data_4ETO
# 
_entry.id   4ETO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ETO         
RCSB  RCSB072055   
WWPDB D_1000072055 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB         2Q91          . unspecified 
TargetTrack NYSGRC-012776 . unspecified 
# 
_pdbx_database_status.entry_id                        4ETO 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-04-24 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ramagopal, U.A.'                                           1 
'Dulyaninova, N.G.'                                         2 
'Kumar, P.R.'                                               3 
'Almo, S.C.'                                                4 
'Bresnick, A.R.'                                            5 
'New York Structural Genomics Research Consortium (NYSGRC)' 6 
'Atoms-to-Animals: The Immune Function Network (IFN)'       7 
# 
_citation.id                        primary 
_citation.title                     'Structure of S100A4 with bound peptide P' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ramagopal, U.A.'   1 
primary 'Dulyaninova, N.G.' 2 
primary 'Kumar, P.R.'       3 
primary 'Almo, S.C.'        4 
primary 'Bresnick, A.R.'    5 
# 
_cell.length_a           30.279 
_cell.length_b           91.989 
_cell.length_c           32.864 
_cell.angle_alpha        90.000 
_cell.angle_beta         112.600 
_cell.angle_gamma        90.000 
_cell.entry_id           4ETO 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         4ETO 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-A4' 10763.358 2  ? ? 'UNP residues 1-93'                     ? 
2 polymer     man Myosin-9          1922.239  1  ? ? 'Coiled coil region residues 1908-1923' ? 
3 non-polymer syn 'CALCIUM ION'     40.078    4  ? ? ?                                       ? 
4 water       nat water             18.015    86 ? ? ?                                       ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Calvasculin, Metastasin, Placental calcium-binding protein, Protein Mts1, S100 calcium-binding protein A4' 
2 
;Cellular myosin heavy chain, type A, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, Non-muscle myosin heavy chain A, NMMHC-A, Non-muscle myosin heavy chain IIa, NMMHC II-a, NMMHC-IIA
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLS
CIAMMCNEFFEGF
;
;MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLS
CIAMMCNEFFEGF
;
A,B NYSGRC-012776 
2 'polypeptide(L)' no no DAMNREVSSLKNKLRR                                                                                 
DAMNREVSSLKNKLRR                                                                                 P   ?             
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  CYS n 
1 4  PRO n 
1 5  LEU n 
1 6  GLU n 
1 7  LYS n 
1 8  ALA n 
1 9  LEU n 
1 10 ASP n 
1 11 VAL n 
1 12 MET n 
1 13 VAL n 
1 14 SER n 
1 15 THR n 
1 16 PHE n 
1 17 HIS n 
1 18 LYS n 
1 19 TYR n 
1 20 SER n 
1 21 GLY n 
1 22 LYS n 
1 23 GLU n 
1 24 GLY n 
1 25 ASP n 
1 26 LYS n 
1 27 PHE n 
1 28 LYS n 
1 29 LEU n 
1 30 ASN n 
1 31 LYS n 
1 32 SER n 
1 33 GLU n 
1 34 LEU n 
1 35 LYS n 
1 36 GLU n 
1 37 LEU n 
1 38 LEU n 
1 39 THR n 
1 40 ARG n 
1 41 GLU n 
1 42 LEU n 
1 43 PRO n 
1 44 SER n 
1 45 PHE n 
1 46 LEU n 
1 47 GLY n 
1 48 LYS n 
1 49 ARG n 
1 50 THR n 
1 51 ASP n 
1 52 GLU n 
1 53 ALA n 
1 54 ALA n 
1 55 PHE n 
1 56 GLN n 
1 57 LYS n 
1 58 LEU n 
1 59 MET n 
1 60 SER n 
1 61 ASN n 
1 62 LEU n 
1 63 ASP n 
1 64 SER n 
1 65 ASN n 
1 66 ARG n 
1 67 ASP n 
1 68 ASN n 
1 69 GLU n 
1 70 VAL n 
1 71 ASP n 
1 72 PHE n 
1 73 GLN n 
1 74 GLU n 
1 75 TYR n 
1 76 CYS n 
1 77 VAL n 
1 78 PHE n 
1 79 LEU n 
1 80 SER n 
1 81 CYS n 
1 82 ILE n 
1 83 ALA n 
1 84 MET n 
1 85 MET n 
1 86 CYS n 
1 87 ASN n 
1 88 GLU n 
1 89 PHE n 
1 90 PHE n 
1 91 GLU n 
1 92 GLY n 
1 93 PHE n 
2 1  ASP n 
2 2  ALA n 
2 3  MET n 
2 4  ASN n 
2 5  ARG n 
2 6  GLU n 
2 7  VAL n 
2 8  SER n 
2 9  SER n 
2 10 LEU n 
2 11 LYS n 
2 12 ASN n 
2 13 LYS n 
2 14 LEU n 
2 15 ARG n 
2 16 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CAPL, MTS1, S100A4' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'PET23A)' ? ? 
2 1 sample ? ? ? human ? MYH9                 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ?                  ?   ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ?       ? ? ? ?         ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP S10A4_HUMAN P26447 1 
;MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLS
CIAMMCNEFFEGF
;
1    ? 
2 UNP MYH9_HUMAN  P35579 2 DAMNREVSSLKNKLRR                                                                                 1908 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ETO A 1 ? 93 ? P26447 1    ? 93   ? 1    93   
2 1 4ETO B 1 ? 93 ? P26447 1    ? 93   ? 1    93   
3 2 4ETO P 1 ? 16 ? P35579 1908 ? 1923 ? 1908 1923 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4ETO 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      1.80 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   31.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'0.1 M HEPES pH 7.0, 30% (v/v) Jeffamine ED-2001, Vapor diffusion, Sitting drop, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2011-02-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
# 
_reflns.entry_id                     4ETO 
_reflns.d_resolution_high            1.540 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   24461 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_netI_over_sigmaI        9.900 
_reflns.pdbx_chi_squared             1.734 
_reflns.pdbx_redundancy              3.600 
_reflns.percent_possible_obs         99.600 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.540 1.570  ? ? ? 0.496 ? ? 1.396 3.500 ? 1214 100.000 1  1 
1.570 1.600  ? ? ? 0.455 ? ? 1.368 3.600 ? 1242 100.000 2  1 
1.600 1.630  ? ? ? 0.399 ? ? 1.388 3.600 ? 1193 100.000 3  1 
1.630 1.660  ? ? ? 0.338 ? ? 1.437 3.600 ? 1237 100.000 4  1 
1.660 1.690  ? ? ? 0.324 ? ? 1.424 3.600 ? 1214 100.000 5  1 
1.690 1.730  ? ? ? 0.265 ? ? 1.406 3.600 ? 1230 100.000 6  1 
1.730 1.780  ? ? ? 0.223 ? ? 1.422 3.600 ? 1237 100.000 7  1 
1.780 1.830  ? ? ? 0.194 ? ? 1.471 3.600 ? 1219 100.000 8  1 
1.830 1.880  ? ? ? 0.166 ? ? 1.557 3.600 ? 1209 99.900  9  1 
1.880 1.940  ? ? ? 0.132 ? ? 1.606 3.600 ? 1238 100.000 10 1 
1.940 2.010  ? ? ? 0.118 ? ? 1.681 3.600 ? 1209 99.800  11 1 
2.010 2.090  ? ? ? 0.095 ? ? 1.650 3.600 ? 1232 100.000 12 1 
2.090 2.190  ? ? ? 0.081 ? ? 1.872 3.600 ? 1243 99.500  13 1 
2.190 2.300  ? ? ? 0.072 ? ? 2.052 3.600 ? 1195 99.300  14 1 
2.300 2.440  ? ? ? 0.063 ? ? 1.943 3.600 ? 1207 99.200  15 1 
2.440 2.630  ? ? ? 0.059 ? ? 2.050 3.600 ? 1231 99.200  16 1 
2.630 2.900  ? ? ? 0.052 ? ? 2.119 3.600 ? 1221 98.900  17 1 
2.900 3.320  ? ? ? 0.047 ? ? 2.197 3.500 ? 1235 99.100  18 1 
3.320 4.180  ? ? ? 0.040 ? ? 2.287 3.500 ? 1221 99.300  19 1 
4.180 50.000 ? ? ? 0.039 ? ? 2.445 3.400 ? 1234 97.800  20 1 
# 
_refine.entry_id                                 4ETO 
_refine.ls_d_res_high                            1.5400 
_refine.ls_d_res_low                             45.9900 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.4900 
_refine.ls_number_reflns_obs                     24415 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2111 
_refine.ls_R_factor_R_work                       0.2089 
_refine.ls_wR_factor_R_work                      0.2093 
_refine.ls_R_factor_R_free                       0.2513 
_refine.ls_wR_factor_R_free                      0.2494 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  1247 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               20.1365 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.1400 
_refine.aniso_B[2][2]                            -0.4000 
_refine.aniso_B[3][3]                            -0.0500 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.7700 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9500 
_refine.correlation_coeff_Fo_to_Fc_free          0.9270 
_refine.overall_SU_R_Cruickshank_DPI             0.1053 
_refine.overall_SU_R_free                        0.1066 
_refine.pdbx_overall_ESU_R                       0.1050 
_refine.pdbx_overall_ESU_R_Free                  0.1070 
_refine.overall_SU_ML                            0.0700 
_refine.overall_SU_B                             1.9130 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      2Q91 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8274 
_refine.B_iso_max                                50.680 
_refine.B_iso_min                                6.210 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1530 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               1620 
_refine_hist.d_res_high                       1.5400 
_refine_hist.d_res_low                        45.9900 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1633 0.020  0.022  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2195 1.823  1.975  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 207  5.231  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 80   31.567 25.750 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 316  15.523 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 6    11.365 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         236  0.129  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1238 0.010  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1012 1.232  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           1625 2.133  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            621  3.545  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           570  5.278  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.5400 
_refine_ls_shell.d_res_low                        1.5800 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.5600 
_refine_ls_shell.number_reflns_R_work             1697 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3040 
_refine_ls_shell.R_factor_R_free                  0.3700 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             102 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1799 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4ETO 
_struct.title                     'Structure of S100A4 in complex with non-muscle myosin-IIA peptide' 
_struct.pdbx_descriptor           'Protein S100-A4, Myosin-9' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ETO 
_struct_keywords.text            
;CALCIUM-BINDING PROTEIN, EF-hand, Structural Genomics, PSI-Biology, Protein Structure Initiative, New York Structural Genomics Research Consortium, NYSGRC, METAL BINDING PROTEIN, Atoms-to-Animals: The Immune Function Network, IFN
;
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'dimer bound to a peptide' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 3  ? GLY A 21 ? CYS A 3    GLY A 21   1 ? 19 
HELX_P HELX_P2  2  ASN A 30 ? LEU A 42 ? ASN A 30   LEU A 42   1 ? 13 
HELX_P HELX_P3  3  PRO A 43 ? LEU A 46 ? PRO A 43   LEU A 46   5 ? 4  
HELX_P HELX_P4  4  ASP A 51 ? ASP A 63 ? ASP A 51   ASP A 63   1 ? 13 
HELX_P HELX_P5  5  ASP A 71 ? GLY A 92 ? ASP A 71   GLY A 92   1 ? 22 
HELX_P HELX_P6  6  CYS B 3  ? GLY B 21 ? CYS B 3    GLY B 21   1 ? 19 
HELX_P HELX_P7  7  ASN B 30 ? LEU B 42 ? ASN B 30   LEU B 42   1 ? 13 
HELX_P HELX_P8  8  GLY B 47 ? THR B 50 ? GLY B 47   THR B 50   5 ? 4  
HELX_P HELX_P9  9  ASP B 51 ? ASP B 63 ? ASP B 51   ASP B 63   1 ? 13 
HELX_P HELX_P10 10 ASP B 71 ? GLY B 92 ? ASP B 71   GLY B 92   1 ? 22 
HELX_P HELX_P11 11 ALA C 2  ? ASN C 12 ? ALA P 1909 ASN P 1919 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? F CA  .  CA  ? ? ? 1_555 I HOH . O  ? ? B CA  101 B HOH 218 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc2  metalc ? ? A GLU 69 O   ? ? ? 1_555 E CA  . CA ? ? A GLU 69  A CA  102 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc3  metalc ? ? A GLU 23 O   ? ? ? 1_555 D CA  . CA ? ? A GLU 23  A CA  101 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc4  metalc ? ? A ASN 65 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASN 65  A CA  102 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc5  metalc ? ? A ASP 63 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 63  A CA  102 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc6  metalc ? ? D CA  .  CA  ? ? ? 1_555 H HOH . O  ? ? A CA  101 A HOH 204 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc7  metalc ? ? A LYS 28 O   ? ? ? 1_555 D CA  . CA ? ? A LYS 28  A CA  101 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc8  metalc ? ? B SER 20 O   ? ? ? 1_555 G CA  . CA ? ? B SER 20  B CA  102 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc9  metalc ? ? B ASP 67 OD1 ? ? ? 1_555 F CA  . CA ? ? B ASP 67  B CA  101 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc10 metalc ? ? B ASP 25 O   ? ? ? 1_555 G CA  . CA ? ? B ASP 25  B CA  102 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc11 metalc ? ? B GLU 74 OE1 ? ? ? 1_555 F CA  . CA ? ? B GLU 74  B CA  101 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc12 metalc ? ? B ASN 65 OD1 ? ? ? 1_555 F CA  . CA ? ? B ASN 65  B CA  101 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc13 metalc ? ? B ASP 63 OD1 ? ? ? 1_555 F CA  . CA ? ? B ASP 63  B CA  101 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc14 metalc ? ? B GLU 33 OE1 ? ? ? 1_555 G CA  . CA ? ? B GLU 33  B CA  102 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc15 metalc ? ? B GLU 69 O   ? ? ? 1_555 F CA  . CA ? ? B GLU 69  B CA  101 1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc16 metalc ? ? A SER 20 O   ? ? ? 1_555 D CA  . CA ? ? A SER 20  A CA  101 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc17 metalc ? ? A ASP 67 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 67  A CA  102 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc18 metalc ? ? B GLU 23 O   ? ? ? 1_555 G CA  . CA ? ? B GLU 23  B CA  102 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc19 metalc ? ? A GLU 33 OE1 ? ? ? 1_555 D CA  . CA ? ? A GLU 33  A CA  101 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc20 metalc ? ? E CA  .  CA  ? ? ? 1_555 H HOH . O  ? ? A CA  102 A HOH 216 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc21 metalc ? ? B LYS 28 O   ? ? ? 1_555 G CA  . CA ? ? B LYS 28  B CA  102 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc22 metalc ? ? A GLU 74 OE1 ? ? ? 1_555 E CA  . CA ? ? A GLU 74  A CA  102 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc23 metalc ? ? A ASP 25 O   ? ? ? 1_555 D CA  . CA ? ? A ASP 25  A CA  101 1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc24 metalc ? ? B GLU 33 OE2 ? ? ? 1_555 G CA  . CA ? ? B GLU 33  B CA  102 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc25 metalc ? ? A GLU 74 OE2 ? ? ? 1_555 E CA  . CA ? ? A GLU 74  A CA  102 1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc26 metalc ? ? A GLU 33 OE2 ? ? ? 1_555 D CA  . CA ? ? A GLU 33  A CA  101 1_555 ? ? ? ? ? ? ? 2.629 ? 
metalc27 metalc ? ? B GLU 74 OE2 ? ? ? 1_555 F CA  . CA ? ? B GLU 74  B CA  101 1_555 ? ? ? ? ? ? ? 2.735 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 101' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 102' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 101' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 SER A 20 ? SER A 20  . ? 1_555 ? 
2  AC1 6 GLU A 23 ? GLU A 23  . ? 1_555 ? 
3  AC1 6 ASP A 25 ? ASP A 25  . ? 1_555 ? 
4  AC1 6 LYS A 28 ? LYS A 28  . ? 1_555 ? 
5  AC1 6 GLU A 33 ? GLU A 33  . ? 1_555 ? 
6  AC1 6 HOH H .  ? HOH A 204 . ? 1_555 ? 
7  AC2 6 ASP A 63 ? ASP A 63  . ? 1_555 ? 
8  AC2 6 ASN A 65 ? ASN A 65  . ? 1_555 ? 
9  AC2 6 ASP A 67 ? ASP A 67  . ? 1_555 ? 
10 AC2 6 GLU A 69 ? GLU A 69  . ? 1_555 ? 
11 AC2 6 GLU A 74 ? GLU A 74  . ? 1_555 ? 
12 AC2 6 HOH H .  ? HOH A 216 . ? 1_555 ? 
13 AC3 6 ASP B 63 ? ASP B 63  . ? 1_555 ? 
14 AC3 6 ASN B 65 ? ASN B 65  . ? 1_555 ? 
15 AC3 6 ASP B 67 ? ASP B 67  . ? 1_555 ? 
16 AC3 6 GLU B 69 ? GLU B 69  . ? 1_555 ? 
17 AC3 6 GLU B 74 ? GLU B 74  . ? 1_555 ? 
18 AC3 6 HOH I .  ? HOH B 218 . ? 1_555 ? 
19 AC4 6 SER B 20 ? SER B 20  . ? 1_555 ? 
20 AC4 6 GLU B 23 ? GLU B 23  . ? 1_555 ? 
21 AC4 6 ASP B 25 ? ASP B 25  . ? 1_555 ? 
22 AC4 6 LYS B 28 ? LYS B 28  . ? 1_555 ? 
23 AC4 6 GLU B 33 ? GLU B 33  . ? 1_555 ? 
24 AC4 6 HOH I .  ? HOH B 207 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ETO 
_atom_sites.fract_transf_matrix[1][1]   0.033026 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.013749 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010871 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.032960 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 2  ? 22.218 6.167   -11.192 1.00 30.13 ? 2    ALA A N   1 
ATOM   2    C  CA  . ALA A 1 2  ? 21.521 5.092   -10.414 1.00 28.95 ? 2    ALA A CA  1 
ATOM   3    C  C   . ALA A 1 2  ? 20.552 5.723   -9.423  1.00 27.79 ? 2    ALA A C   1 
ATOM   4    O  O   . ALA A 1 2  ? 20.796 6.815   -8.893  1.00 28.11 ? 2    ALA A O   1 
ATOM   5    C  CB  . ALA A 1 2  ? 22.518 4.212   -9.691  1.00 29.91 ? 2    ALA A CB  1 
ATOM   6    N  N   . CYS A 1 3  ? 19.445 5.032   -9.212  1.00 25.49 ? 3    CYS A N   1 
ATOM   7    C  CA  . CYS A 1 3  ? 18.461 5.430   -8.243  1.00 22.37 ? 3    CYS A CA  1 
ATOM   8    C  C   . CYS A 1 3  ? 18.372 4.288   -7.207  1.00 20.52 ? 3    CYS A C   1 
ATOM   9    O  O   . CYS A 1 3  ? 17.499 3.417   -7.287  1.00 17.73 ? 3    CYS A O   1 
ATOM   10   C  CB  . CYS A 1 3  ? 17.092 5.710   -8.892  1.00 23.53 ? 3    CYS A CB  1 
ATOM   11   S  SG  . CYS A 1 3  ? 17.027 7.254   -9.971  1.00 25.55 ? 3    CYS A SG  1 
ATOM   12   N  N   . PRO A 1 4  ? 19.259 4.316   -6.195  1.00 18.31 ? 4    PRO A N   1 
ATOM   13   C  CA  . PRO A 1 4  ? 19.230 3.275   -5.183  1.00 17.30 ? 4    PRO A CA  1 
ATOM   14   C  C   . PRO A 1 4  ? 17.837 3.031   -4.544  1.00 14.64 ? 4    PRO A C   1 
ATOM   15   O  O   . PRO A 1 4  ? 17.469 1.882   -4.280  1.00 13.64 ? 4    PRO A O   1 
ATOM   16   C  CB  . PRO A 1 4  ? 20.241 3.767   -4.134  1.00 18.50 ? 4    PRO A CB  1 
ATOM   17   C  CG  . PRO A 1 4  ? 21.155 4.669   -4.937  1.00 20.65 ? 4    PRO A CG  1 
ATOM   18   C  CD  . PRO A 1 4  ? 20.306 5.329   -5.925  1.00 20.14 ? 4    PRO A CD  1 
ATOM   19   N  N   . LEU A 1 5  ? 17.058 4.077   -4.344  1.00 14.35 ? 5    LEU A N   1 
ATOM   20   C  CA  . LEU A 1 5  ? 15.703 3.873   -3.758  1.00 13.30 ? 5    LEU A CA  1 
ATOM   21   C  C   . LEU A 1 5  ? 14.780 3.138   -4.687  1.00 13.47 ? 5    LEU A C   1 
ATOM   22   O  O   . LEU A 1 5  ? 13.944 2.349   -4.228  1.00 11.50 ? 5    LEU A O   1 
ATOM   23   C  CB  . LEU A 1 5  ? 15.056 5.216   -3.410  1.00 13.63 ? 5    LEU A CB  1 
ATOM   24   C  CG  . LEU A 1 5  ? 13.880 5.160   -2.406  1.00 12.63 ? 5    LEU A CG  1 
ATOM   25   C  CD1 . LEU A 1 5  ? 14.249 4.386   -1.156  1.00 14.99 ? 5    LEU A CD1 1 
ATOM   26   C  CD2 . LEU A 1 5  ? 13.523 6.571   -1.980  1.00 12.47 ? 5    LEU A CD2 1 
ATOM   27   N  N   . GLU A 1 6  ? 14.944 3.327   -6.007  1.00 13.01 ? 6    GLU A N   1 
ATOM   28   C  CA  . GLU A 1 6  ? 14.088 2.545   -6.940  1.00 12.81 ? 6    GLU A CA  1 
ATOM   29   C  C   . GLU A 1 6  ? 14.568 1.074   -6.942  1.00 11.74 ? 6    GLU A C   1 
ATOM   30   O  O   . GLU A 1 6  ? 13.777 0.168   -7.080  1.00 10.93 ? 6    GLU A O   1 
ATOM   31   C  CB  . GLU A 1 6  ? 14.104 3.120   -8.367  1.00 12.42 ? 6    GLU A CB  1 
ATOM   32   C  CG  . GLU A 1 6  ? 13.371 4.442   -8.389  1.00 14.76 ? 6    GLU A CG  1 
ATOM   33   C  CD  . GLU A 1 6  ? 13.009 4.994   -9.782  1.00 19.91 ? 6    GLU A CD  1 
ATOM   34   O  OE1 . GLU A 1 6  ? 13.466 4.438   -10.823 1.00 20.13 ? 6    GLU A OE1 1 
ATOM   35   O  OE2 . GLU A 1 6  ? 12.285 5.993   -9.782  1.00 18.30 ? 6    GLU A OE2 1 
ATOM   36   N  N   . LYS A 1 7  ? 15.862 0.857   -6.838  1.00 11.17 ? 7    LYS A N   1 
ATOM   37   C  CA  . LYS A 1 7  ? 16.385 -0.509  -6.719  1.00 11.67 ? 7    LYS A CA  1 
ATOM   38   C  C   . LYS A 1 7  ? 15.864 -1.171  -5.443  1.00 12.43 ? 7    LYS A C   1 
ATOM   39   O  O   . LYS A 1 7  ? 15.548 -2.345  -5.465  1.00 12.70 ? 7    LYS A O   1 
ATOM   40   C  CB  . LYS A 1 7  ? 17.903 -0.535  -6.766  1.00 14.44 ? 7    LYS A CB  1 
ATOM   41   C  CG  . LYS A 1 7  ? 18.482 -0.286  -8.133  1.00 17.32 ? 7    LYS A CG  1 
ATOM   42   C  CD  . LYS A 1 7  ? 20.000 -0.268  -7.973  1.00 22.70 ? 7    LYS A CD  1 
ATOM   43   C  CE  . LYS A 1 7  ? 20.733 0.189   -9.244  1.00 28.10 ? 7    LYS A CE  1 
ATOM   44   N  NZ  . LYS A 1 7  ? 22.191 0.160   -9.006  1.00 30.37 ? 7    LYS A NZ  1 
ATOM   45   N  N   . ALA A 1 8  ? 15.795 -0.415  -4.344  1.00 11.84 ? 8    ALA A N   1 
ATOM   46   C  CA  . ALA A 1 8  ? 15.301 -0.894  -3.081  1.00 11.34 ? 8    ALA A CA  1 
ATOM   47   C  C   . ALA A 1 8  ? 13.855 -1.356  -3.223  1.00 12.29 ? 8    ALA A C   1 
ATOM   48   O  O   . ALA A 1 8  ? 13.474 -2.425  -2.747  1.00 12.55 ? 8    ALA A O   1 
ATOM   49   C  CB  . ALA A 1 8  ? 15.421 0.197   -1.939  1.00 12.96 ? 8    ALA A CB  1 
ATOM   50   N  N   . LEU A 1 9  ? 13.063 -0.492  -3.833  1.00 11.26 ? 9    LEU A N   1 
ATOM   51   C  CA  . LEU A 1 9  ? 11.676 -0.828  -4.066  1.00 11.52 ? 9    LEU A CA  1 
ATOM   52   C  C   . LEU A 1 9  ? 11.526 -2.123  -4.872  1.00 11.47 ? 9    LEU A C   1 
ATOM   53   O  O   . LEU A 1 9  ? 10.665 -2.949  -4.598  1.00 11.09 ? 9    LEU A O   1 
ATOM   54   C  CB  . LEU A 1 9  ? 10.946 0.353   -4.765  1.00 11.77 ? 9    LEU A CB  1 
ATOM   55   C  CG  . LEU A 1 9  ? 10.603 1.511   -3.897  1.00 11.91 ? 9    LEU A CG  1 
ATOM   56   C  CD1 . LEU A 1 9  ? 10.298 2.741   -4.771  1.00 14.60 ? 9    LEU A CD1 1 
ATOM   57   C  CD2 . LEU A 1 9  ? 9.371  1.208   -2.982  1.00 16.66 ? 9    LEU A CD2 1 
ATOM   58   N  N   . ASP A 1 10 ? 12.376 -2.308  -5.920  1.00 10.66 ? 10   ASP A N   1 
ATOM   59   C  CA  . ASP A 1 10 ? 12.251 -3.520  -6.713  1.00 12.41 ? 10   ASP A CA  1 
ATOM   60   C  C   . ASP A 1 10 ? 12.572 -4.791  -5.897  1.00 11.32 ? 10   ASP A C   1 
ATOM   61   O  O   . ASP A 1 10 ? 11.922 -5.837  -6.050  1.00 13.01 ? 10   ASP A O   1 
ATOM   62   C  CB  . ASP A 1 10 ? 13.157 -3.380  -7.962  1.00 11.90 ? 10   ASP A CB  1 
ATOM   63   C  CG  . ASP A 1 10 ? 12.911 -4.465  -8.948  1.00 17.57 ? 10   ASP A CG  1 
ATOM   64   O  OD1 . ASP A 1 10 ? 13.629 -5.459  -8.824  1.00 17.53 ? 10   ASP A OD1 1 
ATOM   65   O  OD2 . ASP A 1 10 ? 11.972 -4.300  -9.762  1.00 22.20 ? 10   ASP A OD2 1 
ATOM   66   N  N   . VAL A 1 11 ? 13.590 -4.680  -5.039  1.00 9.95  ? 11   VAL A N   1 
ATOM   67   C  CA  . VAL A 1 11 ? 13.928 -5.802  -4.141  1.00 10.44 ? 11   VAL A CA  1 
ATOM   68   C  C   . VAL A 1 11 ? 12.797 -6.096  -3.148  1.00 11.03 ? 11   VAL A C   1 
ATOM   69   O  O   . VAL A 1 11 ? 12.506 -7.256  -2.882  1.00 10.97 ? 11   VAL A O   1 
ATOM   70   C  CB  . VAL A 1 11 ? 15.267 -5.495  -3.396  1.00 11.66 ? 11   VAL A CB  1 
ATOM   71   C  CG1 . VAL A 1 11 ? 15.588 -6.493  -2.265  1.00 11.02 ? 11   VAL A CG1 1 
ATOM   72   C  CG2 . VAL A 1 11 ? 16.443 -5.528  -4.432  1.00 12.87 ? 11   VAL A CG2 1 
ATOM   73   N  N   . MET A 1 12 ? 12.170 -5.055  -2.620  1.00 11.43 ? 12   MET A N   1 
ATOM   74   C  CA  . MET A 1 12 ? 11.026 -5.230  -1.674  1.00 11.86 ? 12   MET A CA  1 
ATOM   75   C  C   . MET A 1 12 ? 9.954  -6.053  -2.365  1.00 12.00 ? 12   MET A C   1 
ATOM   76   O  O   . MET A 1 12 ? 9.519  -7.059  -1.854  1.00 11.01 ? 12   MET A O   1 
ATOM   77   C  CB  . MET A 1 12 ? 10.544 -3.853  -1.230  1.00 13.85 ? 12   MET A CB  1 
ATOM   78   C  CG  . MET A 1 12 ? 11.585 -3.233  -0.407  1.00 17.46 ? 12   MET A CG  1 
