data_4EY4
# 
_entry.id   4EY4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4EY4         
RCSB  RCSB072214   
WWPDB D_1000072214 
# 
_pdbx_database_status.entry_id                        4EY4 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-05-01 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheung, J.'    1 
'Rudolph, M.'   2 
'Burshteyn, F.' 3 
'Cassidy, M.'   4 
'Gary, E.'      5 
'Love, J.'      6 
'Height, J.'    7 
'Franklin, M.'  8 
# 
_citation.id                        primary 
_citation.title                     'Structures of human acetylcholinesterase in complex with pharmacologically important ligands.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            55 
_citation.page_first                10282 
_citation.page_last                 10286 
_citation.year                      2012 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23035744 
_citation.pdbx_database_id_DOI      10.1021/jm300871x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cheung, J.'     1 ? 
primary 'Rudolph, M.J.'  2 ? 
primary 'Burshteyn, F.'  3 ? 
primary 'Cassidy, M.S.'  4 ? 
primary 'Gary, E.N.'     5 ? 
primary 'Love, J.'       6 ? 
primary 'Franklin, M.C.' 7 ? 
primary 'Height, J.J.'   8 ? 
# 
_cell.entry_id           4EY4 
_cell.length_a           106.178 
_cell.length_b           106.178 
_cell.length_c           324.388 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4EY4 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 ? 'UNP Residues 33-574' ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ?                     ? 
3 non-polymer syn 1,2-ETHANEDIOL 62.068    3   ?       ? ?                     ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?       ? ?                     ? 
5 non-polymer syn 'NITRATE ION' 62.005    2   ?       ? ?                     ? 
6 non-polymer syn 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL 370.436   1   ?       ? ?                     ? 
7 water       nat water 18.015    397 ?       ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4EY4 A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 4EY4 B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                       ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                      ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                    ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                               ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                                      ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer                   . 1,2-ETHANEDIOL                                'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                          ?                 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                     ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                               ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                       ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                     ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                         ?                 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                    ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                       ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                        ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                                    ?                 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose      ?                 'C8 H15 N O6'    221.208 
NO3 non-polymer                   . 'NITRATE ION'                                 ?                 'N O3 -1'        62.005  
PE8 non-polymer                   . 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL ?                 'C16 H34 O9'     370.436 
PHE 'L-peptide linking'           y PHENYLALANINE                                 ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                       ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                        ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                     ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                    ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                      ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                        ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4EY4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.44 
_exptl_crystal.density_percent_sol   72.30 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'12 to 18% PEG 3350, 0.2M potassium nitrate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.075 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4EY4 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.150 
_reflns.number_obs                   112311 
_reflns.number_all                   115309 
_reflns.percent_possible_obs         97.400 
_reflns.pdbx_Rmerge_I_obs            0.060 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.800 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.100 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
1 1  2.150 2.190  99.000 0.551 ? ? 3.000 
1 2  2.190 2.230  99.000 0.480 ? ? 3.000 
1 3  2.230 2.270  99.100 0.409 ? ? 3.000 
1 4  2.270 2.320  99.100 0.366 ? ? 3.000 
1 5  2.320 2.370  99.100 0.320 ? ? 3.000 
1 6  2.370 2.420  99.200 0.277 ? ? 3.000 
1 7  2.420 2.480  99.100 0.241 ? ? 3.000 
1 8  2.480 2.550  99.300 0.212 ? ? 3.000 
1 9  2.550 2.620  99.300 0.185 ? ? 3.000 
1 10 2.620 2.710  99.300 0.150 ? ? 3.000 
1 11 2.710 2.810  99.200 0.131 ? ? 3.000 
1 12 2.810 2.920  98.900 0.108 ? ? 3.000 
1 13 2.920 3.050  98.500 0.090 ? ? 3.000 
1 14 3.050 3.210  98.200 0.076 ? ? 2.900 
1 15 3.210 3.410  96.900 0.064 ? ? 2.900 
1 16 3.410 3.680  95.800 0.056 ? ? 2.800 
1 17 3.680 4.050  91.200 0.050 ? ? 2.600 
1 18 4.050 4.630  87.300 0.052 ? ? 2.800 
1 19 4.630 5.830  96.300 0.058 ? ? 4.400 
1 20 5.830 50.000 94.000 0.045 ? ? 4.500 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4EY4 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     112096 
_refine.ls_number_reflns_all                     121072 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.606 
_refine.ls_d_res_high                            2.156 
_refine.ls_percent_reflns_obs                    97.21 
_refine.ls_R_factor_obs                          0.1854 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1836 
_refine.ls_R_factor_R_free                       0.2198 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.99 
_refine.ls_number_reflns_R_free                  5594 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.430 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            7.1353 
_refine.aniso_B[2][2]                            7.1353 
_refine.aniso_B[3][3]                            -14.2707 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.20 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4EY7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 23.76 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8284 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         135 
_refine_hist.number_atoms_solvent             397 
_refine_hist.number_atoms_total               8816 
_refine_hist.d_res_high                       2.156 
_refine_hist.d_res_low                        46.606 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 8778  'X-RAY DIFFRACTION' ? 
f_angle_d          1.174  ? ? 11971 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.756 ? ? 3193  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.083  ? ? 1281  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1578  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.1560 2.1805  3509 0.2950 97.00 0.3439 . . 183 . . 
'X-RAY DIFFRACTION' . 2.1805 2.2061  3549 0.2841 99.00 0.3209 . . 196 . . 
'X-RAY DIFFRACTION' . 2.2061 2.2330  3534 0.2750 99.00 0.2944 . . 196 . . 
'X-RAY DIFFRACTION' . 2.2330 2.2613  3602 0.2622 99.00 0.3098 . . 197 . . 
'X-RAY DIFFRACTION' . 2.2613 2.2910  3589 0.2528 99.00 0.2897 . . 169 . . 
'X-RAY DIFFRACTION' . 2.2910 2.3224  3557 0.2375 99.00 0.2956 . . 189 . . 
'X-RAY DIFFRACTION' . 2.3224 2.3556  3610 0.2401 99.00 0.2970 . . 189 . . 
'X-RAY DIFFRACTION' . 2.3556 2.3907  3483 0.2363 99.00 0.2888 . . 199 . . 
'X-RAY DIFFRACTION' . 2.3907 2.4281  3592 0.2257 99.00 0.2654 . . 185 . . 
'X-RAY DIFFRACTION' . 2.4281 2.4679  3637 0.2176 99.00 0.2916 . . 179 . . 
'X-RAY DIFFRACTION' . 2.4679 2.5105  3505 0.2163 99.00 0.2594 . . 226 . . 
'X-RAY DIFFRACTION' . 2.5105 2.5561  3593 0.2055 99.00 0.2570 . . 179 . . 
'X-RAY DIFFRACTION' . 2.5561 2.6053  3605 0.2106 99.00 0.2720 . . 172 . . 
'X-RAY DIFFRACTION' . 2.6053 2.6584  3619 0.2113 99.00 0.2764 . . 212 . . 
'X-RAY DIFFRACTION' . 2.6584 2.7162  3563 0.2025 99.00 0.2642 . . 200 . . 
'X-RAY DIFFRACTION' . 2.7162 2.7794  3583 0.2105 99.00 0.2865 . . 173 . . 
'X-RAY DIFFRACTION' . 2.7794 2.8489  3579 0.2111 99.00 0.2641 . . 202 . . 
'X-RAY DIFFRACTION' . 2.8489 2.9259  3607 0.2064 99.00 0.2622 . . 172 . . 
'X-RAY DIFFRACTION' . 2.9259 3.0120  3595 0.1977 98.00 0.2433 . . 191 . . 
'X-RAY DIFFRACTION' . 3.0120 3.1092  3598 0.1993 98.00 0.2581 . . 183 . . 
'X-RAY DIFFRACTION' . 3.1092 3.2203  3584 0.2016 98.00 0.2399 . . 189 . . 
'X-RAY DIFFRACTION' . 3.2203 3.3492  3542 0.2054 97.00 0.2402 . . 174 . . 
'X-RAY DIFFRACTION' . 3.3492 3.5016  3488 0.1960 96.00 0.2262 . . 196 . . 
'X-RAY DIFFRACTION' . 3.5016 3.6861  3546 0.1826 95.00 0.2121 . . 177 . . 
'X-RAY DIFFRACTION' . 3.6861 3.9170  3398 0.1727 93.00 0.1872 . . 190 . . 
'X-RAY DIFFRACTION' . 3.9170 4.2192  3248 0.1604 88.00 0.1913 . . 156 . . 
'X-RAY DIFFRACTION' . 4.2192 4.6435  3236 0.1440 88.00 0.1814 . . 173 . . 
'X-RAY DIFFRACTION' . 4.6435 5.3146  3625 0.1412 96.00 0.1603 . . 167 . . 
'X-RAY DIFFRACTION' . 5.3146 6.6927  3653 0.1716 97.00 0.1907 . . 209 . . 
'X-RAY DIFFRACTION' . 6.6927 46.6166 3673 0.1726 92.00 0.2068 . . 171 . . 
# 
_struct.entry_id                  4EY4 
_struct.title                     'Crystal Structure of Recombinant Human Acetylcholinesterase in the Apo state' 
_struct.pdbx_descriptor           'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4EY4 
_struct_keywords.text            'acetylcholinesterase, hydrolase, apo' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 3 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 7 ? 
M N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  2  MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 152 ? LEU A 158 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 202 ? LEU A 213 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 11 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 12 ASP A 265 ? THR A 274 ? ASP A 266 THR A 275 1 ? 10 
HELX_P HELX_P13 13 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 310 ? ALA A 317 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 16 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 533 ? ALA A 541 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 27 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 28 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 152 ? LEU B 158 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 37 GLY B 239 ? VAL B 254 ? GLY B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 38 ASN B 264 ? ARG B 273 ? ASN B 265 ARG B 274 1 ? 10 
HELX_P HELX_P39 39 PRO B 276 ? ASN B 282 ? PRO B 277 ASN B 283 1 ? 7  
HELX_P HELX_P40 40 HIS B 283 ? LEU B 288 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P41 41 THR B 310 ? ALA B 317 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P42 42 GLY B 334 ? VAL B 339 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 51 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 52 PHE B 534 ? ALA B 541 ? PHE B 535 ALA B 542 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.077 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.074 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.080 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.072 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
covale1 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.475 ? N-Glycosylation 
covale2 covale one  ? B ASN 264 ND2 ? ? ? 1_555 G NAG .   C1 ? ? B ASN 265 B NAG 604 1_555 ? ? ? ? ? ? ? 1.525 ? N-Glycosylation 
covale3 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.471 ? N-Glycosylation 
covale4 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.456 ? ?               
covale5 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.460 ? ?               
covale6 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale7 covale both ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.465 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 -1.66 
2 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 6.06  
3 CYS 256 B . ? CYS 257 B PRO 257 B ? PRO 258 B 1 -6.19 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 2  ? 
E ? 3  ? 
F ? 11 ? 
G ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? parallel      
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? parallel      
F 5  6  ? parallel      
F 6  7  ? parallel      
F 7  8  ? parallel      
F 8  9  ? parallel      
F 9  10 ? parallel      
F 10 11 ? anti-parallel 
G 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
A 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
A 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
B 1  ILE A 19  ? LEU A 21  ? ILE A 20  LEU A 22  
B 2  VAL A 28  ? PRO A 35  ? VAL A 29  PRO A 36  
B 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
B 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
B 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
B 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
B 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
B 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
B 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
B 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
B 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
C 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
C 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
D 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
D 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
E 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
E 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
E 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
F 1  ILE B 19  ? LEU B 21  ? ILE B 20  LEU B 22  
F 2  VAL B 28  ? PRO B 35  ? VAL B 29  PRO B 36  
F 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
F 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
F 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
F 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
F 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
F 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
F 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
F 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
F 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
G 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
G 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 9   ? N VAL A 10  O LEU A 16  ? O LEU A 17  
A 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
B 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
B 2  3  N SER A 29  ? N SER A 30  O THR A 102 ? O THR A 103 
B 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
B 4  5  O VAL A 144 ? O VAL A 145 N LEU A 114 ? N LEU A 115 
B 5  6  N VAL A 113 ? N VAL A 114 O THR A 197 ? O THR A 198 
B 6  7  N GLY A 200 ? N GLY A 201 O GLN A 227 ? O GLN A 228 
B 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
B 8  9  N VAL A 327 ? N VAL A 328 O TYR A 425 ? O TYR A 426 
B 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
B 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
C 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
D 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
E 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
E 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
F 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
F 2  3  N ILE B 34  ? N ILE B 35  O LEU B 98  ? O LEU B 99  
F 3  4  N TRP B 101 ? N TRP B 102 O LEU B 145 ? O LEU B 146 
F 4  5  O VAL B 146 ? O VAL B 147 N TRP B 116 ? N TRP B 117 
F 5  6  N VAL B 113 ? N VAL B 114 O THR B 197 ? O THR B 198 
F 6  7  N GLY B 200 ? N GLY B 201 O GLN B 227 ? O GLN B 228 
F 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
F 8  9  N VAL B 327 ? N VAL B 328 O TYR B 425 ? O TYR B 426 
F 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
F 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
G 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
# 
_atom_sites.entry_id                    4EY4 
_atom_sites.fract_transf_matrix[1][1]   0.009418 
_atom_sites.fract_transf_matrix[1][2]   0.005438 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010875 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003083 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 3   ? 2.162   -35.797 69.748  1.00 77.71  ? 4   GLU A N   1 
ATOM   2    C CA  . GLU A 1 3   ? 2.144   -35.298 68.374  1.00 88.24  ? 4   GLU A CA  1 
ATOM   3    C C   . GLU A 1 3   ? 3.381   -35.792 67.611  1.00 87.84  ? 4   GLU A C   1 
ATOM   4    O O   . GLU A 1 3   ? 4.510   -35.681 68.106  1.00 83.94  ? 4   GLU A O   1 
ATOM   5    C CB  . GLU A 1 3   ? 2.072   -33.765 68.363  1.00 90.35  ? 4   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 3   ? 1.745   -33.131 67.003  1.00 83.68  ? 4   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 3   ? 0.246   -33.077 66.700  1.00 94.60  ? 4   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 3   ? -0.546  -33.644 67.490  1.00 102.47 ? 4   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 3   ? -0.143  -32.463 65.674  1.00 81.67  ? 4   GLU A OE2 1 
ATOM   10   N N   . ASP A 1 4   ? 3.163   -36.352 66.420  1.00 72.07  ? 5   ASP A N   1 
ATOM   11   C CA  . ASP A 1 4   ? 4.252   -36.888 65.608  1.00 63.32  ? 5   ASP A CA  1 
ATOM   12   C C   . ASP A 1 4   ? 4.820   -35.798 64.692  1.00 72.43  ? 5   ASP A C   1 
ATOM   13   O O   . ASP A 1 4   ? 4.124   -35.287 63.816  1.00 71.57  ? 5   ASP A O   1 
ATOM   14   C CB  . ASP A 1 4   ? 3.761   -38.084 64.789  1.00 66.50  ? 5   ASP A CB  1 
ATOM   15   C CG  . ASP A 1 4   ? 4.897   -38.847 64.114  1.00 68.76  ? 5   ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 4   ? 4.662   -40.011 63.705  1.00 63.16  ? 5   ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 4   ? 6.021   -38.300 63.996  1.00 62.50  ? 5   ASP A OD2 1 
ATOM   18   N N   . ALA A 1 5   ? 6.092   -35.461 64.890  1.00 67.88  ? 6   ALA A N   1 
ATOM   19   C CA  . ALA A 1 5   ? 6.704   -34.327 64.201  1.00 69.91  ? 6   ALA A CA  1 
ATOM   20   C C   . ALA A 1 5   ? 6.988   -34.618 62.737  1.00 70.05  ? 6   ALA A C   1 
ATOM   21   O O   . ALA A 1 5   ? 7.173   -33.696 61.947  1.00 74.43  ? 6   ALA A O   1 
ATOM   22   C CB  . ALA A 1 5   ? 7.979   -33.903 64.900  1.00 65.43  ? 6   ALA A CB  1 
ATOM   23   N N   . GLU A 1 6   ? 7.042   -35.897 62.380  1.00 59.56  ? 7   GLU A N   1 
ATOM   24   C CA  . GLU A 1 6   ? 7.301   -36.283 61.007  1.00 65.13  ? 7   GLU A CA  1 
ATOM   25   C C   . GLU A 1 6   ? 6.145   -35.868 60.094  1.00 65.45  ? 7   GLU A C   1 
ATOM   26   O O   . GLU A 1 6   ? 6.315   -35.715 58.884  1.00 59.84  ? 7   GLU A O   1 
ATOM   27   C CB  . GLU A 1 6   ? 7.526   -37.788 60.923  1.00 65.71  ? 7   GLU A CB  1 
ATOM   28   C CG  . GLU A 1 6   ? 8.743   -38.274 61.698  1.00 64.55  ? 7   GLU A CG  1 
ATOM   29   C CD  . GLU A 1 6   ? 10.060  -37.841 61.069  1.00 73.62  ? 7   GLU A CD  1 
ATOM   30   O OE1 . GLU A 1 6   ? 10.070  -37.397 59.891  1.00 67.91  ? 7   GLU A OE1 1 
ATOM   31   O OE2 . GLU A 1 6   ? 11.094  -37.947 61.759  1.00 71.42  ? 7   GLU A OE2 1 
ATOM   32   N N   . LEU A 1 7   ? 4.979   -35.676 60.698  1.00 54.55  ? 8   LEU A N   1 
ATOM   33   C CA  . LEU A 1 7   ? 3.753   -35.407 59.976  1.00 56.56  ? 8   LEU A CA  1 
ATOM   34   C C   . LEU A 1 7   ? 3.387   -33.934 60.033  1.00 56.55  ? 8   LEU A C   1 
ATOM   35   O O   . LEU A 1 7   ? 2.258   -33.550 59.710  1.00 53.56  ? 8   LEU A O   1 
ATOM   36   C CB  . LEU A 1 7   ? 2.621   -36.239 60.579  1.00 56.31  ? 8   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 7   ? 2.894   -37.743 60.632  1.00 57.15  ? 8   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 7   ? 1.681   -38.466 61.202  1.00 50.72  ? 8   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 7   ? 3.263   -38.269 59.232  1.00 51.79  ? 8   LEU A CD2 1 
ATOM   40   N N   . LEU A 1 8   ? 4.341   -33.114 60.464  1.00 52.96  ? 9   LEU A N   1 
ATOM   41   C CA  . LEU A 1 8   ? 4.153   -31.669 60.495  1.00 51.72  ? 9   LEU A CA  1 
ATOM   42   C C   . LEU A 1 8   ? 5.131   -31.058 59.529  1.00 53.95  ? 9   LEU A C   1 
ATOM   43   O O   . LEU A 1 8   ? 6.328   -31.329 59.601  1.00 53.13  ? 9   LEU A O   1 
ATOM   44   C CB  . LEU A 1 8   ? 4.390   -31.112 61.894  1.00 57.05  ? 9   LEU A CB  1 
ATOM   45   C CG  . LEU A 1 8   ? 3.416   -31.606 62.960  1.00 60.33  ? 9   LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 8   ? 3.664   -30.900 64.290  1.00 61.99  ? 9   LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 8   ? 1.984   -31.401 62.499  1.00 58.37  ? 9   LEU A CD2 1 
ATOM   48   N N   . VAL A 1 9   ? 4.611   -30.259 58.599  1.00 55.27  ? 10  VAL A N   1 
ATOM   49   C CA  . VAL A 1 9   ? 5.422   -29.646 57.544  1.00 53.93  ? 10  VAL A CA  1 
ATOM   50   C C   . VAL A 1 9   ? 4.985   -28.203 57.324  1.00 46.11  ? 10  VAL A C   1 
ATOM   51   O O   . VAL A 1 9   ? 3.795   -27.874 57.360  1.00 50.18  ? 10  VAL A O   1 
ATOM   52   C CB  . VAL A 1 9   ? 5.281   -30.403 56.191  1.00 49.65  ? 10  VAL A CB  1 
ATOM   53   C CG1 . VAL A 1 9   ? 6.242   -29.853 55.135  1.00 48.66  ? 10  VAL A CG1 1 
ATOM   54   C CG2 . VAL A 1 9   ? 5.556   -31.860 56.375  1.00 62.72  ? 10  VAL A CG2 1 
ATOM   55   N N   . THR A 1 10  ? 5.953   -27.344 57.067  1.00 51.75  ? 11  THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? 5.655   -25.974 56.715  1.00 46.66  ? 11  THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? 6.011   -25.771 55.250  1.00 46.14  ? 11  THR A C   1 
ATOM   58   O O   . THR A 1 10  ? 7.133   -26.045 54.842  1.00 47.45  ? 11  THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? 6.432   -25.008 57.634  1.00 51.40  ? 11  THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? 6.063   -25.283 58.992  1.00 51.72  ? 11  THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? 6.102   -23.558 57.315  1.00 46.69  ? 11  THR A CG2 1 
ATOM   62   N N   . VAL A 1 11  ? 5.036   -25.344 54.452  1.00 42.87  ? 12  VAL A N   1 
ATOM   63   C CA  . VAL A 1 11  ? 5.296   -25.005 53.052  1.00 51.20  ? 12  VAL A CA  1 
ATOM   64   C C   . VAL A 1 11  ? 5.100   -23.504 52.934  1.00 52.65  ? 12  VAL A C   1 
ATOM   65   O O   . VAL A 1 11  ? 4.700   -22.864 53.899  1.00 51.22  ? 12  VAL A O   1 
ATOM   66   C CB  . VAL A 1 11  ? 4.369   -25.765 52.081  1.00 49.93  ? 12  VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 11  ? 4.673   -27.260 52.131  1.00 43.32  ? 12  VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 11  ? 2.887   -25.491 52.402  1.00 43.94  ? 12  VAL A CG2 1 
ATOM   69   N N   . ARG A 1 12  ? 5.381   -22.944 51.770  1.00 42.09  ? 13  ARG A N   1 
ATOM   70   C CA  . ARG A 1 12  ? 5.345   -21.491 51.601  1.00 50.88  ? 13  ARG A CA  1 
ATOM   71   C C   . ARG A 1 12  ? 4.038   -20.846 52.023  1.00 47.56  ? 13  ARG A C   1 
ATOM   72   O O   . ARG A 1 12  ? 4.028   -19.729 52.521  1.00 59.98  ? 13  ARG A O   1 
ATOM   73   C CB  . ARG A 1 12  ? 5.704   -21.087 50.156  1.00 52.26  ? 13  ARG A CB  1 
ATOM   74   C CG  . ARG A 1 12  ? 7.209   -21.089 49.927  1.00 58.80  ? 13  ARG A CG  1 
ATOM   75   C CD  . ARG A 1 12  ? 7.619   -20.536 48.575  1.00 73.75  ? 13  ARG A CD  1 
ATOM   76   N NE  . ARG A 1 12  ? 8.968   -20.987 48.229  1.00 82.41  ? 13  ARG A NE  1 
ATOM   77   C CZ  . ARG A 1 12  ? 9.645   -20.603 47.151  1.00 77.96  ? 13  ARG A CZ  1 
ATOM   78   N NH1 . ARG A 1 12  ? 9.112   -19.742 46.298  1.00 75.93  ? 13  ARG A NH1 1 
ATOM   79   N NH2 . ARG A 1 12  ? 10.861  -21.085 46.928  1.00 79.82  ? 13  ARG A NH2 1 
ATOM   80   N N   . GLY A 1 13  ? 2.930   -21.545 51.832  1.00 54.47  ? 14  GLY A N   1 
ATOM   81   C CA  . GLY A 1 13  ? 1.626   -20.973 52.133  1.00 50.02  ? 14  GLY A CA  1 
ATOM   82   C C   . GLY A 1 13  ? 1.182   -21.149 53.575  1.00 45.56  ? 14  GLY A C   1 
ATOM   83   O O   . GLY A 1 13  ? 0.164   -20.584 53.988  1.00 55.10  ? 14  GLY A O   1 
ATOM   84   N N   . GLY A 1 14  ? 1.935   -21.922 54.351  1.00 48.64  ? 15  GLY A N   1 
ATOM   85   C CA  . GLY A 1 14  ? 1.513   -22.229 55.712  1.00 46.67  ? 15  GLY A CA  1 
ATOM   86   C C   . GLY A 1 14  ? 1.799   -23.656 56.136  1.00 48.86  ? 15  GLY A C   1 
ATOM   87   O O   . GLY A 1 14  ? 2.544   -24.374 55.471  1.00 57.51  ? 15  GLY A O   1 
ATOM   88   N N   . ARG A 1 15  ? 1.204   -24.062 57.254  1.00 46.47  ? 16  ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 1.513   -25.335 57.901  1.00 51.92  ? 16  ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 0.529   -26.458 57.546  1.00 49.88  ? 16  ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? -0.671  -26.212 57.374  1.00 48.00  ? 16  ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 1.529   -25.154 59.433  1.00 56.67  ? 16  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 2.776   -24.452 59.995  1.00 58.23  ? 16  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 2.654   -24.263 61.523  1.00 68.60  ? 16  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 1.472   -23.480 61.872  1.00 63.48  ? 16  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 0.810   -23.582 63.019  1.00 73.65  ? 16  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 1.208   -24.439 63.947  1.00 75.44  ? 16  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? -0.258  -22.824 63.237  1.00 78.34  ? 16  ARG A NH2 1 
ATOM   99   N N   . LEU A 1 16  ? 1.045   -27.689 57.504  1.00 45.28  ? 17  LEU A N   1 
ATOM   100  C CA  . LEU A 1 16  ? 0.260   -28.880 57.158  1.00 59.91  ? 17  LEU A CA  1 
ATOM   101  C C   . LEU A 1 16  ? 0.383   -30.011 58.183  1.00 50.46  ? 17  LEU A C   1 
ATOM   102  O O   . LEU A 1 16  ? 1.454   -30.235 58.747  1.00 52.64  ? 17  LEU A O   1 
ATOM   103  C CB  . LEU A 1 16  ? 0.741   -29.464 55.817  1.00 47.91  ? 17  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 16  ? 0.796   -28.550 54.606  1.00 54.42  ? 17  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 16  ? 1.572   -29.234 53.474  1.00 42.58  ? 17  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 16  ? -0.628  -28.201 54.187  1.00 49.06  ? 17  LEU A CD2 1 
ATOM   107  N N   A ARG A 1 17  ? -0.712  -30.740 58.379  0.37 49.14  ? 18  ARG A N   1 
ATOM   108  N N   B ARG A 1 17  ? -0.716  -30.724 58.411  0.63 49.06  ? 18  ARG A N   1 
ATOM   109  C CA  A ARG A 1 17  ? -0.702  -31.968 59.169  0.37 55.95  ? 18  ARG A CA  1 
ATOM   110  C CA  B ARG A 1 17  ? -0.664  -31.967 59.176  0.63 56.04  ? 18  ARG A CA  1 
ATOM   111  C C   A ARG A 1 17  ? -0.998  -33.192 58.284  0.37 51.72  ? 18  ARG A C   1 
ATOM   112  C C   B ARG A 1 17  ? -0.981  -33.179 58.277  0.63 51.72  ? 18  ARG A C   1 
ATOM   113  O O   A ARG A 1 17  ? -2.065  -33.292 57.681  0.37 50.43  ? 18  ARG A O   1 
ATOM   114  O O   B ARG A 1 17  ? -2.041  -33.254 57.657  0.63 50.39  ? 18  ARG A O   1 
ATOM   115  C CB  A ARG A 1 17  ? -1.717  -31.866 60.315  0.37 53.22  ? 18  ARG A CB  1 
ATOM   116  C CB  B ARG A 1 17  ? -1.610  -31.906 60.387  0.63 53.19  ? 18  ARG A CB  1 
ATOM   117  C CG  A ARG A 1 17  ? -2.068  -33.188 60.988  0.37 55.76  ? 18  ARG A CG  1 
ATOM   118  C CG  B ARG A 1 17  ? -1.491  -33.096 61.339  0.63 55.12  ? 18  ARG A CG  1 
ATOM   119  C CD  A ARG A 1 17  ? -2.983  -32.960 62.188  0.37 56.49  ? 18  ARG A CD  1 
ATOM   120  C CD  B ARG A 1 17  ? -2.349  -32.923 62.601  0.63 56.90  ? 18  ARG A CD  1 
ATOM   121  N NE  A ARG A 1 17  ? -3.817  -31.772 62.015  0.37 57.04  ? 18  ARG A NE  1 
ATOM   122  N NE  B ARG A 1 17  ? -1.798  -31.930 63.526  0.63 64.03  ? 18  ARG A NE  1 
ATOM   123  C CZ  A ARG A 1 17  ? -5.077  -31.792 61.599  0.37 54.07  ? 18  ARG A CZ  1 
ATOM   124  C CZ  B ARG A 1 17  ? -2.318  -30.724 63.737  0.63 56.80  ? 18  ARG A CZ  1 
ATOM   125  N NH1 A ARG A 1 17  ? -5.666  -32.947 61.322  0.37 55.29  ? 18  ARG A NH1 1 
ATOM   126  N NH1 B ARG A 1 17  ? -3.419  -30.349 63.103  0.63 57.61  ? 18  ARG A NH1 1 
ATOM   127  N NH2 A ARG A 1 17  ? -5.750  -30.656 61.466  0.37 48.55  ? 18  ARG A NH2 1 
ATOM   128  N NH2 B ARG A 1 17  ? -1.741  -29.894 64.590  0.63 55.53  ? 18  ARG A NH2 1 
ATOM   129  N N   . GLY A 1 18  ? -0.048  -34.119 58.212  1.00 48.52  ? 19  GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? -0.206  -35.302 57.389  1.00 50.65  ? 19  GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? -0.622  -36.534 58.168  1.00 56.22  ? 19  GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? -1.152  -36.426 59.259  1.00 51.48  ? 19  GLY A O   1 
ATOM   133  N N   . ILE A 1 19  ? -0.381  -37.709 57.601  1.00 49.92  ? 20  ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? -0.845  -38.944 58.202  1.00 44.43  ? 20  ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? 0.117   -40.082 57.873  1.00 53.21  ? 20  ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? 0.643   -40.161 56.766  1.00 51.95  ? 20  ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? -2.279  -39.289 57.742  1.00 55.26  ? 20  ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? -2.830  -40.489 58.521  1.00 53.33  ? 20  ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? -2.337  -39.521 56.200  1.00 49.55  ? 20  ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? -4.278  -40.837 58.163  1.00 56.71  ? 20  ILE A CD1 1 
