1 39 ? 14.906 31.376 0.025  0.50 19.44  ? 1086 GLU A CA  1 
ATOM   308  C C   A GLU A 1 39 ? 13.397 30.827 0.356  0.50 18.38  ? 1086 GLU A C   1 
ATOM   309  C C   B GLU A 1 39 ? 13.467 30.875 0.294  0.50 18.05  ? 1086 GLU A C   1 
ATOM   310  O O   A GLU A 1 39 ? 12.697 31.152 1.315  0.50 21.59  ? 1086 GLU A O   1 
ATOM   311  O O   B GLU A 1 39 ? 12.866 31.124 1.344  0.50 22.14  ? 1086 GLU A O   1 
ATOM   312  C CB  A GLU A 1 39 ? 14.908 32.751 0.079  0.50 21.77  ? 1086 GLU A CB  1 
ATOM   313  C CB  B GLU A 1 39 ? 14.906 32.811 -0.671 0.50 19.56  ? 1086 GLU A CB  1 
ATOM   314  C CG  A GLU A 1 39 ? 16.219 33.213 -0.348 0.50 28.43  ? 1086 GLU A CG  1 
ATOM   315  C CG  B GLU A 1 39 ? 16.306 33.357 -1.081 0.50 30.32  ? 1086 GLU A CG  1 
ATOM   316  C CD  A GLU A 1 39 ? 16.379 33.354 -1.911 0.50 34.36  ? 1086 GLU A CD  1 
ATOM   317  C CD  B GLU A 1 39 ? 17.277 33.617 0.100  0.50 36.61  ? 1086 GLU A CD  1 
ATOM   318  O OE1 A GLU A 1 39 ? 16.532 32.268 -2.664 0.50 34.53  ? 1086 GLU A OE1 1 
ATOM   319  O OE1 B GLU A 1 39 ? 16.829 33.631 1.257  0.50 36.48  ? 1086 GLU A OE1 1 
ATOM   320  O OE2 A GLU A 1 39 ? 16.445 34.608 -2.265 0.50 37.77  ? 1086 GLU A OE2 1 
ATOM   321  O OE2 B GLU A 1 39 ? 18.485 33.813 -0.115 0.50 43.11  ? 1086 GLU A OE2 1 
ATOM   322  N N   . ASP A 1 40 ? 12.879 30.213 -0.716 1.00 15.52  ? 1087 ASP A N   1 
ATOM   323  C CA  . ASP A 1 40 ? 11.497 29.886 -0.779 1.00 15.00  ? 1087 ASP A CA  1 
ATOM   324  C C   . ASP A 1 40 ? 11.150 28.473 -0.360 1.00 14.47  ? 1087 ASP A C   1 
ATOM   325  O O   . ASP A 1 40 ? 10.083 28.239 0.187  1.00 15.53  ? 1087 ASP A O   1 
ATOM   326  C CB  . ASP A 1 40 ? 10.981 30.115 -2.191 1.00 15.35  ? 1087 ASP A CB  1 
ATOM   327  C CG  . ASP A 1 40 ? 11.298 31.473 -2.724 1.00 16.48  ? 1087 ASP A CG  1 
ATOM   328  O OD1 . ASP A 1 40 ? 11.032 32.499 -2.045 1.00 18.89  ? 1087 ASP A OD1 1 
ATOM   329  O OD2 . ASP A 1 40 ? 11.852 31.557 -3.833 1.00 20.40  ? 1087 ASP A OD2 1 
ATOM   330  N N   . TRP A 1 41 ? 12.056 27.547 -0.644 1.00 13.71  ? 1088 TRP A N   1 
ATOM   331  C CA  . TRP A 1 41 ? 11.764 26.085 -0.523 1.00 13.17  ? 1088 TRP A CA  1 
ATOM   332  C C   . TRP A 1 41 ? 12.797 25.410 0.317  1.00 12.33  ? 1088 TRP A C   1 
ATOM   333  O O   . TRP A 1 41 ? 13.986 25.517 0.039  1.00 14.53  ? 1088 TRP A O   1 
ATOM   334  C CB  . TRP A 1 41 ? 11.747 25.471 -1.900 1.00 13.35  ? 1088 TRP A CB  1 
ATOM   335  C CG  . TRP A 1 41 ? 10.601 25.838 -2.727 1.00 13.96  ? 1088 TRP A CG  1 
ATOM   336  C CD1 . TRP A 1 41 ? 10.556 26.608 -3.848 1.00 15.38  ? 1088 TRP A CD1 1 
ATOM   337  C CD2 . TRP A 1 41 ? 9.249  25.348 -2.532 1.00 13.57  ? 1088 TRP A CD2 1 
ATOM   338  N NE1 . TRP A 1 41 ? 9.293  26.645 -4.347 1.00 19.12  ? 1088 TRP A NE1 1 
ATOM   339  C CE2 . TRP A 1 41 ? 8.479  25.833 -3.569 1.00 17.09  ? 1088 TRP A CE2 1 
ATOM   340  C CE3 . TRP A 1 41 ? 8.655  24.468 -1.605 1.00 14.97  ? 1088 TRP A CE3 1 
ATOM   341  C CZ2 . TRP A 1 41 ? 7.126  25.514 -3.666 1.00 20.49  ? 1088 TRP A CZ2 1 
ATOM   342  C CZ3 . TRP A 1 41 ? 7.348  24.132 -1.705 1.00 15.68  ? 1088 TRP A CZ3 1 
ATOM   343  C CH2 . TRP A 1 41 ? 6.585  24.671 -2.711 1.00 18.15  ? 1088 TRP A CH2 1 
ATOM   344  N N   . TRP A 1 42 ? 12.345 24.701 1.348  1.00 12.11  ? 1089 TRP A N   1 
ATOM   345  C CA  . TRP A 1 42 ? 13.152 23.858 2.183  1.00 12.03  ? 1089 TRP A CA  1 
ATOM   346  C C   . TRP A 1 42 ? 12.701 22.407 1.982  1.00 12.10  ? 1089 TRP A C   1 
ATOM   347  O O   . TRP A 1 42 ? 11.674 22.162 1.336  1.00 13.10  ? 1089 TRP A O   1 
ATOM   348  C CB  . TRP A 1 42 ? 13.124 24.268 3.649  1.00 13.25  ? 1089 TRP A CB  1 
ATOM   349  C CG  . TRP A 1 42 ? 13.654 25.630 3.945  1.00 13.03  ? 1089 TRP A CG  1 
ATOM   350  C CD1 . TRP A 1 42 ? 14.260 26.533 3.102  1.00 13.60  ? 1089 TRP A CD1 1 
ATOM   351  C CD2 . TRP A 1 42 ? 13.654 26.229 5.222  1.00 14.49  ? 1089 TRP A CD2 1 
ATOM   352  N NE1 . TRP A 1 42 ? 14.629 27.676 3.779  1.00 14.18  ? 1089 TRP A NE1 1 
ATOM   353  C CE2 . TRP A 1 42 ? 14.247 27.524 5.070  1.00 14.30  ? 1089 TRP A CE2 1 
ATOM   354  C CE3 . TRP A 1 42 ? 13.210 25.846 6.501  1.00 15.73  ? 1089 TRP A CE3 1 
ATOM   355  C CZ2 . TRP A 1 42 ? 14.366 28.405 6.150  1.00 16.53  ? 1089 TRP A CZ2 1 
ATOM   356  C CZ3 . TRP A 1 42 ? 13.333 26.720 7.563  1.00 18.17  ? 1089 TRP A CZ3 1 
ATOM   357  C CH2 . TRP A 1 42 ? 13.890 28.008 7.364  1.00 18.61  ? 1089 TRP A CH2 1 
ATOM   358  N N   . TYR A 1 43 ? 13.466 21.455 2.508  1.00 12.60  ? 1090 TYR A N   1 
ATOM   359  C CA  . TYR A 1 43 ? 13.190 20.049 2.315  1.00 12.34  ? 1090 TYR A CA  1 
ATOM   360  C C   . TYR A 1 43 ? 13.463 19.357 3.614  1.00 12.32  ? 1090 TYR A C   1 
ATOM   361  O O   . TYR A 1 43 ? 14.496 19.577 4.255  1.00 13.15  ? 1090 TYR A O   1 
ATOM   362  C CB  . TYR A 1 43 ? 14.090 19.523 1.202  1.00 12.78  ? 1090 TYR A CB  1 
ATOM   363  C CG  . TYR A 1 43 ? 13.728 18.134 0.761  1.00 12.29  ? 1090 TYR A CG  1 
ATOM   364  C CD1 . TYR A 1 43 ? 14.110 16.988 1.469  1.00 13.10  ? 1090 TYR A CD1 1 
ATOM   365  C CD2 . TYR A 1 43 ? 13.017 17.939 -0.421 1.00 13.10  ? 1090 TYR A CD2 1 
ATOM   366  C CE1 . TYR A 1 43 ? 13.717 15.763 1.116  1.00 13.58  ? 1090 TYR A CE1 1 
ATOM   367  C CE2 . TYR A 1 43 ? 12.615 16.702 -0.800 1.00 13.70  ? 1090 TYR A CE2 1 
ATOM   368  C CZ  . TYR A 1 43 ? 12.933 15.596 -0.025 1.00 13.59  ? 1090 TYR A CZ  1 
ATOM   369  O OH  . TYR A 1 43 ? 12.536 14.303 -0.452 1.00 16.31  ? 1090 TYR A OH  1 
ATOM   370  N N   . GLY A 1 44 ? 12.552 18.494 4.069  1.00 12.53  ? 1091 GLY A N   1 
ATOM   371  C CA  . GLY A 1 44 ? 12.741 17.819 5.348  1.00 13.70  ? 1091 GLY A CA  1 
ATOM   372  C C   . GLY A 1 44 ? 11.745 16.763 5.653  1.00 13.40  ? 1091 GLY A C   1 
ATOM   373  O O   . GLY A 1 44 ? 11.098 16.271 4.690  1.00 14.91  ? 1091 GLY A O   1 
ATOM   374  N N   . SER A 1 45 ? 11.629 16.371 6.909  1.00 13.32  ? 1092 SER A N   1 
ATOM   375  C CA  . SER A 1 45 ? 10.916 15.208 7.307  1.00 13.29  ? 1092 SER A CA  1 
ATOM   376  C C   . SER A 1 45 ? 9.907  15.508 8.392  1.00 14.89  ? 1092 SER A C   1 
ATOM   377  O O   . SER A 1 45 ? 10.184 16.245 9.333  1.00 14.80  ? 1092 SER A O   1 
ATOM   378  C CB  . SER A 1 45 ? 11.914 14.174 7.826  1.00 15.57  ? 1092 SER A CB  1 
ATOM   379  O OG  . SER A 1 45 ? 11.229 13.052 8.341  1.00 18.22  ? 1092 SER A OG  1 
ATOM   380  N N   . ILE A 1 46 ? 8.749  14.835 8.312  1.00 14.64  ? 1093 ILE A N   1 
ATOM   381  C CA  . ILE A 1 46 ? 7.747  14.819 9.358  1.00 15.60  ? 1093 ILE A CA  1 
ATOM   382  C C   . ILE A 1 46 ? 7.620  13.482 10.062 1.00 17.07  ? 1093 ILE A C   1 
ATOM   383  O O   . ILE A 1 46 ? 6.752  13.354 10.959 1.00 21.09  ? 1093 ILE A O   1 
ATOM   384  C CB  . ILE A 1 46 ? 6.398  15.376 8.884  1.00 17.32  ? 1093 ILE A CB  1 
ATOM   385  C CG1 . ILE A 1 46 ? 5.854  14.555 7.718  1.00 18.01  ? 1093 ILE A CG1 1 
ATOM   386  C CG2 . ILE A 1 46 ? 6.525  16.904 8.677  1.00 19.21  ? 1093 ILE A CG2 1 
ATOM   387  C CD1 . ILE A 1 46 ? 4.439  14.997 7.238  1.00 23.19  ? 1093 ILE A CD1 1 
ATOM   388  N N   . GLY A 1 47 ? 8.430  12.539 9.728  1.00 16.09  ? 1094 GLY A N   1 
ATOM   389  C CA  . GLY A 1 47 ? 8.384  11.231 10.312 1.00 17.14  ? 1094 GLY A CA  1 
ATOM   390  C C   . GLY A 1 47 ? 9.162  10.215 9.539  1.00 15.94  ? 1094 GLY A C   1 
ATOM   391  O O   . GLY A 1 47 ? 9.673  10.539 8.461  1.00 15.95  ? 1094 GLY A O   1 
ATOM   392  N N   . LYS A 1 48 ? 9.290  8.995  10.065 1.00 16.55  ? 1095 LYS A N   1 
ATOM   393  C CA  A LYS A 1 48 ? 9.983  7.946  9.402  0.50 16.50  ? 1095 LYS A CA  1 
ATOM   394  C CA  B LYS A 1 48 ? 10.016 7.978  9.394  0.50 17.11  ? 1095 LYS A CA  1 
ATOM   395  C C   . LYS A 1 48 ? 9.526  7.780  7.965  1.00 16.52  ? 1095 LYS A C   1 
ATOM   396  O O   . LYS A 1 48 ? 8.338  7.528  7.707  1.00 18.58  ? 1095 LYS A O   1 
ATOM   397  C CB  A LYS A 1 48 ? 9.689  6.620  10.143 0.50 17.64  ? 1095 LYS A CB  1 
ATOM   398  C CB  B LYS A 1 48 ? 9.900  6.629  10.146 0.50 18.96  ? 1095 LYS A CB  1 
ATOM   399  C CG  A LYS A 1 48 ? 10.323 5.389  9.523  0.50 16.89  ? 1095 LYS A CG  1 
ATOM   400  C CG  B LYS A 1 48 ? 10.797 5.558  9.548  0.50 20.00  ? 1095 LYS A CG  1 
ATOM   401  C CD  A LYS A 1 48 ? 9.915  4.080  10.248 0.50 19.91  ? 1095 LYS A CD  1 
ATOM   402  C CD  B LYS A 1 48 ? 10.716 4.220  10.305 0.50 23.84  ? 1095 LYS A CD  1 
ATOM   403  C CE  A LYS A 1 48 ? 10.492 2.846  9.653  0.50 25.64  ? 1095 LYS A CE  1 
ATOM   404  C CE  B LYS A 1 48 ? 9.438  3.452  9.953  0.50 25.01  ? 1095 LYS A CE  1 
ATOM   405  N NZ  A LYS A 1 48 ? 10.009 2.684  8.308  0.50 34.40  ? 1095 LYS A NZ  1 
ATOM   406  N NZ  B LYS A 1 48 ? 9.417  2.037  10.664 0.50 29.26  ? 1095 LYS A NZ  1 
ATOM   407  N N   . GLY A 1 49 ? 10.438 7.928  7.009  1.00 16.21  ? 1096 GLY A N   1 
ATOM   408  C CA  . GLY A 1 49 ? 10.097 7.780  5.634  1.00 17.10  ? 1096 GLY A CA  1 
ATOM   409  C C   . GLY A 1 49 ? 9.163  8.811  5.003  1.00 16.29  ? 1096 GLY A C   1 
ATOM   410  O O   . GLY A 1 49 ? 8.665  8.551  3.906  1.00 19.15  ? 1096 GLY A O   1 
ATOM   411  N N   . GLN A 1 50 ? 8.954  9.933  5.661  1.00 15.18  ? 1097 GLN A N   1 
ATOM   412  C CA  . GLN A 1 50 ? 8.057  10.980 5.183  1.00 14.83  ? 1097 GLN A CA  1 
ATOM   413  C C   . GLN A 1 50 ? 8.831  12.277 4.967  1.00 14.59  ? 1097 GLN A C   1 
ATOM   414  O O   . GLN A 1 50 ? 8.997  13.067 5.903  1.00 15.78  ? 1097 GLN A O   1 
ATOM   415  C CB  . GLN A 1 50 ? 6.954  11.183 6.229  1.00 17.14  ? 1097 GLN A CB  1 
ATOM   416  C CG  . GLN A 1 50 ? 6.063  10.004 6.460  1.00 19.64  ? 1097 GLN A CG  1 
ATOM   417  C CD  . GLN A 1 50 ? 4.887  10.474 7.350  1.00 32.56  ? 1097 GLN A CD  1 
ATOM   418  O OE1 . GLN A 1 50 ? 3.987  11.175 6.900  1.00 45.61  ? 1097 GLN A OE1 1 
ATOM   419  N NE2 . GLN A 1 50 ? 5.026  10.278 8.545  1.00 40.04  ? 1097 GLN A NE2 1 
ATOM   420  N N   A GLU A 1 51 ? 9.306  12.460 3.744  0.50 13.77  ? 1098 GLU A N   1 
ATOM   421  N N   B GLU A 1 51 ? 9.388  12.433 3.767  0.50 14.21  ? 1098 GLU A N   1 
ATOM   422  C CA  A GLU A 1 51 ? 10.143 13.565 3.420  0.50 13.51  ? 1098 GLU A CA  1 
ATOM   423  C CA  B GLU A 1 51 ? 10.217 13.568 3.423  0.50 14.64  ? 1098 GLU A CA  1 
ATOM   424  C C   A GLU A 1 51 ? 9.634  14.287 2.216  0.50 13.29  ? 1098 GLU A C   1 
ATOM   425  C C   B GLU A 1 51 ? 9.679  14.278 2.218  0.50 13.51  ? 1098 GLU A C   1 
ATOM   426  O O   A GLU A 1 51 ? 8.971  13.709 1.350  0.50 15.83  ? 1098 GLU A O   1 
ATOM   427  O O   B GLU A 1 51 ? 9.086  13.673 1.335  0.50 15.42  ? 1098 GLU A O   1 
ATOM   428  C CB  A GLU A 1 51 ? 11.600 13.072 3.127  0.50 15.65  ? 1098 GLU A CB  1 
ATOM   429  C CB  B GLU A 1 51 ? 11.681 13.134 3.053  0.50 16.57  ? 1098 GLU A CB  1 
ATOM   430  C CG  A GLU A 1 51 ? 12.202 12.168 4.212  0.50 15.05  ? 1098 GLU A CG  1 
ATOM   431  C CG  B GLU A 1 51 ? 12.551 12.631 4.166  0.50 19.52  ? 1098 GLU A CG  1 
ATOM   432  C CD  A GLU A 1 51 ? 11.868 10.676 4.079  0.50 15.03  ? 1098 GLU A CD  1 
ATOM   433  C CD  B GLU A 1 51 ? 12.156 11.259 4.650  0.50 19.64  ? 1098 GLU A CD  1 
ATOM   434  O OE1 A GLU A 1 51 ? 11.552 10.279 2.953  0.50 20.69  ? 1098 GLU A OE1 1 
ATOM   435  O OE1 B GLU A 1 51 ? 12.097 10.303 3.847  0.50 26.49  ? 1098 GLU A OE1 1 
ATOM   436  O OE2 A GLU A 1 51 ? 12.068 9.931  5.018  0.50 15.06  ? 1098 GLU A OE2 1 
ATOM   437  O OE2 B GLU A 1 51 ? 11.925 11.126 5.842  0.50 26.74  ? 1098 GLU A OE2 1 
ATOM   438  N N   . GLY A 1 52 ? 9.977  15.577 2.098  1.00 12.74  ? 1099 GLY A N   1 
ATOM   439  C CA  . GLY A 1 52 ? 9.582  16.315 0.972  1.00 12.71  ? 1099 GLY A CA  1 
ATOM   440  C C   . GLY A 1 52 ? 9.879  17.804 1.087  1.00 11.67  ? 1099 GLY A C   1 
ATOM   441  O O   . GLY A 1 52 ? 10.260 18.291 2.144  1.00 12.83  ? 1099 GLY A O   1 
ATOM   442  N N   . TYR A 1 53 ? 9.648  18.505 -0.021 1.00 12.35  ? 1100 TYR A N   1 
ATOM   443  C CA  . TYR A 1 53 ? 9.704  19.938 -0.065 1.00 12.20  ? 1100 TYR A CA  1 
ATOM   444  C C   . TYR A 1 53 ? 8.535  20.565 0.666  1.00 12.60  ? 1100 TYR A C   1 
ATOM   445  O O   . TYR A 1 53 ? 7.411  20.062 0.665  1.00 14.04  ? 1100 TYR A O   1 
ATOM   446  C CB  . TYR A 1 53 ? 9.655  20.451 -1.517 1.00 12.26  ? 1100 TYR A CB  1 
ATOM   447  C CG  . TYR A 1 53 ? 10.952 20.329 -2.277 1.00 12.60  ? 1100 TYR A CG  1 
ATOM   448  C CD1 . TYR A 1 53 ? 11.948 21.225 -2.058 1.00 15.17  ? 1100 TYR A CD1 1 
ATOM   449  C CD2 . TYR A 1 53 ? 11.136 19.364 -3.235 1.00 13.24  ? 1100 TYR A CD2 1 
ATOM   450  C CE1 . TYR A 1 53 ? 13.110 21.197 -2.769 1.00 17.43  ? 1100 TYR A CE1 1 
ATOM   451  C CE2 . TYR A 1 53 ? 12.295 19.277 -3.958 1.00 15.01  ? 1100 TYR A CE2 1 
ATOM   452  C CZ  . TYR A 1 53 ? 13.273 20.228 -3.738 1.00 17.61  ? 1100 TYR A CZ  1 
ATOM   453  O OH  . TYR A 1 53 ? 14.382 20.189 -4.549 1.00 27.17  ? 1100 TYR A OH  1 
ATOM   454  N N   . PHE A 1 54 ? 8.769  21.752 1.246  1.00 12.56  ? 1101 PHE A N   1 
ATOM   455  C CA  . PHE A 1 54 ? 7.726  22.559 1.844  1.00 12.96  ? 1101 PHE A CA  1 
ATOM   456  C C   . PHE A 1 54 ? 8.166  24.038 1.782  1.00 12.31  ? 1101 PHE A C   1 
ATOM   457  O O   . PHE A 1 54 ? 9.355  24.332 1.717  1.00 12.90  ? 1101 PHE A O   1 
ATOM   458  C CB  . PHE A 1 54 ? 7.415  22.146 3.283  1.00 13.93  ? 1101 PHE A CB  1 
ATOM   459  C CG  . PHE A 1 54 ? 8.591  22.295 4.211  1.00 13.95  ? 1101 PHE A CG  1 
ATOM   460  C CD1 . PHE A 1 54 ? 9.560  21.305 4.323  1.00 15.12  ? 1101 PHE A CD1 1 
ATOM   461  C CD2 . PHE A 1 54 ? 8.810  23.442 4.909  1.00 14.17  ? 1101 PHE A CD2 1 
ATOM   462  C CE1 . PHE A 1 54 ? 10.663 21.446 5.141  1.00 15.07  ? 1101 PHE A CE1 1 
ATOM   463  C CE2 . PHE A 1 54 ? 9.931  23.641 5.723  1.00 15.20  ? 1101 PHE A CE2 1 
ATOM   464  C CZ  . PHE A 1 54 ? 10.849 22.632 5.848  1.00 16.07  ? 1101 PHE A CZ  1 
ATOM   465  N N   . PRO A 1 55 ? 7.200  24.961 1.774  1.00 12.55  ? 1102 PRO A N   1 
ATOM   466  C CA  . PRO A 1 55 ? 7.557  26.393 1.687  1.00 12.71  ? 1102 PRO A CA  1 
ATOM   467  C C   . PRO A 1 55 ? 8.124  26.882 2.987  1.00 12.43  ? 1102 PRO A C   1 
ATOM   468  O O   . PRO A 1 55 ? 7.520  26.747 4.067  1.00 13.52  ? 1102 PRO A O   1 
ATOM   469  C CB  . PRO A 1 55 ? 6.265  27.064 1.338  1.00 15.03  ? 1102 PRO A CB  1 
ATOM   470  C CG  . PRO A 1 55 ? 5.215  26.078 1.739  1.00 18.74  ? 1102 PRO A CG  1 
ATOM   471  C CD  . PRO A 1 55 ? 5.750  24.753 1.667  1.00 14.23  ? 1102 PRO A CD  1 
ATOM   472  N N   . ALA A 1 56 ? 9.285  27.539 2.943  1.00 13.15  ? 1103 ALA A N   1 
ATOM   473  C CA  . ALA A 1 56 ? 9.946  28.092 4.103  1.00 13.15  ? 1103 ALA A CA  1 
ATOM   474  C C   . ALA A 1 56 ? 9.053  29.086 4.850  1.00 13.64  ? 1103 ALA A C   1 
ATOM   475  O O   . ALA A 1 56 ? 9.054  29.149 6.077  1.00 14.30  ? 1103 ALA A O   1 
ATOM   476  C CB  . ALA A 1 56 ? 11.289 28.748 3.716  1.00 15.22  ? 1103 ALA A CB  1 
ATOM   477  N N   . ASN A 1 57 ? 8.254  29.857 4.084  1.00 13.21  ? 1104 ASN A N   1 
ATOM   478  C CA  . ASN A 1 57 ? 7.416  30.854 4.703  1.00 13.09  ? 1104 ASN A CA  1 
ATOM   479  C C   . ASN A 1 57 ? 6.272  30.314 5.500  1.00 12.88  ? 1104 ASN A C   1 
ATOM   480  O O   . ASN A 1 57 ? 5.547  31.094 6.126  1.00 14.31  ? 1104 ASN A O   1 
ATOM   481  C CB  . ASN A 1 57 ? 6.996  31.939 3.725  1.00 12.75  ? 1104 ASN A CB  1 
ATOM   482  C CG  . ASN A 1 57 ? 5.982  31.504 2.733  1.00 14.13  ? 1104 ASN A CG  1 
ATOM   483  O OD1 . ASN A 1 57 ? 5.548  30.351 2.754  1.00 15.07  ? 1104 ASN A OD1 1 
ATOM   484  N ND2 . ASN A 1 57 ? 5.580  32.426 1.831  1.00 16.39  ? 1104 ASN A ND2 1 
ATOM   485  N N   . HIS A 1 58 ? 6.077  28.994 5.537  1.00 12.84  ? 1105 HIS A N   1 
ATOM   486  C CA  . HIS A 1 58 ? 5.072  28.390 6.356  1.00 12.81  ? 1105 HIS A CA  1 
ATOM   487  C C   . HIS A 1 58 ? 5.518  27.892 7.695  1.00 13.49  ? 1105 HIS A C   1 
ATOM   488  O O   . HIS A 1 58 ? 4.720  27.368 8.462  1.00 14.77  ? 1105 HIS A O   1 
ATOM   489  C CB  . HIS A 1 58 ? 4.368  27.232 5.606  1.00 13.80  ? 1105 HIS A CB  1 
ATOM   490  C CG  . HIS A 1 58 ? 3.422  27.655 4.561  1.00 14.69  ? 1105 HIS A CG  1 
ATOM   491  N ND1 . HIS A 1 58 ? 3.701  28.595 3.593  1.00 15.84  ? 1105 HIS A ND1 1 
ATOM   492  C CD2 . HIS A 1 58 ? 2.144  27.228 4.331  1.00 16.09  ? 1105 HIS A CD2 1 
ATOM   493  C CE1 . HIS A 1 58 ? 2.643  28.680 2.770  1.00 16.98  ? 1105 HIS A CE1 1 
ATOM   494  N NE2 . HIS A 1 58 ? 1.669  27.896 3.227  1.00 17.76  ? 1105 HIS A NE2 1 
ATOM   495  N N   . VAL A 1 59 ? 6.806  28.053 8.028  1.00 13.33  ? 1106 VAL A N   1 
ATOM   496  C CA  . VAL A 1 59 ? 7.350  27.542 9.255  1.00 14.00  ? 1106 VAL A CA  1 
ATOM   497  C C   . VAL A 1 59 ? 7.923  28.586 10.160 1.00 14.11  ? 1106 VAL A C   1 
ATOM   498  O O   . VAL A 1 59 ? 8.135  29.738 9.752  1.00 15.84  ? 1106 VAL A O   1 
ATOM   499  C CB  . VAL A 1 59 ? 8.373  26.371 8.997  1.00 14.93  ? 1106 VAL A CB  1 
ATOM   500  C CG1 . VAL A 1 59 ? 7.700  25.270 8.105  1.00 16.93  ? 1106 VAL A CG1 1 
ATOM   501  C CG2 . VAL A 1 59 ? 9.697  26.905 8.464  1.00 17.52  ? 1106 VAL A CG2 1 
ATOM   502  N N   . ALA A 1 60 ? 8.187  28.216 11.405 1.00 14.63  ? 1107 ALA A N   1 
ATOM   503  C CA  . ALA A 1 60 ? 8.782  29.066 12.404 1.00 14.07  ? 1107 ALA A CA  1 
ATOM   504  C C   . ALA A 1 60 ? 9.651  28.246 13.326 1.00 13.94  ? 1107 ALA A C   1 
ATOM   505  O O   . ALA A 1 60 ? 9.543  27.007 13.392 1.00 14.66  ? 1107 ALA A O   1 
ATOM   506  C CB  . ALA A 1 60 ? 7.721  29.766 13.199 1.00 19.50  ? 1107 ALA A CB  1 
ATOM   507  N N   . SER A 1 61 ? 10.540 28.893 14.042 1.00 14.40  ? 1108 SER A N   1 
ATOM   508  C CA  . SER A 1 61 ? 11.339 28.237 15.040 1.00 14.68  ? 1108 SER A CA  1 
ATOM   509  C C   . SER A 1 61 ? 10.478 27.642 16.144 1.00 15.87  ? 1108 SER A C   1 
ATOM   510  O O   . SER A 1 61 ? 9.372  28.104 16.439 1.00 15.49  ? 1108 SER A O   1 
ATOM   511  C CB  . SER A 1 61 ? 12.353 29.153 15.643 1.00 16.08  ? 1108 SER A CB  1 
ATOM   512  O OG  . SER A 1 61 ? 11.756 30.142 16.477 1.00 15.83  ? 1108 SER A OG  1 
ATOM   513  N N   A GLU A 1 62 ? 11.021 26.609 16.796 0.50 16.78  ? 1109 GLU A N   1 
ATOM   514  N N   B GLU A 1 62 ? 11.017 26.617 16.811 0.50 16.69  ? 1109 GLU A N   1 
ATOM   515  C CA  A GLU A 1 62 ? 10.447 26.103 18.029 0.50 19.06  ? 1109 GLU A CA  1 
ATOM   516  C CA  B GLU A 1 62 ? 10.350 26.123 17.999 0.50 19.22  ? 1109 GLU A CA  1 
ATOM   517  C C   A GLU A 1 62 ? 10.243 27.210 19.068 0.50 18.11  ? 1109 GLU A C   1 
ATOM   518  C C   B GLU A 1 62 ? 10.245 27.195 19.091 0.50 18.10  ? 1109 GLU A C   1 
ATOM   519  O O   A GLU A 1 62 ? 9.194  27.315 19.713 0.50 19.77  ? 1109 GLU A O   1 
ATOM   520  O O   B GLU A 1 62 ? 9.236  27.277 19.789 0.50 19.85  ? 1109 GLU A O   1 
ATOM   521  C CB  A GLU A 1 62 ? 11.355 25.024 18.611 0.50 21.19  ? 1109 GLU A CB  1 
ATOM   522  C CB  B GLU A 1 62 ? 10.999 24.845 18.531 0.50 20.51  ? 1109 GLU A CB  1 
ATOM   523  C CG  A GLU A 1 62 ? 11.423 23.763 17.841 0.50 23.35  ? 1109 GLU A CG  1 
ATOM   524  C CG  B GLU A 1 62 ? 10.943 23.658 17.606 0.50 25.64  ? 1109 GLU A CG  1 
ATOM   525  C CD  A GLU A 1 62 ? 10.189 22.883 18.045 0.50 26.87  ? 1109 GLU A CD  1 
ATOM   526  C CD  B GLU A 1 62 ? 11.521 22.388 18.198 0.50 29.41  ? 1109 GLU A CD  1 
ATOM   527  O OE1 A GLU A 1 62 ? 9.245  23.251 18.852 0.50 29.78  ? 1109 GLU A OE1 1 
ATOM   528  O OE1 B GLU A 1 62 ? 12.702 22.383 18.647 0.50 33.66  ? 1109 GLU A OE1 1 
ATOM   529  O OE2 A GLU A 1 62 ? 10.106 21.832 17.295 0.50 26.66  ? 1109 GLU A OE2 1 
ATOM   530  O OE2 B GLU A 1 62 ? 10.822 21.370 18.072 0.50 34.88  ? 1109 GLU A OE2 1 
ATOM   531  N N   . THR A 1 63 ? 11.246 28.075 19.200 1.00 17.50  ? 1110 THR A N   1 
ATOM   532  C CA  . THR A 1 63 ? 11.139 29.184 20.180 1.00 17.98  ? 1110 THR A CA  1 
ATOM   533  C C   . THR A 1 63 ? 9.933  30.082 19.891 1.00 18.07  ? 1110 THR A C   1 
ATOM   534  O O   . THR A 1 63 ? 9.158  30.392 20.813 1.00 19.21  ? 1110 THR A O   1 
ATOM   535  C CB  . THR A 1 63 ? 12.446 29.976 20.202 1.00 19.00  ? 1110 THR A CB  1 
ATOM   536  O OG1 . THR A 1 63 ? 13.510 29.089 20.618 1.00 23.90  ? 1110 THR A OG1 1 
ATOM   537  C CG2 . THR A 1 63 ? 12.394 31.206 21.154 1.00 20.37  ? 1110 THR A CG2 1 
ATOM   538  N N   . LEU A 1 64 ? 9.805  30.520 18.645 1.00 16.17  ? 1111 LEU A N   1 
ATOM   539  C CA  . LEU A 1 64 ? 8.683  31.399 18.302 1.00 17.07  ? 1111 LEU A CA  1 
ATOM   540  C C   . LEU A 1 64 ? 7.383  30.714 18.525 1.00 17.93  ? 1111 LEU A C   1 
ATOM   541  O O   . LEU A 1 64 ? 6.450  31.258 19.117 1.00 19.36  ? 1111 LEU A O   1 
ATOM   542  C CB  . LEU A 1 64 ? 8.871  31.883 16.883 1.00 17.51  ? 1111 LEU A CB  1 
ATOM   543  C CG  . LEU A 1 64 ? 7.824  32.854 16.319 1.00 19.07  ? 1111 LEU A CG  1 
ATOM   544  C CD1 . LEU A 1 64 ? 8.445  33.677 15.131 1.00 22.96  ? 1111 LEU A CD1 1 
ATOM   545  C CD2 . LEU A 1 64 ? 6.457  32.302 15.905 1.00 23.00  ? 1111 LEU A CD2 1 
ATOM   546  N N   . TYR A 1 65 ? 7.280  29.446 18.090 1.00 16.79  ? 1112 TYR A N   1 
ATOM   547  C CA  . TYR A 1 65 ? 6.048  28.698 18.211 1.00 17.90  ? 1112 TYR A CA  1 
ATOM   548  C C   . TYR A 1 65 ? 5.595  28.591 19.650 1.00 21.07  ? 1112 TYR A C   1 
ATOM   549  O O   . TYR A 1 65 ? 4.402  28.866 19.969 1.00 23.17  ? 1112 TYR A O   1 
ATOM   550  C CB  . TYR A 1 65 ? 6.185  27.326 17.529 1.00 18.23  ? 1112 TYR A CB  1 
ATOM   551  C CG  . TYR A 1 65 ? 4.841  26.667 17.398 1.00 19.89  ? 1112 TYR A CG  1 
ATOM   552  C CD1 . TYR A 1 65 ? 4.023  26.999 16.350 1.00 21.81  ? 1112 TYR A CD1 1 
ATOM   553  C CD2 . TYR A 1 65 ? 4.381  25.781 18.320 1.00 21.76  ? 1112 TYR A CD2 1 
ATOM   554  C CE1 . TYR A 1 65 ? 2.823  26.437 16.210 1.00 23.55  ? 1112 TYR A CE1 1 
ATOM   555  C CE2 . TYR A 1 65 ? 3.140  25.231 18.179 1.00 23.02  ? 1112 TYR A CE2 1 
ATOM   556  C CZ  . TYR A 1 65 ? 2.337  25.561 17.112 1.00 22.12  ? 1112 TYR A CZ  1 
ATOM   557  O OH  . TYR A 1 65 ? 1.041  25.024 17.004 1.00 28.48  ? 1112 TYR A OH  1 
ATOM   558  N N   . GLN A 1 66 ? 6.522  28.311 20.562 1.00 18.53  ? 1113 GLN A N   1 
ATOM   559  C CA  . GLN A 1 66 ? 6.190  28.177 21.968 1.00 21.12  ? 1113 GLN A CA  1 
ATOM   560  C C   . GLN A 1 66 ? 5.835  29.542 22.617 1.00 20.99  ? 1113 GLN A C   1 
ATOM   561  O O   . GLN A 1 66 ? 5.119  29.558 23.660 1.00 27.86  ? 1113 GLN A O   1 
ATOM   562  C CB  . GLN A 1 66 ? 7.364  27.522 22.613 1.00 24.56  ? 1113 GLN A CB  1 
ATOM   563  C CG  . GLN A 1 66 ? 7.426  26.035 22.252 1.00 31.21  ? 1113 GLN A CG  1 
ATOM   564  C CD  . GLN A 1 66 ? 8.762  25.228 22.557 1.00 45.94  ? 1113 GLN A CD  1 
ATOM   565  O OE1 . GLN A 1 66 ? 9.477  25.474 23.520 1.00 57.36  ? 1113 GLN A OE1 1 
ATOM   566  N NE2 . GLN A 1 66 ? 9.075  24.292 21.701 1.00 52.81  ? 1113 GLN A NE2 1 
ATOM   567  N N   . GLU A 1 67 ? 6.187  30.630 22.018 1.00 19.18  ? 1114 GLU A N   1 
ATOM   568  C CA  . GLU A 1 67 ? 5.877  31.993 22.501 1.00 20.17  ? 1114 GLU A CA  1 
ATOM   569  C C   . GLU A 1 67 ? 4.721  32.597 21.905 1.00 21.60  ? 1114 GLU A C   1 
ATOM   570  O O   . GLU A 1 67 ? 4.338  33.741 22.296 1.00 25.95  ? 1114 GLU A O   1 
ATOM   571  C CB  . GLU A 1 67 ? 7.121  32.946 22.150 1.00 22.29  ? 1114 GLU A CB  1 
ATOM   572  C CG  . GLU A 1 67 ? 8.265  32.641 22.976 1.00 20.19  ? 1114 GLU A CG  1 
ATOM   573  C CD  . GLU A 1 67 ? 9.662  33.251 22.716 1.00 19.63  ? 1114 GLU A CD  1 
ATOM   574  O OE1 . GLU A 1 67 ? 9.848  33.837 21.669 1.00 22.64  ? 1114 GLU A OE1 1 
ATOM   575  O OE2 . GLU A 1 67 ? 10.356 33.091 23.589 1.00 25.21  ? 1114 GLU A OE2 1 
ATOM   576  N N   . LEU A 1 68 ? 3.978  31.931 21.065 1.00 20.33  ? 1115 LEU A N   1 
ATOM   577  C CA  . LEU A 1 68 ? 2.729  32.502 20.526 1.00 23.75  ? 1115 LEU A CA  1 
ATOM   578  C C   . LEU A 1 68 ? 1.733  32.746 21.696 1.00 25.18  ? 1115 LEU A C   1 
ATOM   579  O O   . LEU A 1 68 ? 1.698  31.948 22.635 1.00 28.56  ? 1115 LEU A O   1 
ATOM   580  C CB  . LEU A 1 68 ? 2.165  31.599 19.465 1.00 24.15  ? 1115 LEU A CB  1 
ATOM   581  C CG  . LEU A 1 68 ? 2.876  31.204 18.214 1.00 27.36  ? 1115 LEU A CG  1 
ATOM   582  C CD1 . LEU A 1 68 ? 2.234  29.961 17.515 1.00 31.61  ? 1115 LEU A CD1 1 
ATOM   583  C CD2 . LEU A 1 68 ? 2.896  32.407 17.317 1.00 37.47  ? 1115 LEU A CD2 1 
ATOM   584  N N   . PRO A 1 69 ? 0.775  33.665 21.573 1.00 30.98  ? 1116 PRO A N   1 
ATOM   585  C CA  . PRO A 1 69 ? -0.301 33.812 22.585 1.00 35.51  ? 1116 PRO A CA  1 
ATOM   586  C C   . PRO A 1 69 ? -1.179 32.612 22.776 1.00 39.47  ? 1116 PRO A C   1 
ATOM   587  O O   . PRO A 1 69 ? -1.336 31.839 21.775 1.00 41.26  ? 1116 PRO A O   1 
ATOM   588  C CB  . PRO A 1 69 ? -1.100 35.069 22.111 1.00 36.53  ? 1116 PRO A CB  1 
ATOM   589  C CG  . PRO A 1 69 ? -0.259 35.656 21.012 1.00 38.13  ? 1116 PRO A CG  1 
ATOM   590  C CD  . PRO A 1 69 ? 0.721  34.664 20.497 1.00 34.52  ? 1116 PRO A CD  1 
ATOM   591  O OXT . PRO A 1 69 ? -1.667 32.373 23.965 1.00 43.47  ? 1116 PRO A OXT 1 
ATOM   592  N N   . ALA B 1 6  ? 10.768 2.654  21.701 1.00 43.38  ? 1053 ALA B N   1 
ATOM   593  C CA  . ALA B 1 6  ? 11.039 4.135  22.060 1.00 42.26  ? 1053 ALA B CA  1 
ATOM   594  C C   . ALA B 1 6  ? 11.665 4.338  23.479 1.00 40.59  ? 1053 ALA B C   1 
ATOM   595  O O   . ALA B 1 6  ? 11.231 5.194  24.324 1.00 40.22  ? 1053 ALA B O   1 
ATOM   596  C CB  . ALA B 1 6  ? 9.756  5.071  21.838 1.00 43.81  ? 1053 ALA B CB  1 
ATOM   597  N N   . PRO B 1 7  ? 12.813 3.639  23.725 1.00 39.31  ? 1054 PRO B N   1 
ATOM   598  C CA  . PRO B 1 7  ? 13.421 3.845  25.040 1.00 36.42  ? 1054 PRO B CA  1 
ATOM   599  C C   . PRO B 1 7  ? 14.058 5.285  25.325 1.00 34.07  ? 1054 PRO B C   1 
ATOM   600  O O   . PRO B 1 7  ? 14.036 6.197  24.429 1.00 36.15  ? 1054 PRO B O   1 
ATOM   601  C CB  . PRO B 1 7  ? 14.494 2.731  25.074 1.00 37.28  ? 1054 PRO B CB  1 
ATOM   602  C CG  . PRO B 1 7  ? 14.925 2.619  23.556 1.00 35.69  ? 1054 PRO B CG  1 
ATOM   603  C CD  . PRO B 1 7  ? 13.559 2.677  22.888 1.00 38.60  ? 1054 PRO B CD  1 
ATOM   604  N N   . THR B 1 8  ? 14.602 5.494  26.531 1.00 29.49  ? 1055 THR B N   1 
ATOM   605  C CA  . THR B 1 8  ? 15.636 6.475  26.781 1.00 25.75  ? 1055 THR B CA  1 
ATOM   606  C C   . THR B 1 8  ? 16.900 5.645  26.927 1.00 23.67  ? 1055 THR B C   1 
ATOM   607  O O   . THR B 1 8  ? 16.896 4.681  27.692 1.00 28.08  ? 1055 THR B O   1 
ATOM   608  C CB  . THR B 1 8  ? 15.335 7.270  27.963 1.00 29.90  ? 1055 THR B CB  1 
ATOM   609  O OG1 . THR B 1 8  ? 14.130 8.043  27.659 1.00 37.57  ? 1055 THR B OG1 1 
ATOM   610  C CG2 . THR B 1 8  ? 16.421 8.296  28.229 1.00 36.30  ? 1055 THR B CG2 1 
ATOM   611  N N   . VAL B 1 9  ? 17.958 6.042  26.216 1.00 20.73  ? 1056 VAL B N   1 
ATOM   612  C CA  . VAL B 1 9  ? 19.247 5.395  26.248 1.00 18.64  ? 1056 VAL B CA  1 
ATOM   613  C C   . VAL B 1 9  ? 20.329 6.431  26.482 1.00 18.43  ? 1056 VAL B C   1 
ATOM   614  O O   . VAL B 1 9  ? 20.046 7.640  26.517 1.00 20.76  ? 1056 VAL B O   1 
ATOM   615  C CB  . VAL B 1 9  ? 19.489 4.587  24.932 1.00 18.69  ? 1056 VAL B CB  1 