ATOM   79   S  SD  . MET A 1 12 ? 11.336 -1.461  -0.157  1.00 27.33 ? 12   MET A SD  1 
ATOM   80   C  CE  . MET A 1 12 ? 9.632  -1.610  0.044   1.00 16.17 ? 12   MET A CE  1 
ATOM   81   N  N   . VAL A 1 13 ? 9.606  -5.728  -3.621  1.00 12.12 ? 13   VAL A N   1 
ATOM   82   C  CA  . VAL A 1 13 ? 8.581  -6.538  -4.329  1.00 12.72 ? 13   VAL A CA  1 
ATOM   83   C  C   . VAL A 1 13 ? 9.020  -7.900  -4.716  1.00 12.96 ? 13   VAL A C   1 
ATOM   84   O  O   . VAL A 1 13 ? 8.325  -8.901  -4.481  1.00 13.87 ? 13   VAL A O   1 
ATOM   85   C  CB  . VAL A 1 13 ? 8.134  -5.785  -5.644  1.00 14.02 ? 13   VAL A CB  1 
ATOM   86   C  CG1 . VAL A 1 13 ? 7.166  -6.651  -6.459  1.00 15.15 ? 13   VAL A CG1 1 
ATOM   87   C  CG2 . VAL A 1 13 ? 7.523  -4.465  -5.287  1.00 14.66 ? 13   VAL A CG2 1 
ATOM   88   N  N   . SER A 1 14 ? 10.211 -7.992  -5.338  1.00 11.33 ? 14   SER A N   1 
ATOM   89   C  CA  . SER A 1 14 ? 10.593 -9.307  -5.826  1.00 13.21 ? 14   SER A CA  1 
ATOM   90   C  C   . SER A 1 14 ? 10.872 -10.319 -4.728  1.00 11.97 ? 14   SER A C   1 
ATOM   91   O  O   . SER A 1 14 ? 10.680 -11.556 -4.904  1.00 12.80 ? 14   SER A O   1 
ATOM   92   C  CB  . SER A 1 14 ? 11.784 -9.209  -6.796  1.00 13.27 ? 14   SER A CB  1 
ATOM   93   O  OG  . SER A 1 14 ? 12.936 -8.691  -6.146  1.00 18.47 ? 14   SER A OG  1 
ATOM   94   N  N   . THR A 1 15 ? 11.364 -9.826  -3.591  1.00 10.52 ? 15   THR A N   1 
ATOM   95   C  CA  . THR A 1 15 ? 11.723 -10.787 -2.521  1.00 11.68 ? 15   THR A CA  1 
ATOM   96   C  C   . THR A 1 15 ? 10.519 -11.501 -1.978  1.00 10.33 ? 15   THR A C   1 
ATOM   97   O  O   . THR A 1 15 ? 10.580 -12.677 -1.655  1.00 11.32 ? 15   THR A O   1 
ATOM   98   C  CB  . THR A 1 15 ? 12.543 -10.083 -1.383  1.00 11.37 ? 15   THR A CB  1 
ATOM   99   O  OG1 . THR A 1 15 ? 13.678 -9.438  -1.972  1.00 12.82 ? 15   THR A OG1 1 
ATOM   100  C  CG2 . THR A 1 15 ? 12.978 -11.053 -0.291  1.00 13.41 ? 15   THR A CG2 1 
ATOM   101  N  N   . PHE A 1 16 ? 9.399  -10.805 -1.866  1.00 9.65  ? 16   PHE A N   1 
ATOM   102  C  CA  . PHE A 1 16 ? 8.175  -11.406 -1.389  1.00 9.22  ? 16   PHE A CA  1 
ATOM   103  C  C   . PHE A 1 16 ? 7.800  -12.620 -2.280  1.00 9.95  ? 16   PHE A C   1 
ATOM   104  O  O   . PHE A 1 16 ? 7.530  -13.715 -1.762  1.00 11.55 ? 16   PHE A O   1 
ATOM   105  C  CB  . PHE A 1 16 ? 7.030  -10.361 -1.405  1.00 9.99  ? 16   PHE A CB  1 
ATOM   106  C  CG  . PHE A 1 16 ? 5.670  -10.932 -0.967  1.00 9.93  ? 16   PHE A CG  1 
ATOM   107  C  CD1 . PHE A 1 16 ? 5.314  -10.892 0.344   1.00 10.20 ? 16   PHE A CD1 1 
ATOM   108  C  CD2 . PHE A 1 16 ? 4.768  -11.459 -1.899  1.00 10.53 ? 16   PHE A CD2 1 
ATOM   109  C  CE1 . PHE A 1 16 ? 4.032  -11.318 0.796   1.00 11.10 ? 16   PHE A CE1 1 
ATOM   110  C  CE2 . PHE A 1 16 ? 3.504  -11.895 -1.506  1.00 9.68  ? 16   PHE A CE2 1 
ATOM   111  C  CZ  . PHE A 1 16 ? 3.122  -11.811 -0.170  1.00 11.73 ? 16   PHE A CZ  1 
ATOM   112  N  N   . HIS A 1 17 ? 7.895  -12.392 -3.600  1.00 13.38 ? 17   HIS A N   1 
ATOM   113  C  CA  . HIS A 1 17 ? 7.443  -13.434 -4.587  1.00 15.21 ? 17   HIS A CA  1 
ATOM   114  C  C   . HIS A 1 17 ? 8.419  -14.591 -4.737  1.00 16.08 ? 17   HIS A C   1 
ATOM   115  O  O   . HIS A 1 17 ? 8.035  -15.688 -5.212  1.00 18.27 ? 17   HIS A O   1 
ATOM   116  C  CB  . HIS A 1 17 ? 7.082  -12.791 -5.935  1.00 14.99 ? 17   HIS A CB  1 
ATOM   117  C  CG  . HIS A 1 17 ? 5.881  -11.943 -5.819  1.00 16.43 ? 17   HIS A CG  1 
ATOM   118  N  ND1 . HIS A 1 17 ? 4.605  -12.475 -5.705  1.00 18.37 ? 17   HIS A ND1 1 
ATOM   119  C  CD2 . HIS A 1 17 ? 5.767  -10.611 -5.617  1.00 15.00 ? 17   HIS A CD2 1 
ATOM   120  C  CE1 . HIS A 1 17 ? 3.751  -11.481 -5.528  1.00 16.95 ? 17   HIS A CE1 1 
ATOM   121  N  NE2 . HIS A 1 17 ? 4.428  -10.347 -5.464  1.00 14.99 ? 17   HIS A NE2 1 
ATOM   122  N  N   . LYS A 1 18 ? 9.661  -14.401 -4.284  1.00 13.98 ? 18   LYS A N   1 
ATOM   123  C  CA  . LYS A 1 18 ? 10.604 -15.492 -4.202  1.00 16.49 ? 18   LYS A CA  1 
ATOM   124  C  C   . LYS A 1 18 ? 10.106 -16.600 -3.244  1.00 16.37 ? 18   LYS A C   1 
ATOM   125  O  O   . LYS A 1 18 ? 10.497 -17.752 -3.400  1.00 18.07 ? 18   LYS A O   1 
ATOM   126  C  CB  . LYS A 1 18 ? 11.955 -14.933 -3.728  1.00 17.63 ? 18   LYS A CB  1 
ATOM   127  C  CG  . LYS A 1 18 ? 13.170 -15.800 -3.870  1.00 21.20 ? 18   LYS A CG  1 
ATOM   128  C  CD  . LYS A 1 18 ? 14.428 -14.894 -3.659  1.00 21.75 ? 18   LYS A CD  1 
ATOM   129  C  CE  . LYS A 1 18 ? 15.632 -15.716 -3.296  1.00 26.77 ? 18   LYS A CE  1 
ATOM   130  N  NZ  . LYS A 1 18 ? 16.773 -14.777 -3.106  1.00 28.10 ? 18   LYS A NZ  1 
ATOM   131  N  N   . TYR A 1 19 ? 9.273  -16.271 -2.250  1.00 13.11 ? 19   TYR A N   1 
ATOM   132  C  CA  . TYR A 1 19 ? 8.856  -17.217 -1.226  1.00 14.86 ? 19   TYR A CA  1 
ATOM   133  C  C   . TYR A 1 19 ? 7.346  -17.534 -1.274  1.00 14.16 ? 19   TYR A C   1 
ATOM   134  O  O   . TYR A 1 19 ? 6.921  -18.595 -0.833  1.00 13.48 ? 19   TYR A O   1 
ATOM   135  C  CB  . TYR A 1 19 ? 9.306  -16.706 0.203   1.00 11.82 ? 19   TYR A CB  1 
ATOM   136  C  CG  . TYR A 1 19 ? 10.802 -16.601 0.245   1.00 13.03 ? 19   TYR A CG  1 
ATOM   137  C  CD1 . TYR A 1 19 ? 11.550 -17.770 0.541   1.00 13.86 ? 19   TYR A CD1 1 
ATOM   138  C  CD2 . TYR A 1 19 ? 11.465 -15.425 -0.041  1.00 11.13 ? 19   TYR A CD2 1 
ATOM   139  C  CE1 . TYR A 1 19 ? 12.925 -17.716 0.527   1.00 13.00 ? 19   TYR A CE1 1 
ATOM   140  C  CE2 . TYR A 1 19 ? 12.866 -15.407 -0.114  1.00 11.65 ? 19   TYR A CE2 1 
ATOM   141  C  CZ  . TYR A 1 19 ? 13.558 -16.537 0.206   1.00 15.33 ? 19   TYR A CZ  1 
ATOM   142  O  OH  . TYR A 1 19 ? 14.958 -16.568 0.221   1.00 15.22 ? 19   TYR A OH  1 
ATOM   143  N  N   . SER A 1 20 ? 6.523  -16.553 -1.661  1.00 14.27 ? 20   SER A N   1 
ATOM   144  C  CA  . SER A 1 20 ? 5.067  -16.723 -1.486  1.00 12.56 ? 20   SER A CA  1 
ATOM   145  C  C   . SER A 1 20 ? 4.507  -17.766 -2.450  1.00 14.88 ? 20   SER A C   1 
ATOM   146  O  O   . SER A 1 20 ? 3.417  -18.237 -2.256  1.00 14.77 ? 20   SER A O   1 
ATOM   147  C  CB  . SER A 1 20 ? 4.317  -15.375 -1.748  1.00 12.15 ? 20   SER A CB  1 
ATOM   148  O  OG  . SER A 1 20 ? 4.585  -14.913 -3.025  1.00 13.95 ? 20   SER A OG  1 
ATOM   149  N  N   . GLY A 1 21 ? 5.269  -18.089 -3.485  1.00 16.78 ? 21   GLY A N   1 
ATOM   150  C  CA  . GLY A 1 21 ? 4.813  -19.026 -4.520  1.00 17.86 ? 21   GLY A CA  1 
ATOM   151  C  C   . GLY A 1 21 ? 4.945  -20.524 -4.264  1.00 19.12 ? 21   GLY A C   1 
ATOM   152  O  O   . GLY A 1 21 ? 4.417  -21.340 -5.038  1.00 19.78 ? 21   GLY A O   1 
ATOM   153  N  N   . LYS A 1 22 ? 5.610  -20.920 -3.188  1.00 19.06 ? 22   LYS A N   1 
ATOM   154  C  CA  . LYS A 1 22 ? 5.901  -22.336 -2.902  1.00 19.83 ? 22   LYS A CA  1 
ATOM   155  C  C   . LYS A 1 22 ? 4.696  -23.208 -2.565  1.00 21.22 ? 22   LYS A C   1 
ATOM   156  O  O   . LYS A 1 22 ? 4.581  -24.363 -3.030  1.00 22.05 ? 22   LYS A O   1 
ATOM   157  C  CB  . LYS A 1 22 ? 6.880  -22.384 -1.750  1.00 20.97 ? 22   LYS A CB  1 
ATOM   158  C  CG  . LYS A 1 22 ? 8.098  -21.572 -2.150  1.00 23.49 ? 22   LYS A CG  1 
ATOM   159  C  CD  . LYS A 1 22 ? 9.193  -21.655 -1.112  1.00 31.41 ? 22   LYS A CD  1 
ATOM   160  C  CE  . LYS A 1 22 ? 10.446 -20.981 -1.628  1.00 30.79 ? 22   LYS A CE  1 
ATOM   161  N  NZ  . LYS A 1 22 ? 11.651 -21.809 -1.389  1.00 36.20 ? 22   LYS A NZ  1 
ATOM   162  N  N   . GLU A 1 23 ? 3.817  -22.667 -1.749  1.00 18.70 ? 23   GLU A N   1 
ATOM   163  C  CA  . GLU A 1 23 ? 2.666  -23.399 -1.224  1.00 19.48 ? 23   GLU A CA  1 
ATOM   164  C  C   . GLU A 1 23 ? 1.446  -22.523 -1.205  1.00 19.54 ? 23   GLU A C   1 
ATOM   165  O  O   . GLU A 1 23 ? 1.572  -21.250 -1.123  1.00 16.45 ? 23   GLU A O   1 
ATOM   166  C  CB  . GLU A 1 23 ? 2.929  -23.937 0.185   1.00 19.91 ? 23   GLU A CB  1 
ATOM   167  C  CG  . GLU A 1 23 ? 3.943  -25.116 0.241   1.00 22.32 ? 23   GLU A CG  1 
ATOM   168  C  CD  . GLU A 1 23 ? 4.382  -25.465 1.646   1.00 26.02 ? 23   GLU A CD  1 
ATOM   169  O  OE1 . GLU A 1 23 ? 4.338  -24.600 2.556   1.00 22.97 ? 23   GLU A OE1 1 
ATOM   170  O  OE2 . GLU A 1 23 ? 4.802  -26.631 1.851   1.00 27.06 ? 23   GLU A OE2 1 
ATOM   171  N  N   . GLY A 1 24 ? 0.281  -23.161 -1.280  1.00 19.57 ? 24   GLY A N   1 
ATOM   172  C  CA  . GLY A 1 24 ? -0.980 -22.433 -1.135  1.00 20.55 ? 24   GLY A CA  1 
ATOM   173  C  C   . GLY A 1 24 ? -1.098 -21.287 -2.101  1.00 19.75 ? 24   GLY A C   1 
ATOM   174  O  O   . GLY A 1 24 ? -0.634 -21.394 -3.262  1.00 21.54 ? 24   GLY A O   1 
ATOM   175  N  N   . ASP A 1 25 ? -1.715 -20.208 -1.620  1.00 19.88 ? 25   ASP A N   1 
ATOM   176  C  CA  . ASP A 1 25 ? -1.926 -19.004 -2.403  1.00 17.53 ? 25   ASP A CA  1 
ATOM   177  C  C   . ASP A 1 25 ? -0.555 -18.539 -2.823  1.00 17.03 ? 25   ASP A C   1 
ATOM   178  O  O   . ASP A 1 25 ? 0.302  -18.375 -1.980  1.00 16.26 ? 25   ASP A O   1 
ATOM   179  C  CB  . ASP A 1 25 ? -2.603 -17.921 -1.518  1.00 19.40 ? 25   ASP A CB  1 
ATOM   180  C  CG  . ASP A 1 25 ? -2.970 -16.686 -2.277  1.00 21.25 ? 25   ASP A CG  1 
ATOM   181  O  OD1 . ASP A 1 25 ? -2.210 -16.244 -3.177  1.00 21.50 ? 25   ASP A OD1 1 
ATOM   182  O  OD2 . ASP A 1 25 ? -4.047 -16.107 -1.977  1.00 28.95 ? 25   ASP A OD2 1 
ATOM   183  N  N   . LYS A 1 26 ? -0.361 -18.289 -4.085  1.00 16.59 ? 26   LYS A N   1 
ATOM   184  C  CA  . LYS A 1 26 ? 0.946  -17.930 -4.559  1.00 17.97 ? 26   LYS A CA  1 
ATOM   185  C  C   . LYS A 1 26 ? 1.249  -16.465 -4.305  1.00 16.99 ? 26   LYS A C   1 
ATOM   186  O  O   . LYS A 1 26 ? 2.381  -16.025 -4.587  1.00 18.87 ? 26   LYS A O   1 
ATOM   187  C  CB  . LYS A 1 26 ? 1.101  -18.312 -6.031  1.00 20.56 ? 26   LYS A CB  1 
ATOM   188  C  CG  . LYS A 1 26 ? 1.054  -19.867 -6.216  1.00 22.32 ? 26   LYS A CG  1 
ATOM   189  C  CD  . LYS A 1 26 ? 1.440  -20.251 -7.610  1.00 30.62 ? 26   LYS A CD  1 
ATOM   190  C  CE  . LYS A 1 26 ? 1.568  -21.789 -7.733  1.00 31.34 ? 26   LYS A CE  1 
ATOM   191  N  NZ  . LYS A 1 26 ? 1.955  -22.175 -9.107  1.00 38.08 ? 26   LYS A NZ  1 
ATOM   192  N  N   . PHE A 1 27 ? 0.265  -15.755 -3.759  1.00 16.62 ? 27   PHE A N   1 
ATOM   193  C  CA  . PHE A 1 27 ? 0.480  -14.324 -3.428  1.00 16.30 ? 27   PHE A CA  1 
ATOM   194  C  C   . PHE A 1 27 ? 0.476  -14.042 -1.959  1.00 14.44 ? 27   PHE A C   1 
ATOM   195  O  O   . PHE A 1 27 ? 0.412  -12.899 -1.550  1.00 15.51 ? 27   PHE A O   1 
ATOM   196  C  CB  . PHE A 1 27 ? -0.533 -13.442 -4.162  1.00 18.04 ? 27   PHE A CB  1 
ATOM   197  C  CG  . PHE A 1 27 ? -0.516 -13.632 -5.663  1.00 22.19 ? 27   PHE A CG  1 
ATOM   198  C  CD1 . PHE A 1 27 ? 0.678  -13.597 -6.389  1.00 25.36 ? 27   PHE A CD1 1 
ATOM   199  C  CD2 . PHE A 1 27 ? -1.708 -13.852 -6.342  1.00 30.42 ? 27   PHE A CD2 1 
ATOM   200  C  CE1 . PHE A 1 27 ? 0.680  -13.768 -7.767  1.00 30.48 ? 27   PHE A CE1 1 
ATOM   201  C  CE2 . PHE A 1 27 ? -1.710 -14.036 -7.725  1.00 34.04 ? 27   PHE A CE2 1 
ATOM   202  C  CZ  . PHE A 1 27 ? -0.514 -13.998 -8.434  1.00 31.78 ? 27   PHE A CZ  1 
ATOM   203  N  N   . LYS A 1 28 ? 0.547  -15.069 -1.130  1.00 14.65 ? 28   LYS A N   1 
ATOM   204  C  CA  . LYS A 1 28 ? 0.617  -14.881 0.287   1.00 13.98 ? 28   LYS A CA  1 
ATOM   205  C  C   . LYS A 1 28 ? 1.647  -15.801 0.883   1.00 14.37 ? 28   LYS A C   1 
ATOM   206  O  O   . LYS A 1 28 ? 1.886  -16.902 0.355   1.00 13.78 ? 28   LYS A O   1 
ATOM   207  C  CB  . LYS A 1 28 ? -0.699 -15.169 0.988   1.00 16.69 ? 28   LYS A CB  1 
ATOM   208  C  CG  . LYS A 1 28 ? -1.905 -14.384 0.426   1.00 18.34 ? 28   LYS A CG  1 
ATOM   209  C  CD  . LYS A 1 28 ? -3.027 -14.437 1.453   1.00 21.16 ? 28   LYS A CD  1 
ATOM   210  C  CE  . LYS A 1 28 ? -4.184 -13.602 0.983   1.00 28.66 ? 28   LYS A CE  1 
ATOM   211  N  NZ  . LYS A 1 28 ? -4.809 -14.209 -0.239  1.00 30.86 ? 28   LYS A NZ  1 
ATOM   212  N  N   . LEU A 1 29 ? 2.246  -15.352 1.993   1.00 11.44 ? 29   LEU A N   1 
ATOM   213  C  CA  . LEU A 1 29 ? 3.197  -16.212 2.729   1.00 12.42 ? 29   LEU A CA  1 
ATOM   214  C  C   . LEU A 1 29 ? 2.505  -16.952 3.863   1.00 12.71 ? 29   LEU A C   1 
ATOM   215  O  O   . LEU A 1 29 ? 2.041  -16.364 4.826   1.00 11.80 ? 29   LEU A O   1 
ATOM   216  C  CB  . LEU A 1 29 ? 4.308  -15.320 3.333   1.00 11.92 ? 29   LEU A CB  1 
ATOM   217  C  CG  . LEU A 1 29 ? 5.136  -14.517 2.432   1.00 10.67 ? 29   LEU A CG  1 
ATOM   218  C  CD1 . LEU A 1 29 ? 5.786  -13.311 3.241   1.00 10.15 ? 29   LEU A CD1 1 
ATOM   219  C  CD2 . LEU A 1 29 ? 6.282  -15.350 1.793   1.00 13.59 ? 29   LEU A CD2 1 
ATOM   220  N  N   . ASN A 1 30 ? 2.562  -18.288 3.839   1.00 12.65 ? 30   ASN A N   1 
ATOM   221  C  CA  . ASN A 1 30 ? 2.136  -19.038 4.992   1.00 13.06 ? 30   ASN A CA  1 
ATOM   222  C  C   . ASN A 1 30 ? 3.336  -19.053 5.953   1.00 14.14 ? 30   ASN A C   1 
ATOM   223  O  O   . ASN A 1 30 ? 4.396  -18.482 5.641   1.00 13.98 ? 30   ASN A O   1 
ATOM   224  C  CB  . ASN A 1 30 ? 1.646  -20.465 4.580   1.00 13.08 ? 30   ASN A CB  1 
ATOM   225  C  CG  . ASN A 1 30 ? 2.803  -21.403 4.102   1.00 15.16 ? 30   ASN A CG  1 
ATOM   226  O  OD1 . ASN A 1 30 ? 4.006  -21.273 4.475   1.00 16.72 ? 30   ASN A OD1 1 
ATOM   227  N  ND2 . ASN A 1 30 ? 2.400  -22.437 3.337   1.00 16.87 ? 30   ASN A ND2 1 
ATOM   228  N  N   . LYS A 1 31 ? 3.161  -19.597 7.157   1.00 15.08 ? 31   LYS A N   1 
ATOM   229  C  CA  . LYS A 1 31 ? 4.209  -19.500 8.177   1.00 14.45 ? 31   LYS A CA  1 
ATOM   230  C  C   . LYS A 1 31 ? 5.533  -20.115 7.735   1.00 15.15 ? 31   LYS A C   1 
ATOM   231  O  O   . LYS A 1 31 ? 6.641  -19.596 8.083   1.00 15.42 ? 31   LYS A O   1 
ATOM   232  C  CB  . LYS A 1 31 ? 3.729  -20.078 9.497   1.00 15.98 ? 31   LYS A CB  1 
ATOM   233  C  CG  . LYS A 1 31 ? 4.779  -19.925 10.623  1.00 18.14 ? 31   LYS A CG  1 
ATOM   234  C  CD  . LYS A 1 31 ? 4.254  -20.394 11.994  1.00 25.41 ? 31   LYS A CD  1 
ATOM   235  C  CE  . LYS A 1 31 ? 4.123  -21.881 12.078  1.00 27.53 ? 31   LYS A CE  1 
ATOM   236  N  NZ  . LYS A 1 31 ? 3.863  -22.203 13.508  1.00 30.83 ? 31   LYS A NZ  1 
ATOM   237  N  N   A SER A 1 32 ? 5.452  -21.237 7.027   0.70 13.76 ? 32   SER A N   1 
ATOM   238  N  N   B SER A 1 32 ? 5.478  -21.215 6.988   0.30 13.82 ? 32   SER A N   1 
ATOM   239  C  CA  A SER A 1 32 ? 6.689  -21.837 6.502   0.70 15.69 ? 32   SER A CA  1 
ATOM   240  C  CA  B SER A 1 32 ? 6.721  -21.827 6.479   0.30 13.72 ? 32   SER A CA  1 
ATOM   241  C  C   A SER A 1 32 ? 7.430  -20.940 5.504   0.70 14.36 ? 32   SER A C   1 
ATOM   242  C  C   B SER A 1 32 ? 7.451  -20.952 5.468   0.30 13.66 ? 32   SER A C   1 
ATOM   243  O  O   A SER A 1 32 ? 8.658  -20.815 5.568   0.70 15.20 ? 32   SER A O   1 
ATOM   244  O  O   B SER A 1 32 ? 8.683  -20.872 5.472   0.30 14.17 ? 32   SER A O   1 
ATOM   245  C  CB  A SER A 1 32 ? 6.420  -23.222 5.902   0.70 15.27 ? 32   SER A CB  1 
ATOM   246  C  CB  B SER A 1 32 ? 6.442  -23.202 5.875   0.30 13.29 ? 32   SER A CB  1 
ATOM   247  O  OG  A SER A 1 32 ? 7.580  -23.695 5.268   0.70 22.07 ? 32   SER A OG  1 
ATOM   248  O  OG  B SER A 1 32 ? 5.733  -23.986 6.804   0.30 11.01 ? 32   SER A OG  1 
ATOM   249  N  N   . GLU A 1 33 ? 6.689  -20.280 4.612   1.00 14.03 ? 33   GLU A N   1 
ATOM   250  C  CA  . GLU A 1 33 ? 7.276  -19.431 3.559   1.00 13.09 ? 33   GLU A CA  1 
ATOM   251  C  C   . GLU A 1 33 ? 7.855  -18.160 4.236   1.00 12.23 ? 33   GLU A C   1 
ATOM   252  O  O   . GLU A 1 33 ? 8.912  -17.667 3.856   1.00 12.26 ? 33   GLU A O   1 
ATOM   253  C  CB  . GLU A 1 33 ? 6.164  -19.059 2.603   1.00 13.83 ? 33   GLU A CB  1 
ATOM   254  C  CG  . GLU A 1 33 ? 5.766  -20.230 1.683   1.00 15.73 ? 33   GLU A CG  1 
ATOM   255  C  CD  . GLU A 1 33 ? 4.489  -19.937 0.921   1.00 14.55 ? 33   GLU A CD  1 
ATOM   256  O  OE1 . GLU A 1 33 ? 3.659  -19.133 1.393   1.00 14.40 ? 33   GLU A OE1 1 
ATOM   257  O  OE2 . GLU A 1 33 ? 4.331  -20.441 -0.227  1.00 14.84 ? 33   GLU A OE2 1 
ATOM   258  N  N   . LEU A 1 34 ? 7.143  -17.666 5.235   1.00 12.34 ? 34   LEU A N   1 
ATOM   259  C  CA  . LEU A 1 34 ? 7.654  -16.484 5.962   1.00 11.51 ? 34   LEU A CA  1 
ATOM   260  C  C   . LEU A 1 34 ? 8.941  -16.824 6.716   1.00 12.50 ? 34   LEU A C   1 
ATOM   261  O  O   . LEU A 1 34 ? 9.857  -16.074 6.672   1.00 12.20 ? 34   LEU A O   1 
ATOM   262  C  CB  . LEU A 1 34 ? 6.635  -16.021 6.987   1.00 11.21 ? 34   LEU A CB  1 
ATOM   263  C  CG  . LEU A 1 34 ? 7.081  -14.901 7.929   1.00 14.21 ? 34   LEU A CG  1 
ATOM   264  C  CD1 . LEU A 1 34 ? 7.195  -13.599 7.060   1.00 13.34 ? 34   LEU A CD1 1 
ATOM   265  C  CD2 . LEU A 1 34 ? 6.120  -14.754 9.102   1.00 14.66 ? 34   LEU A CD2 1 
ATOM   266  N  N   . LYS A 1 35 ? 9.017  -18.001 7.353   1.00 12.92 ? 35   LYS A N   1 
ATOM   267  C  CA  . LYS A 1 35 ? 10.240 -18.359 8.063   1.00 14.38 ? 35   LYS A CA  1 
ATOM   268  C  C   . LYS A 1 35 ? 11.407 -18.436 7.091   1.00 14.28 ? 35   LYS A C   1 
ATOM   269  O  O   . LYS A 1 35 ? 12.523 -17.948 7.420   1.00 14.57 ? 35   LYS A O   1 
ATOM   270  C  CB  . LYS A 1 35 ? 10.063 -19.718 8.783   1.00 15.64 ? 35   LYS A CB  1 
ATOM   271  C  CG  . LYS A 1 35 ? 11.356 -20.203 9.412   1.00 20.09 ? 35   LYS A CG  1 
ATOM   272  C  CD  . LYS A 1 35 ? 11.205 -21.628 9.962   1.00 26.95 ? 35   LYS A CD  1 
ATOM   273  C  CE  . LYS A 1 35 ? 10.388 -21.642 11.247  1.00 29.98 ? 35   LYS A CE  1 
ATOM   274  N  NZ  . LYS A 1 35 ? 9.523  -22.858 11.332  1.00 34.10 ? 35   LYS A NZ  1 
ATOM   275  N  N   . GLU A 1 36 ? 11.180 -19.036 5.899   1.00 13.45 ? 36   GLU A N   1 
ATOM   276  C  CA  . GLU A 1 36 ? 12.231 -19.050 4.885   1.00 14.85 ? 36   GLU A CA  1 
ATOM   277  C  C   . GLU A 1 36 ? 12.694 -17.652 4.510   1.00 13.56 ? 36   GLU A C   1 
ATOM   278  O  O   . GLU A 1 36 ? 13.883 -17.367 4.474   1.00 13.90 ? 36   GLU A O   1 
ATOM   279  C  CB  . GLU A 1 36 ? 11.862 -19.808 3.591   1.00 16.66 ? 36   GLU A CB  1 
ATOM   280  C  CG  . GLU A 1 36 ? 11.302 -21.155 3.768   1.00 22.87 ? 36   GLU A CG  1 
ATOM   281  C  CD  . GLU A 1 36 ? 11.386 -21.921 2.455   1.00 28.83 ? 36   GLU A CD  1 
ATOM   282  O  OE1 . GLU A 1 36 ? 11.847 -21.349 1.456   1.00 33.51 ? 36   GLU A OE1 1 
ATOM   283  O  OE2 . GLU A 1 36 ? 11.029 -23.090 2.439   1.00 31.61 ? 36   GLU A OE2 1 
ATOM   284  N  N   . LEU A 1 37 ? 11.731 -16.798 4.185   1.00 13.04 ? 37   LEU A N   1 
ATOM   285  C  CA  . LEU A 1 37 ? 12.045 -15.422 3.832   1.00 10.66 ? 37   LEU A CA  1 
ATOM   286  C  C   . LEU A 1 37 ? 12.858 -14.698 4.911   1.00 10.89 ? 37   LEU A C   1 
ATOM   287  O  O   . LEU A 1 37 ? 13.891 -14.114 4.592   1.00 12.39 ? 37   LEU A O   1 
ATOM   288  C  CB  . LEU A 1 37 ? 10.738 -14.652 3.488   1.00 10.49 ? 37   LEU A CB  1 
ATOM   289  C  CG  . LEU A 1 37 ? 11.029 -13.271 2.951   1.00 10.87 ? 37   LEU A CG  1 
ATOM   290  C  CD1 . LEU A 1 37 ? 9.804  -12.764 2.084   1.00 13.68 ? 37   LEU A CD1 1 
ATOM   291  C  CD2 . LEU A 1 37 ? 11.299 -12.223 3.974   1.00 11.75 ? 37   LEU A CD2 1 
ATOM   292  N  N   . LEU A 1 38 ? 12.422 -14.808 6.164   1.00 12.58 ? 38   LEU A N   1 
ATOM   293  C  CA  . LEU A 1 38 ? 13.115 -14.125 7.250   1.00 12.73 ? 38   LEU A CA  1 
ATOM   294  C  C   . LEU A 1 38 ? 14.519 -14.687 7.415   1.00 13.52 ? 38   LEU A C   1 
ATOM   295  O  O   . LEU A 1 38 ? 15.477 -13.931 7.542   1.00 13.68 ? 38   LEU A O   1 
ATOM   296  C  CB  . LEU A 1 38 ? 12.327 -14.311 8.529   1.00 14.17 ? 38   LEU A CB  1 
ATOM   297  C  CG  . LEU A 1 38 ? 11.001 -13.633 8.562   1.00 17.60 ? 38   LEU A CG  1 
ATOM   298  C  CD1 . LEU A 1 38 ? 10.285 -14.089 9.852   1.00 23.35 ? 38   LEU A CD1 1 
ATOM   299  C  CD2 . LEU A 1 38 ? 11.113 -12.099 8.518   1.00 22.89 ? 38   LEU A CD2 1 
ATOM   300  N  N   . THR A 1 39 ? 14.652 -16.013 7.354   1.00 13.70 ? 39   THR A N   1 
ATOM   301  C  CA  . THR A 1 39 ? 15.954 -16.637 7.642   1.00 15.74 ? 39   THR A CA  1 
ATOM   302  C  C   . THR A 1 39 ? 16.996 -16.292 6.580   1.00 14.14 ? 39   THR A C   1 
ATOM   303  O  O   . THR A 1 39 ? 18.176 -16.002 6.880   1.00 16.17 ? 39   THR A O   1 
ATOM   304  C  CB  . THR A 1 39 ? 15.745 -18.173 7.745   1.00 17.00 ? 39   THR A CB  1 
ATOM   305  O  OG1 . THR A 1 39 ? 15.015 -18.435 8.949   1.00 21.03 ? 39   THR A OG1 1 
ATOM   306  C  CG2 . THR A 1 39 ? 17.126 -18.946 7.789   1.00 22.16 ? 39   THR A CG2 1 
ATOM   307  N  N   A ARG A 1 40 ? 16.531 -16.232 5.353   0.70 13.10 ? 40   ARG A N   1 
ATOM   308  N  N   B ARG A 1 40 ? 16.566 -16.322 5.334   0.30 13.95 ? 40   ARG A N   1 
ATOM   309  C  CA  A ARG A 1 40 ? 17.398 -16.161 4.199   0.70 12.90 ? 40   ARG A CA  1 
ATOM   310  C  CA  B ARG A 1 40 ? 17.498 -16.138 4.251   0.30 13.51 ? 40   ARG A CA  1 
ATOM   311  C  C   A ARG A 1 40 ? 17.655 -14.736 3.733   0.70 12.83 ? 40   ARG A C   1 
ATOM   312  C  C   B ARG A 1 40 ? 17.731 -14.669 3.965   0.30 13.01 ? 40   ARG A C   1 
ATOM   313  O  O   A ARG A 1 40 ? 18.677 -14.430 3.096   0.70 13.74 ? 40   ARG A O   1 
ATOM   314  O  O   B ARG A 1 40 ? 18.862 -14.259 3.808   0.30 14.08 ? 40   ARG A O   1 
ATOM   315  C  CB  A ARG A 1 40 ? 16.821 -17.021 3.069   0.70 14.75 ? 40   ARG A CB  1 
ATOM   316  C  CB  B ARG A 1 40 ? 17.080 -16.937 3.018   0.30 14.33 ? 40   ARG A CB  1 
ATOM   317  C  CG  A ARG A 1 40 ? 16.881 -18.472 3.363   0.70 16.14 ? 40   ARG A CG  1 
ATOM   318  C  CG  B ARG A 1 40 ? 17.068 -18.415 3.308   0.30 14.06 ? 40   ARG A CG  1 
ATOM   319  C  CD  A ARG A 1 40 ? 16.443 -19.207 2.165   0.70 20.44 ? 40   ARG A CD  1 
ATOM   320  C  CD  B ARG A 1 40 ? 16.390 -19.160 2.221   0.30 14.15 ? 40   ARG A CD  1 
ATOM   321  N  NE  A ARG A 1 40 ? 15.943 -20.523 2.549   0.70 24.12 ? 40   ARG A NE  1 
ATOM   322  N  NE  B ARG A 1 40 ? 17.083 -19.030 0.950   0.30 12.27 ? 40   ARG A NE  1 
ATOM   323  C  CZ  A ARG A 1 40 ? 15.298 -21.346 1.733   0.70 24.00 ? 40   ARG A CZ  1 
ATOM   324  C  CZ  B ARG A 1 40 ? 16.741 -19.724 -0.128  0.30 14.46 ? 40   ARG A CZ  1 
ATOM   325  N  NH1 A ARG A 1 40 ? 15.074 -21.008 0.464   0.70 25.21 ? 40   ARG A NH1 1 
ATOM   326  N  NH1 B ARG A 1 40 ? 15.732 -20.570 -0.056  0.30 11.45 ? 40   ARG A NH1 1 
ATOM   327  N  NH2 A ARG A 1 40 ? 14.913 -22.517 2.186   0.70 25.19 ? 40   ARG A NH2 1 
ATOM   328  N  NH2 B ARG A 1 40 ? 17.390 -19.564 -1.270  0.30 14.95 ? 40   ARG A NH2 1 
ATOM   329  N  N   . GLU A 1 41 ? 16.654 -13.881 3.951   1.00 12.82 ? 41   GLU A N   1 
ATOM   330  C  CA  . GLU A 1 41 ? 16.685 -12.515 3.480   1.00 11.16 ? 41   GLU A CA  1 
ATOM   331  C  C   . GLU A 1 41 ? 16.826 -11.460 4.524   1.00 11.07 ? 41   GLU A C   1 
ATOM   332  O  O   . GLU A 1 41 ? 17.301 -10.395 4.205   1.00 10.97 ? 41   GLU A O   1 
ATOM   333  C  CB  . GLU A 1 41 ? 15.401 -12.246 2.676   1.00 11.59 ? 41   GLU A CB  1 
ATOM   334  C  CG  . GLU A 1 41 ? 15.117 -13.246 1.554   1.00 12.64 ? 41   GLU A CG  1 
ATOM   335  C  CD  . GLU A 1 41 ? 16.076 -13.181 0.396   1.00 13.40 ? 41   GLU A CD  1 
ATOM   336  O  OE1 . GLU A 1 41 ? 16.803 -12.168 0.222   1.00 16.63 ? 41   GLU A OE1 1 
ATOM   337  O  OE2 . GLU A 1 41 ? 16.088 -14.202 -0.335  1.00 16.65 ? 41   GLU A OE2 1 
ATOM   338  N  N   . LEU A 1 42 ? 16.450 -11.754 5.773   1.00 9.51  ? 42   LEU A N   1 
ATOM   339  C  CA  . LEU A 1 42 ? 16.576 -10.747 6.843   1.00 10.02 ? 42   LEU A CA  1 
ATOM   340  C  C   . LEU A 1 42 ? 17.283 -11.357 8.048   1.00 11.68 ? 42   LEU A C   1 
ATOM   341  O  O   . LEU A 1 42 ? 16.812 -11.270 9.174   1.00 12.35 ? 42   LEU A O   1 
ATOM   342  C  CB  . LEU A 1 42 ? 15.169 -10.249 7.254   1.00 9.52  ? 42   LEU A CB  1 
ATOM   343  C  CG  . LEU A 1 42 ? 14.525 -9.435  6.135   1.00 12.55 ? 42   LEU A CG  1 
ATOM   344  C  CD1 . LEU A 1 42 ? 13.064 -9.193  6.509   1.00 14.44 ? 42   LEU A CD1 1 