ATOM   141  N N   . ARG A 1 20  ? 0.357   -40.947 58.855  1.00 51.13  ? 21  ARG A N   1 
ATOM   142  C CA  . ARG A 1 20  ? 1.213   -42.115 58.696  1.00 54.95  ? 21  ARG A CA  1 
ATOM   143  C C   . ARG A 1 20  ? 0.390   -43.270 58.131  1.00 55.62  ? 21  ARG A C   1 
ATOM   144  O O   . ARG A 1 20  ? -0.673  -43.588 58.667  1.00 50.18  ? 21  ARG A O   1 
ATOM   145  C CB  . ARG A 1 20  ? 1.792   -42.517 60.057  1.00 55.41  ? 21  ARG A CB  1 
ATOM   146  C CG  . ARG A 1 20  ? 3.107   -43.289 59.983  1.00 57.22  ? 21  ARG A CG  1 
ATOM   147  C CD  . ARG A 1 20  ? 3.746   -43.417 61.391  1.00 65.10  ? 21  ARG A CD  1 
ATOM   148  N NE  . ARG A 1 20  ? 2.794   -43.969 62.346  1.00 58.86  ? 21  ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 20  ? 2.327   -43.333 63.416  1.00 65.59  ? 21  ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 20  ? 2.741   -42.100 63.726  1.00 59.70  ? 21  ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 20  ? 1.437   -43.947 64.183  1.00 60.72  ? 21  ARG A NH2 1 
ATOM   152  N N   . LEU A 1 21  ? 0.882   -43.884 57.055  1.00 47.68  ? 22  LEU A N   1 
ATOM   153  C CA  . LEU A 1 21  ? 0.188   -44.987 56.393  1.00 55.66  ? 22  LEU A CA  1 
ATOM   154  C C   . LEU A 1 21  ? 0.981   -46.279 56.556  1.00 54.36  ? 22  LEU A C   1 
ATOM   155  O O   . LEU A 1 21  ? 2.205   -46.238 56.599  1.00 60.37  ? 22  LEU A O   1 
ATOM   156  C CB  . LEU A 1 21  ? 0.035   -44.699 54.880  1.00 46.50  ? 22  LEU A CB  1 
ATOM   157  C CG  . LEU A 1 21  ? -0.809  -43.493 54.454  1.00 58.28  ? 22  LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 21  ? -0.913  -43.407 52.936  1.00 48.03  ? 22  LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 21  ? -2.198  -43.521 55.088  1.00 51.00  ? 22  LEU A CD2 1 
ATOM   160  N N   . LYS A 1 22  ? 0.290   -47.420 56.579  1.00 55.81  ? 23  LYS A N   1 
ATOM   161  C CA  . LYS A 1 22  ? 0.945   -48.729 56.645  1.00 50.26  ? 23  LYS A CA  1 
ATOM   162  C C   . LYS A 1 22  ? 1.152   -49.362 55.277  1.00 45.08  ? 23  LYS A C   1 
ATOM   163  O O   . LYS A 1 22  ? 0.347   -49.168 54.375  1.00 48.77  ? 23  LYS A O   1 
ATOM   164  C CB  . LYS A 1 22  ? 0.111   -49.709 57.493  1.00 52.80  ? 23  LYS A CB  1 
ATOM   165  C CG  . LYS A 1 22  ? -0.162  -49.260 58.928  1.00 60.37  ? 23  LYS A CG  1 
ATOM   166  C CD  . LYS A 1 22  ? -0.907  -50.355 59.724  1.00 55.22  ? 23  LYS A CD  1 
ATOM   167  C CE  . LYS A 1 22  ? -2.241  -50.698 59.082  1.00 67.51  ? 23  LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 22  ? -2.917  -51.853 59.744  1.00 67.80  ? 23  LYS A NZ  1 
ATOM   169  N N   . THR A 1 23  ? 2.224   -50.146 55.145  1.00 48.46  ? 24  THR A N   1 
ATOM   170  C CA  . THR A 1 23  ? 2.413   -51.059 54.016  1.00 54.25  ? 24  THR A CA  1 
ATOM   171  C C   . THR A 1 23  ? 3.033   -52.353 54.557  1.00 54.48  ? 24  THR A C   1 
ATOM   172  O O   . THR A 1 23  ? 3.570   -52.359 55.664  1.00 50.96  ? 24  THR A O   1 
ATOM   173  C CB  . THR A 1 23  ? 3.372   -50.479 52.904  1.00 47.05  ? 24  THR A CB  1 
ATOM   174  O OG1 . THR A 1 23  ? 4.743   -50.781 53.227  1.00 43.52  ? 24  THR A OG1 1 
ATOM   175  C CG2 . THR A 1 23  ? 3.193   -48.973 52.742  1.00 47.30  ? 24  THR A CG2 1 
ATOM   176  N N   . PRO A 1 24  ? 2.990   -53.446 53.768  1.00 51.93  ? 25  PRO A N   1 
ATOM   177  C CA  . PRO A 1 24  ? 3.682   -54.688 54.141  1.00 54.66  ? 25  PRO A CA  1 
ATOM   178  C C   . PRO A 1 24  ? 5.186   -54.511 54.294  1.00 59.01  ? 25  PRO A C   1 
ATOM   179  O O   . PRO A 1 24  ? 5.832   -55.367 54.886  1.00 56.54  ? 25  PRO A O   1 
ATOM   180  C CB  . PRO A 1 24  ? 3.427   -55.600 52.942  1.00 53.98  ? 25  PRO A CB  1 
ATOM   181  C CG  . PRO A 1 24  ? 2.181   -55.110 52.360  1.00 53.00  ? 25  PRO A CG  1 
ATOM   182  C CD  . PRO A 1 24  ? 2.169   -53.626 52.560  1.00 48.65  ? 25  PRO A CD  1 
ATOM   183  N N   . GLY A 1 25  ? 5.742   -53.437 53.740  1.00 49.50  ? 26  GLY A N   1 
ATOM   184  C CA  . GLY A 1 25  ? 7.161   -53.174 53.881  1.00 53.95  ? 26  GLY A CA  1 
ATOM   185  C C   . GLY A 1 25  ? 7.517   -52.204 54.999  1.00 48.07  ? 26  GLY A C   1 
ATOM   186  O O   . GLY A 1 25  ? 8.688   -51.870 55.177  1.00 52.88  ? 26  GLY A O   1 
ATOM   187  N N   . GLY A 1 26  ? 6.517   -51.743 55.748  1.00 43.59  ? 27  GLY A N   1 
ATOM   188  C CA  . GLY A 1 26  ? 6.732   -50.689 56.730  1.00 47.57  ? 27  GLY A CA  1 
ATOM   189  C C   . GLY A 1 26  ? 6.039   -49.380 56.356  1.00 53.08  ? 27  GLY A C   1 
ATOM   190  O O   . GLY A 1 26  ? 5.465   -49.280 55.277  1.00 56.30  ? 27  GLY A O   1 
ATOM   191  N N   . PRO A 1 27  ? 6.090   -48.371 57.249  1.00 53.58  ? 28  PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? 5.342   -47.111 57.113  1.00 50.07  ? 28  PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? 5.842   -46.101 56.070  1.00 50.48  ? 28  PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? 6.978   -46.120 55.586  1.00 45.37  ? 28  PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? 5.469   -46.483 58.513  1.00 40.57  ? 28  PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? 6.773   -47.015 59.003  1.00 45.92  ? 28  PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? 6.807   -48.433 58.537  1.00 44.18  ? 28  PRO A CD  1 
ATOM   198  N N   . VAL A 1 28  ? 4.948   -45.165 55.783  1.00 41.66  ? 29  VAL A N   1 
ATOM   199  C CA  . VAL A 1 28  ? 5.166   -44.127 54.803  1.00 42.32  ? 29  VAL A CA  1 
ATOM   200  C C   . VAL A 1 28  ? 4.450   -42.902 55.357  1.00 44.20  ? 29  VAL A C   1 
ATOM   201  O O   . VAL A 1 28  ? 3.482   -43.047 56.113  1.00 44.07  ? 29  VAL A O   1 
ATOM   202  C CB  . VAL A 1 28  ? 4.554   -44.591 53.437  1.00 51.64  ? 29  VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 28  ? 4.018   -43.441 52.628  1.00 50.34  ? 29  VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 28  ? 5.564   -45.426 52.650  1.00 43.25  ? 29  VAL A CG2 1 
ATOM   205  N N   . SER A 1 29  ? 4.935   -41.708 55.029  1.00 40.82  ? 30  SER A N   1 
ATOM   206  C CA  . SER A 1 29  ? 4.260   -40.474 55.437  1.00 47.22  ? 30  SER A CA  1 
ATOM   207  C C   . SER A 1 29  ? 3.460   -39.945 54.252  1.00 52.15  ? 30  SER A C   1 
ATOM   208  O O   . SER A 1 29  ? 3.934   -39.985 53.130  1.00 47.37  ? 30  SER A O   1 
ATOM   209  C CB  . SER A 1 29  ? 5.275   -39.399 55.842  1.00 50.83  ? 30  SER A CB  1 
ATOM   210  O OG  . SER A 1 29  ? 6.285   -39.894 56.702  1.00 60.60  ? 30  SER A OG  1 
ATOM   211  N N   . ALA A 1 30  ? 2.260   -39.433 54.497  1.00 48.73  ? 31  ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? 1.420   -38.963 53.412  1.00 48.99  ? 31  ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? 0.793   -37.621 53.750  1.00 49.07  ? 31  ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? 0.368   -37.400 54.879  1.00 46.66  ? 31  ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? 0.326   -39.995 53.086  1.00 49.78  ? 31  ALA A CB  1 
ATOM   216  N N   . PHE A 1 31  ? 0.725   -36.739 52.757  1.00 45.71  ? 32  PHE A N   1 
ATOM   217  C CA  . PHE A 1 31  ? 0.086   -35.434 52.922  1.00 42.09  ? 32  PHE A CA  1 
ATOM   218  C C   . PHE A 1 31  ? -0.902  -35.284 51.790  1.00 48.32  ? 32  PHE A C   1 
ATOM   219  O O   . PHE A 1 31  ? -0.507  -35.050 50.630  1.00 47.23  ? 32  PHE A O   1 
ATOM   220  C CB  . PHE A 1 31  ? 1.143   -34.316 52.918  1.00 41.68  ? 32  PHE A CB  1 
ATOM   221  C CG  . PHE A 1 31  ? 2.182   -34.490 53.999  1.00 48.02  ? 32  PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 31  ? 3.271   -35.327 53.805  1.00 45.32  ? 32  PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 31  ? 2.046   -33.850 55.223  1.00 46.58  ? 32  PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 31  ? 4.217   -35.513 54.800  1.00 51.27  ? 32  PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 31  ? 2.997   -34.033 56.229  1.00 51.38  ? 32  PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 31  ? 4.082   -34.869 56.012  1.00 43.88  ? 32  PHE A CZ  1 
ATOM   227  N N   . LEU A 1 32  ? -2.183  -35.462 52.111  1.00 41.26  ? 33  LEU A N   1 
ATOM   228  C CA  . LEU A 1 32  ? -3.204  -35.590 51.081  1.00 47.07  ? 33  LEU A CA  1 
ATOM   229  C C   . LEU A 1 32  ? -4.154  -34.421 51.144  1.00 46.60  ? 33  LEU A C   1 
ATOM   230  O O   . LEU A 1 32  ? -4.536  -34.005 52.234  1.00 43.21  ? 33  LEU A O   1 
ATOM   231  C CB  . LEU A 1 32  ? -3.984  -36.893 51.262  1.00 45.05  ? 33  LEU A CB  1 
ATOM   232  C CG  . LEU A 1 32  ? -3.151  -38.152 51.516  1.00 48.24  ? 33  LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 32  ? -4.075  -39.319 51.816  1.00 49.36  ? 33  LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 32  ? -2.257  -38.454 50.314  1.00 43.15  ? 33  LEU A CD2 1 
ATOM   235  N N   . GLY A 1 33  ? -4.541  -33.896 49.980  1.00 35.78  ? 34  GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? -5.470  -32.773 49.928  1.00 41.44  ? 34  GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? -4.887  -31.391 50.214  1.00 38.72  ? 34  GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? -5.558  -30.542 50.788  1.00 48.89  ? 34  GLY A O   1 
ATOM   239  N N   . ILE A 1 34  ? -3.650  -31.152 49.794  1.00 42.44  ? 35  ILE A N   1 
ATOM   240  C CA  . ILE A 1 34  ? -3.024  -29.828 49.930  1.00 42.80  ? 35  ILE A CA  1 
ATOM   241  C C   . ILE A 1 34  ? -3.501  -28.854 48.844  1.00 46.53  ? 35  ILE A C   1 
ATOM   242  O O   . ILE A 1 34  ? -3.359  -29.132 47.654  1.00 47.40  ? 35  ILE A O   1 
ATOM   243  C CB  . ILE A 1 34  ? -1.495  -29.949 49.766  1.00 42.02  ? 35  ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? -0.934  -31.072 50.648  1.00 41.94  ? 35  ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? -0.836  -28.623 50.031  1.00 40.74  ? 35  ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? 0.517   -31.461 50.331  1.00 33.23  ? 35  ILE A CD1 1 
ATOM   247  N N   . PRO A 1 35  ? -4.054  -27.699 49.237  1.00 44.38  ? 36  PRO A N   1 
ATOM   248  C CA  . PRO A 1 35  ? -4.511  -26.712 48.244  1.00 34.52  ? 36  PRO A CA  1 
ATOM   249  C C   . PRO A 1 35  ? -3.349  -26.056 47.473  1.00 46.10  ? 36  PRO A C   1 
ATOM   250  O O   . PRO A 1 35  ? -2.426  -25.527 48.083  1.00 44.13  ? 36  PRO A O   1 
ATOM   251  C CB  . PRO A 1 35  ? -5.237  -25.676 49.093  1.00 46.02  ? 36  PRO A CB  1 
ATOM   252  C CG  . PRO A 1 35  ? -4.586  -25.792 50.471  1.00 45.05  ? 36  PRO A CG  1 
ATOM   253  C CD  . PRO A 1 35  ? -4.240  -27.242 50.627  1.00 43.61  ? 36  PRO A CD  1 
ATOM   254  N N   . PHE A 1 36  ? -3.381  -26.097 46.143  1.00 38.39  ? 37  PHE A N   1 
ATOM   255  C CA  . PHE A 1 36  ? -2.302  -25.482 45.388  1.00 43.67  ? 37  PHE A CA  1 
ATOM   256  C C   . PHE A 1 36  ? -2.778  -24.284 44.558  1.00 44.54  ? 37  PHE A C   1 
ATOM   257  O O   . PHE A 1 36  ? -1.975  -23.488 44.093  1.00 44.90  ? 37  PHE A O   1 
ATOM   258  C CB  . PHE A 1 36  ? -1.502  -26.526 44.571  1.00 44.19  ? 37  PHE A CB  1 
ATOM   259  C CG  . PHE A 1 36  ? -2.248  -27.113 43.370  1.00 41.28  ? 37  PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 36  ? -2.294  -26.426 42.166  1.00 38.72  ? 37  PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 36  ? -2.842  -28.375 43.443  1.00 41.63  ? 37  PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 36  ? -2.962  -26.973 41.031  1.00 47.48  ? 37  PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 36  ? -3.504  -28.942 42.326  1.00 38.52  ? 37  PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 36  ? -3.566  -28.233 41.118  1.00 38.46  ? 37  PHE A CZ  1 
ATOM   265  N N   . ALA A 1 37  ? -4.090  -24.146 44.417  1.00 45.81  ? 38  ALA A N   1 
ATOM   266  C CA  . ALA A 1 37  ? -4.691  -23.009 43.726  1.00 38.45  ? 38  ALA A CA  1 
ATOM   267  C C   . ALA A 1 37  ? -5.895  -22.478 44.507  1.00 48.03  ? 38  ALA A C   1 
ATOM   268  O O   . ALA A 1 37  ? -6.450  -23.173 45.364  1.00 43.56  ? 38  ALA A O   1 
ATOM   269  C CB  . ALA A 1 37  ? -5.131  -23.417 42.299  1.00 41.59  ? 38  ALA A CB  1 
ATOM   270  N N   . GLU A 1 38  ? -6.296  -21.242 44.219  1.00 43.24  ? 39  GLU A N   1 
ATOM   271  C CA  . GLU A 1 38  ? -7.598  -20.764 44.676  1.00 48.22  ? 39  GLU A CA  1 
ATOM   272  C C   . GLU A 1 38  ? -8.689  -21.572 43.968  1.00 54.81  ? 39  GLU A C   1 
ATOM   273  O O   . GLU A 1 38  ? -8.547  -21.908 42.779  1.00 43.79  ? 39  GLU A O   1 
ATOM   274  C CB  . GLU A 1 38  ? -7.755  -19.277 44.349  1.00 51.20  ? 39  GLU A CB  1 
ATOM   275  C CG  . GLU A 1 38  ? -6.865  -18.357 45.196  1.00 61.97  ? 39  GLU A CG  1 
ATOM   276  C CD  . GLU A 1 38  ? -7.231  -18.401 46.677  1.00 56.41  ? 39  GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 38  ? -8.414  -18.166 46.996  1.00 63.77  ? 39  GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 38  ? -6.346  -18.692 47.515  1.00 55.70  ? 39  GLU A OE2 1 
ATOM   279  N N   . PRO A 1 39  ? -9.776  -21.902 44.687  1.00 50.25  ? 40  PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? -10.862 -22.653 44.035  1.00 41.65  ? 40  PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? -11.370 -21.943 42.781  1.00 48.50  ? 40  PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? -11.760 -20.784 42.862  1.00 48.76  ? 40  PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? -11.954 -22.668 45.089  1.00 41.68  ? 40  PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? -11.159 -22.661 46.440  1.00 44.16  ? 40  PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? -9.968  -21.766 46.149  1.00 50.93  ? 40  PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? -11.375 -22.642 41.636  1.00 47.04  ? 41  PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? -11.731 -22.003 40.364  1.00 45.45  ? 41  PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? -13.254 -21.991 40.176  1.00 58.71  ? 41  PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? -13.798 -22.663 39.289  1.00 50.39  ? 41  PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? -11.030 -22.884 39.334  1.00 40.39  ? 41  PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? -11.053 -24.269 39.939  1.00 39.74  ? 41  PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? -11.021 -24.068 41.469  1.00 44.92  ? 41  PRO A CD  1 
ATOM   293  N N   . MET A 1 41  ? -13.917 -21.203 41.025  1.00 52.29  ? 42  MET A N   1 
ATOM   294  C CA  . MET A 1 41  ? -15.370 -21.208 41.171  1.00 61.59  ? 42  MET A CA  1 
ATOM   295  C C   . MET A 1 41  ? -15.995 -19.877 40.768  1.00 53.67  ? 42  MET A C   1 
ATOM   296  O O   . MET A 1 41  ? -15.316 -18.846 40.731  1.00 48.75  ? 42  MET A O   1 
ATOM   297  C CB  . MET A 1 41  ? -15.730 -21.515 42.631  1.00 58.14  ? 42  MET A CB  1 
ATOM   298  C CG  . MET A 1 41  ? -15.092 -22.797 43.141  1.00 53.65  ? 42  MET A CG  1 
ATOM   299  S SD  . MET A 1 41  ? -16.244 -23.774 44.105  1.00 77.39  ? 42  MET A SD  1 
ATOM   300  C CE  . MET A 1 41  ? -17.650 -23.854 42.994  1.00 64.91  ? 42  MET A CE  1 
ATOM   301  N N   . GLY A 1 42  ? -17.293 -19.908 40.471  1.00 51.88  ? 43  GLY A N   1 
ATOM   302  C CA  . GLY A 1 42  ? -18.023 -18.702 40.109  1.00 52.50  ? 43  GLY A CA  1 
ATOM   303  C C   . GLY A 1 42  ? -17.428 -17.987 38.907  1.00 56.45  ? 43  GLY A C   1 
ATOM   304  O O   . GLY A 1 42  ? -17.395 -18.548 37.798  1.00 51.46  ? 43  GLY A O   1 
ATOM   305  N N   . PRO A 1 43  ? -16.952 -16.741 39.114  1.00 52.68  ? 44  PRO A N   1 
ATOM   306  C CA  . PRO A 1 43  ? -16.343 -15.963 38.020  1.00 50.07  ? 44  PRO A CA  1 
ATOM   307  C C   . PRO A 1 43  ? -15.030 -16.582 37.519  1.00 55.10  ? 44  PRO A C   1 
ATOM   308  O O   . PRO A 1 43  ? -14.591 -16.264 36.404  1.00 54.58  ? 44  PRO A O   1 
ATOM   309  C CB  . PRO A 1 43  ? -16.114 -14.582 38.642  1.00 51.80  ? 44  PRO A CB  1 
ATOM   310  C CG  . PRO A 1 43  ? -16.030 -14.850 40.145  1.00 50.38  ? 44  PRO A CG  1 
ATOM   311  C CD  . PRO A 1 43  ? -16.976 -16.002 40.392  1.00 53.66  ? 44  PRO A CD  1 
ATOM   312  N N   . ARG A 1 44  ? -14.438 -17.476 38.315  1.00 54.18  ? 45  ARG A N   1 
ATOM   313  C CA  . ARG A 1 44  ? -13.178 -18.140 37.943  1.00 53.01  ? 45  ARG A CA  1 
ATOM   314  C C   . ARG A 1 44  ? -13.330 -19.413 37.105  1.00 53.01  ? 45  ARG A C   1 
ATOM   315  O O   . ARG A 1 44  ? -12.325 -19.972 36.652  1.00 46.38  ? 45  ARG A O   1 
ATOM   316  C CB  . ARG A 1 44  ? -12.358 -18.493 39.181  1.00 49.21  ? 45  ARG A CB  1 
ATOM   317  C CG  . ARG A 1 44  ? -11.730 -17.326 39.916  1.00 61.13  ? 45  ARG A CG  1 
ATOM   318  C CD  . ARG A 1 44  ? -10.848 -17.903 41.040  1.00 67.29  ? 45  ARG A CD  1 
ATOM   319  N NE  . ARG A 1 44  ? -10.792 -17.073 42.242  1.00 85.18  ? 45  ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 44  ? -9.840  -16.176 42.475  1.00 89.70  ? 45  ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 44  ? -8.878  -15.993 41.582  1.00 78.52  ? 45  ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 44  ? -9.848  -15.466 43.596  1.00 87.99  ? 45  ARG A NH2 1 
ATOM   323  N N   . ARG A 1 45  ? -14.560 -19.893 36.924  1.00 46.83  ? 46  ARG A N   1 
ATOM   324  C CA  . ARG A 1 45  ? -14.793 -21.008 36.014  1.00 43.86  ? 46  ARG A CA  1 
ATOM   325  C C   . ARG A 1 45  ? -14.276 -20.650 34.614  1.00 43.48  ? 46  ARG A C   1 
ATOM   326  O O   . ARG A 1 45  ? -14.525 -19.548 34.126  1.00 47.88  ? 46  ARG A O   1 
ATOM   327  C CB  . ARG A 1 45  ? -16.285 -21.392 35.976  1.00 44.00  ? 46  ARG A CB  1 
ATOM   328  C CG  . ARG A 1 45  ? -16.610 -22.507 34.969  1.00 45.62  ? 46  ARG A CG  1 
ATOM   329  C CD  . ARG A 1 45  ? -18.118 -22.756 34.829  1.00 46.07  ? 46  ARG A CD  1 
ATOM   330  N NE  . ARG A 1 45  ? -18.705 -23.459 35.979  1.00 49.46  ? 46  ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 45  ? -20.013 -23.640 36.141  1.00 50.26  ? 46  ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 45  ? -20.855 -23.166 35.237  1.00 53.82  ? 46  ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 45  ? -20.485 -24.297 37.193  1.00 46.57  ? 46  ARG A NH2 1 
ATOM   334  N N   . PHE A 1 46  ? -13.538 -21.580 34.005  1.00 41.40  ? 47  PHE A N   1 
ATOM   335  C CA  . PHE A 1 46  ? -12.901 -21.430 32.681  1.00 48.03  ? 47  PHE A CA  1 
ATOM   336  C C   . PHE A 1 46  ? -11.615 -20.581 32.684  1.00 43.09  ? 47  PHE A C   1 
ATOM   337  O O   . PHE A 1 46  ? -10.943 -20.483 31.663  1.00 43.52  ? 47  PHE A O   1 
ATOM   338  C CB  . PHE A 1 46  ? -13.861 -20.885 31.605  1.00 47.67  ? 47  PHE A CB  1 
ATOM   339  C CG  . PHE A 1 46  ? -15.168 -21.618 31.501  1.00 46.20  ? 47  PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 46  ? -15.202 -22.994 31.324  1.00 45.47  ? 47  PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 46  ? -16.376 -20.915 31.561  1.00 44.98  ? 47  PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 46  ? -16.421 -23.664 31.217  1.00 48.68  ? 47  PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 46  ? -17.595 -21.570 31.455  1.00 44.95  ? 47  PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 46  ? -17.624 -22.946 31.285  1.00 47.11  ? 47  PHE A CZ  1 
ATOM   345  N N   . LEU A 1 47  ? -11.292 -19.948 33.811  1.00 41.17  ? 48  LEU A N   1 
ATOM   346  C CA  . LEU A 1 47  ? -10.108 -19.086 33.901  1.00 43.18  ? 48  LEU A CA  1 
ATOM   347  C C   . LEU A 1 47  ? -8.871  -19.853 34.372  1.00 44.31  ? 48  LEU A C   1 
ATOM   348  O O   . LEU A 1 47  ? -8.999  -20.874 35.055  1.00 42.36  ? 48  LEU A O   1 
ATOM   349  C CB  . LEU A 1 47  ? -10.370 -17.889 34.829  1.00 50.09  ? 48  LEU A CB  1 
ATOM   350  C CG  . LEU A 1 47  ? -11.411 -16.847 34.388  1.00 51.13  ? 48  LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 47  ? -11.354 -15.657 35.339  1.00 49.86  ? 48  LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 47  ? -11.197 -16.395 32.953  1.00 49.23  ? 48  LEU A CD2 1 
ATOM   353  N N   . PRO A 1 48  ? -7.669  -19.370 33.996  1.00 49.21  ? 49  PRO A N   1 
ATOM   354  C CA  . PRO A 1 48  ? -6.407  -19.950 34.475  1.00 43.69  ? 49  PRO A CA  1 
ATOM   355  C C   . PRO A 1 48  ? -6.384  -19.976 35.977  1.00 45.40  ? 49  PRO A C   1 
ATOM   356  O O   . PRO A 1 48  ? -7.019  -19.117 36.595  1.00 46.87  ? 49  PRO A O   1 
ATOM   357  C CB  . PRO A 1 48  ? -5.361  -18.956 33.968  1.00 43.58  ? 49  PRO A CB  1 
ATOM   358  C CG  . PRO A 1 48  ? -5.966  -18.432 32.690  1.00 47.13  ? 49  PRO A CG  1 
ATOM   359  C CD  . PRO A 1 48  ? -7.440  -18.320 32.981  1.00 43.47  ? 49  PRO A CD  1 
ATOM   360  N N   . PRO A 1 49  ? -5.661  -20.938 36.569  1.00 45.49  ? 50  PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? -5.634  -21.036 38.037  1.00 41.98  ? 50  PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? -4.771  -19.955 38.677  1.00 51.00  ? 50  PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? -3.767  -19.558 38.102  1.00 53.44  ? 50  PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? -4.991  -22.408 38.281  1.00 39.69  ? 50  PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? -4.059  -22.578 37.109  1.00 41.31  ? 50  PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? -4.821  -21.967 35.927  1.00 44.43  ? 50  PRO A CD  1 
ATOM   367  N N   . GLU A 1 50  ? -5.162  -19.503 39.865  1.00 53.61  ? 51  GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? -4.361  -18.572 40.642  1.00 57.76  ? 51  GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? -3.747  -19.295 41.824  1.00 51.82  ? 51  GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? -4.376  -20.175 42.412  1.00 51.44  ? 51  GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? -5.221  -17.407 41.128  1.00 61.78  ? 51  GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? -5.812  -16.604 39.982  1.00 70.67  ? 51  GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? -6.240  -15.218 40.404  1.00 99.97  ? 51  GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? -6.759  -15.076 41.536  1.00 97.78  ? 51  GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? -6.053  -14.270 39.607  1.00 113.24 ? 51  GLU A OE2 1 
ATOM   376  N N   . PRO A 1 51  ? -2.503  -18.944 42.166  1.00 50.01  ? 52  PRO A N   1 
ATOM   377  C CA  . PRO A 1 51  ? -1.833  -19.569 43.311  1.00 48.68  ? 52  PRO A CA  1 
ATOM   378  C C   . PRO A 1 51  ? -2.701  -19.469 44.562  1.00 46.03  ? 52  PRO A C   1 
ATOM   379  O O   . PRO A 1 51  ? -3.450  -18.497 44.736  1.00 44.81  ? 52  PRO A O   1 
ATOM   380  C CB  . PRO A 1 51  ? -0.575  -18.720 43.474  1.00 49.46  ? 52  PRO A CB  1 
ATOM   381  C CG  . PRO A 1 51  ? -0.288  -18.236 42.083  1.00 51.05  ? 52  PRO A CG  1 
ATOM   382  C CD  . PRO A 1 51  ? -1.637  -17.978 41.470  1.00 49.56  ? 52  PRO A CD  1 
ATOM   383  N N   . LYS A 1 52  ? -2.638  -20.499 45.393  1.00 47.21  ? 53  LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? -3.364  -20.512 46.654  1.00 53.50  ? 53  LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? -2.767  -19.460 47.576  1.00 52.19  ? 53  LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? -1.561  -19.448 47.801  1.00 52.54  ? 53  LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? -3.255  -21.889 47.321  1.00 45.83  ? 53  LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? -3.824  -21.939 48.751  1.00 46.91  ? 53  LYS A CG  1 
ATOM   389  C CD  . LYS A 1 52  ? -5.349  -21.821 48.770  1.00 48.99  ? 53  LYS A CD  1 
ATOM   390  C CE  . LYS A 1 52  ? -5.924  -22.070 50.161  1.00 47.61  ? 53  LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 52  ? -7.403  -21.824 50.132  1.00 49.12  ? 53  LYS A NZ  1 
ATOM   392  N N   A GLN A 1 53  ? -3.617  -18.587 48.106  0.42 54.09  ? 54  GLN A N   1 
ATOM   393  N N   B GLN A 1 53  ? -3.612  -18.571 48.091  0.58 54.08  ? 54  GLN A N   1 
ATOM   394  C CA  A GLN A 1 53  ? -3.189  -17.560 49.051  0.42 56.81  ? 54  GLN A CA  1 
ATOM   395  C CA  B GLN A 1 53  ? -3.170  -17.562 49.050  0.58 56.84  ? 54  GLN A CA  1 
ATOM   396  C C   A GLN A 1 53  ? -2.814  -18.184 50.400  0.42 55.82  ? 54  GLN A C   1 
ATOM   397  C C   B GLN A 1 53  ? -2.783  -18.208 50.382  0.58 55.84  ? 54  GLN A C   1 
ATOM   398  O O   A GLN A 1 53  ? -3.429  -19.163 50.822  0.42 54.06  ? 54  GLN A O   1 
ATOM   399  O O   B GLN A 1 53  ? -3.363  -19.219 50.777  0.58 54.05  ? 54  GLN A O   1 
ATOM   400  C CB  A GLN A 1 53  ? -4.295  -16.508 49.215  0.42 54.69  ? 54  GLN A CB  1 
ATOM   401  C CB  B GLN A 1 53  ? -4.258  -16.499 49.263  0.58 54.64  ? 54  GLN A CB  1 
ATOM   402  C CG  A GLN A 1 53  ? -4.620  -15.775 47.910  0.42 59.26  ? 54  GLN A CG  1 
ATOM   403  C CG  B GLN A 1 53  ? -4.293  -15.426 48.174  0.58 59.78  ? 54  GLN A CG  1 
ATOM   404  C CD  A GLN A 1 53  ? -5.892  -14.947 47.978  0.42 63.39  ? 54  GLN A CD  1 
ATOM   405  C CD  B GLN A 1 53  ? -3.031  -14.580 48.147  0.58 57.06  ? 54  GLN A CD  1 
ATOM   406  O OE1 A GLN A 1 53  ? -6.551  -14.877 49.015  0.42 57.63  ? 54  GLN A OE1 1 
ATOM   407  O OE1 B GLN A 1 53  ? -2.571  -14.097 49.185  0.58 65.99  ? 54  GLN A OE1 1 
ATOM   408  N NE2 A GLN A 1 53  ? -6.247  -14.321 46.859  0.42 65.00  ? 54  GLN A NE2 1 
ATOM   409  N NE2 B GLN A 1 53  ? -2.459  -14.406 46.964  0.58 51.38  ? 54  GLN A NE2 1 
ATOM   410  N N   . PRO A 1 54  ? -1.785  -17.631 51.067  1.00 59.63  ? 55  PRO A N   1 
ATOM   411  C CA  . PRO A 1 54  ? -1.364  -18.120 52.392  1.00 56.26  ? 55  PRO A CA  1 
ATOM   412  C C   . PRO A 1 54  ? -2.496  -18.214 53.426  1.00 56.20  ? 55  PRO A C   1 
ATOM   413  O O   . PRO A 1 54  ? -3.418  -17.403 53.441  1.00 52.30  ? 55  PRO A O   1 
ATOM   414  C CB  . PRO A 1 54  ? -0.297  -17.102 52.821  1.00 52.60  ? 55  PRO A CB  1 
ATOM   415  C CG  . PRO A 1 54  ? 0.281   -16.608 51.503  1.00 55.87  ? 55  PRO A CG  1 
ATOM   416  C CD  . PRO A 1 54  ? -0.898  -16.563 50.557  1.00 51.37  ? 55  PRO A CD  1 
ATOM   417  N N   . TRP A 1 55  ? -2.423  -19.243 54.264  1.00 52.37  ? 56  TRP A N   1 
ATOM   418  C CA  . TRP A 1 55  ? -3.412  -19.471 55.305  1.00 50.97  ? 56  TRP A CA  1 
ATOM   419  C C   . TRP A 1 55  ? -2.736  -19.438 56.681  1.00 53.26  ? 56  TRP A C   1 
ATOM   420  O O   . TRP A 1 55  ? -1.510  -19.619 56.815  1.00 49.96  ? 56  TRP A O   1 
ATOM   421  C CB  . TRP A 1 55  ? -4.107  -20.829 55.108  1.00 47.01  ? 56  TRP A CB  1 
ATOM   422  C CG  . TRP A 1 55  ? -3.130  -21.990 55.120  1.00 47.46  ? 56  TRP A CG  1 
ATOM   423  C CD1 . TRP A 1 55  ? -2.689  -22.679 56.209  1.00 46.50  ? 56  TRP A CD1 1 
ATOM   424  C CD2 . TRP A 1 55  ? -2.476  -22.577 53.980  1.00 53.29  ? 56  TRP A CD2 1 
ATOM   425  N NE1 . TRP A 1 55  ? -1.791  -23.650 55.828  1.00 56.51  ? 56  TRP A NE1 1 
ATOM   426  C CE2 . TRP A 1 55  ? -1.645  -23.610 54.462  1.00 48.51  ? 56  TRP A CE2 1 
ATOM   427  C CE3 . TRP A 1 55  ? -2.519  -22.331 52.599  1.00 52.87  ? 56  TRP A CE3 1 
ATOM   428  C CZ2 . TRP A 1 55  ? -0.862  -24.401 53.615  1.00 46.53  ? 56  TRP A CZ2 1 
ATOM   429  C CZ3 . TRP A 1 55  ? -1.730  -23.112 51.754  1.00 52.08  ? 56  TRP A CZ3 1 
ATOM   430  C CH2 . TRP A 1 55  ? -0.917  -24.136 52.268  1.00 50.57  ? 56  TRP A CH2 1 
ATOM   431  N N   . SER A 1 56  ? -3.537  -19.195 57.705  1.00 51.03  ? 57  SER A N   1 
ATOM   432  C CA  . SER A 1 56  ? -3.045  -19.291 59.071  1.00 60.01  ? 57  SER A CA  1 
ATOM   433  C C   . SER A 1 56  ? -3.580  -20.592 59.659  1.00 59.60  ? 57  SER A C   1 
ATOM   434  O O   . SER A 1 56  ? -4.488  -21.205 59.093  1.00 68.05  ? 57  SER A O   1 
ATOM   435  C CB  . SER A 1 56  ? -3.498  -18.079 59.887  1.00 67.71  ? 57  SER A CB  1 
ATOM   436  O OG  . SER A 1 56  ? -4.887  -17.844 59.718  1.00 72.46  ? 57  SER A OG  1 
ATOM   437  N N   . GLY A 1 57  ? -3.025  -21.026 60.783  1.00 62.17  ? 58  GLY A N   1 
ATOM   438  C CA  . GLY A 1 57  ? -3.425  -22.302 61.350  1.00 59.78  ? 58  GLY A CA  1 
ATOM   439  C C   . GLY A 1 57  ? -2.842  -23.484 60.580  1.00 67.57  ? 58  GLY A C   1 
ATOM   440  O O   . GLY A 1 57  ? -1.902  -23.339 59.793  1.00 55.44  ? 58  GLY A O   1 
ATOM   441  N N   . VAL A 1 58  ? -3.398  -24.666 60.804  1.00 58.61  ? 59  VAL A N   1 
ATOM   442  C CA  . VAL A 1 58  ? -2.832  -25.873 60.228  1.00 62.49  ? 59  VAL A CA  1 
ATOM   443  C C   . VAL A 1 58  ? -3.819  -26.546 59.290  1.00 64.44  ? 59  VAL A C   1 
ATOM   444  O O   . VAL A 1 58  ? -4.919  -26.918 59.709  1.00 54.03  ? 59  VAL A O   1 
ATOM   445  C CB  . VAL A 1 58  ? -2.424  -26.885 61.313  1.00 61.65  ? 59  VAL A CB  1 
ATOM   446  C CG1 . VAL A 1 58  ? -1.747  -28.094 60.666  1.00 53.09  ? 59  VAL A CG1 1 
ATOM   447  C CG2 . VAL A 1 58  ? -1.501  -26.227 62.356  1.00 55.11  ? 59  VAL A CG2 1 
ATOM   448  N N   . VAL A 1 59  ? -3.428  -26.700 58.024  1.00 57.94  ? 60  VAL A N   1 
ATOM   449  C CA  . VAL A 1 59  ? -4.255  -27.439 57.076  1.00 46.47  ? 60  VAL A CA  1 
ATOM   450  C C   . VAL A 1 59  ? -4.226  -28.940 57.378  1.00 50.10  ? 60  VAL A C   1 
ATOM   451  O O   . VAL A 1 59  ? -3.160  -29.557 57.511  1.00 51.55  ? 60  VAL A O   1 
ATOM   452  C CB  . VAL A 1 59  ? -3.863  -27.165 55.605  1.00 56.74  ? 60  VAL A CB  1 
ATOM   453  C CG1 . VAL A 1 59  ? -4.547  -28.170 54.653  1.00 48.39  ? 60  VAL A CG1 1 
ATOM   454  C CG2 . VAL A 1 59  ? -4.219  -25.732 55.224  1.00 50.83  ? 60  VAL A CG2 1 
ATOM   455  N N   . ASP A 1 60  ? -5.418  -29.508 57.511  1.00 49.26  ? 61  ASP A N   1 
ATOM   456  C CA  . ASP A 1 60  ? -5.594  -30.948 57.649  1.00 60.63  ? 61  ASP A CA  1 
ATOM   457  C C   . ASP A 1 60  ? -5.291  -31.653 56.323  1.00 59.33  ? 61  ASP A C   1 
ATOM   458  O O   . ASP A 1 60  ? -6.080  -31.583 55.385  1.00 59.18  ? 61  ASP A O   1 
ATOM   459  C CB  . ASP A 1 60  ? -7.036  -31.241 58.070  1.00 55.30  ? 61  ASP A CB  1 