ATOM   616  C CG1 . VAL B 1 9  ? 18.433 3.446  24.808 1.00 22.37  ? 1056 VAL B CG1 1 
ATOM   617  C CG2 . VAL B 1 9  ? 19.529 5.472  23.700 1.00 19.92  ? 1056 VAL B CG2 1 
ATOM   618  N N   . VAL B 1 10 ? 21.578 5.987  26.626 1.00 17.70  ? 1057 VAL B N   1 
ATOM   619  C CA  . VAL B 1 10 ? 22.679 6.862  26.881 1.00 18.57  ? 1057 VAL B CA  1 
ATOM   620  C C   . VAL B 1 10 ? 23.701 6.635  25.770 1.00 17.74  ? 1057 VAL B C   1 
ATOM   621  O O   . VAL B 1 10 ? 24.041 5.479  25.453 1.00 18.54  ? 1057 VAL B O   1 
ATOM   622  C CB  . VAL B 1 10 ? 23.306 6.734  28.275 1.00 19.56  ? 1057 VAL B CB  1 
ATOM   623  C CG1 . VAL B 1 10 ? 24.363 7.806  28.538 1.00 21.73  ? 1057 VAL B CG1 1 
ATOM   624  C CG2 . VAL B 1 10 ? 22.247 6.698  29.339 1.00 23.92  ? 1057 VAL B CG2 1 
ATOM   625  N N   . ALA B 1 11 ? 24.262 7.717  25.218 1.00 17.64  ? 1058 ALA B N   1 
ATOM   626  C CA  . ALA B 1 11 ? 25.450 7.574  24.319 1.00 17.38  ? 1058 ALA B CA  1 
ATOM   627  C C   . ALA B 1 11 ? 26.615 7.032  25.105 1.00 17.14  ? 1058 ALA B C   1 
ATOM   628  O O   . ALA B 1 11 ? 27.055 7.617  26.095 1.00 19.92  ? 1058 ALA B O   1 
ATOM   629  C CB  . ALA B 1 11 ? 25.798 8.870  23.614 1.00 18.47  ? 1058 ALA B CB  1 
ATOM   630  N N   . LEU B 1 12 ? 27.163 5.901  24.652 1.00 17.59  ? 1059 LEU B N   1 
ATOM   631  C CA  . LEU B 1 12 ? 28.395 5.342  25.206 1.00 19.00  ? 1059 LEU B CA  1 
ATOM   632  C C   . LEU B 1 12 ? 29.617 5.749  24.419 1.00 19.64  ? 1059 LEU B C   1 
ATOM   633  O O   . LEU B 1 12 ? 30.734 5.884  24.978 1.00 23.05  ? 1059 LEU B O   1 
ATOM   634  C CB  . LEU B 1 12 ? 28.271 3.818  25.257 1.00 20.81  ? 1059 LEU B CB  1 
ATOM   635  C CG  . LEU B 1 12 ? 29.293 3.024  25.959 1.00 23.59  ? 1059 LEU B CG  1 
ATOM   636  C CD1 . LEU B 1 12 ? 29.560 3.519  27.370 1.00 26.64  ? 1059 LEU B CD1 1 
ATOM   637  C CD2 . LEU B 1 12 ? 28.923 1.518  25.920 1.00 24.12  ? 1059 LEU B CD2 1 
ATOM   638  N N   . TYR B 1 13 ? 29.429 6.066  23.125 1.00 18.11  ? 1060 TYR B N   1 
ATOM   639  C CA  . TYR B 1 13 ? 30.505 6.449  22.240 1.00 18.60  ? 1060 TYR B CA  1 
ATOM   640  C C   . TYR B 1 13 ? 30.090 7.714  21.453 1.00 17.81  ? 1060 TYR B C   1 
ATOM   641  O O   . TYR B 1 13 ? 28.949 7.793  20.979 1.00 18.85  ? 1060 TYR B O   1 
ATOM   642  C CB  . TYR B 1 13 ? 30.846 5.309  21.267 1.00 19.17  ? 1060 TYR B CB  1 
ATOM   643  C CG  . TYR B 1 13 ? 31.318 4.065  21.962 1.00 20.00  ? 1060 TYR B CG  1 
ATOM   644  C CD1 . TYR B 1 13 ? 32.643 3.951  22.382 1.00 25.47  ? 1060 TYR B CD1 1 
ATOM   645  C CD2 . TYR B 1 13 ? 30.516 2.988  22.157 1.00 19.38  ? 1060 TYR B CD2 1 
ATOM   646  C CE1 . TYR B 1 13 ? 33.069 2.833  22.972 1.00 30.67  ? 1060 TYR B CE1 1 
ATOM   647  C CE2 . TYR B 1 13 ? 30.926 1.883  22.782 1.00 22.13  ? 1060 TYR B CE2 1 
ATOM   648  C CZ  . TYR B 1 13 ? 32.178 1.777  23.209 1.00 26.97  ? 1060 TYR B CZ  1 
ATOM   649  O OH  . TYR B 1 13 ? 32.664 0.578  23.776 1.00 33.85  ? 1060 TYR B OH  1 
ATOM   650  N N   . ASP B 1 14 ? 31.039 8.613  21.244 1.00 19.81  ? 1061 ASP B N   1 
ATOM   651  C CA  . ASP B 1 14 ? 30.818 9.791  20.445 1.00 18.74  ? 1061 ASP B CA  1 
ATOM   652  C C   . ASP B 1 14 ? 30.524 9.425  18.991 1.00 17.89  ? 1061 ASP B C   1 
ATOM   653  O O   . ASP B 1 14 ? 31.135 8.488  18.443 1.00 18.44  ? 1061 ASP B O   1 
ATOM   654  C CB  . ASP B 1 14 ? 32.046 10.667 20.462 1.00 20.96  ? 1061 ASP B CB  1 
ATOM   655  C CG  . ASP B 1 14 ? 32.375 11.333 21.770 1.00 25.27  ? 1061 ASP B CG  1 
ATOM   656  O OD1 . ASP B 1 14 ? 31.669 11.301 22.737 1.00 26.83  ? 1061 ASP B OD1 1 
ATOM   657  O OD2 . ASP B 1 14 ? 33.485 11.957 21.796 1.00 34.39  ? 1061 ASP B OD2 1 
ATOM   658  N N   . TYR B 1 15 ? 29.658 10.161 18.346 1.00 17.29  ? 1062 TYR B N   1 
ATOM   659  C CA  . TYR B 1 15 ? 29.434 10.033 16.923 1.00 16.54  ? 1062 TYR B CA  1 
ATOM   660  C C   . TYR B 1 15 ? 29.212 11.445 16.379 1.00 16.73  ? 1062 TYR B C   1 
ATOM   661  O O   . TYR B 1 15 ? 28.399 12.210 16.867 1.00 18.02  ? 1062 TYR B O   1 
ATOM   662  C CB  . TYR B 1 15 ? 28.162 9.210  16.598 1.00 16.63  ? 1062 TYR B CB  1 
ATOM   663  C CG  . TYR B 1 15 ? 27.883 9.138  15.128 1.00 15.12  ? 1062 TYR B CG  1 
ATOM   664  C CD1 . TYR B 1 15 ? 28.693 8.376  14.284 1.00 15.17  ? 1062 TYR B CD1 1 
ATOM   665  C CD2 . TYR B 1 15 ? 26.845 9.825  14.532 1.00 16.31  ? 1062 TYR B CD2 1 
ATOM   666  C CE1 . TYR B 1 15 ? 28.486 8.291  12.956 1.00 15.32  ? 1062 TYR B CE1 1 
ATOM   667  C CE2 . TYR B 1 15 ? 26.626 9.750  13.169 1.00 15.25  ? 1062 TYR B CE2 1 
ATOM   668  C CZ  . TYR B 1 15 ? 27.486 8.990  12.370 1.00 14.83  ? 1062 TYR B CZ  1 
ATOM   669  O OH  . TYR B 1 15 ? 27.302 8.923  10.998 1.00 16.99  ? 1062 TYR B OH  1 
ATOM   670  N N   . THR B 1 16 ? 29.954 11.800 15.309 1.00 16.46  ? 1063 THR B N   1 
ATOM   671  C CA  . THR B 1 16 ? 29.802 13.059 14.605 1.00 16.31  ? 1063 THR B CA  1 
ATOM   672  C C   . THR B 1 16 ? 28.924 12.867 13.411 1.00 14.99  ? 1063 THR B C   1 
ATOM   673  O O   . THR B 1 16 ? 29.220 12.062 12.523 1.00 15.75  ? 1063 THR B O   1 
ATOM   674  C CB  . THR B 1 16 ? 31.195 13.594 14.152 1.00 18.68  ? 1063 THR B CB  1 
ATOM   675  O OG1 . THR B 1 16 ? 32.021 13.791 15.311 1.00 23.72  ? 1063 THR B OG1 1 
ATOM   676  C CG2 . THR B 1 16 ? 31.069 14.903 13.367 1.00 19.98  ? 1063 THR B CG2 1 
ATOM   677  N N   . ALA B 1 17 ? 27.839 13.640 13.311 1.00 15.88  ? 1064 ALA B N   1 
ATOM   678  C CA  . ALA B 1 17 ? 26.970 13.526 12.160 1.00 15.15  ? 1064 ALA B CA  1 
ATOM   679  C C   . ALA B 1 17 ? 27.751 13.688 10.886 1.00 15.55  ? 1064 ALA B C   1 
ATOM   680  O O   . ALA B 1 17 ? 28.583 14.604 10.729 1.00 18.14  ? 1064 ALA B O   1 
ATOM   681  C CB  . ALA B 1 17 ? 25.881 14.571 12.229 1.00 17.51  ? 1064 ALA B CB  1 
ATOM   682  N N   . ASN B 1 18 ? 27.426 12.855 9.927  1.00 15.98  ? 1065 ASN B N   1 
ATOM   683  C CA  . ASN B 1 18 ? 27.997 12.927 8.572  1.00 16.97  ? 1065 ASN B CA  1 
ATOM   684  C C   . ASN B 1 18 ? 27.002 13.077 7.480  1.00 15.02  ? 1065 ASN B C   1 
ATOM   685  O O   . ASN B 1 18 ? 27.320 12.781 6.341  1.00 16.55  ? 1065 ASN B O   1 
ATOM   686  C CB  . ASN B 1 18 ? 28.899 11.757 8.313  1.00 21.06  ? 1065 ASN B CB  1 
ATOM   687  C CG  . ASN B 1 18 ? 29.865 12.065 7.112  1.00 23.95  ? 1065 ASN B CG  1 
ATOM   688  O OD1 . ASN B 1 18 ? 30.412 13.235 7.016  1.00 29.08  ? 1065 ASN B OD1 1 
ATOM   689  N ND2 . ASN B 1 18 ? 29.972 11.156 6.192  1.00 27.32  ? 1065 ASN B ND2 1 
ATOM   690  N N   . ARG B 1 19 ? 25.807 13.520 7.815  1.00 14.42  ? 1066 ARG B N   1 
ATOM   691  C CA  . ARG B 1 19 ? 24.750 13.761 6.868  1.00 14.28  ? 1066 ARG B CA  1 
ATOM   692  C C   . ARG B 1 19 ? 23.748 14.617 7.565  1.00 13.54  ? 1066 ARG B C   1 
ATOM   693  O O   . ARG B 1 19 ? 23.645 14.588 8.792  1.00 15.18  ? 1066 ARG B O   1 
ATOM   694  C CB  . ARG B 1 19 ? 24.105 12.329 6.543  1.00 17.12  ? 1066 ARG B CB  1 
ATOM   695  C CG  . ARG B 1 19 ? 23.484 12.252 5.265  1.00 17.50  ? 1066 ARG B CG  1 
ATOM   696  C CD  . ARG B 1 19 ? 23.207 10.841 4.843  1.00 15.68  ? 1066 ARG B CD  1 
ATOM   697  N NE  . ARG B 1 19 ? 22.047 10.283 5.489  1.00 14.84  ? 1066 ARG B NE  1 
ATOM   698  C CZ  . ARG B 1 19 ? 21.583 9.048  5.157  1.00 14.35  ? 1066 ARG B CZ  1 
ATOM   699  N NH1 . ARG B 1 19 ? 22.288 8.285  4.319  1.00 16.54  ? 1066 ARG B NH1 1 
ATOM   700  N NH2 . ARG B 1 19 ? 20.457 8.622  5.590  1.00 16.30  ? 1066 ARG B NH2 1 
ATOM   701  N N   A SER B 1 20 ? 22.935 15.335 6.787  0.50 13.75  ? 1067 SER B N   1 
ATOM   702  N N   B SER B 1 20 ? 22.952 15.384 6.807  0.50 13.85  ? 1067 SER B N   1 
ATOM   703  C CA  A SER B 1 20 ? 22.063 16.334 7.365  0.50 14.52  ? 1067 SER B CA  1 
ATOM   704  C CA  B SER B 1 20 ? 22.096 16.373 7.453  0.50 14.42  ? 1067 SER B CA  1 
ATOM   705  C C   A SER B 1 20 ? 20.867 15.818 8.121  0.50 14.48  ? 1067 SER B C   1 
ATOM   706  C C   B SER B 1 20 ? 21.009 15.757 8.338  0.50 14.52  ? 1067 SER B C   1 
ATOM   707  O O   A SER B 1 20 ? 20.208 16.621 8.772  0.50 18.24  ? 1067 SER B O   1 
ATOM   708  O O   B SER B 1 20 ? 20.599 16.408 9.341  0.50 15.40  ? 1067 SER B O   1 
ATOM   709  C CB  A SER B 1 20 ? 21.596 17.275 6.268  0.50 15.42  ? 1067 SER B CB  1 
ATOM   710  C CB  B SER B 1 20 ? 21.514 17.384 6.431  0.50 15.70  ? 1067 SER B CB  1 
ATOM   711  O OG  A SER B 1 20 ? 22.559 18.213 5.963  0.50 17.43  ? 1067 SER B OG  1 
ATOM   712  O OG  B SER B 1 20 ? 20.774 16.705 5.352  0.50 18.02  ? 1067 SER B OG  1 
ATOM   713  N N   . ASP B 1 21 ? 20.569 14.525 8.033  1.00 14.33  ? 1068 ASP B N   1 
ATOM   714  C CA  . ASP B 1 21 ? 19.554 13.871 8.809  1.00 14.12  ? 1068 ASP B CA  1 
ATOM   715  C C   . ASP B 1 21 ? 20.064 13.200 10.068 1.00 13.65  ? 1068 ASP B C   1 
ATOM   716  O O   . ASP B 1 21 ? 19.308 12.558 10.778 1.00 14.69  ? 1068 ASP B O   1 
ATOM   717  C CB  . ASP B 1 21 ? 18.812 12.843 7.964  1.00 15.71  ? 1068 ASP B CB  1 
ATOM   718  C CG  . ASP B 1 21 ? 19.652 11.683 7.482  1.00 16.86  ? 1068 ASP B CG  1 
ATOM   719  O OD1 . ASP B 1 21 ? 20.888 11.806 7.471  1.00 16.04  ? 1068 ASP B OD1 1 
ATOM   720  O OD2 . ASP B 1 21 ? 19.053 10.623 7.106  1.00 16.31  ? 1068 ASP B OD2 1 
ATOM   721  N N   . GLU B 1 22 ? 21.358 13.368 10.375 1.00 13.83  ? 1069 GLU B N   1 
ATOM   722  C CA  . GLU B 1 22 ? 22.015 12.730 11.532 1.00 13.70  ? 1069 GLU B CA  1 
ATOM   723  C C   . GLU B 1 22 ? 22.148 13.634 12.712 1.00 15.11  ? 1069 GLU B C   1 
ATOM   724  O O   . GLU B 1 22 ? 22.051 14.875 12.601 1.00 16.59  ? 1069 GLU B O   1 
ATOM   725  C CB  . GLU B 1 22 ? 23.346 12.125 11.141 1.00 14.73  ? 1069 GLU B CB  1 
ATOM   726  C CG  . GLU B 1 22 ? 23.187 10.959 10.180 1.00 14.60  ? 1069 GLU B CG  1 
ATOM   727  C CD  . GLU B 1 22 ? 24.461 10.349 9.682  1.00 15.26  ? 1069 GLU B CD  1 
ATOM   728  O OE1 . GLU B 1 22 ? 25.568 10.723 10.163 1.00 16.42  ? 1069 GLU B OE1 1 
ATOM   729  O OE2 . GLU B 1 22 ? 24.354 9.461  8.772  1.00 16.54  ? 1069 GLU B OE2 1 
ATOM   730  N N   . LEU B 1 23 ? 22.348 13.031 13.873 1.00 16.69  ? 1070 LEU B N   1 
ATOM   731  C CA  . LEU B 1 23 ? 22.515 13.663 15.141 1.00 17.04  ? 1070 LEU B CA  1 
ATOM   732  C C   . LEU B 1 23 ? 23.927 13.395 15.671 1.00 16.61  ? 1070 LEU B C   1 
ATOM   733  O O   . LEU B 1 23 ? 24.320 12.229 15.813 1.00 17.44  ? 1070 LEU B O   1 
ATOM   734  C CB  . LEU B 1 23 ? 21.510 13.092 16.159 1.00 18.74  ? 1070 LEU B CB  1 
ATOM   735  C CG  . LEU B 1 23 ? 21.507 13.606 17.567 1.00 19.63  ? 1070 LEU B CG  1 
ATOM   736  C CD1 . LEU B 1 23 ? 21.152 15.105 17.589 1.00 23.22  ? 1070 LEU B CD1 1 
ATOM   737  C CD2 . LEU B 1 23 ? 20.561 12.755 18.470 1.00 22.42  ? 1070 LEU B CD2 1 
ATOM   738  N N   . THR B 1 24 ? 24.680 14.464 16.027 1.00 17.99  ? 1071 THR B N   1 
ATOM   739  C CA  . THR B 1 24 ? 25.932 14.315 16.735 1.00 17.64  ? 1071 THR B CA  1 
ATOM   740  C C   . THR B 1 24 ? 25.618 14.046 18.188 1.00 17.98  ? 1071 THR B C   1 
ATOM   741  O O   . THR B 1 24 ? 24.851 14.763 18.829 1.00 19.88  ? 1071 THR B O   1 
ATOM   742  C CB  . THR B 1 24 ? 26.777 15.561 16.586 1.00 19.17  ? 1071 THR B CB  1 
ATOM   743  O OG1 . THR B 1 24 ? 27.224 15.678 15.217 1.00 20.41  ? 1071 THR B OG1 1 
ATOM   744  C CG2 . THR B 1 24 ? 27.961 15.595 17.551 1.00 20.69  ? 1071 THR B CG2 1 
ATOM   745  N N   . ILE B 1 25 ? 26.226 12.987 18.708 1.00 17.85  ? 1072 ILE B N   1 
ATOM   746  C CA  . ILE B 1 25 ? 26.085 12.583 20.066 1.00 18.27  ? 1072 ILE B CA  1 
ATOM   747  C C   . ILE B 1 25 ? 27.473 12.502 20.735 1.00 18.45  ? 1072 ILE B C   1 
ATOM   748  O O   . ILE B 1 25 ? 28.476 12.211 20.106 1.00 20.27  ? 1072 ILE B O   1 
ATOM   749  C CB  . ILE B 1 25 ? 25.275 11.274 20.223 1.00 17.81  ? 1072 ILE B CB  1 
ATOM   750  C CG1 . ILE B 1 25 ? 25.911 10.084 19.535 1.00 19.25  ? 1072 ILE B CG1 1 
ATOM   751  C CG2 . ILE B 1 25 ? 23.795 11.480 19.746 1.00 19.05  ? 1072 ILE B CG2 1 
ATOM   752  C CD1 . ILE B 1 25 ? 25.238 8.698  19.704 1.00 19.72  ? 1072 ILE B CD1 1 
ATOM   753  N N   . HIS B 1 26 ? 27.473 12.775 22.041 1.00 20.95  ? 1073 HIS B N   1 
ATOM   754  C CA  . HIS B 1 26 ? 28.661 12.637 22.870 1.00 21.80  ? 1073 HIS B CA  1 
ATOM   755  C C   . HIS B 1 26 ? 28.382 11.698 24.014 1.00 20.88  ? 1073 HIS B C   1 
ATOM   756  O O   . HIS B 1 26 ? 27.283 11.674 24.552 1.00 20.82  ? 1073 HIS B O   1 
ATOM   757  C CB  . HIS B 1 26 ? 29.126 14.030 23.409 1.00 24.63  ? 1073 HIS B CB  1 
ATOM   758  C CG  . HIS B 1 26 ? 29.557 14.985 22.345 1.00 30.15  ? 1073 HIS B CG  1 
ATOM   759  N ND1 . HIS B 1 26 ? 30.867 15.104 21.907 1.00 40.99  ? 1073 HIS B ND1 1 
ATOM   760  C CD2 . HIS B 1 26 ? 28.832 15.835 21.586 1.00 34.95  ? 1073 HIS B CD2 1 
ATOM   761  C CE1 . HIS B 1 26 ? 30.930 16.020 20.947 1.00 39.56  ? 1073 HIS B CE1 1 
ATOM   762  N NE2 . HIS B 1 26 ? 29.709 16.494 20.745 1.00 40.71  ? 1073 HIS B NE2 1 
ATOM   763  N N   . ARG B 1 27 ? 29.403 10.999 24.451 1.00 22.61  ? 1074 ARG B N   1 
ATOM   764  C CA  . ARG B 1 27 ? 29.308 10.105 25.593 1.00 22.78  ? 1074 ARG B CA  1 
ATOM   765  C C   . ARG B 1 27 ? 28.635 10.807 26.744 1.00 23.18  ? 1074 ARG B C   1 
ATOM   766  O O   . ARG B 1 27 ? 29.011 11.899 27.162 1.00 26.12  ? 1074 ARG B O   1 
ATOM   767  C CB  . ARG B 1 27 ? 30.663 9.558  25.987 1.00 24.81  ? 1074 ARG B CB  1 
ATOM   768  C CG  . ARG B 1 27 ? 30.649 8.649  27.183 1.00 27.01  ? 1074 ARG B CG  1 
ATOM   769  C CD  . ARG B 1 27 ? 32.007 7.938  27.450 1.00 34.36  ? 1074 ARG B CD  1 
ATOM   770  N NE  . ARG B 1 27 ? 31.835 7.169  28.717 1.00 44.66  ? 1074 ARG B NE  1 
ATOM   771  C CZ  . ARG B 1 27 ? 32.547 6.099  29.143 1.00 52.58  ? 1074 ARG B CZ  1 
ATOM   772  N NH1 . ARG B 1 27 ? 33.505 5.522  28.417 1.00 58.80  ? 1074 ARG B NH1 1 
ATOM   773  N NH2 . ARG B 1 27 ? 32.248 5.566  30.322 1.00 56.47  ? 1074 ARG B NH2 1 
ATOM   774  N N   . GLY B 1 28 ? 27.619 10.140 27.285 1.00 21.77  ? 1075 GLY B N   1 
ATOM   775  C CA  . GLY B 1 28 ? 26.814 10.621 28.396 1.00 22.59  ? 1075 GLY B CA  1 
ATOM   776  C C   . GLY B 1 28 ? 25.549 11.294 28.022 1.00 21.89  ? 1075 GLY B C   1 
ATOM   777  O O   . GLY B 1 28 ? 24.702 11.517 28.885 1.00 24.68  ? 1075 GLY B O   1 
ATOM   778  N N   . ASP B 1 29 ? 25.372 11.646 26.723 1.00 21.48  ? 1076 ASP B N   1 
ATOM   779  C CA  . ASP B 1 29 ? 24.125 12.251 26.323 1.00 20.86  ? 1076 ASP B CA  1 
ATOM   780  C C   . ASP B 1 29 ? 22.938 11.280 26.526 1.00 20.38  ? 1076 ASP B C   1 
ATOM   781  O O   . ASP B 1 29 ? 23.041 10.118 26.115 1.00 21.16  ? 1076 ASP B O   1 
ATOM   782  C CB  . ASP B 1 29 ? 24.132 12.619 24.841 1.00 22.22  ? 1076 ASP B CB  1 
ATOM   783  C CG  . ASP B 1 29 ? 24.982 13.848 24.481 1.00 23.92  ? 1076 ASP B CG  1 
ATOM   784  O OD1 . ASP B 1 29 ? 25.337 14.640 25.374 1.00 30.69  ? 1076 ASP B OD1 1 
ATOM   785  O OD2 . ASP B 1 29 ? 25.205 14.025 23.236 1.00 26.36  ? 1076 ASP B OD2 1 
ATOM   786  N N   . ILE B 1 30 ? 21.845 11.768 27.094 1.00 22.16  ? 1077 ILE B N   1 
ATOM   787  C CA  . ILE B 1 30 ? 20.604 11.057 27.259 1.00 21.63  ? 1077 ILE B CA  1 
ATOM   788  C C   . ILE B 1 30 ? 19.761 11.267 26.030 1.00 21.26  ? 1077 ILE B C   1 
ATOM   789  O O   . ILE B 1 30 ? 19.475 12.406 25.641 1.00 23.74  ? 1077 ILE B O   1 
ATOM   790  C CB  . ILE B 1 30 ? 19.874 11.445 28.548 1.00 23.63  ? 1077 ILE B CB  1 
ATOM   791  C CG1 . ILE B 1 30 ? 20.781 11.265 29.761 1.00 29.31  ? 1077 ILE B CG1 1 
ATOM   792  C CG2 . ILE B 1 30 ? 18.543 10.693 28.605 1.00 24.84  ? 1077 ILE B CG2 1 
ATOM   793  C CD1 . ILE B 1 30 ? 20.155 11.729 31.005 1.00 35.00  ? 1077 ILE B CD1 1 
ATOM   794  N N   . ILE B 1 31 ? 19.437 10.170 25.362 1.00 19.92  ? 1078 ILE B N   1 
ATOM   795  C CA  . ILE B 1 31 ? 18.750 10.162 24.080 1.00 19.15  ? 1078 ILE B CA  1 
ATOM   796  C C   . ILE B 1 31 ? 17.349 9.590  24.265 1.00 19.22  ? 1078 ILE B C   1 
ATOM   797  O O   . ILE B 1 31 ? 17.184 8.433  24.716 1.00 22.20  ? 1078 ILE B O   1 
ATOM   798  C CB  . ILE B 1 31 ? 19.506 9.342  23.014 1.00 18.84  ? 1078 ILE B CB  1 
ATOM   799  C CG1 . ILE B 1 31 ? 20.951 9.834  22.803 1.00 20.27  ? 1078 ILE B CG1 1 
ATOM   800  C CG2 . ILE B 1 31 ? 18.662 9.281  21.709 1.00 21.82  ? 1078 ILE B CG2 1 
ATOM   801  C CD1 . ILE B 1 31 ? 21.881 8.816  22.128 1.00 22.71  ? 1078 ILE B CD1 1 
ATOM   802  N N   . ARG B 1 32 ? 16.342 10.356 23.894 1.00 21.30  ? 1079 ARG B N   1 
ATOM   803  C CA  . ARG B 1 32 ? 15.001 9.876  23.766 1.00 22.81  ? 1079 ARG B CA  1 
ATOM   804  C C   . ARG B 1 32 ? 14.788 9.295  22.366 1.00 20.60  ? 1079 ARG B C   1 
ATOM   805  O O   . ARG B 1 32 ? 14.931 9.995  21.395 1.00 22.34  ? 1079 ARG B O   1 
ATOM   806  C CB  . ARG B 1 32 ? 13.933 10.990 24.017 1.00 24.29  ? 1079 ARG B CB  1 
ATOM   807  C CG  . ARG B 1 32 ? 12.583 10.398 23.897 1.00 33.78  ? 1079 ARG B CG  1 
ATOM   808  N N   . VAL B 1 33 ? 14.572 7.992  22.290 1.00 21.28  ? 1080 VAL B N   1 
ATOM   809  C CA  . VAL B 1 33 ? 14.453 7.276  21.021 1.00 20.04  ? 1080 VAL B CA  1 
ATOM   810  C C   . VAL B 1 33 ? 13.025 7.435  20.498 1.00 21.95  ? 1080 VAL B C   1 
ATOM   811  O O   . VAL B 1 33 ? 12.071 7.048  21.179 1.00 26.68  ? 1080 VAL B O   1 
ATOM   812  C CB  . VAL B 1 33 ? 14.839 5.791  21.131 1.00 21.13  ? 1080 VAL B CB  1 
ATOM   813  C CG1 . VAL B 1 33 ? 14.717 5.093  19.787 1.00 22.59  ? 1080 VAL B CG1 1 
ATOM   814  C CG2 . VAL B 1 33 ? 16.250 5.668  21.715 1.00 21.96  ? 1080 VAL B CG2 1 
ATOM   815  N N   . PHE B 1 34 ? 12.904 8.012  19.321 1.00 20.29  ? 1081 PHE B N   1 
ATOM   816  C CA  . PHE B 1 34 ? 11.613 8.174  18.652 1.00 20.88  ? 1081 PHE B CA  1 
ATOM   817  C C   . PHE B 1 34 ? 11.183 6.902  17.943 1.00 21.64  ? 1081 PHE B C   1 
ATOM   818  O O   . PHE B 1 34 ? 10.013 6.437  18.037 1.00 25.99  ? 1081 PHE B O   1 
ATOM   819  C CB  . PHE B 1 34 ? 11.629 9.297  17.654 1.00 22.06  ? 1081 PHE B CB  1 
ATOM   820  C CG  . PHE B 1 34 ? 11.761 10.677 18.202 1.00 22.66  ? 1081 PHE B CG  1 
ATOM   821  C CD1 . PHE B 1 34 ? 12.007 10.952 19.519 1.00 24.68  ? 1081 PHE B CD1 1 
ATOM   822  C CD2 . PHE B 1 34 ? 11.797 11.731 17.308 1.00 23.50  ? 1081 PHE B CD2 1 
ATOM   823  C CE1 . PHE B 1 34 ? 12.168 12.282 19.940 1.00 29.28  ? 1081 PHE B CE1 1 
ATOM   824  C CE2 . PHE B 1 34 ? 11.907 12.990 17.717 1.00 26.73  ? 1081 PHE B CE2 1 
ATOM   825  C CZ  . PHE B 1 34 ? 12.158 13.261 19.026 1.00 28.75  ? 1081 PHE B CZ  1 
ATOM   826  N N   . PHE B 1 35 ? 12.136 6.308  17.204 1.00 21.06  ? 1082 PHE B N   1 
ATOM   827  C CA  . PHE B 1 35 ? 11.934 5.045  16.558 1.00 21.19  ? 1082 PHE B CA  1 
ATOM   828  C C   . PHE B 1 35 ? 13.245 4.358  16.242 1.00 18.96  ? 1082 PHE B C   1 
ATOM   829  O O   . PHE B 1 35 ? 14.263 5.031  16.119 1.00 19.09  ? 1082 PHE B O   1 
ATOM   830  C CB  . PHE B 1 35 ? 11.084 5.160  15.268 1.00 23.02  ? 1082 PHE B CB  1 
ATOM   831  C CG  . PHE B 1 35 ? 11.625 6.047  14.191 1.00 21.98  ? 1082 PHE B CG  1 
ATOM   832  C CD1 . PHE B 1 35 ? 12.431 5.556  13.172 1.00 21.89  ? 1082 PHE B CD1 1 
ATOM   833  C CD2 . PHE B 1 35 ? 11.287 7.352  14.141 1.00 23.71  ? 1082 PHE B CD2 1 
ATOM   834  C CE1 . PHE B 1 35 ? 12.923 6.396  12.176 1.00 23.27  ? 1082 PHE B CE1 1 
ATOM   835  C CE2 . PHE B 1 35 ? 11.796 8.247  13.165 1.00 22.72  ? 1082 PHE B CE2 1 
ATOM   836  C CZ  . PHE B 1 35 ? 12.581 7.764  12.192 1.00 22.64  ? 1082 PHE B CZ  1 
ATOM   837  N N   . LYS B 1 36 ? 13.183 3.066  16.102 1.00 19.78  ? 1083 LYS B N   1 
ATOM   838  C CA  . LYS B 1 36 ? 14.309 2.248  15.643 1.00 19.55  ? 1083 LYS B CA  1 
ATOM   839  C C   . LYS B 1 36 ? 14.022 1.924  14.181 1.00 19.96  ? 1083 LYS B C   1 
ATOM   840  O O   . LYS B 1 36 ? 13.065 1.263  13.831 1.00 24.18  ? 1083 LYS B O   1 
ATOM   841  C CB  . LYS B 1 36 ? 14.399 0.980  16.474 1.00 18.60  ? 1083 LYS B CB  1 
ATOM   842  C CG  . LYS B 1 36 ? 14.615 1.268  17.922 1.00 19.21  ? 1083 LYS B CG  1 
ATOM   843  C CD  . LYS B 1 36 ? 14.745 0.004  18.782 1.00 20.03  ? 1083 LYS B CD  1 
ATOM   844  C CE  . LYS B 1 36 ? 15.005 0.280  20.230 1.00 23.33  ? 1083 LYS B CE  1 
ATOM   845  N NZ  . LYS B 1 36 ? 15.083 -0.890 21.133 1.00 28.64  ? 1083 LYS B NZ  1 
ATOM   846  N N   . ASP B 1 37 ? 14.824 2.479  13.279 1.00 19.18  ? 1084 ASP B N   1 
ATOM   847  C CA  . ASP B 1 37 ? 14.594 2.314  11.850 1.00 18.66  ? 1084 ASP B CA  1 
ATOM   848  C C   . ASP B 1 37 ? 14.937 0.906  11.403 1.00 18.95  ? 1084 ASP B C   1 
ATOM   849  O O   . ASP B 1 37 ? 14.168 0.261  10.634 1.00 22.49  ? 1084 ASP B O   1 
ATOM   850  C CB  . ASP B 1 37 ? 15.347 3.359  11.066 1.00 19.63  ? 1084 ASP B CB  1 
ATOM   851  C CG  . ASP B 1 37 ? 14.894 3.546  9.656  1.00 19.29  ? 1084 ASP B CG  1 
ATOM   852  O OD1 . ASP B 1 37 ? 13.699 3.338  9.411  1.00 27.92  ? 1084 ASP B OD1 1 
ATOM   853  O OD2 . ASP B 1 37 ? 15.528 4.173  8.892  1.00 24.80  ? 1084 ASP B OD2 1 
ATOM   854  N N   . ASN B 1 38 ? 16.064 0.415  11.883 1.00 18.69  ? 1085 ASN B N   1 
ATOM   855  C CA  . ASN B 1 38 ? 16.544 -0.884 11.567 1.00 19.66  ? 1085 ASN B CA  1 
ATOM   856  C C   . ASN B 1 38 ? 17.530 -1.275 12.619 1.00 20.63  ? 1085 ASN B C   1 
ATOM   857  O O   . ASN B 1 38 ? 17.663 -0.567 13.639 1.00 22.04  ? 1085 ASN B O   1 
ATOM   858  C CB  . ASN B 1 38 ? 17.046 -0.921 10.105 1.00 19.44  ? 1085 ASN B CB  1 
ATOM   859  C CG  . ASN B 1 38 ? 18.136 0.053  9.820  1.00 16.70  ? 1085 ASN B CG  1 
ATOM   860  O OD1 . ASN B 1 38 ? 19.033 0.236  10.649 1.00 17.85  ? 1085 ASN B OD1 1 
ATOM   861  N ND2 . ASN B 1 38 ? 18.049 0.712  8.662  1.00 19.23  ? 1085 ASN B ND2 1 
ATOM   862  N N   . GLU B 1 39 ? 18.301 -2.356 12.394 1.00 22.42  ? 1086 GLU B N   1 
ATOM   863  C CA  A GLU B 1 39 ? 19.325 -2.804 13.350 0.50 22.47  ? 1086 GLU B CA  1 
ATOM   864  C CA  B GLU B 1 39 ? 19.259 -2.819 13.302 0.50 23.16  ? 1086 GLU B CA  1 
ATOM   865  C C   . GLU B 1 39 ? 20.398 -1.797 13.589 1.00 21.01  ? 1086 GLU B C   1 
ATOM   866  O O   . GLU B 1 39 ? 21.027 -1.769 14.666 1.00 24.73  ? 1086 GLU B O   1 
ATOM   867  C CB  A GLU B 1 39 ? 20.118 -4.176 13.019 0.50 22.49  ? 1086 GLU B CB  1 
ATOM   868  C CB  B GLU B 1 39 ? 19.796 -4.210 12.757 0.50 24.43  ? 1086 GLU B CB  1 
ATOM   869  C CG  A GLU B 1 39 ? 19.311 -5.435 12.687 0.50 29.35  ? 1086 GLU B CG  1 
ATOM   870  C CG  B GLU B 1 39 ? 18.666 -5.209 12.093 0.50 31.30  ? 1086 GLU B CG  1 
ATOM   871  C CD  A GLU B 1 39 ? 18.892 -5.550 11.188 0.50 33.22  ? 1086 GLU B CD  1 
ATOM   872  C CD  B GLU B 1 39 ? 17.743 -5.799 13.164 0.50 34.38  ? 1086 GLU B CD  1 
ATOM   873  O OE1 A GLU B 1 39 ? 18.538 -4.441 10.601 0.50 34.08  ? 1086 GLU B OE1 1 
ATOM   874  O OE1 B GLU B 1 39 ? 18.126 -5.702 14.357 0.50 36.94  ? 1086 GLU B OE1 1 
ATOM   875  O OE2 A GLU B 1 39 ? 18.852 -6.739 10.630 0.50 36.13  ? 1086 GLU B OE2 1 
ATOM   876  O OE2 B GLU B 1 39 ? 16.662 -6.374 12.869 0.50 38.62  ? 1086 GLU B OE2 1 
ATOM   877  N N   . ASP B 1 40 ? 20.710 -0.971 12.614 1.00 17.29  ? 1087 ASP B N   1 
ATOM   878  C CA  . ASP B 1 40 ? 21.879 -0.116 12.661 1.00 15.68  ? 1087 ASP B CA  1 
ATOM   879  C C   . ASP B 1 40 ? 21.595 1.330  13.060 1.00 14.51  ? 1087 ASP B C   1 
ATOM   880  O O   . ASP B 1 40 ? 22.440 1.959  13.663 1.00 15.59  ? 1087 ASP B O   1 
ATOM   881  C CB  . ASP B 1 40 ? 22.574 -0.115 11.312 1.00 16.67  ? 1087 ASP B CB  1 
ATOM   882  C CG  . ASP B 1 40 ? 22.771 -1.512 10.787 1.00 16.83  ? 1087 ASP B CG  1 
ATOM   883  O OD1 . ASP B 1 40 ? 23.383 -2.386 11.470 1.00 18.59  ? 1087 ASP B OD1 1 
ATOM   884  O OD2 . ASP B 1 40 ? 22.274 -1.814 9.660  1.00 17.70  ? 1087 ASP B OD2 1 
ATOM   885  N N   . TRP B 1 41 ? 20.406 1.826  12.681 1.00 14.30  ? 1088 TRP B N   1 
ATOM   886  C CA  . TRP B 1 41 ? 20.115 3.244  12.791 1.00 14.66  ? 1088 TRP B CA  1 
ATOM   887  C C   . TRP B 1 41 ? 18.828 3.460  13.556 1.00 15.11  ? 1088 TRP B C   1 
ATOM   888  O O   . TRP B 1 41 ? 17.770 2.926  13.176 1.00 16.34  ? 1088 TRP B O   1 
ATOM   889  C CB  . TRP B 1 41 ? 19.968 3.848  11.384 1.00 14.77  ? 1088 TRP B CB  1 
ATOM   890  C CG  . TRP B 1 41 ? 21.288 3.955  10.675 1.00 14.11  ? 1088 TRP B CG  1 
ATOM   891  C CD1 . TRP B 1 41 ? 21.774 3.104  9.736  1.00 16.08  ? 1088 TRP B CD1 1 
ATOM   892  C CD2 . TRP B 1 41 ? 22.300 4.931  10.951 1.00 14.14  ? 1088 TRP B CD2 1 
ATOM   893  N NE1 . TRP B 1 41 ? 23.069 3.491  9.426  1.00 17.63  ? 1088 TRP B NE1 1 
ATOM   894  C CE2 . TRP B 1 41 ? 23.384 4.634  10.131 1.00 15.45  ? 1088 TRP B CE2 1 
ATOM   895  C CE3 . TRP B 1 41 ? 22.387 6.064  11.763 1.00 15.75  ? 1088 TRP B CE3 1 
ATOM   896  C CZ2 . TRP B 1 41 ? 24.539 5.410  10.148 1.00 18.25  ? 1088 TRP B CZ2 1 
ATOM   897  C CZ3 . TRP B 1 41 ? 23.474 6.848  11.727 1.00 18.61  ? 1088 TRP B CZ3 1 
ATOM   898  C CH2 . TRP B 1 41 ? 24.550 6.525  10.923 1.00 19.35  ? 1088 TRP B CH2 1 
ATOM   899  N N   . TRP B 1 42 ? 18.918 4.301  14.592 1.00 14.85  ? 1089 TRP B N   1 
ATOM   900  C CA  . TRP B 1 42 ? 17.775 4.731  15.348 1.00 14.93  ? 1089 TRP B CA  1 
ATOM   901  C C   . TRP B 1 42 ? 17.656 6.233  15.181 1.00 14.50  ? 1089 TRP B C   1 
ATOM   902  O O   . TRP B 1 42 ? 18.583 6.897  14.714 1.00 15.88  ? 1089 TRP B O   1 
ATOM   903  C CB  . TRP B 1 42 ? 17.906 4.351  16.836 1.00 15.98  ? 1089 TRP B CB  1 
ATOM   904  C CG  . TRP B 1 42 ? 18.029 2.880  17.134 1.00 15.31  ? 1089 TRP B CG  1 
ATOM   905  C CD1 . TRP B 1 42 ? 17.938 1.819  16.248 1.00 15.99  ? 1089 TRP B CD1 1 
ATOM   906  C CD2 . TRP B 1 42 ? 18.243 2.339  18.430 1.00 16.14  ? 1089 TRP B CD2 1 
ATOM   907  N NE1 . TRP B 1 42 ? 18.081 0.631  16.969 1.00 17.03  ? 1089 TRP B NE1 1 
ATOM   908  C CE2 . TRP B 1 42 ? 18.267 0.912  18.294 1.00 16.87  ? 1089 TRP B CE2 1 
ATOM   909  C CE3 . TRP B 1 42 ? 18.365 2.896  19.691 1.00 18.16  ? 1089 TRP B CE3 1 
ATOM   910  C CZ2 . TRP B 1 42 ? 18.510 0.084  19.377 1.00 18.70  ? 1089 TRP B CZ2 1 
ATOM   911  C CZ3 . TRP B 1 42 ? 18.636 2.059  20.765 1.00 20.27  ? 1089 TRP B CZ3 1 
ATOM   912  C CH2 . TRP B 1 42 ? 18.670 0.657  20.592 1.00 21.95  ? 1089 TRP B CH2 1 
ATOM   913  N N   . TYR B 1 43 ? 16.525 6.780  15.572 1.00 16.08  ? 1090 TYR B N   1 
ATOM   914  C CA  . TYR B 1 43 ? 16.258 8.193  15.448 1.00 16.50  ? 1090 TYR B CA  1 
ATOM   915  C C   . TYR B 1 43 ? 15.787 8.713  16.797 1.00 16.65  ? 1090 TYR B C   1 
ATOM   916  O O   . TYR B 1 43 ? 14.905 8.103  17.396 1.00 18.32  ? 1090 TYR B O   1 
ATOM   917  C CB  . TYR B 1 43 ? 15.170 8.454  14.373 1.00 17.02  ? 1090 TYR B CB  1 
ATOM   918  C CG  . TYR B 1 43 ? 14.958 9.890  14.018 1.00 17.50  ? 1090 TYR B CG  1 
ATOM   919  C CD1 . TYR B 1 43 ? 14.230 10.766 14.810 1.00 19.47  ? 1090 TYR B CD1 1 
ATOM   920  C CD2 . TYR B 1 43 ? 15.556 10.411 12.846 1.00 18.33  ? 1090 TYR B CD2 1 
ATOM   921  C CE1 . TYR B 1 43 ? 14.057 12.060 14.485 1.00 21.42  ? 1090 TYR B CE1 1 
ATOM   922  C CE2 . TYR B 1 43 ? 15.397 11.774 12.529 1.00 19.61  ? 1090 TYR B CE2 1 
ATOM   923  C CZ  . TYR B 1 43 ? 14.636 12.604 13.340 1.00 22.53  ? 1090 TYR B CZ  1 