ATOM   345  C  CD2 . LEU A 1 42 ? 15.206 -8.077  6.016   1.00 14.87 ? 42   LEU A CD2 1 
ATOM   346  N  N   . PRO A 1 43 ? 18.416 -12.015 7.829   1.00 11.84 ? 43   PRO A N   1 
ATOM   347  C  CA  . PRO A 1 43 ? 19.001 -12.746 8.958   1.00 12.10 ? 43   PRO A CA  1 
ATOM   348  C  C   . PRO A 1 43 ? 19.395 -11.851 10.107  1.00 12.96 ? 43   PRO A C   1 
ATOM   349  O  O   . PRO A 1 43 ? 19.432 -12.329 11.278  1.00 16.85 ? 43   PRO A O   1 
ATOM   350  C  CB  . PRO A 1 43 ? 20.240 -13.446 8.311   1.00 12.08 ? 43   PRO A CB  1 
ATOM   351  C  CG  . PRO A 1 43 ? 20.542 -12.621 7.166   1.00 10.72 ? 43   PRO A CG  1 
ATOM   352  C  CD  . PRO A 1 43 ? 19.194 -12.255 6.599   1.00 10.63 ? 43   PRO A CD  1 
ATOM   353  N  N   . SER A 1 44 ? 19.664 -10.581 9.814   1.00 13.41 ? 44   SER A N   1 
ATOM   354  C  CA  . SER A 1 44 ? 20.146 -9.652  10.889  1.00 15.61 ? 44   SER A CA  1 
ATOM   355  C  C   . SER A 1 44 ? 19.036 -9.336  11.879  1.00 18.24 ? 44   SER A C   1 
ATOM   356  O  O   . SER A 1 44 ? 19.338 -8.929  13.050  1.00 21.00 ? 44   SER A O   1 
ATOM   357  C  CB  . SER A 1 44 ? 20.717 -8.381  10.320  1.00 16.95 ? 44   SER A CB  1 
ATOM   358  O  OG  . SER A 1 44 ? 19.688 -7.719  9.604   1.00 19.30 ? 44   SER A OG  1 
ATOM   359  N  N   . PHE A 1 45 ? 17.794 -9.534  11.447  1.00 17.32 ? 45   PHE A N   1 
ATOM   360  C  CA  . PHE A 1 45 ? 16.664 -9.239  12.290  1.00 21.40 ? 45   PHE A CA  1 
ATOM   361  C  C   . PHE A 1 45 ? 16.253 -10.382 13.140  1.00 21.56 ? 45   PHE A C   1 
ATOM   362  O  O   . PHE A 1 45 ? 15.538 -10.202 14.092  1.00 22.26 ? 45   PHE A O   1 
ATOM   363  C  CB  . PHE A 1 45 ? 15.551 -8.579  11.469  1.00 20.25 ? 45   PHE A CB  1 
ATOM   364  C  CG  . PHE A 1 45 ? 15.992 -7.289  10.904  1.00 19.11 ? 45   PHE A CG  1 
ATOM   365  C  CD1 . PHE A 1 45 ? 16.017 -6.145  11.715  1.00 27.70 ? 45   PHE A CD1 1 
ATOM   366  C  CD2 . PHE A 1 45 ? 16.476 -7.189  9.593   1.00 20.81 ? 45   PHE A CD2 1 
ATOM   367  C  CE1 . PHE A 1 45 ? 16.475 -4.941  11.228  1.00 28.74 ? 45   PHE A CE1 1 
ATOM   368  C  CE2 . PHE A 1 45 ? 16.927 -5.975  9.071   1.00 24.25 ? 45   PHE A CE2 1 
ATOM   369  C  CZ  . PHE A 1 45 ? 16.936 -4.838  9.901   1.00 28.81 ? 45   PHE A CZ  1 
ATOM   370  N  N   . LEU A 1 46 ? 16.860 -11.543 12.905  1.00 24.41 ? 46   LEU A N   1 
ATOM   371  C  CA  . LEU A 1 46 ? 16.645 -12.717 13.750  1.00 26.76 ? 46   LEU A CA  1 
ATOM   372  C  C   . LEU A 1 46 ? 17.787 -12.936 14.740  1.00 27.18 ? 46   LEU A C   1 
ATOM   373  O  O   . LEU A 1 46 ? 17.510 -13.322 15.890  1.00 28.60 ? 46   LEU A O   1 
ATOM   374  C  CB  . LEU A 1 46 ? 16.479 -13.965 12.886  1.00 27.00 ? 46   LEU A CB  1 
ATOM   375  C  CG  . LEU A 1 46 ? 15.426 -13.995 11.772  1.00 27.62 ? 46   LEU A CG  1 
ATOM   376  C  CD1 . LEU A 1 46 ? 15.669 -15.264 10.999  1.00 28.64 ? 46   LEU A CD1 1 
ATOM   377  C  CD2 . LEU A 1 46 ? 13.997 -13.964 12.290  1.00 30.65 ? 46   LEU A CD2 1 
ATOM   378  N  N   . THR A 1 50 ? 16.861 -18.328 16.632  1.00 40.84 ? 50   THR A N   1 
ATOM   379  C  CA  . THR A 1 50 ? 15.416 -18.157 16.830  1.00 41.15 ? 50   THR A CA  1 
ATOM   380  C  C   . THR A 1 50 ? 14.684 -19.492 16.832  1.00 41.48 ? 50   THR A C   1 
ATOM   381  O  O   . THR A 1 50 ? 14.937 -20.373 15.993  1.00 42.57 ? 50   THR A O   1 
ATOM   382  C  CB  . THR A 1 50 ? 14.783 -17.252 15.745  1.00 40.96 ? 50   THR A CB  1 
ATOM   383  O  OG1 . THR A 1 50 ? 15.741 -16.287 15.315  1.00 40.41 ? 50   THR A OG1 1 
ATOM   384  C  CG2 . THR A 1 50 ? 13.554 -16.529 16.282  1.00 41.09 ? 50   THR A CG2 1 
ATOM   385  N  N   . ASP A 1 51 ? 13.777 -19.630 17.784  1.00 41.12 ? 51   ASP A N   1 
ATOM   386  C  CA  . ASP A 1 51 ? 13.049 -20.871 17.992  1.00 41.32 ? 51   ASP A CA  1 
ATOM   387  C  C   . ASP A 1 51 ? 11.788 -20.895 17.141  1.00 40.90 ? 51   ASP A C   1 
ATOM   388  O  O   . ASP A 1 51 ? 11.436 -19.885 16.516  1.00 39.81 ? 51   ASP A O   1 
ATOM   389  C  CB  . ASP A 1 51 ? 12.705 -21.031 19.486  1.00 41.36 ? 51   ASP A CB  1 
ATOM   390  C  CG  . ASP A 1 51 ? 12.223 -19.748 20.114  1.00 42.65 ? 51   ASP A CG  1 
ATOM   391  O  OD1 . ASP A 1 51 ? 13.029 -18.781 20.219  1.00 43.90 ? 51   ASP A OD1 1 
ATOM   392  O  OD2 . ASP A 1 51 ? 11.043 -19.712 20.539  1.00 43.74 ? 51   ASP A OD2 1 
ATOM   393  N  N   . GLU A 1 52 ? 11.097 -22.031 17.113  1.00 40.33 ? 52   GLU A N   1 
ATOM   394  C  CA  . GLU A 1 52 ? 9.825  -22.064 16.407  1.00 40.04 ? 52   GLU A CA  1 
ATOM   395  C  C   . GLU A 1 52 ? 8.747  -21.218 17.110  1.00 38.56 ? 52   GLU A C   1 
ATOM   396  O  O   . GLU A 1 52 ? 7.863  -20.665 16.415  1.00 38.73 ? 52   GLU A O   1 
ATOM   397  C  CB  . GLU A 1 52 ? 9.348  -23.492 16.140  1.00 41.15 ? 52   GLU A CB  1 
ATOM   398  C  CG  . GLU A 1 52 ? 9.674  -23.981 14.736  1.00 44.81 ? 52   GLU A CG  1 
ATOM   399  C  CD  . GLU A 1 52 ? 8.428  -24.363 13.933  1.00 49.18 ? 52   GLU A CD  1 
ATOM   400  O  OE1 . GLU A 1 52 ? 7.375  -24.698 14.530  1.00 49.78 ? 52   GLU A OE1 1 
ATOM   401  O  OE2 . GLU A 1 52 ? 8.504  -24.325 12.688  1.00 50.68 ? 52   GLU A OE2 1 
ATOM   402  N  N   . ALA A 1 53 ? 8.812  -21.112 18.452  1.00 36.09 ? 53   ALA A N   1 
ATOM   403  C  CA  . ALA A 1 53 ? 7.873  -20.267 19.216  1.00 34.70 ? 53   ALA A CA  1 
ATOM   404  C  C   . ALA A 1 53 ? 8.030  -18.796 18.852  1.00 35.21 ? 53   ALA A C   1 
ATOM   405  O  O   . ALA A 1 53 ? 7.071  -18.001 18.937  1.00 34.22 ? 53   ALA A O   1 
ATOM   406  C  CB  . ALA A 1 53 ? 8.054  -20.438 20.720  1.00 34.37 ? 53   ALA A CB  1 
ATOM   407  N  N   . ALA A 1 54 ? 9.263  -18.440 18.487  1.00 33.87 ? 54   ALA A N   1 
ATOM   408  C  CA  . ALA A 1 54 ? 9.568  -17.064 18.128  1.00 34.00 ? 54   ALA A CA  1 
ATOM   409  C  C   . ALA A 1 54 ? 8.999  -16.725 16.770  1.00 32.67 ? 54   ALA A C   1 
ATOM   410  O  O   . ALA A 1 54 ? 8.432  -15.638 16.612  1.00 34.04 ? 54   ALA A O   1 
ATOM   411  C  CB  . ALA A 1 54 ? 11.092 -16.814 18.174  1.00 34.30 ? 54   ALA A CB  1 
ATOM   412  N  N   . PHE A 1 55 ? 9.169  -17.638 15.798  1.00 31.91 ? 55   PHE A N   1 
ATOM   413  C  CA  . PHE A 1 55 ? 8.565  -17.525 14.473  1.00 30.33 ? 55   PHE A CA  1 
ATOM   414  C  C   . PHE A 1 55 ? 7.020  -17.423 14.568  1.00 29.61 ? 55   PHE A C   1 
ATOM   415  O  O   . PHE A 1 55 ? 6.407  -16.636 13.845  1.00 26.63 ? 55   PHE A O   1 
ATOM   416  C  CB  . PHE A 1 55 ? 9.038  -18.629 13.505  1.00 31.19 ? 55   PHE A CB  1 
ATOM   417  C  CG  . PHE A 1 55 ? 10.468 -18.427 12.949  1.00 32.85 ? 55   PHE A CG  1 
ATOM   418  C  CD1 . PHE A 1 55 ? 11.504 -19.356 13.220  1.00 34.12 ? 55   PHE A CD1 1 
ATOM   419  C  CD2 . PHE A 1 55 ? 10.770 -17.327 12.144  1.00 34.37 ? 55   PHE A CD2 1 
ATOM   420  C  CE1 . PHE A 1 55 ? 12.827 -19.175 12.680  1.00 35.71 ? 55   PHE A CE1 1 
ATOM   421  C  CE2 . PHE A 1 55 ? 12.064 -17.124 11.616  1.00 34.71 ? 55   PHE A CE2 1 
ATOM   422  C  CZ  . PHE A 1 55 ? 13.098 -18.050 11.876  1.00 35.73 ? 55   PHE A CZ  1 
ATOM   423  N  N   . GLN A 1 56 ? 6.409  -18.174 15.489  1.00 27.39 ? 56   GLN A N   1 
ATOM   424  C  CA  . GLN A 1 56 ? 4.941  -18.097 15.710  1.00 25.71 ? 56   GLN A CA  1 
ATOM   425  C  C   . GLN A 1 56 ? 4.371  -16.757 16.253  1.00 24.40 ? 56   GLN A C   1 
ATOM   426  O  O   . GLN A 1 56 ? 3.347  -16.255 15.733  1.00 23.18 ? 56   GLN A O   1 
ATOM   427  C  CB  . GLN A 1 56 ? 4.422  -19.280 16.554  1.00 27.06 ? 56   GLN A CB  1 
ATOM   428  C  CG  . GLN A 1 56 ? 2.893  -19.186 16.875  1.00 29.01 ? 56   GLN A CG  1 
ATOM   429  C  CD  . GLN A 1 56 ? 1.997  -19.090 15.621  1.00 36.54 ? 56   GLN A CD  1 
ATOM   430  O  OE1 . GLN A 1 56 ? 2.257  -19.739 14.594  1.00 38.73 ? 56   GLN A OE1 1 
ATOM   431  N  NE2 . GLN A 1 56 ? 0.933  -18.262 15.708  1.00 36.04 ? 56   GLN A NE2 1 
ATOM   432  N  N   . LYS A 1 57 ? 4.974  -16.172 17.291  1.00 23.07 ? 57   LYS A N   1 
ATOM   433  C  CA  . LYS A 1 57 ? 4.505  -14.863 17.781  1.00 23.28 ? 57   LYS A CA  1 
ATOM   434  C  C   . LYS A 1 57 ? 4.800  -13.802 16.706  1.00 20.92 ? 57   LYS A C   1 
ATOM   435  O  O   . LYS A 1 57 ? 3.998  -12.921 16.488  1.00 20.58 ? 57   LYS A O   1 
ATOM   436  C  CB  . LYS A 1 57 ? 5.157  -14.457 19.115  1.00 24.99 ? 57   LYS A CB  1 
ATOM   437  C  CG  . LYS A 1 57 ? 5.350  -12.956 19.318  1.00 29.29 ? 57   LYS A CG  1 
ATOM   438  C  CD  . LYS A 1 57 ? 4.415  -12.313 20.349  1.00 33.65 ? 57   LYS A CD  1 
ATOM   439  C  CE  . LYS A 1 57 ? 5.090  -11.047 20.930  1.00 35.18 ? 57   LYS A CE  1 
ATOM   440  N  NZ  . LYS A 1 57 ? 4.688  -9.698  20.384  1.00 35.22 ? 57   LYS A NZ  1 
ATOM   441  N  N   . LEU A 1 58 ? 5.907  -13.950 15.998  1.00 20.74 ? 58   LEU A N   1 
ATOM   442  C  CA  . LEU A 1 58 ? 6.125  -13.008 14.876  1.00 18.95 ? 58   LEU A CA  1 
ATOM   443  C  C   . LEU A 1 58 ? 5.040  -13.181 13.784  1.00 16.09 ? 58   LEU A C   1 
ATOM   444  O  O   . LEU A 1 58 ? 4.441  -12.191 13.315  1.00 15.40 ? 58   LEU A O   1 
ATOM   445  C  CB  . LEU A 1 58 ? 7.556  -13.109 14.361  1.00 20.58 ? 58   LEU A CB  1 
ATOM   446  C  CG  . LEU A 1 58 ? 7.835  -12.165 13.205  1.00 19.32 ? 58   LEU A CG  1 
ATOM   447  C  CD1 . LEU A 1 58 ? 7.739  -10.714 13.700  1.00 18.50 ? 58   LEU A CD1 1 
ATOM   448  C  CD2 . LEU A 1 58 ? 9.253  -12.537 12.747  1.00 26.34 ? 58   LEU A CD2 1 
ATOM   449  N  N   . MET A 1 59 ? 4.753  -14.421 13.410  1.00 16.26 ? 59   MET A N   1 
ATOM   450  C  CA  . MET A 1 59 ? 3.657  -14.690 12.453  1.00 17.09 ? 59   MET A CA  1 
ATOM   451  C  C   . MET A 1 59 ? 2.335  -14.073 12.842  1.00 16.76 ? 59   MET A C   1 
ATOM   452  O  O   . MET A 1 59 ? 1.678  -13.420 12.012  1.00 17.11 ? 59   MET A O   1 
ATOM   453  C  CB  . MET A 1 59 ? 3.443  -16.219 12.214  1.00 17.95 ? 59   MET A CB  1 
ATOM   454  C  CG  . MET A 1 59 ? 2.338  -16.592 11.202  1.00 20.57 ? 59   MET A CG  1 
ATOM   455  S  SD  . MET A 1 59 ? 2.897  -16.190 9.498   1.00 21.46 ? 59   MET A SD  1 
ATOM   456  C  CE  . MET A 1 59 ? 1.439  -16.617 8.537   1.00 23.20 ? 59   MET A CE  1 
ATOM   457  N  N   A SER A 1 60 ? 1.957  -14.301 14.097  0.50 15.95 ? 60   SER A N   1 
ATOM   458  N  N   B SER A 1 60 ? 1.909  -14.235 14.084  0.50 16.59 ? 60   SER A N   1 
ATOM   459  C  CA  A SER A 1 60 ? 0.722  -13.784 14.641  0.50 14.76 ? 60   SER A CA  1 
ATOM   460  C  CA  B SER A 1 60 ? 0.595  -13.731 14.461  0.50 15.79 ? 60   SER A CA  1 
ATOM   461  C  C   A SER A 1 60 ? 0.672  -12.283 14.409  0.50 14.30 ? 60   SER A C   1 
ATOM   462  C  C   B SER A 1 60 ? 0.587  -12.198 14.628  0.50 15.34 ? 60   SER A C   1 
ATOM   463  O  O   A SER A 1 60 ? -0.308 -11.774 13.845  0.50 14.71 ? 60   SER A O   1 
ATOM   464  O  O   B SER A 1 60 ? -0.442 -11.559 14.559  0.50 16.54 ? 60   SER A O   1 
ATOM   465  C  CB  A SER A 1 60 ? 0.629  -14.037 16.144  0.50 15.06 ? 60   SER A CB  1 
ATOM   466  C  CB  B SER A 1 60 ? 0.111  -14.441 15.709  0.50 16.98 ? 60   SER A CB  1 
ATOM   467  O  OG  A SER A 1 60 ? -0.653 -13.616 16.564  0.50 18.10 ? 60   SER A OG  1 
ATOM   468  O  OG  B SER A 1 60 ? 0.574  -15.792 15.686  0.50 18.37 ? 60   SER A OG  1 
ATOM   469  N  N   . ASN A 1 61 ? 1.752  -11.608 14.846  1.00 13.33 ? 61   ASN A N   1 
ATOM   470  C  CA  . ASN A 1 61 ? 1.821  -10.120 14.771  1.00 13.34 ? 61   ASN A CA  1 
ATOM   471  C  C   . ASN A 1 61 ? 1.703  -9.604  13.302  1.00 13.93 ? 61   ASN A C   1 
ATOM   472  O  O   . ASN A 1 61 ? 1.049  -8.586  13.049  1.00 15.60 ? 61   ASN A O   1 
ATOM   473  C  CB  . ASN A 1 61 ? 3.144  -9.614  15.372  1.00 12.89 ? 61   ASN A CB  1 
ATOM   474  C  CG  . ASN A 1 61 ? 3.180  -9.741  16.888  1.00 17.79 ? 61   ASN A CG  1 
ATOM   475  O  OD1 . ASN A 1 61 ? 2.136  -9.874  17.540  1.00 23.91 ? 61   ASN A OD1 1 
ATOM   476  N  ND2 . ASN A 1 61 ? 4.366  -9.672  17.450  1.00 17.78 ? 61   ASN A ND2 1 
ATOM   477  N  N   . LEU A 1 62 ? 2.368  -10.297 12.383  1.00 11.22 ? 62   LEU A N   1 
ATOM   478  C  CA  . LEU A 1 62 ? 2.420  -9.788  10.967  1.00 11.29 ? 62   LEU A CA  1 
ATOM   479  C  C   . LEU A 1 62 ? 1.056  -10.013 10.308  1.00 12.77 ? 62   LEU A C   1 
ATOM   480  O  O   . LEU A 1 62 ? 0.675  -9.271  9.404   1.00 12.11 ? 62   LEU A O   1 
ATOM   481  C  CB  . LEU A 1 62 ? 3.496  -10.454 10.117  1.00 9.92  ? 62   LEU A CB  1 
ATOM   482  C  CG  . LEU A 1 62 ? 4.951  -10.304 10.506  1.00 17.73 ? 62   LEU A CG  1 
ATOM   483  C  CD1 . LEU A 1 62 ? 5.916  -10.648 9.352   1.00 13.25 ? 62   LEU A CD1 1 
ATOM   484  C  CD2 . LEU A 1 62 ? 5.327  -9.137  11.377  1.00 18.25 ? 62   LEU A CD2 1 
ATOM   485  N  N   . ASP A 1 63 ? 0.429  -11.113 10.713  1.00 11.88 ? 63   ASP A N   1 
ATOM   486  C  CA  . ASP A 1 63 ? -0.853 -11.502 10.091  1.00 11.88 ? 63   ASP A CA  1 
ATOM   487  C  C   . ASP A 1 63 ? -1.983 -10.692 10.747  1.00 13.60 ? 63   ASP A C   1 
ATOM   488  O  O   . ASP A 1 63 ? -2.771 -11.242 11.527  1.00 13.54 ? 63   ASP A O   1 
ATOM   489  C  CB  . ASP A 1 63 ? -1.043 -13.010 10.351  1.00 11.81 ? 63   ASP A CB  1 
ATOM   490  C  CG  . ASP A 1 63 ? -2.405 -13.533 9.855   1.00 11.36 ? 63   ASP A CG  1 
ATOM   491  O  OD1 . ASP A 1 63 ? -2.993 -12.823 9.006   1.00 12.56 ? 63   ASP A OD1 1 
ATOM   492  O  OD2 . ASP A 1 63 ? -2.842 -14.573 10.424  1.00 14.08 ? 63   ASP A OD2 1 
ATOM   493  N  N   . SER A 1 64 ? -2.089 -9.386  10.442  1.00 13.64 ? 64   SER A N   1 
ATOM   494  C  CA  . SER A 1 64 ? -2.961 -8.524  11.219  1.00 13.25 ? 64   SER A CA  1 
ATOM   495  C  C   . SER A 1 64 ? -4.447 -8.801  10.918  1.00 12.98 ? 64   SER A C   1 
ATOM   496  O  O   . SER A 1 64 ? -5.302 -8.462  11.703  1.00 14.43 ? 64   SER A O   1 
ATOM   497  C  CB  . SER A 1 64 ? -2.583 -7.023  10.993  1.00 14.36 ? 64   SER A CB  1 
ATOM   498  O  OG  . SER A 1 64 ? -2.635 -6.742  9.613   1.00 14.04 ? 64   SER A OG  1 
ATOM   499  N  N   . ASN A 1 65 ? -4.753 -9.471  9.807   1.00 13.21 ? 65   ASN A N   1 
ATOM   500  C  CA  . ASN A 1 65 ? -6.202 -9.817  9.541   1.00 11.52 ? 65   ASN A CA  1 
ATOM   501  C  C   . ASN A 1 65 ? -6.585 -11.230 9.947   1.00 12.38 ? 65   ASN A C   1 
ATOM   502  O  O   . ASN A 1 65 ? -7.691 -11.692 9.632   1.00 12.00 ? 65   ASN A O   1 
ATOM   503  C  CB  . ASN A 1 65 ? -6.619 -9.553  8.052   1.00 13.34 ? 65   ASN A CB  1 
ATOM   504  C  CG  . ASN A 1 65 ? -6.160 -10.638 7.088   1.00 10.77 ? 65   ASN A CG  1 
ATOM   505  O  OD1 . ASN A 1 65 ? -5.138 -11.327 7.378   1.00 10.83 ? 65   ASN A OD1 1 
ATOM   506  N  ND2 . ASN A 1 65 ? -6.794 -10.750 5.933   1.00 12.04 ? 65   ASN A ND2 1 
ATOM   507  N  N   . ARG A 1 66 ? -5.632 -11.929 10.549  1.00 12.23 ? 66   ARG A N   1 
ATOM   508  C  CA  . ARG A 1 66 ? -5.881 -13.252 11.171  1.00 11.99 ? 66   ARG A CA  1 
ATOM   509  C  C   . ARG A 1 66 ? -6.340 -14.251 10.181  1.00 12.37 ? 66   ARG A C   1 
ATOM   510  O  O   . ARG A 1 66 ? -7.229 -15.042 10.513  1.00 11.36 ? 66   ARG A O   1 
ATOM   511  C  CB  . ARG A 1 66 ? -6.916 -13.183 12.315  1.00 14.25 ? 66   ARG A CB  1 
ATOM   512  C  CG  . ARG A 1 66 ? -6.448 -12.273 13.378  1.00 21.19 ? 66   ARG A CG  1 
ATOM   513  C  CD  . ARG A 1 66 ? -7.618 -11.996 14.375  1.00 31.52 ? 66   ARG A CD  1 
ATOM   514  N  NE  . ARG A 1 66 ? -7.495 -10.625 14.857  1.00 37.84 ? 66   ARG A NE  1 
ATOM   515  C  CZ  . ARG A 1 66 ? -8.427 -9.986  15.551  1.00 40.37 ? 66   ARG A CZ  1 
ATOM   516  N  NH1 . ARG A 1 66 ? -9.581 -10.597 15.851  1.00 39.28 ? 66   ARG A NH1 1 
ATOM   517  N  NH2 . ARG A 1 66 ? -8.186 -8.735  15.961  1.00 41.37 ? 66   ARG A NH2 1 
ATOM   518  N  N   . ASP A 1 67 ? -5.774 -14.343 9.024   1.00 11.82 ? 67   ASP A N   1 
ATOM   519  C  CA  . ASP A 1 67 ? -6.123 -15.394 8.076   1.00 13.31 ? 67   ASP A CA  1 
ATOM   520  C  C   . ASP A 1 67 ? -5.026 -16.429 7.939   1.00 14.61 ? 67   ASP A C   1 
ATOM   521  O  O   . ASP A 1 67 ? -5.095 -17.271 7.028   1.00 16.27 ? 67   ASP A O   1 
ATOM   522  C  CB  . ASP A 1 67 ? -6.572 -14.858 6.693   1.00 12.49 ? 67   ASP A CB  1 
ATOM   523  C  CG  . ASP A 1 67 ? -5.482 -14.096 5.910   1.00 12.30 ? 67   ASP A CG  1 
ATOM   524  O  OD1 . ASP A 1 67 ? -4.323 -14.012 6.391   1.00 13.02 ? 67   ASP A OD1 1 
ATOM   525  O  OD2 . ASP A 1 67 ? -5.702 -13.550 4.825   1.00 13.07 ? 67   ASP A OD2 1 
ATOM   526  N  N   . ASN A 1 68 ? -4.017 -16.320 8.801   1.00 14.87 ? 68   ASN A N   1 
ATOM   527  C  CA  . ASN A 1 68 ? -2.894 -17.293 8.821   1.00 14.47 ? 68   ASN A CA  1 
ATOM   528  C  C   . ASN A 1 68 ? -1.963 -17.227 7.668   1.00 15.99 ? 68   ASN A C   1 
ATOM   529  O  O   . ASN A 1 68 ? -1.181 -18.193 7.423   1.00 17.43 ? 68   ASN A O   1 
ATOM   530  C  CB  . ASN A 1 68 ? -3.385 -18.744 9.050   1.00 15.75 ? 68   ASN A CB  1 
ATOM   531  C  CG  . ASN A 1 68 ? -4.253 -18.843 10.274  1.00 18.02 ? 68   ASN A CG  1 
ATOM   532  O  OD1 . ASN A 1 68 ? -3.801 -18.529 11.379  1.00 23.16 ? 68   ASN A OD1 1 
ATOM   533  N  ND2 . ASN A 1 68 ? -5.556 -19.261 10.084  1.00 23.96 ? 68   ASN A ND2 1 
ATOM   534  N  N   . GLU A 1 69 ? -2.006 -16.104 6.974   1.00 14.01 ? 69   GLU A N   1 
ATOM   535  C  CA  . GLU A 1 69 ? -1.051 -15.834 5.893   1.00 14.44 ? 69   GLU A CA  1 
ATOM   536  C  C   . GLU A 1 69 ? -0.608 -14.391 5.989   1.00 11.58 ? 69   GLU A C   1 
ATOM   537  O  O   . GLU A 1 69 ? -1.310 -13.552 6.615   1.00 12.20 ? 69   GLU A O   1 
ATOM   538  C  CB  . GLU A 1 69 ? -1.695 -16.044 4.548   1.00 16.37 ? 69   GLU A CB  1 
ATOM   539  C  CG  . GLU A 1 69 ? -2.068 -17.509 4.326   1.00 22.60 ? 69   GLU A CG  1 
ATOM   540  C  CD  . GLU A 1 69 ? -1.653 -18.015 2.977   1.00 27.67 ? 69   GLU A CD  1 
ATOM   541  O  OE1 . GLU A 1 69 ? -0.543 -17.684 2.516   1.00 32.45 ? 69   GLU A OE1 1 
ATOM   542  O  OE2 . GLU A 1 69 ? -2.405 -18.781 2.380   1.00 30.96 ? 69   GLU A OE2 1 
ATOM   543  N  N   . VAL A 1 70 ? 0.578  -14.119 5.434   1.00 10.20 ? 70   VAL A N   1 
ATOM   544  C  CA  . VAL A 1 70 ? 1.040  -12.714 5.321   1.00 9.64  ? 70   VAL A CA  1 
ATOM   545  C  C   . VAL A 1 70 ? 0.940  -12.305 3.904   1.00 9.00  ? 70   VAL A C   1 
ATOM   546  O  O   . VAL A 1 70 ? 1.633  -12.829 3.039   1.00 10.66 ? 70   VAL A O   1 
ATOM   547  C  CB  . VAL A 1 70 ? 2.510  -12.613 5.816   1.00 8.39  ? 70   VAL A CB  1 
ATOM   548  C  CG1 . VAL A 1 70 ? 3.050  -11.175 5.569   1.00 10.80 ? 70   VAL A CG1 1 
ATOM   549  C  CG2 . VAL A 1 70 ? 2.529  -12.851 7.318   1.00 9.08  ? 70   VAL A CG2 1 
ATOM   550  N  N   . ASP A 1 71 ? 0.066  -11.328 3.617   1.00 8.83  ? 71   ASP A N   1 
ATOM   551  C  CA  . ASP A 1 71 ? -0.069 -10.824 2.286   1.00 8.91  ? 71   ASP A CA  1 
ATOM   552  C  C   . ASP A 1 71 ? 0.863  -9.652  1.970   1.00 9.47  ? 71   ASP A C   1 
ATOM   553  O  O   . ASP A 1 71 ? 1.686  -9.245  2.837   1.00 9.63  ? 71   ASP A O   1 
ATOM   554  C  CB  . ASP A 1 71 ? -1.553 -10.486 1.949   1.00 10.00 ? 71   ASP A CB  1 
ATOM   555  C  CG  . ASP A 1 71 ? -2.127 -9.402  2.825   1.00 13.30 ? 71   ASP A CG  1 
ATOM   556  O  OD1 . ASP A 1 71 ? -1.452 -8.426  3.220   1.00 12.34 ? 71   ASP A OD1 1 
ATOM   557  O  OD2 . ASP A 1 71 ? -3.352 -9.450  3.117   1.00 14.53 ? 71   ASP A OD2 1 
ATOM   558  N  N   . PHE A 1 72 ? 0.859  -9.215  0.710   1.00 10.40 ? 72   PHE A N   1 
ATOM   559  C  CA  . PHE A 1 72 ? 1.834  -8.149  0.321   1.00 11.26 ? 72   PHE A CA  1 
ATOM   560  C  C   . PHE A 1 72 ? 1.728  -6.879  1.189   1.00 11.10 ? 72   PHE A C   1 
ATOM   561  O  O   . PHE A 1 72 ? 2.726  -6.341  1.635   1.00 10.80 ? 72   PHE A O   1 
ATOM   562  C  CB  . PHE A 1 72 ? 1.822  -7.784  -1.182  1.00 11.83 ? 72   PHE A CB  1 
ATOM   563  C  CG  . PHE A 1 72 ? 3.055  -7.035  -1.607  1.00 10.75 ? 72   PHE A CG  1 
ATOM   564  C  CD1 . PHE A 1 72 ? 4.246  -7.721  -1.745  1.00 12.15 ? 72   PHE A CD1 1 
ATOM   565  C  CD2 . PHE A 1 72 ? 3.077  -5.629  -1.800  1.00 10.20 ? 72   PHE A CD2 1 
ATOM   566  C  CE1 . PHE A 1 72 ? 5.423  -7.048  -2.132  1.00 12.09 ? 72   PHE A CE1 1 
ATOM   567  C  CE2 . PHE A 1 72 ? 4.235  -4.951  -2.216  1.00 13.61 ? 72   PHE A CE2 1 
ATOM   568  C  CZ  . PHE A 1 72 ? 5.408  -5.631  -2.375  1.00 12.77 ? 72   PHE A CZ  1 
ATOM   569  N  N   . GLN A 1 73 ? 0.503  -6.480  1.520   1.00 10.00 ? 73   GLN A N   1 
ATOM   570  C  CA  . GLN A 1 73 ? 0.310  -5.269  2.280   1.00 9.56  ? 73   GLN A CA  1 
ATOM   571  C  C   . GLN A 1 73 ? 0.874  -5.472  3.725   1.00 9.27  ? 73   GLN A C   1 
ATOM   572  O  O   . GLN A 1 73 ? 1.602  -4.621  4.250   1.00 8.65  ? 73   GLN A O   1 
ATOM   573  C  CB  . GLN A 1 73 ? -1.194 -4.935  2.389   1.00 11.38 ? 73   GLN A CB  1 
ATOM   574  C  CG  . GLN A 1 73 ? -1.410 -3.588  3.188   1.00 11.57 ? 73   GLN A CG  1 
ATOM   575  C  CD  . GLN A 1 73 ? -2.876 -3.105  3.059   1.00 17.90 ? 73   GLN A CD  1 
ATOM   576  O  OE1 . GLN A 1 73 ? -3.461 -3.186  1.992   1.00 19.80 ? 73   GLN A OE1 1 
ATOM   577  N  NE2 . GLN A 1 73 ? -3.437 -2.594  4.140   1.00 26.02 ? 73   GLN A NE2 1 
ATOM   578  N  N   . GLU A 1 74 ? 0.545  -6.609  4.338   1.00 8.14  ? 74   GLU A N   1 
ATOM   579  C  CA  . GLU A 1 74 ? 1.074  -6.934  5.652   1.00 7.15  ? 74   GLU A CA  1 
ATOM   580  C  C   . GLU A 1 74 ? 2.608  -6.991  5.640   1.00 7.98  ? 74   GLU A C   1 
ATOM   581  O  O   . GLU A 1 74 ? 3.222  -6.565  6.615   1.00 8.36  ? 74   GLU A O   1 
ATOM   582  C  CB  . GLU A 1 74 ? 0.504  -8.303  6.138   1.00 6.21  ? 74   GLU A CB  1 
ATOM   583  C  CG  . GLU A 1 74 ? -1.070 -8.191  6.426   1.00 9.00  ? 74   GLU A CG  1 
ATOM   584  C  CD  . GLU A 1 74 ? -1.674 -9.544  6.677   1.00 10.22 ? 74   GLU A CD  1 
ATOM   585  O  OE1 . GLU A 1 74 ? -1.205 -10.514 6.109   1.00 10.60 ? 74   GLU A OE1 1 
ATOM   586  O  OE2 . GLU A 1 74 ? -2.690 -9.625  7.444   1.00 12.38 ? 74   GLU A OE2 1 
ATOM   587  N  N   . TYR A 1 75 ? 3.183  -7.519  4.548   1.00 7.75  ? 75   TYR A N   1 
ATOM   588  C  CA  . TYR A 1 75 ? 4.640  -7.580  4.408   1.00 7.19  ? 75   TYR A CA  1 
ATOM   589  C  C   . TYR A 1 75 ? 5.219  -6.196  4.292   1.00 7.74  ? 75   TYR A C   1 
ATOM   590  O  O   . TYR A 1 75 ? 6.259  -5.951  4.937   1.00 8.74  ? 75   TYR A O   1 
ATOM   591  C  CB  . TYR A 1 75 ? 4.950  -8.451  3.224   1.00 8.55  ? 75   TYR A CB  1 
ATOM   592  C  CG  . TYR A 1 75 ? 6.288  -8.315  2.585   1.00 8.06  ? 75   TYR A CG  1 
ATOM   593  C  CD1 . TYR A 1 75 ? 7.388  -9.062  3.067   1.00 8.46  ? 75   TYR A CD1 1 
ATOM   594  C  CD2 . TYR A 1 75 ? 6.467  -7.480  1.455   1.00 8.41  ? 75   TYR A CD2 1 
ATOM   595  C  CE1 . TYR A 1 75 ? 8.613  -8.996  2.380   1.00 8.27  ? 75   TYR A CE1 1 
ATOM   596  C  CE2 . TYR A 1 75 ? 7.725  -7.440  0.790   1.00 9.11  ? 75   TYR A CE2 1 
ATOM   597  C  CZ  . TYR A 1 75 ? 8.775  -8.164  1.294   1.00 7.58  ? 75   TYR A CZ  1 
ATOM   598  O  OH  . TYR A 1 75 ? 9.960  -8.114  0.559   1.00 9.34  ? 75   TYR A OH  1 
ATOM   599  N  N   . CYS A 1 76 ? 4.572  -5.282  3.551   1.00 7.69  ? 76   CYS A N   1 
ATOM   600  C  CA  . CYS A 1 76 ? 5.086  -3.891  3.486   1.00 9.29  ? 76   CYS A CA  1 
ATOM   601  C  C   . CYS A 1 76 ? 4.969  -3.229  4.822   1.00 8.14  ? 76   CYS A C   1 
ATOM   602  O  O   . CYS A 1 76 ? 5.862  -2.449  5.167   1.00 7.84  ? 76   CYS A O   1 
ATOM   603  C  CB  . CYS A 1 76 ? 4.281  -3.034  2.476   1.00 9.49  ? 76   CYS A CB  1 
ATOM   604  S  SG  . CYS A 1 76 ? 4.679  -3.541  0.779   1.00 13.90 ? 76   CYS A SG  1 
ATOM   605  N  N   . VAL A 1 77 ? 3.885  -3.441  5.581   1.00 8.16  ? 77   VAL A N   1 
ATOM   606  C  CA  . VAL A 1 77 ? 3.732  -2.853  6.929   1.00 8.19  ? 77   VAL A CA  1 
ATOM   607  C  C   . VAL A 1 77 ? 4.899  -3.337  7.810   1.00 6.82  ? 77   VAL A C   1 
ATOM   608  O  O   . VAL A 1 77 ? 5.508  -2.549  8.533   1.00 6.66  ? 77   VAL A O   1 
ATOM   609  C  CB  . VAL A 1 77 ? 2.354  -3.236  7.525   1.00 7.95  ? 77   VAL A CB  1 
ATOM   610  C  CG1 . VAL A 1 77 ? 2.257  -2.881  9.003   1.00 10.27 ? 77   VAL A CG1 1 