ATOM   460  C CG  . ASP A 1 60  ? -7.369  -32.714 58.025  1.00 68.18  ? 61  ASP A CG  1 
ATOM   461  O OD1 . ASP A 1 60  ? -6.449  -33.540 58.192  1.00 70.99  ? 61  ASP A OD1 1 
ATOM   462  O OD2 . ASP A 1 60  ? -8.556  -33.047 57.822  1.00 83.64  ? 61  ASP A OD2 1 
ATOM   463  N N   . ALA A 1 61  ? -4.152  -32.324 56.235  1.00 52.71  ? 62  ALA A N   1 
ATOM   464  C CA  . ALA A 1 61  ? -3.831  -33.030 55.006  1.00 47.84  ? 62  ALA A CA  1 
ATOM   465  C C   . ALA A 1 61  ? -3.820  -34.535 55.229  1.00 45.35  ? 62  ALA A C   1 
ATOM   466  O O   . ALA A 1 61  ? -2.846  -35.205 54.875  1.00 42.03  ? 62  ALA A O   1 
ATOM   467  C CB  . ALA A 1 61  ? -2.490  -32.569 54.455  1.00 43.99  ? 62  ALA A CB  1 
ATOM   468  N N   . THR A 1 62  ? -4.905  -35.065 55.792  1.00 46.33  ? 63  THR A N   1 
ATOM   469  C CA  . THR A 1 62  ? -4.963  -36.481 56.182  1.00 54.28  ? 63  THR A CA  1 
ATOM   470  C C   . THR A 1 62  ? -5.890  -37.290 55.282  1.00 45.89  ? 63  THR A C   1 
ATOM   471  O O   . THR A 1 62  ? -5.971  -38.514 55.414  1.00 47.87  ? 63  THR A O   1 
ATOM   472  C CB  . THR A 1 62  ? -5.484  -36.679 57.645  1.00 49.47  ? 63  THR A CB  1 
ATOM   473  O OG1 . THR A 1 62  ? -6.765  -36.055 57.765  1.00 51.13  ? 63  THR A OG1 1 
ATOM   474  C CG2 . THR A 1 62  ? -4.536  -36.090 58.667  1.00 44.22  ? 63  THR A CG2 1 
ATOM   475  N N   . THR A 1 63  ? -6.593  -36.614 54.376  1.00 52.79  ? 64  THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? -7.559  -37.291 53.516  1.00 45.28  ? 64  THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? -7.606  -36.698 52.090  1.00 56.30  ? 64  THR A C   1 
ATOM   478  O O   . THR A 1 63  ? -7.329  -35.512 51.903  1.00 45.97  ? 64  THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? -8.976  -37.288 54.187  1.00 56.06  ? 64  THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? -9.888  -38.085 53.427  1.00 72.16  ? 64  THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? -9.528  -35.893 54.304  1.00 46.35  ? 64  THR A CG2 1 
ATOM   482  N N   . PHE A 1 64  ? -7.945  -37.522 51.092  1.00 43.17  ? 65  PHE A N   1 
ATOM   483  C CA  . PHE A 1 64  ? -8.098  -37.024 49.731  1.00 49.32  ? 65  PHE A CA  1 
ATOM   484  C C   . PHE A 1 64  ? -9.216  -35.992 49.675  1.00 48.82  ? 65  PHE A C   1 
ATOM   485  O O   . PHE A 1 64  ? -10.204 -36.078 50.393  1.00 51.16  ? 65  PHE A O   1 
ATOM   486  C CB  . PHE A 1 64  ? -8.389  -38.153 48.740  1.00 39.46  ? 65  PHE A CB  1 
ATOM   487  C CG  . PHE A 1 64  ? -7.201  -39.014 48.430  1.00 44.24  ? 65  PHE A CG  1 
ATOM   488  C CD1 . PHE A 1 64  ? -6.079  -38.482 47.818  1.00 40.13  ? 65  PHE A CD1 1 
ATOM   489  C CD2 . PHE A 1 64  ? -7.223  -40.366 48.713  1.00 43.11  ? 65  PHE A CD2 1 
ATOM   490  C CE1 . PHE A 1 64  ? -4.981  -39.287 47.510  1.00 38.61  ? 65  PHE A CE1 1 
ATOM   491  C CE2 . PHE A 1 64  ? -6.141  -41.174 48.407  1.00 40.94  ? 65  PHE A CE2 1 
ATOM   492  C CZ  . PHE A 1 64  ? -5.017  -40.632 47.801  1.00 47.57  ? 65  PHE A CZ  1 
ATOM   493  N N   . GLN A 1 65  ? -9.029  -34.999 48.826  1.00 42.94  ? 66  GLN A N   1 
ATOM   494  C CA  . GLN A 1 65  ? -10.035 -33.986 48.597  1.00 42.81  ? 66  GLN A CA  1 
ATOM   495  C C   . GLN A 1 65  ? -10.960 -34.356 47.424  1.00 42.59  ? 66  GLN A C   1 
ATOM   496  O O   . GLN A 1 65  ? -10.830 -35.419 46.800  1.00 40.84  ? 66  GLN A O   1 
ATOM   497  C CB  . GLN A 1 65  ? -9.335  -32.658 48.312  1.00 47.68  ? 66  GLN A CB  1 
ATOM   498  C CG  . GLN A 1 65  ? -9.174  -31.766 49.518  1.00 46.50  ? 66  GLN A CG  1 
ATOM   499  C CD  . GLN A 1 65  ? -10.481 -31.112 49.910  1.00 50.93  ? 66  GLN A CD  1 
ATOM   500  O OE1 . GLN A 1 65  ? -11.484 -31.203 49.192  1.00 57.16  ? 66  GLN A OE1 1 
ATOM   501  N NE2 . GLN A 1 65  ? -10.476 -30.437 51.038  1.00 48.97  ? 66  GLN A NE2 1 
ATOM   502  N N   . SER A 1 66  ? -11.883 -33.452 47.132  1.00 33.93  ? 67  SER A N   1 
ATOM   503  C CA  . SER A 1 66  ? -12.924 -33.640 46.145  1.00 42.63  ? 67  SER A CA  1 
ATOM   504  C C   . SER A 1 66  ? -12.401 -33.931 44.730  1.00 50.20  ? 67  SER A C   1 
ATOM   505  O O   . SER A 1 66  ? -11.305 -33.503 44.358  1.00 41.93  ? 67  SER A O   1 
ATOM   506  C CB  . SER A 1 66  ? -13.790 -32.383 46.120  1.00 44.38  ? 67  SER A CB  1 
ATOM   507  O OG  . SER A 1 66  ? -14.471 -32.220 47.362  1.00 51.12  ? 67  SER A OG  1 
ATOM   508  N N   . VAL A 1 67  ? -13.192 -34.659 43.949  1.00 43.01  ? 68  VAL A N   1 
ATOM   509  C CA  . VAL A 1 67  ? -12.848 -34.939 42.548  1.00 44.53  ? 68  VAL A CA  1 
ATOM   510  C C   . VAL A 1 67  ? -13.395 -33.819 41.661  1.00 41.35  ? 68  VAL A C   1 
ATOM   511  O O   . VAL A 1 67  ? -14.494 -33.330 41.892  1.00 44.84  ? 68  VAL A O   1 
ATOM   512  C CB  . VAL A 1 67  ? -13.400 -36.319 42.086  1.00 38.24  ? 68  VAL A CB  1 
ATOM   513  C CG1 . VAL A 1 67  ? -13.235 -36.519 40.555  1.00 35.22  ? 68  VAL A CG1 1 
ATOM   514  C CG2 . VAL A 1 67  ? -12.719 -37.446 42.845  1.00 39.48  ? 68  VAL A CG2 1 
ATOM   515  N N   . CYS A 1 68  ? -12.619 -33.397 40.669  1.00 40.02  ? 69  CYS A N   1 
ATOM   516  C CA  . CYS A 1 68  ? -13.065 -32.377 39.722  1.00 43.41  ? 69  CYS A CA  1 
ATOM   517  C C   . CYS A 1 68  ? -14.327 -32.839 39.001  1.00 45.22  ? 69  CYS A C   1 
ATOM   518  O O   . CYS A 1 68  ? -14.412 -33.999 38.590  1.00 40.41  ? 69  CYS A O   1 
ATOM   519  C CB  . CYS A 1 68  ? -11.947 -32.075 38.711  1.00 44.11  ? 69  CYS A CB  1 
ATOM   520  S SG  . CYS A 1 68  ? -10.562 -31.153 39.466  1.00 48.36  ? 69  CYS A SG  1 
ATOM   521  N N   . TYR A 1 69  ? -15.304 -31.942 38.868  1.00 43.35  ? 70  TYR A N   1 
ATOM   522  C CA  . TYR A 1 69  ? -16.559 -32.252 38.179  1.00 43.85  ? 70  TYR A CA  1 
ATOM   523  C C   . TYR A 1 69  ? -16.363 -32.953 36.836  1.00 48.17  ? 70  TYR A C   1 
ATOM   524  O O   . TYR A 1 69  ? -15.662 -32.447 35.967  1.00 44.80  ? 70  TYR A O   1 
ATOM   525  C CB  . TYR A 1 69  ? -17.406 -30.999 37.983  1.00 49.59  ? 70  TYR A CB  1 
ATOM   526  C CG  . TYR A 1 69  ? -18.672 -31.038 38.793  1.00 49.03  ? 70  TYR A CG  1 
ATOM   527  C CD1 . TYR A 1 69  ? -18.722 -30.447 40.049  1.00 50.01  ? 70  TYR A CD1 1 
ATOM   528  C CD2 . TYR A 1 69  ? -19.808 -31.702 38.329  1.00 52.71  ? 70  TYR A CD2 1 
ATOM   529  C CE1 . TYR A 1 69  ? -19.861 -30.483 40.807  1.00 53.23  ? 70  TYR A CE1 1 
ATOM   530  C CE2 . TYR A 1 69  ? -20.970 -31.755 39.106  1.00 50.63  ? 70  TYR A CE2 1 
ATOM   531  C CZ  . TYR A 1 69  ? -20.976 -31.144 40.341  1.00 53.58  ? 70  TYR A CZ  1 
ATOM   532  O OH  . TYR A 1 69  ? -22.101 -31.159 41.133  1.00 75.13  ? 70  TYR A OH  1 
ATOM   533  N N   . GLN A 1 70  ? -16.972 -34.130 36.688  1.00 41.16  ? 71  GLN A N   1 
ATOM   534  C CA  . GLN A 1 70  ? -16.819 -34.922 35.473  1.00 42.77  ? 71  GLN A CA  1 
ATOM   535  C C   . GLN A 1 70  ? -17.974 -35.896 35.263  1.00 47.43  ? 71  GLN A C   1 
ATOM   536  O O   . GLN A 1 70  ? -18.747 -36.175 36.183  1.00 47.30  ? 71  GLN A O   1 
ATOM   537  C CB  . GLN A 1 70  ? -15.540 -35.737 35.556  1.00 39.09  ? 71  GLN A CB  1 
ATOM   538  C CG  . GLN A 1 70  ? -15.489 -36.673 36.772  1.00 37.82  ? 71  GLN A CG  1 
ATOM   539  C CD  . GLN A 1 70  ? -14.101 -37.242 36.972  1.00 41.53  ? 71  GLN A CD  1 
ATOM   540  O OE1 . GLN A 1 70  ? -13.851 -38.422 36.720  1.00 38.48  ? 71  GLN A OE1 1 
ATOM   541  N NE2 . GLN A 1 70  ? -13.178 -36.391 37.401  1.00 40.68  ? 71  GLN A NE2 1 
ATOM   542  N N   . TYR A 1 71  ? -18.040 -36.436 34.050  1.00 44.30  ? 72  TYR A N   1 
ATOM   543  C CA  . TYR A 1 71  ? -18.992 -37.467 33.671  1.00 38.95  ? 72  TYR A CA  1 
ATOM   544  C C   . TYR A 1 71  ? -18.697 -38.759 34.426  1.00 45.51  ? 72  TYR A C   1 
ATOM   545  O O   . TYR A 1 71  ? -17.528 -39.093 34.668  1.00 47.20  ? 72  TYR A O   1 
ATOM   546  C CB  . TYR A 1 71  ? -18.931 -37.688 32.147  1.00 40.94  ? 72  TYR A CB  1 
ATOM   547  C CG  . TYR A 1 71  ? -19.739 -38.864 31.654  1.00 47.73  ? 72  TYR A CG  1 
ATOM   548  C CD1 . TYR A 1 71  ? -21.105 -38.740 31.385  1.00 50.60  ? 72  TYR A CD1 1 
ATOM   549  C CD2 . TYR A 1 71  ? -19.139 -40.104 31.452  1.00 48.95  ? 72  TYR A CD2 1 
ATOM   550  C CE1 . TYR A 1 71  ? -21.857 -39.838 30.930  1.00 48.16  ? 72  TYR A CE1 1 
ATOM   551  C CE2 . TYR A 1 71  ? -19.875 -41.202 31.002  1.00 45.19  ? 72  TYR A CE2 1 
ATOM   552  C CZ  . TYR A 1 71  ? -21.229 -41.067 30.753  1.00 52.93  ? 72  TYR A CZ  1 
ATOM   553  O OH  . TYR A 1 71  ? -21.935 -42.168 30.326  1.00 59.12  ? 72  TYR A OH  1 
ATOM   554  N N   . VAL A 1 72  ? -19.759 -39.462 34.824  1.00 44.57  ? 73  VAL A N   1 
ATOM   555  C CA  . VAL A 1 72  ? -19.652 -40.722 35.567  1.00 45.67  ? 73  VAL A CA  1 
ATOM   556  C C   . VAL A 1 72  ? -20.174 -41.876 34.709  1.00 49.84  ? 73  VAL A C   1 
ATOM   557  O O   . VAL A 1 72  ? -21.317 -41.867 34.262  1.00 55.59  ? 73  VAL A O   1 
ATOM   558  C CB  . VAL A 1 72  ? -20.431 -40.670 36.917  1.00 47.78  ? 73  VAL A CB  1 
ATOM   559  C CG1 . VAL A 1 72  ? -20.395 -42.021 37.623  1.00 54.54  ? 73  VAL A CG1 1 
ATOM   560  C CG2 . VAL A 1 72  ? -19.865 -39.594 37.819  1.00 50.76  ? 73  VAL A CG2 1 
ATOM   561  N N   . ASP A 1 73  ? -19.318 -42.860 34.477  1.00 56.48  ? 74  ASP A N   1 
ATOM   562  C CA  . ASP A 1 73  ? -19.628 -43.980 33.594  1.00 53.06  ? 74  ASP A CA  1 
ATOM   563  C C   . ASP A 1 73  ? -20.754 -44.864 34.119  1.00 54.76  ? 74  ASP A C   1 
ATOM   564  O O   . ASP A 1 73  ? -20.702 -45.324 35.256  1.00 50.65  ? 74  ASP A O   1 
ATOM   565  C CB  . ASP A 1 73  ? -18.375 -44.834 33.392  1.00 59.04  ? 74  ASP A CB  1 
ATOM   566  C CG  . ASP A 1 73  ? -18.414 -45.630 32.099  1.00 62.55  ? 74  ASP A CG  1 
ATOM   567  O OD1 . ASP A 1 73  ? -18.873 -46.789 32.123  1.00 61.73  ? 74  ASP A OD1 1 
ATOM   568  O OD2 . ASP A 1 73  ? -17.983 -45.088 31.058  1.00 66.25  ? 74  ASP A OD2 1 
ATOM   569  N N   . THR A 1 74  ? -21.753 -45.126 33.277  1.00 57.99  ? 75  THR A N   1 
ATOM   570  C CA  . THR A 1 74  ? -22.870 -45.995 33.659  1.00 75.72  ? 75  THR A CA  1 
ATOM   571  C C   . THR A 1 74  ? -23.127 -47.150 32.677  1.00 65.90  ? 75  THR A C   1 
ATOM   572  O O   . THR A 1 74  ? -24.194 -47.755 32.702  1.00 63.40  ? 75  THR A O   1 
ATOM   573  C CB  . THR A 1 74  ? -24.189 -45.198 33.846  1.00 70.31  ? 75  THR A CB  1 
ATOM   574  O OG1 . THR A 1 74  ? -24.326 -44.253 32.782  1.00 73.70  ? 75  THR A OG1 1 
ATOM   575  C CG2 . THR A 1 74  ? -24.198 -44.461 35.161  1.00 59.86  ? 75  THR A CG2 1 
ATOM   576  N N   . LEU A 1 75  ? -22.156 -47.459 31.824  1.00 65.60  ? 76  LEU A N   1 
ATOM   577  C CA  . LEU A 1 75  ? -22.314 -48.558 30.870  1.00 65.66  ? 76  LEU A CA  1 
ATOM   578  C C   . LEU A 1 75  ? -22.550 -49.903 31.564  1.00 66.31  ? 76  LEU A C   1 
ATOM   579  O O   . LEU A 1 75  ? -23.350 -50.711 31.092  1.00 69.51  ? 76  LEU A O   1 
ATOM   580  C CB  . LEU A 1 75  ? -21.100 -48.664 29.937  1.00 57.35  ? 76  LEU A CB  1 
ATOM   581  C CG  . LEU A 1 75  ? -21.219 -49.700 28.813  1.00 67.33  ? 76  LEU A CG  1 
ATOM   582  C CD1 . LEU A 1 75  ? -22.401 -49.368 27.926  1.00 56.79  ? 76  LEU A CD1 1 
ATOM   583  C CD2 . LEU A 1 75  ? -19.946 -49.789 27.974  1.00 62.31  ? 76  LEU A CD2 1 
ATOM   584  N N   . TYR A 1 76  ? -21.847 -50.142 32.669  1.00 59.46  ? 77  TYR A N   1 
ATOM   585  C CA  . TYR A 1 76  ? -21.972 -51.396 33.406  1.00 54.90  ? 77  TYR A CA  1 
ATOM   586  C C   . TYR A 1 76  ? -22.021 -51.165 34.925  1.00 61.39  ? 77  TYR A C   1 
ATOM   587  O O   . TYR A 1 76  ? -21.041 -51.422 35.634  1.00 64.03  ? 77  TYR A O   1 
ATOM   588  C CB  . TYR A 1 76  ? -20.810 -52.340 33.066  1.00 59.13  ? 77  TYR A CB  1 
ATOM   589  C CG  . TYR A 1 76  ? -20.709 -52.795 31.609  1.00 61.73  ? 77  TYR A CG  1 
ATOM   590  C CD1 . TYR A 1 76  ? -21.647 -53.662 31.049  1.00 66.12  ? 77  TYR A CD1 1 
ATOM   591  C CD2 . TYR A 1 76  ? -19.648 -52.383 30.808  1.00 65.34  ? 77  TYR A CD2 1 
ATOM   592  C CE1 . TYR A 1 76  ? -21.544 -54.081 29.708  1.00 63.55  ? 77  TYR A CE1 1 
ATOM   593  C CE2 . TYR A 1 76  ? -19.530 -52.801 29.475  1.00 67.67  ? 77  TYR A CE2 1 
ATOM   594  C CZ  . TYR A 1 76  ? -20.478 -53.644 28.927  1.00 64.34  ? 77  TYR A CZ  1 
ATOM   595  O OH  . TYR A 1 76  ? -20.342 -54.042 27.603  1.00 64.89  ? 77  TYR A OH  1 
ATOM   596  N N   . PRO A 1 77  ? -23.161 -50.681 35.438  1.00 68.04  ? 78  PRO A N   1 
ATOM   597  C CA  . PRO A 1 77  ? -23.270 -50.319 36.864  1.00 53.21  ? 78  PRO A CA  1 
ATOM   598  C C   . PRO A 1 77  ? -22.817 -51.410 37.821  1.00 56.53  ? 78  PRO A C   1 
ATOM   599  O O   . PRO A 1 77  ? -23.194 -52.559 37.655  1.00 64.17  ? 78  PRO A O   1 
ATOM   600  C CB  . PRO A 1 77  ? -24.761 -50.046 37.038  1.00 55.57  ? 78  PRO A CB  1 
ATOM   601  C CG  . PRO A 1 77  ? -25.196 -49.554 35.687  1.00 60.13  ? 78  PRO A CG  1 
ATOM   602  C CD  . PRO A 1 77  ? -24.395 -50.372 34.691  1.00 65.66  ? 78  PRO A CD  1 
ATOM   603  N N   . GLY A 1 78  ? -22.006 -51.043 38.809  1.00 59.49  ? 79  GLY A N   1 
ATOM   604  C CA  . GLY A 1 78  ? -21.527 -51.987 39.808  1.00 55.20  ? 79  GLY A CA  1 
ATOM   605  C C   . GLY A 1 78  ? -20.344 -52.852 39.380  1.00 55.84  ? 79  GLY A C   1 
ATOM   606  O O   . GLY A 1 78  ? -19.743 -53.539 40.193  1.00 51.10  ? 79  GLY A O   1 
ATOM   607  N N   . PHE A 1 79  ? -20.004 -52.817 38.097  1.00 55.13  ? 80  PHE A N   1 
ATOM   608  C CA  . PHE A 1 79  ? -18.931 -53.651 37.551  1.00 50.17  ? 80  PHE A CA  1 
ATOM   609  C C   . PHE A 1 79  ? -17.563 -53.067 37.916  1.00 49.62  ? 80  PHE A C   1 
ATOM   610  O O   . PHE A 1 79  ? -17.308 -51.881 37.705  1.00 52.57  ? 80  PHE A O   1 
ATOM   611  C CB  . PHE A 1 79  ? -19.116 -53.768 36.022  1.00 46.82  ? 80  PHE A CB  1 
ATOM   612  C CG  . PHE A 1 79  ? -17.996 -54.469 35.304  1.00 55.08  ? 80  PHE A CG  1 
ATOM   613  C CD1 . PHE A 1 79  ? -17.665 -55.786 35.605  1.00 50.39  ? 80  PHE A CD1 1 
ATOM   614  C CD2 . PHE A 1 79  ? -17.306 -53.825 34.283  1.00 53.80  ? 80  PHE A CD2 1 
ATOM   615  C CE1 . PHE A 1 79  ? -16.646 -56.435 34.931  1.00 47.89  ? 80  PHE A CE1 1 
ATOM   616  C CE2 . PHE A 1 79  ? -16.291 -54.476 33.593  1.00 44.66  ? 80  PHE A CE2 1 
ATOM   617  C CZ  . PHE A 1 79  ? -15.959 -55.776 33.916  1.00 46.26  ? 80  PHE A CZ  1 
ATOM   618  N N   . GLU A 1 80  ? -16.689 -53.909 38.456  1.00 46.69  ? 81  GLU A N   1 
ATOM   619  C CA  . GLU A 1 80  ? -15.350 -53.491 38.882  1.00 55.95  ? 81  GLU A CA  1 
ATOM   620  C C   . GLU A 1 80  ? -14.519 -52.814 37.764  1.00 57.99  ? 81  GLU A C   1 
ATOM   621  O O   . GLU A 1 80  ? -13.895 -51.764 37.978  1.00 53.16  ? 81  GLU A O   1 
ATOM   622  C CB  . GLU A 1 80  ? -14.598 -54.697 39.457  1.00 50.78  ? 81  GLU A CB  1 
ATOM   623  C CG  . GLU A 1 80  ? -13.789 -54.411 40.715  1.00 71.56  ? 81  GLU A CG  1 
ATOM   624  C CD  . GLU A 1 80  ? -12.488 -53.685 40.424  1.00 80.39  ? 81  GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 80  ? -11.981 -53.826 39.288  1.00 82.37  ? 81  GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 80  ? -11.974 -52.975 41.324  1.00 79.27  ? 81  GLU A OE2 1 
ATOM   627  N N   . GLY A 1 81  ? -14.531 -53.412 36.573  1.00 56.61  ? 82  GLY A N   1 
ATOM   628  C CA  . GLY A 1 81  ? -13.731 -52.925 35.457  1.00 48.64  ? 82  GLY A CA  1 
ATOM   629  C C   . GLY A 1 81  ? -14.000 -51.486 35.064  1.00 47.80  ? 82  GLY A C   1 
ATOM   630  O O   . GLY A 1 81  ? -13.104 -50.799 34.555  1.00 49.28  ? 82  GLY A O   1 
ATOM   631  N N   . THR A 1 82  ? -15.224 -51.014 35.290  1.00 49.24  ? 83  THR A N   1 
ATOM   632  C CA  . THR A 1 82  ? -15.518 -49.603 35.051  1.00 49.95  ? 83  THR A CA  1 
ATOM   633  C C   . THR A 1 82  ? -15.506 -48.748 36.334  1.00 52.55  ? 83  THR A C   1 
ATOM   634  O O   . THR A 1 82  ? -15.128 -47.576 36.293  1.00 52.38  ? 83  THR A O   1 
ATOM   635  C CB  . THR A 1 82  ? -16.854 -49.383 34.302  1.00 56.98  ? 83  THR A CB  1 
ATOM   636  O OG1 . THR A 1 82  ? -17.933 -49.974 35.041  1.00 59.61  ? 83  THR A OG1 1 
ATOM   637  C CG2 . THR A 1 82  ? -16.792 -49.971 32.899  1.00 50.59  ? 83  THR A CG2 1 
ATOM   638  N N   . GLU A 1 83  ? -15.925 -49.318 37.459  1.00 48.12  ? 84  GLU A N   1 
ATOM   639  C CA  . GLU A 1 83  ? -16.050 -48.530 38.686  1.00 50.79  ? 84  GLU A CA  1 
ATOM   640  C C   . GLU A 1 83  ? -14.695 -48.089 39.260  1.00 48.37  ? 84  GLU A C   1 
ATOM   641  O O   . GLU A 1 83  ? -14.595 -47.027 39.872  1.00 46.95  ? 84  GLU A O   1 
ATOM   642  C CB  . GLU A 1 83  ? -16.876 -49.266 39.762  1.00 53.64  ? 84  GLU A CB  1 
ATOM   643  C CG  . GLU A 1 83  ? -18.337 -49.555 39.369  1.00 56.83  ? 84  GLU A CG  1 
ATOM   644  C CD  . GLU A 1 83  ? -19.254 -48.331 39.376  1.00 60.65  ? 84  GLU A CD  1 
ATOM   645  O OE1 . GLU A 1 83  ? -20.473 -48.503 39.106  1.00 57.39  ? 84  GLU A OE1 1 
ATOM   646  O OE2 . GLU A 1 83  ? -18.773 -47.203 39.648  1.00 53.82  ? 84  GLU A OE2 1 
ATOM   647  N N   . MET A 1 84  ? -13.663 -48.906 39.060  1.00 41.46  ? 85  MET A N   1 
ATOM   648  C CA  . MET A 1 84  ? -12.310 -48.563 39.498  1.00 40.94  ? 85  MET A CA  1 
ATOM   649  C C   . MET A 1 84  ? -11.798 -47.245 38.885  1.00 44.59  ? 85  MET A C   1 
ATOM   650  O O   . MET A 1 84  ? -10.840 -46.671 39.395  1.00 45.83  ? 85  MET A O   1 
ATOM   651  C CB  . MET A 1 84  ? -11.334 -49.694 39.175  1.00 38.58  ? 85  MET A CB  1 
ATOM   652  C CG  . MET A 1 84  ? -11.102 -49.881 37.620  1.00 39.76  ? 85  MET A CG  1 
ATOM   653  S SD  . MET A 1 84  ? -10.016 -51.282 37.250  1.00 50.09  ? 85  MET A SD  1 
ATOM   654  C CE  . MET A 1 84  ? -8.377  -50.602 37.603  1.00 44.44  ? 85  MET A CE  1 
ATOM   655  N N   . TRP A 1 85  ? -12.435 -46.771 37.806  1.00 44.99  ? 86  TRP A N   1 
ATOM   656  C CA  . TRP A 1 85  ? -12.046 -45.517 37.136  1.00 42.14  ? 86  TRP A CA  1 
ATOM   657  C C   . TRP A 1 85  ? -12.957 -44.340 37.516  1.00 47.21  ? 86  TRP A C   1 
ATOM   658  O O   . TRP A 1 85  ? -12.646 -43.187 37.217  1.00 44.77  ? 86  TRP A O   1 
ATOM   659  C CB  . TRP A 1 85  ? -12.020 -45.673 35.590  1.00 39.52  ? 86  TRP A CB  1 
ATOM   660  C CG  . TRP A 1 85  ? -11.155 -46.820 35.105  1.00 48.13  ? 86  TRP A CG  1 
ATOM   661  C CD1 . TRP A 1 85  ? -11.580 -47.982 34.507  1.00 39.43  ? 86  TRP A CD1 1 
ATOM   662  C CD2 . TRP A 1 85  ? -9.720  -46.927 35.215  1.00 46.30  ? 86  TRP A CD2 1 
ATOM   663  N NE1 . TRP A 1 85  ? -10.501 -48.793 34.235  1.00 42.94  ? 86  TRP A NE1 1 
ATOM   664  C CE2 . TRP A 1 85  ? -9.350  -48.176 34.664  1.00 43.00  ? 86  TRP A CE2 1 
ATOM   665  C CE3 . TRP A 1 85  ? -8.717  -46.090 35.738  1.00 41.58  ? 86  TRP A CE3 1 
ATOM   666  C CZ2 . TRP A 1 85  ? -8.009  -48.605 34.596  1.00 43.91  ? 86  TRP A CZ2 1 
ATOM   667  C CZ3 . TRP A 1 85  ? -7.386  -46.517 35.685  1.00 40.50  ? 86  TRP A CZ3 1 
ATOM   668  C CH2 . TRP A 1 85  ? -7.044  -47.769 35.111  1.00 39.40  ? 86  TRP A CH2 1 
ATOM   669  N N   . ASN A 1 86  ? -14.092 -44.646 38.140  1.00 43.94  ? 87  ASN A N   1 
ATOM   670  C CA  . ASN A 1 86  ? -15.081 -43.642 38.522  1.00 44.02  ? 87  ASN A CA  1 
ATOM   671  C C   . ASN A 1 86  ? -14.664 -42.881 39.792  1.00 43.80  ? 87  ASN A C   1 
ATOM   672  O O   . ASN A 1 86  ? -13.857 -43.379 40.583  1.00 41.50  ? 87  ASN A O   1 
ATOM   673  C CB  . ASN A 1 86  ? -16.453 -44.307 38.730  1.00 45.71  ? 87  ASN A CB  1 
ATOM   674  C CG  . ASN A 1 86  ? -17.242 -44.481 37.422  1.00 56.03  ? 87  ASN A CG  1 
ATOM   675  O OD1 . ASN A 1 86  ? -17.050 -43.745 36.447  1.00 51.17  ? 87  ASN A OD1 1 
ATOM   676  N ND2 . ASN A 1 86  ? -18.156 -45.449 37.415  1.00 53.59  ? 87  ASN A ND2 1 
ATOM   677  N N   . PRO A 1 87  ? -15.206 -41.663 39.981  1.00 37.47  ? 88  PRO A N   1 
ATOM   678  C CA  . PRO A 1 87  ? -14.895 -40.848 41.158  1.00 37.49  ? 88  PRO A CA  1 
ATOM   679  C C   . PRO A 1 87  ? -15.154 -41.611 42.454  1.00 48.35  ? 88  PRO A C   1 
ATOM   680  O O   . PRO A 1 87  ? -16.176 -42.282 42.578  1.00 46.83  ? 88  PRO A O   1 
ATOM   681  C CB  . PRO A 1 87  ? -15.859 -39.666 41.037  1.00 39.19  ? 88  PRO A CB  1 
ATOM   682  C CG  . PRO A 1 87  ? -16.159 -39.573 39.552  1.00 39.73  ? 88  PRO A CG  1 
ATOM   683  C CD  . PRO A 1 87  ? -16.074 -40.957 39.016  1.00 38.53  ? 88  PRO A CD  1 
ATOM   684  N N   . ASN A 1 88  ? -14.226 -41.520 43.399  1.00 41.25  ? 89  ASN A N   1 
ATOM   685  C CA  . ASN A 1 88  ? -14.379 -42.197 44.678  1.00 39.43  ? 89  ASN A CA  1 
ATOM   686  C C   . ASN A 1 88  ? -14.415 -41.187 45.836  1.00 41.39  ? 89  ASN A C   1 
ATOM   687  O O   . ASN A 1 88  ? -14.229 -41.559 46.986  1.00 50.08  ? 89  ASN A O   1 
ATOM   688  C CB  . ASN A 1 88  ? -13.264 -43.235 44.878  1.00 37.38  ? 89  ASN A CB  1 
ATOM   689  C CG  . ASN A 1 88  ? -11.872 -42.589 44.978  1.00 49.52  ? 89  ASN A CG  1 
ATOM   690  O OD1 . ASN A 1 88  ? -11.696 -41.429 44.619  1.00 50.51  ? 89  ASN A OD1 1 
ATOM   691  N ND2 . ASN A 1 88  ? -10.890 -43.339 45.466  1.00 43.85  ? 89  ASN A ND2 1 
ATOM   692  N N   . ARG A 1 89  ? -14.609 -39.909 45.508  1.00 41.49  ? 90  ARG A N   1 
ATOM   693  C CA  . ARG A 1 89  ? -14.945 -38.864 46.493  1.00 43.72  ? 90  ARG A CA  1 
ATOM   694  C C   . ARG A 1 89  ? -15.992 -37.996 45.835  1.00 45.67  ? 90  ARG A C   1 
ATOM   695  O O   . ARG A 1 89  ? -16.291 -38.176 44.646  1.00 42.37  ? 90  ARG A O   1 
ATOM   696  C CB  . ARG A 1 89  ? -13.733 -37.994 46.874  1.00 40.89  ? 90  ARG A CB  1 
ATOM   697  C CG  . ARG A 1 89  ? -12.616 -38.751 47.551  1.00 43.05  ? 90  ARG A CG  1 
ATOM   698  C CD  . ARG A 1 89  ? -13.021 -39.164 49.016  1.00 46.74  ? 90  ARG A CD  1 
ATOM   699  N NE  . ARG A 1 89  ? -11.885 -39.738 49.730  1.00 50.21  ? 90  ARG A NE  1 
ATOM   700  C CZ  . ARG A 1 89  ? -11.492 -41.012 49.642  1.00 55.73  ? 90  ARG A CZ  1 
ATOM   701  N NH1 . ARG A 1 89  ? -12.151 -41.865 48.874  1.00 50.87  ? 90  ARG A NH1 1 
ATOM   702  N NH2 . ARG A 1 89  ? -10.437 -41.441 50.328  1.00 50.39  ? 90  ARG A NH2 1 
ATOM   703  N N   . GLU A 1 90  ? -16.527 -37.035 46.574  1.00 40.39  ? 91  GLU A N   1 
ATOM   704  C CA  . GLU A 1 90  ? -17.597 -36.197 46.038  1.00 44.66  ? 91  GLU A CA  1 
ATOM   705  C C   . GLU A 1 90  ? -17.074 -35.284 44.933  1.00 55.02  ? 91  GLU A C   1 
ATOM   706  O O   . GLU A 1 90  ? -15.895 -34.905 44.923  1.00 47.94  ? 91  GLU A O   1 
ATOM   707  C CB  . GLU A 1 90  ? -18.258 -35.363 47.143  1.00 52.10  ? 91  GLU A CB  1 
ATOM   708  C CG  . GLU A 1 90  ? -17.466 -34.135 47.586  1.00 67.18  ? 91  GLU A CG  1 
ATOM   709  C CD  . GLU A 1 90  ? -18.312 -33.123 48.374  1.00 92.04  ? 91  GLU A CD  1 
ATOM   710  O OE1 . GLU A 1 90  ? -19.374 -33.522 48.912  1.00 94.59  ? 91  GLU A OE1 1 
ATOM   711  O OE2 . GLU A 1 90  ? -17.915 -31.929 48.447  1.00 80.55  ? 91  GLU A OE2 1 
ATOM   712  N N   . LEU A 1 91  ? -17.958 -34.934 44.006  1.00 43.14  ? 92  LEU A N   1 
ATOM   713  C CA  . LEU A 1 91  ? -17.609 -34.033 42.911  1.00 50.14  ? 92  LEU A CA  1 
ATOM   714  C C   . LEU A 1 91  ? -17.680 -32.581 43.376  1.00 49.76  ? 92  LEU A C   1 
ATOM   715  O O   . LEU A 1 91  ? -18.619 -32.195 44.060  1.00 49.07  ? 92  LEU A O   1 
ATOM   716  C CB  . LEU A 1 91  ? -18.564 -34.230 41.713  1.00 42.63  ? 92  LEU A CB  1 
ATOM   717  C CG  . LEU A 1 91  ? -18.587 -35.557 40.958  1.00 48.31  ? 92  LEU A CG  1 
ATOM   718  C CD1 . LEU A 1 91  ? -19.561 -35.489 39.787  1.00 37.47  ? 92  LEU A CD1 1 
ATOM   719  C CD2 . LEU A 1 91  ? -17.199 -35.903 40.464  1.00 46.33  ? 92  LEU A CD2 1 
ATOM   720  N N   . SER A 1 92  ? -16.709 -31.768 42.977  1.00 45.97  ? 93  SER A N   1 
ATOM   721  C CA  . SER A 1 92  ? -16.768 -30.338 43.249  1.00 41.94  ? 93  SER A CA  1 
ATOM   722  C C   . SER A 1 92  ? -15.911 -29.560 42.251  1.00 45.12  ? 93  SER A C   1 
ATOM   723  O O   . SER A 1 92  ? -14.944 -30.104 41.729  1.00 43.85  ? 93  SER A O   1 
ATOM   724  C CB  . SER A 1 92  ? -16.264 -30.066 44.678  1.00 39.12  ? 93  SER A CB  1 
ATOM   725  O OG  . SER A 1 92  ? -16.265 -28.678 44.916  1.00 40.16  ? 93  SER A OG  1 
ATOM   726  N N   . GLU A 1 93  ? -16.241 -28.295 41.987  1.00 42.44  ? 94  GLU A N   1 
ATOM   727  C CA  . GLU A 1 93  ? -15.334 -27.459 41.201  1.00 38.24  ? 94  GLU A CA  1 
ATOM   728  C C   . GLU A 1 93  ? -14.173 -26.984 42.080  1.00 48.48  ? 94  GLU A C   1 
ATOM   729  O O   . GLU A 1 93  ? -13.156 -26.513 41.584  1.00 45.22  ? 94  GLU A O   1 
ATOM   730  C CB  . GLU A 1 93  ? -16.051 -26.254 40.601  1.00 41.67  ? 94  GLU A CB  1 
ATOM   731  C CG  . GLU A 1 93  ? -17.042 -26.601 39.497  1.00 46.90  ? 94  GLU A CG  1 
ATOM   732  C CD  . GLU A 1 93  ? -17.634 -25.364 38.852  1.00 49.37  ? 94  GLU A CD  1 
ATOM   733  O OE1 . GLU A 1 93  ? -16.978 -24.792 37.959  1.00 44.56  ? 94  GLU A OE1 1 
ATOM   734  O OE2 . GLU A 1 93  ? -18.750 -24.957 39.242  1.00 51.50  ? 94  GLU A OE2 1 
ATOM   735  N N   . ASP A 1 94  ? -14.344 -27.096 43.393  1.00 42.42  ? 95  ASP A N   1 
ATOM   736  C CA  . ASP A 1 94  ? -13.277 -26.805 44.339  1.00 38.01  ? 95  ASP A CA  1 
ATOM   737  C C   . ASP A 1 94  ? -12.496 -28.109 44.467  1.00 39.93  ? 95  ASP A C   1 
ATOM   738  O O   . ASP A 1 94  ? -12.767 -28.930 45.357  1.00 39.23  ? 95  ASP A O   1 
ATOM   739  C CB  . ASP A 1 94  ? -13.912 -26.385 45.673  1.00 40.25  ? 95  ASP A CB  1 
ATOM   740  C CG  . ASP A 1 94  ? -12.894 -26.005 46.742  1.00 44.05  ? 95  ASP A CG  1 
ATOM   741  O OD1 . ASP A 1 94  ? -11.677 -26.234 46.581  1.00 49.20  ? 95  ASP A OD1 1 
ATOM   742  O OD2 . ASP A 1 94  ? -13.342 -25.485 47.781  1.00 61.84  ? 95  ASP A OD2 1 
ATOM   743  N N   . CYS A 1 95  ? -11.531 -28.309 43.574  1.00 37.10  ? 96  CYS A N   1 
ATOM   744  C CA  . CYS A 1 95  ? -10.890 -29.622 43.443  1.00 39.92  ? 96  CYS A CA  1 
ATOM   745  C C   . CYS A 1 95  ? -9.402  -29.529 43.186  1.00 39.57  ? 96  CYS A C   1 
ATOM   746  O O   . CYS A 1 95  ? -8.751  -30.543 42.932  1.00 42.01  ? 96  CYS A O   1 
ATOM   747  C CB  . CYS A 1 95  ? -11.509 -30.398 42.273  1.00 38.07  ? 96  CYS A CB  1 
ATOM   748  S SG  . CYS A 1 95  ? -11.316 -29.597 40.616  1.00 45.54  ? 96  CYS A SG  1 
ATOM   749  N N   . LEU A 1 96  ? -8.859  -28.321 43.221  1.00 38.69  ? 97  LEU A N   1 
ATOM   750  C CA  . LEU A 1 96  ? -7.444  -28.148 42.895  1.00 35.74  ? 97  LEU A CA  1 
ATOM   751  C C   . LEU A 1 96  ? -6.544  -28.399 44.115  1.00 43.38  ? 97  LEU A C   1 
ATOM   752  O O   . LEU A 1 96  ? -6.096  -27.468 44.787  1.00 40.86  ? 97  LEU A O   1 
ATOM   753  C CB  . LEU A 1 96  ? -7.195  -26.787 42.213  1.00 34.59  ? 97  LEU A CB  1 
ATOM   754  C CG  . LEU A 1 96  ? -7.805  -26.688 40.809  1.00 49.53  ? 97  LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 96  ? -7.393  -25.406 40.065  1.00 42.55  ? 97  LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 96  ? -7.487  -27.950 39.956  1.00 37.33  ? 97  LEU A CD2 1 
ATOM   757  N N   . TYR A 1 97  ? -6.309  -29.682 44.396  1.00 40.88  ? 98  TYR A N   1 
ATOM   758  C CA  . TYR A 1 97  ? -5.469  -30.109 45.505  1.00 35.23  ? 98  TYR A CA  1 
ATOM   759  C C   . TYR A 1 97  ? -4.429  -31.113 45.009  1.00 41.28  ? 98  TYR A C   1 
ATOM   760  O O   . TYR A 1 97  ? -4.628  -31.758 43.983  1.00 41.44  ? 98  TYR A O   1 
ATOM   761  C CB  . TYR A 1 97  ? -6.325  -30.714 46.642  1.00 41.79  ? 98  TYR A CB  1 
ATOM   762  C CG  . TYR A 1 97  ? -7.369  -29.751 47.164  1.00 41.31  ? 98  TYR A CG  1 
ATOM   763  C CD1 . TYR A 1 97  ? -7.155  -29.026 48.333  1.00 45.77  ? 98  TYR A CD1 1 
ATOM   764  C CD2 . TYR A 1 97  ? -8.561  -29.535 46.467  1.00 45.44  ? 98  TYR A CD2 1 
ATOM   765  C CE1 . TYR A 1 97  ? -8.095  -28.124 48.804  1.00 39.13  ? 98  TYR A CE1 1 
ATOM   766  C CE2 . TYR A 1 97  ? -9.507  -28.632 46.929  1.00 40.08  ? 98  TYR A CE2 1 
ATOM   767  C CZ  . TYR A 1 97  ? -9.263  -27.930 48.101  1.00 44.07  ? 98  TYR A CZ  1 
ATOM   768  O OH  . TYR A 1 97  ? -10.192 -27.023 48.565  1.00 43.12  ? 98  TYR A OH  1 
ATOM   769  N N   . LEU A 1 98  ? -3.310  -31.248 45.717  1.00 40.88  ? 99  LEU A N   1 
ATOM   770  C CA  . LEU A 1 98  ? -2.313  -32.258 45.337  1.00 42.16  ? 99  LEU A CA  1 
ATOM   771  C C   . LEU A 1 98  ? -1.885  -33.133 46.530  1.00 42.49  ? 99  LEU A C   1 
ATOM   772  O O   . LEU A 1 98  ? -2.175  -32.815 47.679  1.00 42.90  ? 99  LEU A O   1 
ATOM   773  C CB  . LEU A 1 98  ? -1.113  -31.616 44.609  1.00 43.59  ? 99  LEU A CB  1 
ATOM   774  C CG  . LEU A 1 98  ? -0.314  -30.464 45.242  1.00 48.78  ? 99  LEU A CG  1 
ATOM   775  C CD1 . LEU A 1 98  ? 0.521   -30.918 46.424  1.00 40.20  ? 99  LEU A CD1 1 
ATOM   776  C CD2 . LEU A 1 98  ? 0.575   -29.797 44.212  1.00 41.92  ? 99  LEU A CD2 1 
ATOM   777  N N   . ASN A 1 99  ? -1.205  -34.241 46.259  1.00 45.19  ? 100 ASN A N   1 
ATOM   778  C CA  . ASN A 1 99  ? -0.802  -35.149 47.332  1.00 46.14  ? 100 ASN A CA  1 
ATOM   779  C C   . ASN A 1 99  ? 0.700   -35.440 47.290  1.00 43.00  ? 100 ASN A C   1 
ATOM   780  O O   . ASN A 1 99  ? 1.269   -35.530 46.202  1.00 45.55  ? 100 ASN A O   1 
ATOM   781  C CB  . ASN A 1 99  ? -1.588  -36.459 47.210  1.00 40.58  ? 100 ASN A CB  1 
ATOM   782  C CG  . ASN A 1 99  ? -3.029  -36.230 46.773  1.00 48.51  ? 100 ASN A CG  1 
ATOM   783  O OD1 . ASN A 1 99  ? -3.855  -35.773 47.553  1.00 43.33  ? 100 ASN A OD1 1 
ATOM   784  N ND2 . ASN A 1 99  ? -3.331  -36.550 45.519  1.00 42.20  ? 100 ASN A ND2 1 
ATOM   785  N N   . VAL A 1 100 ? 1.329   -35.588 48.458  1.00 42.84  ? 101 VAL A N   1 
ATOM   786  C CA  . VAL A 1 100 ? 2.751   -35.963 48.566  1.00 36.39  ? 101 VAL A CA  1 
ATOM   787  C C   . VAL A 1 100 ? 2.931   -37.199 49.465  1.00 47.25  ? 101 VAL A C   1 
ATOM   788  O O   . VAL A 1 100 ? 2.458   -37.214 50.608  1.00 42.88  ? 101 VAL A O   1 
ATOM   789  C CB  . VAL A 1 100 ? 3.568   -34.807 49.193  1.00 44.18  ? 101 VAL A CB  1 
ATOM   790  C CG1 . VAL A 1 100 ? 5.066   -35.125 49.218  1.00 42.20  ? 101 VAL A CG1 1 
ATOM   791  C CG2 . VAL A 1 100 ? 3.300   -33.504 48.476  1.00 36.65  ? 101 VAL A CG2 1 