ATOM   924  O OH  . TYR B 1 43 ? 14.486 13.919 12.998 1.00 28.02  ? 1090 TYR B OH  1 
ATOM   925  N N   . GLY B 1 44 ? 16.300 9.831  17.237 1.00 16.98  ? 1091 GLY B N   1 
ATOM   926  C CA  . GLY B 1 44 ? 15.882 10.416 18.500 1.00 18.52  ? 1091 GLY B CA  1 
ATOM   927  C C   . GLY B 1 44 ? 16.449 11.747 18.788 1.00 18.72  ? 1091 GLY B C   1 
ATOM   928  O O   . GLY B 1 44 ? 17.001 12.386 17.907 1.00 18.35  ? 1091 GLY B O   1 
ATOM   929  N N   . SER B 1 45 ? 16.262 12.171 20.029 1.00 20.35  ? 1092 SER B N   1 
ATOM   930  C CA  . SER B 1 45 ? 16.555 13.508 20.442 1.00 20.96  ? 1092 SER B CA  1 
ATOM   931  C C   . SER B 1 45 ? 17.389 13.582 21.691 1.00 20.61  ? 1092 SER B C   1 
ATOM   932  O O   . SER B 1 45 ? 17.224 12.731 22.608 1.00 23.12  ? 1092 SER B O   1 
ATOM   933  C CB  . SER B 1 45 ? 15.251 14.235 20.744 1.00 25.28  ? 1092 SER B CB  1 
ATOM   934  O OG  . SER B 1 45 ? 15.358 15.538 21.179 1.00 32.60  ? 1092 SER B OG  1 
ATOM   935  N N   . ILE B 1 46 ? 18.240 14.572 21.784 1.00 21.60  ? 1093 ILE B N   1 
ATOM   936  C CA  . ILE B 1 46 ? 18.981 14.899 22.992 1.00 23.02  ? 1093 ILE B CA  1 
ATOM   937  C C   . ILE B 1 46 ? 18.507 16.157 23.655 1.00 26.27  ? 1093 ILE B C   1 
ATOM   938  O O   . ILE B 1 46 ? 19.063 16.605 24.649 1.00 29.95  ? 1093 ILE B O   1 
ATOM   939  C CB  . ILE B 1 46 ? 20.500 14.860 22.800 1.00 23.01  ? 1093 ILE B CB  1 
ATOM   940  C CG1 . ILE B 1 46 ? 20.942 15.918 21.761 1.00 24.23  ? 1093 ILE B CG1 1 
ATOM   941  C CG2 . ILE B 1 46 ? 20.969 13.405 22.474 1.00 25.55  ? 1093 ILE B CG2 1 
ATOM   942  C CD1 . ILE B 1 46 ? 22.470 15.944 21.485 1.00 27.51  ? 1093 ILE B CD1 1 
ATOM   943  N N   . GLY B 1 47 ? 17.434 16.711 23.173 1.00 27.77  ? 1094 GLY B N   1 
ATOM   944  C CA  . GLY B 1 47 ? 16.774 17.849 23.786 1.00 31.07  ? 1094 GLY B CA  1 
ATOM   945  C C   . GLY B 1 47 ? 16.970 19.039 22.979 1.00 31.47  ? 1094 GLY B C   1 
ATOM   946  O O   . GLY B 1 47 ? 17.826 19.046 22.099 1.00 34.93  ? 1094 GLY B O   1 
ATOM   947  N N   . LYS B 1 48 ? 16.267 20.115 23.383 1.00 33.97  ? 1095 LYS B N   1 
ATOM   948  C CA  . LYS B 1 48 ? 16.478 21.355 22.766 1.00 37.57  ? 1095 LYS B CA  1 
ATOM   949  C C   . LYS B 1 48 ? 16.303 21.315 21.279 1.00 34.17  ? 1095 LYS B C   1 
ATOM   950  O O   . LYS B 1 48 ? 17.076 21.917 20.626 1.00 37.84  ? 1095 LYS B O   1 
ATOM   951  C CB  . LYS B 1 48 ? 17.954 21.852 23.039 1.00 38.18  ? 1095 LYS B CB  1 
ATOM   952  N N   . GLY B 1 49 ? 15.356 20.541 20.754 1.00 35.42  ? 1096 GLY B N   1 
ATOM   953  C CA  . GLY B 1 49 ? 15.175 20.515 19.367 1.00 34.07  ? 1096 GLY B CA  1 
ATOM   954  C C   . GLY B 1 49 ? 16.223 19.750 18.566 1.00 32.98  ? 1096 GLY B C   1 
ATOM   955  O O   . GLY B 1 49 ? 16.027 19.650 17.365 1.00 38.34  ? 1096 GLY B O   1 
ATOM   956  N N   . GLN B 1 50 ? 17.240 19.135 19.190 1.00 28.65  ? 1097 GLN B N   1 
ATOM   957  C CA  . GLN B 1 50 ? 18.372 18.445 18.510 1.00 24.87  ? 1097 GLN B CA  1 
ATOM   958  C C   . GLN B 1 50 ? 18.021 16.993 18.361 1.00 20.84  ? 1097 GLN B C   1 
ATOM   959  O O   . GLN B 1 50 ? 17.932 16.241 19.355 1.00 23.71  ? 1097 GLN B O   1 
ATOM   960  C CB  . GLN B 1 50 ? 19.628 18.509 19.367 1.00 26.48  ? 1097 GLN B CB  1 
ATOM   961  C CG  . GLN B 1 50 ? 20.108 19.890 19.642 1.00 31.87  ? 1097 GLN B CG  1 
ATOM   962  C CD  . GLN B 1 50 ? 21.314 19.718 20.458 1.00 42.86  ? 1097 GLN B CD  1 
ATOM   963  O OE1 . GLN B 1 50 ? 21.198 19.716 21.721 1.00 46.57  ? 1097 GLN B OE1 1 
ATOM   964  N NE2 . GLN B 1 50 ? 22.479 19.404 19.787 1.00 43.26  ? 1097 GLN B NE2 1 
ATOM   965  N N   . GLU B 1 51 ? 17.803 16.615 17.138 1.00 19.59  ? 1098 GLU B N   1 
ATOM   966  C CA  . GLU B 1 51 ? 17.342 15.296 16.830 1.00 18.20  ? 1098 GLU B CA  1 
ATOM   967  C C   . GLU B 1 51 ? 17.868 14.810 15.510 1.00 16.60  ? 1098 GLU B C   1 
ATOM   968  O O   . GLU B 1 51 ? 18.314 15.576 14.662 1.00 16.67  ? 1098 GLU B O   1 
ATOM   969  C CB  . GLU B 1 51 ? 15.827 15.181 16.829 1.00 20.80  ? 1098 GLU B CB  1 
ATOM   970  C CG  . GLU B 1 51 ? 15.119 16.016 15.762 1.00 23.62  ? 1098 GLU B CG  1 
ATOM   971  C CD  . GLU B 1 51 ? 13.621 15.847 15.766 1.00 25.55  ? 1098 GLU B CD  1 
ATOM   972  O OE1 . GLU B 1 51 ? 13.008 16.258 16.797 1.00 29.47  ? 1098 GLU B OE1 1 
ATOM   973  O OE2 . GLU B 1 51 ? 13.082 15.301 14.782 1.00 26.81  ? 1098 GLU B OE2 1 
ATOM   974  N N   . GLY B 1 52 ? 17.849 13.502 15.306 1.00 16.78  ? 1099 GLY B N   1 
ATOM   975  C CA  . GLY B 1 52 ? 18.303 12.926 14.078 1.00 16.75  ? 1099 GLY B CA  1 
ATOM   976  C C   . GLY B 1 52 ? 18.568 11.438 14.211 1.00 15.60  ? 1099 GLY B C   1 
ATOM   977  O O   . GLY B 1 52 ? 18.416 10.842 15.276 1.00 16.72  ? 1099 GLY B O   1 
ATOM   978  N N   . TYR B 1 53 ? 19.091 10.881 13.113 1.00 15.13  ? 1100 TYR B N   1 
ATOM   979  C CA  . TYR B 1 53 ? 19.561 9.507  13.084 1.00 14.91  ? 1100 TYR B CA  1 
ATOM   980  C C   . TYR B 1 53 ? 20.923 9.387  13.783 1.00 13.76  ? 1100 TYR B C   1 
ATOM   981  O O   . TYR B 1 53 ? 21.808 10.233 13.608 1.00 15.27  ? 1100 TYR B O   1 
ATOM   982  C CB  . TYR B 1 53 ? 19.695 9.043  11.645 1.00 14.93  ? 1100 TYR B CB  1 
ATOM   983  C CG  . TYR B 1 53 ? 18.418 8.625  10.996 1.00 14.96  ? 1100 TYR B CG  1 
ATOM   984  C CD1 . TYR B 1 53 ? 17.784 7.448  11.392 1.00 17.22  ? 1100 TYR B CD1 1 
ATOM   985  C CD2 . TYR B 1 53 ? 17.833 9.378  9.963  1.00 16.33  ? 1100 TYR B CD2 1 
ATOM   986  C CE1 . TYR B 1 53 ? 16.639 7.020  10.767 1.00 18.34  ? 1100 TYR B CE1 1 
ATOM   987  C CE2 . TYR B 1 53 ? 16.683 8.968  9.335  1.00 17.53  ? 1100 TYR B CE2 1 
ATOM   988  C CZ  . TYR B 1 53 ? 16.079 7.790  9.743  1.00 18.86  ? 1100 TYR B CZ  1 
ATOM   989  O OH  . TYR B 1 53 ? 14.910 7.280  9.157  1.00 20.68  ? 1100 TYR B OH  1 
ATOM   990  N N   . PHE B 1 54 ? 21.103 8.286  14.518 1.00 15.19  ? 1101 PHE B N   1 
ATOM   991  C CA  . PHE B 1 54 ? 22.363 7.978  15.136 1.00 14.59  ? 1101 PHE B CA  1 
ATOM   992  C C   . PHE B 1 54 ? 22.565 6.470  15.126 1.00 14.05  ? 1101 PHE B C   1 
ATOM   993  O O   . PHE B 1 54 ? 21.574 5.702  15.046 1.00 14.07  ? 1101 PHE B O   1 
ATOM   994  C CB  . PHE B 1 54 ? 22.416 8.515  16.604 1.00 16.12  ? 1101 PHE B CB  1 
ATOM   995  C CG  . PHE B 1 54 ? 21.379 7.914  17.516 1.00 16.39  ? 1101 PHE B CG  1 
ATOM   996  C CD1 . PHE B 1 54 ? 20.089 8.495  17.589 1.00 18.72  ? 1101 PHE B CD1 1 
ATOM   997  C CD2 . PHE B 1 54 ? 21.612 6.737  18.215 1.00 15.82  ? 1101 PHE B CD2 1 
ATOM   998  C CE1 . PHE B 1 54 ? 19.118 7.923  18.384 1.00 18.67  ? 1101 PHE B CE1 1 
ATOM   999  C CE2 . PHE B 1 54 ? 20.654 6.168  18.950 1.00 18.12  ? 1101 PHE B CE2 1 
ATOM   1000 C CZ  . PHE B 1 54 ? 19.412 6.743  19.049 1.00 18.40  ? 1101 PHE B CZ  1 
ATOM   1001 N N   . PRO B 1 55 ? 23.829 6.042  15.196 1.00 13.70  ? 1102 PRO B N   1 
ATOM   1002 C CA  . PRO B 1 55 ? 24.058 4.588  15.112 1.00 13.39  ? 1102 PRO B CA  1 
ATOM   1003 C C   . PRO B 1 55 ? 23.721 3.906  16.453 1.00 13.84  ? 1102 PRO B C   1 
ATOM   1004 O O   . PRO B 1 55 ? 24.223 4.297  17.522 1.00 14.61  ? 1102 PRO B O   1 
ATOM   1005 C CB  . PRO B 1 55 ? 25.568 4.497  14.824 1.00 15.52  ? 1102 PRO B CB  1 
ATOM   1006 C CG  . PRO B 1 55 ? 26.096 5.815  15.248 1.00 17.70  ? 1102 PRO B CG  1 
ATOM   1007 C CD  . PRO B 1 55 ? 25.050 6.816  15.141 1.00 15.19  ? 1102 PRO B CD  1 
ATOM   1008 N N   . ALA B 1 56 ? 22.902 2.850  16.390 1.00 14.14  ? 1103 ALA B N   1 
ATOM   1009 C CA  . ALA B 1 56 ? 22.493 2.113  17.556 1.00 13.91  ? 1103 ALA B CA  1 
ATOM   1010 C C   . ALA B 1 56 ? 23.660 1.533  18.312 1.00 13.84  ? 1103 ALA B C   1 
ATOM   1011 O O   . ALA B 1 56 ? 23.619 1.472  19.548 1.00 15.22  ? 1103 ALA B O   1 
ATOM   1012 C CB  . ALA B 1 56 ? 21.525 1.007  17.164 1.00 16.47  ? 1103 ALA B CB  1 
ATOM   1013 N N   . ASN B 1 57 ? 24.729 1.161  17.615 1.00 13.62  ? 1104 ASN B N   1 
ATOM   1014 C CA  . ASN B 1 57 ? 25.870 0.549  18.269 1.00 13.44  ? 1104 ASN B CA  1 
ATOM   1015 C C   . ASN B 1 57 ? 26.686 1.515  19.117 1.00 13.98  ? 1104 ASN B C   1 
ATOM   1016 O O   . ASN B 1 57 ? 27.614 1.082  19.780 1.00 14.73  ? 1104 ASN B O   1 
ATOM   1017 C CB  . ASN B 1 57 ? 26.725 -0.255 17.317 1.00 13.45  ? 1104 ASN B CB  1 
ATOM   1018 C CG  . ASN B 1 57 ? 27.503 0.573  16.319 1.00 14.45  ? 1104 ASN B CG  1 
ATOM   1019 O OD1 . ASN B 1 57 ? 27.474 1.836  16.358 1.00 15.59  ? 1104 ASN B OD1 1 
ATOM   1020 N ND2 . ASN B 1 57 ? 28.216 -0.071 15.414 1.00 16.65  ? 1104 ASN B ND2 1 
ATOM   1021 N N   . HIS B 1 58 ? 26.307 2.815  19.139 1.00 13.65  ? 1105 HIS B N   1 
ATOM   1022 C CA  . HIS B 1 58 ? 26.947 3.764  19.995 1.00 13.65  ? 1105 HIS B CA  1 
ATOM   1023 C C   . HIS B 1 58 ? 26.242 4.030  21.289 1.00 15.50  ? 1105 HIS B C   1 
ATOM   1024 O O   . HIS B 1 58 ? 26.702 4.842  22.094 1.00 16.10  ? 1105 HIS B O   1 
ATOM   1025 C CB  . HIS B 1 58 ? 27.137 5.094  19.278 1.00 14.68  ? 1105 HIS B CB  1 
ATOM   1026 C CG  . HIS B 1 58 ? 28.225 5.096  18.273 1.00 14.81  ? 1105 HIS B CG  1 
ATOM   1027 N ND1 . HIS B 1 58 ? 28.370 4.136  17.273 1.00 15.94  ? 1105 HIS B ND1 1 
ATOM   1028 C CD2 . HIS B 1 58 ? 29.216 6.034  18.083 1.00 16.04  ? 1105 HIS B CD2 1 
ATOM   1029 C CE1 . HIS B 1 58 ? 29.441 4.504  16.556 1.00 16.67  ? 1105 HIS B CE1 1 
ATOM   1030 N NE2 . HIS B 1 58 ? 29.979 5.625  17.030 1.00 17.37  ? 1105 HIS B NE2 1 
ATOM   1031 N N   . VAL B 1 59 ? 25.146 3.345  21.567 1.00 15.08  ? 1106 VAL B N   1 
ATOM   1032 C CA  . VAL B 1 59 ? 24.336 3.599  22.760 1.00 16.16  ? 1106 VAL B CA  1 
ATOM   1033 C C   . VAL B 1 59 ? 24.307 2.409  23.712 1.00 15.85  ? 1106 VAL B C   1 
ATOM   1034 O O   . VAL B 1 59 ? 24.659 1.266  23.334 1.00 18.12  ? 1106 VAL B O   1 
ATOM   1035 C CB  . VAL B 1 59 ? 22.947 4.163  22.423 1.00 18.68  ? 1106 VAL B CB  1 
ATOM   1036 C CG1 . VAL B 1 59 ? 23.084 5.438  21.475 1.00 20.71  ? 1106 VAL B CG1 1 
ATOM   1037 C CG2 . VAL B 1 59 ? 22.022 3.127  21.915 1.00 20.92  ? 1106 VAL B CG2 1 
ATOM   1038 N N   . ALA B 1 60 ? 23.855 2.670  24.918 1.00 16.66  ? 1107 ALA B N   1 
ATOM   1039 C CA  . ALA B 1 60 ? 23.675 1.666  25.967 1.00 16.78  ? 1107 ALA B CA  1 
ATOM   1040 C C   . ALA B 1 60 ? 22.462 2.015  26.782 1.00 16.02  ? 1107 ALA B C   1 
ATOM   1041 O O   . ALA B 1 60 ? 22.005 3.181  26.843 1.00 17.39  ? 1107 ALA B O   1 
ATOM   1042 C CB  . ALA B 1 60 ? 24.910 1.635  26.880 1.00 22.10  ? 1107 ALA B CB  1 
ATOM   1043 N N   . SER B 1 61 ? 21.943 1.052  27.508 1.00 15.48  ? 1108 SER B N   1 
ATOM   1044 C CA  . SER B 1 61 ? 20.897 1.319  28.469 1.00 16.37  ? 1108 SER B CA  1 
ATOM   1045 C C   . SER B 1 61 ? 21.360 2.222  29.592 1.00 17.27  ? 1108 SER B C   1 
ATOM   1046 O O   . SER B 1 61 ? 22.535 2.249  29.917 1.00 16.97  ? 1108 SER B O   1 
ATOM   1047 C CB  . SER B 1 61 ? 20.352 0.039  29.047 1.00 17.93  ? 1108 SER B CB  1 
ATOM   1048 O OG  . SER B 1 61 ? 21.266 -0.582 29.901 1.00 18.28  ? 1108 SER B OG  1 
ATOM   1049 N N   . GLU B 1 62 ? 20.411 2.908  30.213 1.00 19.05  ? 1109 GLU B N   1 
ATOM   1050 C CA  . GLU B 1 62 ? 20.713 3.615  31.423 1.00 22.85  ? 1109 GLU B CA  1 
ATOM   1051 C C   . GLU B 1 62 ? 21.235 2.765  32.541 1.00 22.17  ? 1109 GLU B C   1 
ATOM   1052 O O   . GLU B 1 62 ? 22.181 3.148  33.210 1.00 25.32  ? 1109 GLU B O   1 
ATOM   1053 C CB  . GLU B 1 62 ? 19.480 4.387  31.910 1.00 25.13  ? 1109 GLU B CB  1 
ATOM   1054 C CG  . GLU B 1 62 ? 19.089 5.499  30.921 1.00 29.31  ? 1109 GLU B CG  1 
ATOM   1055 C CD  . GLU B 1 62 ? 18.069 6.510  31.357 1.00 41.19  ? 1109 GLU B CD  1 
ATOM   1056 O OE1 . GLU B 1 62 ? 18.221 7.689  30.956 1.00 47.48  ? 1109 GLU B OE1 1 
ATOM   1057 O OE2 . GLU B 1 62 ? 17.144 6.116  32.059 1.00 51.59  ? 1109 GLU B OE2 1 
ATOM   1058 N N   . THR B 1 63 ? 20.713 1.550  32.667 1.00 21.53  ? 1110 THR B N   1 
ATOM   1059 C CA  . THR B 1 63 ? 21.204 0.619  33.691 1.00 21.73  ? 1110 THR B CA  1 
ATOM   1060 C C   . THR B 1 63 ? 22.630 0.323  33.469 1.00 20.85  ? 1110 THR B C   1 
ATOM   1061 O O   . THR B 1 63 ? 23.427 0.352  34.415 1.00 24.10  ? 1110 THR B O   1 
ATOM   1062 C CB  . THR B 1 63 ? 20.375 -0.702 33.704 1.00 22.63  ? 1110 THR B CB  1 
ATOM   1063 O OG1 . THR B 1 63 ? 18.974 -0.400 33.928 1.00 29.93  ? 1110 THR B OG1 1 
ATOM   1064 C CG2 . THR B 1 63 ? 20.923 -1.741 34.730 1.00 25.00  ? 1110 THR B CG2 1 
ATOM   1065 N N   . LEU B 1 64 ? 23.004 -0.065 32.234 1.00 19.18  ? 1111 LEU B N   1 
ATOM   1066 C CA  A LEU B 1 64 ? 24.410 -0.399 31.940 0.50 20.42  ? 1111 LEU B CA  1 
ATOM   1067 C CA  B LEU B 1 64 ? 24.399 -0.394 32.001 0.50 19.53  ? 1111 LEU B CA  1 
ATOM   1068 C C   . LEU B 1 64 ? 25.295 0.804  32.231 1.00 20.36  ? 1111 LEU B C   1 
ATOM   1069 O O   . LEU B 1 64 ? 26.376 0.680  32.846 1.00 24.26  ? 1111 LEU B O   1 
ATOM   1070 C CB  A LEU B 1 64 ? 24.538 -0.879 30.492 0.50 21.59  ? 1111 LEU B CB  1 
ATOM   1071 C CB  B LEU B 1 64 ? 24.574 -0.914 30.620 0.50 19.46  ? 1111 LEU B CB  1 
ATOM   1072 C CG  A LEU B 1 64 ? 25.869 -1.502 30.002 0.50 24.74  ? 1111 LEU B CG  1 
ATOM   1073 C CG  B LEU B 1 64 ? 26.051 -1.106 30.286 0.50 19.13  ? 1111 LEU B CG  1 
ATOM   1074 C CD1 A LEU B 1 64 ? 25.529 -2.581 28.902 0.50 26.81  ? 1111 LEU B CD1 1 
ATOM   1075 C CD1 B LEU B 1 64 ? 26.713 -2.041 31.342 0.50 21.16  ? 1111 LEU B CD1 1 
ATOM   1076 C CD2 A LEU B 1 64 ? 26.869 -0.417 29.500 0.50 26.92  ? 1111 LEU B CD2 1 
ATOM   1077 C CD2 B LEU B 1 64 ? 26.046 -1.652 28.785 0.50 19.99  ? 1111 LEU B CD2 1 
ATOM   1078 N N   . TYR B 1 65 ? 24.908 1.967  31.706 1.00 20.92  ? 1112 TYR B N   1 
ATOM   1079 C CA  . TYR B 1 65 ? 25.728 3.137  31.796 1.00 22.97  ? 1112 TYR B CA  1 
ATOM   1080 C C   . TYR B 1 65 ? 26.020 3.473  33.251 1.00 24.72  ? 1112 TYR B C   1 
ATOM   1081 O O   . TYR B 1 65 ? 27.141 3.876  33.601 1.00 31.45  ? 1112 TYR B O   1 
ATOM   1082 C CB  . TYR B 1 65 ? 25.020 4.308  31.101 1.00 23.53  ? 1112 TYR B CB  1 
ATOM   1083 C CG  . TYR B 1 65 ? 25.975 5.451  30.926 1.00 24.42  ? 1112 TYR B CG  1 
ATOM   1084 C CD1 . TYR B 1 65 ? 26.000 6.497  31.783 1.00 27.57  ? 1112 TYR B CD1 1 
ATOM   1085 C CD2 . TYR B 1 65 ? 26.887 5.435  29.846 1.00 25.70  ? 1112 TYR B CD2 1 
ATOM   1086 C CE1 . TYR B 1 65 ? 26.904 7.579  31.585 1.00 30.23  ? 1112 TYR B CE1 1 
ATOM   1087 C CE2 . TYR B 1 65 ? 27.754 6.488  29.619 1.00 29.10  ? 1112 TYR B CE2 1 
ATOM   1088 C CZ  . TYR B 1 65 ? 27.814 7.519  30.519 1.00 27.94  ? 1112 TYR B CZ  1 
ATOM   1089 O OH  . TYR B 1 65 ? 28.724 8.517  30.315 1.00 34.12  ? 1112 TYR B OH  1 
ATOM   1090 N N   . GLN B 1 66 ? 25.063 3.252  34.136 1.00 22.72  ? 1113 GLN B N   1 
ATOM   1091 C CA  . GLN B 1 66 ? 25.284 3.512  35.579 1.00 26.43  ? 1113 GLN B CA  1 
ATOM   1092 C C   . GLN B 1 66 ? 26.111 2.462  36.267 1.00 26.59  ? 1113 GLN B C   1 
ATOM   1093 O O   . GLN B 1 66 ? 26.612 2.726  37.363 1.00 33.55  ? 1113 GLN B O   1 
ATOM   1094 C CB  . GLN B 1 66 ? 23.937 3.729  36.214 1.00 30.43  ? 1113 GLN B CB  1 
ATOM   1095 C CG  . GLN B 1 66 ? 23.225 4.997  35.711 1.00 38.37  ? 1113 GLN B CG  1 
ATOM   1096 C CD  . GLN B 1 66 ? 21.659 5.040  35.993 1.00 52.46  ? 1113 GLN B CD  1 
ATOM   1097 O OE1 . GLN B 1 66 ? 20.916 5.939  35.505 1.00 61.48  ? 1113 GLN B OE1 1 
ATOM   1098 N NE2 . GLN B 1 66 ? 21.172 4.045  36.734 1.00 59.20  ? 1113 GLN B NE2 1 
ATOM   1099 N N   . GLU B 1 67 ? 26.303 1.294  35.703 1.00 23.85  ? 1114 GLU B N   1 
ATOM   1100 C CA  . GLU B 1 67 ? 27.013 0.301  36.411 1.00 23.92  ? 1114 GLU B CA  1 
ATOM   1101 C C   . GLU B 1 67 ? 28.192 -0.145 35.523 1.00 25.23  ? 1114 GLU B C   1 
ATOM   1102 O O   . GLU B 1 67 ? 28.581 -1.241 35.551 1.00 31.89  ? 1114 GLU B O   1 
ATOM   1103 C CB  . GLU B 1 67 ? 26.126 -0.764 37.059 1.00 29.84  ? 1114 GLU B CB  1 
ATOM   1104 C CG  . GLU B 1 67 ? 25.304 -1.384 36.339 1.00 28.26  ? 1114 GLU B CG  1 
ATOM   1105 C CD  . GLU B 1 67 ? 24.259 -2.317 37.088 1.00 28.54  ? 1114 GLU B CD  1 
ATOM   1106 O OE1 . GLU B 1 67 ? 23.731 -3.030 36.330 1.00 27.74  ? 1114 GLU B OE1 1 
ATOM   1107 O OE2 . GLU B 1 67 ? 24.065 -2.294 38.346 1.00 28.28  ? 1114 GLU B OE2 1 
ATOM   1108 N N   . LEU B 1 68 ? 28.876 0.779  34.839 1.00 25.07  ? 1115 LEU B N   1 
ATOM   1109 C CA  . LEU B 1 68 ? 30.066 0.408  34.035 1.00 28.83  ? 1115 LEU B CA  1 
ATOM   1110 C C   . LEU B 1 68 ? 31.188 0.101  35.010 1.00 30.24  ? 1115 LEU B C   1 
ATOM   1111 O O   . LEU B 1 68 ? 31.313 0.831  36.004 1.00 34.65  ? 1115 LEU B O   1 
ATOM   1112 C CB  . LEU B 1 68 ? 30.501 1.584  33.111 1.00 28.86  ? 1115 LEU B CB  1 
ATOM   1113 C CG  . LEU B 1 68 ? 29.537 2.015  31.997 1.00 34.15  ? 1115 LEU B CG  1 
ATOM   1114 C CD1 . LEU B 1 68 ? 29.862 3.388  31.418 1.00 38.53  ? 1115 LEU B CD1 1 
ATOM   1115 C CD2 . LEU B 1 68 ? 29.449 0.978  30.889 1.00 40.90  ? 1115 LEU B CD2 1 
ATOM   1116 N N   . PRO B 1 69 ? 32.052 -0.905 34.643 1.00 34.01  ? 1116 PRO B N   1 
ATOM   1117 C CA  . PRO B 1 69 ? 33.190 -1.367 35.481 1.00 35.45  ? 1116 PRO B CA  1 
ATOM   1118 C C   . PRO B 1 69 ? 34.410 -0.433 35.424 1.00 37.63  ? 1116 PRO B C   1 
ATOM   1119 O O   . PRO B 1 69 ? 34.661 0.153  34.347 1.00 37.47  ? 1116 PRO B O   1 
ATOM   1120 C CB  . PRO B 1 69 ? 33.529 -2.774 34.921 1.00 37.61  ? 1116 PRO B CB  1 
ATOM   1121 C CG  . PRO B 1 69 ? 32.735 -2.952 33.734 1.00 39.02  ? 1116 PRO B CG  1 
ATOM   1122 C CD  . PRO B 1 69 ? 31.791 -1.781 33.506 1.00 37.32  ? 1116 PRO B CD  1 
ATOM   1123 O OXT . PRO B 1 69 ? 35.095 -0.168 36.434 1.00 38.59  ? 1116 PRO B OXT 1 
HETATM 1124 C C1  . PEG C 2 .  ? 31.199 2.104  18.751 1.00 38.56  ? 1201 PEG B C1  1 
HETATM 1125 O O1  . PEG C 2 .  ? 31.959 2.401  17.627 1.00 41.53  ? 1201 PEG B O1  1 
HETATM 1126 C C2  . PEG C 2 .  ? 30.607 0.759  18.624 1.00 43.62  ? 1201 PEG B C2  1 
HETATM 1127 O O2  . PEG C 2 .  ? 31.634 0.023  19.068 1.00 40.82  ? 1201 PEG B O2  1 
HETATM 1128 C C3  . PEG C 2 .  ? 31.358 -1.265 19.486 1.00 41.88  ? 1201 PEG B C3  1 
HETATM 1129 C C4  . PEG C 2 .  ? 32.055 -1.352 20.773 1.00 39.74  ? 1201 PEG B C4  1 
HETATM 1130 O O4  . PEG C 2 .  ? 32.923 -2.378 20.639 1.00 45.08  ? 1201 PEG B O4  1 
HETATM 1131 C C1  . PEG D 2 .  ? 32.009 4.164  13.675 1.00 32.90  ? 1202 PEG B C1  1 
HETATM 1132 O O1  . PEG D 2 .  ? 31.698 3.226  14.654 1.00 46.15  ? 1202 PEG B O1  1 
HETATM 1133 C C2  . PEG D 2 .  ? 30.681 4.890  13.165 1.00 32.27  ? 1202 PEG B C2  1 
HETATM 1134 O O2  . PEG D 2 .  ? 29.789 3.826  12.779 1.00 43.98  ? 1202 PEG B O2  1 
HETATM 1135 C C3  . PEG D 2 .  ? 28.482 4.070  12.465 1.00 43.50  ? 1202 PEG B C3  1 
HETATM 1136 C C4  . PEG D 2 .  ? 28.449 3.946  10.948 1.00 50.02  ? 1202 PEG B C4  1 
HETATM 1137 O O4  . PEG D 2 .  ? 27.520 3.010  10.435 1.00 53.11  ? 1202 PEG B O4  1 
HETATM 1138 C C1  . PEG E 2 .  ? 30.645 -1.565 24.884 0.50 21.69  ? 1203 PEG B C1  1 
HETATM 1139 O O1  . PEG E 2 .  ? 31.500 -1.868 23.831 0.50 28.25  ? 1203 PEG B O1  1 
HETATM 1140 C C2  . PEG E 2 .  ? 29.827 -2.694 25.417 0.50 23.24  ? 1203 PEG B C2  1 
HETATM 1141 O O2  . PEG E 2 .  ? 28.686 -2.342 26.209 0.50 32.11  ? 1203 PEG B O2  1 
HETATM 1142 C C3  . PEG E 2 .  ? 27.751 -3.458 25.907 0.50 31.56  ? 1203 PEG B C3  1 
HETATM 1143 C C4  . PEG E 2 .  ? 28.263 -4.793 26.427 0.50 35.67  ? 1203 PEG B C4  1 
HETATM 1144 O O4  . PEG E 2 .  ? 28.171 -4.772 27.855 0.50 42.55  ? 1203 PEG B O4  1 
HETATM 1145 O O   . HOH F 3 .  ? 8.433  30.250 1.201  1.00 16.50  ? 1201 HOH A O   1 
HETATM 1146 O O   . HOH F 3 .  ? 5.767  31.126 8.913  1.00 15.70  ? 1202 HOH A O   1 
HETATM 1147 O O   . HOH F 3 .  ? 8.615  10.394 1.756  1.00 24.48  ? 1203 HOH A O   1 
HETATM 1148 O O   . HOH F 3 .  ? 9.224  32.661 0.100  1.00 26.45  ? 1204 HOH A O   1 
HETATM 1149 O O   . HOH F 3 .  ? 3.007  14.525 3.452  1.00 25.65  ? 1205 HOH A O   1 
HETATM 1150 O O   . HOH F 3 .  ? 13.652 25.881 15.705 1.00 23.95  ? 1206 HOH A O   1 
HETATM 1151 O O   . HOH F 3 .  ? 14.248 31.202 3.665  1.00 25.54  ? 1207 HOH A O   1 
HETATM 1152 O O   . HOH F 3 .  ? -3.042 27.830 8.119  1.00 32.87  ? 1208 HOH A O   1 
HETATM 1153 O O   . HOH F 3 .  ? -0.599 27.493 1.786  1.00 25.63  ? 1209 HOH A O   1 
HETATM 1154 O O   . HOH F 3 .  ? 8.017  8.566  12.642 1.00 24.71  ? 1210 HOH A O   1 
HETATM 1155 O O   . HOH F 3 .  ? 17.004 30.640 7.354  1.00 28.77  ? 1211 HOH A O   1 
HETATM 1156 O O   . HOH F 3 .  ? 14.109 27.476 18.305 1.00 28.57  ? 1212 HOH A O   1 
HETATM 1157 O O   . HOH F 3 .  ? 10.270 13.599 -1.499 1.00 24.62  ? 1213 HOH A O   1 
HETATM 1158 O O   . HOH F 3 .  ? 3.526  25.444 -4.213 1.00 30.29  ? 1214 HOH A O   1 
HETATM 1159 O O   . HOH F 3 .  ? 5.998  15.690 12.609 1.00 34.71  ? 1215 HOH A O   1 
HETATM 1160 O O   . HOH F 3 .  ? 4.474  16.994 15.030 1.00 34.04  ? 1216 HOH A O   1 
HETATM 1161 O O   . HOH F 3 .  ? -1.877 16.492 -1.732 1.00 33.68  ? 1217 HOH A O   1 
HETATM 1162 O O   . HOH F 3 .  ? 3.798  21.265 18.114 1.00 36.20  ? 1218 HOH A O   1 
HETATM 1163 O O   . HOH F 3 .  ? 11.324 7.711  2.001  1.00 37.73  ? 1219 HOH A O   1 
HETATM 1164 O O   . HOH F 3 .  ? 11.447 13.512 11.307 1.00 36.49  ? 1220 HOH A O   1 
HETATM 1165 O O   . HOH F 3 .  ? 10.132 29.579 23.624 1.00 32.99  ? 1221 HOH A O   1 
HETATM 1166 O O   . HOH F 3 .  ? 9.108  10.369 14.582 1.00 36.97  ? 1222 HOH A O   1 
HETATM 1167 O O   . HOH F 3 .  ? 10.586 31.389 7.748  1.00 33.32  ? 1223 HOH A O   1 
HETATM 1168 O O   . HOH F 3 .  ? 9.806  15.477 12.752 1.00 41.24  ? 1224 HOH A O   1 
HETATM 1169 O O   . HOH F 3 .  ? 7.809  5.792  13.392 1.00 34.38  ? 1225 HOH A O   1 
HETATM 1170 O O   . HOH F 3 .  ? 8.472  35.077 19.534 1.00 28.47  ? 1226 HOH A O   1 
HETATM 1171 O O   . HOH F 3 .  ? 5.939  34.200 19.007 1.00 26.70  ? 1227 HOH A O   1 
HETATM 1172 O O   . HOH F 3 .  ? 0.493  15.855 -6.455 1.00 43.44  ? 1228 HOH A O   1 
HETATM 1173 O O   . HOH F 3 .  ? 18.058 29.417 2.173  1.00 47.85  ? 1229 HOH A O   1 
HETATM 1174 O O   . HOH F 3 .  ? -3.295 22.082 12.877 1.00 37.29  ? 1230 HOH A O   1 
HETATM 1175 O O   . HOH F 3 .  ? 3.292  14.238 -1.590 1.00 37.83  ? 1231 HOH A O   1 
HETATM 1176 O O   . HOH F 3 .  ? -3.431 23.281 3.343  1.00 33.09  ? 1232 HOH A O   1 
HETATM 1177 O O   . HOH F 3 .  ? -2.143 28.093 4.966  1.00 35.25  ? 1233 HOH A O   1 
HETATM 1178 O O   . HOH F 3 .  ? 17.369 26.022 -5.967 1.00 49.70  ? 1234 HOH A O   1 
HETATM 1179 O O   . HOH F 3 .  ? 11.278 18.898 18.595 1.00 42.39  ? 1235 HOH A O   1 
HETATM 1180 O O   . HOH F 3 .  ? 2.104  27.620 20.783 1.00 35.81  ? 1236 HOH A O   1 
HETATM 1181 O O   . HOH F 3 .  ? 20.202 23.963 -3.394 1.00 37.61  ? 1237 HOH A O   1 
HETATM 1182 O O   . HOH F 3 .  ? 3.822  35.327 24.784 1.00 46.87  ? 1238 HOH A O   1 
HETATM 1183 O O   . HOH F 3 .  ? -1.077 26.968 17.061 1.00 41.26  ? 1239 HOH A O   1 
HETATM 1184 O O   . HOH F 3 .  ? -2.287 18.246 -5.059 1.00 46.04  ? 1240 HOH A O   1 
HETATM 1185 O O   . HOH F 3 .  ? 6.074  7.624  9.211  1.00 42.55  ? 1241 HOH A O   1 
HETATM 1186 O O   . HOH F 3 .  ? -2.641 24.997 1.726  1.00 46.00  ? 1242 HOH A O   1 
HETATM 1187 O O   . HOH F 3 .  ? 3.598  28.528 -0.741 1.00 39.94  ? 1243 HOH A O   1 
HETATM 1188 O O   . HOH F 3 .  ? 5.901  15.459 16.579 1.00 98.10  ? 1244 HOH A O   1 
HETATM 1189 O O   . HOH F 3 .  ? 4.755  31.427 26.136 1.00 39.57  ? 1245 HOH A O   1 
HETATM 1190 O O   . HOH F 3 .  ? 4.597  10.747 -3.499 1.00 42.11  ? 1246 HOH A O   1 
HETATM 1191 O O   . HOH F 3 .  ? 20.945 22.626 -0.054 1.00 48.61  ? 1247 HOH A O   1 
HETATM 1192 O O   . HOH F 3 .  ? -0.991 28.219 19.313 1.00 189.15 ? 1248 HOH A O   1 
HETATM 1193 O O   . HOH F 3 .  ? 12.541 27.473 23.178 1.00 88.85  ? 1249 HOH A O   1 
HETATM 1194 O O   . HOH F 3 .  ? 8.427  28.491 -6.491 1.00 34.46  ? 1250 HOH A O   1 
HETATM 1195 O O   . HOH F 3 .  ? 1.691  14.019 -3.307 1.00 50.55  ? 1251 HOH A O   1 
HETATM 1196 O O   . HOH F 3 .  ? 19.140 31.025 -2.008 1.00 93.40  ? 1252 HOH A O   1 
HETATM 1197 O O   . HOH F 3 .  ? 5.684  35.244 24.156 1.00 44.85  ? 1253 HOH A O   1 
HETATM 1198 O O   . HOH F 3 .  ? 0.661  15.903 -4.313 1.00 39.31  ? 1254 HOH A O   1 
HETATM 1199 O O   . HOH F 3 .  ? 21.710 20.869 4.708  1.00 27.70  ? 1255 HOH A O   1 
HETATM 1200 O O   . HOH F 3 .  ? 20.714 23.134 3.374  1.00 78.60  ? 1256 HOH A O   1 
HETATM 1201 O O   . HOH F 3 .  ? -2.544 21.083 5.020  1.00 36.78  ? 1257 HOH A O   1 
HETATM 1202 O O   . HOH F 3 .  ? 2.769  35.494 9.298  1.00 76.44  ? 1258 HOH A O   1 
HETATM 1203 O O   . HOH F 3 .  ? 11.719 11.668 11.371 1.00 95.98  ? 1259 HOH A O   1 
HETATM 1204 O O   . HOH F 3 .  ? 10.413 12.394 13.585 1.00 52.15  ? 1260 HOH A O   1 
HETATM 1205 O O   . HOH F 3 .  ? 6.524  22.369 19.457 1.00 51.72  ? 1261 HOH A O   1 
HETATM 1206 O O   . HOH F 3 .  ? 1.057  22.792 18.449 1.00 127.81 ? 1262 HOH A O   1 
HETATM 1207 O O   . HOH F 3 .  ? -0.338 19.685 14.049 1.00 38.86  ? 1263 HOH A O   1 
HETATM 1208 O O   . HOH F 3 .  ? 4.639  12.516 3.804  1.00 55.67  ? 1264 HOH A O   1 
HETATM 1209 O O   . HOH F 3 .  ? 5.996  11.816 2.045  1.00 57.34  ? 1265 HOH A O   1 
HETATM 1210 O O   . HOH F 3 .  ? 4.223  22.613 -6.232 1.00 85.08  ? 1266 HOH A O   1 
HETATM 1211 O O   . HOH F 3 .  ? 5.439  9.192  11.992 1.00 42.34  ? 1267 HOH A O   1 
HETATM 1212 O O   . HOH F 3 .  ? 9.643  3.843  5.975  1.00 52.65  ? 1268 HOH A O   1 
HETATM 1213 O O   . HOH F 3 .  ? 9.058  6.310  2.423  1.00 46.16  ? 1269 HOH A O   1 
HETATM 1214 O O   . HOH F 3 .  ? 8.591  3.085  13.543 1.00 44.77  ? 1270 HOH A O   1 
HETATM 1215 O O   . HOH F 3 .  ? 1.778  29.271 22.997 1.00 49.62  ? 1271 HOH A O   1 
HETATM 1216 O O   . HOH F 3 .  ? 1.560  14.418 1.188  1.00 46.66  ? 1272 HOH A O   1 
HETATM 1217 O O   . HOH F 3 .  ? 10.665 1.515  12.726 1.00 105.72 ? 1273 HOH A O   1 
HETATM 1218 O O   . HOH F 3 .  ? 6.698  13.462 -0.762 1.00 187.64 ? 1274 HOH A O   1 
HETATM 1219 O O   . HOH F 3 .  ? 3.278  15.560 11.331 1.00 58.14  ? 1275 HOH A O   1 
HETATM 1220 O O   . HOH F 3 .  ? 8.135  29.411 25.161 1.00 50.38  ? 1276 HOH A O   1 
HETATM 1221 O O   . HOH F 3 .  ? -4.374 23.354 10.851 1.00 57.23  ? 1277 HOH A O   1 
HETATM 1222 O O   . HOH F 3 .  ? 1.930  16.715 14.314 1.00 52.85  ? 1278 HOH A O   1 
HETATM 1223 O O   . HOH F 3 .  ? -0.634 17.116 10.606 1.00 110.01 ? 1279 HOH A O   1 
HETATM 1224 O O   . HOH F 3 .  ? 1.128  14.697 6.018  1.00 61.73  ? 1280 HOH A O   1 
HETATM 1225 O O   . HOH F 3 .  ? -1.431 31.081 4.901  1.00 71.38  ? 1281 HOH A O   1 
HETATM 1226 O O   . HOH F 3 .  ? 17.143 28.035 -6.761 1.00 99.33  ? 1282 HOH A O   1 
HETATM 1227 O O   . HOH F 3 .  ? -2.044 15.860 1.068  1.00 46.46  ? 1283 HOH A O   1 
HETATM 1228 O O   . HOH F 3 .  ? 3.678  27.834 -3.046 1.00 43.54  ? 1284 HOH A O   1 
HETATM 1229 O O   . HOH F 3 .  ? 19.821 28.275 -4.002 1.00 95.31  ? 1285 HOH A O   1 
HETATM 1230 O O   . HOH F 3 .  ? 2.107  11.438 -5.840 1.00 110.25 ? 1286 HOH A O   1 
HETATM 1231 O O   . HOH F 3 .  ? 13.259 10.822 9.440  1.00 32.84  ? 1287 HOH A O   1 
HETATM 1232 O O   . HOH F 3 .  ? 12.649 10.864 7.365  1.00 28.59  ? 1288 HOH A O   1 