ATOM   611  C  CG2 . VAL A 1 77 ? 1.246  -2.518  6.763   1.00 7.75  ? 77   VAL A CG2 1 
ATOM   612  N  N   . PHE A 1 78 ? 5.203  -4.647  7.725   1.00 7.89  ? 78   PHE A N   1 
ATOM   613  C  CA  . PHE A 1 78 ? 6.350  -5.183  8.447   1.00 7.52  ? 78   PHE A CA  1 
ATOM   614  C  C   . PHE A 1 78 ? 7.673  -4.487  8.038   1.00 7.35  ? 78   PHE A C   1 
ATOM   615  O  O   . PHE A 1 78 ? 8.494  -4.157  8.905   1.00 8.25  ? 78   PHE A O   1 
ATOM   616  C  CB  . PHE A 1 78 ? 6.422  -6.692  8.146   1.00 7.11  ? 78   PHE A CB  1 
ATOM   617  C  CG  . PHE A 1 78 ? 7.654  -7.394  8.737   1.00 9.82  ? 78   PHE A CG  1 
ATOM   618  C  CD1 . PHE A 1 78 ? 7.958  -7.277  10.109  1.00 8.02  ? 78   PHE A CD1 1 
ATOM   619  C  CD2 . PHE A 1 78 ? 8.449  -8.190  7.880   1.00 13.70 ? 78   PHE A CD2 1 
ATOM   620  C  CE1 . PHE A 1 78 ? 9.045  -7.954  10.672  1.00 10.89 ? 78   PHE A CE1 1 
ATOM   621  C  CE2 . PHE A 1 78 ? 9.600  -8.858  8.434   1.00 13.44 ? 78   PHE A CE2 1 
ATOM   622  C  CZ  . PHE A 1 78 ? 9.866  -8.733  9.840   1.00 14.06 ? 78   PHE A CZ  1 
ATOM   623  N  N   . LEU A 1 79 ? 7.924  -4.384  6.731   1.00 8.07  ? 79   LEU A N   1 
ATOM   624  C  CA  . LEU A 1 79 ? 9.217  -3.824  6.301   1.00 8.09  ? 79   LEU A CA  1 
ATOM   625  C  C   . LEU A 1 79 ? 9.290  -2.376  6.784   1.00 7.94  ? 79   LEU A C   1 
ATOM   626  O  O   . LEU A 1 79 ? 10.359 -1.908  7.205   1.00 8.75  ? 79   LEU A O   1 
ATOM   627  C  CB  . LEU A 1 79 ? 9.417  -3.841  4.775   1.00 8.63  ? 79   LEU A CB  1 
ATOM   628  C  CG  . LEU A 1 79 ? 9.515  -5.244  4.223   1.00 10.02 ? 79   LEU A CG  1 
ATOM   629  C  CD1 . LEU A 1 79 ? 9.694  -5.054  2.743   1.00 13.76 ? 79   LEU A CD1 1 
ATOM   630  C  CD2 . LEU A 1 79 ? 10.697 -6.058  4.836   1.00 13.76 ? 79   LEU A CD2 1 
ATOM   631  N  N   . SER A 1 80 ? 8.160  -1.661  6.734   1.00 7.58  ? 80   SER A N   1 
ATOM   632  C  CA  . SER A 1 80 ? 8.167  -0.269  7.306   1.00 7.73  ? 80   SER A CA  1 
ATOM   633  C  C   . SER A 1 80 ? 8.566  -0.287  8.764   1.00 8.80  ? 80   SER A C   1 
ATOM   634  O  O   . SER A 1 80 ? 9.428  0.509   9.163   1.00 8.38  ? 80   SER A O   1 
ATOM   635  C  CB  . SER A 1 80 ? 6.764  0.327   7.196   1.00 7.07  ? 80   SER A CB  1 
ATOM   636  O  OG  . SER A 1 80 ? 6.391  0.474   5.815   1.00 10.17 ? 80   SER A OG  1 
ATOM   637  N  N   . CYS A 1 81 ? 8.033  -1.222  9.525   1.00 8.84  ? 81   CYS A N   1 
ATOM   638  C  CA  . CYS A 1 81 ? 8.404  -1.265  10.921  1.00 10.88 ? 81   CYS A CA  1 
ATOM   639  C  C   . CYS A 1 81 ? 9.879  -1.578  11.168  1.00 11.28 ? 81   CYS A C   1 
ATOM   640  O  O   . CYS A 1 81 ? 10.491 -1.004  12.093  1.00 10.28 ? 81   CYS A O   1 
ATOM   641  C  CB  . CYS A 1 81 ? 7.556  -2.323  11.628  1.00 10.96 ? 81   CYS A CB  1 
ATOM   642  S  SG  . CYS A 1 81 ? 5.832  -1.751  11.890  1.00 11.41 ? 81   CYS A SG  1 
ATOM   643  N  N   . ILE A 1 82 ? 10.445 -2.499  10.390  1.00 10.74 ? 82   ILE A N   1 
ATOM   644  C  CA  . ILE A 1 82 ? 11.870 -2.798  10.492  1.00 10.14 ? 82   ILE A CA  1 
ATOM   645  C  C   . ILE A 1 82 ? 12.665 -1.547  10.068  1.00 11.73 ? 82   ILE A C   1 
ATOM   646  O  O   . ILE A 1 82 ? 13.665 -1.233  10.736  1.00 10.72 ? 82   ILE A O   1 
ATOM   647  C  CB  . ILE A 1 82 ? 12.300 -3.945  9.558   1.00 12.00 ? 82   ILE A CB  1 
ATOM   648  C  CG1 . ILE A 1 82 ? 11.554 -5.231  9.859   1.00 17.89 ? 82   ILE A CG1 1 
ATOM   649  C  CG2 . ILE A 1 82 ? 13.883 -4.080  9.625   1.00 14.89 ? 82   ILE A CG2 1 
ATOM   650  C  CD1 . ILE A 1 82 ? 12.029 -6.293  8.824   1.00 21.85 ? 82   ILE A CD1 1 
ATOM   651  N  N   . ALA A 1 83 ? 12.288 -0.875  8.976   1.00 8.83  ? 83   ALA A N   1 
ATOM   652  C  CA  . ALA A 1 83 ? 13.030 0.344   8.636   1.00 10.46 ? 83   ALA A CA  1 
ATOM   653  C  C   . ALA A 1 83 ? 12.943 1.366   9.755   1.00 10.72 ? 83   ALA A C   1 
ATOM   654  O  O   . ALA A 1 83 ? 13.926 2.061   10.049  1.00 10.89 ? 83   ALA A O   1 
ATOM   655  C  CB  . ALA A 1 83 ? 12.485 0.924   7.339   1.00 10.97 ? 83   ALA A CB  1 
ATOM   656  N  N   . MET A 1 84 ? 11.781 1.463   10.385  1.00 9.87  ? 84   MET A N   1 
ATOM   657  C  CA  . MET A 1 84 ? 11.593 2.405   11.512  1.00 11.68 ? 84   MET A CA  1 
ATOM   658  C  C   . MET A 1 84 ? 12.500 2.066   12.674  1.00 12.60 ? 84   MET A C   1 
ATOM   659  O  O   . MET A 1 84 ? 13.089 2.959   13.275  1.00 11.77 ? 84   MET A O   1 
ATOM   660  C  CB  . MET A 1 84 ? 10.139 2.431   11.950  1.00 10.02 ? 84   MET A CB  1 
ATOM   661  C  CG  . MET A 1 84 ? 9.396  3.207   10.874  1.00 12.68 ? 84   MET A CG  1 
ATOM   662  S  SD  . MET A 1 84 ? 7.656  2.792   10.798  1.00 20.42 ? 84   MET A SD  1 
ATOM   663  C  CE  . MET A 1 84 ? 7.211  3.462   12.308  1.00 19.08 ? 84   MET A CE  1 
ATOM   664  N  N   . MET A 1 85 ? 12.660 0.784   12.935  1.00 12.59 ? 85   MET A N   1 
ATOM   665  C  CA  . MET A 1 85 ? 13.651 0.361   14.020  1.00 13.82 ? 85   MET A CA  1 
ATOM   666  C  C   . MET A 1 85 ? 15.014 0.787   13.710  1.00 13.90 ? 85   MET A C   1 
ATOM   667  O  O   . MET A 1 85 ? 15.683 1.355   14.604  1.00 15.37 ? 85   MET A O   1 
ATOM   668  C  CB  . MET A 1 85 ? 13.695 -1.151  14.163  1.00 14.45 ? 85   MET A CB  1 
ATOM   669  C  CG  . MET A 1 85 ? 12.475 -1.701  14.729  1.00 11.77 ? 85   MET A CG  1 
ATOM   670  S  SD  . MET A 1 85 ? 12.569 -3.536  14.671  1.00 23.54 ? 85   MET A SD  1 
ATOM   671  C  CE  . MET A 1 85 ? 11.013 -3.967  15.480  1.00 25.06 ? 85   MET A CE  1 
ATOM   672  N  N   . CYS A 1 86 ? 15.463 0.576   12.481  1.00 12.67 ? 86   CYS A N   1 
ATOM   673  C  CA  . CYS A 1 86 ? 16.806 1.014   12.071  1.00 13.65 ? 86   CYS A CA  1 
ATOM   674  C  C   . CYS A 1 86 ? 16.898 2.517   12.113  1.00 15.65 ? 86   CYS A C   1 
ATOM   675  O  O   . CYS A 1 86 ? 17.972 3.059   12.441  1.00 15.50 ? 86   CYS A O   1 
ATOM   676  C  CB  . CYS A 1 86 ? 17.142 0.577   10.681  1.00 13.63 ? 86   CYS A CB  1 
ATOM   677  S  SG  . CYS A 1 86 ? 17.073 -1.216  10.503  1.00 20.34 ? 86   CYS A SG  1 
ATOM   678  N  N   . ASN A 1 87 ? 15.811 3.202   11.769  1.00 12.49 ? 87   ASN A N   1 
ATOM   679  C  CA  . ASN A 1 87 ? 15.849 4.647   11.781  1.00 14.37 ? 87   ASN A CA  1 
ATOM   680  C  C   . ASN A 1 87 ? 16.019 5.186   13.180  1.00 16.11 ? 87   ASN A C   1 
ATOM   681  O  O   . ASN A 1 87 ? 16.735 6.159   13.389  1.00 16.53 ? 87   ASN A O   1 
ATOM   682  C  CB  . ASN A 1 87 ? 14.600 5.200   11.137  1.00 13.67 ? 87   ASN A CB  1 
ATOM   683  C  CG  . ASN A 1 87 ? 14.665 6.703   11.005  1.00 15.58 ? 87   ASN A CG  1 
ATOM   684  O  OD1 . ASN A 1 87 ? 15.594 7.206   10.363  1.00 17.82 ? 87   ASN A OD1 1 
ATOM   685  N  ND2 . ASN A 1 87 ? 13.760 7.390   11.653  1.00 16.66 ? 87   ASN A ND2 1 
ATOM   686  N  N   . GLU A 1 88 ? 15.297 4.618   14.130  1.00 17.90 ? 88   GLU A N   1 
ATOM   687  C  CA  . GLU A 1 88 ? 15.407 5.052   15.549  1.00 21.75 ? 88   GLU A CA  1 
ATOM   688  C  C   . GLU A 1 88 ? 16.832 4.899   16.075  1.00 25.38 ? 88   GLU A C   1 
ATOM   689  O  O   . GLU A 1 88 ? 17.333 5.789   16.776  1.00 24.82 ? 88   GLU A O   1 
ATOM   690  C  CB  . GLU A 1 88 ? 14.429 4.316   16.440  1.00 23.18 ? 88   GLU A CB  1 
ATOM   691  C  CG  . GLU A 1 88 ? 13.028 4.532   16.062  1.00 25.89 ? 88   GLU A CG  1 
ATOM   692  C  CD  . GLU A 1 88 ? 12.044 4.106   17.132  1.00 34.48 ? 88   GLU A CD  1 
ATOM   693  O  OE1 . GLU A 1 88 ? 11.923 2.892   17.385  1.00 36.50 ? 88   GLU A OE1 1 
ATOM   694  O  OE2 . GLU A 1 88 ? 11.371 5.004   17.682  1.00 38.63 ? 88   GLU A OE2 1 
ATOM   695  N  N   . PHE A 1 89 ? 17.515 3.835   15.670  1.00 26.88 ? 89   PHE A N   1 
ATOM   696  C  CA  . PHE A 1 89 ? 18.932 3.701   15.988  1.00 30.15 ? 89   PHE A CA  1 
ATOM   697  C  C   . PHE A 1 89 ? 19.813 4.764   15.326  1.00 31.78 ? 89   PHE A C   1 
ATOM   698  O  O   . PHE A 1 89 ? 20.719 5.335   15.972  1.00 32.59 ? 89   PHE A O   1 
ATOM   699  C  CB  . PHE A 1 89 ? 19.457 2.316   15.594  1.00 30.13 ? 89   PHE A CB  1 
ATOM   700  C  CG  . PHE A 1 89 ? 20.863 2.046   16.108  1.00 34.41 ? 89   PHE A CG  1 
ATOM   701  C  CD1 . PHE A 1 89 ? 21.982 2.481   15.390  1.00 38.37 ? 89   PHE A CD1 1 
ATOM   702  C  CD2 . PHE A 1 89 ? 21.052 1.425   17.332  1.00 38.96 ? 89   PHE A CD2 1 
ATOM   703  C  CE1 . PHE A 1 89 ? 23.284 2.281   15.882  1.00 39.33 ? 89   PHE A CE1 1 
ATOM   704  C  CE2 . PHE A 1 89 ? 22.337 1.205   17.836  1.00 39.88 ? 89   PHE A CE2 1 
ATOM   705  C  CZ  . PHE A 1 89 ? 23.458 1.642   17.105  1.00 40.73 ? 89   PHE A CZ  1 
ATOM   706  N  N   . PHE A 1 90 ? 19.590 4.989   14.034  1.00 32.64 ? 90   PHE A N   1 
ATOM   707  C  CA  . PHE A 1 90 ? 20.256 6.012   13.248  1.00 34.30 ? 90   PHE A CA  1 
ATOM   708  C  C   . PHE A 1 90 ? 20.081 7.381   13.898  1.00 34.99 ? 90   PHE A C   1 
ATOM   709  O  O   . PHE A 1 90 ? 21.026 8.159   13.974  1.00 35.94 ? 90   PHE A O   1 
ATOM   710  C  CB  . PHE A 1 90 ? 19.702 5.987   11.805  1.00 34.71 ? 90   PHE A CB  1 
ATOM   711  C  CG  . PHE A 1 90 ? 20.305 7.016   10.859  1.00 37.18 ? 90   PHE A CG  1 
ATOM   712  C  CD1 . PHE A 1 90 ? 21.068 6.603   9.751   1.00 41.72 ? 90   PHE A CD1 1 
ATOM   713  C  CD2 . PHE A 1 90 ? 20.041 8.370   11.012  1.00 38.29 ? 90   PHE A CD2 1 
ATOM   714  C  CE1 . PHE A 1 90 ? 21.610 7.546   8.838   1.00 43.12 ? 90   PHE A CE1 1 
ATOM   715  C  CE2 . PHE A 1 90 ? 20.571 9.319   10.136  1.00 41.76 ? 90   PHE A CE2 1 
ATOM   716  C  CZ  . PHE A 1 90 ? 21.362 8.907   9.040   1.00 43.64 ? 90   PHE A CZ  1 
ATOM   717  N  N   . GLU A 1 91 ? 18.884 7.702   14.373  1.00 35.77 ? 91   GLU A N   1 
ATOM   718  C  CA  . GLU A 1 91 ? 18.653 9.046   14.871  1.00 36.53 ? 91   GLU A CA  1 
ATOM   719  C  C   . GLU A 1 91 ? 19.368 9.276   16.203  1.00 37.25 ? 91   GLU A C   1 
ATOM   720  O  O   . GLU A 1 91 ? 19.835 10.381  16.444  1.00 37.44 ? 91   GLU A O   1 
ATOM   721  C  CB  . GLU A 1 91 ? 17.159 9.373   14.945  1.00 36.92 ? 91   GLU A CB  1 
ATOM   722  C  CG  . GLU A 1 91 ? 16.551 9.581   13.538  1.00 36.14 ? 91   GLU A CG  1 
ATOM   723  C  CD  . GLU A 1 91 ? 15.062 9.943   13.530  1.00 38.90 ? 91   GLU A CD  1 
ATOM   724  O  OE1 . GLU A 1 91 ? 14.448 9.915   14.617  1.00 36.83 ? 91   GLU A OE1 1 
ATOM   725  O  OE2 . GLU A 1 91 ? 14.504 10.246  12.415  1.00 38.82 ? 91   GLU A OE2 1 
ATOM   726  N  N   . GLY A 1 92 ? 19.454 8.234   17.032  1.00 37.49 ? 92   GLY A N   1 
ATOM   727  C  CA  . GLY A 1 92 ? 20.170 8.262   18.313  1.00 38.38 ? 92   GLY A CA  1 
ATOM   728  C  C   . GLY A 1 92 ? 19.230 8.474   19.483  1.00 39.97 ? 92   GLY A C   1 
ATOM   729  O  O   . GLY A 1 92 ? 18.425 9.407   19.457  1.00 40.57 ? 92   GLY A O   1 
ATOM   730  N  N   . ALA B 1 2  ? 25.680 -7.107  3.626   1.00 16.06 ? 2    ALA B N   1 
ATOM   731  C  CA  . ALA B 1 2  ? 24.259 -7.515  3.969   1.00 15.67 ? 2    ALA B CA  1 
ATOM   732  C  C   . ALA B 1 2  ? 23.523 -8.070  2.738   1.00 16.16 ? 2    ALA B C   1 
ATOM   733  O  O   . ALA B 1 2  ? 23.946 -7.862  1.563   1.00 17.16 ? 2    ALA B O   1 
ATOM   734  C  CB  . ALA B 1 2  ? 23.543 -6.347  4.536   1.00 19.24 ? 2    ALA B CB  1 
ATOM   735  N  N   . CYS B 1 3  ? 22.415 -8.740  2.996   1.00 13.12 ? 3    CYS B N   1 
ATOM   736  C  CA  . CYS B 1 3  ? 21.631 -9.401  1.942   1.00 13.27 ? 3    CYS B CA  1 
ATOM   737  C  C   . CYS B 1 3  ? 20.785 -8.304  1.224   1.00 11.69 ? 3    CYS B C   1 
ATOM   738  O  O   . CYS B 1 3  ? 20.616 -7.227  1.807   1.00 11.70 ? 3    CYS B O   1 
ATOM   739  C  CB  . CYS B 1 3  ? 20.712 -10.412 2.611   1.00 12.81 ? 3    CYS B CB  1 
ATOM   740  S  SG  . CYS B 1 3  ? 21.707 -11.826 3.293   1.00 21.15 ? 3    CYS B SG  1 
ATOM   741  N  N   . PRO B 1 4  ? 20.247 -8.585  0.013   1.00 14.25 ? 4    PRO B N   1 
ATOM   742  C  CA  . PRO B 1 4  ? 19.553 -7.528  -0.761  1.00 12.84 ? 4    PRO B CA  1 
ATOM   743  C  C   . PRO B 1 4  ? 18.464 -6.756  -0.017  1.00 13.79 ? 4    PRO B C   1 
ATOM   744  O  O   . PRO B 1 4  ? 18.417 -5.523  -0.110  1.00 12.86 ? 4    PRO B O   1 
ATOM   745  C  CB  . PRO B 1 4  ? 18.992 -8.263  -1.974  1.00 14.26 ? 4    PRO B CB  1 
ATOM   746  C  CG  . PRO B 1 4  ? 20.018 -9.458  -2.154  1.00 15.51 ? 4    PRO B CG  1 
ATOM   747  C  CD  . PRO B 1 4  ? 20.330 -9.856  -0.730  1.00 14.99 ? 4    PRO B CD  1 
ATOM   748  N  N   . LEU B 1 5  ? 17.622 -7.482  0.686   1.00 12.09 ? 5    LEU B N   1 
ATOM   749  C  CA  . LEU B 1 5  ? 16.511 -6.830  1.397   1.00 11.76 ? 5    LEU B CA  1 
ATOM   750  C  C   . LEU B 1 5  ? 16.985 -6.013  2.581   1.00 11.44 ? 5    LEU B C   1 
ATOM   751  O  O   . LEU B 1 5  ? 16.431 -4.958  2.855   1.00 12.74 ? 5    LEU B O   1 
ATOM   752  C  CB  . LEU B 1 5  ? 15.415 -7.852  1.756   1.00 11.92 ? 5    LEU B CB  1 
ATOM   753  C  CG  . LEU B 1 5  ? 14.065 -7.268  2.213   1.00 11.57 ? 5    LEU B CG  1 
ATOM   754  C  CD1 . LEU B 1 5  ? 13.361 -6.471  1.145   1.00 13.36 ? 5    LEU B CD1 1 
ATOM   755  C  CD2 . LEU B 1 5  ? 13.191 -8.416  2.709   1.00 11.48 ? 5    LEU B CD2 1 
ATOM   756  N  N   . GLU B 1 6  ? 18.085 -6.450  3.271   1.00 9.14  ? 6    GLU B N   1 
ATOM   757  C  CA  . GLU B 1 6  ? 18.666 -5.658  4.340   1.00 9.66  ? 6    GLU B CA  1 
ATOM   758  C  C   . GLU B 1 6  ? 19.241 -4.350  3.775   1.00 10.01 ? 6    GLU B C   1 
ATOM   759  O  O   . GLU B 1 6  ? 19.036 -3.279  4.341   1.00 11.18 ? 6    GLU B O   1 
ATOM   760  C  CB  . GLU B 1 6  ? 19.714 -6.519  5.077   1.00 9.47  ? 6    GLU B CB  1 
ATOM   761  C  CG  . GLU B 1 6  ? 19.089 -7.702  5.800   1.00 10.10 ? 6    GLU B CG  1 
ATOM   762  C  CD  . GLU B 1 6  ? 20.177 -8.668  6.304   1.00 14.25 ? 6    GLU B CD  1 
ATOM   763  O  OE1 . GLU B 1 6  ? 21.157 -8.933  5.555   1.00 14.19 ? 6    GLU B OE1 1 
ATOM   764  O  OE2 . GLU B 1 6  ? 20.101 -9.133  7.432   1.00 14.51 ? 6    GLU B OE2 1 
ATOM   765  N  N   A LYS B 1 7  ? 19.907 -4.449  2.616   0.70 11.12 ? 7    LYS B N   1 
ATOM   766  N  N   B LYS B 1 7  ? 19.926 -4.477  2.622   0.30 10.83 ? 7    LYS B N   1 
ATOM   767  C  CA  A LYS B 1 7  ? 20.481 -3.283  1.975   0.70 13.53 ? 7    LYS B CA  1 
ATOM   768  C  CA  B LYS B 1 7  ? 20.467 -3.340  1.871   0.30 11.79 ? 7    LYS B CA  1 
ATOM   769  C  C   A LYS B 1 7  ? 19.363 -2.337  1.516   0.70 12.63 ? 7    LYS B C   1 
ATOM   770  C  C   B LYS B 1 7  ? 19.341 -2.369  1.577   0.30 11.93 ? 7    LYS B C   1 
ATOM   771  O  O   A LYS B 1 7  ? 19.504 -1.128  1.666   0.70 13.72 ? 7    LYS B O   1 
ATOM   772  O  O   B LYS B 1 7  ? 19.462 -1.181  1.871   0.30 12.42 ? 7    LYS B O   1 
ATOM   773  C  CB  A LYS B 1 7  ? 21.406 -3.708  0.843   0.70 13.73 ? 7    LYS B CB  1 
ATOM   774  C  CB  B LYS B 1 7  ? 21.120 -3.776  0.547   0.30 12.15 ? 7    LYS B CB  1 
ATOM   775  C  CG  A LYS B 1 7  ? 22.869 -3.849  1.260   0.70 19.86 ? 7    LYS B CG  1 
ATOM   776  C  CG  B LYS B 1 7  ? 22.000 -2.713  -0.051  0.30 12.48 ? 7    LYS B CG  1 
ATOM   777  C  CD  A LYS B 1 7  ? 23.438 -2.384  1.310   0.70 24.21 ? 7    LYS B CD  1 
ATOM   778  C  CD  B LYS B 1 7  ? 22.102 -2.846  -1.562  0.30 16.41 ? 7    LYS B CD  1 
ATOM   779  C  CE  A LYS B 1 7  ? 24.767 -2.166  0.614   0.70 26.71 ? 7    LYS B CE  1 
ATOM   780  C  CE  B LYS B 1 7  ? 23.221 -1.965  -2.062  0.30 16.82 ? 7    LYS B CE  1 
ATOM   781  N  NZ  A LYS B 1 7  ? 24.904 -3.024  -0.593  0.70 32.15 ? 7    LYS B NZ  1 
ATOM   782  N  NZ  B LYS B 1 7  ? 22.918 -1.287  -3.354  0.30 17.66 ? 7    LYS B NZ  1 
ATOM   783  N  N   . ALA B 1 8  ? 18.239 -2.894  1.027   1.00 11.94 ? 8    ALA B N   1 
ATOM   784  C  CA  . ALA B 1 8  ? 17.102 -2.069  0.631   1.00 12.50 ? 8    ALA B CA  1 
ATOM   785  C  C   . ALA B 1 8  ? 16.563 -1.262  1.811   1.00 12.76 ? 8    ALA B C   1 
ATOM   786  O  O   . ALA B 1 8  ? 16.263 -0.067  1.693   1.00 12.26 ? 8    ALA B O   1 
ATOM   787  C  CB  . ALA B 1 8  ? 15.973 -2.940  0.021   1.00 11.99 ? 8    ALA B CB  1 
ATOM   788  N  N   . LEU B 1 9  ? 16.493 -1.892  2.987   1.00 12.81 ? 9    LEU B N   1 
ATOM   789  C  CA  . LEU B 1 9  ? 16.047 -1.203  4.196   1.00 12.94 ? 9    LEU B CA  1 
ATOM   790  C  C   . LEU B 1 9  ? 17.005 -0.095  4.582   1.00 12.62 ? 9    LEU B C   1 
ATOM   791  O  O   . LEU B 1 9  ? 16.644 1.055   4.933   1.00 12.61 ? 9    LEU B O   1 
ATOM   792  C  CB  . LEU B 1 9  ? 15.955 -2.161  5.398   1.00 13.04 ? 9    LEU B CB  1 
ATOM   793  C  CG  . LEU B 1 9  ? 14.805 -3.105  5.166   1.00 17.07 ? 9    LEU B CG  1 
ATOM   794  C  CD1 . LEU B 1 9  ? 14.921 -4.321  6.109   1.00 19.24 ? 9    LEU B CD1 1 
ATOM   795  C  CD2 . LEU B 1 9  ? 13.378 -2.412  5.277   1.00 21.93 ? 9    LEU B CD2 1 
ATOM   796  N  N   . ASP B 1 10 ? 18.309 -0.389  4.449   1.00 12.61 ? 10   ASP B N   1 
ATOM   797  C  CA  . ASP B 1 10 ? 19.280 0.618   4.770   1.00 14.50 ? 10   ASP B CA  1 
ATOM   798  C  C   . ASP B 1 10 ? 19.248 1.838   3.820   1.00 12.93 ? 10   ASP B C   1 
ATOM   799  O  O   . ASP B 1 10 ? 19.455 2.987   4.238   1.00 12.50 ? 10   ASP B O   1 
ATOM   800  C  CB  . ASP B 1 10 ? 20.657 -0.008  4.842   1.00 16.11 ? 10   ASP B CB  1 
ATOM   801  C  CG  . ASP B 1 10 ? 20.891 -0.730  6.186   1.00 23.39 ? 10   ASP B CG  1 
ATOM   802  O  OD1 . ASP B 1 10 ? 20.176 -0.453  7.215   1.00 28.55 ? 10   ASP B OD1 1 
ATOM   803  O  OD2 . ASP B 1 10 ? 21.832 -1.559  6.195   1.00 30.28 ? 10   ASP B OD2 1 
ATOM   804  N  N   . VAL B 1 11 ? 19.008 1.577   2.550   1.00 12.70 ? 11   VAL B N   1 
ATOM   805  C  CA  . VAL B 1 11 ? 18.815 2.639   1.554   1.00 12.70 ? 11   VAL B CA  1 
ATOM   806  C  C   . VAL B 1 11 ? 17.534 3.451   1.854   1.00 12.57 ? 11   VAL B C   1 
ATOM   807  O  O   . VAL B 1 11 ? 17.497 4.678   1.722   1.00 12.88 ? 11   VAL B O   1 
ATOM   808  C  CB  . VAL B 1 11 ? 18.762 2.034   0.126   1.00 12.06 ? 11   VAL B CB  1 
ATOM   809  C  CG1 . VAL B 1 11 ? 18.360 3.098   -0.905  1.00 13.03 ? 11   VAL B CG1 1 
ATOM   810  C  CG2 . VAL B 1 11 ? 20.113 1.440   -0.214  1.00 15.48 ? 11   VAL B CG2 1 
ATOM   811  N  N   . MET B 1 12 ? 16.465 2.779   2.280   1.00 13.03 ? 12   MET B N   1 
ATOM   812  C  CA  . MET B 1 12 ? 15.270 3.544   2.673   1.00 13.48 ? 12   MET B CA  1 
ATOM   813  C  C   . MET B 1 12 ? 15.603 4.599   3.755   1.00 13.67 ? 12   MET B C   1 
ATOM   814  O  O   . MET B 1 12 ? 15.208 5.761   3.702   1.00 11.98 ? 12   MET B O   1 
ATOM   815  C  CB  . MET B 1 12 ? 14.176 2.633   3.191   1.00 14.11 ? 12   MET B CB  1 
ATOM   816  C  CG  . MET B 1 12 ? 13.527 1.810   2.145   1.00 15.51 ? 12   MET B CG  1 
ATOM   817  S  SD  . MET B 1 12 ? 12.425 0.588   2.983   1.00 21.59 ? 12   MET B SD  1 
ATOM   818  C  CE  . MET B 1 12 ? 11.123 1.619   3.604   1.00 20.24 ? 12   MET B CE  1 
ATOM   819  N  N   . VAL B 1 13 ? 16.356 4.166   4.750   1.00 11.64 ? 13   VAL B N   1 
ATOM   820  C  CA  . VAL B 1 13 ? 16.698 5.013   5.883   1.00 13.10 ? 13   VAL B CA  1 
ATOM   821  C  C   . VAL B 1 13 ? 17.645 6.112   5.440   1.00 13.73 ? 13   VAL B C   1 
ATOM   822  O  O   . VAL B 1 13 ? 17.398 7.291   5.699   1.00 14.44 ? 13   VAL B O   1 
ATOM   823  C  CB  . VAL B 1 13 ? 17.342 4.164   7.034   1.00 12.52 ? 13   VAL B CB  1 
ATOM   824  C  CG1 . VAL B 1 13 ? 17.782 5.163   8.161   1.00 15.99 ? 13   VAL B CG1 1 
ATOM   825  C  CG2 . VAL B 1 13 ? 16.403 3.089   7.538   1.00 13.77 ? 13   VAL B CG2 1 
ATOM   826  N  N   . SER B 1 14 ? 18.731 5.733   4.783   1.00 14.78 ? 14   SER B N   1 
ATOM   827  C  CA  . SER B 1 14 ? 19.727 6.722   4.378   1.00 15.06 ? 14   SER B CA  1 
ATOM   828  C  C   . SER B 1 14 ? 19.168 7.751   3.416   1.00 14.60 ? 14   SER B C   1 
ATOM   829  O  O   . SER B 1 14 ? 19.505 8.931   3.537   1.00 16.69 ? 14   SER B O   1 
ATOM   830  C  CB  . SER B 1 14 ? 20.988 6.061   3.799   1.00 14.05 ? 14   SER B CB  1 
ATOM   831  O  OG  . SER B 1 14 ? 20.828 5.438   2.528   1.00 19.32 ? 14   SER B OG  1 
ATOM   832  N  N   . THR B 1 15 ? 18.311 7.323   2.472   1.00 12.84 ? 15   THR B N   1 
ATOM   833  C  CA  . THR B 1 15 ? 17.848 8.263   1.458   1.00 12.90 ? 15   THR B CA  1 
ATOM   834  C  C   . THR B 1 15 ? 16.965 9.340   2.103   1.00 13.00 ? 15   THR B C   1 
ATOM   835  O  O   . THR B 1 15 ? 17.037 10.527  1.776   1.00 14.60 ? 15   THR B O   1 
ATOM   836  C  CB  . THR B 1 15 ? 17.086 7.564   0.310   1.00 11.56 ? 15   THR B CB  1 
ATOM   837  O  OG1 . THR B 1 15 ? 17.902 6.537   -0.251  1.00 14.61 ? 15   THR B OG1 1 
ATOM   838  C  CG2 . THR B 1 15 ? 16.779 8.546   -0.804  1.00 14.41 ? 15   THR B CG2 1 
ATOM   839  N  N   . PHE B 1 16 ? 16.166 8.950   3.085   1.00 12.55 ? 16   PHE B N   1 
ATOM   840  C  CA  . PHE B 1 16 ? 15.354 9.863   3.801   1.00 13.04 ? 16   PHE B CA  1 
ATOM   841  C  C   . PHE B 1 16 ? 16.214 10.958  4.460   1.00 14.80 ? 16   PHE B C   1 
ATOM   842  O  O   . PHE B 1 16 ? 15.913 12.127  4.239   1.00 15.44 ? 16   PHE B O   1 
ATOM   843  C  CB  . PHE B 1 16 ? 14.490 9.144   4.863   1.00 12.14 ? 16   PHE B CB  1 
ATOM   844  C  CG  . PHE B 1 16 ? 13.662 10.069  5.760   1.00 10.56 ? 16   PHE B CG  1 
ATOM   845  C  CD1 . PHE B 1 16 ? 12.353 10.386  5.380   1.00 11.84 ? 16   PHE B CD1 1 
ATOM   846  C  CD2 . PHE B 1 16 ? 14.166 10.556  7.007   1.00 11.19 ? 16   PHE B CD2 1 
ATOM   847  C  CE1 . PHE B 1 16 ? 11.544 11.176  6.117   1.00 13.06 ? 16   PHE B CE1 1 
ATOM   848  C  CE2 . PHE B 1 16 ? 13.279 11.350  7.783   1.00 14.03 ? 16   PHE B CE2 1 
ATOM   849  C  CZ  . PHE B 1 16 ? 12.033 11.673  7.349   1.00 13.57 ? 16   PHE B CZ  1 
ATOM   850  N  N   . HIS B 1 17 ? 17.260 10.575  5.202   1.00 15.46 ? 17   HIS B N   1 
ATOM   851  C  CA  . HIS B 1 17 ? 18.146 11.555  5.906   1.00 17.45 ? 17   HIS B CA  1 
ATOM   852  C  C   . HIS B 1 17 ? 19.008 12.436  5.019   1.00 18.38 ? 17   HIS B C   1 
ATOM   853  O  O   . HIS B 1 17 ? 19.324 13.602  5.402   1.00 19.42 ? 17   HIS B O   1 
ATOM   854  C  CB  . HIS B 1 17 ? 18.936 10.829  6.976   1.00 19.09 ? 17   HIS B CB  1 
ATOM   855  C  CG  . HIS B 1 17 ? 18.049 10.394  8.099   1.00 19.84 ? 17   HIS B CG  1 
ATOM   856  N  ND1 . HIS B 1 17 ? 17.575 11.261  9.076   1.00 22.89 ? 17   HIS B ND1 1 
ATOM   857  C  CD2 . HIS B 1 17 ? 17.483 9.192   8.351   1.00 18.07 ? 17   HIS B CD2 1 
ATOM   858  C  CE1 . HIS B 1 17 ? 16.784 10.590  9.897   1.00 23.95 ? 17   HIS B CE1 1 
ATOM   859  N  NE2 . HIS B 1 17 ? 16.714 9.335   9.479   1.00 21.52 ? 17   HIS B NE2 1 
ATOM   860  N  N   . LYS B 1 18 ? 19.257 11.930  3.802   1.00 18.27 ? 18   LYS B N   1 
ATOM   861  C  CA  . LYS B 1 18 ? 19.981 12.676  2.760   1.00 19.51 ? 18   LYS B CA  1 
ATOM   862  C  C   . LYS B 1 18 ? 19.233 13.980  2.553   1.00 19.63 ? 18   LYS B C   1 
ATOM   863  O  O   . LYS B 1 18 ? 19.884 15.028  2.364   1.00 21.07 ? 18   LYS B O   1 
ATOM   864  C  CB  . LYS B 1 18 ? 20.012 11.878  1.445   1.00 19.72 ? 18   LYS B CB  1 
ATOM   865  C  CG  . LYS B 1 18 ? 20.832 12.495  0.351   1.00 24.59 ? 18   LYS B CG  1 
ATOM   866  C  CD  . LYS B 1 18 ? 21.252 11.397  -0.668  1.00 28.98 ? 18   LYS B CD  1 
ATOM   867  C  CE  . LYS B 1 18 ? 21.899 12.037  -1.891  1.00 34.46 ? 18   LYS B CE  1 
ATOM   868  N  NZ  . LYS B 1 18 ? 22.520 10.944  -2.718  1.00 34.44 ? 18   LYS B NZ  1 
ATOM   869  N  N   . TYR B 1 19 ? 17.898 13.923  2.601   1.00 17.99 ? 19   TYR B N   1 
ATOM   870  C  CA  . TYR B 1 19 ? 17.009 15.073  2.303   1.00 18.14 ? 19   TYR B CA  1 
ATOM   871  C  C   . TYR B 1 19 ? 16.452 15.700  3.548   1.00 18.72 ? 19   TYR B C   1 
ATOM   872  O  O   . TYR B 1 19 ? 16.425 16.934  3.630   1.00 20.24 ? 19   TYR B O   1 
ATOM   873  C  CB  . TYR B 1 19 ? 15.901 14.742  1.292   1.00 19.17 ? 19   TYR B CB  1 
ATOM   874  C  CG  . TYR B 1 19 ? 16.543 14.372  -0.024  1.00 17.67 ? 19   TYR B CG  1 
ATOM   875  C  CD1 . TYR B 1 19 ? 16.893 15.354  -0.971  1.00 19.50 ? 19   TYR B CD1 1 
ATOM   876  C  CD2 . TYR B 1 19 ? 16.836 13.046  -0.304  1.00 16.76 ? 19   TYR B CD2 1 