ATOM   792  N N   . TRP A 1 101 ? 3.599   -38.230 48.948  1.00 45.43  ? 102 TRP A N   1 
ATOM   793  C CA  . TRP A 1 101 ? 3.961   -39.400 49.745  1.00 43.69  ? 102 TRP A CA  1 
ATOM   794  C C   . TRP A 1 101 ? 5.472   -39.378 49.912  1.00 49.12  ? 102 TRP A C   1 
ATOM   795  O O   . TRP A 1 101 ? 6.201   -39.111 48.957  1.00 43.39  ? 102 TRP A O   1 
ATOM   796  C CB  . TRP A 1 101 ? 3.596   -40.710 49.040  1.00 40.11  ? 102 TRP A CB  1 
ATOM   797  C CG  . TRP A 1 101 ? 2.134   -41.040 48.976  1.00 41.60  ? 102 TRP A CG  1 
ATOM   798  C CD1 . TRP A 1 101 ? 1.430   -41.825 49.841  1.00 41.97  ? 102 TRP A CD1 1 
ATOM   799  C CD2 . TRP A 1 101 ? 1.206   -40.614 47.975  1.00 41.28  ? 102 TRP A CD2 1 
ATOM   800  N NE1 . TRP A 1 101 ? 0.116   -41.902 49.448  1.00 47.71  ? 102 TRP A NE1 1 
ATOM   801  C CE2 . TRP A 1 101 ? -0.044  -41.172 48.298  1.00 50.44  ? 102 TRP A CE2 1 
ATOM   802  C CE3 . TRP A 1 101 ? 1.313   -39.810 46.833  1.00 47.61  ? 102 TRP A CE3 1 
ATOM   803  C CZ2 . TRP A 1 101 ? -1.182  -40.955 47.518  1.00 47.12  ? 102 TRP A CZ2 1 
ATOM   804  C CZ3 . TRP A 1 101 ? 0.181   -39.602 46.057  1.00 46.98  ? 102 TRP A CZ3 1 
ATOM   805  C CH2 . TRP A 1 101 ? -1.046  -40.168 46.404  1.00 39.65  ? 102 TRP A CH2 1 
ATOM   806  N N   . THR A 1 102 ? 5.945   -39.668 51.119  1.00 53.18  ? 103 THR A N   1 
ATOM   807  C CA  . THR A 1 102 ? 7.376   -39.644 51.397  1.00 52.50  ? 103 THR A CA  1 
ATOM   808  C C   . THR A 1 102 ? 7.741   -40.832 52.309  1.00 45.29  ? 103 THR A C   1 
ATOM   809  O O   . THR A 1 102 ? 6.863   -41.384 52.976  1.00 47.44  ? 103 THR A O   1 
ATOM   810  C CB  . THR A 1 102 ? 7.757   -38.283 52.022  1.00 58.42  ? 103 THR A CB  1 
ATOM   811  O OG1 . THR A 1 102 ? 9.099   -37.946 51.670  1.00 69.73  ? 103 THR A OG1 1 
ATOM   812  C CG2 . THR A 1 102 ? 7.631   -38.321 53.520  1.00 46.70  ? 103 THR A CG2 1 
ATOM   813  N N   . PRO A 1 103 ? 9.016   -41.280 52.291  1.00 44.88  ? 104 PRO A N   1 
ATOM   814  C CA  . PRO A 1 103 ? 9.416   -42.353 53.220  1.00 47.05  ? 104 PRO A CA  1 
ATOM   815  C C   . PRO A 1 103 ? 9.249   -41.934 54.678  1.00 54.71  ? 104 PRO A C   1 
ATOM   816  O O   . PRO A 1 103 ? 9.128   -40.736 54.936  1.00 57.49  ? 104 PRO A O   1 
ATOM   817  C CB  . PRO A 1 103 ? 10.904  -42.546 52.920  1.00 55.14  ? 104 PRO A CB  1 
ATOM   818  C CG  . PRO A 1 103 ? 11.060  -42.119 51.468  1.00 46.72  ? 104 PRO A CG  1 
ATOM   819  C CD  . PRO A 1 103 ? 10.070  -40.970 51.303  1.00 44.21  ? 104 PRO A CD  1 
ATOM   820  N N   . TYR A 1 104 ? 9.220   -42.904 55.600  1.00 53.61  ? 105 TYR A N   1 
ATOM   821  C CA  . TYR A 1 104 ? 9.116   -42.645 57.042  1.00 51.79  ? 105 TYR A CA  1 
ATOM   822  C C   . TYR A 1 104 ? 10.318  -43.261 57.782  1.00 62.03  ? 105 TYR A C   1 
ATOM   823  O O   . TYR A 1 104 ? 10.626  -44.451 57.606  1.00 55.60  ? 105 TYR A O   1 
ATOM   824  C CB  . TYR A 1 104 ? 7.811   -43.202 57.619  1.00 51.74  ? 105 TYR A CB  1 
ATOM   825  C CG  . TYR A 1 104 ? 7.515   -42.754 59.042  1.00 59.68  ? 105 TYR A CG  1 
ATOM   826  C CD1 . TYR A 1 104 ? 8.137   -43.357 60.142  1.00 61.05  ? 105 TYR A CD1 1 
ATOM   827  C CD2 . TYR A 1 104 ? 6.597   -41.738 59.286  1.00 60.80  ? 105 TYR A CD2 1 
ATOM   828  C CE1 . TYR A 1 104 ? 7.856   -42.942 61.450  1.00 56.77  ? 105 TYR A CE1 1 
ATOM   829  C CE2 . TYR A 1 104 ? 6.310   -41.317 60.572  1.00 60.00  ? 105 TYR A CE2 1 
ATOM   830  C CZ  . TYR A 1 104 ? 6.935   -41.922 61.651  1.00 65.18  ? 105 TYR A CZ  1 
ATOM   831  O OH  . TYR A 1 104 ? 6.631   -41.485 62.919  1.00 60.18  ? 105 TYR A OH  1 
ATOM   832  N N   . PRO A 1 105 ? 11.009  -42.452 58.605  1.00 68.33  ? 106 PRO A N   1 
ATOM   833  C CA  . PRO A 1 105 ? 10.726  -41.028 58.822  1.00 70.50  ? 106 PRO A CA  1 
ATOM   834  C C   . PRO A 1 105 ? 11.073  -40.228 57.561  1.00 60.95  ? 106 PRO A C   1 
ATOM   835  O O   . PRO A 1 105 ? 11.709  -40.801 56.672  1.00 52.76  ? 106 PRO A O   1 
ATOM   836  C CB  . PRO A 1 105 ? 11.688  -40.667 59.957  1.00 56.42  ? 106 PRO A CB  1 
ATOM   837  C CG  . PRO A 1 105 ? 12.845  -41.556 59.736  1.00 63.91  ? 106 PRO A CG  1 
ATOM   838  C CD  . PRO A 1 105 ? 12.250  -42.867 59.286  1.00 59.73  ? 106 PRO A CD  1 
ATOM   839  N N   . ARG A 1 106 ? 10.648  -38.967 57.477  1.00 62.93  ? 107 ARG A N   1 
ATOM   840  C CA  . ARG A 1 106 ? 10.950  -38.117 56.321  1.00 66.33  ? 107 ARG A CA  1 
ATOM   841  C C   . ARG A 1 106 ? 12.424  -38.215 55.937  1.00 54.43  ? 107 ARG A C   1 
ATOM   842  O O   . ARG A 1 106 ? 13.283  -38.263 56.803  1.00 74.88  ? 107 ARG A O   1 
ATOM   843  C CB  . ARG A 1 106 ? 10.571  -36.659 56.619  1.00 60.10  ? 107 ARG A CB  1 
ATOM   844  C CG  . ARG A 1 106 ? 10.926  -35.660 55.507  1.00 69.54  ? 107 ARG A CG  1 
ATOM   845  C CD  . ARG A 1 106 ? 10.471  -34.241 55.865  1.00 69.92  ? 107 ARG A CD  1 
ATOM   846  N NE  . ARG A 1 106 ? 9.251   -34.256 56.675  1.00 69.03  ? 107 ARG A NE  1 
ATOM   847  C CZ  . ARG A 1 106 ? 8.841   -33.232 57.422  1.00 71.45  ? 107 ARG A CZ  1 
ATOM   848  N NH1 . ARG A 1 106 ? 9.551   -32.112 57.442  1.00 71.51  ? 107 ARG A NH1 1 
ATOM   849  N NH2 . ARG A 1 106 ? 7.733   -33.326 58.155  1.00 55.37  ? 107 ARG A NH2 1 
ATOM   850  N N   . PRO A 1 107 ? 12.719  -38.276 54.635  1.00 66.89  ? 108 PRO A N   1 
ATOM   851  C CA  . PRO A 1 107 ? 14.122  -38.294 54.201  1.00 69.86  ? 108 PRO A CA  1 
ATOM   852  C C   . PRO A 1 107 ? 14.825  -37.029 54.661  1.00 74.28  ? 108 PRO A C   1 
ATOM   853  O O   . PRO A 1 107 ? 14.188  -35.976 54.687  1.00 72.32  ? 108 PRO A O   1 
ATOM   854  C CB  . PRO A 1 107 ? 14.023  -38.269 52.676  1.00 61.25  ? 108 PRO A CB  1 
ATOM   855  C CG  . PRO A 1 107 ? 12.664  -38.777 52.361  1.00 63.89  ? 108 PRO A CG  1 
ATOM   856  C CD  . PRO A 1 107 ? 11.776  -38.421 53.511  1.00 61.41  ? 108 PRO A CD  1 
ATOM   857  N N   . THR A 1 108 ? 16.107  -37.119 55.004  1.00 75.35  ? 109 THR A N   1 
ATOM   858  C CA  . THR A 1 108 ? 16.843  -35.928 55.435  1.00 84.27  ? 109 THR A CA  1 
ATOM   859  C C   . THR A 1 108 ? 17.800  -35.411 54.371  1.00 81.33  ? 109 THR A C   1 
ATOM   860  O O   . THR A 1 108 ? 18.443  -34.387 54.570  1.00 85.14  ? 109 THR A O   1 
ATOM   861  C CB  . THR A 1 108 ? 17.592  -36.124 56.786  1.00 73.84  ? 109 THR A CB  1 
ATOM   862  O OG1 . THR A 1 108 ? 18.489  -37.240 56.702  1.00 77.88  ? 109 THR A OG1 1 
ATOM   863  C CG2 . THR A 1 108 ? 16.605  -36.354 57.899  1.00 61.71  ? 109 THR A CG2 1 
ATOM   864  N N   . SER A 1 109 ? 17.880  -36.115 53.245  1.00 73.12  ? 110 SER A N   1 
ATOM   865  C CA  . SER A 1 109 ? 18.669  -35.654 52.103  1.00 68.11  ? 110 SER A CA  1 
ATOM   866  C C   . SER A 1 109 ? 17.836  -35.717 50.804  1.00 73.75  ? 110 SER A C   1 
ATOM   867  O O   . SER A 1 109 ? 16.845  -36.443 50.749  1.00 63.65  ? 110 SER A O   1 
ATOM   868  C CB  . SER A 1 109 ? 19.963  -36.468 51.995  1.00 70.26  ? 110 SER A CB  1 
ATOM   869  O OG  . SER A 1 109 ? 19.751  -37.812 52.371  1.00 71.84  ? 110 SER A OG  1 
ATOM   870  N N   . PRO A 1 110 ? 18.213  -34.929 49.775  1.00 65.16  ? 111 PRO A N   1 
ATOM   871  C CA  . PRO A 1 110 ? 17.463  -34.880 48.507  1.00 69.74  ? 111 PRO A CA  1 
ATOM   872  C C   . PRO A 1 110 ? 17.076  -36.251 47.933  1.00 71.70  ? 111 PRO A C   1 
ATOM   873  O O   . PRO A 1 110 ? 17.936  -37.057 47.570  1.00 73.85  ? 111 PRO A O   1 
ATOM   874  C CB  . PRO A 1 110 ? 18.419  -34.144 47.568  1.00 59.82  ? 111 PRO A CB  1 
ATOM   875  C CG  . PRO A 1 110 ? 19.119  -33.178 48.482  1.00 68.59  ? 111 PRO A CG  1 
ATOM   876  C CD  . PRO A 1 110 ? 19.276  -33.905 49.809  1.00 68.05  ? 111 PRO A CD  1 
ATOM   877  N N   . THR A 1 111 ? 15.768  -36.498 47.884  1.00 59.46  ? 112 THR A N   1 
ATOM   878  C CA  . THR A 1 111 ? 15.200  -37.718 47.334  1.00 62.14  ? 112 THR A CA  1 
ATOM   879  C C   . THR A 1 111 ? 14.582  -37.422 45.950  1.00 59.63  ? 112 THR A C   1 
ATOM   880  O O   . THR A 1 111 ? 13.885  -36.418 45.774  1.00 51.05  ? 112 THR A O   1 
ATOM   881  C CB  . THR A 1 111 ? 14.129  -38.258 48.304  1.00 68.61  ? 112 THR A CB  1 
ATOM   882  O OG1 . THR A 1 111 ? 14.715  -38.472 49.601  1.00 67.51  ? 112 THR A OG1 1 
ATOM   883  C CG2 . THR A 1 111 ? 13.520  -39.549 47.799  1.00 63.34  ? 112 THR A CG2 1 
ATOM   884  N N   . PRO A 1 112 ? 14.851  -38.283 44.955  1.00 64.47  ? 113 PRO A N   1 
ATOM   885  C CA  . PRO A 1 112 ? 14.286  -38.093 43.606  1.00 56.90  ? 113 PRO A CA  1 
ATOM   886  C C   . PRO A 1 112 ? 12.753  -38.071 43.604  1.00 46.23  ? 113 PRO A C   1 
ATOM   887  O O   . PRO A 1 112 ? 12.126  -38.787 44.380  1.00 50.46  ? 113 PRO A O   1 
ATOM   888  C CB  . PRO A 1 112 ? 14.817  -39.300 42.823  1.00 56.38  ? 113 PRO A CB  1 
ATOM   889  C CG  . PRO A 1 112 ? 15.207  -40.300 43.866  1.00 63.25  ? 113 PRO A CG  1 
ATOM   890  C CD  . PRO A 1 112 ? 15.675  -39.499 45.044  1.00 65.83  ? 113 PRO A CD  1 
ATOM   891  N N   . VAL A 1 113 ? 12.163  -37.232 42.757  1.00 51.70  ? 114 VAL A N   1 
ATOM   892  C CA  . VAL A 1 113 ? 10.715  -37.021 42.768  1.00 46.31  ? 114 VAL A CA  1 
ATOM   893  C C   . VAL A 1 113 ? 10.025  -37.584 41.515  1.00 43.58  ? 114 VAL A C   1 
ATOM   894  O O   . VAL A 1 113 ? 10.439  -37.296 40.385  1.00 49.32  ? 114 VAL A O   1 
ATOM   895  C CB  . VAL A 1 113 ? 10.370  -35.513 42.904  1.00 48.98  ? 114 VAL A CB  1 
ATOM   896  C CG1 . VAL A 1 113 ? 8.855   -35.300 42.963  1.00 41.94  ? 114 VAL A CG1 1 
ATOM   897  C CG2 . VAL A 1 113 ? 11.033  -34.916 44.151  1.00 45.11  ? 114 VAL A CG2 1 
ATOM   898  N N   . LEU A 1 114 ? 8.989   -38.394 41.729  1.00 45.28  ? 115 LEU A N   1 
ATOM   899  C CA  . LEU A 1 114 ? 8.098   -38.845 40.651  1.00 43.46  ? 115 LEU A CA  1 
ATOM   900  C C   . LEU A 1 114 ? 6.809   -38.050 40.731  1.00 42.95  ? 115 LEU A C   1 
ATOM   901  O O   . LEU A 1 114 ? 6.246   -37.893 41.822  1.00 44.34  ? 115 LEU A O   1 
ATOM   902  C CB  . LEU A 1 114 ? 7.782   -40.338 40.797  1.00 47.51  ? 115 LEU A CB  1 
ATOM   903  C CG  . LEU A 1 114 ? 8.828   -41.291 40.218  1.00 44.99  ? 115 LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 114 ? 8.746   -42.655 40.870  1.00 57.28  ? 115 LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 114 ? 8.620   -41.410 38.723  1.00 48.61  ? 115 LEU A CD2 1 
ATOM   906  N N   . VAL A 1 115 ? 6.350   -37.513 39.602  1.00 38.19  ? 116 VAL A N   1 
ATOM   907  C CA  . VAL A 1 115 ? 5.074   -36.798 39.600  1.00 36.97  ? 116 VAL A CA  1 
ATOM   908  C C   . VAL A 1 115 ? 4.088   -37.460 38.653  1.00 47.62  ? 116 VAL A C   1 
ATOM   909  O O   . VAL A 1 115 ? 4.349   -37.564 37.455  1.00 44.29  ? 116 VAL A O   1 
ATOM   910  C CB  . VAL A 1 115 ? 5.213   -35.314 39.201  1.00 46.21  ? 116 VAL A CB  1 
ATOM   911  C CG1 . VAL A 1 115 ? 3.846   -34.590 39.378  1.00 33.80  ? 116 VAL A CG1 1 
ATOM   912  C CG2 . VAL A 1 115 ? 6.290   -34.643 40.035  1.00 37.65  ? 116 VAL A CG2 1 
ATOM   913  N N   . TRP A 1 116 ? 2.959   -37.898 39.203  1.00 42.20  ? 117 TRP A N   1 
ATOM   914  C CA  . TRP A 1 116 ? 1.952   -38.637 38.444  1.00 40.25  ? 117 TRP A CA  1 
ATOM   915  C C   . TRP A 1 116 ? 0.847   -37.729 37.895  1.00 39.63  ? 117 TRP A C   1 
ATOM   916  O O   . TRP A 1 116 ? 0.246   -36.957 38.634  1.00 36.72  ? 117 TRP A O   1 
ATOM   917  C CB  . TRP A 1 116 ? 1.328   -39.741 39.326  1.00 41.93  ? 117 TRP A CB  1 
ATOM   918  C CG  . TRP A 1 116 ? 0.204   -40.504 38.652  1.00 43.30  ? 117 TRP A CG  1 
ATOM   919  C CD1 . TRP A 1 116 ? -1.130  -40.418 38.939  1.00 40.80  ? 117 TRP A CD1 1 
ATOM   920  C CD2 . TRP A 1 116 ? 0.317   -41.441 37.554  1.00 40.34  ? 117 TRP A CD2 1 
ATOM   921  N NE1 . TRP A 1 116 ? -1.853  -41.252 38.102  1.00 36.37  ? 117 TRP A NE1 1 
ATOM   922  C CE2 . TRP A 1 116 ? -0.991  -41.893 37.252  1.00 37.39  ? 117 TRP A CE2 1 
ATOM   923  C CE3 . TRP A 1 116 ? 1.394   -41.963 36.826  1.00 41.28  ? 117 TRP A CE3 1 
ATOM   924  C CZ2 . TRP A 1 116 ? -1.248  -42.838 36.248  1.00 34.71  ? 117 TRP A CZ2 1 
ATOM   925  C CZ3 . TRP A 1 116 ? 1.136   -42.893 35.808  1.00 39.47  ? 117 TRP A CZ3 1 
ATOM   926  C CH2 . TRP A 1 116 ? -0.175  -43.322 35.539  1.00 36.89  ? 117 TRP A CH2 1 
ATOM   927  N N   . ILE A 1 117 ? 0.580   -37.829 36.595  1.00 35.79  ? 118 ILE A N   1 
ATOM   928  C CA  . ILE A 1 117 ? -0.572  -37.156 35.989  1.00 39.52  ? 118 ILE A CA  1 
ATOM   929  C C   . ILE A 1 117 ? -1.572  -38.203 35.469  1.00 41.07  ? 118 ILE A C   1 
ATOM   930  O O   . ILE A 1 117 ? -1.237  -38.968 34.563  1.00 37.93  ? 118 ILE A O   1 
ATOM   931  C CB  . ILE A 1 117 ? -0.125  -36.264 34.826  1.00 40.26  ? 118 ILE A CB  1 
ATOM   932  C CG1 . ILE A 1 117 ? 0.934   -35.267 35.330  1.00 46.09  ? 118 ILE A CG1 1 
ATOM   933  C CG2 . ILE A 1 117 ? -1.323  -35.556 34.194  1.00 34.20  ? 118 ILE A CG2 1 
ATOM   934  C CD1 . ILE A 1 117 ? 1.571   -34.457 34.218  1.00 38.35  ? 118 ILE A CD1 1 
ATOM   935  N N   . TYR A 1 118 ? -2.782  -38.251 36.031  1.00 37.35  ? 119 TYR A N   1 
ATOM   936  C CA  . TYR A 1 118 ? -3.753  -39.290 35.626  1.00 37.58  ? 119 TYR A CA  1 
ATOM   937  C C   . TYR A 1 118 ? -4.324  -39.097 34.212  1.00 37.90  ? 119 TYR A C   1 
ATOM   938  O O   . TYR A 1 118 ? -4.370  -37.970 33.707  1.00 36.45  ? 119 TYR A O   1 
ATOM   939  C CB  . TYR A 1 118 ? -4.918  -39.402 36.620  1.00 36.47  ? 119 TYR A CB  1 
ATOM   940  C CG  . TYR A 1 118 ? -5.708  -38.119 36.865  1.00 39.17  ? 119 TYR A CG  1 
ATOM   941  C CD1 . TYR A 1 118 ? -6.614  -37.619 35.923  1.00 37.76  ? 119 TYR A CD1 1 
ATOM   942  C CD2 . TYR A 1 118 ? -5.587  -37.437 38.078  1.00 35.27  ? 119 TYR A CD2 1 
ATOM   943  C CE1 . TYR A 1 118 ? -7.352  -36.431 36.174  1.00 32.24  ? 119 TYR A CE1 1 
ATOM   944  C CE2 . TYR A 1 118 ? -6.301  -36.272 38.332  1.00 34.38  ? 119 TYR A CE2 1 
ATOM   945  C CZ  . TYR A 1 118 ? -7.174  -35.762 37.397  1.00 43.06  ? 119 TYR A CZ  1 
ATOM   946  O OH  . TYR A 1 118 ? -7.869  -34.584 37.716  1.00 39.91  ? 119 TYR A OH  1 
ATOM   947  N N   . GLY A 1 119 ? -4.773  -40.192 33.591  1.00 33.33  ? 120 GLY A N   1 
ATOM   948  C CA  . GLY A 1 119 ? -5.487  -40.124 32.321  1.00 38.27  ? 120 GLY A CA  1 
ATOM   949  C C   . GLY A 1 119 ? -6.997  -40.188 32.549  1.00 42.72  ? 120 GLY A C   1 
ATOM   950  O O   . GLY A 1 119 ? -7.468  -40.070 33.677  1.00 40.93  ? 120 GLY A O   1 
ATOM   951  N N   . GLY A 1 120 ? -7.757  -40.404 31.483  1.00 36.49  ? 121 GLY A N   1 
ATOM   952  C CA  . GLY A 1 120 ? -9.211  -40.316 31.524  1.00 34.27  ? 121 GLY A CA  1 
ATOM   953  C C   . GLY A 1 120 ? -9.729  -39.462 30.364  1.00 37.90  ? 121 GLY A C   1 
ATOM   954  O O   . GLY A 1 120 ? -10.769 -38.821 30.480  1.00 37.88  ? 121 GLY A O   1 
ATOM   955  N N   . GLY A 1 121 ? -9.001  -39.448 29.246  1.00 38.30  ? 122 GLY A N   1 
ATOM   956  C CA  . GLY A 1 121 ? -9.434  -38.735 28.031  1.00 40.08  ? 122 GLY A CA  1 
ATOM   957  C C   . GLY A 1 121 ? -9.663  -37.230 28.168  1.00 41.00  ? 122 GLY A C   1 
ATOM   958  O O   . GLY A 1 121 ? -10.414 -36.633 27.398  1.00 41.71  ? 122 GLY A O   1 
ATOM   959  N N   . PHE A 1 122 ? -9.018  -36.612 29.159  1.00 38.84  ? 123 PHE A N   1 
ATOM   960  C CA  . PHE A 1 122 ? -9.248  -35.197 29.496  1.00 42.64  ? 123 PHE A CA  1 
ATOM   961  C C   . PHE A 1 122 ? -10.689 -34.882 29.941  1.00 34.50  ? 123 PHE A C   1 
ATOM   962  O O   . PHE A 1 122 ? -11.038 -33.716 30.093  1.00 39.70  ? 123 PHE A O   1 
ATOM   963  C CB  . PHE A 1 122 ? -8.825  -34.237 28.348  1.00 38.08  ? 123 PHE A CB  1 
ATOM   964  C CG  . PHE A 1 122 ? -7.358  -34.305 27.990  1.00 41.60  ? 123 PHE A CG  1 
ATOM   965  C CD1 . PHE A 1 122 ? -6.387  -33.797 28.848  1.00 40.56  ? 123 PHE A CD1 1 
ATOM   966  C CD2 . PHE A 1 122 ? -6.949  -34.874 26.790  1.00 37.10  ? 123 PHE A CD2 1 
ATOM   967  C CE1 . PHE A 1 122 ? -5.016  -33.860 28.513  1.00 37.93  ? 123 PHE A CE1 1 
ATOM   968  C CE2 . PHE A 1 122 ? -5.579  -34.934 26.440  1.00 38.37  ? 123 PHE A CE2 1 
ATOM   969  C CZ  . PHE A 1 122 ? -4.619  -34.427 27.302  1.00 37.00  ? 123 PHE A CZ  1 
ATOM   970  N N   . TYR A 1 123 ? -11.527 -35.902 30.137  1.00 38.72  ? 124 TYR A N   1 
ATOM   971  C CA  . TYR A 1 123 ? -12.910 -35.662 30.594  1.00 40.09  ? 124 TYR A CA  1 
ATOM   972  C C   . TYR A 1 123 ? -13.172 -36.279 31.989  1.00 35.51  ? 124 TYR A C   1 
ATOM   973  O O   . TYR A 1 123 ? -14.238 -36.094 32.578  1.00 41.76  ? 124 TYR A O   1 
ATOM   974  C CB  . TYR A 1 123 ? -13.950 -36.174 29.565  1.00 34.71  ? 124 TYR A CB  1 
ATOM   975  C CG  . TYR A 1 123 ? -14.080 -37.687 29.541  1.00 40.79  ? 124 TYR A CG  1 
ATOM   976  C CD1 . TYR A 1 123 ? -14.967 -38.341 30.402  1.00 39.30  ? 124 TYR A CD1 1 
ATOM   977  C CD2 . TYR A 1 123 ? -13.306 -38.464 28.678  1.00 42.10  ? 124 TYR A CD2 1 
ATOM   978  C CE1 . TYR A 1 123 ? -15.061 -39.721 30.430  1.00 41.53  ? 124 TYR A CE1 1 
ATOM   979  C CE2 . TYR A 1 123 ? -13.406 -39.860 28.690  1.00 44.63  ? 124 TYR A CE2 1 
ATOM   980  C CZ  . TYR A 1 123 ? -14.289 -40.472 29.574  1.00 42.51  ? 124 TYR A CZ  1 
ATOM   981  O OH  . TYR A 1 123 ? -14.413 -41.833 29.607  1.00 46.76  ? 124 TYR A OH  1 
ATOM   982  N N   . SER A 1 124 ? -12.202 -37.020 32.507  1.00 40.18  ? 125 SER A N   1 
ATOM   983  C CA  . SER A 1 124 ? -12.399 -37.749 33.746  1.00 38.08  ? 125 SER A CA  1 
ATOM   984  C C   . SER A 1 124 ? -11.065 -38.021 34.446  1.00 40.43  ? 125 SER A C   1 
ATOM   985  O O   . SER A 1 124 ? -10.017 -37.713 33.894  1.00 39.66  ? 125 SER A O   1 
ATOM   986  C CB  . SER A 1 124 ? -13.103 -39.072 33.443  1.00 38.53  ? 125 SER A CB  1 
ATOM   987  O OG  . SER A 1 124 ? -12.283 -39.935 32.667  1.00 40.76  ? 125 SER A OG  1 
ATOM   988  N N   . GLY A 1 125 ? -11.116 -38.636 35.634  1.00 33.01  ? 126 GLY A N   1 
ATOM   989  C CA  . GLY A 1 125 ? -9.931  -39.047 36.371  1.00 36.10  ? 126 GLY A CA  1 
ATOM   990  C C   . GLY A 1 125 ? -9.828  -38.320 37.708  1.00 38.45  ? 126 GLY A C   1 
ATOM   991  O O   . GLY A 1 125 ? -10.491 -37.303 37.914  1.00 39.11  ? 126 GLY A O   1 
ATOM   992  N N   . ALA A 1 126 ? -8.983  -38.838 38.593  1.00 37.85  ? 127 ALA A N   1 
ATOM   993  C CA  . ALA A 1 126 ? -8.747  -38.272 39.927  1.00 41.96  ? 127 ALA A CA  1 
ATOM   994  C C   . ALA A 1 126 ? -7.445  -38.822 40.476  1.00 38.31  ? 127 ALA A C   1 
ATOM   995  O O   . ALA A 1 126 ? -7.058  -39.954 40.157  1.00 44.31  ? 127 ALA A O   1 
ATOM   996  C CB  . ALA A 1 126 ? -9.881  -38.620 40.885  1.00 36.54  ? 127 ALA A CB  1 
ATOM   997  N N   . SER A 1 127 ? -6.766  -38.033 41.307  1.00 43.20  ? 128 SER A N   1 
ATOM   998  C CA  . SER A 1 127 ? -5.528  -38.492 41.949  1.00 39.34  ? 128 SER A CA  1 
ATOM   999  C C   . SER A 1 127 ? -5.818  -39.437 43.123  1.00 46.49  ? 128 SER A C   1 
ATOM   1000 O O   . SER A 1 127 ? -4.912  -40.125 43.632  1.00 42.21  ? 128 SER A O   1 
ATOM   1001 C CB  . SER A 1 127 ? -4.710  -37.293 42.438  1.00 45.38  ? 128 SER A CB  1 
ATOM   1002 O OG  . SER A 1 127 ? -5.444  -36.527 43.383  1.00 50.06  ? 128 SER A OG  1 
ATOM   1003 N N   . SER A 1 128 ? -7.083  -39.482 43.541  1.00 39.56  ? 129 SER A N   1 
ATOM   1004 C CA  . SER A 1 128 ? -7.477  -40.269 44.724  1.00 39.97  ? 129 SER A CA  1 
ATOM   1005 C C   . SER A 1 128 ? -7.885  -41.705 44.410  1.00 51.17  ? 129 SER A C   1 
ATOM   1006 O O   . SER A 1 128 ? -8.211  -42.449 45.324  1.00 42.20  ? 129 SER A O   1 
ATOM   1007 C CB  . SER A 1 128 ? -8.650  -39.613 45.441  1.00 43.29  ? 129 SER A CB  1 
ATOM   1008 O OG  . SER A 1 128 ? -9.711  -39.336 44.546  1.00 39.39  ? 129 SER A OG  1 
ATOM   1009 N N   . LEU A 1 129 ? -7.889  -42.090 43.130  1.00 40.43  ? 130 LEU A N   1 
ATOM   1010 C CA  . LEU A 1 129 ? -8.261  -43.452 42.751  1.00 38.04  ? 130 LEU A CA  1 
ATOM   1011 C C   . LEU A 1 129 ? -7.338  -44.465 43.434  1.00 42.28  ? 130 LEU A C   1 
ATOM   1012 O O   . LEU A 1 129 ? -6.120  -44.242 43.543  1.00 42.27  ? 130 LEU A O   1 
ATOM   1013 C CB  . LEU A 1 129 ? -8.202  -43.614 41.211  1.00 35.60  ? 130 LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 129 ? -9.163  -42.697 40.437  1.00 40.24  ? 130 LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 129 ? -9.188  -43.017 38.912  1.00 41.76  ? 130 LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 129 ? -10.570 -42.811 41.013  1.00 41.28  ? 130 LEU A CD2 1 
ATOM   1017 N N   . ASP A 1 130 ? -7.909  -45.583 43.878  1.00 46.01  ? 131 ASP A N   1 
ATOM   1018 C CA  . ASP A 1 130 ? -7.141  -46.592 44.604  1.00 41.29  ? 131 ASP A CA  1 
ATOM   1019 C C   . ASP A 1 130 ? -5.967  -47.101 43.777  1.00 46.46  ? 131 ASP A C   1 
ATOM   1020 O O   . ASP A 1 130 ? -4.937  -47.475 44.310  1.00 42.60  ? 131 ASP A O   1 
ATOM   1021 C CB  . ASP A 1 130 ? -8.024  -47.784 44.969  1.00 45.47  ? 131 ASP A CB  1 
ATOM   1022 C CG  . ASP A 1 130 ? -9.119  -47.436 45.959  1.00 50.71  ? 131 ASP A CG  1 
ATOM   1023 O OD1 . ASP A 1 130 ? -9.100  -46.339 46.577  1.00 49.61  ? 131 ASP A OD1 1 
ATOM   1024 O OD2 . ASP A 1 130 ? -10.002 -48.290 46.127  1.00 56.59  ? 131 ASP A OD2 1 
ATOM   1025 N N   . VAL A 1 131 ? -6.119  -47.115 42.462  1.00 42.93  ? 132 VAL A N   1 
ATOM   1026 C CA  . VAL A 1 131 ? -5.067  -47.664 41.625  1.00 43.11  ? 132 VAL A CA  1 
ATOM   1027 C C   . VAL A 1 131 ? -3.859  -46.719 41.510  1.00 44.25  ? 132 VAL A C   1 
ATOM   1028 O O   . VAL A 1 131 ? -2.785  -47.142 41.076  1.00 42.00  ? 132 VAL A O   1 
ATOM   1029 C CB  . VAL A 1 131 ? -5.625  -48.096 40.239  1.00 48.41  ? 132 VAL A CB  1 
ATOM   1030 C CG1 . VAL A 1 131 ? -5.928  -46.883 39.385  1.00 44.82  ? 132 VAL A CG1 1 
ATOM   1031 C CG2 . VAL A 1 131 ? -4.687  -49.023 39.554  1.00 47.22  ? 132 VAL A CG2 1 
ATOM   1032 N N   . TYR A 1 132 ? -4.018  -45.461 41.934  1.00 41.90  ? 133 TYR A N   1 
ATOM   1033 C CA  . TYR A 1 132 ? -2.897  -44.501 41.935  1.00 41.04  ? 133 TYR A CA  1 
ATOM   1034 C C   . TYR A 1 132 ? -2.270  -44.290 43.331  1.00 46.91  ? 133 TYR A C   1 
ATOM   1035 O O   . TYR A 1 132 ? -1.612  -43.268 43.574  1.00 42.51  ? 133 TYR A O   1 
ATOM   1036 C CB  . TYR A 1 132 ? -3.353  -43.136 41.398  1.00 35.30  ? 133 TYR A CB  1 
ATOM   1037 C CG  . TYR A 1 132 ? -4.045  -43.187 40.046  1.00 42.66  ? 133 TYR A CG  1 
ATOM   1038 C CD1 . TYR A 1 132 ? -3.706  -44.149 39.095  1.00 34.82  ? 133 TYR A CD1 1 
ATOM   1039 C CD2 . TYR A 1 132 ? -5.047  -42.266 39.724  1.00 39.42  ? 133 TYR A CD2 1 
ATOM   1040 C CE1 . TYR A 1 132 ? -4.349  -44.185 37.850  1.00 38.99  ? 133 TYR A CE1 1 
ATOM   1041 C CE2 . TYR A 1 132 ? -5.691  -42.304 38.502  1.00 38.88  ? 133 TYR A CE2 1 
ATOM   1042 C CZ  . TYR A 1 132 ? -5.336  -43.258 37.561  1.00 39.80  ? 133 TYR A CZ  1 
ATOM   1043 O OH  . TYR A 1 132 ? -5.991  -43.268 36.333  1.00 37.83  ? 133 TYR A OH  1 
ATOM   1044 N N   . ASP A 1 133 ? -2.486  -45.233 44.246  1.00 41.26  ? 134 ASP A N   1 
ATOM   1045 C CA  . ASP A 1 133 ? -2.000  -45.104 45.640  1.00 39.08  ? 134 ASP A CA  1 
ATOM   1046 C C   . ASP A 1 133 ? -0.467  -45.159 45.693  1.00 41.83  ? 134 ASP A C   1 
ATOM   1047 O O   . ASP A 1 133 ? 0.141   -46.175 45.339  1.00 37.38  ? 134 ASP A O   1 
ATOM   1048 C CB  . ASP A 1 133 ? -2.627  -46.223 46.474  1.00 37.76  ? 134 ASP A CB  1 
ATOM   1049 C CG  . ASP A 1 133 ? -2.260  -46.168 47.953  1.00 52.61  ? 134 ASP A CG  1 
ATOM   1050 O OD1 . ASP A 1 133 ? -1.602  -45.210 48.426  1.00 45.85  ? 134 ASP A OD1 1 
ATOM   1051 O OD2 . ASP A 1 133 ? -2.671  -47.116 48.650  1.00 54.88  ? 134 ASP A OD2 1 
ATOM   1052 N N   . GLY A 1 134 ? 0.167   -44.066 46.115  1.00 39.63  ? 135 GLY A N   1 
ATOM   1053 C CA  . GLY A 1 134 ? 1.627   -43.990 46.088  1.00 46.71  ? 135 GLY A CA  1 
ATOM   1054 C C   . GLY A 1 134 ? 2.420   -44.724 47.179  1.00 50.13  ? 135 GLY A C   1 
ATOM   1055 O O   . GLY A 1 134 ? 3.665   -44.776 47.141  1.00 43.47  ? 135 GLY A O   1 
ATOM   1056 N N   . ARG A 1 135 ? 1.719   -45.313 48.143  1.00 41.26  ? 136 ARG A N   1 
ATOM   1057 C CA  . ARG A 1 135 ? 2.400   -45.840 49.333  1.00 45.06  ? 136 ARG A CA  1 
ATOM   1058 C C   . ARG A 1 135 ? 3.414   -46.944 49.011  1.00 46.09  ? 136 ARG A C   1 
ATOM   1059 O O   . ARG A 1 135 ? 4.482   -46.996 49.621  1.00 47.93  ? 136 ARG A O   1 
ATOM   1060 C CB  . ARG A 1 135 ? 1.385   -46.302 50.394  1.00 38.79  ? 136 ARG A CB  1 
ATOM   1061 C CG  . ARG A 1 135 ? 0.828   -47.709 50.159  1.00 49.26  ? 136 ARG A CG  1 
ATOM   1062 C CD  . ARG A 1 135 ? -0.157  -48.100 51.237  1.00 46.07  ? 136 ARG A CD  1 
ATOM   1063 N NE  . ARG A 1 135 ? -1.359  -47.287 51.148  1.00 41.43  ? 136 ARG A NE  1 
ATOM   1064 C CZ  . ARG A 1 135 ? -2.222  -47.126 52.142  1.00 53.89  ? 136 ARG A CZ  1 
ATOM   1065 N NH1 . ARG A 1 135 ? -2.008  -47.710 53.327  1.00 45.04  ? 136 ARG A NH1 1 
ATOM   1066 N NH2 . ARG A 1 135 ? -3.287  -46.364 51.954  1.00 45.86  ? 136 ARG A NH2 1 
ATOM   1067 N N   . PHE A 1 136 ? 3.115   -47.800 48.034  1.00 41.40  ? 137 PHE A N   1 
ATOM   1068 C CA  . PHE A 1 136 ? 4.007   -48.928 47.728  1.00 38.90  ? 137 PHE A CA  1 
ATOM   1069 C C   . PHE A 1 136 ? 5.305   -48.529 47.003  1.00 49.47  ? 137 PHE A C   1 
ATOM   1070 O O   . PHE A 1 136 ? 6.384   -49.100 47.272  1.00 44.60  ? 137 PHE A O   1 
ATOM   1071 C CB  . PHE A 1 136 ? 3.251   -50.031 46.955  1.00 41.51  ? 137 PHE A CB  1 
ATOM   1072 C CG  . PHE A 1 136 ? 1.963   -50.454 47.621  1.00 44.62  ? 137 PHE A CG  1 
ATOM   1073 C CD1 . PHE A 1 136 ? 0.731   -50.028 47.139  1.00 41.64  ? 137 PHE A CD1 1 
ATOM   1074 C CD2 . PHE A 1 136 ? 1.992   -51.232 48.779  1.00 50.96  ? 137 PHE A CD2 1 
ATOM   1075 C CE1 . PHE A 1 136 ? -0.463  -50.406 47.782  1.00 43.89  ? 137 PHE A CE1 1 
ATOM   1076 C CE2 . PHE A 1 136 ? 0.810   -51.618 49.424  1.00 49.47  ? 137 PHE A CE2 1 
ATOM   1077 C CZ  . PHE A 1 136 ? -0.411  -51.205 48.940  1.00 46.01  ? 137 PHE A CZ  1 
ATOM   1078 N N   . LEU A 1 137 ? 5.213   -47.556 46.089  1.00 48.56  ? 138 LEU A N   1 
ATOM   1079 C CA  . LEU A 1 137 ? 6.389   -47.100 45.339  1.00 46.83  ? 138 LEU A CA  1 
ATOM   1080 C C   . LEU A 1 137 ? 7.323   -46.384 46.290  1.00 40.55  ? 138 LEU A C   1 
ATOM   1081 O O   . LEU A 1 137 ? 8.536   -46.568 46.270  1.00 44.09  ? 138 LEU A O   1 
ATOM   1082 C CB  . LEU A 1 137 ? 5.995   -46.113 44.224  1.00 39.17  ? 138 LEU A CB  1 
ATOM   1083 C CG  . LEU A 1 137 ? 5.951   -46.657 42.802  1.00 51.17  ? 138 LEU A CG  1 
ATOM   1084 C CD1 . LEU A 1 137 ? 5.296   -45.632 41.899  1.00 44.89  ? 138 LEU A CD1 1 
ATOM   1085 C CD2 . LEU A 1 137 ? 7.344   -46.980 42.335  1.00 42.47  ? 138 LEU A CD2 1 
ATOM   1086 N N   . VAL A 1 138 ? 6.742   -45.528 47.109  1.00 41.48  ? 139 VAL A N   1 
ATOM   1087 C CA  . VAL A 1 138 ? 7.553   -44.751 48.034  1.00 48.24  ? 139 VAL A CA  1 
ATOM   1088 C C   . VAL A 1 138 ? 8.299   -45.652 49.023  1.00 47.85  ? 139 VAL A C   1 
ATOM   1089 O O   . VAL A 1 138 ? 9.492   -45.476 49.227  1.00 49.04  ? 139 VAL A O   1 
ATOM   1090 C CB  . VAL A 1 138 ? 6.721   -43.650 48.689  1.00 51.85  ? 139 VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 138 ? 7.445   -43.038 49.848  1.00 46.67  ? 139 VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 138 ? 6.383   -42.596 47.617  1.00 43.38  ? 139 VAL A CG2 1 
ATOM   1093 N N   . GLN A 1 139 ? 7.627   -46.652 49.585  1.00 49.10  ? 140 GLN A N   1 
ATOM   1094 C CA  . GLN A 1 139 ? 8.292   -47.532 50.554  1.00 51.51  ? 140 GLN A CA  1 
ATOM   1095 C C   . GLN A 1 139 ? 9.404   -48.356 49.901  1.00 50.74  ? 140 GLN A C   1 
ATOM   1096 O O   . GLN A 1 139 ? 10.528  -48.402 50.400  1.00 52.90  ? 140 GLN A O   1 
ATOM   1097 C CB  . GLN A 1 139 ? 7.292   -48.446 51.288  1.00 52.59  ? 140 GLN A CB  1 
ATOM   1098 C CG  . GLN A 1 139 ? 7.875   -49.188 52.523  1.00 45.87  ? 140 GLN A CG  1 
ATOM   1099 C CD  . GLN A 1 139 ? 8.751   -50.396 52.167  1.00 50.46  ? 140 GLN A CD  1 
ATOM   1100 O OE1 . GLN A 1 139 ? 8.426   -51.177 51.274  1.00 53.81  ? 140 GLN A OE1 1 
ATOM   1101 N NE2 . GLN A 1 139 ? 9.872   -50.538 52.864  1.00 53.64  ? 140 GLN A NE2 1 
ATOM   1102 N N   . ALA A 1 140 ? 9.085   -48.983 48.777  1.00 49.44  ? 141 ALA A N   1 
ATOM   1103 C CA  . ALA A 1 140 ? 9.980   -49.941 48.132  1.00 54.29  ? 141 ALA A CA  1 
ATOM   1104 C C   . ALA A 1 140 ? 11.181  -49.313 47.439  1.00 55.10  ? 141 ALA A C   1 
ATOM   1105 O O   . ALA A 1 140 ? 12.243  -49.939 47.351  1.00 50.12  ? 141 ALA A O   1 
ATOM   1106 C CB  . ALA A 1 140 ? 9.196   -50.802 47.112  1.00 47.33  ? 141 ALA A CB  1 
ATOM   1107 N N   . GLU A 1 141 ? 11.009  -48.103 46.909  1.00 45.57  ? 142 GLU A N   1 
ATOM   1108 C CA  . GLU A 1 141 ? 12.040  -47.515 46.054  1.00 41.71  ? 142 GLU A CA  1 
ATOM   1109 C C   . GLU A 1 141 ? 12.545  -46.186 46.568  1.00 43.73  ? 142 GLU A C   1 
ATOM   1110 O O   . GLU A 1 141 ? 13.451  -45.590 45.979  1.00 44.51  ? 142 GLU A O   1 
ATOM   1111 C CB  . GLU A 1 141 ? 11.554  -47.379 44.605  1.00 47.68  ? 142 GLU A CB  1 
ATOM   1112 C CG  . GLU A 1 141 ? 11.301  -48.722 43.943  1.00 47.25  ? 142 GLU A CG  1 
ATOM   1113 C CD  . GLU A 1 141 ? 12.580  -49.489 43.709  1.00 47.79  ? 142 GLU A CD  1 
ATOM   1114 O OE1 . GLU A 1 141 ? 13.627  -48.836 43.491  1.00 50.98  ? 142 GLU A OE1 1 
ATOM   1115 O OE2 . GLU A 1 141 ? 12.546  -50.739 43.728  1.00 52.05  ? 142 GLU A OE2 1 
ATOM   1116 N N   . ARG A 1 142 ? 11.955  -45.737 47.670  1.00 51.50  ? 143 ARG A N   1 
ATOM   1117 C CA  . ARG A 1 142 ? 12.441  -44.578 48.412  1.00 57.16  ? 143 ARG A CA  1 
ATOM   1118 C C   . ARG A 1 142 ? 12.535  -43.313 47.571  1.00 52.54  ? 143 ARG A C   1 
ATOM   1119 O O   . ARG A 1 142 ? 13.530  -42.602 47.589  1.00 52.04  ? 143 ARG A O   1 
ATOM   1120 C CB  . ARG A 1 142 ? 13.745  -44.918 49.145  1.00 50.98  ? 143 ARG A CB  1 
ATOM   1121 C CG  . ARG A 1 142 ? 13.511  -46.059 50.162  1.00 57.11  ? 143 ARG A CG  1 
ATOM   1122 C CD  . ARG A 1 142 ? 14.654  -46.253 51.134  1.00 52.34  ? 143 ARG A CD  1 