HETATM 1233 O O   . HOH F 3 .  ? 17.098 18.714 15.129 1.00 28.02  ? 1289 HOH A O   1 
HETATM 1234 O O   . HOH F 3 .  ? 23.545 17.245 15.534 1.00 38.48  ? 1290 HOH A O   1 
HETATM 1235 O O   . HOH F 3 .  ? 14.457 23.477 17.640 1.00 54.57  ? 1291 HOH A O   1 
HETATM 1236 O O   . HOH F 3 .  ? 16.994 32.370 -4.810 1.00 40.84  ? 1292 HOH A O   1 
HETATM 1237 O O   . HOH F 3 .  ? 4.338  35.855 20.615 1.00 40.20  ? 1293 HOH A O   1 
HETATM 1238 O O   . HOH F 3 .  ? -0.408 33.826 6.566  1.00 46.48  ? 1294 HOH A O   1 
HETATM 1239 O O   . HOH F 3 .  ? -1.605 34.962 8.954  1.00 47.58  ? 1295 HOH A O   1 
HETATM 1240 O O   . HOH F 3 .  ? 14.731 30.990 -4.682 1.00 61.00  ? 1296 HOH A O   1 
HETATM 1241 O O   . HOH F 3 .  ? 10.898 10.898 0.000  0.50 35.75  ? 1297 HOH A O   1 
HETATM 1242 O O   . HOH F 3 .  ? 14.877 25.103 19.362 1.00 47.89  ? 1298 HOH A O   1 
HETATM 1243 O O   . HOH F 3 .  ? 1.304  16.524 8.124  1.00 45.49  ? 1299 HOH A O   1 
HETATM 1244 O O   . HOH G 3 .  ? 24.777 0.800  14.711 1.00 17.10  ? 1301 HOH B O   1 
HETATM 1245 O O   . HOH G 3 .  ? 27.408 1.004  22.551 1.00 17.26  ? 1302 HOH B O   1 
HETATM 1246 O O   . HOH G 3 .  ? 23.610 -1.867 19.057 1.00 22.61  ? 1303 HOH B O   1 
HETATM 1247 O O   . HOH G 3 .  ? 24.945 -1.800 13.707 1.00 26.15  ? 1304 HOH B O   1 
HETATM 1248 O O   . HOH G 3 .  ? 23.864 2.039  6.983  1.00 23.31  ? 1305 HOH B O   1 
HETATM 1249 O O   . HOH G 3 .  ? 32.025 6.895  15.697 1.00 25.32  ? 1306 HOH B O   1 
HETATM 1250 O O   . HOH G 3 .  ? 33.824 7.987  22.413 1.00 31.84  ? 1307 HOH B O   1 
HETATM 1251 O O   . HOH G 3 .  ? 17.256 -3.321 20.658 1.00 33.25  ? 1308 HOH B O   1 
HETATM 1252 O O   . HOH G 3 .  ? 26.486 8.383  7.417  1.00 30.36  ? 1309 HOH B O   1 
HETATM 1253 O O   . HOH G 3 .  ? 19.679 -2.379 16.942 1.00 25.59  ? 1310 HOH B O   1 
HETATM 1254 O O   . HOH G 3 .  ? 17.782 2.563  28.919 1.00 28.80  ? 1311 HOH B O   1 
HETATM 1255 O O   . HOH G 3 .  ? 17.958 0.585  31.646 1.00 35.55  ? 1312 HOH B O   1 
HETATM 1256 O O   . HOH G 3 .  ? 10.775 1.703  17.052 1.00 33.18  ? 1313 HOH B O   1 
HETATM 1257 O O   . HOH G 3 .  ? 33.391 7.108  19.042 1.00 31.45  ? 1314 HOH B O   1 
HETATM 1258 O O   . HOH G 3 .  ? 23.193 -1.173 21.258 1.00 31.77  ? 1315 HOH B O   1 
HETATM 1259 O O   . HOH G 3 .  ? 32.737 11.901 17.220 1.00 36.03  ? 1316 HOH B O   1 
HETATM 1260 O O   . HOH G 3 .  ? 25.891 16.099 21.677 1.00 43.64  ? 1317 HOH B O   1 
HETATM 1261 O O   . HOH G 3 .  ? 30.044 0.951  13.418 1.00 36.96  ? 1318 HOH B O   1 
HETATM 1262 O O   . HOH G 3 .  ? 24.112 17.412 18.480 1.00 32.71  ? 1319 HOH B O   1 
HETATM 1263 O O   . HOH G 3 .  ? 28.880 17.161 11.795 1.00 35.85  ? 1320 HOH B O   1 
HETATM 1264 O O   . HOH G 3 .  ? 22.362 0.538  37.236 1.00 41.17  ? 1321 HOH B O   1 
HETATM 1265 O O   . HOH G 3 .  ? 13.812 3.466  28.587 1.00 47.19  ? 1322 HOH B O   1 
HETATM 1266 O O   . HOH G 3 .  ? 22.068 14.593 28.138 1.00 40.48  ? 1323 HOH B O   1 
HETATM 1267 O O   . HOH G 3 .  ? 35.549 0.218  22.969 1.00 41.17  ? 1324 HOH B O   1 
HETATM 1268 O O   . HOH G 3 .  ? 30.797 13.597 18.836 1.00 36.09  ? 1325 HOH B O   1 
HETATM 1269 O O   . HOH G 3 .  ? 27.803 17.514 14.758 1.00 110.87 ? 1326 HOH B O   1 
HETATM 1270 O O   . HOH G 3 .  ? 28.216 10.864 32.068 1.00 77.55  ? 1327 HOH B O   1 
HETATM 1271 O O   . HOH G 3 .  ? 23.286 16.908 11.331 1.00 40.14  ? 1328 HOH B O   1 
HETATM 1272 O O   . HOH G 3 .  ? 10.600 16.499 17.792 1.00 37.77  ? 1329 HOH B O   1 
HETATM 1273 O O   . HOH G 3 .  ? 33.988 1.158  31.909 1.00 43.14  ? 1330 HOH B O   1 
HETATM 1274 O O   . HOH G 3 .  ? 24.655 -1.001 40.514 1.00 34.89  ? 1331 HOH B O   1 
HETATM 1275 O O   . HOH G 3 .  ? 24.559 10.913 31.558 1.00 45.76  ? 1332 HOH B O   1 
HETATM 1276 O O   . HOH G 3 .  ? 25.906 17.177 8.421  1.00 185.98 ? 1333 HOH B O   1 
HETATM 1277 O O   . HOH G 3 .  ? 8.495  2.383  16.087 1.00 53.09  ? 1334 HOH B O   1 
HETATM 1278 O O   . HOH G 3 .  ? 21.635 -2.315 18.921 1.00 24.75  ? 1335 HOH B O   1 
HETATM 1279 O O   . HOH G 3 .  ? 19.462 -2.561 8.987  1.00 30.47  ? 1336 HOH B O   1 
HETATM 1280 O O   . HOH G 3 .  ? 33.457 3.864  18.193 1.00 51.52  ? 1337 HOH B O   1 
HETATM 1281 O O   . HOH G 3 .  ? 10.424 14.784 14.829 1.00 42.61  ? 1338 HOH B O   1 
HETATM 1282 O O   . HOH G 3 .  ? 20.035 14.808 26.578 1.00 46.23  ? 1339 HOH B O   1 
HETATM 1283 O O   . HOH G 3 .  ? 15.523 -2.660 14.987 1.00 47.63  ? 1340 HOH B O   1 
HETATM 1284 O O   . HOH G 3 .  ? 30.264 5.638  9.365  1.00 35.16  ? 1341 HOH B O   1 
HETATM 1285 O O   . HOH G 3 .  ? 18.254 -4.769 8.089  1.00 41.25  ? 1342 HOH B O   1 
HETATM 1286 O O   . HOH G 3 .  ? 16.965 13.569 26.111 1.00 44.82  ? 1343 HOH B O   1 
HETATM 1287 O O   . HOH G 3 .  ? 31.169 13.493 26.570 1.00 40.30  ? 1344 HOH B O   1 
HETATM 1288 O O   . HOH G 3 .  ? 23.713 20.586 7.214  1.00 201.49 ? 1345 HOH B O   1 
HETATM 1289 O O   . HOH G 3 .  ? 13.243 -1.819 13.829 1.00 53.17  ? 1346 HOH B O   1 
HETATM 1290 O O   . HOH G 3 .  ? 28.917 3.710  35.561 1.00 40.23  ? 1347 HOH B O   1 
HETATM 1291 O O   . HOH G 3 .  ? 13.908 17.193 19.129 1.00 45.76  ? 1348 HOH B O   1 
HETATM 1292 O O   . HOH G 3 .  ? 27.471 14.310 27.240 1.00 43.88  ? 1349 HOH B O   1 
HETATM 1293 O O   . HOH G 3 .  ? 33.424 5.464  25.835 1.00 87.31  ? 1350 HOH B O   1 
HETATM 1294 O O   . HOH G 3 .  ? 8.694  15.073 16.748 1.00 46.43  ? 1351 HOH B O   1 
HETATM 1295 O O   . HOH G 3 .  ? 26.274 -4.963 34.148 1.00 187.30 ? 1352 HOH B O   1 
HETATM 1296 O O   . HOH G 3 .  ? 12.331 -1.953 19.873 1.00 174.88 ? 1353 HOH B O   1 
HETATM 1297 O O   . HOH G 3 .  ? 29.966 1.749  38.188 1.00 46.94  ? 1354 HOH B O   1 
HETATM 1298 O O   . HOH G 3 .  ? 21.272 7.069  32.774 1.00 74.60  ? 1355 HOH B O   1 
HETATM 1299 O O   . HOH G 3 .  ? 23.093 8.631  32.797 1.00 67.22  ? 1356 HOH B O   1 
HETATM 1300 O O   . HOH G 3 .  ? 15.491 4.381  30.420 1.00 54.01  ? 1357 HOH B O   1 
HETATM 1301 O O   . HOH G 3 .  ? 31.705 15.858 17.082 1.00 48.05  ? 1358 HOH B O   1 
HETATM 1302 O O   . HOH G 3 .  ? 8.278  4.456  17.792 1.00 47.26  ? 1359 HOH B O   1 
HETATM 1303 O O   . HOH G 3 .  ? 13.131 8.998  7.741  1.00 20.01  ? 1360 HOH B O   1 
HETATM 1304 O O   . HOH G 3 .  ? 8.197  12.251 18.695 1.00 62.73  ? 1361 HOH B O   1 
HETATM 1305 O O   . HOH G 3 .  ? 13.153 18.764 22.182 1.00 59.29  ? 1362 HOH B O   1 
HETATM 1306 O O   . HOH G 3 .  ? 11.712 0.614  9.586  1.00 47.20  ? 1363 HOH B O   1 
HETATM 1307 O O   . HOH G 3 .  ? 28.182 0.520  40.050 1.00 45.05  ? 1364 HOH B O   1 
HETATM 1308 O O   . HOH G 3 .  ? 28.002 -5.335 29.719 1.00 49.20  ? 1365 HOH B O   1 
HETATM 1309 O O   . HOH G 3 .  ? 30.399 -6.558 32.036 1.00 61.40  ? 1366 HOH B O   1 
HETATM 1310 O O   . HOH G 3 .  ? 21.844 18.791 10.593 1.00 47.93  ? 1367 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   A THR A 5  ? 0.3828 0.4000 0.5351 -0.0177 0.0299  0.0239  1052 THR A N   
2    N N   B THR A 5  ? 0.2989 0.2311 0.3151 0.0172  0.0260  -0.0143 1052 THR A N   
3    C CA  A THR A 5  ? 0.4180 0.3891 0.4920 0.0284  0.0498  0.0228  1052 THR A CA  
4    C CA  B THR A 5  ? 0.2811 0.2011 0.2989 0.0014  0.0236  -0.0134 1052 THR A CA  
5    C C   A THR A 5  ? 0.3690 0.3958 0.4408 0.0198  0.0249  0.0158  1052 THR A C   
6    C C   B THR A 5  ? 0.2692 0.2328 0.2784 0.0112  0.0073  0.0014  1052 THR A C   
7    O O   A THR A 5  ? 0.4000 0.4628 0.3891 0.0942  -0.0013 0.0804  1052 THR A O   
8    O O   B THR A 5  ? 0.2726 0.2671 0.3018 -0.0061 0.0121  -0.0019 1052 THR A O   
9    C CB  A THR A 5  ? 0.4515 0.4447 0.5456 -0.0227 0.0691  0.0231  1052 THR A CB  
10   C CB  B THR A 5  ? 0.3379 0.1429 0.3134 0.0285  0.0931  0.0448  1052 THR A CB  
11   N N   A ALA A 6  ? 0.3370 0.3175 0.3860 0.0327  0.0116  -0.0030 1053 ALA A N   
12   N N   B ALA A 6  ? 0.2145 0.1687 0.2665 -0.0283 -0.0276 -0.0095 1053 ALA A N   
13   C CA  A ALA A 6  ? 0.2591 0.3011 0.3256 0.0165  -0.0237 0.0027  1053 ALA A CA  
14   C CA  B ALA A 6  ? 0.2329 0.1827 0.2322 -0.0018 -0.0282 -0.0161 1053 ALA A CA  
15   C C   A ALA A 6  ? 0.2737 0.2849 0.3359 0.0424  0.0037  -0.0256 1053 ALA A C   
16   C C   B ALA A 6  ? 0.2469 0.1825 0.2281 -0.0008 -0.0011 0.0136  1053 ALA A C   
17   O O   A ALA A 6  ? 0.2962 0.3237 0.3431 0.0284  0.0029  -0.0235 1053 ALA A O   
18   O O   B ALA A 6  ? 0.2682 0.1646 0.2488 0.0606  0.0005  0.0553  1053 ALA A O   
19   C CB  A ALA A 6  ? 0.2457 0.2845 0.3583 0.0264  -0.0501 -0.0112 1053 ALA A CB  
20   C CB  B ALA A 6  ? 0.2401 0.2068 0.2496 0.0029  -0.0224 -0.0060 1053 ALA A CB  
21   N N   A PRO A 7  ? 0.2545 0.2400 0.3000 0.0110  -0.0185 -0.0093 1054 PRO A N   
22   N N   B PRO A 7  ? 0.2868 0.1832 0.2313 -0.0202 -0.0436 -0.0090 1054 PRO A N   
23   C CA  A PRO A 7  ? 0.2241 0.2387 0.2904 -0.0006 -0.0033 0.0076  1054 PRO A CA  
24   C CA  B PRO A 7  ? 0.2113 0.1780 0.1807 -0.0078 -0.0573 -0.0204 1054 PRO A CA  
25   C C   A PRO A 7  ? 0.2059 0.2472 0.2694 0.0022  0.0094  -0.0187 1054 PRO A C   
26   C C   B PRO A 7  ? 0.2272 0.1527 0.2345 -0.0098 -0.0447 -0.0347 1054 PRO A C   
27   O O   A PRO A 7  ? 0.2471 0.2261 0.1759 -0.0676 0.0085  -0.0628 1054 PRO A O   
28   O O   B PRO A 7  ? 0.1865 0.1905 0.2178 -0.0077 -0.0602 -0.0467 1054 PRO A O   
29   C CB  A PRO A 7  ? 0.2422 0.2468 0.3425 -0.0183 -0.0082 0.0622  1054 PRO A CB  
30   C CB  B PRO A 7  ? 0.2476 0.2469 0.2796 0.0098  -0.0527 -0.0182 1054 PRO A CB  
31   C CG  A PRO A 7  ? 0.2436 0.2340 0.3343 -0.0331 -0.0014 -0.0263 1054 PRO A CG  
32   C CG  B PRO A 7  ? 0.3067 0.2196 0.2738 -0.0510 -0.0529 -0.0651 1054 PRO A CG  
33   C CD  A PRO A 7  ? 0.3012 0.2283 0.3086 -0.0347 -0.0139 -0.0074 1054 PRO A CD  
34   C CD  B PRO A 7  ? 0.2501 0.2323 0.2616 -0.0333 -0.0478 -0.0092 1054 PRO A CD  
35   N N   A THR A 8  ? 0.2658 0.2519 0.2192 0.0133  -0.0109 -0.0036 1055 THR A N   
36   N N   B THR A 8  ? 0.1896 0.1557 0.2310 0.0047  -0.0378 -0.0177 1055 THR A N   
37   C CA  A THR A 8  ? 0.2552 0.2040 0.2559 0.0386  -0.0111 -0.0015 1055 THR A CA  
38   C CA  B THR A 8  ? 0.1952 0.1170 0.2428 0.0184  -0.0517 -0.0337 1055 THR A CA  
39   C C   A THR A 8  ? 0.2462 0.1905 0.2746 0.0152  -0.0424 -0.0388 1055 THR A C   
40   C C   B THR A 8  ? 0.1961 0.1319 0.2627 0.0101  -0.0519 -0.0424 1055 THR A C   
41   O O   A THR A 8  ? 0.3254 0.1736 0.3455 0.0519  -0.0756 -0.0508 1055 THR A O   
42   O O   B THR A 8  ? 0.2420 0.1503 0.3479 0.0401  -0.1058 -0.0708 1055 THR A O   
43   C CB  A THR A 8  ? 0.3093 0.2694 0.2194 0.0289  0.0101  0.0054  1055 THR A CB  
44   C CB  B THR A 8  ? 0.1956 0.1067 0.2441 0.0060  -0.0574 -0.0468 1055 THR A CB  
45   O OG1 A THR A 8  ? 0.3931 0.2469 0.3163 0.1047  0.0150  0.0245  1055 THR A OG1 
46   O OG1 B THR A 8  ? 0.2069 0.1917 0.2640 -0.0083 -0.0001 -0.0426 1055 THR A OG1 
47   C CG2 A THR A 8  ? 0.2876 0.3380 0.2908 0.0051  0.0303  0.0548  1055 THR A CG2 
48   C CG2 B THR A 8  ? 0.2379 0.0801 0.2875 0.0688  -0.0563 -0.0009 1055 THR A CG2 
49   N N   . VAL A 9  ? 0.2034 0.1466 0.2435 0.0176  -0.0294 -0.0214 1056 VAL A N   
50   C CA  . VAL A 9  ? 0.2059 0.1572 0.2105 0.0116  -0.0025 -0.0115 1056 VAL A CA  
51   C C   . VAL A 9  ? 0.1973 0.1316 0.2133 -0.0017 -0.0027 -0.0049 1056 VAL A C   
52   O O   . VAL A 9  ? 0.2247 0.1290 0.2717 -0.0072 0.0125  -0.0027 1056 VAL A O   
53   C CB  . VAL A 9  ? 0.2071 0.1522 0.2143 0.0048  0.0213  0.0009  1056 VAL A CB  
54   C CG1 . VAL A 9  ? 0.1825 0.2282 0.2679 -0.0320 0.0225  -0.0037 1056 VAL A CG1 
55   C CG2 . VAL A 9  ? 0.2285 0.1816 0.2084 0.0288  0.0004  -0.0065 1056 VAL A CG2 
56   N N   . VAL A 10 ? 0.1763 0.1326 0.2252 0.0109  0.0082  0.0000  1057 VAL A N   
57   C CA  . VAL A 10 ? 0.1976 0.1503 0.1915 -0.0022 0.0012  -0.0082 1057 VAL A CA  
58   C C   . VAL A 10 ? 0.1916 0.1576 0.1867 -0.0049 0.0188  -0.0060 1057 VAL A C   
59   O O   . VAL A 10 ? 0.2057 0.1492 0.2300 -0.0154 0.0017  0.0013  1057 VAL A O   
60   C CB  . VAL A 10 ? 0.2207 0.1729 0.1991 -0.0020 0.0123  -0.0049 1057 VAL A CB  
61   C CG1 . VAL A 10 ? 0.1985 0.2577 0.2381 -0.0635 0.0226  -0.0197 1057 VAL A CG1 
62   C CG2 . VAL A 10 ? 0.2685 0.2410 0.2090 0.0050  -0.0094 0.0016  1057 VAL A CG2 
63   N N   . ALA A 11 ? 0.1835 0.1630 0.2153 -0.0255 -0.0046 -0.0107 1058 ALA A N   
64   C CA  . ALA A 11 ? 0.1785 0.1825 0.2025 -0.0167 0.0104  -0.0090 1058 ALA A CA  
65   C C   . ALA A 11 ? 0.2058 0.1770 0.2083 -0.0093 0.0242  0.0069  1058 ALA A C   
66   O O   . ALA A 11 ? 0.2260 0.1846 0.2383 -0.0042 0.0342  0.0018  1058 ALA A O   
67   C CB  . ALA A 11 ? 0.1917 0.1884 0.2489 -0.0360 0.0051  -0.0358 1058 ALA A CB  
68   N N   . LEU A 12 ? 0.2186 0.1782 0.2074 -0.0008 0.0217  0.0063  1059 LEU A N   
69   C CA  . LEU A 12 ? 0.2604 0.1689 0.2291 0.0033  0.0397  -0.0058 1059 LEU A CA  
70   C C   . LEU A 12 ? 0.2549 0.1726 0.2217 0.0309  0.0307  -0.0249 1059 LEU A C   
71   O O   . LEU A 12 ? 0.2859 0.2343 0.2524 0.0635  0.0655  -0.0233 1059 LEU A O   
72   C CB  . LEU A 12 ? 0.3716 0.2040 0.2741 -0.0247 0.0406  -0.0087 1059 LEU A CB  
73   C CG  . LEU A 12 ? 0.4618 0.2507 0.3082 -0.0282 0.1029  0.0063  1059 LEU A CG  
74   C CD1 . LEU A 12 ? 0.5102 0.3339 0.2369 -0.0593 0.1263  -0.0617 1059 LEU A CD1 
75   C CD2 . LEU A 12 ? 0.3661 0.1558 0.3288 -0.0541 0.0358  -0.0284 1059 LEU A CD2 
76   N N   . TYR A 13 ? 0.2117 0.1868 0.2079 0.0187  0.0137  -0.0343 1060 TYR A N   
77   C CA  . TYR A 13 ? 0.2013 0.2100 0.2267 0.0192  0.0227  -0.0338 1060 TYR A CA  
78   C C   . TYR A 13 ? 0.1774 0.2041 0.2382 0.0069  0.0081  -0.0377 1060 TYR A C   
79   O O   . TYR A 13 ? 0.1729 0.2132 0.2815 0.0072  0.0281  -0.0443 1060 TYR A O   
80   C CB  . TYR A 13 ? 0.1988 0.2129 0.2382 0.0288  0.0079  -0.0162 1060 TYR A CB  
81   C CG  . TYR A 13 ? 0.2034 0.1952 0.2710 0.0332  0.0151  -0.0147 1060 TYR A CG  
82   C CD1 . TYR A 13 ? 0.2332 0.2109 0.4687 0.0147  0.0614  -0.0337 1060 TYR A CD1 
83   C CD2 . TYR A 13 ? 0.2288 0.1898 0.2552 0.0232  0.0153  -0.0353 1060 TYR A CD2 
84   C CE1 . TYR A 13 ? 0.2581 0.2266 0.4565 0.0669  0.0867  -0.0246 1060 TYR A CE1 
85   C CE2 . TYR A 13 ? 0.2344 0.1812 0.3215 0.0194  0.0489  -0.0161 1060 TYR A CE2 
86   C CZ  . TYR A 13 ? 0.2910 0.1894 0.3700 0.0279  0.0686  -0.0651 1060 TYR A CZ  
87   O OH  . TYR A 13 ? 0.4035 0.2395 0.4810 -0.0152 0.1384  -0.1209 1060 TYR A OH  
88   N N   . ASP A 14 ? 0.1737 0.2187 0.2555 0.0156  0.0140  -0.0402 1061 ASP A N   
89   C CA  . ASP A 14 ? 0.1728 0.2201 0.2555 -0.0033 0.0231  -0.0267 1061 ASP A CA  
90   C C   . ASP A 14 ? 0.1579 0.2123 0.2348 -0.0124 0.0125  -0.0028 1061 ASP A C   
91   O O   . ASP A 14 ? 0.2068 0.1851 0.2692 0.0151  0.0269  -0.0110 1061 ASP A O   
92   C CB  . ASP A 14 ? 0.1715 0.2464 0.2704 -0.0120 0.0282  -0.0181 1061 ASP A CB  
93   C CG  . ASP A 14 ? 0.1844 0.3995 0.2838 0.0173  0.0163  -0.0086 1061 ASP A CG  
94   O OD1 . ASP A 14 ? 0.2265 0.3802 0.2947 0.0342  0.0156  0.0186  1061 ASP A OD1 
95   O OD2 . ASP A 14 ? 0.2368 0.6312 0.3712 -0.0664 0.0361  0.0211  1061 ASP A OD2 
96   N N   . TYR A 15 ? 0.1799 0.2006 0.2267 0.0008  0.0254  -0.0157 1062 TYR A N   
97   C CA  . TYR A 15 ? 0.1571 0.1792 0.2249 0.0001  0.0054  -0.0086 1062 TYR A CA  
98   C C   . TYR A 15 ? 0.1668 0.1823 0.2024 -0.0127 0.0030  0.0049  1062 TYR A C   
99   O O   . TYR A 15 ? 0.2046 0.1776 0.2244 -0.0053 -0.0280 0.0221  1062 TYR A O   
100  C CB  . TYR A 15 ? 0.1732 0.2056 0.2277 -0.0189 0.0233  -0.0285 1062 TYR A CB  
101  C CG  . TYR A 15 ? 0.1686 0.1726 0.2097 -0.0125 0.0131  -0.0105 1062 TYR A CG  
102  C CD1 . TYR A 15 ? 0.1493 0.1944 0.2319 -0.0082 0.0072  -0.0142 1062 TYR A CD1 
103  C CD2 . TYR A 15 ? 0.1648 0.1774 0.2285 -0.0039 0.0083  -0.0102 1062 TYR A CD2 
104  C CE1 . TYR A 15 ? 0.1328 0.1891 0.2559 -0.0147 0.0018  0.0048  1062 TYR A CE1 
105  C CE2 . TYR A 15 ? 0.1549 0.1737 0.2250 -0.0039 0.0078  -0.0102 1062 TYR A CE2 
106  C CZ  . TYR A 15 ? 0.1570 0.2148 0.2060 -0.0059 0.0150  0.0085  1062 TYR A CZ  
107  O OH  . TYR A 15 ? 0.1711 0.1959 0.2441 -0.0066 0.0180  0.0094  1062 TYR A OH  
108  N N   . THR A 16 ? 0.1711 0.1953 0.2024 -0.0014 -0.0103 -0.0063 1063 THR A N   
109  C CA  . THR A 16 ? 0.1438 0.2018 0.2148 0.0007  -0.0117 -0.0068 1063 THR A CA  
110  C C   . THR A 16 ? 0.1445 0.1827 0.2251 -0.0188 -0.0085 -0.0242 1063 THR A C   
111  O O   . THR A 16 ? 0.1673 0.1896 0.2285 0.0054  0.0001  -0.0009 1063 THR A O   
112  C CB  . THR A 16 ? 0.1427 0.2444 0.2445 -0.0125 0.0026  -0.0052 1063 THR A CB  
113  O OG1 . THR A 16 ? 0.1834 0.3161 0.2895 -0.0143 0.0363  -0.0250 1063 THR A OG1 
114  C CG2 . THR A 16 ? 0.2013 0.2251 0.2754 -0.0700 -0.0346 -0.0215 1063 THR A CG2 
115  N N   . ALA A 17 ? 0.1838 0.1729 0.2236 0.0002  -0.0058 0.0061  1064 ALA A N   
116  C CA  . ALA A 17 ? 0.1666 0.1648 0.2257 -0.0032 -0.0169 -0.0033 1064 ALA A CA  
117  C C   . ALA A 17 ? 0.1925 0.1959 0.2097 0.0115  -0.0163 0.0014  1064 ALA A C   
118  O O   . ALA A 17 ? 0.1914 0.2297 0.2494 -0.0176 -0.0053 -0.0168 1064 ALA A O   
119  C CB  . ALA A 17 ? 0.2378 0.1559 0.2441 0.0309  -0.0399 0.0032  1064 ALA A CB  
120  N N   . ASN A 18 ? 0.1544 0.2222 0.1875 0.0096  -0.0002 -0.0017 1065 ASN A N   
121  C CA  . ASN A 18 ? 0.1777 0.2130 0.1957 0.0038  -0.0063 -0.0120 1065 ASN A CA  
122  C C   . ASN A 18 ? 0.1548 0.2192 0.2019 0.0054  -0.0109 -0.0039 1065 ASN A C   
123  O O   . ASN A 18 ? 0.1950 0.2424 0.2256 0.0339  -0.0001 0.0196  1065 ASN A O   
124  C CB  . ASN A 18 ? 0.1996 0.2400 0.2379 0.0499  0.0056  0.0034  1065 ASN A CB  
125  C CG  . ASN A 18 ? 0.2083 0.3091 0.2786 0.0269  -0.0422 -0.0009 1065 ASN A CG  
126  O OD1 . ASN A 18 ? 0.2226 0.3453 0.3307 0.0598  -0.0434 0.0049  1065 ASN A OD1 
127  N ND2 . ASN A 18 ? 0.2144 0.2520 0.2743 0.0815  0.0193  0.0180  1065 ASN A ND2 
128  N N   . ARG A 19 ? 0.2079 0.2201 0.1949 0.0290  -0.0222 -0.0129 1066 ARG A N   
129  C CA  . ARG A 19 ? 0.1780 0.1893 0.1889 0.0111  -0.0151 -0.0150 1066 ARG A CA  
130  C C   . ARG A 19 ? 0.1730 0.1661 0.2222 -0.0029 -0.0231 -0.0044 1066 ARG A C   
131  O O   . ARG A 19 ? 0.1817 0.1905 0.2211 0.0088  -0.0270 -0.0013 1066 ARG A O   
132  C CB  . ARG A 19 ? 0.1952 0.1582 0.2358 0.0166  -0.0221 -0.0056 1066 ARG A CB  
133  C CG  . ARG A 19 ? 0.1943 0.3209 0.2475 -0.0419 0.0112  -0.0361 1066 ARG A CG  
134  C CD  . ARG A 19 ? 0.2302 0.3085 0.2504 -0.0256 0.0198  -0.0317 1066 ARG A CD  
135  N NE  . ARG A 19 ? 0.1498 0.2633 0.2475 -0.0004 -0.0206 0.0548  1066 ARG A NE  
136  C CZ  . ARG A 19 ? 0.2020 0.2926 0.2331 -0.0261 -0.0120 0.0105  1066 ARG A CZ  
137  N NH1 . ARG A 19 ? 0.2087 0.4547 0.2021 -0.0825 0.0220  -0.0354 1066 ARG A NH1 
138  N NH2 . ARG A 19 ? 0.2567 0.2915 0.3759 0.0092  -0.0092 0.1257  1066 ARG A NH2 
139  N N   . SER A 20 ? 0.1868 0.1462 0.2276 -0.0118 -0.0203 -0.0110 1067 SER A N   
140  C CA  . SER A 20 ? 0.1754 0.1613 0.2261 -0.0153 -0.0131 0.0070  1067 SER A CA  
141  C C   . SER A 20 ? 0.1870 0.1518 0.2298 -0.0133 -0.0113 -0.0028 1067 SER A C   
142  O O   . SER A 20 ? 0.2158 0.1791 0.2672 -0.0221 -0.0340 0.0240  1067 SER A O   
143  C CB  . SER A 20 ? 0.1960 0.1589 0.2530 -0.0126 -0.0450 -0.0123 1067 SER A CB  
144  O OG  . SER A 20 ? 0.2382 0.2015 0.2988 -0.0148 -0.0553 -0.0297 1067 SER A OG  
145  N N   . ASP A 21 ? 0.1833 0.1341 0.2131 0.0075  -0.0183 -0.0075 1068 ASP A N   
146  C CA  . ASP A 21 ? 0.1801 0.1449 0.2030 0.0191  -0.0137 0.0000  1068 ASP A CA  
147  C C   . ASP A 21 ? 0.1748 0.1163 0.2199 0.0054  -0.0212 -0.0216 1068 ASP A C   
148  O O   . ASP A 21 ? 0.1557 0.1562 0.2130 -0.0198 -0.0144 -0.0043 1068 ASP A O   
149  C CB  . ASP A 21 ? 0.1798 0.1502 0.2118 0.0009  -0.0197 -0.0154 1068 ASP A CB  
150  C CG  . ASP A 21 ? 0.1412 0.1539 0.2103 -0.0134 -0.0296 -0.0085 1068 ASP A CG  
151  O OD1 . ASP A 21 ? 0.1657 0.1629 0.2268 0.0011  -0.0230 -0.0008 1068 ASP A OD1 
152  O OD2 . ASP A 21 ? 0.1581 0.1809 0.2470 -0.0090 0.0131  -0.0094 1068 ASP A OD2 
153  N N   . GLU A 22 ? 0.1545 0.1512 0.2120 0.0045  -0.0127 -0.0180 1069 GLU A N   
154  C CA  . GLU A 22 ? 0.1597 0.1415 0.2034 0.0074  -0.0098 -0.0158 1069 GLU A CA  
155  C C   . GLU A 22 ? 0.1880 0.1575 0.1883 0.0278  0.0010  -0.0053 1069 GLU A C   
156  O O   . GLU A 22 ? 0.2505 0.1831 0.2176 -0.0468 -0.0012 -0.0102 1069 GLU A O   
157  C CB  . GLU A 22 ? 0.1732 0.1370 0.2003 -0.0046 0.0073  -0.0109 1069 GLU A CB  
158  C CG  . GLU A 22 ? 0.1638 0.1710 0.2076 0.0237  -0.0303 -0.0019 1069 GLU A CG  
159  C CD  . GLU A 22 ? 0.1433 0.1630 0.1985 0.0191  -0.0003 -0.0094 1069 GLU A CD  
160  O OE1 . GLU A 22 ? 0.1484 0.1851 0.2317 0.0201  0.0174  0.0050  1069 GLU A OE1 
161  O OE2 . GLU A 22 ? 0.1558 0.1859 0.2269 -0.0012 0.0014  0.0028  1069 GLU A OE2 
162  N N   . LEU A 23 ? 0.1842 0.1584 0.1944 0.0010  0.0079  -0.0140 1070 LEU A N   
163  C CA  . LEU A 23 ? 0.2034 0.1622 0.2007 0.0155  -0.0035 -0.0017 1070 LEU A CA  
164  C C   . LEU A 23 ? 0.1966 0.1793 0.2230 0.0055  0.0041  0.0085  1070 LEU A C   
165  O O   . LEU A 23 ? 0.1956 0.1916 0.2873 0.0083  0.0329  0.0307  1070 LEU A O   
166  C CB  . LEU A 23 ? 0.2227 0.1971 0.2275 -0.0038 0.0037  0.0225  1070 LEU A CB  
167  C CG  . LEU A 23 ? 0.1602 0.2764 0.2483 0.0368  0.0081  0.0227  1070 LEU A CG  
168  C CD1 . LEU A 23 ? 0.1920 0.4049 0.2341 -0.0084 -0.0416 0.0235  1070 LEU A CD1 
169  C CD2 . LEU A 23 ? 0.2665 0.2293 0.3368 0.0741  0.0277  0.0649  1070 LEU A CD2 
170  N N   . THR A 24 ? 0.1990 0.1579 0.2242 -0.0130 0.0108  0.0077  1071 THR A N   
171  C CA  . THR A 24 ? 0.1844 0.1683 0.2132 -0.0117 -0.0076 0.0057  1071 THR A CA  
172  C C   . THR A 24 ? 0.2016 0.1736 0.2072 -0.0069 0.0012  -0.0031 1071 THR A C   
173  O O   . THR A 24 ? 0.2648 0.1970 0.2272 0.0063  -0.0179 0.0165  1071 THR A O   
174  C CB  . THR A 24 ? 0.1749 0.1638 0.2575 -0.0268 -0.0033 0.0074  1071 THR A CB  
175  O OG1 . THR A 24 ? 0.2210 0.2572 0.2282 -0.0379 -0.0113 0.0199  1071 THR A OG1 
176  C CG2 . THR A 24 ? 0.1873 0.2366 0.2917 -0.0043 0.0372  0.0114  1071 THR A CG2 
177  N N   . ILE A 25 ? 0.2154 0.1729 0.2080 0.0028  -0.0009 -0.0074 1072 ILE A N   
178  C CA  . ILE A 25 ? 0.2185 0.1730 0.2151 -0.0021 0.0051  -0.0024 1072 ILE A CA  
179  C C   . ILE A 25 ? 0.2143 0.2098 0.2307 0.0010  0.0055  0.0032  1072 ILE A C   
180  O O   . ILE A 25 ? 0.2191 0.2273 0.2246 0.0124  0.0115  -0.0029 1072 ILE A O   
181  C CB  . ILE A 25 ? 0.2108 0.1895 0.2098 -0.0110 -0.0136 -0.0218 1072 ILE A CB  
182  C CG1 . ILE A 25 ? 0.2220 0.1893 0.2384 -0.0062 -0.0245 -0.0079 1072 ILE A CG1 
183  C CG2 . ILE A 25 ? 0.2027 0.2126 0.2845 0.0285  0.0141  -0.0271 1072 ILE A CG2 
184  C CD1 . ILE A 25 ? 0.1877 0.2001 0.2657 -0.0137 -0.0036 -0.0140 1072 ILE A CD1 
185  N N   . HIS A 26 ? 0.2201 0.2208 0.2285 -0.0040 0.0204  -0.0157 1073 HIS A N   
186  C CA  . HIS A 26 ? 0.2111 0.2415 0.2569 -0.0207 0.0298  0.0028  1073 HIS A CA  
187  C C   . HIS A 26 ? 0.2294 0.2159 0.2435 -0.0293 0.0255  -0.0084 1073 HIS A C   
188  O O   . HIS A 26 ? 0.2092 0.2372 0.2315 -0.0252 0.0261  -0.0013 1073 HIS A O   
189  C CB  . HIS A 26 ? 0.2464 0.2912 0.3079 -0.0699 0.0290  -0.0194 1073 HIS A CB  
190  C CG  . HIS A 26 ? 0.2889 0.4373 0.3874 -0.1143 0.0373  -0.0404 1073 HIS A CG  
191  N ND1 . HIS A 26 ? 0.5089 0.5317 0.5263 -0.1582 -0.1113 -0.0993 1073 HIS A ND1 
192  C CD2 . HIS A 26 ? 0.3559 0.4874 0.4936 -0.1367 0.0195  -0.1363 1073 HIS A CD2 
193  C CE1 . HIS A 26 ? 0.4649 0.5736 0.5082 -0.1528 -0.0583 -0.1386 1073 HIS A CE1 
194  N NE2 . HIS A 26 ? 0.3824 0.5751 0.5047 -0.1858 0.0620  -0.0993 1073 HIS A NE2 
195  N N   . ARG A 27 ? 0.1990 0.2591 0.2610 -0.0074 0.0172  -0.0069 1074 ARG A N   
196  C CA  . ARG A 27 ? 0.1949 0.2368 0.2454 -0.0018 0.0256  0.0027  1074 ARG A CA  
197  C C   . ARG A 27 ? 0.2017 0.2249 0.2387 0.0027  0.0495  -0.0060 1074 ARG A C   
198  O O   . ARG A 27 ? 0.2208 0.2953 0.2670 -0.0273 0.0482  0.0047  1074 ARG A O   
199  C CB  . ARG A 27 ? 0.2166 0.2679 0.2697 0.0096  0.0244  -0.0200 1074 ARG A CB  
200  C CG  . ARG A 27 ? 0.2498 0.3111 0.2944 0.0446  0.0440  -0.0315 1074 ARG A CG  
201  C CD  . ARG A 27 ? 0.2372 0.3200 0.3569 0.0598  0.0269  -0.0785 1074 ARG A CD  
202  N NE  . ARG A 27 ? 0.3180 0.3218 0.3939 0.0377  0.0190  -0.0495 1074 ARG A NE  
203  C CZ  . ARG A 27 ? 0.3380 0.3279 0.2850 0.0212  0.0268  -0.0571 1074 ARG A CZ  
204  N NH1 . ARG A 27 ? 0.3872 0.2789 0.3401 0.0256  0.0908  -0.0695 1074 ARG A NH1 
205  N NH2 . ARG A 27 ? 0.3630 0.3833 0.3354 0.0380  0.0174  -0.0952 1074 ARG A NH2 
206  N N   . GLY A 28 ? 0.2007 0.2361 0.2370 -0.0162 0.0239  -0.0066 1075 GLY A N   
207  C CA  . GLY A 28 ? 0.2206 0.2310 0.2265 -0.0122 0.0422  -0.0030 1075 GLY A CA  
208  C C   . GLY A 28 ? 0.2150 0.2033 0.2225 -0.0269 0.0223  0.0116  1075 GLY A C   
209  O O   . GLY A 28 ? 0.2608 0.2236 0.2255 -0.0005 0.0117  0.0115  1075 GLY A O   
210  N N   . ASP A 29 ? 0.2271 0.2111 0.2351 -0.0090 0.0155  0.0088  1076 ASP A N   
211  C CA  . ASP A 29 ? 0.2111 0.1764 0.2428 -0.0206 0.0329  0.0251  1076 ASP A CA  
212  C C   . ASP A 29 ? 0.2127 0.1773 0.2260 -0.0328 0.0206  0.0222  1076 ASP A C   
213  O O   . ASP A 29 ? 0.2189 0.1644 0.2647 -0.0337 0.0187  0.0001  1076 ASP A O   
214  C CB  . ASP A 29 ? 0.2295 0.1913 0.2512 -0.0249 0.0158  -0.0085 1076 ASP A CB  
215  C CG  . ASP A 29 ? 0.3267 0.2348 0.2385 -0.0407 -0.0024 0.0458  1076 ASP A CG  
216  O OD1 . ASP A 29 ? 0.3578 0.2971 0.2941 -0.1204 -0.0219 0.0174  1076 ASP A OD1 
217  O OD2 . ASP A 29 ? 0.3747 0.2408 0.2683 -0.0457 -0.0338 0.0304  1076 ASP A OD2 
218  N N   . ILE A 30 ? 0.2268 0.1693 0.2509 -0.0229 0.0325  0.0211  1077 ILE A N   
219  C CA  A ILE A 30 ? 0.2273 0.1679 0.2298 0.0044  0.0240  0.0099  1077 ILE A CA  
220  C CA  B ILE A 30 ? 0.2262 0.1556 0.2282 0.0037  0.0258  0.0150  1077 ILE A CA  
221  C C   . ILE A 30 ? 0.2292 0.1416 0.2091 0.0193  0.0258  0.0117  1077 ILE A C   
222  O O   . ILE A 30 ? 0.2746 0.1598 0.2573 -0.0231 0.0461  -0.0172 1077 ILE A O   
223  C CB  A ILE A 30 ? 0.2641 0.1986 0.2202 0.0015  0.0251  0.0152  1077 ILE A CB  
224  C CB  B ILE A 30 ? 0.2606 0.1820 0.2135 0.0029  0.0312  0.0194  1077 ILE A CB  
225  C CG1 A ILE A 30 ? 0.2807 0.2560 0.2461 -0.0388 0.0339  -0.0159 1077 ILE A CG1 
226  C CG1 B ILE A 30 ? 0.2813 0.2240 0.2303 -0.0252 0.0351  0.0071  1077 ILE A CG1 
227  C CG2 A ILE A 30 ? 0.2112 0.2471 0.2540 0.0061  -0.0155 -0.0150 1077 ILE A CG2 
228  C CG2 B ILE A 30 ? 0.2236 0.1655 0.2659 -0.0135 -0.0132 0.0168  1077 ILE A CG2 
229  C CD1 A ILE A 30 ? 0.4199 0.2201 0.3352 -0.0212 0.0385  -0.0307 1077 ILE A CD1 
230  C CD1 B ILE A 30 ? 0.3503 0.3263 0.1814 0.0244  0.0301  0.0529  1077 ILE A CD1 
231  N N   . ILE A 31 ? 0.2047 0.1445 0.2022 0.0022  0.0179  0.0049  1078 ILE A N   
232  C CA  . ILE A 31 ? 0.1824 0.1498 0.2003 0.0044  -0.0039 -0.0023 1078 ILE A CA  
233  C C   . ILE A 31 ? 0.1943 0.1482 0.1927 0.0023  0.0087  -0.0148 1078 ILE A C   