ATOM   877  C  CE1 . TYR B 1 19 ? 17.525 14.992  -2.175  1.00 20.01 ? 19   TYR B CE1 1 
ATOM   878  C  CE2 . TYR B 1 19 ? 17.464 12.685  -1.462  1.00 17.61 ? 19   TYR B CE2 1 
ATOM   879  C  CZ  . TYR B 1 19 ? 17.780 13.639  -2.404  1.00 18.47 ? 19   TYR B CZ  1 
ATOM   880  O  OH  . TYR B 1 19 ? 18.419 13.181  -3.497  1.00 18.60 ? 19   TYR B OH  1 
ATOM   881  N  N   . SER B 1 20 ? 16.087 14.897  4.551   1.00 18.32 ? 20   SER B N   1 
ATOM   882  C  CA  . SER B 1 20 ? 15.475 15.485  5.761   1.00 17.65 ? 20   SER B CA  1 
ATOM   883  C  C   . SER B 1 20 ? 16.414 16.399  6.550   1.00 18.22 ? 20   SER B C   1 
ATOM   884  O  O   . SER B 1 20 ? 15.959 17.278  7.226   1.00 19.19 ? 20   SER B O   1 
ATOM   885  C  CB  . SER B 1 20 ? 14.910 14.418  6.716   1.00 16.94 ? 20   SER B CB  1 
ATOM   886  O  OG  . SER B 1 20 ? 15.944 13.723  7.314   1.00 17.32 ? 20   SER B OG  1 
ATOM   887  N  N   . GLY B 1 21 ? 17.703 16.183  6.415   1.00 20.45 ? 21   GLY B N   1 
ATOM   888  C  CA  . GLY B 1 21 ? 18.684 16.889  7.222   1.00 22.20 ? 21   GLY B CA  1 
ATOM   889  C  C   . GLY B 1 21 ? 19.090 18.198  6.591   1.00 22.95 ? 21   GLY B C   1 
ATOM   890  O  O   . GLY B 1 21 ? 19.923 18.887  7.159   1.00 24.41 ? 21   GLY B O   1 
ATOM   891  N  N   . LYS B 1 22 ? 18.510 18.545  5.441   1.00 22.76 ? 22   LYS B N   1 
ATOM   892  C  CA  . LYS B 1 22 ? 18.938 19.735  4.675   1.00 23.95 ? 22   LYS B CA  1 
ATOM   893  C  C   . LYS B 1 22 ? 18.511 21.028  5.353   1.00 25.28 ? 22   LYS B C   1 
ATOM   894  O  O   . LYS B 1 22 ? 19.349 21.948  5.539   1.00 25.86 ? 22   LYS B O   1 
ATOM   895  C  CB  . LYS B 1 22 ? 18.446 19.646  3.222   1.00 23.86 ? 22   LYS B CB  1 
ATOM   896  C  CG  . LYS B 1 22 ? 19.249 18.624  2.414   1.00 26.25 ? 22   LYS B CG  1 
ATOM   897  C  CD  . LYS B 1 22 ? 18.976 18.713  0.920   1.00 27.51 ? 22   LYS B CD  1 
ATOM   898  C  CE  . LYS B 1 22 ? 20.006 17.902  0.139   1.00 28.83 ? 22   LYS B CE  1 
ATOM   899  N  NZ  . LYS B 1 22 ? 20.091 18.272  -1.319  1.00 30.30 ? 22   LYS B NZ  1 
ATOM   900  N  N   . GLU B 1 23 ? 17.254 21.074  5.786   1.00 24.92 ? 23   GLU B N   1 
ATOM   901  C  CA  . GLU B 1 23 ? 16.661 22.281  6.390   1.00 26.13 ? 23   GLU B CA  1 
ATOM   902  C  C   . GLU B 1 23 ? 15.834 21.975  7.626   1.00 25.89 ? 23   GLU B C   1 
ATOM   903  O  O   . GLU B 1 23 ? 15.158 20.916  7.721   1.00 26.55 ? 23   GLU B O   1 
ATOM   904  C  CB  . GLU B 1 23 ? 15.726 22.977  5.401   1.00 26.58 ? 23   GLU B CB  1 
ATOM   905  C  CG  . GLU B 1 23 ? 16.302 23.179  3.987   1.00 30.23 ? 23   GLU B CG  1 
ATOM   906  C  CD  . GLU B 1 23 ? 15.227 23.521  2.952   1.00 32.34 ? 23   GLU B CD  1 
ATOM   907  O  OE1 . GLU B 1 23 ? 14.136 24.012  3.314   1.00 28.26 ? 23   GLU B OE1 1 
ATOM   908  O  OE2 . GLU B 1 23 ? 15.483 23.318  1.752   1.00 38.86 ? 23   GLU B OE2 1 
ATOM   909  N  N   . GLY B 1 24 ? 15.840 22.924  8.556   1.00 25.50 ? 24   GLY B N   1 
ATOM   910  C  CA  . GLY B 1 24 ? 14.948 22.888  9.710   1.00 25.77 ? 24   GLY B CA  1 
ATOM   911  C  C   . GLY B 1 24 ? 15.067 21.624  10.522  1.00 24.33 ? 24   GLY B C   1 
ATOM   912  O  O   . GLY B 1 24 ? 16.177 21.167  10.852  1.00 26.13 ? 24   GLY B O   1 
ATOM   913  N  N   . ASP B 1 25 ? 13.941 21.032  10.850  1.00 25.84 ? 25   ASP B N   1 
ATOM   914  C  CA  . ASP B 1 25 ? 13.898 19.669  11.481  1.00 24.59 ? 25   ASP B CA  1 
ATOM   915  C  C   . ASP B 1 25 ? 14.677 18.659  10.647  1.00 23.18 ? 25   ASP B C   1 
ATOM   916  O  O   . ASP B 1 25 ? 14.286 18.352  9.510   1.00 23.60 ? 25   ASP B O   1 
ATOM   917  C  CB  . ASP B 1 25 ? 12.430 19.253  11.589  1.00 24.36 ? 25   ASP B CB  1 
ATOM   918  C  CG  . ASP B 1 25 ? 12.193 17.990  12.428  1.00 22.56 ? 25   ASP B CG  1 
ATOM   919  O  OD1 . ASP B 1 25 ? 13.092 17.158  12.669  1.00 26.33 ? 25   ASP B OD1 1 
ATOM   920  O  OD2 . ASP B 1 25 ? 11.059 17.843  12.883  1.00 26.19 ? 25   ASP B OD2 1 
ATOM   921  N  N   . LYS B 1 26 ? 15.820 18.230  11.165  1.00 23.27 ? 26   LYS B N   1 
ATOM   922  C  CA  . LYS B 1 26 ? 16.723 17.388  10.412  1.00 23.45 ? 26   LYS B CA  1 
ATOM   923  C  C   . LYS B 1 26 ? 16.122 15.987  10.231  1.00 21.97 ? 26   LYS B C   1 
ATOM   924  O  O   . LYS B 1 26 ? 16.761 15.155  9.556   1.00 24.09 ? 26   LYS B O   1 
ATOM   925  C  CB  . LYS B 1 26 ? 18.107 17.306  11.067  1.00 24.02 ? 26   LYS B CB  1 
ATOM   926  C  CG  . LYS B 1 26 ? 18.885 18.662  10.964  1.00 25.50 ? 26   LYS B CG  1 
ATOM   927  C  CD  . LYS B 1 26 ? 20.178 18.632  11.805  1.00 31.95 ? 26   LYS B CD  1 
ATOM   928  C  CE  . LYS B 1 26 ? 20.655 20.081  12.105  1.00 32.26 ? 26   LYS B CE  1 
ATOM   929  N  NZ  . LYS B 1 26 ? 21.575 20.265  13.314  1.00 36.98 ? 26   LYS B NZ  1 
ATOM   930  N  N   . PHE B 1 27 ? 14.961 15.747  10.853  1.00 21.95 ? 27   PHE B N   1 
ATOM   931  C  CA  . PHE B 1 27 ? 14.313 14.388  10.855  1.00 21.87 ? 27   PHE B CA  1 
ATOM   932  C  C   . PHE B 1 27 ? 12.923 14.277  10.183  1.00 21.04 ? 27   PHE B C   1 
ATOM   933  O  O   . PHE B 1 27 ? 12.232 13.230  10.244  1.00 20.54 ? 27   PHE B O   1 
ATOM   934  C  CB  . PHE B 1 27 ? 14.202 13.893  12.297  1.00 24.45 ? 27   PHE B CB  1 
ATOM   935  C  CG  . PHE B 1 27 ? 15.493 13.912  13.052  1.00 24.72 ? 27   PHE B CG  1 
ATOM   936  C  CD1 . PHE B 1 27 ? 16.514 13.007  12.761  1.00 30.49 ? 27   PHE B CD1 1 
ATOM   937  C  CD2 . PHE B 1 27 ? 15.656 14.801  14.102  1.00 33.10 ? 27   PHE B CD2 1 
ATOM   938  C  CE1 . PHE B 1 27 ? 17.696 12.995  13.498  1.00 32.39 ? 27   PHE B CE1 1 
ATOM   939  C  CE2 . PHE B 1 27 ? 16.830 14.816  14.840  1.00 35.38 ? 27   PHE B CE2 1 
ATOM   940  C  CZ  . PHE B 1 27 ? 17.856 13.907  14.539  1.00 34.67 ? 27   PHE B CZ  1 
ATOM   941  N  N   . LYS B 1 28 ? 12.511 15.327  9.504   1.00 19.43 ? 28   LYS B N   1 
ATOM   942  C  CA  . LYS B 1 28 ? 11.288 15.381  8.742   1.00 19.51 ? 28   LYS B CA  1 
ATOM   943  C  C   . LYS B 1 28 ? 11.619 16.093  7.441   1.00 17.99 ? 28   LYS B C   1 
ATOM   944  O  O   . LYS B 1 28 ? 12.622 16.879  7.371   1.00 16.62 ? 28   LYS B O   1 
ATOM   945  C  CB  . LYS B 1 28 ? 10.143 16.082  9.495   1.00 18.89 ? 28   LYS B CB  1 
ATOM   946  C  CG  . LYS B 1 28 ? 9.675  15.455  10.851  1.00 22.52 ? 28   LYS B CG  1 
ATOM   947  C  CD  . LYS B 1 28 ? 8.364  16.136  11.222  1.00 24.55 ? 28   LYS B CD  1 
ATOM   948  C  CE  . LYS B 1 28 ? 7.873  15.780  12.646  1.00 28.67 ? 28   LYS B CE  1 
ATOM   949  N  NZ  . LYS B 1 28 ? 8.980  15.835  13.629  1.00 28.34 ? 28   LYS B NZ  1 
ATOM   950  N  N   . LEU B 1 29 ? 10.845 15.759  6.422   1.00 17.37 ? 29   LEU B N   1 
ATOM   951  C  CA  . LEU B 1 29 ? 10.904 16.357  5.066   1.00 16.87 ? 29   LEU B CA  1 
ATOM   952  C  C   . LEU B 1 29 ? 9.901  17.494  4.964   1.00 18.23 ? 29   LEU B C   1 
ATOM   953  O  O   . LEU B 1 29 ? 8.718  17.294  5.056   1.00 19.49 ? 29   LEU B O   1 
ATOM   954  C  CB  . LEU B 1 29 ? 10.540 15.267  4.022   1.00 16.33 ? 29   LEU B CB  1 
ATOM   955  C  CG  . LEU B 1 29 ? 11.477 14.061  3.954   1.00 13.04 ? 29   LEU B CG  1 
ATOM   956  C  CD1 . LEU B 1 29 ? 10.808 12.959  3.079   1.00 11.66 ? 29   LEU B CD1 1 
ATOM   957  C  CD2 . LEU B 1 29 ? 12.811 14.389  3.304   1.00 15.11 ? 29   LEU B CD2 1 
ATOM   958  N  N   . ASN B 1 30 ? 10.385 18.717  4.722   1.00 21.48 ? 30   ASN B N   1 
ATOM   959  C  CA  . ASN B 1 30 ? 9.475  19.773  4.378   1.00 23.64 ? 30   ASN B CA  1 
ATOM   960  C  C   . ASN B 1 30 ? 9.128  19.706  2.854   1.00 24.66 ? 30   ASN B C   1 
ATOM   961  O  O   . ASN B 1 30 ? 9.544  18.737  2.141   1.00 23.76 ? 30   ASN B O   1 
ATOM   962  C  CB  . ASN B 1 30 ? 10.087 21.127  4.827   1.00 23.20 ? 30   ASN B CB  1 
ATOM   963  C  CG  . ASN B 1 30 ? 11.340 21.534  4.027   1.00 24.89 ? 30   ASN B CG  1 
ATOM   964  O  OD1 . ASN B 1 30 ? 11.624 21.005  2.969   1.00 24.68 ? 30   ASN B OD1 1 
ATOM   965  N  ND2 . ASN B 1 30 ? 12.080 22.534  4.544   1.00 25.34 ? 30   ASN B ND2 1 
ATOM   966  N  N   . LYS B 1 31 ? 8.372  20.678  2.331   1.00 25.21 ? 31   LYS B N   1 
ATOM   967  C  CA  . LYS B 1 31 ? 7.976  20.612  0.909   1.00 25.09 ? 31   LYS B CA  1 
ATOM   968  C  C   . LYS B 1 31 ? 9.150  20.577  -0.075  1.00 23.34 ? 31   LYS B C   1 
ATOM   969  O  O   . LYS B 1 31 ? 9.117  19.805  -1.031  1.00 22.75 ? 31   LYS B O   1 
ATOM   970  C  CB  . LYS B 1 31 ? 6.938  21.695  0.519   1.00 27.49 ? 31   LYS B CB  1 
ATOM   971  C  CG  . LYS B 1 31 ? 5.925  21.173  -0.570  1.00 28.25 ? 31   LYS B CG  1 
ATOM   972  C  CD  . LYS B 1 31 ? 4.501  21.826  -0.585  1.00 31.52 ? 31   LYS B CD  1 
ATOM   973  C  CE  . LYS B 1 31 ? 3.401  21.017  0.175   1.00 21.05 ? 31   LYS B CE  1 
ATOM   974  N  NZ  . LYS B 1 31 ? 3.382  21.355  1.643   1.00 31.14 ? 31   LYS B NZ  1 
ATOM   975  N  N   . SER B 1 32 ? 10.190 21.380  0.163   1.00 22.95 ? 32   SER B N   1 
ATOM   976  C  CA  . SER B 1 32 ? 11.326 21.437  -0.763  1.00 22.70 ? 32   SER B CA  1 
ATOM   977  C  C   . SER B 1 32 ? 12.158 20.151  -0.725  1.00 21.62 ? 32   SER B C   1 
ATOM   978  O  O   . SER B 1 32 ? 12.642 19.656  -1.769  1.00 21.12 ? 32   SER B O   1 
ATOM   979  C  CB  . SER B 1 32 ? 12.237 22.633  -0.444  1.00 23.76 ? 32   SER B CB  1 
ATOM   980  O  OG  . SER B 1 32 ? 11.555 23.856  -0.612  1.00 28.67 ? 32   SER B OG  1 
ATOM   981  N  N   . GLU B 1 33 ? 12.329 19.604  0.484   1.00 20.05 ? 33   GLU B N   1 
ATOM   982  C  CA  . GLU B 1 33 ? 13.050 18.358  0.687   1.00 18.66 ? 33   GLU B CA  1 
ATOM   983  C  C   . GLU B 1 33 ? 12.284 17.188  0.055   1.00 17.77 ? 33   GLU B C   1 
ATOM   984  O  O   . GLU B 1 33 ? 12.935 16.334  -0.607  1.00 17.76 ? 33   GLU B O   1 
ATOM   985  C  CB  . GLU B 1 33 ? 13.285 18.146  2.212   1.00 18.51 ? 33   GLU B CB  1 
ATOM   986  C  CG  . GLU B 1 33 ? 14.221 19.165  2.870   1.00 17.45 ? 33   GLU B CG  1 
ATOM   987  C  CD  . GLU B 1 33 ? 14.208 19.090  4.396   1.00 16.71 ? 33   GLU B CD  1 
ATOM   988  O  OE1 . GLU B 1 33 ? 13.250 18.531  4.955   1.00 19.02 ? 33   GLU B OE1 1 
ATOM   989  O  OE2 . GLU B 1 33 ? 15.201 19.456  5.038   1.00 18.20 ? 33   GLU B OE2 1 
ATOM   990  N  N   . LEU B 1 34 ? 10.970 17.114  0.273   1.00 17.26 ? 34   LEU B N   1 
ATOM   991  C  CA  . LEU B 1 34 ? 10.181 16.031  -0.332  1.00 16.49 ? 34   LEU B CA  1 
ATOM   992  C  C   . LEU B 1 34 ? 10.246 16.130  -1.840  1.00 17.55 ? 34   LEU B C   1 
ATOM   993  O  O   . LEU B 1 34 ? 10.503 15.131  -2.548  1.00 16.68 ? 34   LEU B O   1 
ATOM   994  C  CB  . LEU B 1 34 ? 8.742  16.091  0.149   1.00 16.37 ? 34   LEU B CB  1 
ATOM   995  C  CG  . LEU B 1 34 ? 7.858  15.000  -0.463  1.00 16.12 ? 34   LEU B CG  1 
ATOM   996  C  CD1 . LEU B 1 34 ? 8.333  13.612  -0.006  1.00 19.10 ? 34   LEU B CD1 1 
ATOM   997  C  CD2 . LEU B 1 34 ? 6.381  15.132  -0.090  1.00 17.23 ? 34   LEU B CD2 1 
ATOM   998  N  N   . LYS B 1 35 ? 10.058 17.343  -2.363  1.00 17.75 ? 35   LYS B N   1 
ATOM   999  C  CA  . LYS B 1 35 ? 10.157 17.512  -3.802  1.00 19.51 ? 35   LYS B CA  1 
ATOM   1000 C  C   . LYS B 1 35 ? 11.491 17.028  -4.367  1.00 17.43 ? 35   LYS B C   1 
ATOM   1001 O  O   . LYS B 1 35 ? 11.495 16.335  -5.415  1.00 18.96 ? 35   LYS B O   1 
ATOM   1002 C  CB  . LYS B 1 35 ? 9.927  18.982  -4.212  1.00 18.56 ? 35   LYS B CB  1 
ATOM   1003 C  CG  . LYS B 1 35 ? 9.753  19.127  -5.726  1.00 24.86 ? 35   LYS B CG  1 
ATOM   1004 C  CD  . LYS B 1 35 ? 8.287  19.172  -6.150  1.00 32.17 ? 35   LYS B CD  1 
ATOM   1005 C  CE  . LYS B 1 35 ? 7.767  17.830  -6.716  1.00 36.64 ? 35   LYS B CE  1 
ATOM   1006 N  NZ  . LYS B 1 35 ? 7.098  17.972  -8.081  1.00 37.86 ? 35   LYS B NZ  1 
ATOM   1007 N  N   A GLU B 1 36 ? 12.617 17.374  -3.721  0.50 18.21 ? 36   GLU B N   1 
ATOM   1008 N  N   B GLU B 1 36 ? 12.601 17.388  -3.724  0.50 18.44 ? 36   GLU B N   1 
ATOM   1009 C  CA  A GLU B 1 36 ? 13.950 16.991  -4.213  0.50 17.90 ? 36   GLU B CA  1 
ATOM   1010 C  CA  B GLU B 1 36 ? 13.905 16.985  -4.201  0.50 18.25 ? 36   GLU B CA  1 
ATOM   1011 C  C   A GLU B 1 36 ? 14.180 15.474  -4.120  0.50 17.36 ? 36   GLU B C   1 
ATOM   1012 C  C   B GLU B 1 36 ? 13.979 15.458  -4.224  0.50 17.44 ? 36   GLU B C   1 
ATOM   1013 O  O   A GLU B 1 36 ? 14.860 14.866  -4.959  0.50 17.89 ? 36   GLU B O   1 
ATOM   1014 O  O   B GLU B 1 36 ? 14.350 14.832  -5.240  0.50 17.05 ? 36   GLU B O   1 
ATOM   1015 C  CB  A GLU B 1 36 ? 15.112 17.731  -3.487  0.50 17.51 ? 36   GLU B CB  1 
ATOM   1016 C  CB  B GLU B 1 36 ? 15.034 17.506  -3.296  0.50 18.25 ? 36   GLU B CB  1 
ATOM   1017 C  CG  A GLU B 1 36 ? 16.448 17.694  -4.273  0.50 18.95 ? 36   GLU B CG  1 
ATOM   1018 C  CG  B GLU B 1 36 ? 14.972 18.965  -2.917  0.50 22.06 ? 36   GLU B CG  1 
ATOM   1019 C  CD  A GLU B 1 36 ? 17.712 18.098  -3.477  0.50 20.70 ? 36   GLU B CD  1 
ATOM   1020 C  CD  B GLU B 1 36 ? 16.246 19.392  -2.253  0.50 23.94 ? 36   GLU B CD  1 
ATOM   1021 O  OE1 A GLU B 1 36 ? 17.632 18.418  -2.265  0.50 22.09 ? 36   GLU B OE1 1 
ATOM   1022 O  OE1 B GLU B 1 36 ? 17.294 19.055  -2.831  0.50 26.01 ? 36   GLU B OE1 1 
ATOM   1023 O  OE2 A GLU B 1 36 ? 18.825 18.066  -4.079  0.50 23.40 ? 36   GLU B OE2 1 
ATOM   1024 O  OE2 B GLU B 1 36 ? 16.212 20.049  -1.168  0.50 27.01 ? 36   GLU B OE2 1 
ATOM   1025 N  N   . LEU B 1 37 ? 13.600 14.863  -3.094  1.00 17.17 ? 37   LEU B N   1 
ATOM   1026 C  CA  . LEU B 1 37 ? 13.685 13.399  -2.956  1.00 15.39 ? 37   LEU B CA  1 
ATOM   1027 C  C   . LEU B 1 37 ? 12.911 12.735  -4.063  1.00 15.34 ? 37   LEU B C   1 
ATOM   1028 O  O   . LEU B 1 37 ? 13.434 11.853  -4.728  1.00 15.06 ? 37   LEU B O   1 
ATOM   1029 C  CB  . LEU B 1 37 ? 13.191 13.001  -1.587  1.00 13.72 ? 37   LEU B CB  1 
ATOM   1030 C  CG  . LEU B 1 37 ? 13.462 11.542  -1.195  1.00 14.25 ? 37   LEU B CG  1 
ATOM   1031 C  CD1 . LEU B 1 37 ? 13.376 11.459  0.300   1.00 13.33 ? 37   LEU B CD1 1 
ATOM   1032 C  CD2 . LEU B 1 37 ? 12.464 10.638  -1.821  1.00 15.62 ? 37   LEU B CD2 1 
ATOM   1033 N  N   . LEU B 1 38 ? 11.665 13.136  -4.291  1.00 14.68 ? 38   LEU B N   1 
ATOM   1034 C  CA  . LEU B 1 38 ? 10.896 12.526  -5.371  1.00 17.31 ? 38   LEU B CA  1 
ATOM   1035 C  C   . LEU B 1 38 ? 11.536 12.673  -6.743  1.00 17.95 ? 38   LEU B C   1 
ATOM   1036 O  O   . LEU B 1 38 ? 11.659 11.694  -7.518  1.00 18.25 ? 38   LEU B O   1 
ATOM   1037 C  CB  . LEU B 1 38 ? 9.511  13.110  -5.400  1.00 17.54 ? 38   LEU B CB  1 
ATOM   1038 C  CG  . LEU B 1 38 ? 8.617  13.023  -4.170  1.00 21.64 ? 38   LEU B CG  1 
ATOM   1039 C  CD1 . LEU B 1 38 ? 7.253  13.644  -4.523  1.00 26.91 ? 38   LEU B CD1 1 
ATOM   1040 C  CD2 . LEU B 1 38 ? 8.499  11.614  -3.773  1.00 22.60 ? 38   LEU B CD2 1 
ATOM   1041 N  N   . THR B 1 39 ? 11.950 13.908  -7.059  1.00 19.36 ? 39   THR B N   1 
ATOM   1042 C  CA  . THR B 1 39 ? 12.557 14.186  -8.364  1.00 19.27 ? 39   THR B CA  1 
ATOM   1043 C  C   . THR B 1 39 ? 13.872 13.443  -8.622  1.00 19.56 ? 39   THR B C   1 
ATOM   1044 O  O   . THR B 1 39 ? 14.072 12.865  -9.695  1.00 19.62 ? 39   THR B O   1 
ATOM   1045 C  CB  . THR B 1 39 ? 12.680 15.725  -8.594  1.00 19.76 ? 39   THR B CB  1 
ATOM   1046 O  OG1 . THR B 1 39 ? 11.398 16.335  -8.317  1.00 22.03 ? 39   THR B OG1 1 
ATOM   1047 C  CG2 . THR B 1 39 ? 12.918 15.958  -10.068 1.00 22.07 ? 39   THR B CG2 1 
ATOM   1048 N  N   A ARG B 1 40 ? 14.785 13.474  -7.657  0.50 17.49 ? 40   ARG B N   1 
ATOM   1049 N  N   B ARG B 1 40 ? 14.745 13.427  -7.629  0.50 17.22 ? 40   ARG B N   1 
ATOM   1050 C  CA  A ARG B 1 40 ? 16.066 12.819  -7.863  0.50 17.35 ? 40   ARG B CA  1 
ATOM   1051 C  CA  B ARG B 1 40 ? 16.058 12.857  -7.819  0.50 16.75 ? 40   ARG B CA  1 
ATOM   1052 C  C   A ARG B 1 40 ? 15.936 11.310  -7.676  0.50 15.43 ? 40   ARG B C   1 
ATOM   1053 C  C   B ARG B 1 40 ? 16.136 11.365  -7.506  0.50 15.33 ? 40   ARG B C   1 
ATOM   1054 O  O   A ARG B 1 40 ? 16.444 10.538  -8.457  0.50 16.66 ? 40   ARG B O   1 
ATOM   1055 O  O   B ARG B 1 40 ? 17.018 10.652  -8.028  0.50 15.55 ? 40   ARG B O   1 
ATOM   1056 C  CB  A ARG B 1 40 ? 17.155 13.376  -6.940  0.50 16.55 ? 40   ARG B CB  1 
ATOM   1057 C  CB  B ARG B 1 40 ? 17.052 13.615  -6.972  0.50 16.06 ? 40   ARG B CB  1 
ATOM   1058 C  CG  A ARG B 1 40 ? 17.812 14.691  -7.412  0.50 20.41 ? 40   ARG B CG  1 
ATOM   1059 C  CG  B ARG B 1 40 ? 17.026 15.124  -7.226  0.50 17.92 ? 40   ARG B CG  1 
ATOM   1060 C  CD  A ARG B 1 40 ? 18.700 15.316  -6.322  0.50 23.97 ? 40   ARG B CD  1 
ATOM   1061 C  CD  B ARG B 1 40 ? 18.047 15.798  -6.360  0.50 21.98 ? 40   ARG B CD  1 
ATOM   1062 N  NE  A ARG B 1 40 ? 19.911 14.561  -6.012  0.50 27.43 ? 40   ARG B NE  1 
ATOM   1063 N  NE  B ARG B 1 40 ? 18.287 17.182  -6.746  0.50 24.73 ? 40   ARG B NE  1 
ATOM   1064 C  CZ  A ARG B 1 40 ? 20.629 14.725  -4.890  0.50 27.21 ? 40   ARG B CZ  1 
ATOM   1065 C  CZ  B ARG B 1 40 ? 19.085 17.572  -7.738  0.50 26.75 ? 40   ARG B CZ  1 
ATOM   1066 N  NH1 A ARG B 1 40 ? 20.254 15.609  -3.978  0.50 25.88 ? 40   ARG B NH1 1 
ATOM   1067 N  NH1 B ARG B 1 40 ? 19.730 16.688  -8.497  0.50 27.65 ? 40   ARG B NH1 1 
ATOM   1068 N  NH2 A ARG B 1 40 ? 21.720 14.003  -4.678  0.50 25.98 ? 40   ARG B NH2 1 
ATOM   1069 N  NH2 B ARG B 1 40 ? 19.221 18.865  -7.979  0.50 27.02 ? 40   ARG B NH2 1 
ATOM   1070 N  N   . GLU B 1 41 ? 15.247 10.906  -6.617  1.00 14.88 ? 41   GLU B N   1 
ATOM   1071 C  CA  . GLU B 1 41 ? 15.351 9.486   -6.124  1.00 13.87 ? 41   GLU B CA  1 
ATOM   1072 C  C   . GLU B 1 41 ? 14.246 8.571   -6.643  1.00 13.14 ? 41   GLU B C   1 
ATOM   1073 O  O   . GLU B 1 41 ? 14.417 7.355   -6.669  1.00 14.22 ? 41   GLU B O   1 
ATOM   1074 C  CB  . GLU B 1 41 ? 15.337 9.471   -4.577  1.00 14.40 ? 41   GLU B CB  1 
ATOM   1075 C  CG  . GLU B 1 41 ? 16.409 10.349  -3.917  1.00 15.81 ? 41   GLU B CG  1 
ATOM   1076 C  CD  . GLU B 1 41 ? 17.824 9.889   -4.189  1.00 15.67 ? 41   GLU B CD  1 
ATOM   1077 O  OE1 . GLU B 1 41 ? 18.090 8.730   -4.579  1.00 21.39 ? 41   GLU B OE1 1 
ATOM   1078 O  OE2 . GLU B 1 41 ? 18.726 10.728  -3.959  1.00 21.23 ? 41   GLU B OE2 1 
ATOM   1079 N  N   . LEU B 1 42 ? 13.144 9.143   -7.060  1.00 14.99 ? 42   LEU B N   1 
ATOM   1080 C  CA  . LEU B 1 42 ? 11.982 8.352   -7.553  1.00 14.83 ? 42   LEU B CA  1 
ATOM   1081 C  C   . LEU B 1 42 ? 11.461 8.845   -8.921  1.00 14.25 ? 42   LEU B C   1 
ATOM   1082 O  O   . LEU B 1 42 ? 10.229 8.940   -9.105  1.00 16.24 ? 42   LEU B O   1 
ATOM   1083 C  CB  . LEU B 1 42 ? 10.809 8.325   -6.537  1.00 14.27 ? 42   LEU B CB  1 
ATOM   1084 C  CG  . LEU B 1 42 ? 11.136 7.678   -5.164  1.00 13.26 ? 42   LEU B CG  1 
ATOM   1085 C  CD1 . LEU B 1 42 ? 10.056 8.022   -4.144  1.00 17.10 ? 42   LEU B CD1 1 
ATOM   1086 C  CD2 . LEU B 1 42 ? 11.292 6.149   -5.273  1.00 15.88 ? 42   LEU B CD2 1 
ATOM   1087 N  N   . PRO B 1 43 ? 12.365 9.173   -9.840  1.00 16.98 ? 43   PRO B N   1 
ATOM   1088 C  CA  . PRO B 1 43 ? 11.938 9.750   -11.129 1.00 18.70 ? 43   PRO B CA  1 
ATOM   1089 C  C   . PRO B 1 43 ? 11.010 8.865   -12.003 1.00 22.31 ? 43   PRO B C   1 
ATOM   1090 O  O   . PRO B 1 43 ? 10.212 9.407   -12.810 1.00 23.98 ? 43   PRO B O   1 
ATOM   1091 C  CB  . PRO B 1 43 ? 13.285 9.966   -11.848 1.00 16.53 ? 43   PRO B CB  1 
ATOM   1092 C  CG  . PRO B 1 43 ? 14.202 8.924   -11.287 1.00 18.01 ? 43   PRO B CG  1 
ATOM   1093 C  CD  . PRO B 1 43 ? 13.824 8.997   -9.782  1.00 16.16 ? 43   PRO B CD  1 
ATOM   1094 N  N   . SER B 1 44 ? 11.089 7.536   -11.841 1.00 23.89 ? 44   SER B N   1 
ATOM   1095 C  CA  . SER B 1 44 ? 10.222 6.614   -12.568 1.00 24.87 ? 44   SER B CA  1 
ATOM   1096 C  C   . SER B 1 44 ? 8.808  6.758   -12.111 1.00 25.64 ? 44   SER B C   1 
ATOM   1097 O  O   . SER B 1 44 ? 7.865  6.417   -12.850 1.00 27.14 ? 44   SER B O   1 
ATOM   1098 C  CB  . SER B 1 44 ? 10.638 5.147   -12.342 1.00 25.18 ? 44   SER B CB  1 
ATOM   1099 O  OG  . SER B 1 44 ? 11.943 4.896   -12.769 1.00 25.10 ? 44   SER B OG  1 
ATOM   1100 N  N   . PHE B 1 45 ? 8.619  7.197   -10.872 1.00 25.58 ? 45   PHE B N   1 
ATOM   1101 C  CA  . PHE B 1 45 ? 7.286  7.145   -10.278 1.00 26.27 ? 45   PHE B CA  1 
ATOM   1102 C  C   . PHE B 1 45 ? 6.542  8.465   -10.172 1.00 28.10 ? 45   PHE B C   1 
ATOM   1103 O  O   . PHE B 1 45 ? 5.337  8.481   -10.004 1.00 30.76 ? 45   PHE B O   1 
ATOM   1104 C  CB  . PHE B 1 45 ? 7.334  6.430   -8.905  1.00 25.26 ? 45   PHE B CB  1 
ATOM   1105 C  CG  . PHE B 1 45 ? 7.840  5.034   -8.994  1.00 24.09 ? 45   PHE B CG  1 
ATOM   1106 C  CD1 . PHE B 1 45 ? 7.031  4.019   -9.487  1.00 20.05 ? 45   PHE B CD1 1 
ATOM   1107 C  CD2 . PHE B 1 45 ? 9.167  4.715   -8.627  1.00 19.44 ? 45   PHE B CD2 1 
ATOM   1108 C  CE1 . PHE B 1 45 ? 7.496  2.743   -9.587  1.00 23.54 ? 45   PHE B CE1 1 
ATOM   1109 C  CE2 . PHE B 1 45 ? 9.641  3.396   -8.711  1.00 20.05 ? 45   PHE B CE2 1 
ATOM   1110 C  CZ  . PHE B 1 45 ? 8.833  2.417   -9.200  1.00 22.14 ? 45   PHE B CZ  1 
ATOM   1111 N  N   . LEU B 1 46 ? 7.285  9.572   -10.146 1.00 29.70 ? 46   LEU B N   1 
ATOM   1112 C  CA  . LEU B 1 46 ? 6.734  10.923  -10.212 1.00 31.22 ? 46   LEU B CA  1 
ATOM   1113 C  C   . LEU B 1 46 ? 6.293  11.154  -11.659 1.00 32.48 ? 46   LEU B C   1 
ATOM   1114 O  O   . LEU B 1 46 ? 7.098  11.059  -12.579 1.00 34.61 ? 46   LEU B O   1 
ATOM   1115 C  CB  . LEU B 1 46 ? 7.831  11.955  -9.846  1.00 31.01 ? 46   LEU B CB  1 
ATOM   1116 C  CG  . LEU B 1 46 ? 7.544  13.483  -9.905  1.00 32.12 ? 46   LEU B CG  1 
ATOM   1117 C  CD1 . LEU B 1 46 ? 6.601  13.921  -8.789  1.00 33.19 ? 46   LEU B CD1 1 
ATOM   1118 C  CD2 . LEU B 1 46 ? 8.793  14.345  -9.817  1.00 33.32 ? 46   LEU B CD2 1 
ATOM   1119 N  N   . GLY B 1 47 ? 5.020  11.435  -11.869 1.00 33.48 ? 47   GLY B N   1 
ATOM   1120 C  CA  . GLY B 1 47 ? 4.553  11.782  -13.200 1.00 35.47 ? 47   GLY B CA  1 
ATOM   1121 C  C   . GLY B 1 47 ? 3.593  12.949  -13.107 1.00 36.58 ? 47   GLY B C   1 
ATOM   1122 O  O   . GLY B 1 47 ? 3.981  14.080  -13.368 1.00 36.98 ? 47   GLY B O   1 
ATOM   1123 N  N   . LYS B 1 48 ? 2.348  12.658  -12.714 1.00 37.55 ? 48   LYS B N   1 
ATOM   1124 C  CA  . LYS B 1 48 ? 1.295  13.667  -12.512 1.00 37.64 ? 48   LYS B CA  1 
ATOM   1125 C  C   . LYS B 1 48 ? 1.691  14.765  -11.494 1.00 38.07 ? 48   LYS B C   1 
ATOM   1126 O  O   . LYS B 1 48 ? 1.179  15.897  -11.556 1.00 37.31 ? 48   LYS B O   1 
ATOM   1127 C  CB  . LYS B 1 48 ? -0.001 12.988  -12.057 1.00 38.01 ? 48   LYS B CB  1 
ATOM   1128 N  N   . ARG B 1 49 ? 2.608  14.417  -10.584 1.00 38.66 ? 49   ARG B N   1 
ATOM   1129 C  CA  . ARG B 1 49 ? 2.933  15.256  -9.416  1.00 38.87 ? 49   ARG B CA  1 
ATOM   1130 C  C   . ARG B 1 49 ? 3.851  16.418  -9.772  1.00 39.01 ? 49   ARG B C   1 
ATOM   1131 O  O   . ARG B 1 49 ? 4.133  17.270  -8.923  1.00 39.06 ? 49   ARG B O   1 
ATOM   1132 C  CB  . ARG B 1 49 ? 3.488  14.405  -8.258  1.00 39.01 ? 49   ARG B CB  1 
ATOM   1133 N  N   . THR B 1 50 ? 4.292  16.468  -11.035 1.00 38.68 ? 50   THR B N   1 
ATOM   1134 C  CA  . THR B 1 50 ? 5.077  17.596  -11.546 1.00 37.97 ? 50   THR B CA  1 
ATOM   1135 C  C   . THR B 1 50 ? 4.339  18.903  -11.323 1.00 36.18 ? 50   THR B C   1 
ATOM   1136 O  O   . THR B 1 50 ? 4.953  19.905  -10.955 1.00 36.99 ? 50   THR B O   1 
ATOM   1137 C  CB  . THR B 1 50 ? 5.346  17.457  -13.033 1.00 38.42 ? 50   THR B CB  1 
ATOM   1138 O  OG1 . THR B 1 50 ? 5.759  16.117  -13.304 1.00 42.08 ? 50   THR B OG1 1 
ATOM   1139 C  CG2 . THR B 1 50 ? 6.428  18.431  -13.493 1.00 39.74 ? 50   THR B CG2 1 
ATOM   1140 N  N   . ASP B 1 51 ? 3.024  18.883  -11.536 1.00 33.26 ? 51   ASP B N   1 
ATOM   1141 C  CA  . ASP B 1 51 ? 2.192  20.075  -11.322 1.00 29.86 ? 51   ASP B CA  1 
ATOM   1142 C  C   . ASP B 1 51 ? 2.280  20.454  -9.820  1.00 26.31 ? 51   ASP B C   1 
ATOM   1143 O  O   . ASP B 1 51 ? 2.176  19.573  -8.963  1.00 24.22 ? 51   ASP B O   1 