ATOM   1123 N NE  . ARG A 1 142 ? 14.934  -45.048 51.915  1.00 68.96  ? 143 ARG A NE  1 
ATOM   1124 C CZ  . ARG A 1 142 ? 14.346  -44.744 53.073  1.00 72.75  ? 143 ARG A CZ  1 
ATOM   1125 N NH1 . ARG A 1 142 ? 13.423  -45.549 53.595  1.00 50.06  ? 143 ARG A NH1 1 
ATOM   1126 N NH2 . ARG A 1 142 ? 14.673  -43.622 53.704  1.00 60.54  ? 143 ARG A NH2 1 
ATOM   1127 N N   . THR A 1 143 ? 11.466  -43.050 46.835  1.00 56.00  ? 144 THR A N   1 
ATOM   1128 C CA  . THR A 1 143 ? 11.287  -41.789 46.135  1.00 52.60  ? 144 THR A CA  1 
ATOM   1129 C C   . THR A 1 143 ? 10.290  -40.909 46.883  1.00 42.63  ? 144 THR A C   1 
ATOM   1130 O O   . THR A 1 143 ? 9.591   -41.362 47.779  1.00 49.41  ? 144 THR A O   1 
ATOM   1131 C CB  . THR A 1 143 ? 10.669  -42.045 44.762  1.00 56.83  ? 144 THR A CB  1 
ATOM   1132 O OG1 . THR A 1 143 ? 9.632   -43.022 44.920  1.00 57.90  ? 144 THR A OG1 1 
ATOM   1133 C CG2 . THR A 1 143 ? 11.717  -42.570 43.799  1.00 53.36  ? 144 THR A CG2 1 
ATOM   1134 N N   . VAL A 1 144 ? 10.210  -39.649 46.497  1.00 42.47  ? 145 VAL A N   1 
ATOM   1135 C CA  . VAL A 1 144 ? 9.055   -38.855 46.859  1.00 46.99  ? 145 VAL A CA  1 
ATOM   1136 C C   . VAL A 1 144 ? 8.097   -38.917 45.662  1.00 46.68  ? 145 VAL A C   1 
ATOM   1137 O O   . VAL A 1 144 ? 8.544   -38.884 44.512  1.00 48.87  ? 145 VAL A O   1 
ATOM   1138 C CB  . VAL A 1 144 ? 9.461   -37.408 47.158  1.00 48.12  ? 145 VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 144 ? 8.239   -36.471 47.127  1.00 44.13  ? 145 VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 144 ? 10.202  -37.350 48.504  1.00 43.70  ? 145 VAL A CG2 1 
ATOM   1141 N N   . LEU A 1 145 ? 6.798   -39.045 45.937  1.00 42.58  ? 146 LEU A N   1 
ATOM   1142 C CA  . LEU A 1 145 ? 5.788   -39.143 44.886  1.00 49.53  ? 146 LEU A CA  1 
ATOM   1143 C C   . LEU A 1 145 ? 4.724   -38.091 45.096  1.00 46.36  ? 146 LEU A C   1 
ATOM   1144 O O   . LEU A 1 145 ? 4.184   -37.972 46.192  1.00 41.73  ? 146 LEU A O   1 
ATOM   1145 C CB  . LEU A 1 145 ? 5.123   -40.516 44.900  1.00 45.13  ? 146 LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 145 ? 3.947   -40.751 43.946  1.00 47.97  ? 146 LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 145 ? 4.324   -40.391 42.535  1.00 48.97  ? 146 LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 145 ? 3.615   -42.202 43.991  1.00 60.82  ? 146 LEU A CD2 1 
ATOM   1149 N N   . VAL A 1 146 ? 4.431   -37.342 44.038  1.00 39.89  ? 147 VAL A N   1 
ATOM   1150 C CA  . VAL A 1 146 ? 3.411   -36.290 44.063  1.00 42.52  ? 147 VAL A CA  1 
ATOM   1151 C C   . VAL A 1 146 ? 2.374   -36.578 42.983  1.00 40.68  ? 147 VAL A C   1 
ATOM   1152 O O   . VAL A 1 146 ? 2.732   -37.010 41.891  1.00 41.24  ? 147 VAL A O   1 
ATOM   1153 C CB  . VAL A 1 146 ? 4.043   -34.916 43.726  1.00 45.92  ? 147 VAL A CB  1 
ATOM   1154 C CG1 . VAL A 1 146 ? 3.021   -33.774 43.846  1.00 37.54  ? 147 VAL A CG1 1 
ATOM   1155 C CG2 . VAL A 1 146 ? 5.267   -34.673 44.590  1.00 42.72  ? 147 VAL A CG2 1 
ATOM   1156 N N   . SER A 1 147 ? 1.095   -36.344 43.272  1.00 41.04  ? 148 SER A N   1 
ATOM   1157 C CA  . SER A 1 147 ? 0.081   -36.379 42.219  1.00 44.53  ? 148 SER A CA  1 
ATOM   1158 C C   . SER A 1 147 ? -0.891  -35.230 42.429  1.00 40.45  ? 148 SER A C   1 
ATOM   1159 O O   . SER A 1 147 ? -1.108  -34.848 43.548  1.00 38.34  ? 148 SER A O   1 
ATOM   1160 C CB  . SER A 1 147 ? -0.667  -37.716 42.212  1.00 40.97  ? 148 SER A CB  1 
ATOM   1161 O OG  . SER A 1 147 ? -1.343  -37.919 43.445  1.00 41.70  ? 148 SER A OG  1 
ATOM   1162 N N   . MET A 1 148 ? -1.474  -34.690 41.353  1.00 35.92  ? 149 MET A N   1 
ATOM   1163 C CA  . MET A 1 148 ? -2.404  -33.581 41.475  1.00 36.75  ? 149 MET A CA  1 
ATOM   1164 C C   . MET A 1 148 ? -3.720  -33.838 40.764  1.00 41.36  ? 149 MET A C   1 
ATOM   1165 O O   . MET A 1 148 ? -3.776  -34.608 39.798  1.00 37.92  ? 149 MET A O   1 
ATOM   1166 C CB  . MET A 1 148 ? -1.773  -32.288 40.907  1.00 44.35  ? 149 MET A CB  1 
ATOM   1167 C CG  . MET A 1 148 ? -1.961  -32.074 39.377  1.00 39.52  ? 149 MET A CG  1 
ATOM   1168 S SD  . MET A 1 148 ? -1.113  -33.306 38.365  1.00 43.12  ? 149 MET A SD  1 
ATOM   1169 C CE  . MET A 1 148 ? 0.620   -32.874 38.623  1.00 31.54  ? 149 MET A CE  1 
ATOM   1170 N N   . ASN A 1 149 ? -4.774  -33.170 41.227  1.00 40.11  ? 150 ASN A N   1 
ATOM   1171 C CA  . ASN A 1 149 ? -6.004  -33.063 40.444  1.00 45.84  ? 150 ASN A CA  1 
ATOM   1172 C C   . ASN A 1 149 ? -5.871  -31.883 39.486  1.00 49.93  ? 150 ASN A C   1 
ATOM   1173 O O   . ASN A 1 149 ? -5.283  -30.862 39.835  1.00 44.21  ? 150 ASN A O   1 
ATOM   1174 C CB  . ASN A 1 149 ? -7.230  -32.817 41.330  1.00 42.35  ? 150 ASN A CB  1 
ATOM   1175 C CG  . ASN A 1 149 ? -7.772  -34.089 41.992  1.00 45.48  ? 150 ASN A CG  1 
ATOM   1176 O OD1 . ASN A 1 149 ? -7.215  -35.182 41.860  1.00 44.18  ? 150 ASN A OD1 1 
ATOM   1177 N ND2 . ASN A 1 149 ? -8.877  -33.936 42.718  1.00 44.97  ? 150 ASN A ND2 1 
ATOM   1178 N N   . TYR A 1 150 ? -6.421  -32.025 38.284  1.00 38.26  ? 151 TYR A N   1 
ATOM   1179 C CA  . TYR A 1 150 ? -6.533  -30.914 37.360  1.00 41.80  ? 151 TYR A CA  1 
ATOM   1180 C C   . TYR A 1 150 ? -7.927  -30.918 36.735  1.00 42.49  ? 151 TYR A C   1 
ATOM   1181 O O   . TYR A 1 150 ? -8.556  -31.963 36.610  1.00 37.80  ? 151 TYR A O   1 
ATOM   1182 C CB  . TYR A 1 150 ? -5.455  -31.006 36.282  1.00 40.03  ? 151 TYR A CB  1 
ATOM   1183 C CG  . TYR A 1 150 ? -5.521  -32.258 35.420  1.00 35.47  ? 151 TYR A CG  1 
ATOM   1184 C CD1 . TYR A 1 150 ? -4.885  -33.426 35.814  1.00 36.78  ? 151 TYR A CD1 1 
ATOM   1185 C CD2 . TYR A 1 150 ? -6.198  -32.257 34.210  1.00 37.51  ? 151 TYR A CD2 1 
ATOM   1186 C CE1 . TYR A 1 150 ? -4.925  -34.562 35.040  1.00 32.05  ? 151 TYR A CE1 1 
ATOM   1187 C CE2 . TYR A 1 150 ? -6.247  -33.402 33.409  1.00 35.67  ? 151 TYR A CE2 1 
ATOM   1188 C CZ  . TYR A 1 150 ? -5.609  -34.547 33.831  1.00 39.01  ? 151 TYR A CZ  1 
ATOM   1189 O OH  . TYR A 1 150 ? -5.654  -35.682 33.048  1.00 35.28  ? 151 TYR A OH  1 
ATOM   1190 N N   . ARG A 1 151 ? -8.414  -29.746 36.358  1.00 36.51  ? 152 ARG A N   1 
ATOM   1191 C CA  . ARG A 1 151 ? -9.748  -29.641 35.776  1.00 41.36  ? 152 ARG A CA  1 
ATOM   1192 C C   . ARG A 1 151 ? -9.899  -30.431 34.474  1.00 42.49  ? 152 ARG A C   1 
ATOM   1193 O O   . ARG A 1 151 ? -9.013  -30.407 33.631  1.00 40.65  ? 152 ARG A O   1 
ATOM   1194 C CB  . ARG A 1 151 ? -10.105 -28.160 35.567  1.00 41.24  ? 152 ARG A CB  1 
ATOM   1195 C CG  . ARG A 1 151 ? -10.536 -27.450 36.872  1.00 35.18  ? 152 ARG A CG  1 
ATOM   1196 C CD  . ARG A 1 151 ? -10.686 -25.950 36.629  1.00 40.82  ? 152 ARG A CD  1 
ATOM   1197 N NE  . ARG A 1 151 ? -9.385  -25.275 36.494  1.00 41.43  ? 152 ARG A NE  1 
ATOM   1198 C CZ  . ARG A 1 151 ? -9.243  -24.003 36.132  1.00 41.06  ? 152 ARG A CZ  1 
ATOM   1199 N NH1 . ARG A 1 151 ? -10.321 -23.267 35.855  1.00 35.56  ? 152 ARG A NH1 1 
ATOM   1200 N NH2 . ARG A 1 151 ? -8.032  -23.464 36.057  1.00 37.75  ? 152 ARG A NH2 1 
ATOM   1201 N N   . VAL A 1 152 ? -11.024 -31.127 34.320  1.00 38.52  ? 153 VAL A N   1 
ATOM   1202 C CA  . VAL A 1 152 ? -11.300 -31.919 33.121  1.00 34.17  ? 153 VAL A CA  1 
ATOM   1203 C C   . VAL A 1 152 ? -12.598 -31.454 32.434  1.00 45.00  ? 153 VAL A C   1 
ATOM   1204 O O   . VAL A 1 152 ? -13.274 -30.556 32.934  1.00 43.46  ? 153 VAL A O   1 
ATOM   1205 C CB  . VAL A 1 152 ? -11.345 -33.438 33.448  1.00 40.58  ? 153 VAL A CB  1 
ATOM   1206 C CG1 . VAL A 1 152 ? -9.961  -33.929 33.881  1.00 38.08  ? 153 VAL A CG1 1 
ATOM   1207 C CG2 . VAL A 1 152 ? -12.377 -33.746 34.550  1.00 36.66  ? 153 VAL A CG2 1 
ATOM   1208 N N   . GLY A 1 153 ? -12.922 -32.037 31.276  1.00 43.91  ? 154 GLY A N   1 
ATOM   1209 C CA  . GLY A 1 153 ? -14.117 -31.664 30.531  1.00 35.90  ? 154 GLY A CA  1 
ATOM   1210 C C   . GLY A 1 153 ? -14.151 -30.190 30.174  1.00 44.59  ? 154 GLY A C   1 
ATOM   1211 O O   . GLY A 1 153 ? -13.103 -29.552 30.029  1.00 39.28  ? 154 GLY A O   1 
ATOM   1212 N N   . ALA A 1 154 ? -15.352 -29.630 30.066  1.00 44.10  ? 155 ALA A N   1 
ATOM   1213 C CA  . ALA A 1 154 ? -15.492 -28.213 29.760  1.00 41.15  ? 155 ALA A CA  1 
ATOM   1214 C C   . ALA A 1 154 ? -14.768 -27.312 30.763  1.00 48.73  ? 155 ALA A C   1 
ATOM   1215 O O   . ALA A 1 154 ? -14.213 -26.286 30.373  1.00 46.17  ? 155 ALA A O   1 
ATOM   1216 C CB  . ALA A 1 154 ? -17.012 -27.805 29.640  1.00 37.69  ? 155 ALA A CB  1 
ATOM   1217 N N   . PHE A 1 155 ? -14.802 -27.684 32.049  1.00 40.46  ? 156 PHE A N   1 
ATOM   1218 C CA  . PHE A 1 155 ? -14.185 -26.883 33.107  1.00 41.42  ? 156 PHE A CA  1 
ATOM   1219 C C   . PHE A 1 155 ? -12.693 -26.664 32.883  1.00 39.03  ? 156 PHE A C   1 
ATOM   1220 O O   . PHE A 1 155 ? -12.176 -25.592 33.199  1.00 43.54  ? 156 PHE A O   1 
ATOM   1221 C CB  . PHE A 1 155 ? -14.469 -27.497 34.510  1.00 36.49  ? 156 PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 155 ? -15.906 -27.826 34.701  1.00 43.38  ? 156 PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 155 ? -16.386 -29.097 34.394  1.00 46.09  ? 156 PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 155 ? -16.805 -26.842 35.089  1.00 39.72  ? 156 PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 155 ? -17.730 -29.394 34.516  1.00 43.31  ? 156 PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 155 ? -18.156 -27.131 35.215  1.00 47.23  ? 156 PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 155 ? -18.620 -28.410 34.922  1.00 42.14  ? 156 PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 156 ? -12.003 -27.673 32.350  1.00 37.17  ? 157 GLY A N   1 
ATOM   1229 C CA  . GLY A 1 156 ? -10.577 -27.551 32.065  1.00 36.79  ? 157 GLY A CA  1 
ATOM   1230 C C   . GLY A 1 156 ? -10.212 -27.200 30.627  1.00 43.77  ? 157 GLY A C   1 
ATOM   1231 O O   . GLY A 1 156 ? -9.133  -26.650 30.379  1.00 42.76  ? 157 GLY A O   1 
ATOM   1232 N N   . PHE A 1 157 ? -11.099 -27.491 29.676  1.00 41.12  ? 158 PHE A N   1 
ATOM   1233 C CA  . PHE A 1 157 ? -10.717 -27.436 28.248  1.00 38.10  ? 158 PHE A CA  1 
ATOM   1234 C C   . PHE A 1 157 ? -11.658 -26.757 27.251  1.00 44.60  ? 158 PHE A C   1 
ATOM   1235 O O   . PHE A 1 157 ? -11.355 -26.688 26.052  1.00 43.50  ? 158 PHE A O   1 
ATOM   1236 C CB  . PHE A 1 157 ? -10.286 -28.840 27.767  1.00 37.70  ? 158 PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 157 ? -9.097  -29.353 28.520  1.00 45.19  ? 158 PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 157 ? -9.251  -30.219 29.593  1.00 37.38  ? 158 PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 157 ? -7.833  -28.875 28.229  1.00 40.40  ? 158 PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 157 ? -8.145  -30.652 30.331  1.00 39.34  ? 158 PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 157 ? -6.728  -29.292 28.961  1.00 42.80  ? 158 PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 157 ? -6.882  -30.185 30.013  1.00 38.75  ? 158 PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 158 ? -12.775 -26.227 27.727  1.00 45.77  ? 159 LEU A N   1 
ATOM   1244 C CA  . LEU A 1 158 ? -13.629 -25.434 26.853  1.00 44.21  ? 159 LEU A CA  1 
ATOM   1245 C C   . LEU A 1 158 ? -12.853 -24.205 26.391  1.00 49.02  ? 159 LEU A C   1 
ATOM   1246 O O   . LEU A 1 158 ? -12.196 -23.551 27.187  1.00 44.89  ? 159 LEU A O   1 
ATOM   1247 C CB  . LEU A 1 158 ? -14.928 -25.017 27.548  1.00 42.34  ? 159 LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 158 ? -15.889 -24.192 26.670  1.00 49.62  ? 159 LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 158 ? -17.342 -24.622 26.839  1.00 46.20  ? 159 LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 158 ? -15.752 -22.700 26.941  1.00 51.34  ? 159 LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 159 ? -12.931 -23.892 25.100  1.00 44.36  ? 160 ALA A N   1 
ATOM   1252 C CA  . ALA A 1 159 ? -12.144 -22.798 24.561  1.00 49.04  ? 160 ALA A CA  1 
ATOM   1253 C C   . ALA A 1 159 ? -12.926 -22.006 23.527  1.00 56.76  ? 160 ALA A C   1 
ATOM   1254 O O   . ALA A 1 159 ? -13.454 -22.574 22.576  1.00 50.39  ? 160 ALA A O   1 
ATOM   1255 C CB  . ALA A 1 159 ? -10.841 -23.337 23.935  1.00 45.31  ? 160 ALA A CB  1 
ATOM   1256 N N   . LEU A 1 160 ? -12.998 -20.696 23.729  1.00 51.14  ? 161 LEU A N   1 
ATOM   1257 C CA  . LEU A 1 160 ? -13.369 -19.776 22.669  1.00 54.62  ? 161 LEU A CA  1 
ATOM   1258 C C   . LEU A 1 160 ? -12.100 -19.005 22.334  1.00 53.66  ? 161 LEU A C   1 
ATOM   1259 O O   . LEU A 1 160 ? -11.821 -17.979 22.936  1.00 57.30  ? 161 LEU A O   1 
ATOM   1260 C CB  . LEU A 1 160 ? -14.482 -18.825 23.123  1.00 46.88  ? 161 LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 160 ? -15.842 -19.480 23.365  1.00 61.67  ? 161 LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 160 ? -16.708 -18.603 24.247  1.00 67.76  ? 161 LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 160 ? -16.552 -19.798 22.042  1.00 50.54  ? 161 LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 161 ? -11.313 -19.517 21.375  1.00 60.05  ? 162 PRO A N   1 
ATOM   1265 C CA  . PRO A 1 161 ? -9.975  -18.985 21.083  1.00 67.13  ? 162 PRO A CA  1 
ATOM   1266 C C   . PRO A 1 161 ? -10.001 -17.494 20.754  1.00 60.47  ? 162 PRO A C   1 
ATOM   1267 O O   . PRO A 1 161 ? -10.883 -17.035 20.040  1.00 54.92  ? 162 PRO A O   1 
ATOM   1268 C CB  . PRO A 1 161 ? -9.540  -19.806 19.869  1.00 55.00  ? 162 PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 161 ? -10.288 -21.094 20.006  1.00 52.22  ? 162 PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 161 ? -11.635 -20.677 20.526  1.00 47.33  ? 162 PRO A CD  1 
ATOM   1271 N N   . GLY A 1 162 ? -9.049  -16.750 21.299  1.00 58.29  ? 163 GLY A N   1 
ATOM   1272 C CA  . GLY A 1 162 ? -9.086  -15.306 21.216  1.00 59.38  ? 163 GLY A CA  1 
ATOM   1273 C C   . GLY A 1 162 ? -9.609  -14.657 22.491  1.00 71.09  ? 163 GLY A C   1 
ATOM   1274 O O   . GLY A 1 162 ? -9.105  -13.606 22.894  1.00 65.94  ? 163 GLY A O   1 
ATOM   1275 N N   . SER A 1 163 ? -10.604 -15.278 23.132  1.00 58.87  ? 164 SER A N   1 
ATOM   1276 C CA  . SER A 1 163 ? -11.254 -14.674 24.300  1.00 53.48  ? 164 SER A CA  1 
ATOM   1277 C C   . SER A 1 163 ? -10.429 -14.777 25.563  1.00 58.54  ? 164 SER A C   1 
ATOM   1278 O O   . SER A 1 163 ? -9.585  -15.651 25.706  1.00 65.09  ? 164 SER A O   1 
ATOM   1279 C CB  . SER A 1 163 ? -12.636 -15.286 24.559  1.00 66.95  ? 164 SER A CB  1 
ATOM   1280 O OG  . SER A 1 163 ? -12.535 -16.530 25.238  1.00 58.60  ? 164 SER A OG  1 
ATOM   1281 N N   . ARG A 1 164 ? -10.696 -13.876 26.489  1.00 58.52  ? 165 ARG A N   1 
ATOM   1282 C CA  . ARG A 1 164 ? -10.014 -13.885 27.760  1.00 62.12  ? 165 ARG A CA  1 
ATOM   1283 C C   . ARG A 1 164 ? -10.886 -14.626 28.782  1.00 53.91  ? 165 ARG A C   1 
ATOM   1284 O O   . ARG A 1 164 ? -10.380 -15.203 29.727  1.00 65.65  ? 165 ARG A O   1 
ATOM   1285 C CB  . ARG A 1 164 ? -9.709  -12.451 28.201  1.00 64.56  ? 165 ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 164 ? -8.876  -12.361 29.470  1.00 95.57  ? 165 ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 164 ? -8.488  -10.922 29.799  1.00 110.68 ? 165 ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 164 ? -7.933  -10.805 31.147  1.00 122.86 ? 165 ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 164 ? -6.665  -11.056 31.462  1.00 118.78 ? 165 ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 164 ? -5.810  -11.446 30.525  1.00 115.68 ? 165 ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 164 ? -6.252  -10.922 32.717  1.00 107.37 ? 165 ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 165 ? -12.196 -14.638 28.552  1.00 61.36  ? 166 GLU A N   1 
ATOM   1293 C CA  . GLU A 1 165 ? -13.138 -15.312 29.445  1.00 58.05  ? 166 GLU A CA  1 
ATOM   1294 C C   . GLU A 1 165 ? -13.087 -16.846 29.360  1.00 60.51  ? 166 GLU A C   1 
ATOM   1295 O O   . GLU A 1 165 ? -13.469 -17.525 30.304  1.00 59.73  ? 166 GLU A O   1 
ATOM   1296 C CB  . GLU A 1 165 ? -14.569 -14.811 29.214  1.00 58.08  ? 166 GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 165 ? -14.731 -13.291 29.324  1.00 62.01  ? 166 GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 165 ? -14.612 -12.572 27.972  1.00 80.65  ? 166 GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 165 ? -14.165 -13.203 26.984  1.00 74.34  ? 166 GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 165 ? -14.975 -11.373 27.894  1.00 81.54  ? 166 GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 166 ? -12.614 -17.387 28.241  1.00 56.69  ? 167 ALA A N   1 
ATOM   1302 C CA  . ALA A 1 166 ? -12.412 -18.832 28.120  1.00 54.64  ? 167 ALA A CA  1 
ATOM   1303 C C   . ALA A 1 166 ? -11.301 -19.181 27.113  1.00 51.53  ? 167 ALA A C   1 
ATOM   1304 O O   . ALA A 1 166 ? -11.576 -19.583 25.988  1.00 55.05  ? 167 ALA A O   1 
ATOM   1305 C CB  . ALA A 1 166 ? -13.724 -19.524 27.749  1.00 56.60  ? 167 ALA A CB  1 
ATOM   1306 N N   . PRO A 1 167 ? -10.036 -19.034 27.525  1.00 48.16  ? 168 PRO A N   1 
ATOM   1307 C CA  . PRO A 1 167 ? -8.914  -19.173 26.589  1.00 45.25  ? 168 PRO A CA  1 
ATOM   1308 C C   . PRO A 1 167 ? -8.572  -20.611 26.188  1.00 53.26  ? 168 PRO A C   1 
ATOM   1309 O O   . PRO A 1 167 ? -7.939  -20.797 25.156  1.00 54.84  ? 168 PRO A O   1 
ATOM   1310 C CB  . PRO A 1 167 ? -7.744  -18.539 27.350  1.00 45.57  ? 168 PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 167 ? -8.100  -18.749 28.819  1.00 42.29  ? 168 PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 167 ? -9.605  -18.614 28.872  1.00 48.43  ? 168 PRO A CD  1 
ATOM   1313 N N   . GLY A 1 168 ? -8.984  -21.607 26.971  1.00 55.78  ? 169 GLY A N   1 
ATOM   1314 C CA  . GLY A 1 168 ? -8.593  -22.982 26.700  1.00 47.03  ? 169 GLY A CA  1 
ATOM   1315 C C   . GLY A 1 168 ? -7.341  -23.421 27.454  1.00 50.01  ? 169 GLY A C   1 
ATOM   1316 O O   . GLY A 1 168 ? -6.590  -22.590 27.958  1.00 43.86  ? 169 GLY A O   1 
ATOM   1317 N N   . ASN A 1 169 ? -7.145  -24.738 27.549  1.00 48.19  ? 170 ASN A N   1 
ATOM   1318 C CA  . ASN A 1 169 ? -5.960  -25.332 28.160  1.00 42.10  ? 170 ASN A CA  1 
ATOM   1319 C C   . ASN A 1 169 ? -5.742  -25.025 29.656  1.00 42.56  ? 170 ASN A C   1 
ATOM   1320 O O   . ASN A 1 169 ? -4.624  -25.169 30.157  1.00 40.64  ? 170 ASN A O   1 
ATOM   1321 C CB  . ASN A 1 169 ? -4.704  -24.950 27.366  1.00 41.11  ? 170 ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 169 ? -4.757  -25.425 25.927  1.00 47.70  ? 170 ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 169 ? -5.450  -26.389 25.602  1.00 47.34  ? 170 ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 169 ? -4.032  -24.746 25.058  1.00 41.80  ? 170 ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 170 ? -6.783  -24.614 30.372  1.00 43.02  ? 171 VAL A N   1 
ATOM   1326 C CA  . VAL A 1 170 ? -6.585  -24.272 31.785  1.00 44.21  ? 171 VAL A CA  1 
ATOM   1327 C C   . VAL A 1 170 ? -6.262  -25.491 32.684  1.00 39.94  ? 171 VAL A C   1 
ATOM   1328 O O   . VAL A 1 170 ? -5.526  -25.379 33.673  1.00 42.15  ? 171 VAL A O   1 
ATOM   1329 C CB  . VAL A 1 170 ? -7.714  -23.345 32.349  1.00 47.76  ? 171 VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 170 ? -7.803  -22.059 31.517  1.00 40.79  ? 171 VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 170 ? -9.068  -24.054 32.413  1.00 43.61  ? 171 VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 171 ? -6.783  -26.654 32.318  1.00 41.48  ? 172 GLY A N   1 
ATOM   1333 C CA  . GLY A 1 171 ? -6.451  -27.890 33.018  1.00 39.32  ? 172 GLY A CA  1 
ATOM   1334 C C   . GLY A 1 171 ? -4.971  -28.228 32.874  1.00 39.83  ? 172 GLY A C   1 
ATOM   1335 O O   . GLY A 1 171 ? -4.352  -28.772 33.804  1.00 38.44  ? 172 GLY A O   1 
ATOM   1336 N N   . LEU A 1 172 ? -4.402  -27.912 31.709  1.00 40.32  ? 173 LEU A N   1 
ATOM   1337 C CA  . LEU A 1 172 ? -2.948  -28.029 31.496  1.00 42.07  ? 173 LEU A CA  1 
ATOM   1338 C C   . LEU A 1 172 ? -2.179  -27.041 32.388  1.00 40.19  ? 173 LEU A C   1 
ATOM   1339 O O   . LEU A 1 172 ? -1.150  -27.384 32.972  1.00 40.17  ? 173 LEU A O   1 
ATOM   1340 C CB  . LEU A 1 172 ? -2.598  -27.809 30.024  1.00 39.11  ? 173 LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 172 ? -2.814  -29.009 29.101  1.00 38.13  ? 173 LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 172 ? -2.601  -28.627 27.631  1.00 36.08  ? 173 LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 172 ? -1.892  -30.160 29.477  1.00 37.60  ? 173 LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 173 ? -2.710  -25.828 32.515  1.00 36.79  ? 174 LEU A N   1 
ATOM   1345 C CA  . LEU A 1 173 ? -2.133  -24.831 33.401  1.00 42.30  ? 174 LEU A CA  1 
ATOM   1346 C C   . LEU A 1 173 ? -2.296  -25.246 34.871  1.00 43.42  ? 174 LEU A C   1 
ATOM   1347 O O   . LEU A 1 173 ? -1.450  -24.913 35.687  1.00 42.39  ? 174 LEU A O   1 
ATOM   1348 C CB  . LEU A 1 173 ? -2.726  -23.427 33.153  1.00 38.88  ? 174 LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 173 ? -2.508  -22.784 31.773  1.00 46.06  ? 174 LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 173 ? -3.159  -21.402 31.710  1.00 43.98  ? 174 LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 173 ? -1.029  -22.665 31.451  1.00 39.93  ? 174 LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 174 ? -3.359  -25.977 35.204  1.00 41.50  ? 175 ASP A N   1 
ATOM   1353 C CA  . ASP A 1 174 ? -3.493  -26.516 36.567  1.00 41.02  ? 175 ASP A CA  1 
ATOM   1354 C C   . ASP A 1 174 ? -2.312  -27.449 36.858  1.00 45.51  ? 175 ASP A C   1 
ATOM   1355 O O   . ASP A 1 174 ? -1.756  -27.443 37.958  1.00 39.92  ? 175 ASP A O   1 
ATOM   1356 C CB  . ASP A 1 174 ? -4.778  -27.324 36.741  1.00 37.82  ? 175 ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 174 ? -6.033  -26.478 36.678  1.00 42.29  ? 175 ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 174 ? -5.951  -25.238 36.850  1.00 44.33  ? 175 ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 174 ? -7.115  -27.074 36.466  1.00 42.57  ? 175 ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 175 ? -1.939  -28.267 35.875  1.00 41.02  ? 176 GLN A N   1 
ATOM   1361 C CA  . GLN A 1 175 ? -0.802  -29.180 36.049  1.00 41.92  ? 176 GLN A CA  1 
ATOM   1362 C C   . GLN A 1 175 ? 0.528   -28.407 36.201  1.00 48.68  ? 176 GLN A C   1 
ATOM   1363 O O   . GLN A 1 175 ? 1.362   -28.752 37.059  1.00 40.82  ? 176 GLN A O   1 
ATOM   1364 C CB  . GLN A 1 175 ? -0.688  -30.170 34.872  1.00 41.34  ? 176 GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 175 ? -1.878  -31.111 34.657  1.00 37.55  ? 176 GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 175 ? -1.791  -31.827 33.306  1.00 42.14  ? 176 GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 175 ? -0.737  -31.822 32.653  1.00 42.21  ? 176 GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 175 ? -2.895  -32.441 32.881  1.00 38.35  ? 176 GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 176 ? 0.724   -27.380 35.363  1.00 39.84  ? 177 ARG A N   1 
ATOM   1370 C CA  . ARG A 1 176 ? 1.944   -26.563 35.403  1.00 38.05  ? 177 ARG A CA  1 
ATOM   1371 C C   . ARG A 1 176 ? 2.102   -25.887 36.750  1.00 43.20  ? 177 ARG A C   1 
ATOM   1372 O O   . ARG A 1 176 ? 3.193   -25.874 37.326  1.00 43.48  ? 177 ARG A O   1 
ATOM   1373 C CB  . ARG A 1 176 ? 1.946   -25.489 34.298  1.00 38.46  ? 177 ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 176 ? 3.167   -24.553 34.339  1.00 43.16  ? 177 ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 176 ? 3.148   -23.524 33.199  1.00 43.14  ? 177 ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 176 ? 3.385   -24.153 31.901  1.00 43.41  ? 177 ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 176 ? 3.127   -23.566 30.739  1.00 50.26  ? 177 ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 176 ? 2.618   -22.335 30.718  1.00 42.61  ? 177 ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 176 ? 3.362   -24.213 29.607  1.00 46.58  ? 177 ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 177 ? 1.008   -25.313 37.241  1.00 43.96  ? 178 LEU A N   1 
ATOM   1381 C CA  . LEU A 1 177 ? 1.003   -24.687 38.557  1.00 48.81  ? 178 LEU A CA  1 
ATOM   1382 C C   . LEU A 1 177 ? 1.401   -25.708 39.633  1.00 44.03  ? 178 LEU A C   1 
ATOM   1383 O O   . LEU A 1 177 ? 2.171   -25.396 40.538  1.00 47.32  ? 178 LEU A O   1 
ATOM   1384 C CB  . LEU A 1 177 ? -0.352  -24.031 38.872  1.00 45.29  ? 178 LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 177 ? -0.472  -23.370 40.263  1.00 45.96  ? 178 LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 177 ? 0.484   -22.187 40.414  1.00 44.04  ? 178 LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 177 ? -1.884  -22.914 40.545  1.00 44.21  ? 178 LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 178 ? 0.919   -26.942 39.518  1.00 46.21  ? 179 ALA A N   1 
ATOM   1389 C CA  . ALA A 1 178 ? 1.328   -27.973 40.477  1.00 41.97  ? 179 ALA A CA  1 
ATOM   1390 C C   . ALA A 1 178 ? 2.827   -28.276 40.352  1.00 42.47  ? 179 ALA A C   1 
ATOM   1391 O O   . ALA A 1 178 ? 3.507   -28.485 41.357  1.00 39.66  ? 179 ALA A O   1 
ATOM   1392 C CB  . ALA A 1 178 ? 0.498   -29.241 40.292  1.00 42.93  ? 179 ALA A CB  1 
ATOM   1393 N N   . LEU A 1 179 ? 3.344   -28.290 39.117  1.00 38.43  ? 180 LEU A N   1 
ATOM   1394 C CA  . LEU A 1 179 ? 4.783   -28.498 38.914  1.00 43.69  ? 180 LEU A CA  1 
ATOM   1395 C C   . LEU A 1 179 ? 5.618   -27.320 39.480  1.00 46.57  ? 180 LEU A C   1 
ATOM   1396 O O   . LEU A 1 179 ? 6.705   -27.523 40.027  1.00 45.28  ? 180 LEU A O   1 
ATOM   1397 C CB  . LEU A 1 179 ? 5.114   -28.772 37.439  1.00 45.12  ? 180 LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 179 ? 4.496   -30.013 36.774  1.00 41.87  ? 180 LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 179 ? 4.866   -30.093 35.262  1.00 38.11  ? 180 LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 179 ? 4.911   -31.276 37.478  1.00 41.64  ? 180 LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 180 ? 5.094   -26.102 39.363  1.00 44.23  ? 181 GLN A N   1 
ATOM   1402 C CA  . GLN A 1 180 ? 5.716   -24.944 40.003  1.00 50.82  ? 181 GLN A CA  1 
ATOM   1403 C C   . GLN A 1 180 ? 5.687   -25.092 41.535  1.00 50.45  ? 181 GLN A C   1 
ATOM   1404 O O   . GLN A 1 180 ? 6.675   -24.772 42.206  1.00 48.78  ? 181 GLN A O   1 
ATOM   1405 C CB  . GLN A 1 180 ? 5.044   -23.632 39.555  1.00 41.16  ? 181 GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 180 ? 5.302   -23.309 38.089  1.00 51.30  ? 181 GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 180 ? 4.380   -22.231 37.541  1.00 60.31  ? 181 GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 180 ? 3.314   -21.970 38.096  1.00 66.36  ? 181 GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 180 ? 4.782   -21.610 36.436  1.00 61.89  ? 181 GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 181 ? 4.568   -25.593 42.070  1.00 41.35  ? 182 TRP A N   1 
ATOM   1411 C CA  . TRP A 1 181 ? 4.422   -25.813 43.517  1.00 44.15  ? 182 TRP A CA  1 
ATOM   1412 C C   . TRP A 1 181 ? 5.467   -26.817 43.989  1.00 46.25  ? 182 TRP A C   1 
ATOM   1413 O O   . TRP A 1 181 ? 6.000   -26.702 45.089  1.00 46.15  ? 182 TRP A O   1 
ATOM   1414 C CB  . TRP A 1 181 ? 2.996   -26.289 43.868  1.00 36.61  ? 182 TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 181 ? 2.704   -26.445 45.365  1.00 37.13  ? 182 TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 181 ? 1.998   -25.581 46.157  1.00 39.65  ? 182 TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 181 ? 3.071   -27.555 46.214  1.00 37.26  ? 182 TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 181 ? 1.929   -26.070 47.450  1.00 46.04  ? 182 TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 181 ? 2.576   -27.279 47.504  1.00 39.83  ? 182 TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 181 ? 3.780   -28.747 46.008  1.00 38.98  ? 182 TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 181 ? 2.768   -28.145 48.576  1.00 44.80  ? 182 TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 181 ? 3.970   -29.603 47.081  1.00 45.75  ? 182 TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 181 ? 3.463   -29.299 48.344  1.00 37.85  ? 182 TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 182 ? 5.756   -27.809 43.154  1.00 44.27  ? 183 VAL A N   1 
ATOM   1425 C CA  . VAL A 1 182 ? 6.763   -28.810 43.492  1.00 45.49  ? 183 VAL A CA  1 
ATOM   1426 C C   . VAL A 1 182 ? 8.181   -28.198 43.558  1.00 44.46  ? 183 VAL A C   1 
ATOM   1427 O O   . VAL A 1 182 ? 8.909   -28.418 44.532  1.00 51.32  ? 183 VAL A O   1 
ATOM   1428 C CB  . VAL A 1 182 ? 6.708   -30.017 42.520  1.00 42.04  ? 183 VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 182 ? 7.967   -30.877 42.639  1.00 39.75  ? 183 VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 182 ? 5.481   -30.848 42.808  1.00 41.12  ? 183 VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 183 ? 8.551   -27.429 42.534  1.00 45.39  ? 184 GLN A N   1 
ATOM   1432 C CA  . GLN A 1 183 ? 9.811   -26.685 42.542  1.00 51.25  ? 184 GLN A CA  1 
ATOM   1433 C C   . GLN A 1 183 ? 10.002  -25.909 43.851  1.00 46.89  ? 184 GLN A C   1 
ATOM   1434 O O   . GLN A 1 183 ? 11.061  -25.985 44.473  1.00 50.10  ? 184 GLN A O   1 
ATOM   1435 C CB  . GLN A 1 183 ? 9.901   -25.742 41.339  1.00 45.39  ? 184 GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 183 ? 10.174  -26.467 40.014  1.00 43.44  ? 184 GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 183 ? 11.435  -27.320 40.075  1.00 55.54  ? 184 GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 183 ? 12.541  -26.802 40.210  1.00 64.04  ? 184 GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 183 ? 11.272  -28.629 39.987  1.00 53.60  ? 184 GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 184 ? 8.953   -25.226 44.293  1.00 46.56  ? 185 GLU A N   1 