234  O O   . ILE A 31 ? 0.1878 0.1370 0.2514 0.0175  -0.0020 -0.0171 1078 ILE A O   
235  C CB  . ILE A 31 ? 0.1932 0.1494 0.2079 -0.0046 0.0000  0.0139  1078 ILE A CB  
236  C CG1 . ILE A 31 ? 0.1809 0.1789 0.2465 0.0227  -0.0138 -0.0125 1078 ILE A CG1 
237  C CG2 . ILE A 31 ? 0.2384 0.2346 0.1905 0.0313  0.0393  0.0342  1078 ILE A CG2 
238  C CD1 . ILE A 31 ? 0.2844 0.1650 0.2955 0.0585  -0.0542 0.0204  1078 ILE A CD1 
239  N N   . ARG A 32 ? 0.1676 0.1312 0.2174 0.0055  0.0233  -0.0106 1079 ARG A N   
240  C CA  . ARG A 32 ? 0.1842 0.1178 0.2003 0.0072  0.0041  -0.0012 1079 ARG A CA  
241  C C   . ARG A 32 ? 0.1748 0.1374 0.1879 0.0137  0.0010  0.0086  1079 ARG A C   
242  O O   . ARG A 32 ? 0.1812 0.1509 0.1963 -0.0049 0.0024  -0.0123 1079 ARG A O   
243  C CB  . ARG A 32 ? 0.1935 0.1256 0.2108 0.0166  -0.0132 0.0082  1079 ARG A CB  
244  C CG  . ARG A 32 ? 0.1649 0.1549 0.2449 0.0074  -0.0066 0.0176  1079 ARG A CG  
245  C CD  . ARG A 32 ? 0.1535 0.2007 0.2304 0.0277  -0.0076 0.0040  1079 ARG A CD  
246  N NE  . ARG A 32 ? 0.1792 0.1992 0.1971 0.0319  -0.0194 0.0036  1079 ARG A NE  
247  C CZ  . ARG A 32 ? 0.1695 0.1755 0.2124 0.0197  -0.0016 0.0066  1079 ARG A CZ  
248  N NH1 . ARG A 32 ? 0.1718 0.2304 0.2183 0.0421  0.0042  0.0285  1079 ARG A NH1 
249  N NH2 . ARG A 32 ? 0.1845 0.2127 0.2186 0.0549  -0.0188 0.0099  1079 ARG A NH2 
250  N N   . VAL A 33 ? 0.1878 0.1399 0.1771 -0.0136 -0.0029 -0.0002 1080 VAL A N   
251  C CA  . VAL A 33 ? 0.1770 0.1325 0.1908 -0.0041 -0.0058 0.0012  1080 VAL A CA  
252  C C   . VAL A 33 ? 0.1734 0.1464 0.1807 0.0056  -0.0117 0.0065  1080 VAL A C   
253  O O   . VAL A 33 ? 0.1895 0.1780 0.2094 0.0202  -0.0228 0.0044  1080 VAL A O   
254  C CB  . VAL A 33 ? 0.1983 0.1182 0.2035 -0.0066 0.0022  0.0067  1080 VAL A CB  
255  C CG1 . VAL A 33 ? 0.2424 0.1668 0.2201 -0.0078 0.0355  0.0324  1080 VAL A CG1 
256  C CG2 . VAL A 33 ? 0.2114 0.1596 0.2755 0.0400  0.0337  -0.0190 1080 VAL A CG2 
257  N N   . PHE A 34 ? 0.1623 0.1652 0.1724 0.0199  -0.0140 -0.0071 1081 PHE A N   
258  C CA  . PHE A 34 ? 0.1445 0.1582 0.2019 0.0168  -0.0024 0.0080  1081 PHE A CA  
259  C C   . PHE A 34 ? 0.1467 0.1835 0.2188 0.0083  0.0005  0.0267  1081 PHE A C   
260  O O   . PHE A 34 ? 0.1520 0.2543 0.2692 -0.0020 -0.0082 0.0628  1081 PHE A O   
261  C CB  . PHE A 34 ? 0.1724 0.1631 0.2103 0.0340  0.0003  -0.0109 1081 PHE A CB  
262  C CG  . PHE A 34 ? 0.1719 0.1484 0.2430 0.0209  -0.0123 -0.0151 1081 PHE A CG  
263  C CD1 . PHE A 34 ? 0.1762 0.1385 0.2712 0.0045  0.0039  0.0030  1081 PHE A CD1 
264  C CD2 . PHE A 34 ? 0.2182 0.1761 0.2818 0.0289  -0.0330 -0.0433 1081 PHE A CD2 
265  C CE1 . PHE A 34 ? 0.2052 0.1579 0.2858 0.0168  0.0375  -0.0080 1081 PHE A CE1 
266  C CE2 . PHE A 34 ? 0.2109 0.1682 0.3412 0.0220  -0.0063 -0.0507 1081 PHE A CE2 
267  C CZ  . PHE A 34 ? 0.1552 0.1736 0.3365 0.0233  0.0206  -0.0074 1081 PHE A CZ  
268  N N   . PHE A 35 ? 0.1453 0.1642 0.2033 0.0067  0.0006  0.0172  1082 PHE A N   
269  C CA  . PHE A 35 ? 0.1706 0.1714 0.2017 0.0193  0.0028  0.0024  1082 PHE A CA  
270  C C   . PHE A 35 ? 0.1631 0.1544 0.2063 0.0078  -0.0068 0.0025  1082 PHE A C   
271  O O   . PHE A 35 ? 0.1593 0.1618 0.2776 -0.0001 -0.0128 0.0202  1082 PHE A O   
272  C CB  . PHE A 35 ? 0.1857 0.1700 0.2193 0.0134  0.0094  0.0204  1082 PHE A CB  
273  C CG  . PHE A 35 ? 0.2388 0.2679 0.2040 0.0353  0.0001  -0.0018 1082 PHE A CG  
274  C CD1 . PHE A 35 ? 0.3023 0.2673 0.2983 0.0774  -0.0564 -0.0300 1082 PHE A CD1 
275  C CD2 . PHE A 35 ? 0.2796 0.1992 0.2283 0.0263  0.0340  -0.0342 1082 PHE A CD2 
276  C CE1 . PHE A 35 ? 0.3456 0.3036 0.3472 0.1454  -0.1241 -0.0735 1082 PHE A CE1 
277  C CE2 . PHE A 35 ? 0.4386 0.2393 0.2342 0.0391  0.0451  -0.0264 1082 PHE A CE2 
278  C CZ  . PHE A 35 ? 0.4534 0.2382 0.2619 0.0975  -0.0401 -0.0495 1082 PHE A CZ  
279  N N   . LYS A 36 ? 0.1762 0.1607 0.2197 -0.0044 -0.0174 0.0089  1083 LYS A N   
280  C CA  . LYS A 36 ? 0.1678 0.1753 0.2261 0.0048  -0.0131 -0.0014 1083 LYS A CA  
281  C C   . LYS A 36 ? 0.1842 0.1639 0.2459 -0.0004 -0.0180 -0.0042 1083 LYS A C   
282  O O   . LYS A 36 ? 0.2147 0.3109 0.2599 -0.0408 -0.0006 0.0380  1083 LYS A O   
283  C CB  . LYS A 36 ? 0.1987 0.1865 0.2407 -0.0201 -0.0295 0.0042  1083 LYS A CB  
284  C CG  . LYS A 36 ? 0.2036 0.1933 0.2297 0.0099  -0.0373 -0.0117 1083 LYS A CG  
285  C CD  . LYS A 36 ? 0.2499 0.2081 0.2940 0.0056  -0.0821 -0.0065 1083 LYS A CD  
286  C CE  . LYS A 36 ? 0.3401 0.2465 0.2768 0.0326  -0.0602 -0.0087 1083 LYS A CE  
287  N NZ  . LYS A 36 ? 0.4567 0.3181 0.3316 0.0792  -0.1193 -0.1117 1083 LYS A NZ  
288  N N   . ASP A 37 ? 0.1813 0.2169 0.2122 -0.0217 -0.0108 -0.0087 1084 ASP A N   
289  C CA  . ASP A 37 ? 0.1877 0.2276 0.2326 0.0100  0.0048  0.0047  1084 ASP A CA  
290  C C   . ASP A 37 ? 0.1983 0.2415 0.2353 -0.0082 -0.0143 -0.0042 1084 ASP A C   
291  O O   . ASP A 37 ? 0.2042 0.2760 0.3071 -0.0021 0.0181  0.0123  1084 ASP A O   
292  C CB  . ASP A 37 ? 0.1942 0.2716 0.2373 0.0211  -0.0264 -0.0353 1084 ASP A CB  
293  C CG  . ASP A 37 ? 0.1947 0.2754 0.2393 -0.0302 -0.0007 -0.0132 1084 ASP A CG  
294  O OD1 . ASP A 37 ? 0.2548 0.4692 0.2691 -0.0975 0.0222  -0.0583 1084 ASP A OD1 
295  O OD2 . ASP A 37 ? 0.1897 0.3283 0.2306 0.0091  0.0006  0.0154  1084 ASP A OD2 
296  N N   . ASN A 38 ? 0.2097 0.2127 0.2546 -0.0124 0.0043  0.0059  1085 ASN A N   
297  C CA  . ASN A 38 ? 0.1914 0.1995 0.2599 -0.0397 -0.0102 -0.0044 1085 ASN A CA  
298  C C   . ASN A 38 ? 0.2013 0.2061 0.2702 -0.0284 -0.0198 -0.0005 1085 ASN A C   
299  O O   . ASN A 38 ? 0.2853 0.2262 0.2449 0.0010  -0.0038 -0.0047 1085 ASN A O   
300  C CB  . ASN A 38 ? 0.2220 0.2222 0.2541 -0.0442 0.0005  0.0090  1085 ASN A CB  
301  C CG  . ASN A 38 ? 0.1754 0.2416 0.2539 -0.0169 -0.0065 -0.0151 1085 ASN A CG  
302  O OD1 . ASN A 38 ? 0.1908 0.1842 0.2180 -0.0176 0.0050  -0.0083 1085 ASN A OD1 
303  N ND2 . ASN A 38 ? 0.2437 0.3195 0.2624 -0.0367 0.0060  -0.0831 1085 ASN A ND2 
304  N N   A GLU A 39 ? 0.2477 0.1913 0.2850 -0.0447 -0.0117 -0.0127 1086 GLU A N   
305  N N   B GLU A 39 ? 0.2355 0.2027 0.2744 -0.0346 -0.0217 0.0009  1086 GLU A N   
306  C CA  A GLU A 39 ? 0.2707 0.1821 0.2954 -0.0421 -0.0017 -0.0411 1086 GLU A CA  
307  C CA  B GLU A 39 ? 0.2458 0.2130 0.2797 -0.0230 -0.0094 -0.0091 1086 GLU A CA  
308  C C   A GLU A 39 ? 0.2571 0.1762 0.2650 -0.0321 -0.0012 -0.0299 1086 GLU A C   
309  C C   B GLU A 39 ? 0.2390 0.1889 0.2578 -0.0262 -0.0070 -0.0197 1086 GLU A C   
310  O O   A GLU A 39 ? 0.2962 0.2596 0.2647 -0.0392 0.0041  -0.0661 1086 GLU A O   
311  O O   B GLU A 39 ? 0.2962 0.2772 0.2678 -0.0458 0.0062  -0.0610 1086 GLU A O   
312  C CB  A GLU A 39 ? 0.3180 0.1663 0.3430 -0.0870 0.0132  -0.0499 1086 GLU A CB  
313  C CB  B GLU A 39 ? 0.2380 0.2154 0.2897 -0.0520 -0.0221 0.0084  1086 GLU A CB  
314  C CG  A GLU A 39 ? 0.3931 0.2559 0.4314 -0.0711 0.0166  -0.0278 1086 GLU A CG  
315  C CG  B GLU A 39 ? 0.3773 0.3596 0.4152 -0.0578 0.0174  0.0248  1086 GLU A CG  
316  C CD  A GLU A 39 ? 0.4788 0.3161 0.5106 -0.0832 0.0398  0.0322  1086 GLU A CD  
317  C CD  B GLU A 39 ? 0.3639 0.4835 0.5437 -0.1095 -0.0018 -0.0193 1086 GLU A CD  
318  O OE1 A GLU A 39 ? 0.4494 0.2484 0.6141 -0.0637 0.0565  0.1265  1086 GLU A OE1 
319  O OE1 B GLU A 39 ? 0.4703 0.4016 0.5142 -0.1300 -0.0184 -0.0480 1086 GLU A OE1 
320  O OE2 A GLU A 39 ? 0.5639 0.2868 0.5843 -0.0570 -0.0328 0.0441  1086 GLU A OE2 
321  O OE2 B GLU A 39 ? 0.3950 0.5447 0.6983 -0.1641 0.1179  0.0127  1086 GLU A OE2 
322  N N   . ASP A 40 ? 0.2173 0.1422 0.2303 -0.0092 -0.0089 -0.0214 1087 ASP A N   
323  C CA  . ASP A 40 ? 0.1875 0.1516 0.2308 -0.0042 0.0178  -0.0107 1087 ASP A CA  
324  C C   . ASP A 40 ? 0.2164 0.1454 0.1880 0.0030  0.0153  -0.0008 1087 ASP A C   
325  O O   . ASP A 40 ? 0.2206 0.1384 0.2309 0.0176  0.0334  0.0038  1087 ASP A O   
326  C CB  . ASP A 40 ? 0.2091 0.1377 0.2363 0.0018  -0.0019 0.0257  1087 ASP A CB  
327  C CG  . ASP A 40 ? 0.2274 0.1717 0.2271 0.0235  0.0185  0.0009  1087 ASP A CG  
328  O OD1 . ASP A 40 ? 0.2993 0.1500 0.2686 0.0166  0.0287  -0.0005 1087 ASP A OD1 
329  O OD2 . ASP A 40 ? 0.3301 0.1810 0.2641 -0.0067 0.0407  0.0054  1087 ASP A OD2 
330  N N   . TRP A 41 ? 0.1830 0.1436 0.1942 -0.0050 0.0029  0.0007  1088 TRP A N   
331  C CA  . TRP A 41 ? 0.1907 0.1291 0.1805 -0.0031 -0.0057 0.0102  1088 TRP A CA  
332  C C   . TRP A 41 ? 0.1572 0.1198 0.1913 -0.0078 -0.0090 0.0091  1088 TRP A C   
333  O O   . TRP A 41 ? 0.1660 0.1694 0.2165 -0.0064 0.0095  0.0134  1088 TRP A O   
334  C CB  . TRP A 41 ? 0.1923 0.1264 0.1886 -0.0071 -0.0134 0.0002  1088 TRP A CB  
335  C CG  . TRP A 41 ? 0.1850 0.1550 0.1905 -0.0092 -0.0204 -0.0007 1088 TRP A CG  
336  C CD1 . TRP A 41 ? 0.1887 0.1824 0.2133 0.0081  -0.0122 0.0140  1088 TRP A CD1 
337  C CD2 . TRP A 41 ? 0.1826 0.1430 0.1899 0.0004  -0.0147 0.0003  1088 TRP A CD2 
338  N NE1 . TRP A 41 ? 0.1938 0.2546 0.2779 0.0099  -0.0330 0.0914  1088 TRP A NE1 
339  C CE2 . TRP A 41 ? 0.1833 0.2315 0.2344 -0.0241 -0.0403 0.0361  1088 TRP A CE2 
340  C CE3 . TRP A 41 ? 0.1818 0.1800 0.2069 -0.0278 -0.0016 -0.0017 1088 TRP A CE3 
341  C CZ2 . TRP A 41 ? 0.1940 0.2678 0.3168 -0.0291 -0.0528 0.0470  1088 TRP A CZ2 
342  C CZ3 . TRP A 41 ? 0.1774 0.1931 0.2252 -0.0237 0.0140  -0.0275 1088 TRP A CZ3 
343  C CH2 . TRP A 41 ? 0.1517 0.2397 0.2982 -0.0419 -0.0273 -0.0013 1088 TRP A CH2 
344  N N   . TRP A 42 ? 0.1467 0.1256 0.1878 0.0098  -0.0014 0.0035  1089 TRP A N   
345  C CA  . TRP A 42 ? 0.1426 0.1262 0.1883 0.0085  -0.0121 -0.0013 1089 TRP A CA  
346  C C   . TRP A 42 ? 0.1462 0.1220 0.1917 0.0160  0.0022  -0.0110 1089 TRP A C   
347  O O   . TRP A 42 ? 0.1608 0.1280 0.2089 0.0103  -0.0250 -0.0103 1089 TRP A O   
348  C CB  . TRP A 42 ? 0.1829 0.1166 0.2039 0.0010  -0.0177 -0.0060 1089 TRP A CB  
349  C CG  . TRP A 42 ? 0.1718 0.1229 0.2005 -0.0127 -0.0112 -0.0089 1089 TRP A CG  
350  C CD1 . TRP A 42 ? 0.1606 0.1352 0.2209 -0.0141 -0.0242 -0.0162 1089 TRP A CD1 
351  C CD2 . TRP A 42 ? 0.2087 0.1417 0.2000 0.0107  -0.0167 -0.0135 1089 TRP A CD2 
352  N NE1 . TRP A 42 ? 0.1742 0.1523 0.2122 -0.0238 -0.0098 -0.0013 1089 TRP A NE1 
353  C CE2 . TRP A 42 ? 0.1865 0.1502 0.2066 -0.0026 -0.0148 -0.0131 1089 TRP A CE2 
354  C CE3 . TRP A 42 ? 0.2098 0.1907 0.1970 -0.0312 -0.0088 -0.0206 1089 TRP A CE3 
355  C CZ2 . TRP A 42 ? 0.2425 0.1670 0.2187 -0.0167 -0.0209 -0.0373 1089 TRP A CZ2 
356  C CZ3 . TRP A 42 ? 0.2562 0.2272 0.2071 -0.0274 0.0069  -0.0271 1089 TRP A CZ3 
357  C CH2 . TRP A 42 ? 0.2725 0.2166 0.2180 -0.0263 -0.0084 -0.0571 1089 TRP A CH2 
358  N N   . TYR A 43 ? 0.1569 0.1147 0.2073 0.0165  -0.0180 -0.0055 1090 TYR A N   
359  C CA  . TYR A 43 ? 0.1644 0.1214 0.1830 0.0039  -0.0130 0.0041  1090 TYR A CA  
360  C C   . TYR A 43 ? 0.1695 0.1263 0.1723 -0.0006 0.0009  -0.0072 1090 TYR A C   
361  O O   . TYR A 43 ? 0.1590 0.1472 0.1935 -0.0106 -0.0154 0.0045  1090 TYR A O   
362  C CB  . TYR A 43 ? 0.1806 0.1296 0.1754 -0.0110 0.0020  -0.0106 1090 TYR A CB  
363  C CG  . TYR A 43 ? 0.1491 0.1305 0.1874 0.0133  0.0153  -0.0019 1090 TYR A CG  
364  C CD1 . TYR A 43 ? 0.1536 0.1234 0.2209 -0.0053 0.0008  0.0005  1090 TYR A CD1 
365  C CD2 . TYR A 43 ? 0.1626 0.1348 0.2004 0.0179  -0.0057 -0.0198 1090 TYR A CD2 
366  C CE1 . TYR A 43 ? 0.1300 0.1539 0.2321 0.0029  -0.0049 0.0019  1090 TYR A CE1 
367  C CE2 . TYR A 43 ? 0.1522 0.1629 0.2054 0.0460  -0.0141 -0.0274 1090 TYR A CE2 
368  C CZ  . TYR A 43 ? 0.1236 0.1180 0.2747 0.0220  0.0220  -0.0351 1090 TYR A CZ  
369  O OH  . TYR A 43 ? 0.1549 0.1438 0.3209 0.0061  0.0225  -0.0589 1090 TYR A OH  
370  N N   . GLY A 44 ? 0.1658 0.1290 0.1812 0.0039  -0.0090 -0.0046 1091 GLY A N   
371  C CA  . GLY A 44 ? 0.1782 0.1385 0.2037 -0.0180 -0.0018 0.0288  1091 GLY A CA  
372  C C   . GLY A 44 ? 0.1793 0.1290 0.2007 0.0041  -0.0112 0.0076  1091 GLY A C   
373  O O   . GLY A 44 ? 0.2065 0.1524 0.2075 -0.0192 -0.0351 0.0157  1091 GLY A O   
374  N N   . SER A 45 ? 0.1792 0.1420 0.1850 -0.0278 -0.0041 0.0076  1092 SER A N   
375  C CA  . SER A 45 ? 0.1507 0.1548 0.1996 -0.0255 0.0053  -0.0111 1092 SER A CA  
376  C C   . SER A 45 ? 0.1836 0.1552 0.2271 -0.0090 0.0135  -0.0065 1092 SER A C   
377  O O   . SER A 45 ? 0.1790 0.1531 0.2302 -0.0094 0.0172  -0.0083 1092 SER A O   
378  C CB  . SER A 45 ? 0.1641 0.1591 0.2683 -0.0251 0.0252  -0.0029 1092 SER A CB  
379  O OG  . SER A 45 ? 0.1809 0.1732 0.3382 -0.0004 0.0225  0.0041  1092 SER A OG  
380  N N   . ILE A 46 ? 0.1814 0.1561 0.2186 -0.0002 0.0247  -0.0087 1093 ILE A N   
381  C CA  . ILE A 46 ? 0.1691 0.1871 0.2364 0.0166  0.0280  0.0060  1093 ILE A CA  
382  C C   . ILE A 46 ? 0.1934 0.1893 0.2657 0.0285  0.0366  0.0207  1093 ILE A C   
383  O O   . ILE A 46 ? 0.2528 0.2303 0.3181 0.0385  0.0904  0.0281  1093 ILE A O   
384  C CB  . ILE A 46 ? 0.1758 0.2158 0.2665 0.0174  0.0377  0.0154  1093 ILE A CB  
385  C CG1 . ILE A 46 ? 0.1840 0.2174 0.2830 0.0043  0.0216  0.0074  1093 ILE A CG1 
386  C CG2 . ILE A 46 ? 0.2610 0.1518 0.3171 0.0336  0.0336  0.0418  1093 ILE A CG2 
387  C CD1 . ILE A 46 ? 0.1572 0.3708 0.3532 0.0294  -0.0277 0.0041  1093 ILE A CD1 
388  N N   . GLY A 47 ? 0.1912 0.1642 0.2559 0.0008  0.0476  0.0256  1094 GLY A N   
389  C CA  . GLY A 47 ? 0.2119 0.1853 0.2542 0.0067  0.0353  0.0255  1094 GLY A CA  
390  C C   . GLY A 47 ? 0.1931 0.1690 0.2436 -0.0060 0.0182  0.0228  1094 GLY A C   
391  O O   . GLY A 47 ? 0.1960 0.1653 0.2448 -0.0125 0.0203  0.0126  1094 GLY A O   
392  N N   . LYS A 48 ? 0.2126 0.1699 0.2462 0.0007  0.0256  0.0205  1095 LYS A N   
393  C CA  A LYS A 48 ? 0.2031 0.1758 0.2482 -0.0031 0.0087  0.0246  1095 LYS A CA  
394  C CA  B LYS A 48 ? 0.2187 0.1770 0.2545 -0.0043 0.0058  0.0198  1095 LYS A CA  
395  C C   . LYS A 48 ? 0.2232 0.1523 0.2521 -0.0094 0.0022  0.0213  1095 LYS A C   
396  O O   . LYS A 48 ? 0.2294 0.1964 0.2803 -0.0338 -0.0136 0.0321  1095 LYS A O   
397  C CB  A LYS A 48 ? 0.2248 0.1876 0.2579 -0.0188 0.0110  0.0463  1095 LYS A CB  
398  C CB  B LYS A 48 ? 0.2548 0.1961 0.2696 -0.0226 0.0090  0.0321  1095 LYS A CB  
399  C CG  A LYS A 48 ? 0.1915 0.1764 0.2738 -0.0125 -0.0007 0.0345  1095 LYS A CG  
400  C CG  B LYS A 48 ? 0.2984 0.1494 0.3121 -0.0247 -0.0196 0.0162  1095 LYS A CG  
401  C CD  A LYS A 48 ? 0.2277 0.1918 0.3368 -0.0038 0.0323  0.0279  1095 LYS A CD  
402  C CD  B LYS A 48 ? 0.3482 0.2232 0.3343 -0.0283 0.0010  0.0352  1095 LYS A CD  
403  C CE  A LYS A 48 ? 0.3252 0.2473 0.4016 -0.0161 0.0448  0.0238  1095 LYS A CE  
404  C CE  B LYS A 48 ? 0.3599 0.2386 0.3518 -0.0632 0.0099  0.0706  1095 LYS A CE  
405  N NZ  A LYS A 48 ? 0.4927 0.3845 0.4298 -0.0937 0.0599  -0.0021 1095 LYS A NZ  
406  N NZ  B LYS A 48 ? 0.4194 0.2554 0.4368 -0.1315 0.0696  0.1237  1095 LYS A NZ  
407  N N   . GLY A 49 ? 0.2082 0.1651 0.2427 0.0032  0.0077  0.0175  1096 GLY A N   
408  C CA  . GLY A 49 ? 0.2497 0.1377 0.2625 0.0076  0.0062  0.0048  1096 GLY A CA  
409  C C   . GLY A 49 ? 0.2196 0.1660 0.2333 -0.0011 -0.0063 0.0131  1096 GLY A C   
410  O O   . GLY A 49 ? 0.2910 0.1712 0.2654 -0.0022 -0.0294 -0.0075 1096 GLY A O   
411  N N   . GLN A 50 ? 0.1920 0.1515 0.2331 -0.0110 -0.0053 0.0118  1097 GLN A N   
412  C CA  . GLN A 50 ? 0.1690 0.1526 0.2420 -0.0142 -0.0070 0.0164  1097 GLN A CA  
413  C C   . GLN A 50 ? 0.1815 0.1423 0.2306 -0.0285 0.0072  -0.0051 1097 GLN A C   
414  O O   . GLN A 50 ? 0.2082 0.1673 0.2240 -0.0341 0.0125  -0.0039 1097 GLN A O   
415  C CB  . GLN A 50 ? 0.1872 0.1711 0.2929 -0.0351 -0.0048 0.0047  1097 GLN A CB  
416  C CG  . GLN A 50 ? 0.2178 0.2187 0.3096 -0.0413 0.0229  0.0213  1097 GLN A CG  
417  C CD  . GLN A 50 ? 0.3355 0.4412 0.4605 -0.0875 0.0164  -0.0252 1097 GLN A CD  
418  O OE1 . GLN A 50 ? 0.4602 0.5787 0.6941 -0.0220 0.1476  -0.0168 1097 GLN A OE1 
419  N NE2 . GLN A 50 ? 0.5101 0.5846 0.4266 -0.1993 0.0827  0.0057  1097 GLN A NE2 
420  N N   A GLU A 51 ? 0.1757 0.1290 0.2185 -0.0170 -0.0019 0.0000  1098 GLU A N   
421  N N   B GLU A 51 ? 0.1760 0.1464 0.2175 -0.0229 -0.0009 -0.0017 1098 GLU A N   
422  C CA  A GLU A 51 ? 0.1716 0.1231 0.2188 -0.0161 -0.0138 0.0102  1098 GLU A CA  
423  C CA  B GLU A 51 ? 0.1921 0.1423 0.2220 -0.0171 -0.0073 0.0163  1098 GLU A CA  
424  C C   A GLU A 51 ? 0.1585 0.1428 0.2036 -0.0174 -0.0113 0.0009  1098 GLU A C   
425  C C   B GLU A 51 ? 0.1618 0.1471 0.2044 -0.0176 -0.0095 0.0029  1098 GLU A C   
426  O O   A GLU A 51 ? 0.2266 0.1466 0.2281 -0.0230 -0.0259 -0.0012 1098 GLU A O   
427  O O   B GLU A 51 ? 0.2292 0.1316 0.2249 -0.0249 -0.0071 -0.0044 1098 GLU A O   
428  C CB  A GLU A 51 ? 0.1755 0.1656 0.2534 -0.0229 -0.0185 0.0205  1098 GLU A CB  
429  C CB  B GLU A 51 ? 0.1880 0.1749 0.2667 -0.0337 -0.0128 0.0293  1098 GLU A CB  
430  C CG  A GLU A 51 ? 0.1731 0.1140 0.2846 -0.0118 -0.0187 0.0006  1098 GLU A CG  
431  C CG  B GLU A 51 ? 0.2126 0.2234 0.3058 -0.0112 -0.0013 0.0271  1098 GLU A CG  
432  C CD  A GLU A 51 ? 0.1087 0.1791 0.2831 -0.0313 0.0387  0.0420  1098 GLU A CD  
433  C CD  B GLU A 51 ? 0.1983 0.2703 0.2776 0.0100  -0.0349 0.0543  1098 GLU A CD  
434  O OE1 A GLU A 51 ? 0.2293 0.2424 0.3143 -0.0127 -0.0384 -0.0103 1098 GLU A OE1 
435  O OE1 B GLU A 51 ? 0.3062 0.2926 0.4077 0.0350  0.0050  -0.0127 1098 GLU A OE1 
436  O OE2 A GLU A 51 ? 0.1658 0.1243 0.2823 -0.0128 0.0053  -0.0237 1098 GLU A OE2 
437  O OE2 B GLU A 51 ? 0.3467 0.3657 0.3037 -0.1082 -0.0298 -0.0069 1098 GLU A OE2 
438  N N   . GLY A 52 ? 0.1571 0.1220 0.2049 -0.0134 -0.0112 0.0028  1099 GLY A N   
439  C CA  . GLY A 52 ? 0.1498 0.1321 0.2010 -0.0064 -0.0004 -0.0043 1099 GLY A CA  
440  C C   . GLY A 52 ? 0.1368 0.1236 0.1830 0.0029  -0.0210 -0.0098 1099 GLY A C   
441  O O   . GLY A 52 ? 0.1582 0.1401 0.1893 -0.0013 -0.0157 -0.0042 1099 GLY A O   
442  N N   . TYR A 53 ? 0.1740 0.1184 0.1770 0.0092  -0.0217 -0.0119 1100 TYR A N   
443  C CA  . TYR A 53 ? 0.1521 0.1204 0.1912 -0.0012 -0.0032 -0.0088 1100 TYR A CA  
444  C C   . TYR A 53 ? 0.1759 0.1158 0.1872 0.0015  -0.0075 0.0008  1100 TYR A C   
445  O O   . TYR A 53 ? 0.1698 0.1357 0.2281 -0.0058 -0.0025 -0.0178 1100 TYR A O   
446  C CB  . TYR A 53 ? 0.1552 0.1284 0.1822 0.0256  -0.0151 -0.0132 1100 TYR A CB  
447  C CG  . TYR A 53 ? 0.1699 0.1264 0.1826 -0.0083 -0.0094 0.0068  1100 TYR A CG  
448  C CD1 . TYR A 53 ? 0.1970 0.1565 0.2229 -0.0022 -0.0230 -0.0043 1100 TYR A CD1 
449  C CD2 . TYR A 53 ? 0.1478 0.1582 0.1972 0.0233  -0.0035 -0.0164 1100 TYR A CD2 
450  C CE1 . TYR A 53 ? 0.1727 0.2254 0.2640 -0.0449 -0.0289 0.0677  1100 TYR A CE1 
451  C CE2 . TYR A 53 ? 0.1612 0.2417 0.1676 0.0148  -0.0288 -0.0140 1100 TYR A CE2 
452  C CZ  . TYR A 53 ? 0.1523 0.3197 0.1972 0.0179  0.0117  0.0289  1100 TYR A CZ  
453  O OH  . TYR A 53 ? 0.1699 0.6264 0.2361 0.0332  0.0162  0.1141  1100 TYR A OH  
454  N N   . PHE A 54 ? 0.1581 0.1178 0.2013 0.0111  0.0004  -0.0079 1101 PHE A N   
455  C CA  . PHE A 54 ? 0.1633 0.1159 0.2133 0.0136  0.0109  -0.0142 1101 PHE A CA  
456  C C   . PHE A 54 ? 0.1444 0.1299 0.1934 0.0053  0.0094  -0.0245 1101 PHE A C   
457  O O   . PHE A 54 ? 0.1569 0.1241 0.2090 0.0042  0.0072  -0.0098 1101 PHE A O   
458  C CB  . PHE A 54 ? 0.1935 0.1210 0.2149 -0.0038 0.0097  -0.0053 1101 PHE A CB  
459  C CG  . PHE A 54 ? 0.1786 0.1336 0.2178 0.0051  0.0280  -0.0202 1101 PHE A CG  
460  C CD1 . PHE A 54 ? 0.2085 0.1576 0.2084 0.0237  0.0117  -0.0086 1101 PHE A CD1 
461  C CD2 . PHE A 54 ? 0.2131 0.1295 0.1957 0.0122  0.0124  -0.0093 1101 PHE A CD2 
462  C CE1 . PHE A 54 ? 0.2090 0.1704 0.1932 0.0150  0.0195  -0.0028 1101 PHE A CE1 
463  C CE2 . PHE A 54 ? 0.2236 0.1735 0.1804 -0.0099 -0.0130 -0.0086 1101 PHE A CE2 
464  C CZ  . PHE A 54 ? 0.2172 0.1806 0.2127 0.0148  -0.0055 0.0058  1101 PHE A CZ  
465  N N   . PRO A 55 ? 0.1465 0.1217 0.2088 0.0149  0.0030  -0.0128 1102 PRO A N   
466  C CA  . PRO A 55 ? 0.1703 0.1175 0.1952 0.0218  -0.0056 -0.0048 1102 PRO A CA  
467  C C   . PRO A 55 ? 0.1703 0.1293 0.1727 0.0082  -0.0085 -0.0126 1102 PRO A C   
468  O O   . PRO A 55 ? 0.1787 0.1261 0.2090 0.0074  0.0113  -0.0071 1102 PRO A O   
469  C CB  . PRO A 55 ? 0.1813 0.1528 0.2368 0.0451  -0.0219 -0.0056 1102 PRO A CB  
470  C CG  . PRO A 55 ? 0.1916 0.1742 0.3464 0.0285  -0.0274 -0.0387 1102 PRO A CG  
471  C CD  . PRO A 55 ? 0.1512 0.1603 0.2291 0.0163  -0.0018 -0.0204 1102 PRO A CD  
472  N N   . ALA A 56 ? 0.1659 0.1389 0.1950 0.0048  0.0013  -0.0142 1103 ALA A N   
473  C CA  . ALA A 56 ? 0.1705 0.1362 0.1930 0.0043  -0.0008 -0.0159 1103 ALA A CA  
474  C C   . ALA A 56 ? 0.1746 0.1483 0.1955 -0.0213 -0.0124 -0.0022 1103 ALA A C   
475  O O   . ALA A 56 ? 0.1930 0.1450 0.2052 0.0034  -0.0098 -0.0019 1103 ALA A O   
476  C CB  . ALA A 56 ? 0.1590 0.1642 0.2552 -0.0326 0.0223  -0.0038 1103 ALA A CB  
477  N N   . ASN A 57 ? 0.1722 0.1320 0.1977 0.0024  -0.0067 -0.0074 1104 ASN A N   
478  C CA  . ASN A 57 ? 0.1771 0.1148 0.2055 0.0004  0.0051  -0.0182 1104 ASN A CA  
479  C C   . ASN A 57 ? 0.1658 0.1390 0.1845 -0.0004 0.0035  -0.0172 1104 ASN A C   
480  O O   . ASN A 57 ? 0.1963 0.1459 0.2017 0.0058  0.0073  -0.0286 1104 ASN A O   
481  C CB  . ASN A 57 ? 0.1501 0.1279 0.2065 0.0100  0.0021  -0.0098 1104 ASN A CB  
482  C CG  . ASN A 57 ? 0.2063 0.1141 0.2163 -0.0091 -0.0103 -0.0152 1104 ASN A CG  
483  O OD1 . ASN A 57 ? 0.2179 0.1276 0.2271 -0.0079 -0.0147 -0.0011 1104 ASN A OD1 
484  N ND2 . ASN A 57 ? 0.2429 0.1581 0.2218 0.0176  -0.0131 0.0083  1104 ASN A ND2 
485  N N   . HIS A 58 ? 0.1727 0.1190 0.1960 0.0007  0.0178  -0.0016 1105 HIS A N   
486  C CA  . HIS A 58 ? 0.1660 0.1425 0.1781 0.0002  -0.0007 -0.0107 1105 HIS A CA  
487  C C   . HIS A 58 ? 0.1864 0.1487 0.1776 0.0006  -0.0033 -0.0054 1105 HIS A C   
488  O O   . HIS A 58 ? 0.1889 0.1599 0.2125 -0.0154 0.0150  0.0105  1105 HIS A O   
489  C CB  . HIS A 58 ? 0.1743 0.1572 0.1927 -0.0063 0.0074  -0.0188 1105 HIS A CB  
490  C CG  . HIS A 58 ? 0.1842 0.1748 0.1993 0.0186  -0.0043 -0.0142 1105 HIS A CG  
491  N ND1 . HIS A 58 ? 0.1809 0.1927 0.2282 0.0286  -0.0267 0.0063  1105 HIS A ND1 
492  C CD2 . HIS A 58 ? 0.1554 0.2013 0.2548 0.0100  -0.0032 -0.0095 1105 HIS A CD2 
493  C CE1 . HIS A 58 ? 0.2117 0.2021 0.2313 0.0189  -0.0223 0.0313  1105 HIS A CE1 
494  N NE2 . HIS A 58 ? 0.1936 0.1962 0.2851 0.0122  -0.0225 -0.0062 1105 HIS A NE2 
495  N N   . VAL A 59 ? 0.1888 0.1390 0.1788 0.0019  -0.0183 -0.0059 1106 VAL A N   
496  C CA  . VAL A 59 ? 0.2018 0.1472 0.1828 0.0018  -0.0088 -0.0101 1106 VAL A CA  
497  C C   . VAL A 59 ? 0.1876 0.1545 0.1942 -0.0073 -0.0133 -0.0054 1106 VAL A C   
498  O O   . VAL A 59 ? 0.2298 0.1529 0.2191 -0.0311 -0.0279 0.0141  1106 VAL A O   
499  C CB  . VAL A 59 ? 0.2088 0.1587 0.1997 0.0199  -0.0109 0.0038  1106 VAL A CB  
500  C CG1 . VAL A 59 ? 0.2597 0.1439 0.2395 0.0144  -0.0111 -0.0388 1106 VAL A CG1 
501  C CG2 . VAL A 59 ? 0.1719 0.2315 0.2624 -0.0006 0.0050  0.0487  1106 VAL A CG2 
502  N N   . ALA A 60 ? 0.2234 0.1321 0.2003 -0.0148 -0.0203 -0.0108 1107 ALA A N   
503  C CA  . ALA A 60 ? 0.2202 0.1170 0.1975 -0.0108 -0.0287 -0.0114 1107 ALA A CA  
504  C C   . ALA A 60 ? 0.1911 0.1556 0.1829 -0.0038 -0.0046 -0.0101 1107 ALA A C   
505  O O   . ALA A 60 ? 0.2090 0.1292 0.2189 -0.0054 -0.0029 -0.0090 1107 ALA A O   
506  C CB  . ALA A 60 ? 0.2535 0.2094 0.2779 0.0593  -0.0230 -0.0825 1107 ALA A CB  
507  N N   . SER A 61 ? 0.2003 0.1508 0.1961 -0.0197 -0.0046 -0.0050 1108 SER A N   
508  C CA  . SER A 61 ? 0.1964 0.1669 0.1943 0.0105  0.0021  -0.0248 1108 SER A CA  
509  C C   . SER A 61 ? 0.2382 0.1554 0.2092 -0.0104 0.0018  -0.0111 1108 SER A C   
510  O O   . SER A 61 ? 0.2309 0.1660 0.1918 -0.0241 0.0094  -0.0105 1108 SER A O   
511  C CB  . SER A 61 ? 0.2206 0.1768 0.2136 -0.0076 -0.0131 -0.0159 1108 SER A CB  
512  O OG  . SER A 61 ? 0.2142 0.1731 0.2143 -0.0100 -0.0043 -0.0105 1108 SER A OG  
513  N N   A GLU A 62 ? 0.2716 0.1551 0.2108 0.0169  -0.0041 -0.0063 1109 GLU A N   
514  N N   B GLU A 62 ? 0.2715 0.1461 0.2165 0.0122  -0.0032 -0.0065 1109 GLU A N   
515  C CA  A GLU A 62 ? 0.3089 0.1964 0.2189 -0.0023 -0.0104 -0.0093 1109 GLU A CA  
516  C CA  B GLU A 62 ? 0.3115 0.1863 0.2326 -0.0123 -0.0091 -0.0048 1109 GLU A CA  
517  C C   A GLU A 62 ? 0.3085 0.1819 0.1976 -0.0152 0.0000  -0.0004 1109 GLU A C   
518  C C   B GLU A 62 ? 0.3088 0.1736 0.2055 -0.0216 0.0001  0.0029  1109 GLU A C   
519  O O   A GLU A 62 ? 0.3234 0.2059 0.2220 -0.0334 0.0083  -0.0094 1109 GLU A O   
520  O O   B GLU A 62 ? 0.3235 0.2064 0.2243 -0.0426 0.0102  0.0026  1109 GLU A O   
521  C CB  A GLU A 62 ? 0.3483 0.2212 0.2357 -0.0104 -0.0168 -0.0062 1109 GLU A CB  
522  C CB  B GLU A 62 ? 0.3455 0.1768 0.2571 -0.0249 -0.0158 -0.0021 1109 GLU A CB  
523  C CG  A GLU A 62 ? 0.3659 0.2713 0.2500 0.0378  -0.0571 -0.0092 1109 GLU A CG  
524  C CG  B GLU A 62 ? 0.3892 0.2622 0.3228 -0.0134 -0.0352 0.0053  1109 GLU A CG  
525  C CD  A GLU A 62 ? 0.4415 0.2839 0.2955 -0.0286 -0.0218 -0.0363 1109 GLU A CD  
526  C CD  B GLU A 62 ? 0.4305 0.2806 0.4062 -0.0154 -0.0671 0.0833  1109 GLU A CD  
527  O OE1 A GLU A 62 ? 0.4808 0.3718 0.2789 0.0021  0.0147  0.0291  1109 GLU A OE1 
528  O OE1 B GLU A 62 ? 0.4644 0.3369 0.4775 0.1049  -0.0986 0.0286  1109 GLU A OE1 
529  O OE2 A GLU A 62 ? 0.4335 0.1715 0.4081 -0.0104 -0.0504 -0.0601 1109 GLU A OE2 
530  O OE2 B GLU A 62 ? 0.4505 0.3447 0.5302 0.0302  -0.0854 0.0689  1109 GLU A OE2 
531  N N   . THR A 63 ? 0.2911 0.1664 0.2075 -0.0208 0.0025  -0.0005 1110 THR A N   
532  C CA  . THR A 63 ? 0.2859 0.1904 0.2067 -0.0179 -0.0119 -0.0023 1110 THR A CA  
533  C C   . THR A 63 ? 0.2581 0.1969 0.2316 -0.0424 0.0043  -0.0213 1110 THR A C   
534  O O   . THR A 63 ? 0.2815 0.2263 0.2222 -0.0235 0.0448  -0.0323 1110 THR A O   
535  C CB  . THR A 63 ? 0.2763 0.1914 0.2541 -0.0144 -0.0324 0.0039  1110 THR A CB  
536  O OG1 . THR A 63 ? 0.3367 0.2315 0.3400 0.0192  -0.0911 -0.0391 1110 THR A OG1 
537  C CG2 . THR A 63 ? 0.3239 0.2076 0.2423 -0.0181 -0.0159 -0.0594 1110 THR A CG2 
538  N N   . LEU A 64 ? 0.2277 0.1773 0.2095 -0.0258 0.0157  -0.0173 1111 LEU A N   
539  C CA  . LEU A 64 ? 0.2129 0.1854 0.2503 -0.0031 0.0099  -0.0303 1111 LEU A CA  
540  C C   . LEU A 64 ? 0.2123 0.2374 0.2315 -0.0216 0.0202  -0.0440 1111 LEU A C   
541  O O   . LEU A 64 ? 0.2267 0.2429 0.2660 -0.0311 0.0523  -0.0627 1111 LEU A O   
542  C CB  . LEU A 64 ? 0.2207 0.1756 0.2691 -0.0081 -0.0093 0.0162  1111 LEU A CB  
543  C CG  . LEU A 64 ? 0.2220 0.2170 0.2857 0.0252  -0.0062 -0.0498 1111 LEU A CG  
544  C CD1 . LEU A 64 ? 0.3370 0.2719 0.2636 0.0496  0.0005  0.0435  1111 LEU A CD1 
545  C CD2 . LEU A 64 ? 0.2685 0.2834 0.3221 0.0344  -0.0284 -0.0586 1111 LEU A CD2 