ATOM   1144 C  CB  . ASP B 1 51 ? 0.766  19.710  -11.774 1.00 31.40 ? 51   ASP B CB  1 
ATOM   1145 C  CG  . ASP B 1 51 ? -0.284 20.659  -11.262 1.00 32.84 ? 51   ASP B CG  1 
ATOM   1146 O  OD1 . ASP B 1 51 ? -0.422 21.770  -11.828 1.00 38.86 ? 51   ASP B OD1 1 
ATOM   1147 O  OD2 . ASP B 1 51 ? -1.004 20.278  -10.328 1.00 34.77 ? 51   ASP B OD2 1 
ATOM   1148 N  N   . GLU B 1 52 ? 2.500  21.742  -9.508  1.00 23.35 ? 52   GLU B N   1 
ATOM   1149 C  CA  . GLU B 1 52 ? 2.655  22.173  -8.127  1.00 21.92 ? 52   GLU B CA  1 
ATOM   1150 C  C   . GLU B 1 52 ? 1.462  21.846  -7.230  1.00 21.38 ? 52   GLU B C   1 
ATOM   1151 O  O   . GLU B 1 52 ? 1.644  21.334  -6.093  1.00 20.73 ? 52   GLU B O   1 
ATOM   1152 C  CB  . GLU B 1 52 ? 3.013  23.671  -8.067  1.00 21.26 ? 52   GLU B CB  1 
ATOM   1153 C  CG  . GLU B 1 52 ? 3.227  24.283  -6.623  1.00 21.22 ? 52   GLU B CG  1 
ATOM   1154 C  CD  . GLU B 1 52 ? 4.384  23.614  -5.877  1.00 21.80 ? 52   GLU B CD  1 
ATOM   1155 O  OE1 . GLU B 1 52 ? 4.331  23.526  -4.649  1.00 21.27 ? 52   GLU B OE1 1 
ATOM   1156 O  OE2 . GLU B 1 52 ? 5.355  23.173  -6.547  1.00 24.90 ? 52   GLU B OE2 1 
ATOM   1157 N  N   . ALA B 1 53 ? 0.235  22.129  -7.702  1.00 20.76 ? 53   ALA B N   1 
ATOM   1158 C  CA  . ALA B 1 53 ? -0.969 21.821  -6.914  1.00 20.80 ? 53   ALA B CA  1 
ATOM   1159 C  C   . ALA B 1 53 ? -1.091 20.321  -6.689  1.00 21.47 ? 53   ALA B C   1 
ATOM   1160 O  O   . ALA B 1 53 ? -1.532 19.895  -5.599  1.00 21.73 ? 53   ALA B O   1 
ATOM   1161 C  CB  . ALA B 1 53 ? -2.224 22.377  -7.607  1.00 21.36 ? 53   ALA B CB  1 
ATOM   1162 N  N   . ALA B 1 54 ? -0.750 19.541  -7.717  1.00 22.03 ? 54   ALA B N   1 
ATOM   1163 C  CA  . ALA B 1 54 ? -0.761 18.049  -7.600  1.00 22.02 ? 54   ALA B CA  1 
ATOM   1164 C  C   . ALA B 1 54 ? 0.291  17.560  -6.603  1.00 22.13 ? 54   ALA B C   1 
ATOM   1165 O  O   . ALA B 1 54 ? 0.007  16.655  -5.780  1.00 22.53 ? 54   ALA B O   1 
ATOM   1166 C  CB  . ALA B 1 54 ? -0.550 17.385  -9.003  1.00 22.57 ? 54   ALA B CB  1 
ATOM   1167 N  N   . PHE B 1 55 ? 1.495  18.146  -6.646  1.00 19.46 ? 55   PHE B N   1 
ATOM   1168 C  CA  . PHE B 1 55 ? 2.505  17.761  -5.669  1.00 19.94 ? 55   PHE B CA  1 
ATOM   1169 C  C   . PHE B 1 55 ? 1.999  18.144  -4.289  1.00 18.48 ? 55   PHE B C   1 
ATOM   1170 O  O   . PHE B 1 55 ? 2.192  17.379  -3.353  1.00 18.81 ? 55   PHE B O   1 
ATOM   1171 C  CB  . PHE B 1 55 ? 3.881  18.394  -5.953  1.00 20.47 ? 55   PHE B CB  1 
ATOM   1172 C  CG  . PHE B 1 55 ? 4.827  18.300  -4.796  1.00 22.03 ? 55   PHE B CG  1 
ATOM   1173 C  CD1 . PHE B 1 55 ? 5.425  17.077  -4.452  1.00 23.26 ? 55   PHE B CD1 1 
ATOM   1174 C  CD2 . PHE B 1 55 ? 5.098  19.437  -4.034  1.00 23.95 ? 55   PHE B CD2 1 
ATOM   1175 C  CE1 . PHE B 1 55 ? 6.297  17.017  -3.341  1.00 23.15 ? 55   PHE B CE1 1 
ATOM   1176 C  CE2 . PHE B 1 55 ? 5.962  19.391  -2.943  1.00 24.64 ? 55   PHE B CE2 1 
ATOM   1177 C  CZ  . PHE B 1 55 ? 6.550  18.176  -2.571  1.00 22.23 ? 55   PHE B CZ  1 
ATOM   1178 N  N   . GLN B 1 56 ? 1.380  19.340  -4.120  1.00 18.06 ? 56   GLN B N   1 
ATOM   1179 C  CA  . GLN B 1 56 ? 0.938  19.698  -2.770  1.00 17.74 ? 56   GLN B CA  1 
ATOM   1180 C  C   . GLN B 1 56 ? -0.170 18.789  -2.300  1.00 17.79 ? 56   GLN B C   1 
ATOM   1181 O  O   . GLN B 1 56 ? -0.279 18.517  -1.122  1.00 18.19 ? 56   GLN B O   1 
ATOM   1182 C  CB  . GLN B 1 56 ? 0.484  21.174  -2.674  1.00 17.88 ? 56   GLN B CB  1 
ATOM   1183 C  CG  . GLN B 1 56 ? 1.616  22.112  -2.955  1.00 16.77 ? 56   GLN B CG  1 
ATOM   1184 C  CD  . GLN B 1 56 ? 1.216  23.582  -2.796  1.00 17.82 ? 56   GLN B CD  1 
ATOM   1185 O  OE1 . GLN B 1 56 ? 0.190  23.886  -2.174  1.00 14.59 ? 56   GLN B OE1 1 
ATOM   1186 N  NE2 . GLN B 1 56 ? 2.092  24.497  -3.285  1.00 20.16 ? 56   GLN B NE2 1 
ATOM   1187 N  N   . LYS B 1 57 ? -0.976 18.299  -3.218  1.00 19.89 ? 57   LYS B N   1 
ATOM   1188 C  CA  . LYS B 1 57 ? -1.993 17.328  -2.846  1.00 21.93 ? 57   LYS B CA  1 
ATOM   1189 C  C   . LYS B 1 57 ? -1.360 16.008  -2.370  1.00 21.44 ? 57   LYS B C   1 
ATOM   1190 O  O   . LYS B 1 57 ? -1.754 15.463  -1.316  1.00 22.89 ? 57   LYS B O   1 
ATOM   1191 C  CB  . LYS B 1 57 ? -2.933 17.105  -4.014  1.00 23.45 ? 57   LYS B CB  1 
ATOM   1192 C  CG  . LYS B 1 57 ? -3.707 15.804  -3.875  1.00 29.31 ? 57   LYS B CG  1 
ATOM   1193 C  CD  . LYS B 1 57 ? -4.964 15.793  -4.700  1.00 33.90 ? 57   LYS B CD  1 
ATOM   1194 C  CE  . LYS B 1 57 ? -6.037 16.512  -3.982  1.00 34.23 ? 57   LYS B CE  1 
ATOM   1195 N  NZ  . LYS B 1 57 ? -6.273 17.899  -4.546  1.00 34.49 ? 57   LYS B NZ  1 
ATOM   1196 N  N   . LEU B 1 58 ? -0.374 15.521  -3.118  1.00 20.62 ? 58   LEU B N   1 
ATOM   1197 C  CA  . LEU B 1 58 ? 0.341  14.315  -2.676  1.00 21.11 ? 58   LEU B CA  1 
ATOM   1198 C  C   . LEU B 1 58 ? 0.918  14.500  -1.274  1.00 21.32 ? 58   LEU B C   1 
ATOM   1199 O  O   . LEU B 1 58 ? 0.730  13.663  -0.352  1.00 21.51 ? 58   LEU B O   1 
ATOM   1200 C  CB  . LEU B 1 58 ? 1.492  14.047  -3.628  1.00 19.92 ? 58   LEU B CB  1 
ATOM   1201 C  CG  . LEU B 1 58 ? 2.479  12.963  -3.175  1.00 20.57 ? 58   LEU B CG  1 
ATOM   1202 C  CD1 . LEU B 1 58 ? 1.773  11.635  -3.050  1.00 24.87 ? 58   LEU B CD1 1 
ATOM   1203 C  CD2 . LEU B 1 58 ? 3.646  12.856  -4.184  1.00 22.55 ? 58   LEU B CD2 1 
ATOM   1204 N  N   . MET B 1 59 ? 1.568  15.639  -1.098  1.00 22.54 ? 59   MET B N   1 
ATOM   1205 C  CA  . MET B 1 59 ? 2.111  15.976  0.173   1.00 23.06 ? 59   MET B CA  1 
ATOM   1206 C  C   . MET B 1 59 ? 1.068  15.973  1.292   1.00 24.26 ? 59   MET B C   1 
ATOM   1207 O  O   . MET B 1 59 ? 1.342  15.457  2.392   1.00 22.43 ? 59   MET B O   1 
ATOM   1208 C  CB  . MET B 1 59 ? 2.738  17.346  0.066   1.00 24.61 ? 59   MET B CB  1 
ATOM   1209 C  CG  . MET B 1 59 ? 2.680  18.019  1.347   1.00 28.81 ? 59   MET B CG  1 
ATOM   1210 S  SD  . MET B 1 59 ? 4.052  17.333  2.132   1.00 37.91 ? 59   MET B SD  1 
ATOM   1211 C  CE  . MET B 1 59 ? 5.138  18.553  1.484   1.00 9.62  ? 59   MET B CE  1 
ATOM   1212 N  N   A SER B 1 60 ? -0.116 16.540  1.045   0.60 23.88 ? 60   SER B N   1 
ATOM   1213 N  N   B SER B 1 60 ? -0.097 16.567  1.020   0.40 23.08 ? 60   SER B N   1 
ATOM   1214 C  CA  A SER B 1 60 ? -1.136 16.598  2.106   0.60 24.94 ? 60   SER B CA  1 
ATOM   1215 C  CA  B SER B 1 60 ? -1.169 16.603  2.005   0.40 22.99 ? 60   SER B CA  1 
ATOM   1216 C  C   A SER B 1 60 ? -1.764 15.229  2.411   0.60 24.90 ? 60   SER B C   1 
ATOM   1217 C  C   B SER B 1 60 ? -1.488 15.182  2.419   0.40 23.75 ? 60   SER B C   1 
ATOM   1218 O  O   A SER B 1 60 ? -2.196 14.979  3.536   0.60 24.81 ? 60   SER B O   1 
ATOM   1219 O  O   B SER B 1 60 ? -1.421 14.860  3.618   0.40 22.69 ? 60   SER B O   1 
ATOM   1220 C  CB  A SER B 1 60 ? -2.206 17.664  1.829   0.60 25.15 ? 60   SER B CB  1 
ATOM   1221 C  CB  B SER B 1 60 ? -2.425 17.279  1.456   0.40 23.08 ? 60   SER B CB  1 
ATOM   1222 O  OG  A SER B 1 60 ? -2.806 17.468  0.565   0.60 28.05 ? 60   SER B OG  1 
ATOM   1223 O  OG  B SER B 1 60 ? -3.388 17.450  2.477   0.40 19.15 ? 60   SER B OG  1 
ATOM   1224 N  N   . ASN B 1 61 ? -1.786 14.346  1.417   1.00 24.10 ? 61   ASN B N   1 
ATOM   1225 C  CA  . ASN B 1 61 ? -2.124 12.930  1.647   1.00 26.27 ? 61   ASN B CA  1 
ATOM   1226 C  C   . ASN B 1 61 ? -1.055 12.172  2.448   1.00 25.56 ? 61   ASN B C   1 
ATOM   1227 O  O   . ASN B 1 61 ? -1.409 11.349  3.301   1.00 27.87 ? 61   ASN B O   1 
ATOM   1228 C  CB  . ASN B 1 61 ? -2.355 12.176  0.344   1.00 26.15 ? 61   ASN B CB  1 
ATOM   1229 C  CG  . ASN B 1 61 ? -3.515 12.741  -0.494  1.00 32.62 ? 61   ASN B CG  1 
ATOM   1230 O  OD1 . ASN B 1 61 ? -4.509 13.293  0.024   1.00 34.03 ? 61   ASN B OD1 1 
ATOM   1231 N  ND2 . ASN B 1 61 ? -3.405 12.554  -1.805  1.00 35.59 ? 61   ASN B ND2 1 
ATOM   1232 N  N   . LEU B 1 62 ? 0.232  12.410  2.190   1.00 25.65 ? 62   LEU B N   1 
ATOM   1233 C  CA  . LEU B 1 62 ? 1.304  11.740  2.974   1.00 24.09 ? 62   LEU B CA  1 
ATOM   1234 C  C   . LEU B 1 62 ? 1.340  12.175  4.438   1.00 25.12 ? 62   LEU B C   1 
ATOM   1235 O  O   . LEU B 1 62 ? 1.707  11.391  5.344   1.00 25.83 ? 62   LEU B O   1 
ATOM   1236 C  CB  . LEU B 1 62 ? 2.666  11.987  2.326   1.00 24.30 ? 62   LEU B CB  1 
ATOM   1237 C  CG  . LEU B 1 62 ? 2.893  11.487  0.906   1.00 25.87 ? 62   LEU B CG  1 
ATOM   1238 C  CD1 . LEU B 1 62 ? 4.406  11.477  0.608   1.00 25.74 ? 62   LEU B CD1 1 
ATOM   1239 C  CD2 . LEU B 1 62 ? 2.316  10.056  0.780   1.00 25.89 ? 62   LEU B CD2 1 
ATOM   1240 N  N   . ASP B 1 63 ? 0.996  13.447  4.678   1.00 23.97 ? 63   ASP B N   1 
ATOM   1241 C  CA  . ASP B 1 63 ? 1.181  14.063  5.966   1.00 25.73 ? 63   ASP B CA  1 
ATOM   1242 C  C   . ASP B 1 63 ? -0.063 13.740  6.758   1.00 26.81 ? 63   ASP B C   1 
ATOM   1243 O  O   . ASP B 1 63 ? -0.967 14.570  6.917   1.00 28.35 ? 63   ASP B O   1 
ATOM   1244 C  CB  . ASP B 1 63 ? 1.359  15.594  5.795   1.00 25.49 ? 63   ASP B CB  1 
ATOM   1245 C  CG  . ASP B 1 63 ? 1.455  16.318  7.112   1.00 27.66 ? 63   ASP B CG  1 
ATOM   1246 O  OD1 . ASP B 1 63 ? 1.806  15.673  8.113   1.00 28.42 ? 63   ASP B OD1 1 
ATOM   1247 O  OD2 . ASP B 1 63 ? 1.154  17.553  7.150   1.00 28.90 ? 63   ASP B OD2 1 
ATOM   1248 N  N   . SER B 1 64 ? -0.109 12.531  7.296   1.00 26.81 ? 64   SER B N   1 
ATOM   1249 C  CA  . SER B 1 64 ? -1.320 12.060  7.947   1.00 29.12 ? 64   SER B CA  1 
ATOM   1250 C  C   . SER B 1 64 ? -1.533 12.618  9.380   1.00 29.58 ? 64   SER B C   1 
ATOM   1251 O  O   . SER B 1 64 ? -2.659 12.663  9.856   1.00 29.92 ? 64   SER B O   1 
ATOM   1252 C  CB  . SER B 1 64 ? -1.350 10.542  7.914   1.00 29.27 ? 64   SER B CB  1 
ATOM   1253 O  OG  . SER B 1 64 ? -0.221 10.072  8.572   1.00 29.97 ? 64   SER B OG  1 
ATOM   1254 N  N   . ASN B 1 65 ? -0.480 13.056  10.055  1.00 29.78 ? 65   ASN B N   1 
ATOM   1255 C  CA  . ASN B 1 65 ? -0.647 13.728  11.351  1.00 30.00 ? 65   ASN B CA  1 
ATOM   1256 C  C   . ASN B 1 65 ? -0.681 15.281  11.301  1.00 30.43 ? 65   ASN B C   1 
ATOM   1257 O  O   . ASN B 1 65 ? -0.586 15.935  12.345  1.00 30.54 ? 65   ASN B O   1 
ATOM   1258 C  CB  . ASN B 1 65 ? 0.450  13.273  12.316  1.00 30.16 ? 65   ASN B CB  1 
ATOM   1259 C  CG  . ASN B 1 65 ? 1.742  14.050  12.132  1.00 29.41 ? 65   ASN B CG  1 
ATOM   1260 O  OD1 . ASN B 1 65 ? 2.005  14.652  11.066  1.00 26.75 ? 65   ASN B OD1 1 
ATOM   1261 N  ND2 . ASN B 1 65 ? 2.551  14.064  13.172  1.00 31.89 ? 65   ASN B ND2 1 
ATOM   1262 N  N   . ARG B 1 66 ? -0.747 15.858  10.102  1.00 30.82 ? 66   ARG B N   1 
ATOM   1263 C  CA  . ARG B 1 66 ? -1.012 17.307  9.886   1.00 30.94 ? 66   ARG B CA  1 
ATOM   1264 C  C   . ARG B 1 66 ? -0.023 18.331  10.489  1.00 30.29 ? 66   ARG B C   1 
ATOM   1265 O  O   . ARG B 1 66 ? -0.399 19.477  10.849  1.00 30.22 ? 66   ARG B O   1 
ATOM   1266 C  CB  . ARG B 1 66 ? -2.462 17.635  10.300  1.00 31.76 ? 66   ARG B CB  1 
ATOM   1267 C  CG  . ARG B 1 66 ? -3.563 17.029  9.393   1.00 33.48 ? 66   ARG B CG  1 
ATOM   1268 C  CD  . ARG B 1 66 ? -4.976 17.631  9.733   1.00 40.81 ? 66   ARG B CD  1 
ATOM   1269 N  NE  . ARG B 1 66 ? -6.085 16.899  9.094   1.00 45.76 ? 66   ARG B NE  1 
ATOM   1270 C  CZ  . ARG B 1 66 ? -6.726 17.272  7.979   1.00 45.82 ? 66   ARG B CZ  1 
ATOM   1271 N  NH1 . ARG B 1 66 ? -6.404 18.395  7.346   1.00 49.17 ? 66   ARG B NH1 1 
ATOM   1272 N  NH2 . ARG B 1 66 ? -7.709 16.517  7.500   1.00 47.13 ? 66   ARG B NH2 1 
ATOM   1273 N  N   . ASP B 1 67 ? 1.247  17.976  10.555  1.00 28.50 ? 67   ASP B N   1 
ATOM   1274 C  CA  . ASP B 1 67 ? 2.216  18.868  11.198  1.00 28.17 ? 67   ASP B CA  1 
ATOM   1275 C  C   . ASP B 1 67 ? 3.053  19.572  10.139  1.00 26.52 ? 67   ASP B C   1 
ATOM   1276 O  O   . ASP B 1 67 ? 4.141  20.116  10.435  1.00 26.95 ? 67   ASP B O   1 
ATOM   1277 C  CB  . ASP B 1 67 ? 3.101  18.117  12.212  1.00 27.69 ? 67   ASP B CB  1 
ATOM   1278 C  CG  . ASP B 1 67 ? 3.988  17.078  11.539  1.00 28.11 ? 67   ASP B CG  1 
ATOM   1279 O  OD1 . ASP B 1 67 ? 3.714  16.839  10.340  1.00 27.79 ? 67   ASP B OD1 1 
ATOM   1280 O  OD2 . ASP B 1 67 ? 4.934  16.550  12.187  1.00 28.49 ? 67   ASP B OD2 1 
ATOM   1281 N  N   . ASN B 1 68 ? 2.555  19.533  8.905   1.00 26.44 ? 68   ASN B N   1 
ATOM   1282 C  CA  . ASN B 1 68 ? 3.237  20.125  7.746   1.00 26.74 ? 68   ASN B CA  1 
ATOM   1283 C  C   . ASN B 1 68 ? 4.475  19.494  7.141   1.00 25.81 ? 68   ASN B C   1 
ATOM   1284 O  O   . ASN B 1 68 ? 4.986  20.042  6.149   1.00 25.16 ? 68   ASN B O   1 
ATOM   1285 C  CB  . ASN B 1 68 ? 3.498  21.626  7.958   1.00 27.88 ? 68   ASN B CB  1 
ATOM   1286 C  CG  . ASN B 1 68 ? 2.222  22.451  7.883   1.00 32.22 ? 68   ASN B CG  1 
ATOM   1287 O  OD1 . ASN B 1 68 ? 1.129  21.903  7.704   1.00 36.38 ? 68   ASN B OD1 1 
ATOM   1288 N  ND2 . ASN B 1 68 ? 2.362  23.785  7.981   1.00 34.47 ? 68   ASN B ND2 1 
ATOM   1289 N  N   . GLU B 1 69 ? 4.941  18.364  7.696   1.00 23.84 ? 69   GLU B N   1 
ATOM   1290 C  CA  . GLU B 1 69 ? 6.133  17.711  7.175   1.00 21.36 ? 69   GLU B CA  1 
ATOM   1291 C  C   . GLU B 1 69 ? 5.829  16.236  7.005   1.00 20.57 ? 69   GLU B C   1 
ATOM   1292 O  O   . GLU B 1 69 ? 4.788  15.737  7.446   1.00 20.93 ? 69   GLU B O   1 
ATOM   1293 C  CB  . GLU B 1 69 ? 7.398  18.009  8.018   1.00 23.68 ? 69   GLU B CB  1 
ATOM   1294 C  CG  . GLU B 1 69 ? 7.653  19.546  8.012   1.00 21.99 ? 69   GLU B CG  1 
ATOM   1295 C  CD  . GLU B 1 69 ? 9.000  20.081  8.367   1.00 30.78 ? 69   GLU B CD  1 
ATOM   1296 O  OE1 . GLU B 1 69 ? 9.110  21.363  8.397   1.00 35.25 ? 69   GLU B OE1 1 
ATOM   1297 O  OE2 . GLU B 1 69 ? 9.949  19.309  8.578   1.00 29.05 ? 69   GLU B OE2 1 
ATOM   1298 N  N   . VAL B 1 70 ? 6.735  15.549  6.334   1.00 17.92 ? 70   VAL B N   1 
ATOM   1299 C  CA  . VAL B 1 70 ? 6.596  14.083  6.192   1.00 16.38 ? 70   VAL B CA  1 
ATOM   1300 C  C   . VAL B 1 70 ? 7.683  13.459  7.063   1.00 15.99 ? 70   VAL B C   1 
ATOM   1301 O  O   . VAL B 1 70 ? 8.885  13.628  6.843   1.00 15.77 ? 70   VAL B O   1 
ATOM   1302 C  CB  . VAL B 1 70 ? 6.746  13.664  4.733   1.00 16.51 ? 70   VAL B CB  1 
ATOM   1303 C  CG1 . VAL B 1 70 ? 6.727  12.141  4.561   1.00 16.49 ? 70   VAL B CG1 1 
ATOM   1304 C  CG2 . VAL B 1 70 ? 5.629  14.193  3.911   1.00 15.92 ? 70   VAL B CG2 1 
ATOM   1305 N  N   . ASP B 1 71 ? 7.257  12.742  8.123   1.00 14.71 ? 71   ASP B N   1 
ATOM   1306 C  CA  . ASP B 1 71 ? 8.240  12.103  8.988   1.00 15.08 ? 71   ASP B CA  1 
ATOM   1307 C  C   . ASP B 1 71 ? 8.551  10.710  8.446   1.00 13.71 ? 71   ASP B C   1 
ATOM   1308 O  O   . ASP B 1 71 ? 8.009  10.321  7.417   1.00 13.32 ? 71   ASP B O   1 
ATOM   1309 C  CB  . ASP B 1 71 ? 7.785  12.044  10.449  1.00 16.10 ? 71   ASP B CB  1 
ATOM   1310 C  CG  . ASP B 1 71 ? 6.491  11.221  10.664  1.00 18.65 ? 71   ASP B CG  1 
ATOM   1311 O  OD1 . ASP B 1 71 ? 6.145  10.293  9.890   1.00 16.05 ? 71   ASP B OD1 1 
ATOM   1312 O  OD2 . ASP B 1 71 ? 5.730  11.521  11.630  1.00 22.32 ? 71   ASP B OD2 1 
ATOM   1313 N  N   . PHE B 1 72 ? 9.420  9.997   9.145   1.00 12.70 ? 72   PHE B N   1 
ATOM   1314 C  CA  . PHE B 1 72 ? 9.935  8.768   8.574   1.00 10.57 ? 72   PHE B CA  1 
ATOM   1315 C  C   . PHE B 1 72 ? 8.810  7.724   8.409   1.00 11.48 ? 72   PHE B C   1 
ATOM   1316 O  O   . PHE B 1 72 ? 8.783  7.016   7.416   1.00 11.73 ? 72   PHE B O   1 
ATOM   1317 C  CB  . PHE B 1 72 ? 11.063 8.195   9.448   1.00 11.20 ? 72   PHE B CB  1 
ATOM   1318 C  CG  . PHE B 1 72 ? 11.760 7.041   8.813   1.00 9.62  ? 72   PHE B CG  1 
ATOM   1319 C  CD1 . PHE B 1 72 ? 12.655 7.248   7.755   1.00 11.11 ? 72   PHE B CD1 1 
ATOM   1320 C  CD2 . PHE B 1 72 ? 11.494 5.731   9.210   1.00 9.83  ? 72   PHE B CD2 1 
ATOM   1321 C  CE1 . PHE B 1 72 ? 13.285 6.201   7.088   1.00 11.20 ? 72   PHE B CE1 1 
ATOM   1322 C  CE2 . PHE B 1 72 ? 12.105 4.652   8.537   1.00 9.40  ? 72   PHE B CE2 1 
ATOM   1323 C  CZ  . PHE B 1 72 ? 13.025 4.864   7.444   1.00 10.17 ? 72   PHE B CZ  1 
ATOM   1324 N  N   . GLN B 1 73 ? 7.920  7.603   9.403   1.00 11.93 ? 73   GLN B N   1 
ATOM   1325 C  CA  . GLN B 1 73 ? 6.789  6.684   9.282   1.00 12.14 ? 73   GLN B CA  1 
ATOM   1326 C  C   . GLN B 1 73 ? 5.929  7.010   8.074   1.00 11.41 ? 73   GLN B C   1 
ATOM   1327 O  O   . GLN B 1 73 ? 5.595  6.076   7.298   1.00 12.35 ? 73   GLN B O   1 
ATOM   1328 C  CB  . GLN B 1 73 ? 5.944  6.622   10.585  1.00 11.57 ? 73   GLN B CB  1 
ATOM   1329 C  CG  . GLN B 1 73 ? 4.750  5.713   10.461  1.00 11.56 ? 73   GLN B CG  1 
ATOM   1330 C  CD  . GLN B 1 73 ? 4.047  5.375   11.798  1.00 15.25 ? 73   GLN B CD  1 
ATOM   1331 O  OE1 . GLN B 1 73 ? 4.640  5.444   12.892  1.00 17.28 ? 73   GLN B OE1 1 
ATOM   1332 N  NE2 . GLN B 1 73 ? 2.756  4.980   11.688  1.00 17.74 ? 73   GLN B NE2 1 
ATOM   1333 N  N   . GLU B 1 74 ? 5.624  8.302   7.887   1.00 11.65 ? 74   GLU B N   1 
ATOM   1334 C  CA  . GLU B 1 74 ? 4.797  8.719   6.739   1.00 12.37 ? 74   GLU B CA  1 
ATOM   1335 C  C   . GLU B 1 74 ? 5.494  8.405   5.397   1.00 12.31 ? 74   GLU B C   1 
ATOM   1336 O  O   . GLU B 1 74 ? 4.848  7.994   4.407   1.00 11.77 ? 74   GLU B O   1 
ATOM   1337 C  CB  . GLU B 1 74 ? 4.498  10.227  6.824   1.00 13.80 ? 74   GLU B CB  1 
ATOM   1338 C  CG  . GLU B 1 74 ? 3.468  10.476  8.017   1.00 11.74 ? 74   GLU B CG  1 
ATOM   1339 C  CD  . GLU B 1 74 ? 3.370  11.975  8.409   1.00 18.33 ? 74   GLU B CD  1 
ATOM   1340 O  OE1 . GLU B 1 74 ? 4.276  12.756  8.064   1.00 17.23 ? 74   GLU B OE1 1 
ATOM   1341 O  OE2 . GLU B 1 74 ? 2.330  12.329  9.080   1.00 19.42 ? 74   GLU B OE2 1 
ATOM   1342 N  N   . TYR B 1 75 ? 6.815  8.597   5.384   1.00 9.79  ? 75   TYR B N   1 
ATOM   1343 C  CA  . TYR B 1 75 ? 7.632  8.283   4.229   1.00 10.93 ? 75   TYR B CA  1 
ATOM   1344 C  C   . TYR B 1 75 ? 7.624  6.755   3.958   1.00 10.06 ? 75   TYR B C   1 
ATOM   1345 O  O   . TYR B 1 75 ? 7.558  6.329   2.807   1.00 11.09 ? 75   TYR B O   1 
ATOM   1346 C  CB  . TYR B 1 75 ? 8.987  8.791   4.489   1.00 10.29 ? 75   TYR B CB  1 
ATOM   1347 C  CG  . TYR B 1 75 ? 10.136 8.227   3.701   1.00 9.29  ? 75   TYR B CG  1 
ATOM   1348 C  CD1 . TYR B 1 75 ? 10.530 8.734   2.419   1.00 8.92  ? 75   TYR B CD1 1 
ATOM   1349 C  CD2 . TYR B 1 75 ? 10.932 7.210   4.267   1.00 9.83  ? 75   TYR B CD2 1 
ATOM   1350 C  CE1 . TYR B 1 75 ? 11.644 8.250   1.756   1.00 13.15 ? 75   TYR B CE1 1 
ATOM   1351 C  CE2 . TYR B 1 75 ? 12.057 6.703   3.553   1.00 10.69 ? 75   TYR B CE2 1 
ATOM   1352 C  CZ  . TYR B 1 75 ? 12.398 7.242   2.322   1.00 8.71  ? 75   TYR B CZ  1 
ATOM   1353 O  OH  . TYR B 1 75 ? 13.556 6.801   1.759   1.00 11.03 ? 75   TYR B OH  1 
ATOM   1354 N  N   . CYS B 1 76 ? 7.716  5.933   5.004   1.00 9.94  ? 76   CYS B N   1 
ATOM   1355 C  CA  . CYS B 1 76 ? 7.592  4.474   4.784   1.00 11.44 ? 76   CYS B CA  1 
ATOM   1356 C  C   . CYS B 1 76 ? 6.265  4.052   4.214   1.00 11.26 ? 76   CYS B C   1 
ATOM   1357 O  O   . CYS B 1 76 ? 6.234  3.122   3.375   1.00 11.51 ? 76   CYS B O   1 
ATOM   1358 C  CB  . CYS B 1 76 ? 7.857  3.667   6.072   1.00 11.16 ? 76   CYS B CB  1 
ATOM   1359 S  SG  . CYS B 1 76 ? 9.603  3.728   6.613   1.00 12.91 ? 76   CYS B SG  1 
ATOM   1360 N  N   . VAL B 1 77 ? 5.177  4.676   4.688   1.00 10.90 ? 77   VAL B N   1 
ATOM   1361 C  CA  . VAL B 1 77 ? 3.855  4.405   4.163   1.00 12.99 ? 77   VAL B CA  1 
ATOM   1362 C  C   . VAL B 1 77 ? 3.830  4.785   2.678   1.00 12.72 ? 77   VAL B C   1 
ATOM   1363 O  O   . VAL B 1 77 ? 3.311  4.039   1.874   1.00 12.00 ? 77   VAL B O   1 
ATOM   1364 C  CB  . VAL B 1 77 ? 2.804  5.120   5.018   1.00 13.80 ? 77   VAL B CB  1 
ATOM   1365 C  CG1 . VAL B 1 77 ? 1.447  5.117   4.300   1.00 15.80 ? 77   VAL B CG1 1 
ATOM   1366 C  CG2 . VAL B 1 77 ? 2.743  4.389   6.370   1.00 15.15 ? 77   VAL B CG2 1 
ATOM   1367 N  N   . PHE B 1 78 ? 4.373  5.961   2.340   1.00 12.32 ? 78   PHE B N   1 
ATOM   1368 C  CA  . PHE B 1 78 ? 4.529  6.366   0.945   1.00 11.89 ? 78   PHE B CA  1 
ATOM   1369 C  C   . PHE B 1 78 ? 5.221  5.292   0.121   1.00 12.80 ? 78   PHE B C   1 
ATOM   1370 O  O   . PHE B 1 78 ? 4.724  4.852   -0.909  1.00 11.66 ? 78   PHE B O   1 
ATOM   1371 C  CB  . PHE B 1 78 ? 5.263  7.694   0.884   1.00 11.55 ? 78   PHE B CB  1 
ATOM   1372 C  CG  . PHE B 1 78 ? 5.589  8.172   -0.503  1.00 15.04 ? 78   PHE B CG  1 
ATOM   1373 C  CD1 . PHE B 1 78 ? 4.607  8.198   -1.481  1.00 14.59 ? 78   PHE B CD1 1 
ATOM   1374 C  CD2 . PHE B 1 78 ? 6.857  8.654   -0.781  1.00 18.95 ? 78   PHE B CD2 1 
ATOM   1375 C  CE1 . PHE B 1 78 ? 4.901  8.692   -2.771  1.00 19.20 ? 78   PHE B CE1 1 
ATOM   1376 C  CE2 . PHE B 1 78 ? 7.177  9.148   -2.069  1.00 22.50 ? 78   PHE B CE2 1 
ATOM   1377 C  CZ  . PHE B 1 78 ? 6.207  9.130   -3.045  1.00 17.03 ? 78   PHE B CZ  1 
ATOM   1378 N  N   . LEU B 1 79 ? 6.417  4.888   0.551   1.00 12.03 ? 79   LEU B N   1 
ATOM   1379 C  CA  . LEU B 1 79 ? 7.160  3.843   -0.194  1.00 11.84 ? 79   LEU B CA  1 
ATOM   1380 C  C   . LEU B 1 79 ? 6.372  2.530   -0.296  1.00 11.23 ? 79   LEU B C   1 
ATOM   1381 O  O   . LEU B 1 79 ? 6.363  1.904   -1.356  1.00 12.04 ? 79   LEU B O   1 
ATOM   1382 C  CB  . LEU B 1 79 ? 8.525  3.573   0.424   1.00 10.93 ? 79   LEU B CB  1 
ATOM   1383 C  CG  . LEU B 1 79 ? 9.499  4.758   0.452   1.00 10.88 ? 79   LEU B CG  1 
ATOM   1384 C  CD1 . LEU B 1 79 ? 10.887 4.349   0.936   1.00 12.62 ? 79   LEU B CD1 1 
ATOM   1385 C  CD2 . LEU B 1 79 ? 9.672  5.281   -0.936  1.00 15.36 ? 79   LEU B CD2 1 
ATOM   1386 N  N   . SER B 1 80 ? 5.668  2.148   0.778   1.00 10.64 ? 80   SER B N   1 
ATOM   1387 C  CA  . SER B 1 80 ? 4.849  0.949   0.732   1.00 11.09 ? 80   SER B CA  1 
ATOM   1388 C  C   . SER B 1 80 ? 3.686  1.062   -0.298  1.00 11.98 ? 80   SER B C   1 
ATOM   1389 O  O   . SER B 1 80 ? 3.253  0.060   -0.863  1.00 11.82 ? 80   SER B O   1 
ATOM   1390 C  CB  . SER B 1 80 ? 4.188  0.701   2.094   1.00 9.68  ? 80   SER B CB  1 
ATOM   1391 O  OG  . SER B 1 80 ? 5.244  0.339   3.021   1.00 12.11 ? 80   SER B OG  1 
ATOM   1392 N  N   . CYS B 1 81 ? 3.119  2.247   -0.421  1.00 12.61 ? 81   CYS B N   1 
ATOM   1393 C  CA  . CYS B 1 81 ? 2.133  2.482   -1.452  1.00 13.95 ? 81   CYS B CA  1 
ATOM   1394 C  C   . CYS B 1 81 ? 2.694  2.346   -2.872  1.00 13.58 ? 81   CYS B C   1 
ATOM   1395 O  O   . CYS B 1 81 ? 2.042  1.742   -3.711  1.00 14.36 ? 81   CYS B O   1 
ATOM   1396 C  CB  . CYS B 1 81 ? 1.516  3.840   -1.236  1.00 14.16 ? 81   CYS B CB  1 
ATOM   1397 S  SG  . CYS B 1 81 ? 0.378  3.821   0.250   1.00 23.42 ? 81   CYS B SG  1 
ATOM   1398 N  N   . ILE B 1 82 ? 3.908  2.837   -3.107  1.00 12.90 ? 82   ILE B N   1 
ATOM   1399 C  CA  . ILE B 1 82 ? 4.570  2.618   -4.384  1.00 12.90 ? 82   ILE B CA  1 
ATOM   1400 C  C   . ILE B 1 82 ? 4.848  1.134   -4.599  1.00 12.05 ? 82   ILE B C   1 
ATOM   1401 O  O   . ILE B 1 82 ? 4.570  0.611   -5.679  1.00 12.99 ? 82   ILE B O   1 
ATOM   1402 C  CB  . ILE B 1 82 ? 5.867  3.429   -4.524  1.00 12.34 ? 82   ILE B CB  1 
ATOM   1403 C  CG1 . ILE B 1 82 ? 5.555  4.950   -4.407  1.00 15.57 ? 82   ILE B CG1 1 
ATOM   1404 C  CG2 . ILE B 1 82 ? 6.616  3.023   -5.854  1.00 14.73 ? 82   ILE B CG2 1 
ATOM   1405 C  CD1 . ILE B 1 82 ? 6.837  5.788   -4.277  1.00 15.00 ? 82   ILE B CD1 1 
ATOM   1406 N  N   . ALA B 1 83 ? 5.374  0.450   -3.581  1.00 11.05 ? 83   ALA B N   1 
ATOM   1407 C  CA  . ALA B 1 83 ? 5.589  -0.990  -3.728  1.00 10.42 ? 83   ALA B CA  1 
ATOM   1408 C  C   . ALA B 1 83 ? 4.275  -1.755  -4.040  1.00 11.76 ? 83   ALA B C   1 
ATOM   1409 O  O   . ALA B 1 83 ? 4.285  -2.723  -4.827  1.00 12.74 ? 83   ALA B O   1 