ATOM   1441 C CA  . GLU A 1 184 ? 9.034   -24.363 45.475  1.00 55.63  ? 185 GLU A CA  1 
ATOM   1442 C C   . GLU A 1 184 ? 8.897   -25.043 46.834  1.00 57.11  ? 185 GLU A C   1 
ATOM   1443 O O   . GLU A 1 184 ? 9.356   -24.502 47.833  1.00 61.90  ? 185 GLU A O   1 
ATOM   1444 C CB  . GLU A 1 184 ? 8.010   -23.234 45.369  1.00 55.67  ? 185 GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 184 ? 8.250   -22.346 44.133  1.00 68.38  ? 185 GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 184 ? 7.201   -21.261 43.950  1.00 71.57  ? 185 GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 184 ? 7.110   -20.724 42.827  1.00 79.71  ? 185 GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 184 ? 6.478   -20.943 44.925  1.00 79.02  ? 185 GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 185 ? 8.283   -26.221 46.888  1.00 52.32  ? 186 ASN A N   1 
ATOM   1450 C CA  . ASN A 1 185 ? 7.903   -26.782 48.178  1.00 50.95  ? 186 ASN A CA  1 
ATOM   1451 C C   . ASN A 1 185 ? 8.335   -28.217 48.483  1.00 53.25  ? 186 ASN A C   1 
ATOM   1452 O O   . ASN A 1 185 ? 8.284   -28.647 49.646  1.00 46.18  ? 186 ASN A O   1 
ATOM   1453 C CB  . ASN A 1 185 ? 6.395   -26.645 48.366  1.00 48.48  ? 186 ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 185 ? 5.945   -25.214 48.314  1.00 45.76  ? 186 ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 185 ? 6.220   -24.443 49.225  1.00 52.11  ? 186 ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 185 ? 5.258   -24.841 47.246  1.00 48.54  ? 186 ASN A ND2 1 
ATOM   1457 N N   . VAL A 1 186 ? 8.754   -28.954 47.458  1.00 47.62  ? 187 VAL A N   1 
ATOM   1458 C CA  . VAL A 1 186 ? 9.034   -30.380 47.637  1.00 48.00  ? 187 VAL A CA  1 
ATOM   1459 C C   . VAL A 1 186 ? 10.219  -30.642 48.581  1.00 54.76  ? 187 VAL A C   1 
ATOM   1460 O O   . VAL A 1 186 ? 10.226  -31.650 49.301  1.00 47.53  ? 187 VAL A O   1 
ATOM   1461 C CB  . VAL A 1 186 ? 9.181   -31.128 46.264  1.00 49.37  ? 187 VAL A CB  1 
ATOM   1462 C CG1 . VAL A 1 186 ? 10.584  -30.984 45.697  1.00 45.60  ? 187 VAL A CG1 1 
ATOM   1463 C CG2 . VAL A 1 186 ? 8.801   -32.605 46.385  1.00 41.78  ? 187 VAL A CG2 1 
ATOM   1464 N N   . ALA A 1 187 ? 11.201  -29.733 48.604  1.00 50.63  ? 188 ALA A N   1 
ATOM   1465 C CA  . ALA A 1 187 ? 12.359  -29.886 49.510  1.00 51.53  ? 188 ALA A CA  1 
ATOM   1466 C C   . ALA A 1 187 ? 11.950  -29.990 50.979  1.00 46.72  ? 188 ALA A C   1 
ATOM   1467 O O   . ALA A 1 187 ? 12.580  -30.703 51.745  1.00 54.13  ? 188 ALA A O   1 
ATOM   1468 C CB  . ALA A 1 187 ? 13.400  -28.764 49.308  1.00 42.36  ? 188 ALA A CB  1 
ATOM   1469 N N   . ALA A 1 188 ? 10.870  -29.314 51.357  1.00 49.12  ? 189 ALA A N   1 
ATOM   1470 C CA  . ALA A 1 188 ? 10.343  -29.394 52.723  1.00 46.32  ? 189 ALA A CA  1 
ATOM   1471 C C   . ALA A 1 188 ? 9.902   -30.815 53.106  1.00 59.04  ? 189 ALA A C   1 
ATOM   1472 O O   . ALA A 1 188 ? 9.655   -31.097 54.282  1.00 56.51  ? 189 ALA A O   1 
ATOM   1473 C CB  . ALA A 1 188 ? 9.160   -28.415 52.901  1.00 43.56  ? 189 ALA A CB  1 
ATOM   1474 N N   . PHE A 1 189 ? 9.782   -31.694 52.112  1.00 49.92  ? 190 PHE A N   1 
ATOM   1475 C CA  . PHE A 1 189 ? 9.373   -33.078 52.337  1.00 50.73  ? 190 PHE A CA  1 
ATOM   1476 C C   . PHE A 1 189 ? 10.570  -34.018 52.169  1.00 51.51  ? 190 PHE A C   1 
ATOM   1477 O O   . PHE A 1 189 ? 10.455  -35.221 52.374  1.00 58.14  ? 190 PHE A O   1 
ATOM   1478 C CB  . PHE A 1 189 ? 8.256   -33.467 51.344  1.00 53.29  ? 190 PHE A CB  1 
ATOM   1479 C CG  . PHE A 1 189 ? 6.989   -32.654 51.503  1.00 48.28  ? 190 PHE A CG  1 
ATOM   1480 C CD1 . PHE A 1 189 ? 6.856   -31.417 50.883  1.00 42.42  ? 190 PHE A CD1 1 
ATOM   1481 C CD2 . PHE A 1 189 ? 5.943   -33.123 52.278  1.00 43.50  ? 190 PHE A CD2 1 
ATOM   1482 C CE1 . PHE A 1 189 ? 5.710   -30.666 51.034  1.00 40.26  ? 190 PHE A CE1 1 
ATOM   1483 C CE2 . PHE A 1 189 ? 4.776   -32.378 52.429  1.00 46.77  ? 190 PHE A CE2 1 
ATOM   1484 C CZ  . PHE A 1 189 ? 4.666   -31.144 51.799  1.00 42.44  ? 190 PHE A CZ  1 
ATOM   1485 N N   . GLY A 1 190 ? 11.720  -33.468 51.794  1.00 50.21  ? 191 GLY A N   1 
ATOM   1486 C CA  . GLY A 1 190 ? 12.900  -34.283 51.524  1.00 51.90  ? 191 GLY A CA  1 
ATOM   1487 C C   . GLY A 1 190 ? 13.096  -34.592 50.045  1.00 58.45  ? 191 GLY A C   1 
ATOM   1488 O O   . GLY A 1 190 ? 13.967  -35.380 49.663  1.00 57.34  ? 191 GLY A O   1 
ATOM   1489 N N   . GLY A 1 191 ? 12.290  -33.966 49.196  1.00 47.86  ? 192 GLY A N   1 
ATOM   1490 C CA  . GLY A 1 191 ? 12.393  -34.220 47.776  1.00 48.24  ? 192 GLY A CA  1 
ATOM   1491 C C   . GLY A 1 191 ? 13.428  -33.322 47.150  1.00 51.75  ? 192 GLY A C   1 
ATOM   1492 O O   . GLY A 1 191 ? 13.651  -32.233 47.645  1.00 58.70  ? 192 GLY A O   1 
ATOM   1493 N N   . ASP A 1 192 ? 14.043  -33.777 46.059  1.00 48.43  ? 193 ASP A N   1 
ATOM   1494 C CA  . ASP A 1 192 ? 15.029  -32.998 45.310  1.00 53.90  ? 193 ASP A CA  1 
ATOM   1495 C C   . ASP A 1 192 ? 14.378  -32.344 44.087  1.00 58.14  ? 193 ASP A C   1 
ATOM   1496 O O   . ASP A 1 192 ? 14.071  -33.024 43.103  1.00 55.39  ? 193 ASP A O   1 
ATOM   1497 C CB  . ASP A 1 192 ? 16.193  -33.921 44.883  1.00 42.08  ? 193 ASP A CB  1 
ATOM   1498 C CG  . ASP A 1 192 ? 17.232  -33.225 44.038  1.00 53.68  ? 193 ASP A CG  1 
ATOM   1499 O OD1 . ASP A 1 192 ? 17.144  -32.000 43.804  1.00 57.15  ? 193 ASP A OD1 1 
ATOM   1500 O OD2 . ASP A 1 192 ? 18.159  -33.924 43.584  1.00 63.72  ? 193 ASP A OD2 1 
ATOM   1501 N N   . PRO A 1 193 ? 14.194  -31.015 44.133  1.00 58.34  ? 194 PRO A N   1 
ATOM   1502 C CA  . PRO A 1 193 ? 13.625  -30.254 43.004  1.00 46.53  ? 194 PRO A CA  1 
ATOM   1503 C C   . PRO A 1 193 ? 14.456  -30.295 41.723  1.00 61.79  ? 194 PRO A C   1 
ATOM   1504 O O   . PRO A 1 193 ? 13.943  -29.925 40.667  1.00 59.17  ? 194 PRO A O   1 
ATOM   1505 C CB  . PRO A 1 193 ? 13.537  -28.816 43.542  1.00 57.72  ? 194 PRO A CB  1 
ATOM   1506 C CG  . PRO A 1 193 ? 14.462  -28.785 44.757  1.00 50.45  ? 194 PRO A CG  1 
ATOM   1507 C CD  . PRO A 1 193 ? 14.428  -30.175 45.326  1.00 49.89  ? 194 PRO A CD  1 
ATOM   1508 N N   . THR A 1 194 ? 15.707  -30.745 41.804  1.00 64.68  ? 195 THR A N   1 
ATOM   1509 C CA  . THR A 1 194 ? 16.548  -30.881 40.607  1.00 59.82  ? 195 THR A CA  1 
ATOM   1510 C C   . THR A 1 194 ? 16.423  -32.260 39.925  1.00 56.57  ? 195 THR A C   1 
ATOM   1511 O O   . THR A 1 194 ? 17.031  -32.511 38.885  1.00 61.77  ? 195 THR A O   1 
ATOM   1512 C CB  . THR A 1 194 ? 18.046  -30.593 40.927  1.00 65.99  ? 195 THR A CB  1 
ATOM   1513 O OG1 . THR A 1 194 ? 18.548  -31.571 41.854  1.00 61.68  ? 195 THR A OG1 1 
ATOM   1514 C CG2 . THR A 1 194 ? 18.200  -29.200 41.530  1.00 61.99  ? 195 THR A CG2 1 
ATOM   1515 N N   . SER A 1 195 ? 15.629  -33.146 40.511  1.00 54.07  ? 196 SER A N   1 
ATOM   1516 C CA  . SER A 1 195 ? 15.419  -34.478 39.949  1.00 60.60  ? 196 SER A CA  1 
ATOM   1517 C C   . SER A 1 195 ? 13.930  -34.846 40.011  1.00 52.81  ? 196 SER A C   1 
ATOM   1518 O O   . SER A 1 195 ? 13.474  -35.554 40.929  1.00 49.23  ? 196 SER A O   1 
ATOM   1519 C CB  . SER A 1 195 ? 16.264  -35.511 40.700  1.00 62.05  ? 196 SER A CB  1 
ATOM   1520 O OG  . SER A 1 195 ? 16.054  -36.812 40.180  1.00 61.58  ? 196 SER A OG  1 
ATOM   1521 N N   . VAL A 1 196 ? 13.174  -34.322 39.054  1.00 47.17  ? 197 VAL A N   1 
ATOM   1522 C CA  . VAL A 1 196 ? 11.732  -34.534 38.990  1.00 48.30  ? 197 VAL A CA  1 
ATOM   1523 C C   . VAL A 1 196 ? 11.362  -35.287 37.717  1.00 51.13  ? 197 VAL A C   1 
ATOM   1524 O O   . VAL A 1 196 ? 11.595  -34.803 36.621  1.00 44.11  ? 197 VAL A O   1 
ATOM   1525 C CB  . VAL A 1 196 ? 10.963  -33.205 39.019  1.00 50.74  ? 197 VAL A CB  1 
ATOM   1526 C CG1 . VAL A 1 196 ? 9.463   -33.447 38.818  1.00 48.60  ? 197 VAL A CG1 1 
ATOM   1527 C CG2 . VAL A 1 196 ? 11.208  -32.476 40.325  1.00 43.68  ? 197 VAL A CG2 1 
ATOM   1528 N N   . THR A 1 197 ? 10.799  -36.481 37.869  1.00 53.78  ? 198 THR A N   1 
ATOM   1529 C CA  . THR A 1 197 ? 10.409  -37.290 36.726  1.00 44.10  ? 198 THR A CA  1 
ATOM   1530 C C   . THR A 1 197 ? 8.887   -37.277 36.583  1.00 46.79  ? 198 THR A C   1 
ATOM   1531 O O   . THR A 1 197 ? 8.172   -37.602 37.529  1.00 42.19  ? 198 THR A O   1 
ATOM   1532 C CB  . THR A 1 197 ? 10.921  -38.744 36.874  1.00 51.00  ? 198 THR A CB  1 
ATOM   1533 O OG1 . THR A 1 197 ? 12.353  -38.738 36.945  1.00 47.55  ? 198 THR A OG1 1 
ATOM   1534 C CG2 . THR A 1 197 ? 10.458  -39.642 35.692  1.00 41.00  ? 198 THR A CG2 1 
ATOM   1535 N N   . LEU A 1 198 ? 8.398   -36.876 35.408  1.00 44.24  ? 199 LEU A N   1 
ATOM   1536 C CA  . LEU A 1 198 ? 6.962   -36.899 35.124  1.00 44.06  ? 199 LEU A CA  1 
ATOM   1537 C C   . LEU A 1 198 ? 6.578   -38.258 34.544  1.00 42.45  ? 199 LEU A C   1 
ATOM   1538 O O   . LEU A 1 198 ? 7.261   -38.766 33.653  1.00 46.27  ? 199 LEU A O   1 
ATOM   1539 C CB  . LEU A 1 198 ? 6.593   -35.840 34.079  1.00 46.93  ? 199 LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 198 ? 6.809   -34.364 34.341  1.00 43.76  ? 199 LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 198 ? 6.053   -33.544 33.292  1.00 42.53  ? 199 LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 198 ? 6.327   -34.006 35.725  1.00 40.79  ? 199 LEU A CD2 1 
ATOM   1543 N N   . PHE A 1 199 ? 5.485   -38.830 35.034  1.00 39.01  ? 200 PHE A N   1 
ATOM   1544 C CA  . PHE A 1 199 ? 4.901   -40.024 34.424  1.00 41.15  ? 200 PHE A CA  1 
ATOM   1545 C C   . PHE A 1 199 ? 3.382   -39.941 34.410  1.00 37.12  ? 200 PHE A C   1 
ATOM   1546 O O   . PHE A 1 199 ? 2.773   -39.414 35.347  1.00 40.69  ? 200 PHE A O   1 
ATOM   1547 C CB  . PHE A 1 199 ? 5.436   -41.364 35.014  1.00 36.01  ? 200 PHE A CB  1 
ATOM   1548 C CG  . PHE A 1 199 ? 5.002   -41.693 36.447  1.00 43.05  ? 200 PHE A CG  1 
ATOM   1549 C CD1 . PHE A 1 199 ? 5.076   -40.762 37.470  1.00 42.53  ? 200 PHE A CD1 1 
ATOM   1550 C CD2 . PHE A 1 199 ? 4.599   -42.997 36.766  1.00 38.04  ? 200 PHE A CD2 1 
ATOM   1551 C CE1 . PHE A 1 199 ? 4.710   -41.106 38.782  1.00 40.62  ? 200 PHE A CE1 1 
ATOM   1552 C CE2 . PHE A 1 199 ? 4.231   -43.350 38.049  1.00 47.27  ? 200 PHE A CE2 1 
ATOM   1553 C CZ  . PHE A 1 199 ? 4.289   -42.407 39.072  1.00 44.66  ? 200 PHE A CZ  1 
ATOM   1554 N N   . GLY A 1 200 ? 2.784   -40.443 33.336  1.00 40.26  ? 201 GLY A N   1 
ATOM   1555 C CA  . GLY A 1 200 ? 1.343   -40.406 33.173  1.00 38.73  ? 201 GLY A CA  1 
ATOM   1556 C C   . GLY A 1 200 ? 0.867   -41.481 32.204  1.00 41.73  ? 201 GLY A C   1 
ATOM   1557 O O   . GLY A 1 200 ? 1.651   -42.059 31.455  1.00 40.39  ? 201 GLY A O   1 
ATOM   1558 N N   . GLU A 1 201 ? -0.427  -41.767 32.222  1.00 45.14  ? 202 GLU A N   1 
ATOM   1559 C CA  . GLU A 1 201 ? -0.960  -42.804 31.354  1.00 39.13  ? 202 GLU A CA  1 
ATOM   1560 C C   . GLU A 1 201 ? -2.103  -42.222 30.542  1.00 40.20  ? 202 GLU A C   1 
ATOM   1561 O O   . GLU A 1 201 ? -2.850  -41.379 31.034  1.00 39.76  ? 202 GLU A O   1 
ATOM   1562 C CB  . GLU A 1 201 ? -1.370  -44.040 32.167  1.00 38.97  ? 202 GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 201 ? -1.839  -45.257 31.327  1.00 39.34  ? 202 GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 201 ? -3.349  -45.235 31.040  1.00 42.80  ? 202 GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 201 ? -4.035  -44.399 31.651  1.00 41.30  ? 202 GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 201 ? -3.837  -46.025 30.185  1.00 44.71  ? 202 GLU A OE2 1 
ATOM   1567 N N   . SER A 1 202 ? -2.188  -42.617 29.267  1.00 41.68  ? 203 SER A N   1 
ATOM   1568 C CA  . SER A 1 202 ? -3.266  -42.161 28.395  1.00 35.90  ? 203 SER A CA  1 
ATOM   1569 C C   . SER A 1 202 ? -3.276  -40.632 28.242  1.00 34.88  ? 203 SER A C   1 
ATOM   1570 O O   . SER A 1 202 ? -2.278  -40.060 27.818  1.00 39.67  ? 203 SER A O   1 
ATOM   1571 C CB  . SER A 1 202 ? -4.626  -42.698 28.871  1.00 42.70  ? 203 SER A CB  1 
ATOM   1572 O OG  . SER A 1 202 ? -5.499  -42.863 27.763  1.00 50.36  ? 203 SER A OG  1 
ATOM   1573 N N   . ALA A 1 203 ? -4.384  -39.968 28.569  1.00 33.99  ? 204 ALA A N   1 
ATOM   1574 C CA  . ALA A 1 203 ? -4.398  -38.493 28.564  1.00 38.34  ? 204 ALA A CA  1 
ATOM   1575 C C   . ALA A 1 203 ? -3.311  -37.884 29.481  1.00 39.77  ? 204 ALA A C   1 
ATOM   1576 O O   . ALA A 1 203 ? -2.828  -36.774 29.231  1.00 39.48  ? 204 ALA A O   1 
ATOM   1577 C CB  . ALA A 1 203 ? -5.789  -37.953 28.962  1.00 33.46  ? 204 ALA A CB  1 
ATOM   1578 N N   . GLY A 1 204 ? -2.953  -38.615 30.543  1.00 38.62  ? 205 GLY A N   1 
ATOM   1579 C CA  . GLY A 1 204 ? -1.847  -38.246 31.418  1.00 40.03  ? 205 GLY A CA  1 
ATOM   1580 C C   . GLY A 1 204 ? -0.514  -38.272 30.673  1.00 41.65  ? 205 GLY A C   1 
ATOM   1581 O O   . GLY A 1 204 ? 0.320   -37.394 30.847  1.00 40.41  ? 205 GLY A O   1 
ATOM   1582 N N   . ALA A 1 205 ? -0.327  -39.281 29.829  1.00 36.70  ? 206 ALA A N   1 
ATOM   1583 C CA  . ALA A 1 205 ? 0.856   -39.377 28.982  1.00 43.23  ? 206 ALA A CA  1 
ATOM   1584 C C   . ALA A 1 205 ? 0.850   -38.264 27.910  1.00 44.43  ? 206 ALA A C   1 
ATOM   1585 O O   . ALA A 1 205 ? 1.883   -37.650 27.629  1.00 41.00  ? 206 ALA A O   1 
ATOM   1586 C CB  . ALA A 1 205 ? 0.943   -40.787 28.321  1.00 33.55  ? 206 ALA A CB  1 
ATOM   1587 N N   . ALA A 1 206 ? -0.311  -38.005 27.314  1.00 38.35  ? 207 ALA A N   1 
ATOM   1588 C CA  . ALA A 1 206 ? -0.407  -36.933 26.323  1.00 43.52  ? 207 ALA A CA  1 
ATOM   1589 C C   . ALA A 1 206 ? -0.078  -35.620 27.011  1.00 42.61  ? 207 ALA A C   1 
ATOM   1590 O O   . ALA A 1 206 ? 0.595   -34.771 26.434  1.00 42.87  ? 207 ALA A O   1 
ATOM   1591 C CB  . ALA A 1 206 ? -1.791  -36.879 25.677  1.00 39.61  ? 207 ALA A CB  1 
ATOM   1592 N N   . SER A 1 207 ? -0.537  -35.480 28.258  1.00 42.20  ? 208 SER A N   1 
ATOM   1593 C CA  . SER A 1 207 ? -0.237  -34.311 29.066  1.00 40.46  ? 208 SER A CA  1 
ATOM   1594 C C   . SER A 1 207 ? 1.273   -34.160 29.276  1.00 44.76  ? 208 SER A C   1 
ATOM   1595 O O   . SER A 1 207 ? 1.819   -33.073 29.093  1.00 43.48  ? 208 SER A O   1 
ATOM   1596 C CB  . SER A 1 207 ? -0.945  -34.396 30.433  1.00 37.26  ? 208 SER A CB  1 
ATOM   1597 O OG  . SER A 1 207 ? -2.299  -34.012 30.332  1.00 40.52  ? 208 SER A OG  1 
ATOM   1598 N N   . VAL A 1 208 ? 1.938   -35.245 29.672  1.00 39.06  ? 209 VAL A N   1 
ATOM   1599 C CA  . VAL A 1 208 ? 3.389   -35.217 29.863  1.00 35.02  ? 209 VAL A CA  1 
ATOM   1600 C C   . VAL A 1 208 ? 4.088   -34.731 28.584  1.00 44.83  ? 209 VAL A C   1 
ATOM   1601 O O   . VAL A 1 208 ? 4.959   -33.864 28.622  1.00 41.18  ? 209 VAL A O   1 
ATOM   1602 C CB  . VAL A 1 208 ? 3.947   -36.607 30.288  1.00 37.44  ? 209 VAL A CB  1 
ATOM   1603 C CG1 . VAL A 1 208 ? 5.466   -36.638 30.140  1.00 41.84  ? 209 VAL A CG1 1 
ATOM   1604 C CG2 . VAL A 1 208 ? 3.541   -36.956 31.740  1.00 37.33  ? 209 VAL A CG2 1 
ATOM   1605 N N   . GLY A 1 209 ? 3.667   -35.268 27.449  1.00 38.33  ? 210 GLY A N   1 
ATOM   1606 C CA  . GLY A 1 209 ? 4.246   -34.884 26.177  1.00 45.39  ? 210 GLY A CA  1 
ATOM   1607 C C   . GLY A 1 209 ? 4.035   -33.417 25.867  1.00 43.63  ? 210 GLY A C   1 
ATOM   1608 O O   . GLY A 1 209 ? 4.908   -32.755 25.323  1.00 45.21  ? 210 GLY A O   1 
ATOM   1609 N N   . MET A 1 210 ? 2.873   -32.892 26.217  1.00 42.16  ? 211 MET A N   1 
ATOM   1610 C CA  . MET A 1 210 ? 2.628   -31.468 26.017  1.00 40.57  ? 211 MET A CA  1 
ATOM   1611 C C   . MET A 1 210 ? 3.518   -30.561 26.863  1.00 43.62  ? 211 MET A C   1 
ATOM   1612 O O   . MET A 1 210 ? 3.985   -29.527 26.370  1.00 43.95  ? 211 MET A O   1 
ATOM   1613 C CB  . MET A 1 210 ? 1.144   -31.153 26.194  1.00 40.41  ? 211 MET A CB  1 
ATOM   1614 C CG  . MET A 1 210 ? 0.320   -31.726 25.019  1.00 44.78  ? 211 MET A CG  1 
ATOM   1615 S SD  . MET A 1 210 ? -1.442  -31.552 25.272  1.00 56.35  ? 211 MET A SD  1 
ATOM   1616 C CE  . MET A 1 210 ? -2.084  -32.953 24.303  1.00 38.13  ? 211 MET A CE  1 
ATOM   1617 N N   . HIS A 1 211 ? 3.775   -30.942 28.115  1.00 38.37  ? 212 HIS A N   1 
ATOM   1618 C CA  . HIS A 1 211 ? 4.753   -30.203 28.926  1.00 42.08  ? 212 HIS A CA  1 
ATOM   1619 C C   . HIS A 1 211 ? 6.169   -30.259 28.319  1.00 43.77  ? 212 HIS A C   1 
ATOM   1620 O O   . HIS A 1 211 ? 6.939   -29.310 28.454  1.00 42.88  ? 212 HIS A O   1 
ATOM   1621 C CB  . HIS A 1 211 ? 4.773   -30.680 30.388  1.00 41.97  ? 212 HIS A CB  1 
ATOM   1622 C CG  . HIS A 1 211 ? 3.496   -30.416 31.121  1.00 40.28  ? 212 HIS A CG  1 
ATOM   1623 N ND1 . HIS A 1 211 ? 3.076   -29.143 31.448  1.00 41.69  ? 212 HIS A ND1 1 
ATOM   1624 C CD2 . HIS A 1 211 ? 2.543   -31.260 31.585  1.00 37.64  ? 212 HIS A CD2 1 
ATOM   1625 C CE1 . HIS A 1 211 ? 1.918   -29.215 32.083  1.00 40.20  ? 212 HIS A CE1 1 
ATOM   1626 N NE2 . HIS A 1 211 ? 1.577   -30.489 32.187  1.00 39.14  ? 212 HIS A NE2 1 
ATOM   1627 N N   . LEU A 1 212 ? 6.493   -31.360 27.646  1.00 38.77  ? 213 LEU A N   1 
ATOM   1628 C CA  . LEU A 1 212 ? 7.763   -31.494 26.939  1.00 46.78  ? 213 LEU A CA  1 
ATOM   1629 C C   . LEU A 1 212 ? 7.902   -30.441 25.851  1.00 53.86  ? 213 LEU A C   1 
ATOM   1630 O O   . LEU A 1 212 ? 8.995   -29.927 25.617  1.00 54.15  ? 213 LEU A O   1 
ATOM   1631 C CB  . LEU A 1 212 ? 7.889   -32.880 26.284  1.00 45.03  ? 213 LEU A CB  1 
ATOM   1632 C CG  . LEU A 1 212 ? 8.443   -33.990 27.176  1.00 56.17  ? 213 LEU A CG  1 
ATOM   1633 C CD1 . LEU A 1 212 ? 8.508   -35.305 26.414  1.00 56.38  ? 213 LEU A CD1 1 
ATOM   1634 C CD2 . LEU A 1 212 ? 9.814   -33.607 27.713  1.00 51.91  ? 213 LEU A CD2 1 
ATOM   1635 N N   . LEU A 1 213 ? 6.790   -30.139 25.181  1.00 47.88  ? 214 LEU A N   1 
ATOM   1636 C CA  . LEU A 1 213 ? 6.810   -29.309 23.976  1.00 42.99  ? 214 LEU A CA  1 
ATOM   1637 C C   . LEU A 1 213 ? 6.428   -27.871 24.278  1.00 48.78  ? 214 LEU A C   1 
ATOM   1638 O O   . LEU A 1 213 ? 6.260   -27.068 23.365  1.00 50.56  ? 214 LEU A O   1 
ATOM   1639 C CB  . LEU A 1 213 ? 5.868   -29.885 22.914  1.00 36.86  ? 214 LEU A CB  1 
ATOM   1640 C CG  . LEU A 1 213 ? 6.068   -31.369 22.573  1.00 44.00  ? 214 LEU A CG  1 
ATOM   1641 C CD1 . LEU A 1 213 ? 5.022   -31.853 21.601  1.00 46.35  ? 214 LEU A CD1 1 
ATOM   1642 C CD2 . LEU A 1 213 ? 7.452   -31.640 22.010  1.00 49.68  ? 214 LEU A CD2 1 
ATOM   1643 N N   . SER A 1 214 ? 6.264   -27.546 25.560  1.00 45.75  ? 215 SER A N   1 
ATOM   1644 C CA  . SER A 1 214 ? 5.889   -26.189 25.940  1.00 48.62  ? 215 SER A CA  1 
ATOM   1645 C C   . SER A 1 214 ? 6.947   -25.576 26.861  1.00 45.19  ? 215 SER A C   1 
ATOM   1646 O O   . SER A 1 214 ? 7.064   -25.983 28.009  1.00 54.16  ? 215 SER A O   1 
ATOM   1647 C CB  . SER A 1 214 ? 4.513   -26.190 26.605  1.00 49.29  ? 215 SER A CB  1 
ATOM   1648 O OG  . SER A 1 214 ? 4.143   -24.885 27.002  1.00 50.62  ? 215 SER A OG  1 
ATOM   1649 N N   . PRO A 1 215 ? 7.735   -24.607 26.349  1.00 53.31  ? 216 PRO A N   1 
ATOM   1650 C CA  . PRO A 1 215 ? 8.907   -24.079 27.074  1.00 47.99  ? 216 PRO A CA  1 
ATOM   1651 C C   . PRO A 1 215 ? 8.694   -23.613 28.521  1.00 45.19  ? 216 PRO A C   1 
ATOM   1652 O O   . PRO A 1 215 ? 9.564   -23.899 29.333  1.00 51.24  ? 216 PRO A O   1 
ATOM   1653 C CB  . PRO A 1 215 ? 9.405   -22.938 26.168  1.00 52.15  ? 216 PRO A CB  1 
ATOM   1654 C CG  . PRO A 1 215 ? 9.022   -23.394 24.787  1.00 55.85  ? 216 PRO A CG  1 
ATOM   1655 C CD  . PRO A 1 215 ? 7.682   -24.099 24.963  1.00 58.12  ? 216 PRO A CD  1 
ATOM   1656 N N   . PRO A 1 216 ? 7.582   -22.917 28.846  1.00 46.86  ? 217 PRO A N   1 
ATOM   1657 C CA  . PRO A 1 216 ? 7.418   -22.597 30.277  1.00 40.60  ? 217 PRO A CA  1 
ATOM   1658 C C   . PRO A 1 216 ? 7.316   -23.845 31.183  1.00 49.23  ? 217 PRO A C   1 
ATOM   1659 O O   . PRO A 1 216 ? 7.626   -23.743 32.361  1.00 51.96  ? 217 PRO A O   1 
ATOM   1660 C CB  . PRO A 1 216 ? 6.113   -21.789 30.324  1.00 46.87  ? 217 PRO A CB  1 
ATOM   1661 C CG  . PRO A 1 216 ? 5.924   -21.250 28.877  1.00 38.39  ? 217 PRO A CG  1 
ATOM   1662 C CD  . PRO A 1 216 ? 6.535   -22.306 27.997  1.00 42.95  ? 217 PRO A CD  1 
ATOM   1663 N N   . SER A 1 217 ? 6.905   -24.997 30.654  1.00 42.82  ? 218 SER A N   1 
ATOM   1664 C CA  . SER A 1 217 ? 6.829   -26.219 31.472  1.00 54.25  ? 218 SER A CA  1 
ATOM   1665 C C   . SER A 1 217 ? 8.156   -26.964 31.555  1.00 50.73  ? 218 SER A C   1 
ATOM   1666 O O   . SER A 1 217 ? 8.417   -27.666 32.519  1.00 48.86  ? 218 SER A O   1 
ATOM   1667 C CB  . SER A 1 217 ? 5.758   -27.189 30.948  1.00 42.78  ? 218 SER A CB  1 
ATOM   1668 O OG  . SER A 1 217 ? 4.444   -26.746 31.241  1.00 45.94  ? 218 SER A OG  1 
ATOM   1669 N N   . ARG A 1 218 ? 8.987   -26.793 30.536  1.00 51.42  ? 219 ARG A N   1 
ATOM   1670 C CA  . ARG A 1 218 ? 10.174  -27.608 30.347  1.00 56.57  ? 219 ARG A CA  1 
ATOM   1671 C C   . ARG A 1 218 ? 11.243  -27.364 31.425  1.00 54.66  ? 219 ARG A C   1 
ATOM   1672 O O   . ARG A 1 218 ? 12.050  -28.243 31.734  1.00 58.80  ? 219 ARG A O   1 
ATOM   1673 C CB  . ARG A 1 218 ? 10.709  -27.408 28.914  1.00 58.56  ? 219 ARG A CB  1 
ATOM   1674 C CG  . ARG A 1 218 ? 11.848  -28.321 28.512  1.00 63.65  ? 219 ARG A CG  1 
ATOM   1675 C CD  . ARG A 1 218 ? 11.394  -29.742 28.239  1.00 59.99  ? 219 ARG A CD  1 
ATOM   1676 N NE  . ARG A 1 218 ? 12.542  -30.641 28.096  1.00 66.89  ? 219 ARG A NE  1 
ATOM   1677 C CZ  . ARG A 1 218 ? 13.201  -31.207 29.113  1.00 78.00  ? 219 ARG A CZ  1 
ATOM   1678 N NH1 . ARG A 1 218 ? 12.839  -30.978 30.384  1.00 51.19  ? 219 ARG A NH1 1 
ATOM   1679 N NH2 . ARG A 1 218 ? 14.234  -32.006 28.853  1.00 64.34  ? 219 ARG A NH2 1 
ATOM   1680 N N   . GLY A 1 219 ? 11.224  -26.193 32.039  1.00 59.75  ? 220 GLY A N   1 
ATOM   1681 C CA  . GLY A 1 219 ? 12.127  -25.943 33.150  1.00 53.83  ? 220 GLY A CA  1 
ATOM   1682 C C   . GLY A 1 219 ? 11.707  -26.579 34.464  1.00 58.11  ? 220 GLY A C   1 
ATOM   1683 O O   . GLY A 1 219 ? 12.437  -26.505 35.442  1.00 60.09  ? 220 GLY A O   1 
ATOM   1684 N N   . LEU A 1 220 ? 10.538  -27.216 34.492  1.00 56.13  ? 221 LEU A N   1 
ATOM   1685 C CA  . LEU A 1 220 ? 9.966   -27.689 35.750  1.00 49.62  ? 221 LEU A CA  1 
ATOM   1686 C C   . LEU A 1 220 ? 10.170  -29.187 36.024  1.00 48.68  ? 221 LEU A C   1 
ATOM   1687 O O   . LEU A 1 220 ? 9.692   -29.702 37.032  1.00 49.76  ? 221 LEU A O   1 
ATOM   1688 C CB  . LEU A 1 220 ? 8.475   -27.344 35.799  1.00 48.07  ? 221 LEU A CB  1 
ATOM   1689 C CG  . LEU A 1 220 ? 8.113   -25.874 35.551  1.00 52.62  ? 221 LEU A CG  1 
ATOM   1690 C CD1 . LEU A 1 220 ? 6.604   -25.699 35.353  1.00 48.16  ? 221 LEU A CD1 1 
ATOM   1691 C CD2 . LEU A 1 220 ? 8.589   -24.988 36.691  1.00 44.64  ? 221 LEU A CD2 1 
ATOM   1692 N N   . PHE A 1 221 ? 10.858  -29.884 35.123  1.00 46.77  ? 222 PHE A N   1 
ATOM   1693 C CA  . PHE A 1 221 ? 11.092  -31.321 35.278  1.00 50.43  ? 222 PHE A CA  1 
ATOM   1694 C C   . PHE A 1 221 ? 12.286  -31.762 34.445  1.00 46.98  ? 222 PHE A C   1 
ATOM   1695 O O   . PHE A 1 221 ? 12.775  -31.015 33.616  1.00 50.41  ? 222 PHE A O   1 
ATOM   1696 C CB  . PHE A 1 221 ? 9.843   -32.144 34.911  1.00 45.90  ? 222 PHE A CB  1 
ATOM   1697 C CG  . PHE A 1 221 ? 9.463   -32.090 33.436  1.00 41.69  ? 222 PHE A CG  1 
ATOM   1698 C CD1 . PHE A 1 221 ? 8.774   -31.003 32.916  1.00 47.35  ? 222 PHE A CD1 1 
ATOM   1699 C CD2 . PHE A 1 221 ? 9.761   -33.155 32.590  1.00 43.40  ? 222 PHE A CD2 1 
ATOM   1700 C CE1 . PHE A 1 221 ? 8.390   -30.971 31.559  1.00 46.69  ? 222 PHE A CE1 1 
ATOM   1701 C CE2 . PHE A 1 221 ? 9.399   -33.135 31.233  1.00 47.36  ? 222 PHE A CE2 1 
ATOM   1702 C CZ  . PHE A 1 221 ? 8.709   -32.042 30.716  1.00 47.37  ? 222 PHE A CZ  1 
ATOM   1703 N N   . HIS A 1 222 ? 12.721  -33.001 34.644  1.00 53.31  ? 223 HIS A N   1 
ATOM   1704 C CA  . HIS A 1 222 ? 13.982  -33.449 34.077  1.00 52.51  ? 223 HIS A CA  1 
ATOM   1705 C C   . HIS A 1 222 ? 13.880  -34.705 33.202  1.00 47.57  ? 223 HIS A C   1 
ATOM   1706 O O   . HIS A 1 222 ? 14.609  -34.837 32.237  1.00 52.91  ? 223 HIS A O   1 
ATOM   1707 C CB  . HIS A 1 222 ? 15.005  -33.595 35.216  1.00 52.70  ? 223 HIS A CB  1 
ATOM   1708 C CG  . HIS A 1 222 ? 14.999  -32.417 36.144  1.00 68.82  ? 223 HIS A CG  1 
ATOM   1709 N ND1 . HIS A 1 222 ? 14.141  -32.320 37.224  1.00 54.91  ? 223 HIS A ND1 1 
ATOM   1710 C CD2 . HIS A 1 222 ? 15.685  -31.247 36.102  1.00 59.31  ? 223 HIS A CD2 1 
ATOM   1711 C CE1 . HIS A 1 222 ? 14.321  -31.156 37.822  1.00 57.56  ? 223 HIS A CE1 1 
ATOM   1712 N NE2 . HIS A 1 222 ? 15.253  -30.487 37.162  1.00 65.35  ? 223 HIS A NE2 1 
ATOM   1713 N N   . ARG A 1 223 ? 12.982  -35.625 33.526  1.00 52.37  ? 224 ARG A N   1 
ATOM   1714 C CA  . ARG A 1 223 ? 12.791  -36.811 32.680  1.00 50.76  ? 224 ARG A CA  1 
ATOM   1715 C C   . ARG A 1 223 ? 11.297  -37.074 32.487  1.00 41.05  ? 224 ARG A C   1 
ATOM   1716 O O   . ARG A 1 223 ? 10.475  -36.481 33.177  1.00 47.30  ? 224 ARG A O   1 
ATOM   1717 C CB  . ARG A 1 223 ? 13.454  -38.037 33.305  1.00 48.54  ? 224 ARG A CB  1 
ATOM   1718 C CG  . ARG A 1 223 ? 14.938  -37.907 33.517  1.00 59.35  ? 224 ARG A CG  1 
ATOM   1719 C CD  . ARG A 1 223 ? 15.445  -39.017 34.424  1.00 62.62  ? 224 ARG A CD  1 
ATOM   1720 N NE  . ARG A 1 223 ? 16.839  -38.811 34.800  1.00 75.49  ? 224 ARG A NE  1 
ATOM   1721 C CZ  . ARG A 1 223 ? 17.246  -37.922 35.702  1.00 71.87  ? 224 ARG A CZ  1 
ATOM   1722 N NH1 . ARG A 1 223 ? 16.366  -37.146 36.326  1.00 72.77  ? 224 ARG A NH1 1 
ATOM   1723 N NH2 . ARG A 1 223 ? 18.541  -37.808 35.979  1.00 84.41  ? 224 ARG A NH2 1 
ATOM   1724 N N   . ALA A 1 224 ? 10.949  -37.967 31.566  1.00 47.08  ? 225 ALA A N   1 
ATOM   1725 C CA  . ALA A 1 224 ? 9.548   -38.156 31.199  1.00 46.20  ? 225 ALA A CA  1 
ATOM   1726 C C   . ALA A 1 224 ? 9.208   -39.625 30.950  1.00 47.60  ? 225 ALA A C   1 
ATOM   1727 O O   . ALA A 1 224 ? 10.018  -40.364 30.392  1.00 43.59  ? 225 ALA A O   1 
ATOM   1728 C CB  . ALA A 1 224 ? 9.210   -37.307 29.982  1.00 40.01  ? 225 ALA A CB  1 
ATOM   1729 N N   . VAL A 1 225 ? 8.024   -40.046 31.397  1.00 41.59  ? 226 VAL A N   1 
ATOM   1730 C CA  . VAL A 1 225 ? 7.516   -41.391 31.108  1.00 41.64  ? 226 VAL A CA  1 
ATOM   1731 C C   . VAL A 1 225 ? 6.127   -41.284 30.490  1.00 45.47  ? 226 VAL A C   1 
ATOM   1732 O O   . VAL A 1 225 ? 5.239   -40.693 31.096  1.00 41.81  ? 226 VAL A O   1 
ATOM   1733 C CB  . VAL A 1 225 ? 7.384   -42.274 32.374  1.00 42.10  ? 226 VAL A CB  1 
ATOM   1734 C CG1 . VAL A 1 225 ? 7.001   -43.701 31.982  1.00 39.81  ? 226 VAL A CG1 1 
ATOM   1735 C CG2 . VAL A 1 225 ? 8.667   -42.265 33.220  1.00 38.35  ? 226 VAL A CG2 1 
ATOM   1736 N N   . LEU A 1 226 ? 5.938   -41.852 29.296  1.00 40.60  ? 227 LEU A N   1 
ATOM   1737 C CA  . LEU A 1 226 ? 4.642   -41.784 28.618  1.00 42.32  ? 227 LEU A CA  1 
ATOM   1738 C C   . LEU A 1 226 ? 4.051   -43.177 28.422  1.00 44.45  ? 227 LEU A C   1 
ATOM   1739 O O   . LEU A 1 226 ? 4.491   -43.910 27.540  1.00 46.34  ? 227 LEU A O   1 
ATOM   1740 C CB  . LEU A 1 226 ? 4.768   -41.083 27.252  1.00 42.57  ? 227 LEU A CB  1 
ATOM   1741 C CG  . LEU A 1 226 ? 4.954   -39.564 27.264  1.00 42.26  ? 227 LEU A CG  1 
ATOM   1742 C CD1 . LEU A 1 226 ? 6.390   -39.210 27.603  1.00 37.33  ? 227 LEU A CD1 1 
ATOM   1743 C CD2 . LEU A 1 226 ? 4.562   -38.966 25.914  1.00 43.04  ? 227 LEU A CD2 1 
ATOM   1744 N N   . GLN A 1 227 ? 3.046   -43.528 29.225  1.00 44.96  ? 228 GLN A N   1 
ATOM   1745 C CA  . GLN A 1 227 ? 2.412   -44.851 29.162  1.00 39.86  ? 228 GLN A CA  1 
ATOM   1746 C C   . GLN A 1 227 ? 1.111   -44.799 28.330  1.00 40.73  ? 228 GLN A C   1 
ATOM   1747 O O   . GLN A 1 227 ? 0.168   -44.081 28.696  1.00 40.55  ? 228 GLN A O   1 
ATOM   1748 C CB  . GLN A 1 227 ? 2.108   -45.364 30.594  1.00 31.55  ? 228 GLN A CB  1 
ATOM   1749 C CG  . GLN A 1 227 ? 3.356   -45.395 31.528  1.00 39.42  ? 228 GLN A CG  1 
ATOM   1750 C CD  . GLN A 1 227 ? 3.024   -45.603 33.017  1.00 42.24  ? 228 GLN A CD  1 
ATOM   1751 O OE1 . GLN A 1 227 ? 3.805   -45.220 33.900  1.00 43.50  ? 228 GLN A OE1 1 
ATOM   1752 N NE2 . GLN A 1 227 ? 1.873   -46.208 33.298  1.00 40.75  ? 228 GLN A NE2 1 
ATOM   1753 N N   . SER A 1 228 ? 1.072   -45.535 27.213  1.00 44.75  ? 229 SER A N   1 
ATOM   1754 C CA  . SER A 1 228 ? -0.137  -45.651 26.377  1.00 36.88  ? 229 SER A CA  1 
ATOM   1755 C C   . SER A 1 228 ? -0.768  -44.321 25.972  1.00 38.84  ? 229 SER A C   1 
ATOM   1756 O O   . SER A 1 228 ? -1.988  -44.162 26.042  1.00 40.65  ? 229 SER A O   1 
ATOM   1757 C CB  . SER A 1 228 ? -1.209  -46.482 27.095  1.00 36.69  ? 229 SER A CB  1 
ATOM   1758 O OG  . SER A 1 228 ? -0.752  -47.790 27.375  1.00 41.49  ? 229 SER A OG  1 
ATOM   1759 N N   . GLY A 1 229 ? 0.044   -43.368 25.537  1.00 38.56  ? 230 GLY A N   1 
ATOM   1760 C CA  . GLY A 1 229 ? -0.498  -42.089 25.118  1.00 38.55  ? 230 GLY A CA  1 
ATOM   1761 C C   . GLY A 1 229 ? 0.591   -41.151 24.662  1.00 44.49  ? 230 GLY A C   1 
ATOM   1762 O O   . GLY A 1 229 ? 1.762   -41.339 25.020  1.00 42.28  ? 230 GLY A O   1 
ATOM   1763 N N   . ALA A 1 230 ? 0.204   -40.144 23.882  1.00 37.47  ? 231 ALA A N   1 
ATOM   1764 C CA  . ALA A 1 230 ? 1.149   -39.241 23.235  1.00 42.25  ? 231 ALA A CA  1 
ATOM   1765 C C   . ALA A 1 230 ? 0.454   -37.944 22.836  1.00 38.73  ? 231 ALA A C   1 
ATOM   1766 O O   . ALA A 1 230 ? -0.736  -37.940 22.553  1.00 44.21  ? 231 ALA A O   1 
ATOM   1767 C CB  . ALA A 1 230 ? 1.797   -39.915 22.009  1.00 46.32  ? 231 ALA A CB  1 
ATOM   1768 N N   . PRO A 1 231 ? 1.195   -36.828 22.834  1.00 41.30  ? 232 PRO A N   1 
ATOM   1769 C CA  . PRO A 1 231 ? 0.543   -35.539 22.569  1.00 39.05  ? 232 PRO A CA  1 