546  N N   . TYR A 65 ? 0.2091 0.1979 0.2309 -0.0378 0.0322  -0.0361 1112 TYR A N   
547  C CA  . TYR A 65 ? 0.2229 0.2281 0.2291 -0.0672 0.0135  -0.0360 1112 TYR A CA  
548  C C   . TYR A 65 ? 0.2651 0.2761 0.2594 -0.0660 0.0073  -0.0485 1112 TYR A C   
549  O O   . TYR A 65 ? 0.2740 0.3358 0.2705 -0.0672 0.0214  -0.0443 1112 TYR A O   
550  C CB  . TYR A 65 ? 0.2327 0.2198 0.2402 -0.0552 0.0046  -0.0192 1112 TYR A CB  
551  C CG  . TYR A 65 ? 0.2645 0.2320 0.2594 -0.0450 0.0180  -0.0482 1112 TYR A CG  
552  C CD1 . TYR A 65 ? 0.2397 0.2609 0.3279 -0.0955 0.0015  -0.0349 1112 TYR A CD1 
553  C CD2 . TYR A 65 ? 0.2677 0.2693 0.2897 -0.0971 0.0400  -0.0355 1112 TYR A CD2 
554  C CE1 . TYR A 65 ? 0.2566 0.2505 0.3878 -0.0501 0.0115  -0.0535 1112 TYR A CE1 
555  C CE2 . TYR A 65 ? 0.2786 0.2832 0.3129 -0.0972 0.0705  -0.0247 1112 TYR A CE2 
556  C CZ  . TYR A 65 ? 0.2375 0.2379 0.3652 -0.1104 0.0711  -0.0724 1112 TYR A CZ  
557  O OH  . TYR A 65 ? 0.2492 0.3680 0.4648 -0.1078 0.0838  -0.1655 1112 TYR A OH  
558  N N   . GLN A 66 ? 0.2393 0.2484 0.2163 -0.0634 0.0304  -0.0110 1113 GLN A N   
559  C CA  . GLN A 66 ? 0.2854 0.2642 0.2529 -0.0704 0.0499  -0.0123 1113 GLN A CA  
560  C C   . GLN A 66 ? 0.2968 0.2816 0.2191 -0.0411 0.0213  0.0019  1113 GLN A C   
561  O O   . GLN A 66 ? 0.3995 0.3699 0.2891 -0.0366 0.0871  -0.0103 1113 GLN A O   
562  C CB  . GLN A 66 ? 0.3682 0.3153 0.2496 -0.0338 0.0379  0.0185  1113 GLN A CB  
563  C CG  . GLN A 66 ? 0.4847 0.3621 0.3390 -0.0620 0.0614  0.0187  1113 GLN A CG  
564  C CD  . GLN A 66 ? 0.6660 0.5649 0.5146 -0.0167 -0.0230 0.0033  1113 GLN A CD  
565  O OE1 . GLN A 66 ? 0.8338 0.7209 0.6249 -0.0191 -0.0853 -0.0555 1113 GLN A OE1 
566  N NE2 . GLN A 66 ? 0.8142 0.5602 0.6322 -0.0278 0.0412  -0.0438 1113 GLN A NE2 
567  N N   . GLU A 67 ? 0.2207 0.2740 0.2340 -0.0294 0.0351  -0.0331 1114 GLU A N   
568  C CA  . GLU A 67 ? 0.2474 0.2637 0.2552 -0.0141 0.0435  -0.0567 1114 GLU A CA  
569  C C   . GLU A 67 ? 0.3012 0.2632 0.2563 0.0086  0.0142  -0.0400 1114 GLU A C   
570  O O   . GLU A 67 ? 0.3302 0.3015 0.3543 -0.0161 -0.0413 -0.0493 1114 GLU A O   
571  C CB  . GLU A 67 ? 0.3266 0.2384 0.2821 -0.0075 0.0061  -0.0338 1114 GLU A CB  
572  C CG  . GLU A 67 ? 0.2754 0.2473 0.2443 0.0227  0.0096  -0.0056 1114 GLU A CG  
573  C CD  . GLU A 67 ? 0.3481 0.1855 0.2122 -0.0045 0.0174  -0.0358 1114 GLU A CD  
574  O OE1 . GLU A 67 ? 0.2683 0.2572 0.3349 -0.0311 0.0319  -0.0631 1114 GLU A OE1 
575  O OE2 . GLU A 67 ? 0.3273 0.2093 0.4211 0.0698  -0.1338 -0.0901 1114 GLU A OE2 
576  N N   . LEU A 68 ? 0.2254 0.2689 0.2780 0.0001  0.0005  -0.0618 1115 LEU A N   
577  C CA  . LEU A 68 ? 0.2790 0.3073 0.3161 0.0102  -0.0136 -0.0581 1115 LEU A CA  
578  C C   . LEU A 68 ? 0.2739 0.3454 0.3376 0.0328  -0.0203 -0.0501 1115 LEU A C   
579  O O   . LEU A 68 ? 0.3276 0.3989 0.3587 0.0298  0.0328  -0.0596 1115 LEU A O   
580  C CB  . LEU A 68 ? 0.2059 0.3844 0.3273 0.0227  -0.0326 -0.0607 1115 LEU A CB  
581  C CG  . LEU A 68 ? 0.2459 0.4481 0.3455 -0.0007 0.0149  -0.0674 1115 LEU A CG  
582  C CD1 . LEU A 68 ? 0.2895 0.5535 0.3582 -0.0338 -0.0230 -0.1244 1115 LEU A CD1 
583  C CD2 . LEU A 68 ? 0.3545 0.6470 0.4221 -0.0381 -0.0043 0.0942  1115 LEU A CD2 
584  N N   . PRO A 69 ? 0.3850 0.3748 0.4174 0.0011  -0.0086 -0.0323 1116 PRO A N   
585  C CA  . PRO A 69 ? 0.4401 0.4262 0.4828 0.0456  -0.0044 -0.0412 1116 PRO A CA  
586  C C   . PRO A 69 ? 0.4651 0.5312 0.5035 0.0201  0.0215  -0.0540 1116 PRO A C   
587  O O   . PRO A 69 ? 0.4757 0.5684 0.5237 0.0126  0.0218  -0.0915 1116 PRO A O   
588  C CB  . PRO A 69 ? 0.4171 0.4450 0.5260 0.0699  -0.0143 -0.0156 1116 PRO A CB  
589  C CG  . PRO A 69 ? 0.4693 0.4380 0.5413 0.0713  0.0144  -0.0102 1116 PRO A CG  
590  C CD  . PRO A 69 ? 0.4370 0.4074 0.4672 0.0249  -0.0178 -0.0135 1116 PRO A CD  
591  O OXT . PRO A 69 ? 0.5186 0.6129 0.5202 0.0186  0.0765  -0.1063 1116 PRO A OXT 
592  N N   . ALA B 6  ? 0.4831 0.5097 0.6555 0.0276  0.0030  0.0810  1053 ALA B N   
593  C CA  . ALA B 6  ? 0.4654 0.5405 0.5997 0.0329  0.0134  0.0354  1053 ALA B CA  
594  C C   . ALA B 6  ? 0.4671 0.5254 0.5499 0.0498  0.0022  0.0532  1053 ALA B C   
595  O O   . ALA B 6  ? 0.4552 0.5459 0.5272 0.0159  0.0255  0.0541  1053 ALA B O   
596  C CB  . ALA B 6  ? 0.4953 0.5310 0.6383 0.0494  -0.0126 0.0672  1053 ALA B CB  
597  N N   . PRO B 7  ? 0.4935 0.5172 0.4829 0.0322  0.0170  0.0386  1054 PRO B N   
598  C CA  . PRO B 7  ? 0.4884 0.4718 0.4235 0.0240  0.0021  0.0755  1054 PRO B CA  
599  C C   . PRO B 7  ? 0.4631 0.4429 0.3886 0.0056  -0.0080 0.0822  1054 PRO B C   
600  O O   . PRO B 7  ? 0.5154 0.4709 0.3874 -0.0637 -0.0383 0.1733  1054 PRO B O   
601  C CB  . PRO B 7  ? 0.5033 0.4699 0.4431 0.0375  0.0287  0.0526  1054 PRO B CB  
602  C CG  . PRO B 7  ? 0.4764 0.4622 0.4173 0.0223  0.0208  0.0575  1054 PRO B CG  
603  C CD  . PRO B 7  ? 0.5125 0.4924 0.4617 0.0408  0.0133  0.0488  1054 PRO B CD  
604  N N   . THR B 8  ? 0.3751 0.4154 0.3301 0.0429  0.0415  0.0672  1055 THR B N   
605  C CA  . THR B 8  ? 0.3377 0.3435 0.2972 0.0952  0.0513  0.0464  1055 THR B CA  
606  C C   . THR B 8  ? 0.3076 0.3027 0.2892 0.0654  0.0394  0.0714  1055 THR B C   
607  O O   . THR B 8  ? 0.3645 0.3248 0.3778 0.0688  0.0672  0.1091  1055 THR B O   
608  C CB  . THR B 8  ? 0.3703 0.3717 0.3941 0.1174  0.0463  -0.0039 1055 THR B CB  
609  O OG1 . THR B 8  ? 0.4671 0.5071 0.4534 0.1926  0.0913  0.0229  1055 THR B OG1 
610  C CG2 . THR B 8  ? 0.4555 0.4790 0.4449 0.0434  0.0679  -0.0610 1055 THR B CG2 
611  N N   . VAL B 9  ? 0.2813 0.2491 0.2573 0.0711  0.0343  0.0547  1056 VAL B N   
612  C CA  . VAL B 9  ? 0.2643 0.2027 0.2411 0.0307  0.0211  0.0169  1056 VAL B CA  
613  C C   . VAL B 9  ? 0.2851 0.1893 0.2258 0.0326  0.0311  0.0243  1056 VAL B C   
614  O O   . VAL B 9  ? 0.3201 0.1966 0.2720 0.0681  0.0142  0.0112  1056 VAL B O   
615  C CB  . VAL B 9  ? 0.2666 0.1935 0.2499 0.0335  0.0280  -0.0070 1056 VAL B CB  
616  C CG1 . VAL B 9  ? 0.3398 0.2341 0.2760 -0.0233 0.0054  0.0044  1056 VAL B CG1 
617  C CG2 . VAL B 9  ? 0.2940 0.2517 0.2112 0.0397  0.0140  0.0514  1056 VAL B CG2 
618  N N   . VAL B 10 ? 0.2734 0.1653 0.2340 0.0307  0.0100  -0.0031 1057 VAL B N   
619  C CA  . VAL B 10 ? 0.3125 0.1737 0.2195 0.0324  0.0105  0.0011  1057 VAL B CA  
620  C C   . VAL B 10 ? 0.2906 0.1888 0.1946 0.0283  0.0069  -0.0005 1057 VAL B C   
621  O O   . VAL B 10 ? 0.3047 0.1682 0.2314 0.0316  0.0306  0.0111  1057 VAL B O   
622  C CB  . VAL B 10 ? 0.3249 0.1935 0.2249 0.0268  -0.0031 -0.0129 1057 VAL B CB  
623  C CG1 . VAL B 10 ? 0.3739 0.2158 0.2361 -0.0339 0.0016  -0.0169 1057 VAL B CG1 
624  C CG2 . VAL B 10 ? 0.3926 0.2875 0.2287 0.0243  0.0409  -0.0090 1057 VAL B CG2 
625  N N   . ALA B 11 ? 0.2947 0.1576 0.2180 0.0175  0.0202  0.0064  1058 ALA B N   
626  C CA  . ALA B 11 ? 0.2911 0.1568 0.2124 0.0027  -0.0172 -0.0095 1058 ALA B CA  
627  C C   . ALA B 11 ? 0.2646 0.1579 0.2287 -0.0024 -0.0223 0.0067  1058 ALA B C   
628  O O   . ALA B 11 ? 0.3216 0.2083 0.2269 -0.0037 -0.0389 -0.0206 1058 ALA B O   
629  C CB  . ALA B 11 ? 0.3214 0.1321 0.2482 -0.0181 -0.0057 0.0328  1058 ALA B CB  
630  N N   . LEU B 12 ? 0.2585 0.1861 0.2236 0.0044  -0.0228 -0.0139 1059 LEU B N   
631  C CA  . LEU B 12 ? 0.2798 0.2149 0.2271 0.0144  -0.0338 0.0027  1059 LEU B CA  
632  C C   . LEU B 12 ? 0.2723 0.2291 0.2447 0.0083  -0.0313 0.0158  1059 LEU B C   
633  O O   . LEU B 12 ? 0.3001 0.3133 0.2623 -0.0034 -0.0585 0.0244  1059 LEU B O   
634  C CB  . LEU B 12 ? 0.3046 0.2381 0.2478 0.0278  -0.0162 0.0194  1059 LEU B CB  
635  C CG  . LEU B 12 ? 0.3421 0.2676 0.2868 0.0574  -0.0479 -0.0030 1059 LEU B CG  
636  C CD1 . LEU B 12 ? 0.4623 0.3005 0.2494 0.0755  -0.1018 0.0187  1059 LEU B CD1 
637  C CD2 . LEU B 12 ? 0.3595 0.2134 0.3434 0.0551  -0.0438 0.0514  1059 LEU B CD2 
638  N N   . TYR B 13 ? 0.2544 0.2117 0.2219 0.0064  -0.0280 0.0281  1060 TYR B N   
639  C CA  . TYR B 13 ? 0.2462 0.2073 0.2534 -0.0006 -0.0482 0.0332  1060 TYR B CA  
640  C C   . TYR B 13 ? 0.2370 0.1859 0.2539 -0.0280 -0.0488 0.0448  1060 TYR B C   
641  O O   . TYR B 13 ? 0.2401 0.2023 0.2738 -0.0246 -0.0535 0.0318  1060 TYR B O   
642  C CB  . TYR B 13 ? 0.2113 0.2498 0.2674 0.0009  -0.0256 0.0260  1060 TYR B CB  
643  C CG  . TYR B 13 ? 0.2252 0.2290 0.3056 0.0174  -0.0582 0.0274  1060 TYR B CG  
644  C CD1 . TYR B 13 ? 0.2347 0.2784 0.4548 0.0031  -0.0677 0.0898  1060 TYR B CD1 
645  C CD2 . TYR B 13 ? 0.2621 0.2032 0.2709 0.0381  -0.0313 0.0339  1060 TYR B CD2 
646  C CE1 . TYR B 13 ? 0.3032 0.2912 0.5708 0.0656  -0.1152 0.1018  1060 TYR B CE1 
647  C CE2 . TYR B 13 ? 0.2717 0.2160 0.3530 0.0259  -0.0601 0.0295  1060 TYR B CE2 
648  C CZ  . TYR B 13 ? 0.3042 0.3149 0.4057 0.0411  -0.0638 0.1130  1060 TYR B CZ  
649  O OH  . TYR B 13 ? 0.3944 0.3169 0.5748 0.0482  -0.1541 0.1445  1060 TYR B OH  
650  N N   . ASP B 14 ? 0.2597 0.2319 0.2610 -0.0560 -0.0690 0.0509  1061 ASP B N   
651  C CA  . ASP B 14 ? 0.2597 0.2068 0.2456 -0.0352 -0.0528 0.0318  1061 ASP B CA  
652  C C   . ASP B 14 ? 0.2303 0.2123 0.2373 -0.0361 -0.0474 0.0259  1061 ASP B C   
653  O O   . ASP B 14 ? 0.2453 0.2029 0.2525 -0.0254 -0.0502 0.0243  1061 ASP B O   
654  C CB  . ASP B 14 ? 0.2868 0.2403 0.2692 -0.0707 -0.0549 0.0205  1061 ASP B CB  
655  C CG  . ASP B 14 ? 0.3100 0.3427 0.3074 -0.0702 -0.0715 0.0028  1061 ASP B CG  
656  O OD1 . ASP B 14 ? 0.3513 0.3702 0.2979 -0.1098 -0.0393 -0.0057 1061 ASP B OD1 
657  O OD2 . ASP B 14 ? 0.4351 0.4769 0.3945 -0.1979 -0.0549 -0.0525 1061 ASP B OD2 
658  N N   . TYR B 15 ? 0.2543 0.1775 0.2251 -0.0163 -0.0528 0.0202  1062 TYR B N   
659  C CA  . TYR B 15 ? 0.2365 0.1723 0.2198 -0.0103 -0.0397 0.0157  1062 TYR B CA  
660  C C   . TYR B 15 ? 0.2490 0.1667 0.2200 -0.0192 -0.0295 -0.0004 1062 TYR B C   
661  O O   . TYR B 15 ? 0.2940 0.1622 0.2286 -0.0092 -0.0062 0.0050  1062 TYR B O   
662  C CB  . TYR B 15 ? 0.2527 0.1591 0.2201 -0.0115 -0.0325 0.0043  1062 TYR B CB  
663  C CG  . TYR B 15 ? 0.2045 0.1644 0.2057 -0.0277 -0.0201 0.0004  1062 TYR B CG  
664  C CD1 . TYR B 15 ? 0.1834 0.1708 0.2222 -0.0028 -0.0361 0.0291  1062 TYR B CD1 
665  C CD2 . TYR B 15 ? 0.2203 0.1679 0.2316 -0.0212 -0.0169 0.0340  1062 TYR B CD2 
666  C CE1 . TYR B 15 ? 0.2025 0.1491 0.2304 0.0081  -0.0368 0.0042  1062 TYR B CE1 
667  C CE2 . TYR B 15 ? 0.1910 0.1512 0.2372 0.0016  -0.0010 0.0244  1062 TYR B CE2 
668  C CZ  . TYR B 15 ? 0.1840 0.1587 0.2209 0.0028  -0.0286 0.0071  1062 TYR B CZ  
669  O OH  . TYR B 15 ? 0.2046 0.2138 0.2273 0.0097  -0.0333 0.0042  1062 TYR B OH  
670  N N   . THR B 16 ? 0.2333 0.1607 0.2315 -0.0175 -0.0305 0.0109  1063 THR B N   
671  C CA  . THR B 16 ? 0.2102 0.1757 0.2338 -0.0178 -0.0340 0.0097  1063 THR B CA  
672  C C   . THR B 16 ? 0.2149 0.1579 0.1967 -0.0147 -0.0031 0.0094  1063 THR B C   
673  O O   . THR B 16 ? 0.2090 0.1782 0.2114 -0.0002 -0.0166 0.0065  1063 THR B O   
674  C CB  . THR B 16 ? 0.2515 0.2123 0.2459 -0.0475 -0.0319 -0.0099 1063 THR B CB  
675  O OG1 . THR B 16 ? 0.3024 0.2978 0.3010 -0.1047 -0.0697 0.0307  1063 THR B OG1 
676  C CG2 . THR B 16 ? 0.2780 0.1818 0.2995 -0.0610 -0.0160 0.0277  1063 THR B CG2 
677  N N   . ALA B 17 ? 0.2152 0.1641 0.2240 0.0012  -0.0067 0.0095  1064 ALA B N   
678  C CA  . ALA B 17 ? 0.1747 0.1834 0.2174 0.0172  0.0089  0.0236  1064 ALA B CA  
679  C C   . ALA B 17 ? 0.1930 0.1853 0.2125 0.0140  -0.0080 0.0281  1064 ALA B C   
680  O O   . ALA B 17 ? 0.2299 0.1960 0.2635 -0.0123 0.0000  0.0232  1064 ALA B O   
681  C CB  . ALA B 17 ? 0.2004 0.1929 0.2719 0.0129  0.0091  0.0160  1064 ALA B CB  
682  N N   . ASN B 18 ? 0.1754 0.2376 0.1943 0.0172  -0.0125 0.0198  1065 ASN B N   
683  C CA  . ASN B 18 ? 0.1871 0.2432 0.2144 0.0021  -0.0132 0.0143  1065 ASN B CA  
684  C C   . ASN B 18 ? 0.1697 0.2015 0.1994 -0.0145 0.0072  0.0184  1065 ASN B C   
685  O O   . ASN B 18 ? 0.1880 0.2193 0.2215 0.0220  -0.0031 -0.0200 1065 ASN B O   
686  C CB  . ASN B 18 ? 0.2048 0.3522 0.2431 0.0368  -0.0260 0.0280  1065 ASN B CB  
687  C CG  . ASN B 18 ? 0.2485 0.3796 0.2819 0.0153  -0.0077 0.0205  1065 ASN B CG  
688  O OD1 . ASN B 18 ? 0.2747 0.4332 0.3971 -0.0323 0.0503  0.0127  1065 ASN B OD1 
689  N ND2 . ASN B 18 ? 0.2492 0.4501 0.3388 0.0706  -0.0069 -0.0631 1065 ASN B ND2 
690  N N   . ARG B 19 ? 0.1535 0.1864 0.2081 0.0094  0.0080  0.0123  1066 ARG B N   
691  C CA  . ARG B 19 ? 0.1487 0.1677 0.2262 0.0144  -0.0143 0.0069  1066 ARG B CA  
692  C C   . ARG B 19 ? 0.1451 0.1533 0.2161 -0.0056 -0.0039 0.0224  1066 ARG B C   
693  O O   . ARG B 19 ? 0.1605 0.2072 0.2092 0.0079  0.0021  0.0271  1066 ARG B O   
694  C CB  . ARG B 19 ? 0.1945 0.2015 0.2544 0.0283  0.0019  -0.0058 1066 ARG B CB  
695  C CG  . ARG B 19 ? 0.2222 0.1924 0.2502 0.0487  0.0128  0.0019  1066 ARG B CG  
696  C CD  . ARG B 19 ? 0.1753 0.1584 0.2619 0.0103  0.0176  -0.0143 1066 ARG B CD  
697  N NE  . ARG B 19 ? 0.1553 0.2036 0.2050 -0.0226 -0.0057 0.0021  1066 ARG B NE  
698  C CZ  . ARG B 19 ? 0.1574 0.1888 0.1989 -0.0138 -0.0364 0.0272  1066 ARG B CZ  
699  N NH1 . ARG B 19 ? 0.2302 0.1780 0.2202 -0.0346 0.0016  -0.0013 1066 ARG B NH1 
700  N NH2 . ARG B 19 ? 0.1538 0.2031 0.2623 -0.0336 -0.0169 0.0418  1066 ARG B NH2 
701  N N   A SER B 20 ? 0.1472 0.1666 0.2088 0.0151  0.0075  0.0140  1067 SER B N   
702  N N   B SER B 20 ? 0.1519 0.1729 0.2015 0.0079  -0.0030 0.0194  1067 SER B N   
703  C CA  A SER B 20 ? 0.1645 0.1591 0.2281 0.0265  0.0235  0.0027  1067 SER B CA  
704  C CA  B SER B 20 ? 0.1540 0.1786 0.2153 0.0158  -0.0025 0.0102  1067 SER B CA  
705  C C   A SER B 20 ? 0.1872 0.1514 0.2115 0.0308  0.0239  0.0100  1067 SER B C   
706  C C   B SER B 20 ? 0.1828 0.1817 0.1871 0.0187  -0.0020 0.0133  1067 SER B C   
707  O O   A SER B 20 ? 0.2339 0.1958 0.2633 0.0523  0.0629  0.0192  1067 SER B O   
708  O O   B SER B 20 ? 0.1753 0.2301 0.1797 0.0413  -0.0076 0.0230  1067 SER B O   
709  C CB  A SER B 20 ? 0.1857 0.1681 0.2320 0.0328  0.0059  0.0001  1067 SER B CB  
710  C CB  B SER B 20 ? 0.1901 0.1916 0.2150 0.0038  -0.0275 0.0332  1067 SER B CB  
711  O OG  A SER B 20 ? 0.2246 0.1782 0.2593 0.0264  0.0383  0.0174  1067 SER B OG  
712  O OG  B SER B 20 ? 0.2069 0.2036 0.2743 -0.0102 -0.0296 0.0131  1067 SER B OG  
713  N N   . ASP B 21 ? 0.1756 0.1693 0.1995 0.0215  0.0147  0.0250  1068 ASP B N   
714  C CA  . ASP B 21 ? 0.1665 0.1773 0.1928 0.0375  0.0252  0.0357  1068 ASP B CA  
715  C C   . ASP B 21 ? 0.1702 0.1656 0.1830 0.0188  0.0125  0.0217  1068 ASP B C   
716  O O   . ASP B 21 ? 0.1752 0.1710 0.2118 0.0248  0.0171  0.0469  1068 ASP B O   
717  C CB  . ASP B 21 ? 0.1643 0.2101 0.2224 0.0070  0.0146  0.0453  1068 ASP B CB  
718  C CG  . ASP B 21 ? 0.2013 0.2338 0.2054 -0.0055 0.0129  0.0189  1068 ASP B CG  
719  O OD1 . ASP B 21 ? 0.1674 0.2021 0.2400 0.0032  0.0046  -0.0168 1068 ASP B OD1 
720  O OD2 . ASP B 21 ? 0.1829 0.2235 0.2134 -0.0121 0.0157  0.0039  1068 ASP B OD2 
721  N N   . GLU B 22 ? 0.1763 0.1540 0.1953 0.0238  -0.0001 0.0256  1069 GLU B N   
722  C CA  . GLU B 22 ? 0.1681 0.1624 0.1902 0.0270  -0.0090 0.0272  1069 GLU B CA  
723  C C   . GLU B 22 ? 0.2145 0.1645 0.1952 0.0223  -0.0046 -0.0029 1069 GLU B C   
724  O O   . GLU B 22 ? 0.2266 0.1687 0.2352 0.0303  0.0027  0.0132  1069 GLU B O   
725  C CB  . GLU B 22 ? 0.1691 0.1751 0.2155 0.0480  -0.0077 0.0155  1069 GLU B CB  
726  C CG  . GLU B 22 ? 0.1658 0.1872 0.2017 0.0383  -0.0005 0.0178  1069 GLU B CG  
727  C CD  . GLU B 22 ? 0.1864 0.2056 0.1880 0.0040  -0.0117 0.0146  1069 GLU B CD  
728  O OE1 . GLU B 22 ? 0.1871 0.2039 0.2329 0.0171  -0.0020 -0.0137 1069 GLU B OE1 
729  O OE2 . GLU B 22 ? 0.1950 0.2120 0.2213 0.0350  -0.0054 -0.0020 1069 GLU B OE2 
730  N N   . LEU B 23 ? 0.2729 0.1735 0.1877 0.0578  0.0023  0.0131  1070 LEU B N   
731  C CA  . LEU B 23 ? 0.2872 0.1710 0.1891 0.0514  0.0029  -0.0025 1070 LEU B CA  
732  C C   . LEU B 23 ? 0.2718 0.1571 0.2023 0.0227  -0.0030 0.0010  1070 LEU B C   
733  O O   . LEU B 23 ? 0.2662 0.1504 0.2459 0.0216  -0.0218 0.0042  1070 LEU B O   
734  C CB  . LEU B 23 ? 0.2905 0.2070 0.2145 0.0615  0.0008  -0.0028 1070 LEU B CB  
735  C CG  . LEU B 23 ? 0.3186 0.2554 0.1718 0.0469  -0.0126 -0.0227 1070 LEU B CG  
736  C CD1 . LEU B 23 ? 0.4076 0.2116 0.2632 0.0819  -0.0027 -0.0533 1070 LEU B CD1 
737  C CD2 . LEU B 23 ? 0.3099 0.3156 0.2265 0.0196  0.0189  0.0230  1070 LEU B CD2 
738  N N   . THR B 24 ? 0.3041 0.1348 0.2448 -0.0033 -0.0131 -0.0033 1071 THR B N   
739  C CA  . THR B 24 ? 0.3111 0.1543 0.2047 -0.0327 -0.0111 -0.0072 1071 THR B CA  
740  C C   . THR B 24 ? 0.3304 0.1485 0.2043 -0.0072 -0.0255 -0.0225 1071 THR B C   
741  O O   . THR B 24 ? 0.3580 0.1747 0.2226 0.0308  0.0015  -0.0010 1071 THR B O   
742  C CB  . THR B 24 ? 0.3509 0.1399 0.2374 -0.0238 -0.0068 -0.0231 1071 THR B CB  
743  O OG1 . THR B 24 ? 0.3705 0.1848 0.2202 -0.0213 0.0280  0.0021  1071 THR B OG1 
744  C CG2 . THR B 24 ? 0.3456 0.1908 0.2497 -0.0752 -0.0198 -0.0321 1071 THR B CG2 
745  N N   . ILE B 25 ? 0.3095 0.1670 0.2019 -0.0024 -0.0054 0.0006  1072 ILE B N   
746  C CA  . ILE B 25 ? 0.3085 0.1732 0.2124 -0.0168 -0.0131 -0.0054 1072 ILE B CA  
747  C C   . ILE B 25 ? 0.3005 0.1827 0.2177 -0.0358 -0.0121 -0.0128 1072 ILE B C   
748  O O   . ILE B 25 ? 0.3110 0.2392 0.2199 -0.0164 -0.0204 -0.0146 1072 ILE B O   
749  C CB  . ILE B 25 ? 0.2978 0.1580 0.2210 -0.0353 -0.0045 0.0112  1072 ILE B CB  
750  C CG1 . ILE B 25 ? 0.3220 0.1655 0.2441 0.0332  0.0120  -0.0051 1072 ILE B CG1 
751  C CG2 . ILE B 25 ? 0.2583 0.2107 0.2548 0.0048  -0.0064 0.0183  1072 ILE B CG2 
752  C CD1 . ILE B 25 ? 0.3586 0.1305 0.2603 -0.0385 -0.0211 0.0052  1072 ILE B CD1 
753  N N   . HIS B 26 ? 0.3553 0.2128 0.2278 -0.0472 -0.0366 -0.0045 1073 HIS B N   
754  C CA  . HIS B 26 ? 0.3651 0.2215 0.2418 -0.0590 -0.0159 -0.0040 1073 HIS B CA  
755  C C   . HIS B 26 ? 0.3576 0.1963 0.2393 -0.0543 -0.0343 -0.0068 1073 HIS B C   
756  O O   . HIS B 26 ? 0.3672 0.2012 0.2226 -0.0550 -0.0171 -0.0011 1073 HIS B O   
757  C CB  . HIS B 26 ? 0.4123 0.2424 0.2813 -0.0958 -0.0424 -0.0044 1073 HIS B CB  
758  C CG  . HIS B 26 ? 0.4653 0.2925 0.3877 -0.1553 -0.0375 0.0019  1073 HIS B CG  
759  N ND1 . HIS B 26 ? 0.5888 0.4592 0.5093 -0.1699 -0.0002 0.0919  1073 HIS B ND1 
760  C CD2 . HIS B 26 ? 0.5233 0.4059 0.3988 -0.1420 -0.0627 0.0254  1073 HIS B CD2 
761  C CE1 . HIS B 26 ? 0.5606 0.4296 0.5129 -0.1933 -0.0412 0.1121  1073 HIS B CE1 
762  N NE2 . HIS B 26 ? 0.6089 0.4304 0.5076 -0.1929 -0.0389 0.0681  1073 HIS B NE2 
763  N N   . ARG B 27 ? 0.3469 0.2703 0.2417 -0.0465 -0.0527 -0.0006 1074 ARG B N   
764  C CA  . ARG B 27 ? 0.3498 0.2605 0.2553 -0.0337 -0.0483 0.0174  1074 ARG B CA  
765  C C   . ARG B 27 ? 0.3881 0.2568 0.2360 -0.0339 -0.0555 0.0004  1074 ARG B C   
766  O O   . ARG B 27 ? 0.4590 0.2743 0.2592 -0.0598 -0.0805 -0.0208 1074 ARG B O   
767  C CB  . ARG B 27 ? 0.3364 0.3199 0.2862 -0.0459 -0.0768 0.0184  1074 ARG B CB  
768  C CG  . ARG B 27 ? 0.3578 0.3483 0.3203 -0.0455 -0.0752 0.0345  1074 ARG B CG  
769  C CD  . ARG B 27 ? 0.3595 0.5389 0.4073 0.0082  -0.1197 0.1163  1074 ARG B CD  
770  N NE  . ARG B 27 ? 0.5113 0.6102 0.5755 -0.0158 -0.0937 0.1360  1074 ARG B NE  
771  C CZ  . ARG B 27 ? 0.6413 0.6749 0.6817 0.0120  -0.0687 0.0852  1074 ARG B CZ  
772  N NH1 . ARG B 27 ? 0.6909 0.7750 0.7681 0.0503  -0.0777 0.0247  1074 ARG B NH1 
773  N NH2 . ARG B 27 ? 0.7147 0.7501 0.6807 -0.0318 -0.0915 0.1245  1074 ARG B NH2 
774  N N   . GLY B 28 ? 0.3707 0.2213 0.2352 -0.0303 -0.0409 -0.0074 1075 GLY B N   
775  C CA  . GLY B 28 ? 0.3979 0.2213 0.2393 -0.0061 -0.0389 -0.0153 1075 GLY B CA  
776  C C   . GLY B 28 ? 0.3899 0.2149 0.2270 0.0120  -0.0161 -0.0307 1075 GLY B C   
777  O O   . GLY B 28 ? 0.4522 0.2512 0.2343 0.0168  -0.0117 -0.0154 1075 GLY B O   
778  N N   . ASP B 29 ? 0.3831 0.2091 0.2238 0.0122  -0.0119 -0.0173 1076 ASP B N   
779  C CA  . ASP B 29 ? 0.3765 0.1806 0.2356 0.0059  -0.0002 -0.0242 1076 ASP B CA  
780  C C   . ASP B 29 ? 0.3424 0.1885 0.2433 0.0422  0.0102  0.0073  1076 ASP B C   
781  O O   . ASP B 29 ? 0.3798 0.1583 0.2658 0.0442  0.0139  -0.0106 1076 ASP B O   
782  C CB  . ASP B 29 ? 0.3985 0.1938 0.2518 0.0097  -0.0028 0.0072  1076 ASP B CB  
783  C CG  . ASP B 29 ? 0.4638 0.1913 0.2538 0.0084  -0.0053 -0.0200 1076 ASP B CG  
784  O OD1 . ASP B 29 ? 0.6204 0.2194 0.3262 -0.0441 0.0183  -0.0548 1076 ASP B OD1 
785  O OD2 . ASP B 29 ? 0.4894 0.2532 0.2590 0.0220  0.0021  0.0131  1076 ASP B OD2 
786  N N   . ILE B 30 ? 0.3716 0.2160 0.2543 0.0583  0.0180  -0.0297 1077 ILE B N   
787  C CA  . ILE B 30 ? 0.3717 0.1948 0.2553 0.0800  0.0260  -0.0175 1077 ILE B CA  
788  C C   . ILE B 30 ? 0.3867 0.2023 0.2188 0.0763  0.0310  -0.0213 1077 ILE B C   
789  O O   . ILE B 30 ? 0.4554 0.1862 0.2603 0.0868  0.0162  0.0154  1077 ILE B O   
790  C CB  . ILE B 30 ? 0.4210 0.2339 0.2431 0.0788  0.0259  -0.0144 1077 ILE B CB  
791  C CG1 . ILE B 30 ? 0.4884 0.3849 0.2402 0.0418  0.0025  -0.0542 1077 ILE B CG1 
792  C CG2 . ILE B 30 ? 0.3454 0.3339 0.2645 0.0685  0.0433  0.0013  1077 ILE B CG2 
793  C CD1 . ILE B 30 ? 0.5774 0.4416 0.3110 0.1018  0.0452  -0.0480 1077 ILE B CD1 
794  N N   . ILE B 31 ? 0.3363 0.1991 0.2215 0.0816  0.0183  0.0000  1078 ILE B N   
795  C CA  . ILE B 31 ? 0.3202 0.1957 0.2117 0.0864  0.0237  0.0160  1078 ILE B CA  
796  C C   . ILE B 31 ? 0.3030 0.2347 0.1924 0.0929  0.0311  0.0194  1078 ILE B C   
797  O O   . ILE B 31 ? 0.3466 0.2453 0.2515 0.0935  0.0322  0.0599  1078 ILE B O   
798  C CB  . ILE B 31 ? 0.2981 0.2046 0.2131 0.0794  0.0351  0.0115  1078 ILE B CB  
799  C CG1 . ILE B 31 ? 0.3279 0.2266 0.2158 0.0641  0.0185  0.0125  1078 ILE B CG1 
800  C CG2 . ILE B 31 ? 0.3500 0.2745 0.2044 0.0622  0.0085  -0.0182 1078 ILE B CG2 
801  C CD1 . ILE B 31 ? 0.3281 0.2676 0.2672 0.0995  0.0610  -0.0162 1078 ILE B CD1 
802  N N   . ARG B 32 ? 0.3183 0.2463 0.2446 0.1163  0.0329  0.0243  1079 ARG B N   
803  C CA  . ARG B 32 ? 0.3256 0.2824 0.2585 0.1055  0.0440  0.0236  1079 ARG B CA  
804  C C   . ARG B 32 ? 0.2773 0.2655 0.2399 0.1036  0.0570  0.0258  1079 ARG B C   
805  O O   . ARG B 32 ? 0.3422 0.2627 0.2439 0.0641  0.0517  0.0583  1079 ARG B O   
806  C CB  . ARG B 32 ? 0.3433 0.2977 0.2819 0.1159  0.0352  0.0388  1079 ARG B CB  
807  C CG  . ARG B 32 ? 0.3949 0.4386 0.4498 0.0955  0.0629  -0.0043 1079 ARG B CG  
808  N N   . VAL B 33 ? 0.3003 0.2634 0.2448 0.0796  0.0524  0.0608  1080 VAL B N   
809  C CA  . VAL B 33 ? 0.2406 0.2835 0.2375 0.0525  0.0445  0.0467  1080 VAL B CA  
810  C C   . VAL B 33 ? 0.2485 0.3276 0.2579 0.0588  0.0401  0.0652  1080 VAL B C   
811  O O   . VAL B 33 ? 0.2702 0.4419 0.3018 0.0575  0.0570  0.1231  1080 VAL B O   
812  C CB  . VAL B 33 ? 0.2644 0.2607 0.2778 0.0470  0.0483  0.0433  1080 VAL B CB  
813  C CG1 . VAL B 33 ? 0.3046 0.2817 0.2721 0.0428  0.0227  0.0209  1080 VAL B CG1 
814  C CG2 . VAL B 33 ? 0.2546 0.2510 0.3288 0.0575  -0.0035 0.0232  1080 VAL B CG2 
815  N N   . PHE B 34 ? 0.2202 0.2987 0.2519 0.0591  0.0429  0.0450  1081 PHE B N   
816  C CA  . PHE B 34 ? 0.2183 0.3172 0.2580 0.0559  0.0481  0.0417  1081 PHE B CA  
817  C C   . PHE B 34 ? 0.2184 0.3142 0.2898 0.0657  0.0371  0.0500  1081 PHE B C   
818  O O   . PHE B 34 ? 0.2278 0.3879 0.3718 0.0456  0.0558  0.0635  1081 PHE B O   
819  C CB  . PHE B 34 ? 0.2438 0.3134 0.2809 0.0802  0.0256  0.0446  1081 PHE B CB  
820  C CG  . PHE B 34 ? 0.2425 0.3199 0.2985 0.1109  0.0496  0.0397  1081 PHE B CG  
821  C CD1 . PHE B 34 ? 0.3021 0.3221 0.3134 0.1455  0.0094  0.0359  1081 PHE B CD1 
822  C CD2 . PHE B 34 ? 0.3358 0.2766 0.2806 0.1157  0.0647  0.0334  1081 PHE B CD2 
823  C CE1 . PHE B 34 ? 0.3924 0.3313 0.3888 0.1723  0.0031  0.0511  1081 PHE B CE1 
824  C CE2 . PHE B 34 ? 0.3679 0.2946 0.3532 0.1755  0.0170  0.0178  1081 PHE B CE2 
825  C CZ  . PHE B 34 ? 0.4180 0.3133 0.3610 0.1569  0.0044  0.0026  1081 PHE B CZ  
826  N N   . PHE B 35 ? 0.1914 0.3102 0.2985 0.0468  0.0521  0.0382  1082 PHE B N   
827  C CA  . PHE B 35 ? 0.2291 0.2864 0.2895 0.0410  0.0137  0.0588  1082 PHE B CA  
828  C C   . PHE B 35 ? 0.1964 0.2625 0.2614 0.0243  0.0357  0.0268  1082 PHE B C   
829  O O   . PHE B 35 ? 0.2036 0.2291 0.2927 0.0057  0.0284  0.0388  1082 PHE B O   
830  C CB  . PHE B 35 ? 0.2364 0.3049 0.3334 0.0597  0.0012  0.0379  1082 PHE B CB  
831  C CG  . PHE B 35 ? 0.2421 0.3184 0.2747 0.0407  -0.0227 0.0441  1082 PHE B CG  
832  C CD1 . PHE B 35 ? 0.2478 0.2850 0.2988 0.0535  -0.0127 0.0289  1082 PHE B CD1 
833  C CD2 . PHE B 35 ? 0.2512 0.3212 0.3284 0.0234  -0.0154 0.0446  1082 PHE B CD2 
834  C CE1 . PHE B 35 ? 0.2641 0.3352 0.2849 0.0380  -0.0110 0.0146  1082 PHE B CE1 
835  C CE2 . PHE B 35 ? 0.2497 0.2957 0.3180 0.0136  -0.0231 0.0245  1082 PHE B CE2 
836  C CZ  . PHE B 35 ? 0.2486 0.3295 0.2823 -0.0034 -0.0027 0.0242  1082 PHE B CZ  
837  N N   . LYS B 36 ? 0.2098 0.2699 0.2718 0.0063  0.0215  0.0440  1083 LYS B N   
838  C CA  . LYS B 36 ? 0.2221 0.2589 0.2617 -0.0045 0.0200  0.0362  1083 LYS B CA  
839  C C   . LYS B 36 ? 0.2212 0.2743 0.2629 -0.0453 0.0107  0.0305  1083 LYS B C   
840  O O   . LYS B 36 ? 0.2582 0.3806 0.2798 -0.0971 0.0145  0.0085  1083 LYS B O   
841  C CB  . LYS B 36 ? 0.2137 0.2277 0.2653 -0.0145 0.0290  0.0311  1083 LYS B CB  
842  C CG  . LYS B 36 ? 0.2239 0.2414 0.2647 0.0062  0.0311  0.0575  1083 LYS B CG  
843  C CD  . LYS B 36 ? 0.2062 0.2513 0.3035 0.0268  0.0493  0.0581  1083 LYS B CD  
844  C CE  . LYS B 36 ? 0.2987 0.3133 0.2744 0.0596  0.0395  0.0342  1083 LYS B CE  
845  N NZ  . LYS B 36 ? 0.3866 0.3659 0.3357 0.0696  0.0496  0.1155  1083 LYS B NZ  
846  N N   . ASP B 37 ? 0.2168 0.2460 0.2658 -0.0422 0.0163  0.0229  1084 ASP B N   
847  C CA  . ASP B 37 ? 0.2121 0.2454 0.2516 -0.0153 -0.0002 0.0420  1084 ASP B CA  
848  C C   . ASP B 37 ? 0.2334 0.2550 0.2316 -0.0436 0.0119  0.0299  1084 ASP B C   
849  O O   . ASP B 37 ? 0.2876 0.2693 0.2975 -0.0737 -0.0191 0.0219  1084 ASP B O   
850  C CB  . ASP B 37 ? 0.2275 0.2612 0.2572 -0.0181 -0.0088 0.0569  1084 ASP B CB  
851  C CG  . ASP B 37 ? 0.1926 0.2358 0.3044 0.0081  -0.0129 0.0738  1084 ASP B CG  
852  O OD1 . ASP B 37 ? 0.2493 0.4193 0.3922 -0.0967 -0.0672 0.1942  1084 ASP B OD1 
853  O OD2 . ASP B 37 ? 0.2725 0.4449 0.2249 -0.0880 -0.0019 0.0447  1084 ASP B OD2 
854  N N   . ASN B 38 ? 0.2379 0.2172 0.2549 -0.0354 -0.0020 0.0062  1085 ASN B N   
855  C CA  . ASN B 38 ? 0.2592 0.2193 0.2686 -0.0570 0.0127  0.0078  1085 ASN B CA  
856  C C   . ASN B 38 ? 0.2916 0.2027 0.2897 -0.0344 0.0029  0.0214  1085 ASN B C   
857  O O   . ASN B 38 ? 0.2985 0.2995 0.2393 0.0039  0.0100  0.0432  1085 ASN B O   