ATOM   1410 C  CB  . ALA B 1 83 ? 6.221  -1.564  -2.422  1.00 11.11 ? 83   ALA B CB  1 
ATOM   1411 N  N   . MET B 1 84 ? 3.163  -1.357  -3.388  1.00 13.05 ? 84   MET B N   1 
ATOM   1412 C  CA  . MET B 1 84 ? 1.887  -2.057  -3.588  1.00 14.14 ? 84   MET B CA  1 
ATOM   1413 C  C   . MET B 1 84 ? 1.382  -1.769  -4.986  1.00 14.63 ? 84   MET B C   1 
ATOM   1414 O  O   . MET B 1 84 ? 0.836  -2.666  -5.608  1.00 14.01 ? 84   MET B O   1 
ATOM   1415 C  CB  . MET B 1 84 ? 0.871  -1.622  -2.572  1.00 14.02 ? 84   MET B CB  1 
ATOM   1416 C  CG  . MET B 1 84 ? 1.195  -2.255  -1.284  1.00 14.99 ? 84   MET B CG  1 
ATOM   1417 S  SD  . MET B 1 84 ? 0.174  -1.606  0.057   1.00 28.25 ? 84   MET B SD  1 
ATOM   1418 C  CE  . MET B 1 84 ? -0.350 0.023   -0.507  1.00 30.36 ? 84   MET B CE  1 
ATOM   1419 N  N   . MET B 1 85 ? 1.602  -0.539  -5.460  1.00 14.99 ? 85   MET B N   1 
ATOM   1420 C  CA  . MET B 1 85 ? 1.295  -0.153  -6.884  1.00 16.81 ? 85   MET B CA  1 
ATOM   1421 C  C   . MET B 1 85 ? 2.048  -1.071  -7.844  1.00 17.20 ? 85   MET B C   1 
ATOM   1422 O  O   . MET B 1 85 ? 1.455  -1.663  -8.799  1.00 18.22 ? 85   MET B O   1 
ATOM   1423 C  CB  . MET B 1 85 ? 1.637  1.327   -7.093  1.00 17.59 ? 85   MET B CB  1 
ATOM   1424 C  CG  . MET B 1 85 ? 1.211  1.946   -8.457  1.00 23.09 ? 85   MET B CG  1 
ATOM   1425 S  SD  . MET B 1 85 ? 1.823  3.621   -8.781  1.00 33.90 ? 85   MET B SD  1 
ATOM   1426 C  CE  . MET B 1 85 ? 0.855  4.535   -7.559  1.00 34.52 ? 85   MET B CE  1 
ATOM   1427 N  N   . CYS B 1 86 ? 3.344  -1.248  -7.611  1.00 14.63 ? 86   CYS B N   1 
ATOM   1428 C  CA  . CYS B 1 86 ? 4.134  -1.999  -8.567  1.00 15.49 ? 86   CYS B CA  1 
ATOM   1429 C  C   . CYS B 1 86 ? 3.782  -3.481  -8.430  1.00 15.08 ? 86   CYS B C   1 
ATOM   1430 O  O   . CYS B 1 86 ? 3.828  -4.249  -9.370  1.00 16.78 ? 86   CYS B O   1 
ATOM   1431 C  CB  . CYS B 1 86 ? 5.648  -1.785  -8.311  1.00 15.63 ? 86   CYS B CB  1 
ATOM   1432 S  SG  . CYS B 1 86 ? 6.301  -0.160  -8.466  1.00 15.61 ? 86   CYS B SG  1 
ATOM   1433 N  N   . ASN B 1 87 ? 3.413  -3.907  -7.236  1.00 14.24 ? 87   ASN B N   1 
ATOM   1434 C  CA  . ASN B 1 87 ? 3.116  -5.296  -7.041  1.00 15.83 ? 87   ASN B CA  1 
ATOM   1435 C  C   . ASN B 1 87 ? 1.832  -5.694  -7.834  1.00 17.00 ? 87   ASN B C   1 
ATOM   1436 O  O   . ASN B 1 87 ? 1.697  -6.834  -8.285  1.00 17.45 ? 87   ASN B O   1 
ATOM   1437 C  CB  . ASN B 1 87 ? 2.922  -5.576  -5.529  1.00 15.72 ? 87   ASN B CB  1 
ATOM   1438 C  CG  . ASN B 1 87 ? 2.635  -7.032  -5.262  1.00 13.31 ? 87   ASN B CG  1 
ATOM   1439 O  OD1 . ASN B 1 87 ? 3.456  -7.872  -5.592  1.00 17.28 ? 87   ASN B OD1 1 
ATOM   1440 N  ND2 . ASN B 1 87 ? 1.496  -7.337  -4.662  1.00 14.27 ? 87   ASN B ND2 1 
ATOM   1441 N  N   . GLU B 1 88 ? 0.881  -4.781  -7.946  1.00 18.67 ? 88   GLU B N   1 
ATOM   1442 C  CA  . GLU B 1 88 ? -0.293 -5.081  -8.821  1.00 23.32 ? 88   GLU B CA  1 
ATOM   1443 C  C   . GLU B 1 88 ? 0.140  -5.589  -10.213 1.00 25.14 ? 88   GLU B C   1 
ATOM   1444 O  O   . GLU B 1 88 ? -0.401 -6.566  -10.751 1.00 24.93 ? 88   GLU B O   1 
ATOM   1445 C  CB  . GLU B 1 88 ? -1.180 -3.866  -8.955  1.00 25.32 ? 88   GLU B CB  1 
ATOM   1446 C  CG  . GLU B 1 88 ? -1.909 -3.592  -7.679  1.00 27.86 ? 88   GLU B CG  1 
ATOM   1447 C  CD  . GLU B 1 88 ? -3.016 -2.544  -7.790  1.00 35.02 ? 88   GLU B CD  1 
ATOM   1448 O  OE1 . GLU B 1 88 ? -3.670 -2.285  -6.749  1.00 37.27 ? 88   GLU B OE1 1 
ATOM   1449 O  OE2 . GLU B 1 88 ? -3.236 -1.979  -8.887  1.00 39.35 ? 88   GLU B OE2 1 
ATOM   1450 N  N   . PHE B 1 89 ? 1.198  -4.976  -10.724 1.00 27.74 ? 89   PHE B N   1 
ATOM   1451 C  CA  . PHE B 1 89 ? 1.742  -5.310  -12.021 1.00 28.93 ? 89   PHE B CA  1 
ATOM   1452 C  C   . PHE B 1 89 ? 2.481  -6.644  -12.034 1.00 30.15 ? 89   PHE B C   1 
ATOM   1453 O  O   . PHE B 1 89 ? 2.432  -7.363  -13.047 1.00 31.92 ? 89   PHE B O   1 
ATOM   1454 C  CB  . PHE B 1 89 ? 2.591  -4.173  -12.582 1.00 29.48 ? 89   PHE B CB  1 
ATOM   1455 C  CG  . PHE B 1 89 ? 1.772  -3.058  -13.178 1.00 31.00 ? 89   PHE B CG  1 
ATOM   1456 C  CD1 . PHE B 1 89 ? 1.262  -3.162  -14.475 1.00 32.36 ? 89   PHE B CD1 1 
ATOM   1457 C  CD2 . PHE B 1 89 ? 1.468  -1.935  -12.440 1.00 31.55 ? 89   PHE B CD2 1 
ATOM   1458 C  CE1 . PHE B 1 89 ? 0.462  -2.136  -15.034 1.00 31.01 ? 89   PHE B CE1 1 
ATOM   1459 C  CE2 . PHE B 1 89 ? 0.704  -0.907  -13.016 1.00 32.65 ? 89   PHE B CE2 1 
ATOM   1460 C  CZ  . PHE B 1 89 ? 0.202  -1.042  -14.316 1.00 31.66 ? 89   PHE B CZ  1 
ATOM   1461 N  N   . PHE B 1 90 ? 3.133  -6.992  -10.926 1.00 29.82 ? 90   PHE B N   1 
ATOM   1462 C  CA  . PHE B 1 90 ? 3.782  -8.282  -10.825 1.00 29.72 ? 90   PHE B CA  1 
ATOM   1463 C  C   . PHE B 1 90 ? 2.757  -9.396  -10.836 1.00 29.43 ? 90   PHE B C   1 
ATOM   1464 O  O   . PHE B 1 90 ? 2.929  -10.372 -11.591 1.00 29.97 ? 90   PHE B O   1 
ATOM   1465 C  CB  . PHE B 1 90 ? 4.670  -8.368  -9.581  1.00 30.43 ? 90   PHE B CB  1 
ATOM   1466 C  CG  . PHE B 1 90 ? 5.609  -9.552  -9.576  1.00 33.01 ? 90   PHE B CG  1 
ATOM   1467 C  CD1 . PHE B 1 90 ? 6.994  -9.378  -9.765  1.00 35.72 ? 90   PHE B CD1 1 
ATOM   1468 C  CD2 . PHE B 1 90 ? 5.122  -10.835 -9.329  1.00 35.51 ? 90   PHE B CD2 1 
ATOM   1469 C  CE1 . PHE B 1 90 ? 7.872  -10.469 -9.729  1.00 38.13 ? 90   PHE B CE1 1 
ATOM   1470 C  CE2 . PHE B 1 90 ? 5.979  -11.937 -9.282  1.00 38.65 ? 90   PHE B CE2 1 
ATOM   1471 C  CZ  . PHE B 1 90 ? 7.359  -11.759 -9.491  1.00 39.65 ? 90   PHE B CZ  1 
ATOM   1472 N  N   . GLU B 1 91 ? 1.693  -9.243  -10.047 1.00 27.68 ? 91   GLU B N   1 
ATOM   1473 C  CA  . GLU B 1 91 ? 0.697  -10.277 -9.881  1.00 28.82 ? 91   GLU B CA  1 
ATOM   1474 C  C   . GLU B 1 91 ? -0.093 -10.473 -11.162 1.00 30.05 ? 91   GLU B C   1 
ATOM   1475 O  O   . GLU B 1 91 ? -0.295 -11.613 -11.582 1.00 30.46 ? 91   GLU B O   1 
ATOM   1476 C  CB  . GLU B 1 91 ? -0.229 -10.006 -8.676  1.00 28.29 ? 91   GLU B CB  1 
ATOM   1477 C  CG  . GLU B 1 91 ? 0.569  -10.075 -7.338  1.00 27.45 ? 91   GLU B CG  1 
ATOM   1478 C  CD  . GLU B 1 91 ? -0.248 -9.860  -6.114  1.00 26.95 ? 91   GLU B CD  1 
ATOM   1479 O  OE1 . GLU B 1 91 ? -1.440 -9.501  -6.273  1.00 23.93 ? 91   GLU B OE1 1 
ATOM   1480 O  OE2 . GLU B 1 91 ? 0.292  -10.000 -4.968  1.00 26.64 ? 91   GLU B OE2 1 
ATOM   1481 N  N   . GLY B 1 92 ? -0.465 -9.373  -11.812 1.00 29.87 ? 92   GLY B N   1 
ATOM   1482 C  CA  . GLY B 1 92 ? -1.327 -9.480  -13.019 1.00 31.55 ? 92   GLY B CA  1 
ATOM   1483 C  C   . GLY B 1 92 ? -2.652 -10.171 -12.716 1.00 31.20 ? 92   GLY B C   1 
ATOM   1484 O  O   . GLY B 1 92 ? -3.221 -9.966  -11.644 1.00 32.79 ? 92   GLY B O   1 
ATOM   1485 N  N   . ASP C 2 1  ? -4.216 7.489   6.844   1.00 36.37 ? 1908 ASP P N   1 
ATOM   1486 C  CA  . ASP C 2 1  ? -4.178 6.169   6.152   1.00 35.66 ? 1908 ASP P CA  1 
ATOM   1487 C  C   . ASP C 2 1  ? -4.627 5.025   7.025   1.00 34.16 ? 1908 ASP P C   1 
ATOM   1488 O  O   . ASP C 2 1  ? -4.361 5.005   8.251   1.00 34.44 ? 1908 ASP P O   1 
ATOM   1489 C  CB  . ASP C 2 1  ? -2.753 5.846   5.650   1.00 36.42 ? 1908 ASP P CB  1 
ATOM   1490 C  CG  . ASP C 2 1  ? -2.354 6.698   4.479   1.00 39.44 ? 1908 ASP P CG  1 
ATOM   1491 O  OD1 . ASP C 2 1  ? -2.251 7.935   4.670   1.00 43.11 ? 1908 ASP P OD1 1 
ATOM   1492 O  OD2 . ASP C 2 1  ? -2.151 6.133   3.377   1.00 39.66 ? 1908 ASP P OD2 1 
ATOM   1493 N  N   . ALA C 2 2  ? -5.252 4.040   6.386   1.00 31.76 ? 1909 ALA P N   1 
ATOM   1494 C  CA  . ALA C 2 2  ? -5.352 2.733   6.989   1.00 30.01 ? 1909 ALA P CA  1 
ATOM   1495 C  C   . ALA C 2 2  ? -3.913 2.223   7.167   1.00 27.80 ? 1909 ALA P C   1 
ATOM   1496 O  O   . ALA C 2 2  ? -3.605 1.631   8.192   1.00 28.17 ? 1909 ALA P O   1 
ATOM   1497 C  CB  . ALA C 2 2  ? -6.179 1.772   6.139   1.00 29.46 ? 1909 ALA P CB  1 
ATOM   1498 N  N   . MET C 2 3  ? -3.033 2.506   6.203   1.00 25.75 ? 1910 MET P N   1 
ATOM   1499 C  CA  . MET C 2 3  ? -1.633 1.997   6.258   1.00 23.09 ? 1910 MET P CA  1 
ATOM   1500 C  C   . MET C 2 3  ? -0.856 2.606   7.430   1.00 20.17 ? 1910 MET P C   1 
ATOM   1501 O  O   . MET C 2 3  ? -0.164 1.894   8.151   1.00 17.72 ? 1910 MET P O   1 
ATOM   1502 C  CB  . MET C 2 3  ? -0.860 2.283   4.934   1.00 23.20 ? 1910 MET P CB  1 
ATOM   1503 C  CG  . MET C 2 3  ? -1.289 1.418   3.746   1.00 30.33 ? 1910 MET P CG  1 
ATOM   1504 S  SD  . MET C 2 3  ? -0.520 -0.189  3.935   1.00 37.79 ? 1910 MET P SD  1 
ATOM   1505 C  CE  . MET C 2 3  ? 1.128  0.229   3.464   1.00 36.14 ? 1910 MET P CE  1 
ATOM   1506 N  N   A ASN C 2 4  ? -0.970 3.907   7.621   0.70 19.55 ? 1911 ASN P N   1 
ATOM   1507 N  N   B ASN C 2 4  ? -0.999 3.905   7.642   0.30 19.70 ? 1911 ASN P N   1 
ATOM   1508 C  CA  A ASN C 2 4  ? -0.311 4.556   8.750   0.70 19.21 ? 1911 ASN P CA  1 
ATOM   1509 C  CA  B ASN C 2 4  ? -0.322 4.550   8.760   0.30 19.23 ? 1911 ASN P CA  1 
ATOM   1510 C  C   A ASN C 2 4  ? -0.761 3.922   10.081  0.70 19.78 ? 1911 ASN P C   1 
ATOM   1511 C  C   B ASN C 2 4  ? -0.767 3.990   10.110  0.30 19.62 ? 1911 ASN P C   1 
ATOM   1512 O  O   A ASN C 2 4  ? 0.082  3.569   10.923  0.70 18.62 ? 1911 ASN P O   1 
ATOM   1513 O  O   B ASN C 2 4  ? 0.070  3.774   10.997  0.30 19.02 ? 1911 ASN P O   1 
ATOM   1514 C  CB  A ASN C 2 4  ? -0.465 6.099   8.724   0.70 20.39 ? 1911 ASN P CB  1 
ATOM   1515 C  CB  B ASN C 2 4  ? -0.469 6.073   8.719   0.30 19.72 ? 1911 ASN P CB  1 
ATOM   1516 C  CG  A ASN C 2 4  ? 0.718  6.823   8.012   0.70 21.82 ? 1911 ASN P CG  1 
ATOM   1517 C  CG  B ASN C 2 4  ? 0.705  6.778   9.366   0.30 18.92 ? 1911 ASN P CG  1 
ATOM   1518 O  OD1 A ASN C 2 4  ? 1.817  6.947   8.580   0.70 25.18 ? 1911 ASN P OD1 1 
ATOM   1519 O  OD1 B ASN C 2 4  ? 0.960  6.618   10.548  0.30 19.02 ? 1911 ASN P OD1 1 
ATOM   1520 N  ND2 A ASN C 2 4  ? 0.459  7.374   6.820   0.70 18.36 ? 1911 ASN P ND2 1 
ATOM   1521 N  ND2 B ASN C 2 4  ? 1.447  7.553   8.575   0.30 21.30 ? 1911 ASN P ND2 1 
ATOM   1522 N  N   . ARG C 2 5  ? -2.076 3.761   10.247  1.00 19.22 ? 1912 ARG P N   1 
ATOM   1523 C  CA  . ARG C 2 5  ? -2.643 3.072   11.394  1.00 20.22 ? 1912 ARG P CA  1 
ATOM   1524 C  C   . ARG C 2 5  ? -2.075 1.646   11.578  1.00 17.74 ? 1912 ARG P C   1 
ATOM   1525 O  O   . ARG C 2 5  ? -1.686 1.243   12.699  1.00 17.40 ? 1912 ARG P O   1 
ATOM   1526 C  CB  . ARG C 2 5  ? -4.150 2.976   11.209  1.00 20.92 ? 1912 ARG P CB  1 
ATOM   1527 N  N   . GLU C 2 6  ? -2.023 0.882   10.486  1.00 16.86 ? 1913 GLU P N   1 
ATOM   1528 C  CA  . GLU C 2 6  ? -1.492 -0.453  10.573  1.00 15.54 ? 1913 GLU P CA  1 
ATOM   1529 C  C   . GLU C 2 6  ? -0.019 -0.463  10.978  1.00 12.03 ? 1913 GLU P C   1 
ATOM   1530 O  O   . GLU C 2 6  ? 0.415  -1.395  11.664  1.00 11.97 ? 1913 GLU P O   1 
ATOM   1531 C  CB  . GLU C 2 6  ? -1.628 -1.243  9.272   1.00 17.62 ? 1913 GLU P CB  1 
ATOM   1532 C  CG  . GLU C 2 6  ? -3.094 -1.571  8.930   1.00 22.36 ? 1913 GLU P CG  1 
ATOM   1533 C  CD  . GLU C 2 6  ? -3.341 -1.601  7.420   1.00 24.92 ? 1913 GLU P CD  1 
ATOM   1534 O  OE1 . GLU C 2 6  ? -2.358 -1.747  6.650   1.00 22.55 ? 1913 GLU P OE1 1 
ATOM   1535 O  OE2 . GLU C 2 6  ? -4.529 -1.433  6.999   1.00 31.15 ? 1913 GLU P OE2 1 
ATOM   1536 N  N   . VAL C 2 7  ? 0.761  0.467   10.449  1.00 13.10 ? 1914 VAL P N   1 
ATOM   1537 C  CA  . VAL C 2 7  ? 2.193  0.577   10.822  1.00 11.51 ? 1914 VAL P CA  1 
ATOM   1538 C  C   . VAL C 2 7  ? 2.293  0.870   12.323  1.00 12.82 ? 1914 VAL P C   1 
ATOM   1539 O  O   . VAL C 2 7  ? 3.099  0.224   13.022  1.00 11.35 ? 1914 VAL P O   1 
ATOM   1540 C  CB  . VAL C 2 7  ? 2.975  1.611   9.963   1.00 11.13 ? 1914 VAL P CB  1 
ATOM   1541 C  CG1 . VAL C 2 7  ? 4.363  1.810   10.514  1.00 12.53 ? 1914 VAL P CG1 1 
ATOM   1542 C  CG2 . VAL C 2 7  ? 3.094  1.096   8.505   1.00 11.83 ? 1914 VAL P CG2 1 
ATOM   1543 N  N   . SER C 2 8  ? 1.489  1.827   12.806  1.00 13.60 ? 1915 SER P N   1 
ATOM   1544 C  CA  . SER C 2 8  ? 1.551  2.135   14.233  1.00 14.07 ? 1915 SER P CA  1 
ATOM   1545 C  C   . SER C 2 8  ? 1.150  0.933   15.081  1.00 14.92 ? 1915 SER P C   1 
ATOM   1546 O  O   . SER C 2 8  ? 1.819  0.663   16.078  1.00 16.38 ? 1915 SER P O   1 
ATOM   1547 C  CB  . SER C 2 8  ? 0.655  3.357   14.558  1.00 16.76 ? 1915 SER P CB  1 
ATOM   1548 O  OG  . SER C 2 8  ? 1.223  4.568   14.073  1.00 20.10 ? 1915 SER P OG  1 
ATOM   1549 N  N   A SER C 2 9  ? 0.113  0.207   14.675  0.70 14.69 ? 1916 SER P N   1 
ATOM   1550 N  N   B SER C 2 9  ? 0.108  0.214   14.674  0.30 14.53 ? 1916 SER P N   1 
ATOM   1551 C  CA  A SER C 2 9  ? -0.317 -1.010  15.411  0.70 14.51 ? 1916 SER P CA  1 
ATOM   1552 C  CA  B SER C 2 9  ? -0.329 -0.983  15.404  0.30 14.12 ? 1916 SER P CA  1 
ATOM   1553 C  C   A SER C 2 9  ? 0.812  -2.033  15.504  0.70 13.47 ? 1916 SER P C   1 
ATOM   1554 C  C   B SER C 2 9  ? 0.773  -2.046  15.481  0.30 13.33 ? 1916 SER P C   1 
ATOM   1555 O  O   A SER C 2 9  ? 1.093  -2.619  16.565  0.70 13.73 ? 1916 SER P O   1 
ATOM   1556 O  O   B SER C 2 9  ? 1.015  -2.631  16.544  0.30 13.63 ? 1916 SER P O   1 
ATOM   1557 C  CB  A SER C 2 9  ? -1.544 -1.643  14.751  0.70 15.86 ? 1916 SER P CB  1 
ATOM   1558 C  CB  B SER C 2 9  ? -1.608 -1.563  14.795  0.30 14.79 ? 1916 SER P CB  1 
ATOM   1559 O  OG  A SER C 2 9  ? -1.937 -2.853  15.382  0.70 16.70 ? 1916 SER P OG  1 
ATOM   1560 O  OG  B SER C 2 9  ? -2.706 -0.670  14.941  0.30 15.31 ? 1916 SER P OG  1 
ATOM   1561 N  N   . LEU C 2 10 ? 1.447  -2.309  14.355  1.00 12.23 ? 1917 LEU P N   1 
ATOM   1562 C  CA  . LEU C 2 10 ? 2.465  -3.339  14.352  1.00 10.75 ? 1917 LEU P CA  1 
ATOM   1563 C  C   . LEU C 2 10 ? 3.731  -2.913  15.073  1.00 10.81 ? 1917 LEU P C   1 
ATOM   1564 O  O   . LEU C 2 10 ? 4.333  -3.744  15.788  1.00 11.60 ? 1917 LEU P O   1 
ATOM   1565 C  CB  . LEU C 2 10 ? 2.765  -3.809  12.941  1.00 10.92 ? 1917 LEU P CB  1 
ATOM   1566 C  CG  . LEU C 2 10 ? 3.847  -4.890  12.883  1.00 11.92 ? 1917 LEU P CG  1 
ATOM   1567 C  CD1 . LEU C 2 10 ? 3.422  -6.189  13.632  1.00 15.25 ? 1917 LEU P CD1 1 
ATOM   1568 C  CD2 . LEU C 2 10 ? 4.151  -5.175  11.361  1.00 13.28 ? 1917 LEU P CD2 1 
ATOM   1569 N  N   . LYS C 2 11 ? 4.053  -1.640  14.982  1.00 9.61  ? 1918 LYS P N   1 
ATOM   1570 C  CA  . LYS C 2 11 ? 5.321  -1.218  15.579  1.00 11.00 ? 1918 LYS P CA  1 
ATOM   1571 C  C   . LYS C 2 11 ? 5.231  -1.339  17.095  1.00 12.87 ? 1918 LYS P C   1 
ATOM   1572 O  O   . LYS C 2 11 ? 6.242  -1.523  17.761  1.00 13.80 ? 1918 LYS P O   1 
ATOM   1573 C  CB  . LYS C 2 11 ? 5.716  0.205   15.162  1.00 13.73 ? 1918 LYS P CB  1 
ATOM   1574 C  CG  . LYS C 2 11 ? 4.855  1.319   15.795  1.00 17.22 ? 1918 LYS P CG  1 
ATOM   1575 C  CD  . LYS C 2 11 ? 5.221  2.692   15.204  1.00 18.64 ? 1918 LYS P CD  1 
ATOM   1576 C  CE  . LYS C 2 11 ? 4.586  3.852   15.955  1.00 25.98 ? 1918 LYS P CE  1 
ATOM   1577 N  NZ  . LYS C 2 11 ? 5.193  5.116   15.455  1.00 25.78 ? 1918 LYS P NZ  1 
ATOM   1578 N  N   . ASN C 2 12 ? 4.042  -1.210  17.619  1.00 13.76 ? 1919 ASN P N   1 
ATOM   1579 C  CA  . ASN C 2 12 ? 3.845  -1.275  19.069  1.00 14.20 ? 1919 ASN P CA  1 
ATOM   1580 C  C   . ASN C 2 12 ? 3.809  -2.729  19.527  1.00 15.80 ? 1919 ASN P C   1 
ATOM   1581 O  O   . ASN C 2 12 ? 3.889  -3.006  20.740  1.00 17.79 ? 1919 ASN P O   1 
ATOM   1582 C  CB  . ASN C 2 12 ? 2.542  -0.510  19.478  1.00 14.47 ? 1919 ASN P CB  1 
ATOM   1583 C  CG  . ASN C 2 12 ? 2.718  0.977   19.410  1.00 17.62 ? 1919 ASN P CG  1 
ATOM   1584 O  OD1 . ASN C 2 12 ? 3.827  1.470   19.671  1.00 21.96 ? 1919 ASN P OD1 1 
ATOM   1585 N  ND2 . ASN C 2 12 ? 1.656  1.706   19.040  1.00 22.04 ? 1919 ASN P ND2 1 
ATOM   1586 N  N   . LYS C 2 13 ? 3.781  -3.678  18.592  1.00 15.49 ? 1920 LYS P N   1 
ATOM   1587 C  CA  . LYS C 2 13 ? 3.732  -5.112  18.936  1.00 16.82 ? 1920 LYS P CA  1 
ATOM   1588 C  C   . LYS C 2 13 ? 5.071  -5.798  18.849  1.00 19.21 ? 1920 LYS P C   1 
ATOM   1589 O  O   . LYS C 2 13 ? 5.352  -6.802  19.551  1.00 21.35 ? 1920 LYS P O   1 
ATOM   1590 C  CB  . LYS C 2 13 ? 2.785  -5.850  17.978  1.00 17.09 ? 1920 LYS P CB  1 
ATOM   1591 C  CG  . LYS C 2 13 ? 1.398  -5.472  18.125  1.00 18.53 ? 1920 LYS P CG  1 
ATOM   1592 C  CD  . LYS C 2 13 ? 0.531  -6.417  17.288  1.00 21.98 ? 1920 LYS P CD  1 
ATOM   1593 C  CE  . LYS C 2 13 ? -0.889 -5.964  17.278  1.00 23.51 ? 1920 LYS P CE  1 
ATOM   1594 N  NZ  . LYS C 2 13 ? -1.561 -6.107  18.612  1.00 25.69 ? 1920 LYS P NZ  1 
ATOM   1595 N  N   . LEU C 2 14 ? 5.893  -5.305  17.946  1.00 19.62 ? 1921 LEU P N   1 
ATOM   1596 C  CA  . LEU C 2 14 ? 7.154  -5.985  17.676  1.00 21.82 ? 1921 LEU P CA  1 
ATOM   1597 C  C   . LEU C 2 14 ? 8.137  -5.715  18.791  1.00 23.52 ? 1921 LEU P C   1 
ATOM   1598 O  O   . LEU C 2 14 ? 8.676  -4.614  18.852  1.00 28.53 ? 1921 LEU P O   1 
ATOM   1599 C  CB  . LEU C 2 14 ? 7.710  -5.507  16.349  1.00 20.75 ? 1921 LEU P CB  1 
ATOM   1600 C  CG  . LEU C 2 14 ? 6.893  -5.923  15.147  1.00 19.40 ? 1921 LEU P CG  1 
ATOM   1601 C  CD1 . LEU C 2 14 ? 7.509  -5.314  13.872  1.00 23.64 ? 1921 LEU P CD1 1 
ATOM   1602 C  CD2 . LEU C 2 14 ? 6.881  -7.439  15.100  1.00 22.83 ? 1921 LEU P CD2 1 
HETATM 1603 CA CA  . CA  D 3 .  ? 2.072  -19.114 -0.447  1.00 13.86 ? 101  CA  A CA  1 
HETATM 1604 CA CA  . CA  E 3 .  ? -3.005 -12.027 6.810   1.00 11.28 ? 102  CA  A CA  1 
HETATM 1605 CA CA  . CA  F 3 .  ? 3.657  14.709  9.315   1.00 21.19 ? 101  CA  B CA  1 
HETATM 1606 CA CA  . CA  G 3 .  ? 14.137 18.781  7.184   1.00 21.10 ? 102  CA  B CA  1 
HETATM 1607 O  O   . HOH H 4 .  ? -1.987 -7.248  -0.085  1.00 21.64 ? 201  HOH A O   1 
HETATM 1608 O  O   . HOH H 4 .  ? 10.424 -22.765 6.525   1.00 23.74 ? 202  HOH A O   1 
HETATM 1609 O  O   . HOH H 4 .  ? 1.772  -6.733  9.047   1.00 10.98 ? 203  HOH A O   1 
HETATM 1610 O  O   . HOH H 4 .  ? 0.451  -19.601 1.169   1.00 14.18 ? 204  HOH A O   1 
HETATM 1611 O  O   . HOH H 4 .  ? 9.036  -0.150  14.396  1.00 20.20 ? 205  HOH A O   1 
HETATM 1612 O  O   . HOH H 4 .  ? 11.993 -2.425  -11.652 1.00 20.03 ? 206  HOH A O   1 
HETATM 1613 O  O   . HOH H 4 .  ? -0.635 -10.380 -1.480  1.00 16.10 ? 207  HOH A O   1 
HETATM 1614 O  O   . HOH H 4 .  ? 22.060 5.158   18.416  1.00 29.76 ? 208  HOH A O   1 
HETATM 1615 O  O   . HOH H 4 .  ? 11.325 0.294   -8.476  1.00 16.84 ? 209  HOH A O   1 
HETATM 1616 O  O   . HOH H 4 .  ? -0.439 -5.201  9.176   1.00 13.24 ? 210  HOH A O   1 
HETATM 1617 O  O   . HOH H 4 .  ? 0.475  -20.291 7.778   1.00 17.04 ? 211  HOH A O   1 
HETATM 1618 O  O   . HOH H 4 .  ? 3.757  -14.960 -6.662  1.00 21.96 ? 212  HOH A O   1 
HETATM 1619 O  O   . HOH H 4 .  ? 17.840 -10.141 1.399   1.00 13.95 ? 213  HOH A O   1 
HETATM 1620 O  O   . HOH H 4 .  ? 11.827 5.730   13.245  1.00 23.03 ? 214  HOH A O   1 
HETATM 1621 O  O   . HOH H 4 .  ? 6.052  -16.512 -6.996  1.00 24.90 ? 215  HOH A O   1 
HETATM 1622 O  O   . HOH H 4 .  ? -3.604 -11.830 4.463   1.00 12.48 ? 216  HOH A O   1 
HETATM 1623 O  O   . HOH H 4 .  ? 19.739 0.182   -3.617  1.00 22.21 ? 217  HOH A O   1 
HETATM 1624 O  O   . HOH H 4 .  ? 10.500 -23.521 19.981  1.00 28.89 ? 218  HOH A O   1 
HETATM 1625 O  O   . HOH H 4 .  ? 15.851 7.444   18.429  1.00 37.25 ? 219  HOH A O   1 
HETATM 1626 O  O   . HOH H 4 .  ? 20.324 -14.960 11.242  1.00 25.32 ? 220  HOH A O   1 
HETATM 1627 O  O   . HOH H 4 .  ? -4.186 -7.201  6.945   1.00 21.58 ? 221  HOH A O   1 
HETATM 1628 O  O   . HOH H 4 .  ? 1.591  -22.712 -4.545  1.00 31.18 ? 222  HOH A O   1 
HETATM 1629 O  O   . HOH H 4 .  ? -2.780 -12.796 14.167  1.00 24.24 ? 223  HOH A O   1 
HETATM 1630 O  O   . HOH H 4 .  ? 7.838  -18.469 -4.773  1.00 25.87 ? 224  HOH A O   1 
HETATM 1631 O  O   . HOH H 4 .  ? 9.894  2.305   15.548  1.00 34.00 ? 225  HOH A O   1 
HETATM 1632 O  O   . HOH H 4 .  ? 10.899 -12.868 -7.232  1.00 26.10 ? 226  HOH A O   1 
HETATM 1633 O  O   . HOH H 4 .  ? 18.898 -13.042 -1.463  1.00 34.02 ? 227  HOH A O   1 
HETATM 1634 O  O   . HOH H 4 .  ? 12.061 -19.520 -4.579  1.00 38.14 ? 228  HOH A O   1 
HETATM 1635 O  O   . HOH H 4 .  ? 11.437 0.182   -11.120 1.00 21.14 ? 229  HOH A O   1 
HETATM 1636 O  O   . HOH H 4 .  ? 5.327  -23.583 9.395   1.00 31.36 ? 230  HOH A O   1 
HETATM 1637 O  O   . HOH H 4 .  ? 20.332 2.195   11.260  1.00 34.55 ? 231  HOH A O   1 
HETATM 1638 O  O   . HOH H 4 .  ? 14.925 -7.650  15.023  1.00 30.93 ? 232  HOH A O   1 
HETATM 1639 O  O   . HOH H 4 .  ? -5.156 -17.286 0.552   1.00 39.63 ? 233  HOH A O   1 
HETATM 1640 O  O   . HOH H 4 .  ? -5.825 -17.447 4.294   1.00 30.22 ? 234  HOH A O   1 
HETATM 1641 O  O   . HOH H 4 .  ? 15.594 -20.945 5.398   1.00 31.08 ? 235  HOH A O   1 
HETATM 1642 O  O   . HOH H 4 .  ? 16.158 -10.421 -1.886  1.00 30.13 ? 236  HOH A O   1 
HETATM 1643 O  O   . HOH H 4 .  ? 9.288  -1.241  -7.542  1.00 21.27 ? 237  HOH A O   1 
HETATM 1644 O  O   . HOH H 4 .  ? 17.087 -10.299 -4.243  1.00 28.90 ? 238  HOH A O   1 
HETATM 1645 O  O   . HOH H 4 .  ? -1.202 -7.655  14.229  1.00 27.31 ? 239  HOH A O   1 
HETATM 1646 O  O   . HOH H 4 .  ? 15.246 0.715   17.277  1.00 31.84 ? 240  HOH A O   1 
HETATM 1647 O  O   . HOH H 4 .  ? -2.562 -18.774 -5.924  1.00 26.65 ? 241  HOH A O   1 
HETATM 1648 O  O   . HOH H 4 .  ? 16.570 1.872   19.083  1.00 29.68 ? 242  HOH A O   1 
HETATM 1649 O  O   . HOH H 4 .  ? 0.694  -17.159 18.429  1.00 34.39 ? 243  HOH A O   1 
HETATM 1650 O  O   . HOH H 4 .  ? 20.875 -15.852 3.638   1.00 31.10 ? 244  HOH A O   1 
HETATM 1651 O  O   . HOH I 4 .  ? -4.078 20.507  -5.142  1.00 19.71 ? 201  HOH B O   1 
HETATM 1652 O  O   . HOH I 4 .  ? 17.066 6.565   -5.662  1.00 19.22 ? 202  HOH B O   1 
HETATM 1653 O  O   . HOH I 4 .  ? 13.141 21.150  -4.155  1.00 28.30 ? 203  HOH B O   1 
HETATM 1654 O  O   . HOH I 4 .  ? 21.858 9.833   4.757   1.00 27.37 ? 204  HOH B O   1 
HETATM 1655 O  O   . HOH I 4 .  ? 5.859  8.086   13.641  1.00 24.06 ? 205  HOH B O   1 
HETATM 1656 O  O   . HOH I 4 .  ? 2.122  8.742   4.620   1.00 19.07 ? 206  HOH B O   1 
HETATM 1657 O  O   . HOH I 4 .  ? 12.538 19.566  7.279   1.00 23.74 ? 207  HOH B O   1 
HETATM 1658 O  O   . HOH I 4 .  ? 0.592  20.138  1.099   1.00 24.71 ? 208  HOH B O   1 
HETATM 1659 O  O   . HOH I 4 .  ? 11.182 11.013  11.490  1.00 24.04 ? 209  HOH B O   1 
HETATM 1660 O  O   . HOH I 4 .  ? 4.203  9.650   12.530  1.00 30.64 ? 210  HOH B O   1 
HETATM 1661 O  O   . HOH I 4 .  ? -1.008 -0.374  -9.624  1.00 23.84 ? 211  HOH B O   1 
HETATM 1662 O  O   . HOH I 4 .  ? 6.649  6.872   -15.307 1.00 45.28 ? 212  HOH B O   1 
HETATM 1663 O  O   . HOH I 4 .  ? 20.957 3.391   6.544   1.00 22.08 ? 213  HOH B O   1 
HETATM 1664 O  O   . HOH I 4 .  ? 19.007 13.747  9.505   1.00 27.52 ? 214  HOH B O   1 
HETATM 1665 O  O   . HOH I 4 .  ? 8.396  8.526   12.228  1.00 20.26 ? 215  HOH B O   1 
HETATM 1666 O  O   . HOH I 4 .  ? 5.314  7.987   -13.560 1.00 31.31 ? 216  HOH B O   1 
HETATM 1667 O  O   . HOH I 4 .  ? 1.560  19.031  3.490   1.00 34.46 ? 217  HOH B O   1 
HETATM 1668 O  O   . HOH I 4 .  ? 5.218  14.312  10.912  1.00 24.25 ? 218  HOH B O   1 
HETATM 1669 O  O   . HOH I 4 .  ? 11.800 13.489  -11.989 1.00 36.32 ? 219  HOH B O   1 
HETATM 1670 O  O   . HOH I 4 .  ? -0.375 -5.036  -4.275  1.00 24.02 ? 220  HOH B O   1 
HETATM 1671 O  O   . HOH I 4 .  ? 21.833 16.379  -2.057  1.00 30.60 ? 221  HOH B O   1 
HETATM 1672 O  O   . HOH I 4 .  ? 18.935 -3.445  7.334   1.00 26.92 ? 222  HOH B O   1 
HETATM 1673 O  O   . HOH I 4 .  ? 24.605 -3.436  5.595   1.00 27.25 ? 223  HOH B O   1 
HETATM 1674 O  O   . HOH I 4 .  ? -0.682 1.644   -3.693  1.00 24.11 ? 224  HOH B O   1 
HETATM 1675 O  O   . HOH I 4 .  ? 6.069  -4.828  -10.970 1.00 38.97 ? 225  HOH B O   1 