ATOM   1770 C C   . PRO A 1 231 ? 0.073   -35.420 21.114  1.00 43.39  ? 232 PRO A C   1 
ATOM   1771 O O   . PRO A 1 231 ? -0.830  -34.622 20.832  1.00 44.73  ? 232 PRO A O   1 
ATOM   1772 C CB  . PRO A 1 231 ? 1.637   -34.498 22.899  1.00 39.56  ? 232 PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 231 ? 2.936   -35.239 22.790  1.00 43.05  ? 232 PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 231 ? 2.643   -36.700 23.095  1.00 41.30  ? 232 PRO A CD  1 
ATOM   1775 N N   . ASN A 1 232 ? 0.668   -36.216 20.224  1.00 40.16  ? 233 ASN A N   1 
ATOM   1776 C CA  . ASN A 1 232 ? 0.327   -36.225 18.794  1.00 47.79  ? 233 ASN A CA  1 
ATOM   1777 C C   . ASN A 1 232 ? -0.781  -37.226 18.475  1.00 43.50  ? 233 ASN A C   1 
ATOM   1778 O O   . ASN A 1 232 ? -1.122  -37.434 17.313  1.00 43.02  ? 233 ASN A O   1 
ATOM   1779 C CB  . ASN A 1 232 ? 1.565   -36.557 17.950  1.00 41.61  ? 233 ASN A CB  1 
ATOM   1780 C CG  . ASN A 1 232 ? 2.364   -37.717 18.531  1.00 44.18  ? 233 ASN A CG  1 
ATOM   1781 O OD1 . ASN A 1 232 ? 2.623   -37.753 19.734  1.00 50.50  ? 233 ASN A OD1 1 
ATOM   1782 N ND2 . ASN A 1 232 ? 2.711   -38.684 17.703  1.00 36.49  ? 233 ASN A ND2 1 
ATOM   1783 N N   . GLY A 1 233 ? -1.341  -37.870 19.500  1.00 42.69  ? 234 GLY A N   1 
ATOM   1784 C CA  . GLY A 1 233 ? -2.506  -38.720 19.258  1.00 50.34  ? 234 GLY A CA  1 
ATOM   1785 C C   . GLY A 1 233 ? -3.663  -37.925 18.648  1.00 52.87  ? 234 GLY A C   1 
ATOM   1786 O O   . GLY A 1 233 ? -3.903  -36.788 19.061  1.00 57.25  ? 234 GLY A O   1 
ATOM   1787 N N   . PRO A 1 234 ? -4.395  -38.516 17.681  1.00 45.19  ? 235 PRO A N   1 
ATOM   1788 C CA  . PRO A 1 234 ? -5.463  -37.784 16.972  1.00 40.31  ? 235 PRO A CA  1 
ATOM   1789 C C   . PRO A 1 234 ? -6.635  -37.356 17.865  1.00 44.20  ? 235 PRO A C   1 
ATOM   1790 O O   . PRO A 1 234 ? -7.470  -36.576 17.419  1.00 43.94  ? 235 PRO A O   1 
ATOM   1791 C CB  . PRO A 1 234 ? -5.957  -38.798 15.931  1.00 36.79  ? 235 PRO A CB  1 
ATOM   1792 C CG  . PRO A 1 234 ? -5.699  -40.159 16.573  1.00 40.35  ? 235 PRO A CG  1 
ATOM   1793 C CD  . PRO A 1 234 ? -4.380  -39.954 17.336  1.00 42.45  ? 235 PRO A CD  1 
ATOM   1794 N N   . TRP A 1 235 ? -6.692  -37.846 19.103  1.00 38.29  ? 236 TRP A N   1 
ATOM   1795 C CA  . TRP A 1 235 ? -7.749  -37.459 20.048  1.00 42.08  ? 236 TRP A CA  1 
ATOM   1796 C C   . TRP A 1 235 ? -7.304  -36.402 21.051  1.00 47.34  ? 236 TRP A C   1 
ATOM   1797 O O   . TRP A 1 235 ? -8.128  -35.867 21.802  1.00 43.24  ? 236 TRP A O   1 
ATOM   1798 C CB  . TRP A 1 235 ? -8.151  -38.675 20.879  1.00 41.83  ? 236 TRP A CB  1 
ATOM   1799 C CG  . TRP A 1 235 ? -6.955  -39.417 21.410  1.00 42.46  ? 236 TRP A CG  1 
ATOM   1800 C CD1 . TRP A 1 235 ? -6.260  -40.414 20.759  1.00 43.52  ? 236 TRP A CD1 1 
ATOM   1801 C CD2 . TRP A 1 235 ? -6.301  -39.233 22.679  1.00 40.41  ? 236 TRP A CD2 1 
ATOM   1802 N NE1 . TRP A 1 235 ? -5.224  -40.853 21.540  1.00 41.09  ? 236 TRP A NE1 1 
ATOM   1803 C CE2 . TRP A 1 235 ? -5.225  -40.156 22.726  1.00 37.10  ? 236 TRP A CE2 1 
ATOM   1804 C CE3 . TRP A 1 235 ? -6.523  -38.387 23.783  1.00 41.34  ? 236 TRP A CE3 1 
ATOM   1805 C CZ2 . TRP A 1 235 ? -4.374  -40.267 23.834  1.00 40.13  ? 236 TRP A CZ2 1 
ATOM   1806 C CZ3 . TRP A 1 235 ? -5.667  -38.488 24.894  1.00 37.29  ? 236 TRP A CZ3 1 
ATOM   1807 C CH2 . TRP A 1 235 ? -4.605  -39.429 24.908  1.00 39.99  ? 236 TRP A CH2 1 
ATOM   1808 N N   . ALA A 1 236 ? -6.000  -36.134 21.085  1.00 41.07  ? 237 ALA A N   1 
ATOM   1809 C CA  . ALA A 1 236 ? -5.388  -35.416 22.200  1.00 45.27  ? 237 ALA A CA  1 
ATOM   1810 C C   . ALA A 1 236 ? -5.402  -33.898 22.036  1.00 42.77  ? 237 ALA A C   1 
ATOM   1811 O O   . ALA A 1 236 ? -5.221  -33.166 23.005  1.00 39.67  ? 237 ALA A O   1 
ATOM   1812 C CB  . ALA A 1 236 ? -3.959  -35.920 22.440  1.00 39.32  ? 237 ALA A CB  1 
ATOM   1813 N N   . THR A 1 237 ? -5.609  -33.424 20.812  1.00 40.73  ? 238 THR A N   1 
ATOM   1814 C CA  . THR A 1 237 ? -5.748  -31.993 20.581  1.00 43.22  ? 238 THR A CA  1 
ATOM   1815 C C   . THR A 1 237 ? -6.864  -31.682 19.611  1.00 47.39  ? 238 THR A C   1 
ATOM   1816 O O   . THR A 1 237 ? -7.367  -32.556 18.890  1.00 42.71  ? 238 THR A O   1 
ATOM   1817 C CB  . THR A 1 237 ? -4.464  -31.334 20.029  1.00 42.48  ? 238 THR A CB  1 
ATOM   1818 O OG1 . THR A 1 237 ? -4.122  -31.922 18.769  1.00 39.05  ? 238 THR A OG1 1 
ATOM   1819 C CG2 . THR A 1 237 ? -3.307  -31.485 21.003  1.00 42.85  ? 238 THR A CG2 1 
ATOM   1820 N N   . VAL A 1 238 ? -7.219  -30.408 19.567  1.00 41.89  ? 239 VAL A N   1 
ATOM   1821 C CA  . VAL A 1 238 ? -8.276  -29.956 18.685  1.00 42.78  ? 239 VAL A CA  1 
ATOM   1822 C C   . VAL A 1 238 ? -7.850  -28.604 18.110  1.00 51.68  ? 239 VAL A C   1 
ATOM   1823 O O   . VAL A 1 238 ? -7.108  -27.856 18.767  1.00 44.54  ? 239 VAL A O   1 
ATOM   1824 C CB  . VAL A 1 238 ? -9.634  -29.897 19.463  1.00 50.37  ? 239 VAL A CB  1 
ATOM   1825 C CG1 . VAL A 1 238 ? -9.749  -28.634 20.350  1.00 45.30  ? 239 VAL A CG1 1 
ATOM   1826 C CG2 . VAL A 1 238 ? -10.777 -30.013 18.529  1.00 48.19  ? 239 VAL A CG2 1 
ATOM   1827 N N   . GLY A 1 239 ? -8.253  -28.317 16.867  1.00 52.12  ? 240 GLY A N   1 
ATOM   1828 C CA  . GLY A 1 239 ? -7.959  -27.031 16.261  1.00 42.55  ? 240 GLY A CA  1 
ATOM   1829 C C   . GLY A 1 239 ? -8.865  -25.926 16.791  1.00 52.01  ? 240 GLY A C   1 
ATOM   1830 O O   . GLY A 1 239 ? -9.916  -26.204 17.393  1.00 50.46  ? 240 GLY A O   1 
ATOM   1831 N N   . MET A 1 240 ? -8.458  -24.674 16.574  1.00 54.08  ? 241 MET A N   1 
ATOM   1832 C CA  . MET A 1 240 ? -9.197  -23.509 17.068  1.00 52.88  ? 241 MET A CA  1 
ATOM   1833 C C   . MET A 1 240 ? -10.652 -23.456 16.584  1.00 60.53  ? 241 MET A C   1 
ATOM   1834 O O   . MET A 1 240 ? -11.572 -23.216 17.381  1.00 52.85  ? 241 MET A O   1 
ATOM   1835 C CB  . MET A 1 240 ? -8.476  -22.219 16.678  1.00 54.43  ? 241 MET A CB  1 
ATOM   1836 C CG  . MET A 1 240 ? -7.377  -21.837 17.637  1.00 57.82  ? 241 MET A CG  1 
ATOM   1837 S SD  . MET A 1 240 ? -6.353  -20.446 17.102  1.00 68.39  ? 241 MET A SD  1 
ATOM   1838 C CE  . MET A 1 240 ? -7.351  -18.998 17.422  1.00 72.13  ? 241 MET A CE  1 
ATOM   1839 N N   . GLY A 1 241 ? -10.848 -23.677 15.283  1.00 51.60  ? 242 GLY A N   1 
ATOM   1840 C CA  . GLY A 1 241 ? -12.176 -23.695 14.688  1.00 52.83  ? 242 GLY A CA  1 
ATOM   1841 C C   . GLY A 1 241 ? -13.123 -24.735 15.281  1.00 52.53  ? 242 GLY A C   1 
ATOM   1842 O O   . GLY A 1 241 ? -14.268 -24.428 15.611  1.00 47.78  ? 242 GLY A O   1 
ATOM   1843 N N   . GLU A 1 242 ? -12.660 -25.974 15.405  1.00 45.32  ? 243 GLU A N   1 
ATOM   1844 C CA  . GLU A 1 242 ? -13.490 -27.011 15.995  1.00 45.47  ? 243 GLU A CA  1 
ATOM   1845 C C   . GLU A 1 242 ? -13.717 -26.775 17.504  1.00 49.54  ? 243 GLU A C   1 
ATOM   1846 O O   . GLU A 1 242 ? -14.786 -27.101 18.024  1.00 48.70  ? 243 GLU A O   1 
ATOM   1847 C CB  . GLU A 1 242 ? -12.890 -28.394 15.739  1.00 44.17  ? 243 GLU A CB  1 
ATOM   1848 C CG  . GLU A 1 242 ? -13.636 -29.568 16.386  1.00 46.98  ? 243 GLU A CG  1 
ATOM   1849 C CD  . GLU A 1 242 ? -15.019 -29.818 15.793  1.00 51.09  ? 243 GLU A CD  1 
ATOM   1850 O OE1 . GLU A 1 242 ? -15.435 -29.070 14.889  1.00 56.47  ? 243 GLU A OE1 1 
ATOM   1851 O OE2 . GLU A 1 242 ? -15.704 -30.761 16.239  1.00 50.52  ? 243 GLU A OE2 1 
ATOM   1852 N N   . ALA A 1 243 ? -12.734 -26.205 18.205  1.00 46.69  ? 244 ALA A N   1 
ATOM   1853 C CA  . ALA A 1 243 ? -12.940 -25.896 19.628  1.00 49.86  ? 244 ALA A CA  1 
ATOM   1854 C C   . ALA A 1 243 ? -14.079 -24.884 19.784  1.00 50.23  ? 244 ALA A C   1 
ATOM   1855 O O   . ALA A 1 243 ? -14.979 -25.082 20.598  1.00 45.10  ? 244 ALA A O   1 
ATOM   1856 C CB  . ALA A 1 243 ? -11.680 -25.374 20.269  1.00 43.58  ? 244 ALA A CB  1 
ATOM   1857 N N   . ARG A 1 244 ? -14.048 -23.826 18.973  1.00 52.35  ? 245 ARG A N   1 
ATOM   1858 C CA  . ARG A 1 244 ? -15.084 -22.794 19.005  1.00 48.05  ? 245 ARG A CA  1 
ATOM   1859 C C   . ARG A 1 244 ? -16.452 -23.384 18.681  1.00 53.73  ? 245 ARG A C   1 
ATOM   1860 O O   . ARG A 1 244 ? -17.445 -23.061 19.331  1.00 54.29  ? 245 ARG A O   1 
ATOM   1861 C CB  . ARG A 1 244 ? -14.754 -21.626 18.059  1.00 53.16  ? 245 ARG A CB  1 
ATOM   1862 C CG  . ARG A 1 244 ? -15.886 -20.593 17.913  1.00 51.07  ? 245 ARG A CG  1 
ATOM   1863 C CD  . ARG A 1 244 ? -15.408 -19.315 17.234  1.00 52.28  ? 245 ARG A CD  1 
ATOM   1864 N NE  . ARG A 1 244 ? -14.478 -18.563 18.072  1.00 55.64  ? 245 ARG A NE  1 
ATOM   1865 C CZ  . ARG A 1 244 ? -14.855 -17.673 18.984  1.00 58.75  ? 245 ARG A CZ  1 
ATOM   1866 N NH1 . ARG A 1 244 ? -16.144 -17.435 19.172  1.00 55.76  ? 245 ARG A NH1 1 
ATOM   1867 N NH2 . ARG A 1 244 ? -13.948 -17.030 19.717  1.00 55.69  ? 245 ARG A NH2 1 
ATOM   1868 N N   . ARG A 1 245 ? -16.500 -24.282 17.706  1.00 51.24  ? 246 ARG A N   1 
ATOM   1869 C CA  . ARG A 1 245 ? -17.769 -24.892 17.348  1.00 57.27  ? 246 ARG A CA  1 
ATOM   1870 C C   . ARG A 1 245 ? -18.384 -25.691 18.487  1.00 52.99  ? 246 ARG A C   1 
ATOM   1871 O O   . ARG A 1 245 ? -19.589 -25.620 18.721  1.00 50.65  ? 246 ARG A O   1 
ATOM   1872 C CB  . ARG A 1 245 ? -17.641 -25.805 16.131  1.00 46.73  ? 246 ARG A CB  1 
ATOM   1873 C CG  . ARG A 1 245 ? -19.005 -26.212 15.612  1.00 47.83  ? 246 ARG A CG  1 
ATOM   1874 C CD  . ARG A 1 245 ? -18.948 -27.385 14.670  1.00 54.00  ? 246 ARG A CD  1 
ATOM   1875 N NE  . ARG A 1 245 ? -18.451 -28.609 15.291  1.00 54.30  ? 246 ARG A NE  1 
ATOM   1876 C CZ  . ARG A 1 245 ? -19.170 -29.416 16.065  1.00 57.20  ? 246 ARG A CZ  1 
ATOM   1877 N NH1 . ARG A 1 245 ? -20.431 -29.117 16.363  1.00 58.22  ? 246 ARG A NH1 1 
ATOM   1878 N NH2 . ARG A 1 245 ? -18.619 -30.524 16.553  1.00 47.23  ? 246 ARG A NH2 1 
ATOM   1879 N N   . ARG A 1 246 ? -17.558 -26.483 19.158  1.00 53.19  ? 247 ARG A N   1 
ATOM   1880 C CA  . ARG A 1 246 ? -18.021 -27.343 20.239  1.00 51.06  ? 247 ARG A CA  1 
ATOM   1881 C C   . ARG A 1 246 ? -18.481 -26.539 21.450  1.00 44.74  ? 247 ARG A C   1 
ATOM   1882 O O   . ARG A 1 246 ? -19.516 -26.846 22.050  1.00 47.59  ? 247 ARG A O   1 
ATOM   1883 C CB  . ARG A 1 246 ? -16.930 -28.346 20.631  1.00 49.82  ? 247 ARG A CB  1 
ATOM   1884 C CG  . ARG A 1 246 ? -16.629 -29.380 19.540  1.00 49.51  ? 247 ARG A CG  1 
ATOM   1885 C CD  . ARG A 1 246 ? -15.541 -30.341 19.985  1.00 45.69  ? 247 ARG A CD  1 
ATOM   1886 N NE  . ARG A 1 246 ? -15.075 -31.216 18.914  1.00 44.11  ? 247 ARG A NE  1 
ATOM   1887 C CZ  . ARG A 1 246 ? -14.212 -32.209 19.103  1.00 47.48  ? 247 ARG A CZ  1 
ATOM   1888 N NH1 . ARG A 1 246 ? -13.735 -32.449 20.324  1.00 40.28  ? 247 ARG A NH1 1 
ATOM   1889 N NH2 . ARG A 1 246 ? -13.823 -32.965 18.081  1.00 44.88  ? 247 ARG A NH2 1 
ATOM   1890 N N   . ALA A 1 247 ? -17.718 -25.507 21.803  1.00 45.22  ? 248 ALA A N   1 
ATOM   1891 C CA  . ALA A 1 247 ? -18.093 -24.624 22.912  1.00 47.57  ? 248 ALA A CA  1 
ATOM   1892 C C   . ALA A 1 247 ? -19.431 -23.965 22.605  1.00 57.92  ? 248 ALA A C   1 
ATOM   1893 O O   . ALA A 1 247 ? -20.312 -23.879 23.466  1.00 48.31  ? 248 ALA A O   1 
ATOM   1894 C CB  . ALA A 1 247 ? -17.032 -23.564 23.129  1.00 46.80  ? 248 ALA A CB  1 
ATOM   1895 N N   . THR A 1 248 ? -19.581 -23.525 21.355  1.00 49.31  ? 249 THR A N   1 
ATOM   1896 C CA  . THR A 1 248 ? -20.763 -22.794 20.929  1.00 44.10  ? 249 THR A CA  1 
ATOM   1897 C C   . THR A 1 248 ? -21.993 -23.701 20.931  1.00 51.17  ? 249 THR A C   1 
ATOM   1898 O O   . THR A 1 248 ? -23.083 -23.267 21.290  1.00 54.95  ? 249 THR A O   1 
ATOM   1899 C CB  . THR A 1 248 ? -20.518 -22.132 19.551  1.00 59.41  ? 249 THR A CB  1 
ATOM   1900 O OG1 . THR A 1 248 ? -19.454 -21.177 19.684  1.00 55.78  ? 249 THR A OG1 1 
ATOM   1901 C CG2 . THR A 1 248 ? -21.775 -21.435 19.029  1.00 50.54  ? 249 THR A CG2 1 
ATOM   1902 N N   A GLN A 1 249 ? -21.810 -24.959 20.541  0.48 49.06  ? 250 GLN A N   1 
ATOM   1903 N N   B GLN A 1 249 ? -21.807 -24.963 20.552  0.52 49.05  ? 250 GLN A N   1 
ATOM   1904 C CA  A GLN A 1 249 ? -22.897 -25.928 20.605  0.48 49.39  ? 250 GLN A CA  1 
ATOM   1905 C CA  B GLN A 1 249 ? -22.887 -25.946 20.594  0.52 49.38  ? 250 GLN A CA  1 
ATOM   1906 C C   A GLN A 1 249 ? -23.274 -26.272 22.049  0.48 51.52  ? 250 GLN A C   1 
ATOM   1907 C C   B GLN A 1 249 ? -23.257 -26.348 22.030  0.52 51.51  ? 250 GLN A C   1 
ATOM   1908 O O   A GLN A 1 249 ? -24.450 -26.490 22.359  0.48 48.67  ? 250 GLN A O   1 
ATOM   1909 O O   B GLN A 1 249 ? -24.412 -26.675 22.321  0.52 48.58  ? 250 GLN A O   1 
ATOM   1910 C CB  A GLN A 1 249 ? -22.556 -27.209 19.837  0.48 49.79  ? 250 GLN A CB  1 
ATOM   1911 C CB  B GLN A 1 249 ? -22.526 -27.187 19.764  0.52 49.78  ? 250 GLN A CB  1 
ATOM   1912 C CG  A GLN A 1 249 ? -23.696 -28.218 19.870  0.48 52.37  ? 250 GLN A CG  1 
ATOM   1913 C CG  B GLN A 1 249 ? -23.680 -28.176 19.572  0.52 52.75  ? 250 GLN A CG  1 
ATOM   1914 C CD  A GLN A 1 249 ? -23.446 -29.438 19.023  0.48 54.07  ? 250 GLN A CD  1 
ATOM   1915 C CD  B GLN A 1 249 ? -24.874 -27.568 18.843  0.52 55.25  ? 250 GLN A CD  1 
ATOM   1916 O OE1 A GLN A 1 249 ? -22.421 -29.546 18.351  0.48 54.03  ? 250 GLN A OE1 1 
ATOM   1917 O OE1 B GLN A 1 249 ? -24.733 -26.621 18.063  0.52 56.09  ? 250 GLN A OE1 1 
ATOM   1918 N NE2 A GLN A 1 249 ? -24.386 -30.373 19.051  0.48 59.16  ? 250 GLN A NE2 1 
ATOM   1919 N NE2 B GLN A 1 249 ? -26.060 -28.114 19.098  0.52 54.91  ? 250 GLN A NE2 1 
ATOM   1920 N N   . LEU A 1 250 ? -22.278 -26.325 22.929  1.00 52.32  ? 251 LEU A N   1 
ATOM   1921 C CA  . LEU A 1 250 ? -22.557 -26.610 24.334  1.00 52.42  ? 251 LEU A CA  1 
ATOM   1922 C C   . LEU A 1 250 ? -23.460 -25.504 24.870  1.00 43.22  ? 251 LEU A C   1 
ATOM   1923 O O   . LEU A 1 250 ? -24.475 -25.791 25.488  1.00 46.13  ? 251 LEU A O   1 
ATOM   1924 C CB  . LEU A 1 250 ? -21.286 -26.752 25.183  1.00 41.78  ? 251 LEU A CB  1 
ATOM   1925 C CG  . LEU A 1 250 ? -21.554 -27.032 26.670  1.00 49.47  ? 251 LEU A CG  1 
ATOM   1926 C CD1 . LEU A 1 250 ? -22.215 -28.400 26.843  1.00 40.80  ? 251 LEU A CD1 1 
ATOM   1927 C CD2 . LEU A 1 250 ? -20.278 -26.950 27.484  1.00 41.39  ? 251 LEU A CD2 1 
ATOM   1928 N N   . ALA A 1 251 ? -23.116 -24.252 24.581  1.00 48.25  ? 252 ALA A N   1 
ATOM   1929 C CA  . ALA A 1 251 ? -23.928 -23.125 25.040  1.00 56.44  ? 252 ALA A CA  1 
ATOM   1930 C C   . ALA A 1 251 ? -25.365 -23.277 24.568  1.00 58.23  ? 252 ALA A C   1 
ATOM   1931 O O   . ALA A 1 251 ? -26.291 -23.193 25.370  1.00 54.72  ? 252 ALA A O   1 
ATOM   1932 C CB  . ALA A 1 251 ? -23.359 -21.808 24.567  1.00 44.80  ? 252 ALA A CB  1 
ATOM   1933 N N   . HIS A 1 252 ? -25.539 -23.536 23.274  1.00 56.37  ? 253 HIS A N   1 
ATOM   1934 C CA  . HIS A 1 252 ? -26.871 -23.697 22.708  1.00 55.70  ? 253 HIS A CA  1 
ATOM   1935 C C   . HIS A 1 252 ? -27.685 -24.812 23.390  1.00 57.90  ? 253 HIS A C   1 
ATOM   1936 O O   . HIS A 1 252 ? -28.876 -24.634 23.669  1.00 55.02  ? 253 HIS A O   1 
ATOM   1937 C CB  . HIS A 1 252 ? -26.799 -23.920 21.190  1.00 51.57  ? 253 HIS A CB  1 
ATOM   1938 C CG  . HIS A 1 252 ? -28.117 -24.284 20.578  1.00 65.37  ? 253 HIS A CG  1 
ATOM   1939 N ND1 . HIS A 1 252 ? -28.557 -25.589 20.476  1.00 72.36  ? 253 HIS A ND1 1 
ATOM   1940 C CD2 . HIS A 1 252 ? -29.107 -23.513 20.069  1.00 67.92  ? 253 HIS A CD2 1 
ATOM   1941 C CE1 . HIS A 1 252 ? -29.756 -25.607 19.920  1.00 60.21  ? 253 HIS A CE1 1 
ATOM   1942 N NE2 . HIS A 1 252 ? -30.110 -24.360 19.661  1.00 73.77  ? 253 HIS A NE2 1 
ATOM   1943 N N   . LEU A 1 253 ? -27.040 -25.946 23.664  1.00 51.40  ? 254 LEU A N   1 
ATOM   1944 C CA  . LEU A 1 253 ? -27.707 -27.097 24.273  1.00 48.44  ? 254 LEU A CA  1 
ATOM   1945 C C   . LEU A 1 253 ? -28.169 -26.870 25.721  1.00 54.94  ? 254 LEU A C   1 
ATOM   1946 O O   . LEU A 1 253 ? -29.081 -27.547 26.191  1.00 49.67  ? 254 LEU A O   1 
ATOM   1947 C CB  . LEU A 1 253 ? -26.811 -28.340 24.235  1.00 49.44  ? 254 LEU A CB  1 
ATOM   1948 C CG  . LEU A 1 253 ? -26.600 -29.038 22.887  1.00 57.90  ? 254 LEU A CG  1 
ATOM   1949 C CD1 . LEU A 1 253 ? -25.611 -30.188 23.030  1.00 52.59  ? 254 LEU A CD1 1 
ATOM   1950 C CD2 . LEU A 1 253 ? -27.931 -29.544 22.350  1.00 53.86  ? 254 LEU A CD2 1 
ATOM   1951 N N   . VAL A 1 254 ? -27.513 -25.957 26.431  1.00 45.47  ? 255 VAL A N   1 
ATOM   1952 C CA  . VAL A 1 254 ? -27.874 -25.649 27.818  1.00 56.20  ? 255 VAL A CA  1 
ATOM   1953 C C   . VAL A 1 254 ? -28.603 -24.293 27.959  1.00 49.61  ? 255 VAL A C   1 
ATOM   1954 O O   . VAL A 1 254 ? -28.824 -23.797 29.079  1.00 51.91  ? 255 VAL A O   1 
ATOM   1955 C CB  . VAL A 1 254 ? -26.648 -25.745 28.781  1.00 52.87  ? 255 VAL A CB  1 
ATOM   1956 C CG1 . VAL A 1 254 ? -25.952 -27.094 28.608  1.00 47.33  ? 255 VAL A CG1 1 
ATOM   1957 C CG2 . VAL A 1 254 ? -25.683 -24.608 28.547  1.00 42.85  ? 255 VAL A CG2 1 
ATOM   1958 N N   . GLY A 1 255 ? -28.979 -23.717 26.814  1.00 49.71  ? 256 GLY A N   1 
ATOM   1959 C CA  . GLY A 1 255 ? -29.865 -22.565 26.773  1.00 50.79  ? 256 GLY A CA  1 
ATOM   1960 C C   . GLY A 1 255 ? -29.236 -21.184 26.801  1.00 54.76  ? 256 GLY A C   1 
ATOM   1961 O O   . GLY A 1 255 ? -29.900 -20.214 27.146  1.00 55.66  ? 256 GLY A O   1 
ATOM   1962 N N   . CYS A 1 256 ? -27.964 -21.091 26.421  1.00 53.43  ? 257 CYS A N   1 
ATOM   1963 C CA  . CYS A 1 256 ? -27.252 -19.820 26.384  1.00 53.62  ? 257 CYS A CA  1 
ATOM   1964 C C   . CYS A 1 256 ? -27.070 -19.381 24.936  1.00 60.12  ? 257 CYS A C   1 
ATOM   1965 O O   . CYS A 1 256 ? -26.989 -20.224 24.052  1.00 62.25  ? 257 CYS A O   1 
ATOM   1966 C CB  . CYS A 1 256 ? -25.890 -19.972 27.066  1.00 54.17  ? 257 CYS A CB  1 
ATOM   1967 S SG  . CYS A 1 256 ? -26.027 -20.372 28.823  1.00 59.83  ? 257 CYS A SG  1 
ATOM   1968 N N   . PRO A 1 257 ? -27.010 -18.061 24.694  1.00 70.44  ? 258 PRO A N   1 
ATOM   1969 C CA  . PRO A 1 257 ? -26.861 -17.491 23.347  1.00 75.26  ? 258 PRO A CA  1 
ATOM   1970 C C   . PRO A 1 257 ? -25.589 -17.940 22.614  1.00 83.29  ? 258 PRO A C   1 
ATOM   1971 O O   . PRO A 1 257 ? -25.552 -17.914 21.372  1.00 90.10  ? 258 PRO A O   1 
ATOM   1972 C CB  . PRO A 1 257 ? -26.817 -15.979 23.613  1.00 69.70  ? 258 PRO A CB  1 
ATOM   1973 C CG  . PRO A 1 257 ? -26.440 -15.846 25.052  1.00 69.91  ? 258 PRO A CG  1 
ATOM   1974 C CD  . PRO A 1 257 ? -27.093 -17.009 25.721  1.00 70.41  ? 258 PRO A CD  1 
ATOM   1975 N N   . ASN A 1 264 ? -21.210 -12.880 20.651  1.00 77.15  ? 265 ASN A N   1 
ATOM   1976 C CA  . ASN A 1 264 ? -20.381 -12.241 21.667  1.00 63.02  ? 265 ASN A CA  1 
ATOM   1977 C C   . ASN A 1 264 ? -19.870 -13.246 22.713  1.00 70.66  ? 265 ASN A C   1 
ATOM   1978 O O   . ASN A 1 264 ? -20.631 -13.718 23.562  1.00 65.31  ? 265 ASN A O   1 
ATOM   1979 C CB  . ASN A 1 264 ? -21.148 -11.093 22.331  1.00 81.06  ? 265 ASN A CB  1 
ATOM   1980 C CG  . ASN A 1 264 ? -20.254 -10.187 23.175  1.00 85.15  ? 265 ASN A CG  1 
ATOM   1981 O OD1 . ASN A 1 264 ? -19.278 -10.635 23.772  1.00 83.88  ? 265 ASN A OD1 1 
ATOM   1982 N ND2 . ASN A 1 264 ? -20.599 -8.901  23.234  1.00 93.23  ? 265 ASN A ND2 1 
ATOM   1983 N N   . ASP A 1 265 ? -18.575 -13.554 22.642  1.00 60.62  ? 266 ASP A N   1 
ATOM   1984 C CA  . ASP A 1 265 ? -17.924 -14.487 23.559  1.00 60.21  ? 266 ASP A CA  1 
ATOM   1985 C C   . ASP A 1 265 ? -18.210 -14.166 25.034  1.00 64.70  ? 266 ASP A C   1 
ATOM   1986 O O   . ASP A 1 265 ? -18.508 -15.061 25.828  1.00 63.36  ? 266 ASP A O   1 
ATOM   1987 C CB  . ASP A 1 265 ? -16.402 -14.484 23.336  1.00 58.32  ? 266 ASP A CB  1 
ATOM   1988 C CG  . ASP A 1 265 ? -15.981 -15.109 22.000  1.00 59.83  ? 266 ASP A CG  1 
ATOM   1989 O OD1 . ASP A 1 265 ? -16.778 -15.835 21.375  1.00 58.03  ? 266 ASP A OD1 1 
ATOM   1990 O OD2 . ASP A 1 265 ? -14.824 -14.881 21.587  1.00 66.94  ? 266 ASP A OD2 1 
ATOM   1991 N N   . THR A 1 266 ? -18.112 -12.887 25.391  1.00 58.70  ? 267 THR A N   1 
ATOM   1992 C CA  . THR A 1 266 ? -18.293 -12.450 26.775  1.00 60.42  ? 267 THR A CA  1 
ATOM   1993 C C   . THR A 1 266 ? -19.669 -12.784 27.339  1.00 59.00  ? 267 THR A C   1 
ATOM   1994 O O   . THR A 1 266 ? -19.782 -13.282 28.457  1.00 66.57  ? 267 THR A O   1 
ATOM   1995 C CB  . THR A 1 266 ? -18.060 -10.949 26.916  1.00 68.23  ? 267 THR A CB  1 
ATOM   1996 O OG1 . THR A 1 266 ? -16.728 -10.640 26.488  1.00 63.83  ? 267 THR A OG1 1 
ATOM   1997 C CG2 . THR A 1 266 ? -18.244 -10.514 28.380  1.00 64.45  ? 267 THR A CG2 1 
ATOM   1998 N N   . GLU A 1 267 ? -20.712 -12.514 26.560  1.00 60.96  ? 268 GLU A N   1 
ATOM   1999 C CA  . GLU A 1 267 ? -22.074 -12.860 26.953  1.00 60.67  ? 268 GLU A CA  1 
ATOM   2000 C C   . GLU A 1 267 ? -22.272 -14.372 26.959  1.00 59.32  ? 268 GLU A C   1 
ATOM   2001 O O   . GLU A 1 267 ? -23.040 -14.903 27.760  1.00 60.14  ? 268 GLU A O   1 
ATOM   2002 C CB  . GLU A 1 267 ? -23.088 -12.214 26.008  1.00 68.94  ? 268 GLU A CB  1 
ATOM   2003 C CG  . GLU A 1 267 ? -23.053 -10.694 25.986  1.00 84.63  ? 268 GLU A CG  1 
ATOM   2004 C CD  . GLU A 1 267 ? -23.960 -10.107 24.911  1.00 112.31 ? 268 GLU A CD  1 
ATOM   2005 O OE1 . GLU A 1 267 ? -25.034 -10.700 24.650  1.00 114.48 ? 268 GLU A OE1 1 
ATOM   2006 O OE2 . GLU A 1 267 ? -23.594 -9.060  24.324  1.00 111.90 ? 268 GLU A OE2 1 
ATOM   2007 N N   . LEU A 1 268 ? -21.586 -15.069 26.058  1.00 54.72  ? 269 LEU A N   1 
ATOM   2008 C CA  . LEU A 1 268 ? -21.717 -16.518 26.003  1.00 57.94  ? 269 LEU A CA  1 
ATOM   2009 C C   . LEU A 1 268 ? -21.147 -17.158 27.280  1.00 56.77  ? 269 LEU A C   1 
ATOM   2010 O O   . LEU A 1 268 ? -21.829 -17.921 27.955  1.00 55.32  ? 269 LEU A O   1 
ATOM   2011 C CB  . LEU A 1 268 ? -21.075 -17.086 24.727  1.00 58.31  ? 269 LEU A CB  1 
ATOM   2012 C CG  . LEU A 1 268 ? -21.319 -18.570 24.459  1.00 63.26  ? 269 LEU A CG  1 
ATOM   2013 C CD1 . LEU A 1 268 ? -21.415 -18.852 22.983  1.00 54.31  ? 269 LEU A CD1 1 
ATOM   2014 C CD2 . LEU A 1 268 ? -20.192 -19.399 25.059  1.00 67.68  ? 269 LEU A CD2 1 
ATOM   2015 N N   . VAL A 1 269 ? -19.906 -16.824 27.613  1.00 48.59  ? 270 VAL A N   1 
ATOM   2016 C CA  . VAL A 1 269 ? -19.264 -17.375 28.799  1.00 54.73  ? 270 VAL A CA  1 
ATOM   2017 C C   . VAL A 1 269 ? -20.007 -16.985 30.075  1.00 53.46  ? 270 VAL A C   1 
ATOM   2018 O O   . VAL A 1 269 ? -20.156 -17.810 30.982  1.00 55.34  ? 270 VAL A O   1 
ATOM   2019 C CB  . VAL A 1 269 ? -17.756 -16.980 28.877  1.00 56.68  ? 270 VAL A CB  1 
ATOM   2020 C CG1 . VAL A 1 269 ? -17.093 -17.550 30.123  1.00 55.94  ? 270 VAL A CG1 1 
ATOM   2021 C CG2 . VAL A 1 269 ? -17.025 -17.485 27.647  1.00 58.89  ? 270 VAL A CG2 1 
ATOM   2022 N N   . ALA A 1 270 ? -20.486 -15.745 30.145  1.00 50.08  ? 271 ALA A N   1 
ATOM   2023 C CA  . ALA A 1 270 ? -21.199 -15.302 31.345  1.00 55.49  ? 271 ALA A CA  1 
ATOM   2024 C C   . ALA A 1 270 ? -22.434 -16.177 31.592  1.00 50.39  ? 271 ALA A C   1 
ATOM   2025 O O   . ALA A 1 270 ? -22.696 -16.581 32.710  1.00 58.31  ? 271 ALA A O   1 
ATOM   2026 C CB  . ALA A 1 270 ? -21.576 -13.818 31.252  1.00 47.36  ? 271 ALA A CB  1 
ATOM   2027 N N   . CYS A 1 271 ? -23.172 -16.492 30.533  1.00 53.49  ? 272 CYS A N   1 
ATOM   2028 C CA  . CYS A 1 271 ? -24.322 -17.377 30.649  1.00 47.12  ? 272 CYS A CA  1 
ATOM   2029 C C   . CYS A 1 271 ? -23.902 -18.793 31.057  1.00 52.33  ? 272 CYS A C   1 
ATOM   2030 O O   . CYS A 1 271 ? -24.532 -19.405 31.917  1.00 51.27  ? 272 CYS A O   1 
ATOM   2031 C CB  . CYS A 1 271 ? -25.133 -17.390 29.342  1.00 50.96  ? 272 CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 271 ? -26.619 -18.461 29.369  1.00 63.78  ? 272 CYS A SG  1 
ATOM   2033 N N   . LEU A 1 272 ? -22.842 -19.317 30.446  1.00 50.29  ? 273 LEU A N   1 
ATOM   2034 C CA  . LEU A 1 272 ? -22.302 -20.617 30.869  1.00 51.08  ? 273 LEU A CA  1 
ATOM   2035 C C   . LEU A 1 272 ? -21.927 -20.635 32.368  1.00 51.68  ? 273 LEU A C   1 
ATOM   2036 O O   . LEU A 1 272 ? -22.125 -21.645 33.069  1.00 48.04  ? 273 LEU A O   1 
ATOM   2037 C CB  . LEU A 1 272 ? -21.097 -21.020 30.010  1.00 48.10  ? 273 LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 272 ? -21.344 -21.351 28.534  1.00 47.63  ? 273 LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 272 ? -20.020 -21.589 27.800  1.00 50.03  ? 273 LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 272 ? -22.245 -22.577 28.407  1.00 52.33  ? 273 LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 273 ? -21.403 -19.517 32.864  1.00 51.98  ? 274 ARG A N   1 
ATOM   2042 C CA  . ARG A 1 273 ? -20.999 -19.434 34.269  1.00 54.74  ? 274 ARG A CA  1 
ATOM   2043 C C   . ARG A 1 273 ? -22.179 -19.465 35.253  1.00 52.64  ? 274 ARG A C   1 
ATOM   2044 O O   . ARG A 1 273 ? -21.990 -19.747 36.432  1.00 49.84  ? 274 ARG A O   1 
ATOM   2045 C CB  . ARG A 1 273 ? -20.094 -18.218 34.525  1.00 53.53  ? 274 ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 273 ? -18.685 -18.403 33.984  1.00 51.43  ? 274 ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 273 ? -17.665 -17.518 34.665  1.00 47.90  ? 274 ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 273 ? -17.392 -16.296 33.926  1.00 68.33  ? 274 ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 273 ? -16.251 -16.029 33.288  1.00 70.62  ? 274 ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 273 ? -15.237 -16.896 33.287  1.00 55.70  ? 274 ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 273 ? -16.122 -14.876 32.650  1.00 63.63  ? 274 ARG A NH2 1 
ATOM   2052 N N   . THR A 1 274 ? -23.390 -19.203 34.766  1.00 50.39  ? 275 THR A N   1 
ATOM   2053 C CA  . THR A 1 274 ? -24.570 -19.229 35.637  1.00 53.14  ? 275 THR A CA  1 
ATOM   2054 C C   . THR A 1 274 ? -25.144 -20.640 35.769  1.00 53.18  ? 275 THR A C   1 
ATOM   2055 O O   . THR A 1 274 ? -26.002 -20.881 36.606  1.00 57.80  ? 275 THR A O   1 
ATOM   2056 C CB  . THR A 1 274 ? -25.697 -18.312 35.117  1.00 56.27  ? 275 THR A CB  1 
ATOM   2057 O OG1 . THR A 1 274 ? -26.252 -18.862 33.911  1.00 53.36  ? 275 THR A OG1 1 
ATOM   2058 C CG2 . THR A 1 274 ? -25.180 -16.921 34.846  1.00 53.58  ? 275 THR A CG2 1 
ATOM   2059 N N   . ARG A 1 275 ? -24.670 -21.568 34.937  1.00 54.31  ? 276 ARG A N   1 
ATOM   2060 C CA  . ARG A 1 275 ? -25.200 -22.932 34.908  1.00 43.20  ? 276 ARG A CA  1 
ATOM   2061 C C   . ARG A 1 275 ? -24.529 -23.844 35.936  1.00 48.74  ? 276 ARG A C   1 
ATOM   2062 O O   . ARG A 1 275 ? -23.306 -23.810 36.083  1.00 51.13  ? 276 ARG A O   1 
ATOM   2063 C CB  . ARG A 1 275 ? -25.016 -23.541 33.510  1.00 44.31  ? 276 ARG A CB  1 
ATOM   2064 C CG  . ARG A 1 275 ? -25.823 -22.868 32.399  1.00 51.40  ? 276 ARG A CG  1 
ATOM   2065 C CD  . ARG A 1 275 ? -27.297 -22.987 32.685  1.00 56.28  ? 276 ARG A CD  1 
ATOM   2066 N NE  . ARG A 1 275 ? -28.127 -22.575 31.564  1.00 56.67  ? 276 ARG A NE  1 
ATOM   2067 C CZ  . ARG A 1 275 ? -28.639 -21.359 31.419  1.00 54.78  ? 276 ARG A CZ  1 
ATOM   2068 N NH1 . ARG A 1 275 ? -28.396 -20.425 32.325  1.00 49.79  ? 276 ARG A NH1 1 
ATOM   2069 N NH2 . ARG A 1 275 ? -29.387 -21.080 30.358  1.00 54.66  ? 276 ARG A NH2 1 
ATOM   2070 N N   . PRO A 1 276 ? -25.327 -24.671 36.643  1.00 50.78  ? 277 PRO A N   1 
ATOM   2071 C CA  . PRO A 1 276 ? -24.757 -25.697 37.527  1.00 45.92  ? 277 PRO A CA  1 
ATOM   2072 C C   . PRO A 1 276 ? -23.773 -26.597 36.772  1.00 54.93  ? 277 PRO A C   1 
ATOM   2073 O O   . PRO A 1 276 ? -24.030 -26.920 35.605  1.00 47.86  ? 277 PRO A O   1 
ATOM   2074 C CB  . PRO A 1 276 ? -25.987 -26.515 37.962  1.00 45.96  ? 277 PRO A CB  1 
ATOM   2075 C CG  . PRO A 1 276 ? -27.129 -25.527 37.902  1.00 50.53  ? 277 PRO A CG  1 
ATOM   2076 C CD  . PRO A 1 276 ? -26.801 -24.599 36.744  1.00 49.47  ? 277 PRO A CD  1 
ATOM   2077 N N   . ALA A 1 277 ? -22.675 -26.980 37.432  1.00 45.96  ? 278 ALA A N   1 
ATOM   2078 C CA  . ALA A 1 277 ? -21.650 -27.829 36.836  1.00 50.59  ? 278 ALA A CA  1 
ATOM   2079 C C   . ALA A 1 277 ? -22.240 -29.085 36.184  1.00 48.02  ? 278 ALA A C   1 
ATOM   2080 O O   . ALA A 1 277 ? -21.957 -29.391 35.019  1.00 47.56  ? 278 ALA A O   1 
ATOM   2081 C CB  . ALA A 1 277 ? -20.603 -28.205 37.877  1.00 45.74  ? 278 ALA A CB  1 
ATOM   2082 N N   . GLN A 1 278 ? -23.089 -29.785 36.931  1.00 47.19  ? 279 GLN A N   1 
ATOM   2083 C CA  . GLN A 1 278 ? -23.722 -31.006 36.442  1.00 48.94  ? 279 GLN A CA  1 
ATOM   2084 C C   . GLN A 1 278 ? -24.464 -30.830 35.095  1.00 52.33  ? 279 GLN A C   1 
ATOM   2085 O O   . GLN A 1 278 ? -24.516 -31.756 34.283  1.00 46.24  ? 279 GLN A O   1 
ATOM   2086 C CB  . GLN A 1 278 ? -24.631 -31.616 37.525  1.00 47.40  ? 279 GLN A CB  1 
ATOM   2087 C CG  . GLN A 1 278 ? -25.127 -33.026 37.198  1.00 45.45  ? 279 GLN A CG  1 
ATOM   2088 C CD  . GLN A 1 278 ? -23.997 -34.004 36.936  1.00 51.88  ? 279 GLN A CD  1 
ATOM   2089 O OE1 . GLN A 1 278 ? -23.091 -34.157 37.753  1.00 60.59  ? 279 GLN A OE1 1 
ATOM   2090 N NE2 . GLN A 1 278 ? -24.047 -34.673 35.790  1.00 56.97  ? 279 GLN A NE2 1 
ATOM   2091 N N   . VAL A 1 279 ? -25.005 -29.639 34.849  1.00 48.55  ? 280 VAL A N   1 
ATOM   2092 C CA  . VAL A 1 279 ? -25.728 -29.388 33.606  1.00 44.66  ? 280 VAL A CA  1 
ATOM   2093 C C   . VAL A 1 279 ? -24.765 -29.363 32.413  1.00 49.80  ? 280 VAL A C   1 
ATOM   2094 O O   . VAL A 1 279 ? -25.067 -29.914 31.356  1.00 45.77  ? 280 VAL A O   1 
ATOM   2095 C CB  . VAL A 1 279 ? -26.539 -28.068 33.660  1.00 48.41  ? 280 VAL A CB  1 
ATOM   2096 C CG1 . VAL A 1 279 ? -27.187 -27.777 32.318  1.00 46.16  ? 280 VAL A CG1 1 
ATOM   2097 C CG2 . VAL A 1 279 ? -27.603 -28.135 34.744  1.00 43.59  ? 280 VAL A CG2 1 
ATOM   2098 N N   . LEU A 1 280 ? -23.613 -28.717 32.578  1.00 47.05  ? 281 LEU A N   1 
ATOM   2099 C CA  . LEU A 1 280 ? -22.590 -28.756 31.538  1.00 49.23  ? 281 LEU A CA  1 
ATOM   2100 C C   . LEU A 1 280 ? -22.208 -30.208 31.239  1.00 42.64  ? 281 LEU A C   1 