858  C CB  . ASN B 38 ? 0.2730 0.2154 0.2501 -0.0493 -0.0008 0.0106  1085 ASN B CB  
859  C CG  . ASN B 38 ? 0.2233 0.1900 0.2212 -0.0398 0.0127  -0.0104 1085 ASN B CG  
860  O OD1 . ASN B 38 ? 0.2607 0.1818 0.2358 -0.0280 -0.0234 0.0085  1085 ASN B OD1 
861  N ND2 . ASN B 38 ? 0.2679 0.2489 0.2138 -0.0114 0.0005  0.0281  1085 ASN B ND2 
862  N N   . GLU B 39 ? 0.3203 0.2147 0.3169 -0.0286 0.0087  0.0375  1086 GLU B N   
863  C CA  A GLU B 39 ? 0.3331 0.2021 0.3185 -0.0085 0.0056  0.0453  1086 GLU B CA  
864  C CA  B GLU B 39 ? 0.3415 0.2271 0.3114 -0.0179 -0.0051 0.0452  1086 GLU B CA  
865  C C   . GLU B 39 ? 0.2972 0.2214 0.2797 -0.0033 -0.0006 0.0517  1086 GLU B C   
866  O O   . GLU B 39 ? 0.3946 0.2645 0.2804 -0.0239 -0.0228 0.0982  1086 GLU B O   
867  C CB  A GLU B 39 ? 0.3434 0.1328 0.3782 -0.0008 0.0042  0.0451  1086 GLU B CB  
868  C CB  B GLU B 39 ? 0.3638 0.1979 0.3667 -0.0308 -0.0155 0.0294  1086 GLU B CB  
869  C CG  A GLU B 39 ? 0.4036 0.2121 0.4993 0.0115  0.0091  0.0279  1086 GLU B CG  
870  C CG  B GLU B 39 ? 0.4455 0.3270 0.4167 -0.0101 -0.0777 0.0287  1086 GLU B CG  
871  C CD  A GLU B 39 ? 0.4605 0.2862 0.5155 0.0154  0.0439  -0.0084 1086 GLU B CD  
872  C CD  B GLU B 39 ? 0.4697 0.3130 0.5236 -0.0427 -0.1027 0.0784  1086 GLU B CD  
873  O OE1 A GLU B 39 ? 0.4661 0.2064 0.6224 0.0419  0.1335  -0.0613 1086 GLU B OE1 
874  O OE1 B GLU B 39 ? 0.5888 0.3580 0.4566 -0.0694 -0.1605 0.0804  1086 GLU B OE1 
875  O OE2 A GLU B 39 ? 0.5197 0.1597 0.6935 0.0360  0.1624  0.0805  1086 GLU B OE2 
876  O OE2 B GLU B 39 ? 0.5556 0.2812 0.6306 -0.0344 -0.2206 0.0418  1086 GLU B OE2 
877  N N   . ASP B 40 ? 0.2777 0.1628 0.2163 0.0135  0.0015  0.0258  1087 ASP B N   
878  C CA  . ASP B 40 ? 0.2286 0.1582 0.2091 0.0357  -0.0159 0.0128  1087 ASP B CA  
879  C C   . ASP B 40 ? 0.1938 0.1612 0.1965 0.0299  0.0004  -0.0128 1087 ASP B C   
880  O O   . ASP B 40 ? 0.2150 0.1498 0.2274 0.0245  -0.0310 -0.0013 1087 ASP B O   
881  C CB  . ASP B 40 ? 0.2718 0.1304 0.2311 0.0278  -0.0037 -0.0307 1087 ASP B CB  
882  C CG  . ASP B 40 ? 0.2377 0.1719 0.2297 0.0271  -0.0142 0.0065  1087 ASP B CG  
883  O OD1 . ASP B 40 ? 0.2937 0.1602 0.2525 0.0454  -0.0365 0.0062  1087 ASP B OD1 
884  O OD2 . ASP B 40 ? 0.2741 0.1685 0.2298 0.0304  -0.0143 -0.0103 1087 ASP B OD2 
885  N N   . TRP B 41 ? 0.1835 0.1487 0.2110 0.0031  0.0092  0.0091  1088 TRP B N   
886  C CA  . TRP B 41 ? 0.2039 0.1505 0.2027 0.0295  0.0027  0.0113  1088 TRP B CA  
887  C C   . TRP B 41 ? 0.1895 0.1644 0.2204 0.0204  0.0037  0.0147  1088 TRP B C   
888  O O   . TRP B 41 ? 0.1863 0.2054 0.2293 0.0014  -0.0019 0.0006  1088 TRP B O   
889  C CB  . TRP B 41 ? 0.1884 0.1564 0.2165 0.0305  0.0155  0.0126  1088 TRP B CB  
890  C CG  . TRP B 41 ? 0.2001 0.1349 0.2012 0.0222  -0.0063 0.0196  1088 TRP B CG  
891  C CD1 . TRP B 41 ? 0.2048 0.1831 0.2231 0.0223  0.0092  0.0048  1088 TRP B CD1 
892  C CD2 . TRP B 41 ? 0.1795 0.1835 0.1741 0.0182  0.0052  0.0229  1088 TRP B CD2 
893  N NE1 . TRP B 41 ? 0.2157 0.2072 0.2470 0.0284  0.0369  -0.0178 1088 TRP B NE1 
894  C CE2 . TRP B 41 ? 0.1930 0.1809 0.2133 0.0011  0.0113  0.0221  1088 TRP B CE2 
895  C CE3 . TRP B 41 ? 0.2455 0.1462 0.2068 0.0165  -0.0042 -0.0022 1088 TRP B CE3 
896  C CZ2 . TRP B 41 ? 0.1987 0.2354 0.2595 -0.0156 0.0564  0.0210  1088 TRP B CZ2 
897  C CZ3 . TRP B 41 ? 0.2812 0.1953 0.2307 0.0083  -0.0392 0.0014  1088 TRP B CZ3 
898  C CH2 . TRP B 41 ? 0.2360 0.2285 0.2709 -0.0238 -0.0462 0.0038  1088 TRP B CH2 
899  N N   . TRP B 42 ? 0.2002 0.1673 0.1969 0.0248  0.0073  0.0019  1089 TRP B N   
900  C CA  . TRP B 42 ? 0.1957 0.1634 0.2081 0.0231  0.0202  0.0182  1089 TRP B CA  
901  C C   . TRP B 42 ? 0.1914 0.1458 0.2137 0.0187  0.0080  0.0195  1089 TRP B C   
902  O O   . TRP B 42 ? 0.2072 0.1670 0.2293 0.0263  0.0166  0.0398  1089 TRP B O   
903  C CB  . TRP B 42 ? 0.2210 0.1698 0.2164 0.0359  0.0090  0.0443  1089 TRP B CB  
904  C CG  . TRP B 42 ? 0.2048 0.1729 0.2042 0.0151  0.0154  0.0404  1089 TRP B CG  
905  C CD1 . TRP B 42 ? 0.2090 0.1771 0.2214 0.0033  0.0007  0.0293  1089 TRP B CD1 
906  C CD2 . TRP B 42 ? 0.2246 0.1744 0.2142 0.0192  0.0096  0.0405  1089 TRP B CD2 
907  N NE1 . TRP B 42 ? 0.2159 0.1898 0.2414 -0.0173 0.0247  0.0323  1089 TRP B NE1 
908  C CE2 . TRP B 42 ? 0.2285 0.1926 0.2200 0.0020  0.0298  0.0492  1089 TRP B CE2 
909  C CE3 . TRP B 42 ? 0.2687 0.2226 0.1988 -0.0089 0.0127  0.0456  1089 TRP B CE3 
910  C CZ2 . TRP B 42 ? 0.2704 0.1983 0.2417 0.0130  0.0076  0.0583  1089 TRP B CZ2 
911  C CZ3 . TRP B 42 ? 0.3161 0.2444 0.2097 -0.0130 0.0136  0.0353  1089 TRP B CZ3 
912  C CH2 . TRP B 42 ? 0.3397 0.2364 0.2580 -0.0199 -0.0131 0.0585  1089 TRP B CH2 
913  N N   . TYR B 43 ? 0.1933 0.1788 0.2388 0.0417  0.0298  0.0335  1090 TYR B N   
914  C CA  . TYR B 43 ? 0.2176 0.1946 0.2147 0.0578  0.0205  0.0368  1090 TYR B CA  
915  C C   . TYR B 43 ? 0.2194 0.2076 0.2055 0.0556  0.0251  0.0312  1090 TYR B C   
916  O O   . TYR B 43 ? 0.2324 0.2272 0.2363 0.0434  0.0534  0.0354  1090 TYR B O   
917  C CB  . TYR B 43 ? 0.2091 0.2168 0.2208 0.0603  0.0177  0.0313  1090 TYR B CB  
918  C CG  . TYR B 43 ? 0.2056 0.2181 0.2412 0.0894  0.0000  0.0521  1090 TYR B CG  
919  C CD1 . TYR B 43 ? 0.2444 0.2330 0.2622 0.0949  0.0502  0.0443  1090 TYR B CD1 
920  C CD2 . TYR B 43 ? 0.2487 0.2315 0.2161 0.0600  0.0128  0.0177  1090 TYR B CD2 
921  C CE1 . TYR B 43 ? 0.3060 0.2331 0.2747 0.1303  0.0547  0.0642  1090 TYR B CE1 
922  C CE2 . TYR B 43 ? 0.2942 0.2076 0.2432 0.0950  0.0581  0.0425  1090 TYR B CE2 
923  C CZ  . TYR B 43 ? 0.3480 0.2449 0.2632 0.1243  0.0628  0.0682  1090 TYR B CZ  
924  O OH  . TYR B 43 ? 0.4711 0.2476 0.3458 0.1480  0.0839  0.1099  1090 TYR B OH  
925  N N   . GLY B 44 ? 0.2436 0.1972 0.2043 0.0576  0.0369  0.0128  1091 GLY B N   
926  C CA  . GLY B 44 ? 0.2707 0.2204 0.2125 0.0665  0.0344  0.0258  1091 GLY B CA  
927  C C   . GLY B 44 ? 0.3000 0.2042 0.2071 0.0838  0.0232  0.0143  1091 GLY B C   
928  O O   . GLY B 44 ? 0.2951 0.1934 0.2086 0.0830  0.0379  0.0140  1091 GLY B O   
929  N N   . SER B 45 ? 0.3370 0.2199 0.2162 0.0852  0.0305  0.0220  1092 SER B N   
930  C CA  . SER B 45 ? 0.3613 0.2017 0.2335 0.1155  0.0139  0.0052  1092 SER B CA  
931  C C   . SER B 45 ? 0.3471 0.2111 0.2249 0.0982  0.0237  0.0058  1092 SER B C   
932  O O   . SER B 45 ? 0.4430 0.2242 0.2112 0.0894  0.0319  0.0156  1092 SER B O   
933  C CB  . SER B 45 ? 0.3906 0.2332 0.3369 0.1474  -0.0263 0.0124  1092 SER B CB  
934  O OG  . SER B 45 ? 0.5291 0.3331 0.3766 0.1785  0.0320  -0.0151 1092 SER B OG  
935  N N   . ILE B 46 ? 0.3806 0.2215 0.2185 0.0925  0.0121  0.0139  1093 ILE B N   
936  C CA  . ILE B 46 ? 0.4343 0.2191 0.2213 0.0794  0.0067  -0.0051 1093 ILE B CA  
937  C C   . ILE B 46 ? 0.4764 0.2715 0.2504 0.0932  0.0157  -0.0092 1093 ILE B C   
938  O O   . ILE B 46 ? 0.5960 0.2492 0.2928 0.1211  -0.0093 -0.0300 1093 ILE B O   
939  C CB  . ILE B 46 ? 0.4236 0.2481 0.2025 0.0591  0.0059  0.0177  1093 ILE B CB  
940  C CG1 . ILE B 46 ? 0.4528 0.2354 0.2325 0.0483  0.0062  -0.0060 1093 ILE B CG1 
941  C CG2 . ILE B 46 ? 0.4796 0.2226 0.2685 0.1317  0.0072  -0.0076 1093 ILE B CG2 
942  C CD1 . ILE B 46 ? 0.4028 0.2942 0.3481 0.0377  -0.0075 0.0375  1093 ILE B CD1 
943  N N   . GLY B 47 ? 0.5327 0.2605 0.2618 0.1411  0.0169  -0.0544 1094 GLY B N   
944  C CA  . GLY B 47 ? 0.5841 0.3108 0.2858 0.1301  0.0502  -0.0348 1094 GLY B CA  
945  C C   . GLY B 47 ? 0.6082 0.2762 0.3112 0.1208  0.0625  -0.0648 1094 GLY B C   
946  O O   . GLY B 47 ? 0.7341 0.2954 0.2978 0.1619  0.0615  -0.0222 1094 GLY B O   
947  N N   . LYS B 48 ? 0.6378 0.3004 0.3525 0.1365  0.0732  -0.0484 1095 LYS B N   
948  C CA  . LYS B 48 ? 0.6557 0.3689 0.4028 0.1140  0.0442  -0.0228 1095 LYS B CA  
949  C C   . LYS B 48 ? 0.6251 0.3059 0.3673 0.1074  0.0314  -0.0791 1095 LYS B C   
950  O O   . LYS B 48 ? 0.6895 0.3187 0.4295 0.1679  0.0792  -0.0316 1095 LYS B O   
951  C CB  . LYS B 48 ? 0.6327 0.3937 0.4244 0.0886  0.0163  -0.0271 1095 LYS B CB  
952  N N   . GLY B 49 ? 0.5842 0.3707 0.3908 0.1488  0.0407  -0.0415 1096 GLY B N   
953  C CA  . GLY B 49 ? 0.5728 0.3473 0.3745 0.1659  -0.0058 -0.0467 1096 GLY B CA  
954  C C   . GLY B 49 ? 0.5643 0.3660 0.3226 0.1744  -0.0067 -0.0542 1096 GLY B C   
955  O O   . GLY B 49 ? 0.6507 0.4578 0.3483 0.2431  -0.0129 -0.0035 1096 GLY B O   
956  N N   . GLN B 50 ? 0.5331 0.2943 0.2610 0.1513  0.0026  -0.0360 1097 GLN B N   
957  C CA  . GLN B 50 ? 0.4511 0.2322 0.2617 0.1016  -0.0053 -0.0268 1097 GLN B CA  
958  C C   . GLN B 50 ? 0.3809 0.1977 0.2133 0.1114  0.0048  0.0006  1097 GLN B C   
959  O O   . GLN B 50 ? 0.4832 0.2239 0.1937 0.1153  0.0149  0.0154  1097 GLN B O   
960  C CB  . GLN B 50 ? 0.4873 0.2189 0.2998 0.0550  -0.0007 0.0079  1097 GLN B CB  
961  C CG  . GLN B 50 ? 0.5892 0.2784 0.3435 0.0102  -0.0351 -0.0006 1097 GLN B CG  
962  C CD  . GLN B 50 ? 0.6578 0.4706 0.4999 -0.0079 -0.0865 -0.0227 1097 GLN B CD  
963  O OE1 . GLN B 50 ? 0.8158 0.4935 0.4602 -0.0013 -0.0980 -0.1008 1097 GLN B OE1 
964  N NE2 . GLN B 50 ? 0.6831 0.3646 0.5960 -0.0352 -0.0712 -0.0245 1097 GLN B NE2 
965  N N   . GLU B 51 ? 0.3547 0.1968 0.1930 0.1052  0.0215  0.0039  1098 GLU B N   
966  C CA  . GLU B 51 ? 0.2883 0.1985 0.2048 0.0998  0.0084  0.0098  1098 GLU B CA  
967  C C   . GLU B 51 ? 0.2471 0.1915 0.1922 0.0827  0.0112  0.0087  1098 GLU B C   
968  O O   . GLU B 51 ? 0.2318 0.1966 0.2049 0.0591  0.0074  0.0133  1098 GLU B O   
969  C CB  . GLU B 51 ? 0.3160 0.2433 0.2310 0.1225  0.0417  0.0086  1098 GLU B CB  
970  C CG  . GLU B 51 ? 0.3023 0.3013 0.2938 0.1358  0.0142  0.0300  1098 GLU B CG  
971  C CD  . GLU B 51 ? 0.3145 0.3485 0.3079 0.1632  0.0253  0.0370  1098 GLU B CD  
972  O OE1 . GLU B 51 ? 0.3638 0.4358 0.3200 0.1805  0.0497  0.0146  1098 GLU B OE1 
973  O OE2 . GLU B 51 ? 0.3789 0.3084 0.3312 0.1448  0.0153  0.0365  1098 GLU B OE2 
974  N N   . GLY B 52 ? 0.2587 0.1696 0.2093 0.0809  0.0367  0.0190  1099 GLY B N   
975  C CA  . GLY B 52 ? 0.2491 0.1796 0.2076 0.0787  0.0334  0.0130  1099 GLY B CA  
976  C C   . GLY B 52 ? 0.2211 0.1613 0.2102 0.0678  0.0231  0.0190  1099 GLY B C   
977  O O   . GLY B 52 ? 0.2496 0.1761 0.2097 0.0689  0.0401  0.0301  1099 GLY B O   
978  N N   . TYR B 53 ? 0.2256 0.1580 0.1914 0.0693  0.0233  0.0248  1100 TYR B N   
979  C CA  . TYR B 53 ? 0.2018 0.1602 0.2047 0.0417  0.0129  0.0075  1100 TYR B CA  
980  C C   . TYR B 53 ? 0.1983 0.1335 0.1909 0.0220  0.0100  0.0113  1100 TYR B C   
981  O O   . TYR B 53 ? 0.2098 0.1516 0.2187 0.0232  0.0030  0.0093  1100 TYR B O   
982  C CB  . TYR B 53 ? 0.2124 0.1635 0.1912 0.0430  0.0132  0.0218  1100 TYR B CB  
983  C CG  . TYR B 53 ? 0.2042 0.1798 0.1843 0.0370  0.0206  0.0015  1100 TYR B CG  
984  C CD1 . TYR B 53 ? 0.2352 0.1728 0.2461 0.0219  0.0165  0.0103  1100 TYR B CD1 
985  C CD2 . TYR B 53 ? 0.2335 0.1851 0.2019 0.0292  0.0014  0.0319  1100 TYR B CD2 
986  C CE1 . TYR B 53 ? 0.2931 0.1406 0.2630 0.0184  0.0155  0.0351  1100 TYR B CE1 
987  C CE2 . TYR B 53 ? 0.2779 0.1867 0.2015 0.0224  -0.0010 0.0241  1100 TYR B CE2 
988  C CZ  . TYR B 53 ? 0.2618 0.2078 0.2469 0.0023  -0.0212 0.0147  1100 TYR B CZ  
989  O OH  . TYR B 53 ? 0.3192 0.1857 0.2809 0.0070  -0.0508 0.0024  1100 TYR B OH  
990  N N   . PHE B 54 ? 0.2180 0.1491 0.2100 0.0271  0.0069  0.0221  1101 PHE B N   
991  C CA  . PHE B 54 ? 0.1940 0.1394 0.2210 0.0189  -0.0152 0.0136  1101 PHE B CA  
992  C C   . PHE B 54 ? 0.1953 0.1636 0.1750 0.0112  -0.0044 0.0159  1101 PHE B C   
993  O O   . PHE B 54 ? 0.1811 0.1515 0.2021 0.0129  0.0025  0.0073  1101 PHE B O   
994  C CB  . PHE B 54 ? 0.2391 0.1498 0.2237 0.0352  -0.0224 -0.0059 1101 PHE B CB  
995  C CG  . PHE B 54 ? 0.2423 0.1689 0.2114 0.0215  0.0016  -0.0132 1101 PHE B CG  
996  C CD1 . PHE B 54 ? 0.2994 0.2170 0.1950 0.0938  0.0044  -0.0061 1101 PHE B CD1 
997  C CD2 . PHE B 54 ? 0.2698 0.1252 0.2060 0.0710  -0.0001 0.0115  1101 PHE B CD2 
998  C CE1 . PHE B 54 ? 0.2814 0.2210 0.2070 0.0852  0.0125  -0.0148 1101 PHE B CE1 
999  C CE2 . PHE B 54 ? 0.2697 0.2228 0.1959 0.0458  0.0004  0.0218  1101 PHE B CE2 
1000 C CZ  . PHE B 54 ? 0.2755 0.2124 0.2114 0.0427  0.0039  0.0156  1101 PHE B CZ  
1001 N N   . PRO B 55 ? 0.1757 0.1351 0.2097 0.0226  -0.0050 0.0177  1102 PRO B N   
1002 C CA  . PRO B 55 ? 0.1839 0.1310 0.1937 0.0126  -0.0017 0.0075  1102 PRO B CA  
1003 C C   . PRO B 55 ? 0.1833 0.1421 0.2003 0.0221  -0.0029 0.0197  1102 PRO B C   
1004 O O   . PRO B 55 ? 0.2101 0.1341 0.2111 0.0074  -0.0164 0.0161  1102 PRO B O   
1005 C CB  . PRO B 55 ? 0.1869 0.1814 0.2215 0.0307  0.0175  0.0053  1102 PRO B CB  
1006 C CG  . PRO B 55 ? 0.2134 0.1802 0.2789 0.0099  -0.0053 0.0351  1102 PRO B CG  
1007 C CD  . PRO B 55 ? 0.1959 0.1614 0.2200 0.0040  -0.0029 0.0209  1102 PRO B CD  
1008 N N   . ALA B 56 ? 0.1860 0.1375 0.2138 0.0126  0.0020  0.0124  1103 ALA B N   
1009 C CA  . ALA B 56 ? 0.1788 0.1393 0.2105 0.0225  0.0189  0.0194  1103 ALA B CA  
1010 C C   . ALA B 56 ? 0.1962 0.1306 0.1991 0.0158  0.0250  0.0111  1103 ALA B C   
1011 O O   . ALA B 56 ? 0.2055 0.1627 0.2101 0.0200  0.0224  0.0085  1103 ALA B O   
1012 C CB  . ALA B 56 ? 0.2106 0.1588 0.2562 -0.0369 -0.0146 0.0048  1103 ALA B CB  
1013 N N   . ASN B 57 ? 0.1822 0.1416 0.1938 0.0077  0.0107  0.0171  1104 ASN B N   
1014 C CA  . ASN B 57 ? 0.1865 0.1249 0.1993 0.0263  -0.0028 0.0233  1104 ASN B CA  
1015 C C   . ASN B 57 ? 0.1775 0.1515 0.2023 0.0120  -0.0025 0.0277  1104 ASN B C   
1016 O O   . ASN B 57 ? 0.1937 0.1427 0.2232 0.0153  -0.0086 0.0212  1104 ASN B O   
1017 C CB  . ASN B 57 ? 0.1723 0.1310 0.2079 0.0025  0.0020  0.0244  1104 ASN B CB  
1018 C CG  . ASN B 57 ? 0.1918 0.1318 0.2255 -0.0055 -0.0025 0.0124  1104 ASN B CG  
1019 O OD1 . ASN B 57 ? 0.2206 0.1348 0.2371 0.0060  0.0220  0.0234  1104 ASN B OD1 
1020 N ND2 . ASN B 57 ? 0.2477 0.1583 0.2265 0.0304  0.0357  0.0062  1104 ASN B ND2 
1021 N N   . HIS B 58 ? 0.1986 0.1235 0.1966 0.0168  -0.0117 0.0180  1105 HIS B N   
1022 C CA  . HIS B 58 ? 0.1982 0.1384 0.1819 -0.0029 -0.0092 0.0237  1105 HIS B CA  
1023 C C   . HIS B 58 ? 0.2272 0.1668 0.1948 0.0096  -0.0055 0.0100  1105 HIS B C   
1024 O O   . HIS B 58 ? 0.2432 0.1605 0.2079 -0.0077 -0.0099 -0.0058 1105 HIS B O   
1025 C CB  . HIS B 58 ? 0.1891 0.1684 0.2003 -0.0182 -0.0167 0.0064  1105 HIS B CB  
1026 C CG  . HIS B 58 ? 0.2055 0.1490 0.2082 0.0092  -0.0079 0.0371  1105 HIS B CG  
1027 N ND1 . HIS B 58 ? 0.2001 0.1859 0.2198 0.0124  0.0286  0.0238  1105 HIS B ND1 
1028 C CD2 . HIS B 58 ? 0.2131 0.1700 0.2263 -0.0253 -0.0183 0.0220  1105 HIS B CD2 
1029 C CE1 . HIS B 58 ? 0.2121 0.1911 0.2302 -0.0072 0.0082  0.0031  1105 HIS B CE1 
1030 N NE2 . HIS B 58 ? 0.2037 0.1983 0.2580 -0.0257 -0.0196 0.0188  1105 HIS B NE2 
1031 N N   . VAL B 59 ? 0.2243 0.1471 0.2015 0.0216  0.0139  0.0163  1106 VAL B N   
1032 C CA  . VAL B 59 ? 0.2464 0.1469 0.2206 0.0229  0.0357  0.0075  1106 VAL B CA  
1033 C C   . VAL B 59 ? 0.2327 0.1613 0.2083 0.0117  0.0456  0.0196  1106 VAL B C   
1034 O O   . VAL B 59 ? 0.2835 0.1558 0.2491 0.0079  0.0407  -0.0028 1106 VAL B O   
1035 C CB  . VAL B 59 ? 0.2535 0.2241 0.2320 0.0480  0.0470  -0.0325 1106 VAL B CB  
1036 C CG1 . VAL B 59 ? 0.3389 0.2261 0.2217 0.0582  -0.0042 0.0309  1106 VAL B CG1 
1037 C CG2 . VAL B 59 ? 0.2442 0.2878 0.2628 0.0019  0.0245  -0.0735 1106 VAL B CG2 
1038 N N   . ALA B 60 ? 0.2547 0.1847 0.1936 0.0374  0.0533  0.0294  1107 ALA B N   
1039 C CA  . ALA B 60 ? 0.2628 0.1571 0.2178 0.0138  0.0475  0.0222  1107 ALA B CA  
1040 C C   . ALA B 60 ? 0.2358 0.1942 0.1787 0.0103  0.0341  0.0218  1107 ALA B C   
1041 O O   . ALA B 60 ? 0.2683 0.1625 0.2301 0.0337  0.0241  0.0179  1107 ALA B O   
1042 C CB  . ALA B 60 ? 0.2428 0.3067 0.2902 0.0409  0.0166  0.1013  1107 ALA B CB  
1043 N N   . SER B 61 ? 0.2329 0.1530 0.2024 0.0112  0.0196  0.0171  1108 SER B N   
1044 C CA  . SER B 61 ? 0.2076 0.2001 0.2143 0.0126  0.0202  0.0113  1108 SER B CA  
1045 C C   . SER B 61 ? 0.2536 0.1774 0.2253 0.0217  0.0068  0.0070  1108 SER B C   
1046 O O   . SER B 61 ? 0.2555 0.1720 0.2171 0.0202  -0.0014 0.0020  1108 SER B O   
1047 C CB  . SER B 61 ? 0.2308 0.2090 0.2413 0.0015  0.0201  0.0172  1108 SER B CB  
1048 O OG  . SER B 61 ? 0.2594 0.2040 0.2312 0.0042  0.0000  0.0287  1108 SER B OG  
1049 N N   . GLU B 62 ? 0.2654 0.2181 0.2405 0.0582  0.0125  0.0099  1109 GLU B N   
1050 C CA  . GLU B 62 ? 0.3581 0.2541 0.2560 0.0715  0.0247  0.0095  1109 GLU B CA  
1051 C C   . GLU B 62 ? 0.3692 0.2294 0.2437 0.0520  0.0255  0.0048  1109 GLU B C   
1052 O O   . GLU B 62 ? 0.4685 0.2473 0.2461 0.0264  -0.0111 -0.0098 1109 GLU B O   
1053 C CB  . GLU B 62 ? 0.4020 0.2525 0.3005 0.0982  0.0305  0.0228  1109 GLU B CB  
1054 C CG  . GLU B 62 ? 0.4888 0.2813 0.3434 0.1469  0.0624  0.0439  1109 GLU B CG  
1055 C CD  . GLU B 62 ? 0.6566 0.4214 0.4870 0.1554  0.1446  0.0256  1109 GLU B CD  
1056 O OE1 . GLU B 62 ? 0.7341 0.4158 0.6541 0.1449  0.1067  0.0678  1109 GLU B OE1 
1057 O OE2 . GLU B 62 ? 0.6709 0.5864 0.7029 0.1245  0.2126  0.0748  1109 GLU B OE2 
1058 N N   . THR B 63 ? 0.3564 0.2185 0.2433 0.0412  0.0102  0.0021  1110 THR B N   
1059 C CA  . THR B 63 ? 0.3476 0.2275 0.2506 0.0458  0.0007  0.0121  1110 THR B CA  
1060 C C   . THR B 63 ? 0.3291 0.2139 0.2492 0.0103  -0.0389 0.0246  1110 THR B C   
1061 O O   . THR B 63 ? 0.4222 0.2280 0.2654 -0.0057 -0.0819 0.0144  1110 THR B O   
1062 C CB  . THR B 63 ? 0.2815 0.2797 0.2985 0.0308  0.0053  0.0313  1110 THR B CB  
1063 O OG1 . THR B 63 ? 0.3515 0.3678 0.4178 0.0871  0.0636  0.1117  1110 THR B OG1 
1064 C CG2 . THR B 63 ? 0.3762 0.2790 0.2947 0.0725  0.0018  0.0510  1110 THR B CG2 
1065 N N   . LEU B 64 ? 0.3052 0.1862 0.2374 -0.0020 -0.0263 0.0184  1111 LEU B N   
1066 C CA  A LEU B 64 ? 0.2953 0.2163 0.2641 0.0017  -0.0466 0.0137  1111 LEU B CA  
1067 C CA  B LEU B 64 ? 0.2841 0.1984 0.2594 0.0011  -0.0444 0.0170  1111 LEU B CA  
1068 C C   . LEU B 64 ? 0.2898 0.2218 0.2618 -0.0147 -0.0493 0.0295  1111 LEU B C   
1069 O O   . LEU B 64 ? 0.3323 0.2776 0.3118 -0.0294 -0.0980 0.0551  1111 LEU B O   
1070 C CB  A LEU B 64 ? 0.2881 0.2384 0.2939 0.0187  -0.0253 -0.0063 1111 LEU B CB  
1071 C CB  B LEU B 64 ? 0.2596 0.2017 0.2782 0.0283  -0.0144 0.0078  1111 LEU B CB  
1072 C CG  A LEU B 64 ? 0.2904 0.3265 0.3232 0.0150  -0.0288 0.0003  1111 LEU B CG  
1073 C CG  B LEU B 64 ? 0.2122 0.2040 0.3106 -0.0161 -0.0286 0.0331  1111 LEU B CG  
1074 C CD1 A LEU B 64 ? 0.3361 0.3613 0.3211 -0.0121 -0.0568 -0.0277 1111 LEU B CD1 
1075 C CD1 B LEU B 64 ? 0.2707 0.2262 0.3071 0.0769  -0.0912 -0.0035 1111 LEU B CD1 
1076 C CD2 A LEU B 64 ? 0.2909 0.3773 0.3545 0.0000  -0.0250 0.0657  1111 LEU B CD2 
1077 C CD2 B LEU B 64 ? 0.1683 0.2351 0.3562 -0.0421 0.0399  0.0213  1111 LEU B CD2 
1078 N N   . TYR B 65 ? 0.3036 0.2256 0.2656 -0.0164 -0.0612 0.0360  1112 TYR B N   
1079 C CA  . TYR B 65 ? 0.3334 0.2547 0.2848 -0.0352 -0.0686 0.0223  1112 TYR B CA  
1080 C C   . TYR B 65 ? 0.3488 0.3029 0.2874 -0.0587 -0.0779 0.0573  1112 TYR B C   
1081 O O   . TYR B 65 ? 0.4400 0.4382 0.3168 -0.1469 -0.1016 0.0855  1112 TYR B O   
1082 C CB  . TYR B 65 ? 0.3548 0.2662 0.2730 -0.0501 -0.0683 0.0330  1112 TYR B CB  
1083 C CG  . TYR B 65 ? 0.3844 0.2624 0.2812 -0.0542 -0.0547 0.0088  1112 TYR B CG  
1084 C CD1 . TYR B 65 ? 0.4668 0.3030 0.2778 -0.1078 -0.0274 0.0105  1112 TYR B CD1 
1085 C CD2 . TYR B 65 ? 0.3663 0.2789 0.3311 -0.0478 -0.0348 0.0394  1112 TYR B CD2 
1086 C CE1 . TYR B 65 ? 0.4867 0.3331 0.3289 -0.1698 -0.0653 0.0146  1112 TYR B CE1 
1087 C CE2 . TYR B 65 ? 0.4229 0.3534 0.3292 -0.0683 -0.0379 0.0429  1112 TYR B CE2 
1088 C CZ  . TYR B 65 ? 0.4347 0.2782 0.3487 -0.1203 -0.0865 0.0703  1112 TYR B CZ  
1089 O OH  . TYR B 65 ? 0.4802 0.3796 0.4367 -0.1798 -0.1341 0.1068  1112 TYR B OH  
1090 N N   . GLN B 66 ? 0.3645 0.2360 0.2626 -0.0383 -0.0745 0.0103  1113 GLN B N   
1091 C CA  . GLN B 66 ? 0.4266 0.2710 0.3068 -0.0366 -0.0834 0.0011  1113 GLN B CA  
1092 C C   . GLN B 66 ? 0.4209 0.3008 0.2887 -0.0509 -0.1210 -0.0121 1113 GLN B C   
1093 O O   . GLN B 66 ? 0.5806 0.3337 0.3603 -0.0420 -0.1767 -0.0165 1113 GLN B O   
1094 C CB  . GLN B 66 ? 0.4880 0.3527 0.3156 -0.0254 -0.0732 -0.0251 1113 GLN B CB  
1095 C CG  . GLN B 66 ? 0.5901 0.4343 0.4336 0.0217  -0.0631 0.0069  1113 GLN B CG  
1096 C CD  . GLN B 66 ? 0.7280 0.6059 0.6592 0.0035  0.0396  0.0468  1113 GLN B CD  
1097 O OE1 . GLN B 66 ? 0.8881 0.6616 0.7863 0.0848  0.0101  0.0346  1113 GLN B OE1 
1098 N NE2 . GLN B 66 ? 0.8944 0.6251 0.7300 0.0087  0.1022  0.0941  1113 GLN B NE2 
1099 N N   . GLU B 67 ? 0.3249 0.2988 0.2825 -0.0329 -0.0650 0.0445  1114 GLU B N   
1100 C CA  . GLU B 67 ? 0.3149 0.2924 0.3014 -0.0426 -0.0824 0.0749  1114 GLU B CA  
1101 C C   . GLU B 67 ? 0.3139 0.3333 0.3114 0.0048  -0.0615 0.0912  1114 GLU B C   
1102 O O   . GLU B 67 ? 0.4225 0.3887 0.4006 0.0221  0.0618  0.1074  1114 GLU B O   
1103 C CB  . GLU B 67 ? 0.3807 0.3382 0.4148 0.0018  -0.0848 0.0984  1114 GLU B CB  
1104 C CG  . GLU B 67 ? 0.4049 0.2797 0.3891 -0.0042 -0.1041 0.0868  1114 GLU B CG  
1105 C CD  . GLU B 67 ? 0.3249 0.2463 0.5133 0.0516  -0.0762 0.0929  1114 GLU B CD  
1106 O OE1 . GLU B 67 ? 0.3013 0.2341 0.5186 0.0040  -0.0836 0.0667  1114 GLU B OE1 
1107 O OE2 . GLU B 67 ? 0.2964 0.2595 0.5187 -0.0326 -0.0401 0.0619  1114 GLU B OE2 
1108 N N   . LEU B 68 ? 0.2778 0.3477 0.3272 -0.0263 -0.0222 0.0856  1115 LEU B N   
1109 C CA  . LEU B 68 ? 0.3316 0.4189 0.3450 0.0040  -0.0362 0.0897  1115 LEU B CA  
1110 C C   . LEU B 68 ? 0.3120 0.4571 0.3800 -0.0231 -0.0156 0.0701  1115 LEU B C   
1111 O O   . LEU B 68 ? 0.3468 0.5667 0.4029 -0.0334 -0.0664 0.0534  1115 LEU B O   
1112 C CB  . LEU B 68 ? 0.2988 0.4311 0.3668 -0.0290 -0.0132 0.1078  1115 LEU B CB  
1113 C CG  . LEU B 68 ? 0.3791 0.5106 0.4078 -0.0464 -0.0357 0.0951  1115 LEU B CG  
1114 C CD1 . LEU B 68 ? 0.4039 0.5835 0.4766 -0.0547 -0.0307 0.2187  1115 LEU B CD1 
1115 C CD2 . LEU B 68 ? 0.5398 0.5489 0.4654 -0.0331 -0.0311 -0.0048 1115 LEU B CD2 
1116 N N   . PRO B 69 ? 0.4056 0.4772 0.4094 -0.0026 -0.0189 0.0430  1116 PRO B N   
1117 C CA  . PRO B 69 ? 0.3924 0.4950 0.4596 -0.0037 -0.0171 0.0427  1116 PRO B CA  
1118 C C   . PRO B 69 ? 0.4486 0.5196 0.4614 -0.0270 -0.0135 0.0700  1116 PRO B C   
1119 O O   . PRO B 69 ? 0.4119 0.5537 0.4580 -0.0027 0.0009  0.0568  1116 PRO B O   
1120 C CB  . PRO B 69 ? 0.4665 0.5109 0.4516 -0.0003 -0.0186 0.0584  1116 PRO B CB  
1121 C CG  . PRO B 69 ? 0.4339 0.5215 0.5270 0.0175  -0.0321 -0.0110 1116 PRO B CG  
1122 C CD  . PRO B 69 ? 0.4613 0.4853 0.4714 -0.0001 -0.0091 0.0411  1116 PRO B CD  
1123 O OXT . PRO B 69 ? 0.4238 0.5803 0.4622 -0.0338 -0.0550 0.0868  1116 PRO B OXT 
1124 C C1  . PEG C .  ? 0.4387 0.5714 0.4551 0.1054  0.0097  -0.0916 1201 PEG B C1  
1125 O O1  . PEG C .  ? 0.4347 0.6529 0.4902 0.1446  0.0337  -0.0976 1201 PEG B O1  
1126 C C2  . PEG C .  ? 0.4165 0.6748 0.5661 0.0471  0.0488  -0.0940 1201 PEG B C2  
1127 O O2  . PEG C .  ? 0.5121 0.5284 0.5105 0.0605  -0.0085 -0.0901 1201 PEG B O2  
1128 C C3  . PEG C .  ? 0.5030 0.5656 0.5226 -0.1248 0.0559  -0.1088 1201 PEG B C3  
1129 C C4  . PEG C .  ? 0.4468 0.5237 0.5393 -0.0714 0.0516  -0.0292 1201 PEG B C4  
1130 O O4  . PEG C .  ? 0.6316 0.4500 0.6314 -0.1003 0.0408  -0.0502 1201 PEG B O4  
1131 C C1  . PEG D .  ? 0.4492 0.3627 0.4381 0.0238  0.1369  0.0186  1202 PEG B C1  
1132 O O1  . PEG D .  ? 0.7277 0.4568 0.5689 -0.0481 0.2485  -0.0393 1202 PEG B O1  
1133 C C2  . PEG D .  ? 0.4229 0.4277 0.3755 0.0160  0.1256  -0.0110 1202 PEG B C2  
1134 O O2  . PEG D .  ? 0.5316 0.5134 0.6261 -0.0443 0.1292  0.0020  1202 PEG B O2  
1135 C C3  . PEG D .  ? 0.4294 0.5632 0.6601 0.0266  0.1061  -0.0160 1202 PEG B C3  
1136 C C4  . PEG D .  ? 0.5604 0.5968 0.7433 0.0442  0.0381  -0.0449 1202 PEG B C4  
1137 O O4  . PEG D .  ? 0.5857 0.5332 0.8990 0.0694  -0.0472 -0.0734 1202 PEG B O4  
1138 C C1  . PEG E .  ? 0.3060 0.2146 0.3037 0.0024  -0.0915 -0.0153 1203 PEG B C1  
1139 O O1  . PEG E .  ? 0.3489 0.3168 0.4078 -0.0193 -0.1016 0.0070  1203 PEG B O1  
1140 C C2  . PEG E .  ? 0.2460 0.3274 0.3098 -0.0236 -0.0779 -0.0347 1203 PEG B C2  
1141 O O2  . PEG E .  ? 0.4324 0.4063 0.3813 -0.0326 0.0262  0.0232  1203 PEG B O2  
1142 C C3  . PEG E .  ? 0.3628 0.4342 0.4022 -0.0719 -0.0243 0.0688  1203 PEG B C3  
1143 C C4  . PEG E .  ? 0.4507 0.4393 0.4653 0.0045  -0.0108 -0.0456 1203 PEG B C4  
1144 O O4  . PEG E .  ? 0.5867 0.4871 0.5429 0.0210  0.0021  -0.0295 1203 PEG B O4  
1145 O O   . HOH F .  ? 0.2218 0.1688 0.2364 0.0168  0.0215  0.0007  1201 HOH A O   
1146 O O   . HOH F .  ? 0.2265 0.1351 0.2349 -0.0066 0.0174  -0.0158 1202 HOH A O   
1147 O O   . HOH F .  ? 0.4207 0.1955 0.3141 -0.0509 -0.0570 -0.0345 1203 HOH A O   
1148 O O   . HOH F .  ? 0.4404 0.1679 0.3967 -0.0112 0.1729  0.0049  1204 HOH A O   
1149 O O   . HOH F .  ? 0.3358 0.1902 0.4487 -0.0303 0.0202  0.0185  1205 HOH A O   
1150 O O   . HOH F .  ? 0.3013 0.2207 0.3880 0.0494  -0.0687 -0.0989 1206 HOH A O   
1151 O O   . HOH F .  ? 0.3793 0.3150 0.2762 -0.1234 0.0041  -0.0225 1207 HOH A O   
1152 O O   . HOH F .  ? 0.2156 0.3626 0.6707 0.0539  0.0232  -0.1535 1208 HOH A O   
1153 O O   . HOH F .  ? 0.2296 0.3631 0.3810 -0.0133 -0.0620 0.0052  1209 HOH A O   
1154 O O   . HOH F .  ? 0.3187 0.3055 0.3146 0.0246  0.0869  0.0895  1210 HOH A O   
1155 O O   . HOH F .  ? 0.3193 0.3500 0.4237 -0.0616 -0.0711 -0.0332 1211 HOH A O   
1156 O O   . HOH F .  ? 0.3197 0.4631 0.3027 0.0667  -0.0497 -0.0114 1212 HOH A O   
1157 O O   . HOH F .  ? 0.2488 0.3495 0.3372 0.0327  -0.0397 0.0093  1213 HOH A O   
1158 O O   . HOH F .  ? 0.3609 0.3556 0.4342 0.0186  0.0288  0.0701  1214 HOH A O   
1159 O O   . HOH F .  ? 0.5561 0.3032 0.4594 -0.1721 0.2332  -0.1073 1215 HOH A O   
1160 O O   . HOH F .  ? 0.3674 0.3917 0.5343 -0.0795 0.0258  0.2267  1216 HOH A O   
1161 O O   . HOH F .  ? 0.4043 0.3641 0.5112 -0.1485 0.0012  -0.0631 1217 HOH A O   
1162 O O   . HOH F .  ? 0.6603 0.4430 0.2723 -0.0066 0.0125  0.0011  1218 HOH A O   
1163 O O   . HOH F .  ? 0.4095 0.5458 0.4784 -0.0428 -0.0309 0.0397  1219 HOH A O   
1164 O O   . HOH F .  ? 0.5517 0.3910 0.4439 -0.0204 -0.0151 0.0525  1220 HOH A O   
1165 O O   . HOH F .  ? 0.5094 0.3676 0.3763 -0.0611 0.0218  -0.0625 1221 HOH A O   
1166 O O   . HOH F .  ? 0.4769 0.5354 0.3925 0.0486  0.0059  -0.0505 1222 HOH A O   
1167 O O   . HOH F .  ? 0.4751 0.2925 0.4983 -0.0587 -0.1203 0.0296  1223 HOH A O   
1168 O O   . HOH F .  ? 0.6070 0.3184 0.6415 -0.0086 0.0251  0.0588  1224 HOH A O   
1169 O O   . HOH F .  ? 0.3449 0.4123 0.5492 -0.0372 0.0387  0.1572  1225 HOH A O   