HETATM 1676 O  O   . HOH I 4 .  ? 10.368 13.016  13.514  1.00 28.58 ? 226  HOH B O   1 
HETATM 1677 O  O   . HOH I 4 .  ? 2.569  21.500  4.674   1.00 42.13 ? 227  HOH B O   1 
HETATM 1678 O  O   . HOH I 4 .  ? 11.786 21.825  10.005  1.00 26.87 ? 228  HOH B O   1 
HETATM 1679 O  O   . HOH I 4 .  ? 26.144 -5.715  0.783   1.00 23.64 ? 229  HOH B O   1 
HETATM 1680 O  O   . HOH I 4 .  ? -2.613 -2.077  -11.951 1.00 31.49 ? 230  HOH B O   1 
HETATM 1681 O  O   . HOH I 4 .  ? 4.127  23.539  -11.483 1.00 35.46 ? 231  HOH B O   1 
HETATM 1682 O  O   . HOH I 4 .  ? 21.508 7.796   0.750   1.00 31.90 ? 232  HOH B O   1 
HETATM 1683 O  O   . HOH I 4 .  ? 6.092  23.606  -2.676  1.00 28.18 ? 233  HOH B O   1 
HETATM 1684 O  O   . HOH I 4 .  ? 0.093  24.241  -10.255 1.00 23.64 ? 234  HOH B O   1 
HETATM 1685 O  O   . HOH J 4 .  ? 2.281  8.400   11.081  1.00 30.09 ? 2001 HOH P O   1 
HETATM 1686 O  O   . HOH J 4 .  ? -0.829 -3.839  11.464  1.00 15.24 ? 2002 HOH P O   1 
HETATM 1687 O  O   . HOH J 4 .  ? -1.531 -4.548  6.631   1.00 15.50 ? 2003 HOH P O   1 
HETATM 1688 O  O   . HOH J 4 .  ? -2.929 2.021   14.971  1.00 25.60 ? 2004 HOH P O   1 
HETATM 1689 O  O   . HOH J 4 .  ? 0.753  6.384   15.665  1.00 28.33 ? 2005 HOH P O   1 
HETATM 1690 O  O   . HOH J 4 .  ? 8.615  -1.849  16.668  1.00 29.66 ? 2006 HOH P O   1 
HETATM 1691 O  O   . HOH J 4 .  ? 3.469  6.867   16.970  1.00 27.51 ? 2007 HOH P O   1 
HETATM 1692 O  O   . HOH J 4 .  ? 3.113  4.649   18.473  1.00 29.03 ? 2008 HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1    ?    ?   ?   A . n 
A 1 2  ALA 2  2    2    ALA ALA A . n 
A 1 3  CYS 3  3    3    CYS CYS A . n 
A 1 4  PRO 4  4    4    PRO PRO A . n 
A 1 5  LEU 5  5    5    LEU LEU A . n 
A 1 6  GLU 6  6    6    GLU GLU A . n 
A 1 7  LYS 7  7    7    LYS LYS A . n 
A 1 8  ALA 8  8    8    ALA ALA A . n 
A 1 9  LEU 9  9    9    LEU LEU A . n 
A 1 10 ASP 10 10   10   ASP ASP A . n 
A 1 11 VAL 11 11   11   VAL VAL A . n 
A 1 12 MET 12 12   12   MET MET A . n 
A 1 13 VAL 13 13   13   VAL VAL A . n 
A 1 14 SER 14 14   14   SER SER A . n 
A 1 15 THR 15 15   15   THR THR A . n 
A 1 16 PHE 16 16   16   PHE PHE A . n 
A 1 17 HIS 17 17   17   HIS HIS A . n 
A 1 18 LYS 18 18   18   LYS LYS A . n 
A 1 19 TYR 19 19   19   TYR TYR A . n 
A 1 20 SER 20 20   20   SER SER A . n 
A 1 21 GLY 21 21   21   GLY GLY A . n 
A 1 22 LYS 22 22   22   LYS LYS A . n 
A 1 23 GLU 23 23   23   GLU GLU A . n 
A 1 24 GLY 24 24   24   GLY GLY A . n 
A 1 25 ASP 25 25   25   ASP ASP A . n 
A 1 26 LYS 26 26   26   LYS LYS A . n 
A 1 27 PHE 27 27   27   PHE PHE A . n 
A 1 28 LYS 28 28   28   LYS LYS A . n 
A 1 29 LEU 29 29   29   LEU LEU A . n 
A 1 30 ASN 30 30   30   ASN ASN A . n 
A 1 31 LYS 31 31   31   LYS LYS A . n 
A 1 32 SER 32 32   32   SER SER A . n 
A 1 33 GLU 33 33   33   GLU GLU A . n 
A 1 34 LEU 34 34   34   LEU LEU A . n 
A 1 35 LYS 35 35   35   LYS LYS A . n 
A 1 36 GLU 36 36   36   GLU GLU A . n 
A 1 37 LEU 37 37   37   LEU LEU A . n 
A 1 38 LEU 38 38   38   LEU LEU A . n 
A 1 39 THR 39 39   39   THR THR A . n 
A 1 40 ARG 40 40   40   ARG ARG A . n 
A 1 41 GLU 41 41   41   GLU GLU A . n 
A 1 42 LEU 42 42   42   LEU LEU A . n 
A 1 43 PRO 43 43   43   PRO PRO A . n 
A 1 44 SER 44 44   44   SER SER A . n 
A 1 45 PHE 45 45   45   PHE PHE A . n 
A 1 46 LEU 46 46   46   LEU LEU A . n 
A 1 47 GLY 47 47   ?    ?   ?   A . n 
A 1 48 LYS 48 48   ?    ?   ?   A . n 
A 1 49 ARG 49 49   ?    ?   ?   A . n 
A 1 50 THR 50 50   50   THR THR A . n 
A 1 51 ASP 51 51   51   ASP ASP A . n 
A 1 52 GLU 52 52   52   GLU GLU A . n 
A 1 53 ALA 53 53   53   ALA ALA A . n 
A 1 54 ALA 54 54   54   ALA ALA A . n 
A 1 55 PHE 55 55   55   PHE PHE A . n 
A 1 56 GLN 56 56   56   GLN GLN A . n 
A 1 57 LYS 57 57   57   LYS LYS A . n 
A 1 58 LEU 58 58   58   LEU LEU A . n 
A 1 59 MET 59 59   59   MET MET A . n 
A 1 60 SER 60 60   60   SER SER A . n 
A 1 61 ASN 61 61   61   ASN ASN A . n 
A 1 62 LEU 62 62   62   LEU LEU A . n 
A 1 63 ASP 63 63   63   ASP ASP A . n 
A 1 64 SER 64 64   64   SER SER A . n 
A 1 65 ASN 65 65   65   ASN ASN A . n 
A 1 66 ARG 66 66   66   ARG ARG A . n 
A 1 67 ASP 67 67   67   ASP ASP A . n 
A 1 68 ASN 68 68   68   ASN ASN A . n 
A 1 69 GLU 69 69   69   GLU GLU A . n 
A 1 70 VAL 70 70   70   VAL VAL A . n 
A 1 71 ASP 71 71   71   ASP ASP A . n 
A 1 72 PHE 72 72   72   PHE PHE A . n 
A 1 73 GLN 73 73   73   GLN GLN A . n 
A 1 74 GLU 74 74   74   GLU GLU A . n 
A 1 75 TYR 75 75   75   TYR TYR A . n 
A 1 76 CYS 76 76   76   CYS CYS A . n 
A 1 77 VAL 77 77   77   VAL VAL A . n 
A 1 78 PHE 78 78   78   PHE PHE A . n 
A 1 79 LEU 79 79   79   LEU LEU A . n 
A 1 80 SER 80 80   80   SER SER A . n 
A 1 81 CYS 81 81   81   CYS CYS A . n 
A 1 82 ILE 82 82   82   ILE ILE A . n 
A 1 83 ALA 83 83   83   ALA ALA A . n 
A 1 84 MET 84 84   84   MET MET A . n 
A 1 85 MET 85 85   85   MET MET A . n 
A 1 86 CYS 86 86   86   CYS CYS A . n 
A 1 87 ASN 87 87   87   ASN ASN A . n 
A 1 88 GLU 88 88   88   GLU GLU A . n 
A 1 89 PHE 89 89   89   PHE PHE A . n 
A 1 90 PHE 90 90   90   PHE PHE A . n 
A 1 91 GLU 91 91   91   GLU GLU A . n 
A 1 92 GLY 92 92   92   GLY GLY A . n 
A 1 93 PHE 93 93   ?    ?   ?   A . n 
B 1 1  MET 1  1    ?    ?   ?   B . n 
B 1 2  ALA 2  2    2    ALA ALA B . n 
B 1 3  CYS 3  3    3    CYS CYS B . n 
B 1 4  PRO 4  4    4    PRO PRO B . n 
B 1 5  LEU 5  5    5    LEU LEU B . n 
B 1 6  GLU 6  6    6    GLU GLU B . n 
B 1 7  LYS 7  7    7    LYS LYS B . n 
B 1 8  ALA 8  8    8    ALA ALA B . n 
B 1 9  LEU 9  9    9    LEU LEU B . n 
B 1 10 ASP 10 10   10   ASP ASP B . n 
B 1 11 VAL 11 11   11   VAL VAL B . n 
B 1 12 MET 12 12   12   MET MET B . n 
B 1 13 VAL 13 13   13   VAL VAL B . n 
B 1 14 SER 14 14   14   SER SER B . n 
B 1 15 THR 15 15   15   THR THR B . n 
B 1 16 PHE 16 16   16   PHE PHE B . n 
B 1 17 HIS 17 17   17   HIS HIS B . n 
B 1 18 LYS 18 18   18   LYS LYS B . n 
B 1 19 TYR 19 19   19   TYR TYR B . n 
B 1 20 SER 20 20   20   SER SER B . n 
B 1 21 GLY 21 21   21   GLY GLY B . n 
B 1 22 LYS 22 22   22   LYS LYS B . n 
B 1 23 GLU 23 23   23   GLU GLU B . n 
B 1 24 GLY 24 24   24   GLY GLY B . n 
B 1 25 ASP 25 25   25   ASP ASP B . n 
B 1 26 LYS 26 26   26   LYS LYS B . n 
B 1 27 PHE 27 27   27   PHE PHE B . n 
B 1 28 LYS 28 28   28   LYS LYS B . n 
B 1 29 LEU 29 29   29   LEU LEU B . n 
B 1 30 ASN 30 30   30   ASN ASN B . n 
B 1 31 LYS 31 31   31   LYS LYS B . n 
B 1 32 SER 32 32   32   SER SER B . n 
B 1 33 GLU 33 33   33   GLU GLU B . n 
B 1 34 LEU 34 34   34   LEU LEU B . n 
B 1 35 LYS 35 35   35   LYS LYS B . n 
B 1 36 GLU 36 36   36   GLU GLU B . n 
B 1 37 LEU 37 37   37   LEU LEU B . n 
B 1 38 LEU 38 38   38   LEU LEU B . n 
B 1 39 THR 39 39   39   THR THR B . n 
B 1 40 ARG 40 40   40   ARG ARG B . n 
B 1 41 GLU 41 41   41   GLU GLU B . n 
B 1 42 LEU 42 42   42   LEU LEU B . n 
B 1 43 PRO 43 43   43   PRO PRO B . n 
B 1 44 SER 44 44   44   SER SER B . n 
B 1 45 PHE 45 45   45   PHE PHE B . n 
B 1 46 LEU 46 46   46   LEU LEU B . n 
B 1 47 GLY 47 47   47   GLY GLY B . n 
B 1 48 LYS 48 48   48   LYS LYS B . n 
B 1 49 ARG 49 49   49   ARG ARG B . n 
B 1 50 THR 50 50   50   THR THR B . n 
B 1 51 ASP 51 51   51   ASP ASP B . n 
B 1 52 GLU 52 52   52   GLU GLU B . n 
B 1 53 ALA 53 53   53   ALA ALA B . n 
B 1 54 ALA 54 54   54   ALA ALA B . n 
B 1 55 PHE 55 55   55   PHE PHE B . n 
B 1 56 GLN 56 56   56   GLN GLN B . n 
B 1 57 LYS 57 57   57   LYS LYS B . n 
B 1 58 LEU 58 58   58   LEU LEU B . n 
B 1 59 MET 59 59   59   MET MET B . n 
B 1 60 SER 60 60   60   SER SER B . n 
B 1 61 ASN 61 61   61   ASN ASN B . n 
B 1 62 LEU 62 62   62   LEU LEU B . n 
B 1 63 ASP 63 63   63   ASP ASP B . n 
B 1 64 SER 64 64   64   SER SER B . n 
B 1 65 ASN 65 65   65   ASN ASN B . n 
B 1 66 ARG 66 66   66   ARG ARG B . n 
B 1 67 ASP 67 67   67   ASP ASP B . n 
B 1 68 ASN 68 68   68   ASN ASN B . n 
B 1 69 GLU 69 69   69   GLU GLU B . n 
B 1 70 VAL 70 70   70   VAL VAL B . n 
B 1 71 ASP 71 71   71   ASP ASP B . n 
B 1 72 PHE 72 72   72   PHE PHE B . n 
B 1 73 GLN 73 73   73   GLN GLN B . n 
B 1 74 GLU 74 74   74   GLU GLU B . n 
B 1 75 TYR 75 75   75   TYR TYR B . n 
B 1 76 CYS 76 76   76   CYS CYS B . n 
B 1 77 VAL 77 77   77   VAL VAL B . n 
B 1 78 PHE 78 78   78   PHE PHE B . n 
B 1 79 LEU 79 79   79   LEU LEU B . n 
B 1 80 SER 80 80   80   SER SER B . n 
B 1 81 CYS 81 81   81   CYS CYS B . n 
B 1 82 ILE 82 82   82   ILE ILE B . n 
B 1 83 ALA 83 83   83   ALA ALA B . n 
B 1 84 MET 84 84   84   MET MET B . n 
B 1 85 MET 85 85   85   MET MET B . n 
B 1 86 CYS 86 86   86   CYS CYS B . n 
B 1 87 ASN 87 87   87   ASN ASN B . n 
B 1 88 GLU 88 88   88   GLU GLU B . n 
B 1 89 PHE 89 89   89   PHE PHE B . n 
B 1 90 PHE 90 90   90   PHE PHE B . n 
B 1 91 GLU 91 91   91   GLU GLU B . n 
B 1 92 GLY 92 92   92   GLY GLY B . n 
B 1 93 PHE 93 93   ?    ?   ?   B . n 
C 2 1  ASP 1  1908 1908 ASP ASP P . n 
C 2 2  ALA 2  1909 1909 ALA ALA P . n 
C 2 3  MET 3  1910 1910 MET MET P . n 
C 2 4  ASN 4  1911 1911 ASN ASN P . n 
C 2 5  ARG 5  1912 1912 ARG ARG P . n 
C 2 6  GLU 6  1913 1913 GLU GLU P . n 
C 2 7  VAL 7  1914 1914 VAL VAL P . n 
C 2 8  SER 8  1915 1915 SER SER P . n 
C 2 9  SER 9  1916 1916 SER SER P . n 
C 2 10 LEU 10 1917 1917 LEU LEU P . n 
C 2 11 LYS 11 1918 1918 LYS LYS P . n 
C 2 12 ASN 12 1919 1919 ASN ASN P . n 
C 2 13 LYS 13 1920 1920 LYS LYS P . n 
C 2 14 LEU 14 1921 1921 LEU LEU P . n 
C 2 15 ARG 15 1922 ?    ?   ?   P . n 
C 2 16 ARG 16 1923 ?    ?   ?   P . n 
# 
loop_
_pdbx_SG_project.id 
_pdbx_SG_project.project_name 
_pdbx_SG_project.full_name_of_center 
_pdbx_SG_project.initial_of_center 
1 PSI:Biology 'New York Structural Genomics Research Consortium' NYSGRC 
2 PSI:Biology 'Atoms-to-Animals: The Immune Function Network'    IFN    
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4620 ? 
1 MORE         -99  ? 
1 'SSA (A^2)'  9710 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? I HOH .  ? B HOH 218 ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OD1 ? B ASP 67 ? B ASP 67  ? 1_555 80.6  ? 
2  O   ? I HOH .  ? B HOH 218 ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OE1 ? B GLU 74 ? B GLU 74  ? 1_555 92.7  ? 
3  OD1 ? B ASP 67 ? B ASP 67  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OE1 ? B GLU 74 ? B GLU 74  ? 1_555 162.3 ? 
4  O   ? I HOH .  ? B HOH 218 ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OD1 ? B ASN 65 ? B ASN 65  ? 1_555 87.5  ? 
5  OD1 ? B ASP 67 ? B ASP 67  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OD1 ? B ASN 65 ? B ASN 65  ? 1_555 73.9  ? 
6  OE1 ? B GLU 74 ? B GLU 74  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OD1 ? B ASN 65 ? B ASN 65  ? 1_555 122.5 ? 
7  O   ? I HOH .  ? B HOH 218 ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OD1 ? B ASP 63 ? B ASP 63  ? 1_555 161.9 ? 
8  OD1 ? B ASP 67 ? B ASP 67  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OD1 ? B ASP 63 ? B ASP 63  ? 1_555 82.8  ? 
9  OE1 ? B GLU 74 ? B GLU 74  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OD1 ? B ASP 63 ? B ASP 63  ? 1_555 105.3 ? 
10 OD1 ? B ASN 65 ? B ASN 65  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OD1 ? B ASP 63 ? B ASP 63  ? 1_555 81.1  ? 
11 O   ? I HOH .  ? B HOH 218 ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 O   ? B GLU 69 ? B GLU 69  ? 1_555 107.3 ? 
12 OD1 ? B ASP 67 ? B ASP 67  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 O   ? B GLU 69 ? B GLU 69  ? 1_555 86.6  ? 
13 OE1 ? B GLU 74 ? B GLU 74  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 O   ? B GLU 69 ? B GLU 69  ? 1_555 79.8  ? 
14 OD1 ? B ASN 65 ? B ASN 65  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 O   ? B GLU 69 ? B GLU 69  ? 1_555 153.4 ? 
15 OD1 ? B ASP 63 ? B ASP 63  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 O   ? B GLU 69 ? B GLU 69  ? 1_555 78.7  ? 
16 O   ? I HOH .  ? B HOH 218 ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74  ? 1_555 104.0 ? 
17 OD1 ? B ASP 67 ? B ASP 67  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74  ? 1_555 146.4 ? 
18 OE1 ? B GLU 74 ? B GLU 74  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74  ? 1_555 51.1  ? 
19 OD1 ? B ASN 65 ? B ASN 65  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74  ? 1_555 73.1  ? 
20 OD1 ? B ASP 63 ? B ASP 63  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74  ? 1_555 86.1  ? 
21 O   ? B GLU 69 ? B GLU 69  ? 1_555 CA ? F CA . ? B CA 101 ? 1_555 OE2 ? B GLU 74 ? B GLU 74  ? 1_555 122.1 ? 
22 O   ? A GLU 69 ? A GLU 69  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASN 65 ? A ASN 65  ? 1_555 154.8 ? 
23 O   ? A GLU 69 ? A GLU 69  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASP 63 ? A ASP 63  ? 1_555 81.3  ? 
24 OD1 ? A ASN 65 ? A ASN 65  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASP 63 ? A ASP 63  ? 1_555 82.9  ? 
25 O   ? A GLU 69 ? A GLU 69  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASP 67 ? A ASP 67  ? 1_555 80.9  ? 
26 OD1 ? A ASN 65 ? A ASN 65  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASP 67 ? A ASP 67  ? 1_555 77.8  ? 
27 OD1 ? A ASP 63 ? A ASP 63  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OD1 ? A ASP 67 ? A ASP 67  ? 1_555 83.5  ? 
28 O   ? A GLU 69 ? A GLU 69  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 98.9  ? 
29 OD1 ? A ASN 65 ? A ASN 65  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 89.2  ? 
30 OD1 ? A ASP 63 ? A ASP 63  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 159.5 ? 
31 OD1 ? A ASP 67 ? A ASP 67  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 76.4  ? 
32 O   ? A GLU 69 ? A GLU 69  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74  ? 1_555 81.0  ? 
33 OD1 ? A ASN 65 ? A ASN 65  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74  ? 1_555 124.0 ? 
34 OD1 ? A ASP 63 ? A ASP 63  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74  ? 1_555 118.4 ? 
35 OD1 ? A ASP 67 ? A ASP 67  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74  ? 1_555 148.9 ? 
36 O   ? H HOH .  ? A HOH 216 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE1 ? A GLU 74 ? A GLU 74  ? 1_555 81.7  ? 
37 O   ? A GLU 69 ? A GLU 69  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74  ? 1_555 124.6 ? 
38 OD1 ? A ASN 65 ? A ASN 65  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74  ? 1_555 76.3  ? 
39 OD1 ? A ASP 63 ? A ASP 63  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74  ? 1_555 95.1  ? 
40 OD1 ? A ASP 67 ? A ASP 67  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74  ? 1_555 154.1 ? 
41 O   ? H HOH .  ? A HOH 216 ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74  ? 1_555 101.4 ? 
42 OE1 ? A GLU 74 ? A GLU 74  ? 1_555 CA ? E CA . ? A CA 102 ? 1_555 OE2 ? A GLU 74 ? A GLU 74  ? 1_555 52.3  ? 
43 O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? H HOH .  ? A HOH 204 ? 1_555 81.9  ? 
44 O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A LYS 28 ? A LYS 28  ? 1_555 162.7 ? 
45 O   ? H HOH .  ? A HOH 204 ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A LYS 28 ? A LYS 28  ? 1_555 84.6  ? 
46 O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A SER 20 ? A SER 20  ? 1_555 103.8 ? 
47 O   ? H HOH .  ? A HOH 204 ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A SER 20 ? A SER 20  ? 1_555 167.7 ? 
48 O   ? A LYS 28 ? A LYS 28  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A SER 20 ? A SER 20  ? 1_555 87.6  ? 
49 O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 111.0 ? 
50 O   ? H HOH .  ? A HOH 204 ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 85.9  ? 
51 O   ? A LYS 28 ? A LYS 28  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 78.6  ? 
52 O   ? A SER 20 ? A SER 20  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 101.9 ? 
53 O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A ASP 25 ? A ASP 25  ? 1_555 86.5  ? 
54 O   ? H HOH .  ? A HOH 204 ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A ASP 25 ? A ASP 25  ? 1_555 89.7  ? 
55 O   ? A LYS 28 ? A LYS 28  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A ASP 25 ? A ASP 25  ? 1_555 82.7  ? 
56 O   ? A SER 20 ? A SER 20  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A ASP 25 ? A ASP 25  ? 1_555 79.9  ? 
57 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 O   ? A ASP 25 ? A ASP 25  ? 1_555 161.1 ? 
58 O   ? A GLU 23 ? A GLU 23  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 75.1  ? 
59 O   ? H HOH .  ? A HOH 204 ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 115.6 ? 
60 O   ? A LYS 28 ? A LYS 28  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 120.8 ? 
61 O   ? A SER 20 ? A SER 20  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 76.6  ? 
62 OE1 ? A GLU 33 ? A GLU 33  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 51.1  ? 
63 O   ? A ASP 25 ? A ASP 25  ? 1_555 CA ? D CA . ? A CA 101 ? 1_555 OE2 ? A GLU 33 ? A GLU 33  ? 1_555 145.4 ? 
64 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 O   ? B ASP 25 ? B ASP 25  ? 1_555 79.6  ? 
65 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 103.5 ? 
66 O   ? B ASP 25 ? B ASP 25  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 155.7 ? 
67 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 O   ? B GLU 23 ? B GLU 23  ? 1_555 103.4 ? 
68 O   ? B ASP 25 ? B ASP 25  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 O   ? B GLU 23 ? B GLU 23  ? 1_555 85.2  ? 
69 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 O   ? B GLU 23 ? B GLU 23  ? 1_555 116.8 ? 
70 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 O   ? B LYS 28 ? B LYS 28  ? 1_555 88.9  ? 
71 O   ? B ASP 25 ? B ASP 25  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 O   ? B LYS 28 ? B LYS 28  ? 1_555 79.8  ? 
72 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 O   ? B LYS 28 ? B LYS 28  ? 1_555 76.2  ? 
73 O   ? B GLU 23 ? B GLU 23  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 O   ? B LYS 28 ? B LYS 28  ? 1_555 158.5 ? 
74 O   ? B SER 20 ? B SER 20  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 81.8  ? 
75 O   ? B ASP 25 ? B ASP 25  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 150.3 ? 
76 OE1 ? B GLU 33 ? B GLU 33  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 52.3  ? 
77 O   ? B GLU 23 ? B GLU 23  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 76.8  ? 
78 O   ? B LYS 28 ? B LYS 28  ? 1_555 CA ? G CA . ? B CA 102 ? 1_555 OE2 ? B GLU 33 ? B GLU 33  ? 1_555 122.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-07-11 
2 'Structure model' 1 1 2012-07-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 2 'Structure model' 'Structure summary'   
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .       ?                program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 REFMAC      .       ?                program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.11    'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 ADSC        Quantum ?                ?       ?                    ?                        'data collection' ? ?          ? 
5 HKL-2000    .       ?                ?       ?                    ?                        'data reduction'  ? ?          ? 
6 MOLREP      .       ?                ?       ?                    ?                        phasing           ? ?          ? 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     25 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -53.53 
_pdbx_validate_torsion.psi             109.18 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B LYS 48   ? CG  ? B LYS 48 CG  
2  1 Y 1 B LYS 48   ? CD  ? B LYS 48 CD  
3  1 Y 1 B LYS 48   ? CE  ? B LYS 48 CE  
4  1 Y 1 B LYS 48   ? NZ  ? B LYS 48 NZ  
5  1 Y 1 B ARG 49   ? CG  ? B ARG 49 CG  
6  1 Y 1 B ARG 49   ? CD  ? B ARG 49 CD  
7  1 Y 1 B ARG 49   ? NE  ? B ARG 49 NE  
8  1 Y 1 B ARG 49   ? CZ  ? B ARG 49 CZ  
9  1 Y 1 B ARG 49   ? NH1 ? B ARG 49 NH1 
10 1 Y 1 B ARG 49   ? NH2 ? B ARG 49 NH2 
11 1 Y 1 P ARG 1912 ? CG  ? C ARG 5  CG  
12 1 Y 1 P ARG 1912 ? CD  ? C ARG 5  CD  
13 1 Y 1 P ARG 1912 ? NE  ? C ARG 5  NE  
14 1 Y 1 P ARG 1912 ? CZ  ? C ARG 5  CZ  
15 1 Y 1 P ARG 1912 ? NH1 ? C ARG 5  NH1 
16 1 Y 1 P ARG 1912 ? NH2 ? C ARG 5  NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1    ? A MET 1  
2 1 Y 1 A GLY 47   ? A GLY 47 
3 1 Y 1 A LYS 48   ? A LYS 48 
4 1 Y 1 A ARG 49   ? A ARG 49 
5 1 Y 1 A PHE 93   ? A PHE 93 
6 1 Y 1 B MET 1    ? B MET 1  
7 1 Y 1 B PHE 93   ? B PHE 93 
8 1 Y 1 P ARG 1922 ? C ARG 15 
9 1 Y 1 P ARG 1923 ? C ARG 16 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CALCIUM ION' CA  
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 CA  1  101  102 CA  CA  A . 
E 3 CA  1  102  103 CA  CA  A . 
F 3 CA  1  101  103 CA  CA  B . 
G 3 CA  1  102  104 CA  CA  B . 
H 4 HOH 1  201  1   HOH HOH A . 
H 4 HOH 2  202  2   HOH HOH A . 
H 4 HOH 3  203  4   HOH HOH A . 
H 4 HOH 4  204  5   HOH HOH A . 
H 4 HOH 5  205  6   HOH HOH A . 
H 4 HOH 6  206  7   HOH HOH A . 
H 4 HOH 7  207  10  HOH HOH A . 
H 4 HOH 8  208  11  HOH HOH A . 
H 4 HOH 9  209  12  HOH HOH A . 
H 4 HOH 10 210  14  HOH HOH A . 
H 4 HOH 11 211  15  HOH HOH A . 
H 4 HOH 12 212  16  HOH HOH A . 
H 4 HOH 13 213  20  HOH HOH A . 
H 4 HOH 14 214  21  HOH HOH A . 
H 4 HOH 15 215  24  HOH HOH A . 
H 4 HOH 16 216  26  HOH HOH A . 
H 4 HOH 17 217  27  HOH HOH A . 
H 4 HOH 18 218  29  HOH HOH A . 
H 4 HOH 19 219  30  HOH HOH A . 
H 4 HOH 20 220  31  HOH HOH A . 
H 4 HOH 21 221  32  HOH HOH A . 
H 4 HOH 22 222  37  HOH HOH A . 
H 4 HOH 23 223  43  HOH HOH A . 
H 4 HOH 24 224  48  HOH HOH A . 
H 4 HOH 25 225  49  HOH HOH A . 
H 4 HOH 26 226  50  HOH HOH A . 
H 4 HOH 27 227  52  HOH HOH A . 
H 4 HOH 28 228  54  HOH HOH A . 
H 4 HOH 29 229  57  HOH HOH A . 
H 4 HOH 30 230  58  HOH HOH A . 
H 4 HOH 31 231  59  HOH HOH A . 
H 4 HOH 32 232  62  HOH HOH A . 
H 4 HOH 33 233  66  HOH HOH A . 
H 4 HOH 34 234  67  HOH HOH A . 
H 4 HOH 35 235  69  HOH HOH A . 
H 4 HOH 36 236  70  HOH HOH A . 
H 4 HOH 37 237  80  HOH HOH A . 
H 4 HOH 38 238  86  HOH HOH A . 
H 4 HOH 39 239  92  HOH HOH A . 
H 4 HOH 40 240  94  HOH HOH A . 
H 4 HOH 41 241  97  HOH HOH A . 
H 4 HOH 42 242  102 HOH HOH A . 
H 4 HOH 43 243  105 HOH HOH A . 
H 4 HOH 44 244  106 HOH HOH A . 
I 4 HOH 1  201  3   HOH HOH B . 
I 4 HOH 2  202  9   HOH HOH B . 
I 4 HOH 3  203  13  HOH HOH B . 
I 4 HOH 4  204  18  HOH HOH B . 
I 4 HOH 5  205  19  HOH HOH B . 
I 4 HOH 6  206  22  HOH HOH B . 
I 4 HOH 7  207  23  HOH HOH B . 
I 4 HOH 8  208  25  HOH HOH B . 
I 4 HOH 9  209  33  HOH HOH B . 
I 4 HOH 10 210  35  HOH HOH B . 
I 4 HOH 11 211  38  HOH HOH B . 
I 4 HOH 12 212  40  HOH HOH B . 
I 4 HOH 13 213  41  HOH HOH B . 
I 4 HOH 14 214  42  HOH HOH B . 
I 4 HOH 15 215  44  HOH HOH B . 
I 4 HOH 16 216  45  HOH HOH B . 
I 4 HOH 17 217  53  HOH HOH B . 
I 4 HOH 18 218  56  HOH HOH B . 
I 4 HOH 19 219  60  HOH HOH B . 
I 4 HOH 20 220  61  HOH HOH B . 
I 4 HOH 21 221  63  HOH HOH B . 
I 4 HOH 22 222  68  HOH HOH B . 
I 4 HOH 23 223  71  HOH HOH B . 
I 4 HOH 24 224  76  HOH HOH B . 
I 4 HOH 25 225  78  HOH HOH B . 
I 4 HOH 26 226  88  HOH HOH B . 
I 4 HOH 27 227  89  HOH HOH B . 
I 4 HOH 28 228  90  HOH HOH B . 
I 4 HOH 29 229  93  HOH HOH B . 
I 4 HOH 30 230  95  HOH HOH B . 
I 4 HOH 31 231  98  HOH HOH B . 
I 4 HOH 32 232  104 HOH HOH B . 
I 4 HOH 33 233  107 HOH HOH B . 
I 4 HOH 34 234  108 HOH HOH B . 
J 4 HOH 1  2001 51  HOH HOH P . 
J 4 HOH 2  2002 82  HOH HOH P . 
J 4 HOH 3  2003 83  HOH HOH P . 
J 4 HOH 4  2004 91  HOH HOH P . 
J 4 HOH 5  2005 99  HOH HOH P . 
J 4 HOH 6  2006 100 HOH HOH P . 
J 4 HOH 7  2007 101 HOH HOH P . 
J 4 HOH 8  2008 109 HOH HOH P . 
#