1170 O O   . HOH F .  ? 0.3940 0.3366 0.3510 -0.0185 0.0778  0.0390  1226 HOH A O   
1171 O O   . HOH F .  ? 0.3735 0.2943 0.3468 0.0145  0.0051  -0.0178 1227 HOH A O   
1172 O O   . HOH F .  ? 0.6584 0.5751 0.4171 -0.3601 -0.0698 0.0784  1228 HOH A O   
1173 O O   . HOH F .  ? 0.6819 0.3518 0.7844 0.0111  -0.3027 -0.0913 1229 HOH A O   
1174 O O   . HOH F .  ? 0.2948 0.6320 0.4899 -0.0875 0.0662  0.0063  1230 HOH A O   
1175 O O   . HOH F .  ? 0.5641 0.2995 0.5736 -0.0875 -0.1063 -0.0326 1231 HOH A O   
1176 O O   . HOH F .  ? 0.2963 0.5320 0.4291 -0.0086 0.0184  -0.1281 1232 HOH A O   
1177 O O   . HOH F .  ? 0.4788 0.3590 0.5017 0.2061  0.0158  0.0223  1233 HOH A O   
1178 O O   . HOH F .  ? 0.5399 0.5559 0.7924 -0.0220 0.1799  0.2223  1234 HOH A O   
1179 O O   . HOH F .  ? 0.7531 0.4599 0.3976 -0.1154 -0.0698 0.0788  1235 HOH A O   
1180 O O   . HOH F .  ? 0.4226 0.4219 0.5161 -0.0860 0.1720  -0.0766 1236 HOH A O   
1181 O O   . HOH F .  ? 0.3089 0.4505 0.6695 0.0314  -0.0156 -0.1499 1237 HOH A O   
1182 O O   . HOH F .  ? 0.4467 0.7319 0.6024 0.0451  -0.1769 -0.1849 1238 HOH A O   
1183 O O   . HOH F .  ? 0.4969 0.6070 0.4637 0.1324  0.1065  0.0575  1239 HOH A O   
1184 O O   . HOH F .  ? 0.3588 0.5943 0.7963 -0.1260 -0.1409 0.1067  1240 HOH A O   
1185 O O   . HOH F .  ? 0.2950 0.8530 0.4688 -0.0512 0.0252  0.0838  1241 HOH A O   
1186 O O   . HOH F .  ? 0.5152 0.7746 0.4581 0.2357  -0.0105 0.1591  1242 HOH A O   
1187 O O   . HOH F .  ? 0.4796 0.4925 0.5453 0.0280  -0.0607 0.0177  1243 HOH A O   
1188 O O   . HOH F .  ? 1.2121 0.6056 1.9098 -0.3286 -0.2851 0.2491  1244 HOH A O   
1189 O O   . HOH F .  ? 0.5589 0.3894 0.5552 -0.1150 0.0367  0.0062  1245 HOH A O   
1190 O O   . HOH F .  ? 0.4711 0.4272 0.7015 -0.0593 0.0958  0.1693  1246 HOH A O   
1191 O O   . HOH F .  ? 0.5438 0.6828 0.6202 -0.1786 -0.0058 -0.0966 1247 HOH A O   
1192 O O   . HOH F .  ? 1.8402 3.2019 2.1449 -1.9012 1.4989  -1.8557 1248 HOH A O   
1193 O O   . HOH F .  ? 2.0922 0.7030 0.5807 0.5475  -0.7670 0.1765  1249 HOH A O   
1194 O O   . HOH F .  ? 0.5716 0.3386 0.3993 0.1342  -0.0854 -0.0120 1250 HOH A O   
1195 O O   . HOH F .  ? 0.6671 0.6845 0.5689 -0.3465 0.0844  -0.1475 1251 HOH A O   
1196 O O   . HOH F .  ? 0.3684 0.5979 2.5823 -0.3655 -0.2603 -0.1953 1252 HOH A O   
1197 O O   . HOH F .  ? 0.3676 0.6932 0.6432 -0.0104 -0.0234 -0.2297 1253 HOH A O   
1198 O O   . HOH F .  ? 0.4509 0.3928 0.6498 -0.0310 0.0568  -0.0143 1254 HOH A O   
1199 O O   . HOH F .  ? 0.2681 0.3177 0.4666 -0.0631 -0.0649 0.0757  1255 HOH A O   
1200 O O   . HOH F .  ? 0.6009 0.6578 1.7276 0.0468  -0.1546 0.0347  1256 HOH A O   
1201 O O   . HOH F .  ? 0.2990 0.4831 0.6152 -0.0192 -0.0275 -0.0454 1257 HOH A O   
1202 O O   . HOH F .  ? 0.9949 0.3982 1.5113 -0.3907 0.6915  -0.1366 1258 HOH A O   
1203 O O   . HOH F .  ? 1.4324 0.6053 1.6090 0.1903  -1.1941 0.4006  1259 HOH A O   
1204 O O   . HOH F .  ? 0.6389 0.8247 0.5177 -0.0860 0.0653  0.0595  1260 HOH A O   
1205 O O   . HOH F .  ? 1.0211 0.5973 0.3469 0.0203  -0.0235 0.0197  1261 HOH A O   
1206 O O   . HOH F .  ? 1.6961 1.5316 1.6284 -1.2707 1.5605  -0.9065 1262 HOH A O   
1207 O O   . HOH F .  ? 0.4325 0.3900 0.6539 -0.1103 0.0985  0.0873  1263 HOH A O   
1208 O O   . HOH F .  ? 0.7381 0.3725 1.0045 0.0882  -0.4651 -0.0451 1264 HOH A O   
1209 O O   . HOH F .  ? 0.6051 0.9364 0.6372 0.2833  -0.1105 -0.0788 1265 HOH A O   
1210 O O   . HOH F .  ? 0.8687 1.3064 1.0574 0.7333  0.1407  0.9280  1266 HOH A O   
1211 O O   . HOH F .  ? 0.3633 0.4376 0.8080 -0.0067 0.0255  0.1530  1267 HOH A O   
1212 O O   . HOH F .  ? 0.6429 0.8670 0.4906 -0.3108 0.0054  0.0695  1268 HOH A O   
1213 O O   . HOH F .  ? 0.7177 0.4584 0.5778 0.0870  -0.1494 -0.2443 1269 HOH A O   
1214 O O   . HOH F .  ? 0.4817 0.6868 0.5325 -0.1726 -0.0015 0.0389  1270 HOH A O   
1215 O O   . HOH F .  ? 0.8805 0.4771 0.5278 0.0343  0.1405  -0.0451 1271 HOH A O   
1216 O O   . HOH F .  ? 0.8530 0.5081 0.4117 -0.0448 0.0078  -0.0039 1272 HOH A O   
1217 O O   . HOH F .  ? 0.9424 1.5127 1.5617 -0.9097 -0.9614 1.4798  1273 HOH A O   
1218 O O   . HOH F .  ? 2.6556 2.0659 2.4080 1.1783  -1.7599 -1.0002 1274 HOH A O   
1219 O O   . HOH F .  ? 0.4330 0.4678 1.3084 0.0049  0.2047  -0.0242 1275 HOH A O   
1220 O O   . HOH F .  ? 0.7137 0.5339 0.6668 0.2658  0.0668  0.0145  1276 HOH A O   
1221 O O   . HOH F .  ? 0.4832 1.2509 0.4403 0.0858  0.0537  0.2101  1277 HOH A O   
1222 O O   . HOH F .  ? 0.5407 0.6627 0.8047 -0.2238 -0.2001 0.2685  1278 HOH A O   
1223 O O   . HOH F .  ? 0.5708 0.5234 3.0857 -0.1638 -0.9874 -0.4592 1279 HOH A O   
1224 O O   . HOH F .  ? 0.2849 1.1140 0.9465 -0.2444 -0.0454 0.7738  1280 HOH A O   
1225 O O   . HOH F .  ? 1.1686 0.6588 0.8849 -0.2495 -0.5118 0.2747  1281 HOH A O   
1226 O O   . HOH F .  ? 0.5621 2.4662 0.7458 0.0639  -0.1054 -0.2685 1282 HOH A O   
1227 O O   . HOH F .  ? 0.7189 0.5254 0.5211 -0.3126 -0.1175 0.0504  1283 HOH A O   
1228 O O   . HOH F .  ? 0.5369 0.5194 0.5982 -0.0347 -0.0649 -0.0081 1284 HOH A O   
1229 O O   . HOH F .  ? 0.4114 0.8198 2.3902 -0.5010 0.4889  -0.1325 1285 HOH A O   
1230 O O   . HOH F .  ? 0.8681 1.2829 2.0380 -0.3577 -0.4054 0.7030  1286 HOH A O   
1231 O O   . HOH F .  ? 0.4435 0.3944 0.4099 -0.0075 -0.0501 0.0369  1287 HOH A O   
1232 O O   . HOH F .  ? 0.2541 0.2932 0.5391 -0.0711 0.1021  -0.1613 1288 HOH A O   
1233 O O   . HOH F .  ? 0.3797 0.3970 0.2879 0.1426  -0.0383 -0.0034 1289 HOH A O   
1234 O O   . HOH F .  ? 0.7048 0.2017 0.5557 0.0543  -0.1596 0.0248  1290 HOH A O   
1235 O O   . HOH F .  ? 0.8701 0.6968 0.5067 0.3628  -0.0989 0.0388  1291 HOH A O   
1236 O O   . HOH F .  ? 0.3984 0.4352 0.7183 0.0249  0.0971  -0.0108 1292 HOH A O   
1237 O O   . HOH F .  ? 0.4593 0.4659 0.6023 0.0154  0.0572  0.0639  1293 HOH A O   
1238 O O   . HOH F .  ? 0.4277 0.7331 0.6053 0.1354  0.0303  -0.0039 1294 HOH A O   
1239 O O   . HOH F .  ? 0.4842 0.4710 0.8525 0.0044  0.0365  0.0785  1295 HOH A O   
1240 O O   . HOH F .  ? 0.8685 0.4740 0.9752 0.3005  -0.0739 0.1015  1296 HOH A O   
1241 O O   . HOH F .  ? 0.4674 0.4674 0.4234 -0.0090 -0.0159 0.0159  1297 HOH A O   
1242 O O   . HOH F .  ? 0.4945 0.5480 0.7771 0.1053  -0.0838 0.0000  1298 HOH A O   
1243 O O   . HOH F .  ? 0.5809 0.5393 0.6084 -0.0193 -0.0129 0.0563  1299 HOH A O   
1244 O O   . HOH G .  ? 0.2135 0.1879 0.2482 0.0280  -0.0136 -0.0206 1301 HOH B O   
1245 O O   . HOH G .  ? 0.2622 0.1488 0.2447 -0.0129 -0.0258 0.0024  1302 HOH B O   
1246 O O   . HOH G .  ? 0.2824 0.2112 0.3653 0.0098  -0.0197 0.0554  1303 HOH B O   
1247 O O   . HOH G .  ? 0.4253 0.1781 0.3900 0.0823  -0.1667 -0.0477 1304 HOH B O   
1248 O O   . HOH G .  ? 0.3295 0.2721 0.2841 0.0804  -0.0180 -0.0322 1305 HOH B O   
1249 O O   . HOH G .  ? 0.2778 0.2986 0.3856 -0.0809 0.0488  0.0339  1306 HOH B O   
1250 O O   . HOH G .  ? 0.3300 0.3483 0.5316 -0.0611 -0.1750 0.1392  1307 HOH B O   
1251 O O   . HOH G .  ? 0.4076 0.4587 0.3970 -0.1805 0.1309  -0.1439 1308 HOH B O   
1252 O O   . HOH G .  ? 0.3413 0.4906 0.3218 0.1658  -0.0284 -0.0803 1309 HOH B O   
1253 O O   . HOH G .  ? 0.4935 0.2219 0.2568 -0.0563 0.0435  0.0253  1310 HOH B O   
1254 O O   . HOH G .  ? 0.2794 0.3910 0.4239 0.0521  0.0251  0.1286  1311 HOH B O   
1255 O O   . HOH G .  ? 0.3839 0.6035 0.3635 -0.0108 0.0869  0.0734  1312 HOH B O   
1256 O O   . HOH G .  ? 0.2911 0.4101 0.5593 -0.0522 0.1081  0.0655  1313 HOH B O   
1257 O O   . HOH G .  ? 0.3179 0.4298 0.4474 0.0561  -0.0274 0.0316  1314 HOH B O   
1258 O O   . HOH G .  ? 0.4318 0.2617 0.5137 0.0000  0.1054  0.0265  1315 HOH B O   
1259 O O   . HOH G .  ? 0.4146 0.5258 0.4287 -0.1456 -0.1259 0.1436  1316 HOH B O   
1260 O O   . HOH G .  ? 0.6524 0.3329 0.6727 0.0162  0.1420  0.1074  1317 HOH B O   
1261 O O   . HOH G .  ? 0.5425 0.3551 0.5066 -0.0544 0.2387  0.0666  1318 HOH B O   
1262 O O   . HOH G .  ? 0.5717 0.2065 0.4648 0.0233  0.0750  -0.0051 1319 HOH B O   
1263 O O   . HOH G .  ? 0.5660 0.2610 0.5351 -0.0762 -0.0643 0.0031  1320 HOH B O   
1264 O O   . HOH G .  ? 0.6031 0.5459 0.4151 0.1134  -0.0306 0.0638  1321 HOH B O   
1265 O O   . HOH G .  ? 0.5040 0.7491 0.5400 -0.0918 0.0151  0.3549  1322 HOH B O   
1266 O O   . HOH G .  ? 0.6222 0.3276 0.5882 0.0369  0.0858  -0.2016 1323 HOH B O   
1267 O O   . HOH G .  ? 0.4745 0.4820 0.6078 0.0202  -0.0362 0.0568  1324 HOH B O   
1268 O O   . HOH G .  ? 0.4575 0.3873 0.5265 -0.1264 -0.0555 0.0439  1325 HOH B O   
1269 O O   . HOH G .  ? 2.7140 0.6462 0.8525 -0.3495 0.3781  -0.1103 1326 HOH B O   
1270 O O   . HOH G .  ? 1.5750 0.7194 0.6522 -0.2449 -0.0911 0.2110  1327 HOH B O   
1271 O O   . HOH G .  ? 0.5989 0.2796 0.6468 0.0043  0.0310  0.1200  1328 HOH B O   
1272 O O   . HOH G .  ? 0.4259 0.3700 0.6391 0.1467  0.0651  0.1712  1329 HOH B O   
1273 O O   . HOH G .  ? 0.4521 0.7102 0.4768 0.0138  -0.0222 0.1227  1330 HOH B O   
1274 O O   . HOH G .  ? 0.4248 0.3809 0.5199 0.0217  -0.1032 0.0472  1331 HOH B O   
1275 O O   . HOH G .  ? 0.7693 0.6970 0.2723 0.0600  0.0072  -0.0090 1332 HOH B O   
1276 O O   . HOH G .  ? 2.5285 1.9287 2.6092 -2.0583 -2.0021 1.8803  1333 HOH B O   
1277 O O   . HOH G .  ? 0.4784 0.5620 0.9766 -0.0324 0.0255  0.2471  1334 HOH B O   
1278 O O   . HOH G .  ? 0.3137 0.2206 0.4059 -0.0180 -0.0463 0.1028  1335 HOH B O   
1279 O O   . HOH G .  ? 0.3634 0.3381 0.4562 0.0852  0.0119  -0.0103 1336 HOH B O   
1280 O O   . HOH G .  ? 0.5338 0.7884 0.6352 0.1748  -0.0151 -0.0434 1337 HOH B O   
1281 O O   . HOH G .  ? 0.4005 0.6769 0.5416 0.0114  -0.0182 0.1318  1338 HOH B O   
1282 O O   . HOH G .  ? 1.1256 0.2894 0.3416 0.1072  -0.2083 -0.0129 1339 HOH B O   
1283 O O   . HOH G .  ? 0.4717 0.6168 0.7212 0.0612  0.1074  0.3606  1340 HOH B O   
1284 O O   . HOH G .  ? 0.3903 0.4716 0.4740 0.0196  0.0263  0.0862  1341 HOH B O   
1285 O O   . HOH G .  ? 0.3850 0.4759 0.7066 0.0323  -0.1612 -0.0043 1342 HOH B O   
1286 O O   . HOH G .  ? 0.6905 0.5061 0.5062 0.2834  0.1429  0.0340  1343 HOH B O   
1287 O O   . HOH G .  ? 0.6180 0.3913 0.5220 -0.1695 -0.0625 -0.0489 1344 HOH B O   
1288 O O   . HOH G .  ? 2.3495 3.2922 2.0141 -2.0747 1.3717  -1.6737 1345 HOH B O   
1289 O O   . HOH G .  ? 0.6023 0.4718 0.9462 -0.1751 0.1799  -0.1893 1346 HOH B O   
1290 O O   . HOH G .  ? 0.4716 0.4901 0.5669 -0.0538 -0.1065 0.1180  1347 HOH B O   
1291 O O   . HOH G .  ? 0.6081 0.5908 0.5396 0.1630  -0.0208 -0.1904 1348 HOH B O   
1292 O O   . HOH G .  ? 0.6346 0.3284 0.7042 -0.0422 -0.0412 -0.0809 1349 HOH B O   
1293 O O   . HOH G .  ? 1.0374 1.0530 1.2270 0.5213  -0.4468 -0.4452 1350 HOH B O   
1294 O O   . HOH G .  ? 0.5810 0.4959 0.6871 0.0806  -0.0292 0.0131  1351 HOH B O   
1295 O O   . HOH G .  ? 3.5412 1.9451 1.6301 -1.7923 1.6511  -0.9809 1352 HOH B O   
1296 O O   . HOH G .  ? 2.1373 2.1726 2.3348 -1.1530 -1.5142 1.4396  1353 HOH B O   
1297 O O   . HOH G .  ? 0.5753 0.5987 0.6096 -0.1543 -0.0473 -0.0392 1354 HOH B O   
1298 O O   . HOH G .  ? 1.0717 1.1785 0.5844 -0.2940 0.2768  -0.2587 1355 HOH B O   
1299 O O   . HOH G .  ? 0.8690 1.2460 0.4391 0.2038  0.0797  0.1489  1356 HOH B O   
1300 O O   . HOH G .  ? 0.7056 0.7020 0.6446 0.2588  0.0947  0.1248  1357 HOH B O   
1301 O O   . HOH G .  ? 0.5726 0.5394 0.7138 0.0689  -0.1369 -0.1749 1358 HOH B O   
1302 O O   . HOH G .  ? 0.4607 0.5629 0.7722 -0.1424 0.1426  0.0247  1359 HOH B O   
1303 O O   . HOH G .  ? 0.1807 0.2616 0.3180 -0.0159 -0.0133 0.0810  1360 HOH B O   
1304 O O   . HOH G .  ? 0.4725 0.9015 1.0095 0.1615  0.1309  0.1565  1361 HOH B O   
1305 O O   . HOH G .  ? 0.9532 0.7941 0.5053 0.5069  0.1378  0.0555  1362 HOH B O   
1306 O O   . HOH G .  ? 0.4004 0.5106 0.8822 -0.0616 -0.1386 -0.1205 1363 HOH B O   
1307 O O   . HOH G .  ? 0.7549 0.3946 0.5622 -0.0306 -0.0738 -0.0349 1364 HOH B O   
1308 O O   . HOH G .  ? 0.7391 0.3593 0.7710 -0.1046 0.0278  -0.0207 1365 HOH B O   
1309 O O   . HOH G .  ? 0.6005 0.9068 0.8256 -0.1245 0.3040  -0.2135 1366 HOH B O   
1310 O O   . HOH G .  ? 0.6823 0.4523 0.6865 -0.0962 -0.0920 0.0477  1367 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  HIS 1  1048 ?    ?   ?   A . n 
A 1 2  GLN 2  1049 ?    ?   ?   A . n 
A 1 3  VAL 3  1050 ?    ?   ?   A . n 
A 1 4  ASP 4  1051 ?    ?   ?   A . n 
A 1 5  THR 5  1052 1052 THR THR A . n 
A 1 6  ALA 6  1053 1053 ALA ALA A . n 
A 1 7  PRO 7  1054 1054 PRO PRO A . n 
A 1 8  THR 8  1055 1055 THR THR A . n 
A 1 9  VAL 9  1056 1056 VAL VAL A . n 
A 1 10 VAL 10 1057 1057 VAL VAL A . n 
A 1 11 ALA 11 1058 1058 ALA ALA A . n 
A 1 12 LEU 12 1059 1059 LEU LEU A . n 
A 1 13 TYR 13 1060 1060 TYR TYR A . n 
A 1 14 ASP 14 1061 1061 ASP ASP A . n 
A 1 15 TYR 15 1062 1062 TYR TYR A . n 
A 1 16 THR 16 1063 1063 THR THR A . n 
A 1 17 ALA 17 1064 1064 ALA ALA A . n 
A 1 18 ASN 18 1065 1065 ASN ASN A . n 
A 1 19 ARG 19 1066 1066 ARG ARG A . n 
A 1 20 SER 20 1067 1067 SER SER A . n 
A 1 21 ASP 21 1068 1068 ASP ASP A . n 
A 1 22 GLU 22 1069 1069 GLU GLU A . n 
A 1 23 LEU 23 1070 1070 LEU LEU A . n 
A 1 24 THR 24 1071 1071 THR THR A . n 
A 1 25 ILE 25 1072 1072 ILE ILE A . n 
A 1 26 HIS 26 1073 1073 HIS HIS A . n 
A 1 27 ARG 27 1074 1074 ARG ARG A . n 
A 1 28 GLY 28 1075 1075 GLY GLY A . n 
A 1 29 ASP 29 1076 1076 ASP ASP A . n 
A 1 30 ILE 30 1077 1077 ILE ILE A . n 
A 1 31 ILE 31 1078 1078 ILE ILE A . n 
A 1 32 ARG 32 1079 1079 ARG ARG A . n 
A 1 33 VAL 33 1080 1080 VAL VAL A . n 
A 1 34 PHE 34 1081 1081 PHE PHE A . n 
A 1 35 PHE 35 1082 1082 PHE PHE A . n 
A 1 36 LYS 36 1083 1083 LYS LYS A . n 
A 1 37 ASP 37 1084 1084 ASP ASP A . n 
A 1 38 ASN 38 1085 1085 ASN ASN A . n 
A 1 39 GLU 39 1086 1086 GLU GLU A . n 
A 1 40 ASP 40 1087 1087 ASP ASP A . n 
A 1 41 TRP 41 1088 1088 TRP TRP A . n 
A 1 42 TRP 42 1089 1089 TRP TRP A . n 
A 1 43 TYR 43 1090 1090 TYR TYR A . n 
A 1 44 GLY 44 1091 1091 GLY GLY A . n 
A 1 45 SER 45 1092 1092 SER SER A . n 
A 1 46 ILE 46 1093 1093 ILE ILE A . n 
A 1 47 GLY 47 1094 1094 GLY GLY A . n 
A 1 48 LYS 48 1095 1095 LYS LYS A . n 
A 1 49 GLY 49 1096 1096 GLY GLY A . n 
A 1 50 GLN 50 1097 1097 GLN GLN A . n 
A 1 51 GLU 51 1098 1098 GLU GLU A . n 
A 1 52 GLY 52 1099 1099 GLY GLY A . n 
A 1 53 TYR 53 1100 1100 TYR TYR A . n 
A 1 54 PHE 54 1101 1101 PHE PHE A . n 
A 1 55 PRO 55 1102 1102 PRO PRO A . n 
A 1 56 ALA 56 1103 1103 ALA ALA A . n 
A 1 57 ASN 57 1104 1104 ASN ASN A . n 
A 1 58 HIS 58 1105 1105 HIS HIS A . n 
A 1 59 VAL 59 1106 1106 VAL VAL A . n 
A 1 60 ALA 60 1107 1107 ALA ALA A . n 
A 1 61 SER 61 1108 1108 SER SER A . n 
A 1 62 GLU 62 1109 1109 GLU GLU A . n 
A 1 63 THR 63 1110 1110 THR THR A . n 
A 1 64 LEU 64 1111 1111 LEU LEU A . n 
A 1 65 TYR 65 1112 1112 TYR TYR A . n 
A 1 66 GLN 66 1113 1113 GLN GLN A . n 
A 1 67 GLU 67 1114 1114 GLU GLU A . n 
A 1 68 LEU 68 1115 1115 LEU LEU A . n 
A 1 69 PRO 69 1116 1116 PRO PRO A . n 
B 1 1  HIS 1  1048 ?    ?   ?   B . n 
B 1 2  GLN 2  1049 ?    ?   ?   B . n 
B 1 3  VAL 3  1050 ?    ?   ?   B . n 
B 1 4  ASP 4  1051 ?    ?   ?   B . n 
B 1 5  THR 5  1052 ?    ?   ?   B . n 
B 1 6  ALA 6  1053 1053 ALA ALA B . n 
B 1 7  PRO 7  1054 1054 PRO PRO B . n 
B 1 8  THR 8  1055 1055 THR THR B . n 
B 1 9  VAL 9  1056 1056 VAL VAL B . n 
B 1 10 VAL 10 1057 1057 VAL VAL B . n 
B 1 11 ALA 11 1058 1058 ALA ALA B . n 
B 1 12 LEU 12 1059 1059 LEU LEU B . n 
B 1 13 TYR 13 1060 1060 TYR TYR B . n 
B 1 14 ASP 14 1061 1061 ASP ASP B . n 
B 1 15 TYR 15 1062 1062 TYR TYR B . n 
B 1 16 THR 16 1063 1063 THR THR B . n 
B 1 17 ALA 17 1064 1064 ALA ALA B . n 
B 1 18 ASN 18 1065 1065 ASN ASN B . n 
B 1 19 ARG 19 1066 1066 ARG ARG B . n 
B 1 20 SER 20 1067 1067 SER SER B . n 
B 1 21 ASP 21 1068 1068 ASP ASP B . n 
B 1 22 GLU 22 1069 1069 GLU GLU B . n 
B 1 23 LEU 23 1070 1070 LEU LEU B . n 
B 1 24 THR 24 1071 1071 THR THR B . n 
B 1 25 ILE 25 1072 1072 ILE ILE B . n 
B 1 26 HIS 26 1073 1073 HIS HIS B . n 
B 1 27 ARG 27 1074 1074 ARG ARG B . n 
B 1 28 GLY 28 1075 1075 GLY GLY B . n 
B 1 29 ASP 29 1076 1076 ASP ASP B . n 
B 1 30 ILE 30 1077 1077 ILE ILE B . n 
B 1 31 ILE 31 1078 1078 ILE ILE B . n 
B 1 32 ARG 32 1079 1079 ARG ARG B . n 
B 1 33 VAL 33 1080 1080 VAL VAL B . n 
B 1 34 PHE 34 1081 1081 PHE PHE B . n 
B 1 35 PHE 35 1082 1082 PHE PHE B . n 
B 1 36 LYS 36 1083 1083 LYS LYS B . n 
B 1 37 ASP 37 1084 1084 ASP ASP B . n 
B 1 38 ASN 38 1085 1085 ASN ASN B . n 
B 1 39 GLU 39 1086 1086 GLU GLU B . n 
B 1 40 ASP 40 1087 1087 ASP ASP B . n 
B 1 41 TRP 41 1088 1088 TRP TRP B . n 
B 1 42 TRP 42 1089 1089 TRP TRP B . n 
B 1 43 TYR 43 1090 1090 TYR TYR B . n 
B 1 44 GLY 44 1091 1091 GLY GLY B . n 
B 1 45 SER 45 1092 1092 SER SER B . n 
B 1 46 ILE 46 1093 1093 ILE ILE B . n 
B 1 47 GLY 47 1094 1094 GLY GLY B . n 
B 1 48 LYS 48 1095 1095 LYS LYS B . n 
B 1 49 GLY 49 1096 1096 GLY GLY B . n 
B 1 50 GLN 50 1097 1097 GLN GLN B . n 
B 1 51 GLU 51 1098 1098 GLU GLU B . n 
B 1 52 GLY 52 1099 1099 GLY GLY B . n 
B 1 53 TYR 53 1100 1100 TYR TYR B . n 
B 1 54 PHE 54 1101 1101 PHE PHE B . n 
B 1 55 PRO 55 1102 1102 PRO PRO B . n 
B 1 56 ALA 56 1103 1103 ALA ALA B . n 
B 1 57 ASN 57 1104 1104 ASN ASN B . n 
B 1 58 HIS 58 1105 1105 HIS HIS B . n 
B 1 59 VAL 59 1106 1106 VAL VAL B . n 
B 1 60 ALA 60 1107 1107 ALA ALA B . n 
B 1 61 SER 61 1108 1108 SER SER B . n 
B 1 62 GLU 62 1109 1109 GLU GLU B . n 
B 1 63 THR 63 1110 1110 THR THR B . n 
B 1 64 LEU 64 1111 1111 LEU LEU B . n 
B 1 65 TYR 65 1112 1112 TYR TYR B . n 
B 1 66 GLN 66 1113 1113 GLN GLN B . n 
B 1 67 GLU 67 1114 1114 GLU GLU B . n 
B 1 68 LEU 68 1115 1115 LEU LEU B . n 
B 1 69 PRO 69 1116 1116 PRO PRO B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PEG 1  1201 1   PEG PEG B . 
D 2 PEG 1  1202 1   PEG PEG B . 
E 2 PEG 1  1203 1   PEG PEG B . 
F 3 HOH 1  1201 1   HOH HOH A . 
F 3 HOH 2  1202 2   HOH HOH A . 
F 3 HOH 3  1203 6   HOH HOH A . 
F 3 HOH 4  1204 8   HOH HOH A . 
F 3 HOH 5  1205 10  HOH HOH A . 
F 3 HOH 6  1206 11  HOH HOH A . 
F 3 HOH 7  1207 12  HOH HOH A . 
F 3 HOH 8  1208 16  HOH HOH A . 
F 3 HOH 9  1209 17  HOH HOH A . 
F 3 HOH 10 1210 18  HOH HOH A . 
F 3 HOH 11 1211 19  HOH HOH A . 
F 3 HOH 12 1212 21  HOH HOH A . 
F 3 HOH 13 1213 25  HOH HOH A . 
F 3 HOH 14 1214 27  HOH HOH A . 
F 3 HOH 15 1215 29  HOH HOH A . 
F 3 HOH 16 1216 30  HOH HOH A . 
F 3 HOH 17 1217 31  HOH HOH A . 
F 3 HOH 18 1218 32  HOH HOH A . 
F 3 HOH 19 1219 33  HOH HOH A . 
F 3 HOH 20 1220 34  HOH HOH A . 
F 3 HOH 21 1221 35  HOH HOH A . 
F 3 HOH 22 1222 36  HOH HOH A . 
F 3 HOH 23 1223 38  HOH HOH A . 
F 3 HOH 24 1224 39  HOH HOH A . 
F 3 HOH 25 1225 40  HOH HOH A . 
F 3 HOH 26 1226 42  HOH HOH A . 
F 3 HOH 27 1227 44  HOH HOH A . 
F 3 HOH 28 1228 47  HOH HOH A . 
F 3 HOH 29 1229 48  HOH HOH A . 
F 3 HOH 30 1230 50  HOH HOH A . 
F 3 HOH 31 1231 51  HOH HOH A . 
F 3 HOH 32 1232 52  HOH HOH A . 
F 3 HOH 33 1233 55  HOH HOH A . 
F 3 HOH 34 1234 56  HOH HOH A . 
F 3 HOH 35 1235 59  HOH HOH A . 
F 3 HOH 36 1236 63  HOH HOH A . 
F 3 HOH 37 1237 64  HOH HOH A . 
F 3 HOH 38 1238 68  HOH HOH A . 
F 3 HOH 39 1239 70  HOH HOH A . 
F 3 HOH 40 1240 71  HOH HOH A . 
F 3 HOH 41 1241 72  HOH HOH A . 
F 3 HOH 42 1242 73  HOH HOH A . 
F 3 HOH 43 1243 74  HOH HOH A . 
F 3 HOH 44 1244 75  HOH HOH A . 
F 3 HOH 45 1245 77  HOH HOH A . 
F 3 HOH 46 1246 78  HOH HOH A . 
F 3 HOH 47 1247 79  HOH HOH A . 
F 3 HOH 48 1248 80  HOH HOH A . 
F 3 HOH 49 1249 81  HOH HOH A . 
F 3 HOH 50 1250 84  HOH HOH A . 
F 3 HOH 51 1251 85  HOH HOH A . 
F 3 HOH 52 1252 86  HOH HOH A . 
F 3 HOH 53 1253 87  HOH HOH A . 
F 3 HOH 54 1254 89  HOH HOH A . 
F 3 HOH 55 1255 90  HOH HOH A . 
F 3 HOH 56 1256 91  HOH HOH A . 
F 3 HOH 57 1257 93  HOH HOH A . 
F 3 HOH 58 1258 94  HOH HOH A . 
F 3 HOH 59 1259 96  HOH HOH A . 
F 3 HOH 60 1260 97  HOH HOH A . 
F 3 HOH 61 1261 99  HOH HOH A . 
F 3 HOH 62 1262 100 HOH HOH A . 
F 3 HOH 63 1263 101 HOH HOH A . 
F 3 HOH 64 1264 102 HOH HOH A . 
F 3 HOH 65 1265 103 HOH HOH A . 
F 3 HOH 66 1266 104 HOH HOH A . 
F 3 HOH 67 1267 106 HOH HOH A . 
F 3 HOH 68 1268 109 HOH HOH A . 
F 3 HOH 69 1269 112 HOH HOH A . 
F 3 HOH 70 1270 116 HOH HOH A . 
F 3 HOH 71 1271 118 HOH HOH A . 
F 3 HOH 72 1272 119 HOH HOH A . 
F 3 HOH 73 1273 120 HOH HOH A . 
F 3 HOH 74 1274 122 HOH HOH A . 
F 3 HOH 75 1275 126 HOH HOH A . 
F 3 HOH 76 1276 128 HOH HOH A . 
F 3 HOH 77 1277 129 HOH HOH A . 
F 3 HOH 78 1278 130 HOH HOH A . 
F 3 HOH 79 1279 135 HOH HOH A . 
F 3 HOH 80 1280 136 HOH HOH A . 
F 3 HOH 81 1281 137 HOH HOH A . 
F 3 HOH 82 1282 140 HOH HOH A . 
F 3 HOH 83 1283 142 HOH HOH A . 
F 3 HOH 84 1284 143 HOH HOH A . 
F 3 HOH 85 1285 144 HOH HOH A . 
F 3 HOH 86 1286 145 HOH HOH A . 
F 3 HOH 87 1287 146 HOH HOH A . 
F 3 HOH 88 1288 148 HOH HOH A . 
F 3 HOH 89 1289 151 HOH HOH A . 
F 3 HOH 90 1290 152 HOH HOH A . 
F 3 HOH 91 1291 153 HOH HOH A . 
F 3 HOH 92 1292 155 HOH HOH A . 
F 3 HOH 93 1293 156 HOH HOH A . 
F 3 HOH 94 1294 158 HOH HOH A . 
F 3 HOH 95 1295 159 HOH HOH A . 
F 3 HOH 96 1296 160 HOH HOH A . 
F 3 HOH 97 1297 164 HOH HOH A . 
F 3 HOH 98 1298 165 HOH HOH A . 
F 3 HOH 99 1299 166 HOH HOH A . 
G 3 HOH 1  1301 3   HOH HOH B . 
G 3 HOH 2  1302 4   HOH HOH B . 
G 3 HOH 3  1303 5   HOH HOH B . 
G 3 HOH 4  1304 7   HOH HOH B . 
G 3 HOH 5  1305 9   HOH HOH B . 
G 3 HOH 6  1306 13  HOH HOH B . 
G 3 HOH 7  1307 14  HOH HOH B . 
G 3 HOH 8  1308 15  HOH HOH B . 
G 3 HOH 9  1309 20  HOH HOH B . 
G 3 HOH 10 1310 22  HOH HOH B . 
G 3 HOH 11 1311 23  HOH HOH B . 
G 3 HOH 12 1312 24  HOH HOH B . 
G 3 HOH 13 1313 26  HOH HOH B . 
G 3 HOH 14 1314 28  HOH HOH B . 
G 3 HOH 15 1315 37  HOH HOH B . 
G 3 HOH 16 1316 41  HOH HOH B . 
G 3 HOH 17 1317 43  HOH HOH B . 
G 3 HOH 18 1318 45  HOH HOH B . 
G 3 HOH 19 1319 46  HOH HOH B . 
G 3 HOH 20 1320 49  HOH HOH B . 
G 3 HOH 21 1321 53  HOH HOH B . 
G 3 HOH 22 1322 54  HOH HOH B . 
G 3 HOH 23 1323 57  HOH HOH B . 
G 3 HOH 24 1324 58  HOH HOH B . 
G 3 HOH 25 1325 60  HOH HOH B . 
G 3 HOH 26 1326 61  HOH HOH B . 
G 3 HOH 27 1327 62  HOH HOH B . 
G 3 HOH 28 1328 65  HOH HOH B . 
G 3 HOH 29 1329 66  HOH HOH B . 
G 3 HOH 30 1330 67  HOH HOH B . 
G 3 HOH 31 1331 69  HOH HOH B . 
G 3 HOH 32 1332 76  HOH HOH B . 
G 3 HOH 33 1333 82  HOH HOH B . 
G 3 HOH 34 1334 83  HOH HOH B . 
G 3 HOH 35 1335 88  HOH HOH B . 
G 3 HOH 36 1336 92  HOH HOH B . 
G 3 HOH 37 1337 95  HOH HOH B . 
G 3 HOH 38 1338 98  HOH HOH B . 
G 3 HOH 39 1339 105 HOH HOH B . 
G 3 HOH 40 1340 107 HOH HOH B . 
G 3 HOH 41 1341 108 HOH HOH B . 
G 3 HOH 42 1342 110 HOH HOH B . 
G 3 HOH 43 1343 111 HOH HOH B . 
G 3 HOH 44 1344 113 HOH HOH B . 
G 3 HOH 45 1345 114 HOH HOH B . 
G 3 HOH 46 1346 115 HOH HOH B . 
G 3 HOH 47 1347 117 HOH HOH B . 
G 3 HOH 48 1348 121 HOH HOH B . 
G 3 HOH 49 1349 123 HOH HOH B . 
G 3 HOH 50 1350 124 HOH HOH B . 
G 3 HOH 51 1351 125 HOH HOH B . 
G 3 HOH 52 1352 127 HOH HOH B . 
G 3 HOH 53 1353 131 HOH HOH B . 
G 3 HOH 54 1354 132 HOH HOH B . 
G 3 HOH 55 1355 133 HOH HOH B . 
G 3 HOH 56 1356 134 HOH HOH B . 
G 3 HOH 57 1357 138 HOH HOH B . 
G 3 HOH 58 1358 139 HOH HOH B . 
G 3 HOH 59 1359 141 HOH HOH B . 
G 3 HOH 60 1360 147 HOH HOH B . 
G 3 HOH 61 1361 149 HOH HOH B . 
G 3 HOH 62 1362 150 HOH HOH B . 
G 3 HOH 63 1363 154 HOH HOH B . 
G 3 HOH 64 1364 157 HOH HOH B . 
G 3 HOH 65 1365 161 HOH HOH B . 
G 3 HOH 66 1366 162 HOH HOH B . 
G 3 HOH 67 1367 163 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,F       
2 1 B,C,D,E,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1297 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-06-06 
2 'Structure model' 1 1 2012-11-14 
3 'Structure model' 1 2 2017-11-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 REFMAC      5.5.0109 ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
4 PDB_EXTRACT 3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
5 HKL-2000    .        ?                ?       ?                    ?                        'data collection' ? ?          ? 
6 HKL-2000    .        ?                ?       ?                    ?                        'data reduction'  ? ?          ? 
7 PHASER      .        ?                ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OE2 A GLU 1098 ? B O A HOH 1288 ? ? 1.71 
2  1 O   A HOH 1220 ? ? O A HOH 1259 ? ? 1.87 
3  1 O4  B PEG 1203 ? ? O B HOH 1365 ? ? 1.95 
4  1 O   A HOH 1288 ? ? O B HOH 1360 ? ? 1.96 
5  1 O   A HOH 1238 ? ? O A HOH 1253 ? ? 1.97 
6  1 OG1 B THR 1071 ? ? O B HOH 1326 ? ? 1.98 
7  1 O   B HOH 1303 ? ? O B HOH 1335 ? ? 2.03 
8  1 CB  A PRO 1054 ? B O A HOH 1291 ? ? 2.05 
9  1 CB  A THR 1052 ? B O A HOH 1290 ? ? 2.15 
10 1 O   A HOH 1228 ? ? O A HOH 1254 ? ? 2.15 
11 1 O   A HOH 1287 ? ? O A HOH 1288 ? ? 2.16 
12 1 O1  B PEG 1201 ? ? O B HOH 1337 ? ? 2.17 
13 1 O   A HOH 1234 ? ? O A HOH 1282 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O1 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    PEG 
_pdbx_validate_symm_contact.auth_seq_id_1     1202 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     1258 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_545 
_pdbx_validate_symm_contact.dist              1.96 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  A ALA 1053 ? B O   A ALA 1053 ? B 1.363 1.229 0.134  0.019 N 
2 1 CD A GLU 1086 ? A OE1 A GLU 1086 ? A 1.330 1.252 0.078  0.011 N 
3 1 CD A GLU 1114 ? ? OE2 A GLU 1114 ? ? 1.127 1.252 -0.125 0.011 N 
4 1 CB B GLU 1086 ? B CG  B GLU 1086 ? B 1.648 1.517 0.131  0.019 N 
5 1 CB B GLU 1114 ? ? CG  B GLU 1114 ? ? 1.256 1.517 -0.261 0.019 N 
6 1 CD B GLU 1114 ? ? OE1 B GLU 1114 ? ? 1.167 1.252 -0.085 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 1066 ? ? CZ A ARG 1066 ? ? NH1 A ARG 1066 ? ? 117.16 120.30 -3.14 0.50 N 
2 1 CB B ASP 1061 ? ? CG B ASP 1061 ? ? OD1 B ASP 1061 ? ? 124.15 118.30 5.85  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 1055 ? B -48.71  165.51  
2 1 ASN B 1085 ? ? -160.25 -167.68 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     1074 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.073 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A THR 1052 ? OG1 ? A THR 5  OG1 
2  1 Y 1 A THR 1052 ? CG2 ? A THR 5  CG2 
3  1 Y 1 B ARG 1079 ? CD  ? B ARG 32 CD  
4  1 Y 1 B ARG 1079 ? NE  ? B ARG 32 NE  
5  1 Y 1 B ARG 1079 ? CZ  ? B ARG 32 CZ  
6  1 Y 1 B ARG 1079 ? NH1 ? B ARG 32 NH1 
7  1 Y 1 B ARG 1079 ? NH2 ? B ARG 32 NH2 
8  1 Y 1 B LYS 1095 ? CG  ? B LYS 48 CG  
9  1 Y 1 B LYS 1095 ? CD  ? B LYS 48 CD  
10 1 Y 1 B LYS 1095 ? CE  ? B LYS 48 CE  
11 1 Y 1 B LYS 1095 ? NZ  ? B LYS 48 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 1048 ? A HIS 1 
2 1 Y 1 A GLN 1049 ? A GLN 2 
3 1 Y 1 A VAL 1050 ? A VAL 3 
4 1 Y 1 A ASP 1051 ? A ASP 4 
5 1 Y 1 B HIS 1048 ? B HIS 1 
6 1 Y 1 B GLN 1049 ? B GLN 2 
7 1 Y 1 B VAL 1050 ? B VAL 3 
8 1 Y 1 B ASP 1051 ? B ASP 4 
9 1 Y 1 B THR 1052 ? B THR 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DI(HYDROXYETHYL)ETHER' PEG 
3 water                   HOH 
#