ATOM   2101 O O   . LEU A 1 280 ? -22.176 -30.627 30.078  1.00 55.08  ? 281 LEU A O   1 
ATOM   2102 C CB  . LEU A 1 280 ? -21.366 -27.920 31.934  1.00 41.72  ? 281 LEU A CB  1 
ATOM   2103 C CG  . LEU A 1 280 ? -21.673 -26.437 32.192  1.00 43.77  ? 281 LEU A CG  1 
ATOM   2104 C CD1 . LEU A 1 280 ? -20.385 -25.637 32.223  1.00 51.09  ? 281 LEU A CD1 1 
ATOM   2105 C CD2 . LEU A 1 280 ? -22.638 -25.864 31.144  1.00 48.46  ? 281 LEU A CD2 1 
ATOM   2106 N N   . VAL A 1 281 ? -21.974 -30.980 32.292  1.00 41.56  ? 282 VAL A N   1 
ATOM   2107 C CA  . VAL A 1 281 ? -21.642 -32.390 32.155  1.00 44.23  ? 282 VAL A CA  1 
ATOM   2108 C C   . VAL A 1 281 ? -22.714 -33.190 31.403  1.00 55.32  ? 282 VAL A C   1 
ATOM   2109 O O   . VAL A 1 281 ? -22.381 -34.033 30.578  1.00 49.23  ? 282 VAL A O   1 
ATOM   2110 C CB  . VAL A 1 281 ? -21.363 -33.048 33.523  1.00 41.86  ? 282 VAL A CB  1 
ATOM   2111 C CG1 . VAL A 1 281 ? -21.203 -34.566 33.374  1.00 44.52  ? 282 VAL A CG1 1 
ATOM   2112 C CG2 . VAL A 1 281 ? -20.133 -32.440 34.160  1.00 42.42  ? 282 VAL A CG2 1 
ATOM   2113 N N   . ASN A 1 282 ? -23.991 -32.931 31.685  1.00 46.01  ? 283 ASN A N   1 
ATOM   2114 C CA  . ASN A 1 282 ? -25.079 -33.666 31.044  1.00 47.60  ? 283 ASN A CA  1 
ATOM   2115 C C   . ASN A 1 282 ? -25.148 -33.560 29.511  1.00 48.47  ? 283 ASN A C   1 
ATOM   2116 O O   . ASN A 1 282 ? -25.730 -34.423 28.866  1.00 47.61  ? 283 ASN A O   1 
ATOM   2117 C CB  . ASN A 1 282 ? -26.435 -33.275 31.646  1.00 47.39  ? 283 ASN A CB  1 
ATOM   2118 C CG  . ASN A 1 282 ? -26.608 -33.777 33.073  1.00 50.71  ? 283 ASN A CG  1 
ATOM   2119 O OD1 . ASN A 1 282 ? -25.901 -34.675 33.523  1.00 52.99  ? 283 ASN A OD1 1 
ATOM   2120 N ND2 . ASN A 1 282 ? -27.561 -33.201 33.783  1.00 45.13  ? 283 ASN A ND2 1 
ATOM   2121 N N   . HIS A 1 283 ? -24.567 -32.509 28.941  1.00 41.90  ? 284 HIS A N   1 
ATOM   2122 C CA  . HIS A 1 283 ? -24.586 -32.315 27.487  1.00 48.71  ? 284 HIS A CA  1 
ATOM   2123 C C   . HIS A 1 283 ? -23.231 -32.495 26.791  1.00 51.39  ? 284 HIS A C   1 
ATOM   2124 O O   . HIS A 1 283 ? -23.136 -32.380 25.563  1.00 51.84  ? 284 HIS A O   1 
ATOM   2125 C CB  . HIS A 1 283 ? -25.171 -30.939 27.148  1.00 51.39  ? 284 HIS A CB  1 
ATOM   2126 C CG  . HIS A 1 283 ? -26.592 -30.783 27.574  1.00 60.97  ? 284 HIS A CG  1 
ATOM   2127 N ND1 . HIS A 1 283 ? -27.653 -31.091 26.748  1.00 67.23  ? 284 HIS A ND1 1 
ATOM   2128 C CD2 . HIS A 1 283 ? -27.132 -30.390 28.751  1.00 49.32  ? 284 HIS A CD2 1 
ATOM   2129 C CE1 . HIS A 1 283 ? -28.786 -30.870 27.390  1.00 61.94  ? 284 HIS A CE1 1 
ATOM   2130 N NE2 . HIS A 1 283 ? -28.498 -30.442 28.607  1.00 65.74  ? 284 HIS A NE2 1 
ATOM   2131 N N   . GLU A 1 284 ? -22.202 -32.801 27.576  1.00 51.37  ? 285 GLU A N   1 
ATOM   2132 C CA  . GLU A 1 284 ? -20.825 -32.865 27.093  1.00 50.92  ? 285 GLU A CA  1 
ATOM   2133 C C   . GLU A 1 284 ? -20.618 -33.708 25.816  1.00 46.18  ? 285 GLU A C   1 
ATOM   2134 O O   . GLU A 1 284 ? -19.984 -33.265 24.867  1.00 44.44  ? 285 GLU A O   1 
ATOM   2135 C CB  . GLU A 1 284 ? -19.921 -33.400 28.206  1.00 46.67  ? 285 GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 284 ? -18.501 -33.672 27.746  1.00 56.73  ? 285 GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 284 ? -17.590 -34.149 28.865  1.00 59.51  ? 285 GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 284 ? -17.972 -34.053 30.051  1.00 58.14  ? 285 GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 284 ? -16.489 -34.635 28.549  1.00 62.04  ? 285 GLU A OE2 1 
ATOM   2140 N N   . TRP A 1 285 ? -21.163 -34.919 25.809  1.00 51.38  ? 286 TRP A N   1 
ATOM   2141 C CA  . TRP A 1 285 ? -20.890 -35.865 24.747  1.00 51.18  ? 286 TRP A CA  1 
ATOM   2142 C C   . TRP A 1 285 ? -21.570 -35.465 23.441  1.00 58.72  ? 286 TRP A C   1 
ATOM   2143 O O   . TRP A 1 285 ? -21.145 -35.877 22.365  1.00 53.36  ? 286 TRP A O   1 
ATOM   2144 C CB  . TRP A 1 285 ? -21.317 -37.269 25.173  1.00 47.66  ? 286 TRP A CB  1 
ATOM   2145 C CG  . TRP A 1 285 ? -20.442 -37.840 26.253  1.00 57.05  ? 286 TRP A CG  1 
ATOM   2146 C CD1 . TRP A 1 285 ? -20.724 -37.902 27.597  1.00 56.28  ? 286 TRP A CD1 1 
ATOM   2147 C CD2 . TRP A 1 285 ? -19.138 -38.423 26.089  1.00 48.77  ? 286 TRP A CD2 1 
ATOM   2148 N NE1 . TRP A 1 285 ? -19.679 -38.489 28.271  1.00 49.24  ? 286 TRP A NE1 1 
ATOM   2149 C CE2 . TRP A 1 285 ? -18.692 -38.817 27.376  1.00 52.08  ? 286 TRP A CE2 1 
ATOM   2150 C CE3 . TRP A 1 285 ? -18.301 -38.646 24.983  1.00 49.50  ? 286 TRP A CE3 1 
ATOM   2151 C CZ2 . TRP A 1 285 ? -17.444 -39.429 27.588  1.00 45.53  ? 286 TRP A CZ2 1 
ATOM   2152 C CZ3 . TRP A 1 285 ? -17.064 -39.260 25.192  1.00 49.38  ? 286 TRP A CZ3 1 
ATOM   2153 C CH2 . TRP A 1 285 ? -16.649 -39.644 26.494  1.00 48.43  ? 286 TRP A CH2 1 
ATOM   2154 N N   . HIS A 1 286 ? -22.607 -34.640 23.544  1.00 51.16  ? 287 HIS A N   1 
ATOM   2155 C CA  . HIS A 1 286 ? -23.420 -34.300 22.386  1.00 54.67  ? 287 HIS A CA  1 
ATOM   2156 C C   . HIS A 1 286 ? -22.814 -33.268 21.458  1.00 54.45  ? 287 HIS A C   1 
ATOM   2157 O O   . HIS A 1 286 ? -23.345 -33.038 20.379  1.00 58.68  ? 287 HIS A O   1 
ATOM   2158 C CB  . HIS A 1 286 ? -24.827 -33.887 22.818  1.00 52.39  ? 287 HIS A CB  1 
ATOM   2159 C CG  . HIS A 1 286 ? -25.535 -34.953 23.593  1.00 62.51  ? 287 HIS A CG  1 
ATOM   2160 N ND1 . HIS A 1 286 ? -26.041 -36.091 23.000  1.00 73.15  ? 287 HIS A ND1 1 
ATOM   2161 C CD2 . HIS A 1 286 ? -25.786 -35.078 24.918  1.00 71.68  ? 287 HIS A CD2 1 
ATOM   2162 C CE1 . HIS A 1 286 ? -26.586 -36.862 23.924  1.00 74.63  ? 287 HIS A CE1 1 
ATOM   2163 N NE2 . HIS A 1 286 ? -26.448 -36.268 25.096  1.00 78.03  ? 287 HIS A NE2 1 
ATOM   2164 N N   . VAL A 1 287 ? -21.704 -32.648 21.849  1.00 54.28  ? 288 VAL A N   1 
ATOM   2165 C CA  . VAL A 1 287 ? -21.067 -31.690 20.936  1.00 48.63  ? 288 VAL A CA  1 
ATOM   2166 C C   . VAL A 1 287 ? -20.074 -32.350 19.968  1.00 46.09  ? 288 VAL A C   1 
ATOM   2167 O O   . VAL A 1 287 ? -19.482 -31.678 19.121  1.00 53.48  ? 288 VAL A O   1 
ATOM   2168 C CB  . VAL A 1 287 ? -20.408 -30.501 21.671  1.00 51.92  ? 288 VAL A CB  1 
ATOM   2169 C CG1 . VAL A 1 287 ? -21.400 -29.876 22.641  1.00 58.39  ? 288 VAL A CG1 1 
ATOM   2170 C CG2 . VAL A 1 287 ? -19.160 -30.942 22.403  1.00 41.69  ? 288 VAL A CG2 1 
ATOM   2171 N N   . LEU A 1 288 ? -19.900 -33.662 20.077  1.00 46.62  ? 289 LEU A N   1 
ATOM   2172 C CA  . LEU A 1 288 ? -19.021 -34.366 19.139  1.00 46.77  ? 289 LEU A CA  1 
ATOM   2173 C C   . LEU A 1 288 ? -19.655 -34.363 17.743  1.00 50.48  ? 289 LEU A C   1 
ATOM   2174 O O   . LEU A 1 288 ? -20.864 -34.548 17.606  1.00 47.76  ? 289 LEU A O   1 
ATOM   2175 C CB  . LEU A 1 288 ? -18.712 -35.795 19.613  1.00 38.95  ? 289 LEU A CB  1 
ATOM   2176 C CG  . LEU A 1 288 ? -17.655 -35.909 20.740  1.00 49.47  ? 289 LEU A CG  1 
ATOM   2177 C CD1 . LEU A 1 288 ? -17.441 -37.326 21.154  1.00 39.90  ? 289 LEU A CD1 1 
ATOM   2178 C CD2 . LEU A 1 288 ? -16.309 -35.291 20.358  1.00 43.46  ? 289 LEU A CD2 1 
ATOM   2179 N N   . PRO A 1 289 ? -18.839 -34.152 16.703  1.00 46.10  ? 290 PRO A N   1 
ATOM   2180 C CA  . PRO A 1 289 ? -19.387 -34.085 15.336  1.00 56.20  ? 290 PRO A CA  1 
ATOM   2181 C C   . PRO A 1 289 ? -19.921 -35.416 14.783  1.00 49.11  ? 290 PRO A C   1 
ATOM   2182 O O   . PRO A 1 289 ? -20.665 -35.382 13.817  1.00 56.59  ? 290 PRO A O   1 
ATOM   2183 C CB  . PRO A 1 289 ? -18.200 -33.588 14.506  1.00 51.69  ? 290 PRO A CB  1 
ATOM   2184 C CG  . PRO A 1 289 ? -16.994 -34.095 15.248  1.00 61.78  ? 290 PRO A CG  1 
ATOM   2185 C CD  . PRO A 1 289 ? -17.365 -34.043 16.723  1.00 47.78  ? 290 PRO A CD  1 
ATOM   2186 N N   . GLN A 1 290 ? -19.573 -36.556 15.371  1.00 52.52  ? 291 GLN A N   1 
ATOM   2187 C CA  . GLN A 1 290 ? -20.149 -37.829 14.911  1.00 53.18  ? 291 GLN A CA  1 
ATOM   2188 C C   . GLN A 1 290 ? -20.070 -38.918 15.970  1.00 55.41  ? 291 GLN A C   1 
ATOM   2189 O O   . GLN A 1 290 ? -19.367 -38.779 16.958  1.00 56.87  ? 291 GLN A O   1 
ATOM   2190 C CB  . GLN A 1 290 ? -19.454 -38.324 13.634  1.00 60.19  ? 291 GLN A CB  1 
ATOM   2191 C CG  . GLN A 1 290 ? -18.293 -39.291 13.900  1.00 62.85  ? 291 GLN A CG  1 
ATOM   2192 C CD  . GLN A 1 290 ? -17.921 -40.154 12.684  1.00 72.05  ? 291 GLN A CD  1 
ATOM   2193 O OE1 . GLN A 1 290 ? -17.380 -39.647 11.695  1.00 75.80  ? 291 GLN A OE1 1 
ATOM   2194 N NE2 . GLN A 1 290 ? -18.208 -41.469 12.762  1.00 50.43  ? 291 GLN A NE2 1 
ATOM   2195 N N   . GLU A 1 291 ? -20.815 -39.996 15.751  1.00 65.79  ? 292 GLU A N   1 
ATOM   2196 C CA  . GLU A 1 291 ? -20.726 -41.207 16.550  1.00 60.28  ? 292 GLU A CA  1 
ATOM   2197 C C   . GLU A 1 291 ? -19.300 -41.746 16.464  1.00 58.67  ? 292 GLU A C   1 
ATOM   2198 O O   . GLU A 1 291 ? -18.777 -41.931 15.374  1.00 58.34  ? 292 GLU A O   1 
ATOM   2199 C CB  . GLU A 1 291 ? -21.699 -42.245 15.984  1.00 71.37  ? 292 GLU A CB  1 
ATOM   2200 C CG  . GLU A 1 291 ? -21.659 -43.618 16.652  1.00 91.36  ? 292 GLU A CG  1 
ATOM   2201 C CD  . GLU A 1 291 ? -22.509 -44.662 15.918  1.00 98.75  ? 292 GLU A CD  1 
ATOM   2202 O OE1 . GLU A 1 291 ? -22.680 -44.545 14.680  1.00 80.09  ? 292 GLU A OE1 1 
ATOM   2203 O OE2 . GLU A 1 291 ? -23.003 -45.601 16.585  1.00 105.25 ? 292 GLU A OE2 1 
ATOM   2204 N N   . SER A 1 292 ? -18.674 -42.007 17.604  1.00 52.04  ? 293 SER A N   1 
ATOM   2205 C CA  . SER A 1 292 ? -17.270 -42.417 17.623  1.00 53.01  ? 293 SER A CA  1 
ATOM   2206 C C   . SER A 1 292 ? -16.882 -43.233 18.858  1.00 54.46  ? 293 SER A C   1 
ATOM   2207 O O   . SER A 1 292 ? -17.664 -43.369 19.794  1.00 50.15  ? 293 SER A O   1 
ATOM   2208 C CB  . SER A 1 292 ? -16.363 -41.190 17.496  1.00 49.69  ? 293 SER A CB  1 
ATOM   2209 O OG  . SER A 1 292 ? -16.738 -40.165 18.404  1.00 56.62  ? 293 SER A OG  1 
ATOM   2210 N N   . VAL A 1 293 ? -15.695 -43.831 18.822  1.00 49.56  ? 294 VAL A N   1 
ATOM   2211 C CA  . VAL A 1 293 ? -15.035 -44.251 20.051  1.00 42.72  ? 294 VAL A CA  1 
ATOM   2212 C C   . VAL A 1 293 ? -13.666 -43.595 20.090  1.00 44.82  ? 294 VAL A C   1 
ATOM   2213 O O   . VAL A 1 293 ? -13.130 -43.184 19.045  1.00 44.47  ? 294 VAL A O   1 
ATOM   2214 C CB  . VAL A 1 293 ? -14.940 -45.787 20.239  1.00 48.34  ? 294 VAL A CB  1 
ATOM   2215 C CG1 . VAL A 1 293 ? -16.332 -46.419 20.182  1.00 51.69  ? 294 VAL A CG1 1 
ATOM   2216 C CG2 . VAL A 1 293 ? -13.997 -46.421 19.236  1.00 46.32  ? 294 VAL A CG2 1 
ATOM   2217 N N   . PHE A 1 294 ? -13.133 -43.457 21.299  1.00 47.61  ? 295 PHE A N   1 
ATOM   2218 C CA  . PHE A 1 294 ? -11.818 -42.851 21.533  1.00 41.32  ? 295 PHE A CA  1 
ATOM   2219 C C   . PHE A 1 294 ? -11.761 -41.392 21.054  1.00 42.81  ? 295 PHE A C   1 
ATOM   2220 O O   . PHE A 1 294 ? -10.752 -40.944 20.483  1.00 41.18  ? 295 PHE A O   1 
ATOM   2221 C CB  . PHE A 1 294 ? -10.696 -43.708 20.911  1.00 38.71  ? 295 PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 294 ? -9.443  -43.779 21.752  1.00 43.60  ? 295 PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 294 ? -8.922  -42.630 22.359  1.00 37.32  ? 295 PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 294 ? -8.786  -44.988 21.938  1.00 36.79  ? 295 PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 294 ? -7.758  -42.692 23.136  1.00 35.43  ? 295 PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 294 ? -7.626  -45.058 22.719  1.00 38.32  ? 295 PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 294 ? -7.113  -43.920 23.315  1.00 36.99  ? 295 PHE A CZ  1 
ATOM   2228 N N   . ARG A 1 295 ? -12.854 -40.663 21.283  1.00 40.36  ? 296 ARG A N   1 
ATOM   2229 C CA  . ARG A 1 295 ? -12.908 -39.226 20.993  1.00 38.28  ? 296 ARG A CA  1 
ATOM   2230 C C   . ARG A 1 295 ? -13.590 -38.501 22.150  1.00 43.23  ? 296 ARG A C   1 
ATOM   2231 O O   . ARG A 1 295 ? -14.596 -38.972 22.674  1.00 40.71  ? 296 ARG A O   1 
ATOM   2232 C CB  . ARG A 1 295 ? -13.671 -38.945 19.690  1.00 38.63  ? 296 ARG A CB  1 
ATOM   2233 C CG  . ARG A 1 295 ? -12.930 -39.284 18.400  1.00 42.09  ? 296 ARG A CG  1 
ATOM   2234 C CD  . ARG A 1 295 ? -11.663 -38.445 18.204  1.00 39.11  ? 296 ARG A CD  1 
ATOM   2235 N NE  . ARG A 1 295 ? -10.990 -38.810 16.961  1.00 38.99  ? 296 ARG A NE  1 
ATOM   2236 C CZ  . ARG A 1 295 ? -10.152 -39.839 16.818  1.00 48.96  ? 296 ARG A CZ  1 
ATOM   2237 N NH1 . ARG A 1 295 ? -9.855  -40.623 17.857  1.00 41.72  ? 296 ARG A NH1 1 
ATOM   2238 N NH2 . ARG A 1 295 ? -9.605  -40.083 15.626  1.00 36.25  ? 296 ARG A NH2 1 
ATOM   2239 N N   . PHE A 1 296 ? -13.067 -37.340 22.526  1.00 38.85  ? 297 PHE A N   1 
ATOM   2240 C CA  . PHE A 1 296 ? -13.551 -36.648 23.718  1.00 48.41  ? 297 PHE A CA  1 
ATOM   2241 C C   . PHE A 1 296 ? -13.780 -35.190 23.375  1.00 41.75  ? 297 PHE A C   1 
ATOM   2242 O O   . PHE A 1 296 ? -13.006 -34.599 22.622  1.00 44.28  ? 297 PHE A O   1 
ATOM   2243 C CB  . PHE A 1 296 ? -12.557 -36.825 24.892  1.00 39.18  ? 297 PHE A CB  1 
ATOM   2244 C CG  . PHE A 1 296 ? -11.922 -38.174 24.925  1.00 36.94  ? 297 PHE A CG  1 
ATOM   2245 C CD1 . PHE A 1 296 ? -12.656 -39.292 25.310  1.00 42.85  ? 297 PHE A CD1 1 
ATOM   2246 C CD2 . PHE A 1 296 ? -10.602 -38.345 24.517  1.00 38.70  ? 297 PHE A CD2 1 
ATOM   2247 C CE1 . PHE A 1 296 ? -12.068 -40.575 25.311  1.00 40.14  ? 297 PHE A CE1 1 
ATOM   2248 C CE2 . PHE A 1 296 ? -10.003 -39.612 24.504  1.00 37.12  ? 297 PHE A CE2 1 
ATOM   2249 C CZ  . PHE A 1 296 ? -10.732 -40.730 24.896  1.00 41.64  ? 297 PHE A CZ  1 
ATOM   2250 N N   . SER A 1 297 ? -14.847 -34.612 23.922  1.00 44.88  ? 298 SER A N   1 
ATOM   2251 C CA  . SER A 1 297 ? -15.275 -33.265 23.525  1.00 43.96  ? 298 SER A CA  1 
ATOM   2252 C C   . SER A 1 297 ? -14.298 -32.132 23.809  1.00 44.76  ? 298 SER A C   1 
ATOM   2253 O O   . SER A 1 297 ? -13.977 -31.349 22.909  1.00 43.40  ? 298 SER A O   1 
ATOM   2254 C CB  . SER A 1 297 ? -16.646 -32.926 24.121  1.00 41.72  ? 298 SER A CB  1 
ATOM   2255 O OG  . SER A 1 297 ? -17.634 -33.795 23.590  1.00 50.50  ? 298 SER A OG  1 
ATOM   2256 N N   . PHE A 1 298 ? -13.848 -32.028 25.056  1.00 39.55  ? 299 PHE A N   1 
ATOM   2257 C CA  . PHE A 1 298 ? -13.047 -30.879 25.467  1.00 42.42  ? 299 PHE A CA  1 
ATOM   2258 C C   . PHE A 1 298 ? -11.629 -31.286 25.799  1.00 45.31  ? 299 PHE A C   1 
ATOM   2259 O O   . PHE A 1 298 ? -11.365 -31.867 26.870  1.00 38.55  ? 299 PHE A O   1 
ATOM   2260 C CB  . PHE A 1 298 ? -13.738 -30.111 26.610  1.00 42.66  ? 299 PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 298 ? -15.098 -29.611 26.225  1.00 41.36  ? 299 PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 298 ? -15.226 -28.571 25.303  1.00 41.30  ? 299 PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 298 ? -16.250 -30.217 26.724  1.00 39.96  ? 299 PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 298 ? -16.483 -28.117 24.891  1.00 38.61  ? 299 PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 298 ? -17.515 -29.776 26.323  1.00 43.10  ? 299 PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 298 ? -17.632 -28.726 25.405  1.00 43.19  ? 299 PHE A CZ  1 
ATOM   2267 N N   . VAL A 1 299 ? -10.732 -31.002 24.848  1.00 40.06  ? 300 VAL A N   1 
ATOM   2268 C CA  . VAL A 1 299 ? -9.324  -31.410 24.916  1.00 38.35  ? 300 VAL A CA  1 
ATOM   2269 C C   . VAL A 1 299 ? -8.410  -30.199 24.691  1.00 37.52  ? 300 VAL A C   1 
ATOM   2270 O O   . VAL A 1 299 ? -8.900  -29.115 24.372  1.00 41.51  ? 300 VAL A O   1 
ATOM   2271 C CB  . VAL A 1 299 ? -9.021  -32.562 23.914  1.00 41.46  ? 300 VAL A CB  1 
ATOM   2272 C CG1 . VAL A 1 299 ? -9.920  -33.776 24.211  1.00 38.28  ? 300 VAL A CG1 1 
ATOM   2273 C CG2 . VAL A 1 299 ? -9.199  -32.096 22.475  1.00 37.32  ? 300 VAL A CG2 1 
ATOM   2274 N N   . PRO A 1 300 ? -7.088  -30.356 24.917  1.00 45.16  ? 301 PRO A N   1 
ATOM   2275 C CA  . PRO A 1 300 ? -6.181  -29.235 24.614  1.00 39.83  ? 301 PRO A CA  1 
ATOM   2276 C C   . PRO A 1 300 ? -6.338  -28.649 23.193  1.00 45.12  ? 301 PRO A C   1 
ATOM   2277 O O   . PRO A 1 300 ? -6.521  -29.382 22.226  1.00 40.90  ? 301 PRO A O   1 
ATOM   2278 C CB  . PRO A 1 300 ? -4.797  -29.866 24.773  1.00 42.24  ? 301 PRO A CB  1 
ATOM   2279 C CG  . PRO A 1 300 ? -5.005  -30.890 25.885  1.00 44.51  ? 301 PRO A CG  1 
ATOM   2280 C CD  . PRO A 1 300 ? -6.389  -31.457 25.624  1.00 36.45  ? 301 PRO A CD  1 
ATOM   2281 N N   . VAL A 1 301 ? -6.280  -27.324 23.088  1.00 42.54  ? 302 VAL A N   1 
ATOM   2282 C CA  . VAL A 1 301 ? -6.454  -26.641 21.821  1.00 45.05  ? 302 VAL A CA  1 
ATOM   2283 C C   . VAL A 1 301 ? -5.111  -26.046 21.347  1.00 51.60  ? 302 VAL A C   1 
ATOM   2284 O O   . VAL A 1 301 ? -4.347  -25.500 22.151  1.00 48.06  ? 302 VAL A O   1 
ATOM   2285 C CB  . VAL A 1 301 ? -7.558  -25.550 21.925  1.00 45.52  ? 302 VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 301 ? -7.223  -24.524 23.010  1.00 47.10  ? 302 VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 301 ? -7.787  -24.860 20.566  1.00 47.31  ? 302 VAL A CG2 1 
ATOM   2288 N N   . VAL A 1 302 ? -4.817  -26.189 20.054  1.00 48.68  ? 303 VAL A N   1 
ATOM   2289 C CA  . VAL A 1 302 ? -3.610  -25.602 19.453  1.00 47.09  ? 303 VAL A CA  1 
ATOM   2290 C C   . VAL A 1 302 ? -3.913  -24.181 19.020  1.00 44.10  ? 303 VAL A C   1 
ATOM   2291 O O   . VAL A 1 302 ? -4.613  -23.972 18.038  1.00 49.53  ? 303 VAL A O   1 
ATOM   2292 C CB  . VAL A 1 302 ? -3.171  -26.364 18.167  1.00 53.62  ? 303 VAL A CB  1 
ATOM   2293 C CG1 . VAL A 1 302 ? -1.825  -25.841 17.670  1.00 52.56  ? 303 VAL A CG1 1 
ATOM   2294 C CG2 . VAL A 1 302 ? -3.100  -27.860 18.406  1.00 50.54  ? 303 VAL A CG2 1 
ATOM   2295 N N   . ASP A 1 303 ? -3.398  -23.192 19.730  1.00 54.59  ? 304 ASP A N   1 
ATOM   2296 C CA  . ASP A 1 303 ? -3.780  -21.824 19.404  1.00 57.78  ? 304 ASP A CA  1 
ATOM   2297 C C   . ASP A 1 303 ? -2.624  -20.835 19.465  1.00 54.27  ? 304 ASP A C   1 
ATOM   2298 O O   . ASP A 1 303 ? -2.846  -19.632 19.544  1.00 59.25  ? 304 ASP A O   1 
ATOM   2299 C CB  . ASP A 1 303 ? -4.922  -21.368 20.317  1.00 51.87  ? 304 ASP A CB  1 
ATOM   2300 C CG  . ASP A 1 303 ? -4.473  -21.137 21.766  1.00 61.19  ? 304 ASP A CG  1 
ATOM   2301 O OD1 . ASP A 1 303 ? -3.373  -21.588 22.170  1.00 56.81  ? 304 ASP A OD1 1 
ATOM   2302 O OD2 . ASP A 1 303 ? -5.241  -20.492 22.509  1.00 60.71  ? 304 ASP A OD2 1 
ATOM   2303 N N   . GLY A 1 304 ? -1.395  -21.344 19.471  1.00 56.17  ? 305 GLY A N   1 
ATOM   2304 C CA  . GLY A 1 304 ? -0.229  -20.482 19.471  1.00 49.80  ? 305 GLY A CA  1 
ATOM   2305 C C   . GLY A 1 304 ? 0.388   -20.202 20.824  1.00 56.87  ? 305 GLY A C   1 
ATOM   2306 O O   . GLY A 1 304 ? 1.559   -19.818 20.895  1.00 59.22  ? 305 GLY A O   1 
ATOM   2307 N N   . ASP A 1 305 ? -0.379  -20.413 21.895  1.00 55.72  ? 306 ASP A N   1 
ATOM   2308 C CA  . ASP A 1 305 ? 0.047   -20.053 23.255  1.00 49.59  ? 306 ASP A CA  1 
ATOM   2309 C C   . ASP A 1 305 ? 0.740   -21.241 23.967  1.00 57.22  ? 306 ASP A C   1 
ATOM   2310 O O   . ASP A 1 305 ? 1.952   -21.401 23.829  1.00 50.91  ? 306 ASP A O   1 
ATOM   2311 C CB  . ASP A 1 305 ? -1.150  -19.475 24.039  1.00 47.35  ? 306 ASP A CB  1 
ATOM   2312 C CG  . ASP A 1 305 ? -0.753  -18.837 25.368  1.00 63.52  ? 306 ASP A CG  1 
ATOM   2313 O OD1 . ASP A 1 305 ? 0.459   -18.695 25.650  1.00 61.30  ? 306 ASP A OD1 1 
ATOM   2314 O OD2 . ASP A 1 305 ? -1.673  -18.454 26.128  1.00 66.21  ? 306 ASP A OD2 1 
ATOM   2315 N N   . PHE A 1 306 ? -0.002  -22.078 24.701  1.00 54.18  ? 307 PHE A N   1 
ATOM   2316 C CA  . PHE A 1 306 ? 0.600   -23.268 25.332  1.00 49.67  ? 307 PHE A CA  1 
ATOM   2317 C C   . PHE A 1 306 ? 1.345   -24.130 24.298  1.00 52.92  ? 307 PHE A C   1 
ATOM   2318 O O   . PHE A 1 306 ? 2.482   -24.560 24.532  1.00 52.27  ? 307 PHE A O   1 
ATOM   2319 C CB  . PHE A 1 306 ? -0.459  -24.113 26.065  1.00 48.31  ? 307 PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 306 ? 0.115   -25.089 27.078  1.00 44.99  ? 307 PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 306 ? 0.767   -26.251 26.664  1.00 44.99  ? 307 PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 306 ? -0.020  -24.854 28.441  1.00 40.92  ? 307 PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 306 ? 1.296   -27.150 27.599  1.00 41.29  ? 307 PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 306 ? 0.491   -25.750 29.392  1.00 41.24  ? 307 PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 306 ? 1.161   -26.896 28.972  1.00 41.41  ? 307 PHE A CZ  1 
ATOM   2326 N N   . LEU A 1 307 ? 0.692   -24.384 23.164  1.00 50.83  ? 308 LEU A N   1 
ATOM   2327 C CA  . LEU A 1 307 ? 1.324   -25.054 22.038  1.00 52.61  ? 308 LEU A CA  1 
ATOM   2328 C C   . LEU A 1 307 ? 1.399   -24.078 20.860  1.00 51.76  ? 308 LEU A C   1 
ATOM   2329 O O   . LEU A 1 307 ? 0.374   -23.676 20.314  1.00 52.23  ? 308 LEU A O   1 
ATOM   2330 C CB  . LEU A 1 307 ? 0.523   -26.291 21.633  1.00 52.19  ? 308 LEU A CB  1 
ATOM   2331 C CG  . LEU A 1 307 ? 0.229   -27.283 22.762  1.00 57.17  ? 308 LEU A CG  1 
ATOM   2332 C CD1 . LEU A 1 307 ? -0.924  -28.206 22.378  1.00 49.75  ? 308 LEU A CD1 1 
ATOM   2333 C CD2 . LEU A 1 307 ? 1.482   -28.092 23.133  1.00 42.15  ? 308 LEU A CD2 1 
ATOM   2334 N N   . SER A 1 308 ? 2.613   -23.686 20.490  1.00 48.06  ? 309 SER A N   1 
ATOM   2335 C CA  . SER A 1 308 ? 2.818   -22.754 19.383  1.00 61.22  ? 309 SER A CA  1 
ATOM   2336 C C   . SER A 1 308 ? 2.548   -23.399 18.008  1.00 55.84  ? 309 SER A C   1 
ATOM   2337 O O   . SER A 1 308 ? 2.247   -22.705 17.050  1.00 69.82  ? 309 SER A O   1 
ATOM   2338 C CB  . SER A 1 308 ? 4.215   -22.132 19.454  1.00 59.74  ? 309 SER A CB  1 
ATOM   2339 O OG  . SER A 1 308 ? 5.220   -23.108 19.261  1.00 63.79  ? 309 SER A OG  1 
ATOM   2340 N N   . ASP A 1 309 ? 2.630   -24.724 17.920  1.00 58.73  ? 310 ASP A N   1 
ATOM   2341 C CA  . ASP A 1 309 ? 2.187   -25.437 16.719  1.00 55.13  ? 310 ASP A CA  1 
ATOM   2342 C C   . ASP A 1 309 ? 1.517   -26.745 17.136  1.00 58.40  ? 310 ASP A C   1 
ATOM   2343 O O   . ASP A 1 309 ? 1.383   -27.027 18.320  1.00 54.70  ? 310 ASP A O   1 
ATOM   2344 C CB  . ASP A 1 309 ? 3.372   -25.728 15.805  1.00 57.42  ? 310 ASP A CB  1 
ATOM   2345 C CG  . ASP A 1 309 ? 2.993   -25.747 14.324  1.00 66.32  ? 310 ASP A CG  1 
ATOM   2346 O OD1 . ASP A 1 309 ? 1.937   -26.308 13.962  1.00 65.56  ? 310 ASP A OD1 1 
ATOM   2347 O OD2 . ASP A 1 309 ? 3.766   -25.191 13.520  1.00 67.77  ? 310 ASP A OD2 1 
ATOM   2348 N N   . THR A 1 310 ? 1.075   -27.537 16.171  1.00 49.59  ? 311 THR A N   1 
ATOM   2349 C CA  . THR A 1 310 ? 0.599   -28.879 16.478  1.00 51.27  ? 311 THR A CA  1 
ATOM   2350 C C   . THR A 1 310 ? 1.737   -29.697 17.121  1.00 52.94  ? 311 THR A C   1 
ATOM   2351 O O   . THR A 1 310 ? 2.906   -29.454 16.847  1.00 55.62  ? 311 THR A O   1 
ATOM   2352 C CB  . THR A 1 310 ? 0.101   -29.594 15.208  1.00 55.64  ? 311 THR A CB  1 
ATOM   2353 O OG1 . THR A 1 310 ? 1.228   -30.046 14.449  1.00 59.79  ? 311 THR A OG1 1 
ATOM   2354 C CG2 . THR A 1 310 ? -0.746  -28.648 14.361  1.00 50.12  ? 311 THR A CG2 1 
ATOM   2355 N N   . PRO A 1 311 ? 1.398   -30.648 18.008  1.00 58.53  ? 312 PRO A N   1 
ATOM   2356 C CA  . PRO A 1 311 ? 2.463   -31.450 18.623  1.00 54.46  ? 312 PRO A CA  1 
ATOM   2357 C C   . PRO A 1 311 ? 3.274   -32.223 17.575  1.00 55.21  ? 312 PRO A C   1 
ATOM   2358 O O   . PRO A 1 311 ? 4.488   -32.389 17.729  1.00 54.37  ? 312 PRO A O   1 
ATOM   2359 C CB  . PRO A 1 311 ? 1.693   -32.404 19.548  1.00 50.76  ? 312 PRO A CB  1 
ATOM   2360 C CG  . PRO A 1 311 ? 0.430   -31.625 19.903  1.00 46.78  ? 312 PRO A CG  1 
ATOM   2361 C CD  . PRO A 1 311 ? 0.081   -30.884 18.638  1.00 48.72  ? 312 PRO A CD  1 
ATOM   2362 N N   A GLU A 1 312 ? 2.598   -32.698 16.536  0.45 56.65  ? 313 GLU A N   1 
ATOM   2363 N N   B GLU A 1 312 ? 2.610   -32.696 16.525  0.55 56.66  ? 313 GLU A N   1 
ATOM   2364 C CA  A GLU A 1 312 ? 3.270   -33.347 15.417  0.45 60.14  ? 313 GLU A CA  1 
ATOM   2365 C CA  B GLU A 1 312 ? 3.312   -33.351 15.423  0.55 60.15  ? 313 GLU A CA  1 
ATOM   2366 C C   A GLU A 1 312 ? 4.404   -32.472 14.864  0.45 58.46  ? 313 GLU A C   1 
ATOM   2367 C C   B GLU A 1 312 ? 4.434   -32.454 14.900  0.55 58.45  ? 313 GLU A C   1 
ATOM   2368 O O   A GLU A 1 312 ? 5.543   -32.921 14.741  0.45 57.56  ? 313 GLU A O   1 
ATOM   2369 O O   B GLU A 1 312 ? 5.591   -32.870 14.823  0.55 57.50  ? 313 GLU A O   1 
ATOM   2370 C CB  A GLU A 1 312 ? 2.261   -33.704 14.318  0.45 59.94  ? 313 GLU A CB  1 
ATOM   2371 C CB  B GLU A 1 312 ? 2.348   -33.697 14.285  0.55 59.93  ? 313 GLU A CB  1 
ATOM   2372 C CG  A GLU A 1 312 ? 1.433   -34.964 14.610  0.45 60.69  ? 313 GLU A CG  1 
ATOM   2373 C CG  B GLU A 1 312 ? 2.877   -34.769 13.344  0.55 61.20  ? 313 GLU A CG  1 
ATOM   2374 C CD  A GLU A 1 312 ? 0.077   -34.682 15.268  0.45 59.50  ? 313 GLU A CD  1 
ATOM   2375 C CD  B GLU A 1 312 ? 2.513   -34.509 11.896  0.55 66.74  ? 313 GLU A CD  1 
ATOM   2376 O OE1 A GLU A 1 312 ? -0.878  -35.430 14.962  0.45 60.04  ? 313 GLU A OE1 1 
ATOM   2377 O OE1 B GLU A 1 312 ? 1.461   -33.877 11.643  0.55 62.19  ? 313 GLU A OE1 1 
ATOM   2378 O OE2 A GLU A 1 312 ? -0.042  -33.733 16.087  0.45 51.07  ? 313 GLU A OE2 1 
ATOM   2379 O OE2 B GLU A 1 312 ? 3.289   -34.934 11.012  0.55 68.71  ? 313 GLU A OE2 1 
ATOM   2380 N N   . ALA A 1 313 ? 4.092   -31.216 14.561  1.00 55.73  ? 314 ALA A N   1 
ATOM   2381 C CA  . ALA A 1 313 ? 5.093   -30.281 14.051  1.00 55.21  ? 314 ALA A CA  1 
ATOM   2382 C C   . ALA A 1 313 ? 6.206   -30.037 15.059  1.00 62.35  ? 314 ALA A C   1 
ATOM   2383 O O   . ALA A 1 313 ? 7.386   -30.069 14.704  1.00 59.94  ? 314 ALA A O   1 
ATOM   2384 C CB  . ALA A 1 313 ? 4.448   -28.964 13.638  1.00 57.19  ? 314 ALA A CB  1 
ATOM   2385 N N   . LEU A 1 314 ? 5.826   -29.793 16.317  1.00 59.10  ? 315 LEU A N   1 
ATOM   2386 C CA  . LEU A 1 314 ? 6.798   -29.487 17.365  1.00 50.54  ? 315 LEU A CA  1 
ATOM   2387 C C   . LEU A 1 314 ? 7.769   -30.637 17.589  1.00 53.48  ? 315 LEU A C   1 
ATOM   2388 O O   . LEU A 1 314 ? 8.935   -30.430 17.929  1.00 53.15  ? 315 LEU A O   1 
ATOM   2389 C CB  . LEU A 1 314 ? 6.084   -29.154 18.673  1.00 57.87  ? 315 LEU A CB  1 
ATOM   2390 C CG  . LEU A 1 314 ? 5.359   -27.814 18.679  1.00 63.72  ? 315 LEU A CG  1 
ATOM   2391 C CD1 . LEU A 1 314 ? 4.636   -27.592 20.011  1.00 52.24  ? 315 LEU A CD1 1 
ATOM   2392 C CD2 . LEU A 1 314 ? 6.355   -26.701 18.384  1.00 60.12  ? 315 LEU A CD2 1 
ATOM   2393 N N   . ILE A 1 315 ? 7.265   -31.853 17.420  1.00 54.11  ? 316 ILE A N   1 
ATOM   2394 C CA  . ILE A 1 315 ? 8.083   -33.046 17.549  1.00 55.00  ? 316 ILE A CA  1 
ATOM   2395 C C   . ILE A 1 315 ? 9.055   -33.165 16.373  1.00 62.92  ? 316 ILE A C   1 
ATOM   2396 O O   . ILE A 1 315 ? 10.251  -33.300 16.589  1.00 62.43  ? 316 ILE A O   1 
ATOM   2397 C CB  . ILE A 1 315 ? 7.208   -34.306 17.705  1.00 54.57  ? 316 ILE A CB  1 
ATOM   2398 C CG1 . ILE A 1 315 ? 6.637   -34.369 19.125  1.00 51.59  ? 316 ILE A CG1 1 
ATOM   2399 C CG2 . ILE A 1 315 ? 8.011   -35.567 17.473  1.00 54.10  ? 316 ILE A CG2 1 
ATOM   2400 C CD1 . ILE A 1 315 ? 5.455   -35.286 19.235  1.00 50.08  ? 316 ILE A CD1 1 
ATOM   2401 N N   . ASN A 1 316 ? 8.545   -33.098 15.140  1.00 61.36  ? 317 ASN A N   1 
ATOM   2402 C CA  . ASN A 1 316 ? 9.408   -33.132 13.948  1.00 68.89  ? 317 ASN A CA  1 
ATOM   2403 C C   . ASN A 1 316 ? 10.523  -32.080 13.928  1.00 61.41  ? 317 ASN A C   1 
ATOM   2404 O O   . ASN A 1 316 ? 11.581  -32.324 13.367  1.00 78.16  ? 317 ASN A O   1 
ATOM   2405 C CB  . ASN A 1 316 ? 8.584   -33.025 12.665  1.00 53.90  ? 317 ASN A CB  1 
ATOM   2406 C CG  . ASN A 1 316 ? 7.538   -34.095 12.566  1.00 65.49  ? 317 ASN A CG  1 
ATOM   2407 O OD1 . ASN A 1 316 ? 7.674   -35.165 13.163  1.00 77.83  ? 317 ASN A OD1 1 
ATOM   2408 N ND2 . ASN A 1 316 ? 6.467   -33.815 11.827  1.00 73.90  ? 317 ASN A ND2 1 
ATOM   2409 N N   . ALA A 1 317 ? 10.297  -30.938 14.575  1.00 68.91  ? 318 ALA A N   1 
ATOM   2410 C CA  . ALA A 1 317 ? 11.221  -29.806 14.499  1.00 65.39  ? 318 ALA A CA  1 
ATOM   2411 C C   . ALA A 1 317 ? 12.059  -29.535 15.745  1.00 70.94  ? 318 ALA A C   1 
ATOM   2412 O O   . ALA A 1 317 ? 12.789  -28.542 15.790  1.00 81.89  ? 318 ALA A O   1 
ATOM   2413 C CB  . ALA A 1 317 ? 10.455  -28.545 14.122  1.00 73.24  ? 318 ALA A CB  1 
ATOM   2414 N N   . GLY A 1 318 ? 11.965  -30.391 16.757  1.00 68.32  ? 319 GLY A N   1 
ATOM   2415 C CA  . GLY A 1 318 ? 12.589  -30.091 18.038  1.00 60.45  ? 319 GLY A CA  1 
ATOM   2416 C C   . GLY A 1 318 ? 13.955  -30.728 18.248  1.00 58.55  ? 319 GLY A C   1 
ATOM   2417 O O   . GLY A 1 318 ? 14.253  -31.776 17.671  1.00 56.43  ? 319 GLY A O   1 
ATOM   2418 N N   . ASP A 1 319 ? 14.785  -30.089 19.073  1.00 56.49  ? 320 ASP A N   1 
ATOM   2419 C CA  . ASP A 1 319 ? 16.070  -30.648 19.470  1.00 59.69  ? 320 ASP A CA  1 
ATOM   2420 C C   . ASP A 1 319 ? 15.885  -31.303 20.823  1.00 63.61  ? 320 ASP A C   1 
ATOM   2421 O O   . ASP A 1 319 ? 15.457  -30.645 21.766  1.00 62.92  ? 320 ASP A O   1 
ATOM   2422 C CB  . ASP A 1 319 ? 17.127  -29.547 19.593  1.00 61.10  ? 320 ASP A CB  1 
ATOM   2423 C CG  . ASP A 1 319 ? 18.486  -30.082 20.042  1.00 65.70  ? 320 ASP A CG  1 
ATOM   2424 O OD1 . ASP A 1 319 ? 19.380  -30.199 19.193  1.00 89.28  ? 320 ASP A OD1 1 
ATOM   2425 O OD2 . ASP A 1 319 ? 18.674  -30.391 21.234  1.00 78.08  ? 320 ASP A OD2 1 
ATOM   2426 N N   . PHE A 1 320 ? 16.220  -32.585 20.937  1.00 68.49  ? 321 PHE A N   1 
ATOM   2427 C CA  . PHE A 1 320 ? 15.948  -33.315 22.179  1.00 58.14  ? 321 PHE A CA  1 
ATOM   2428 C C   . PHE A 1 320 ? 17.180  -33.958 22.799  1.00 62.73  ? 321 PHE A C   1 
ATOM   2429 O O   . PHE A 1 320 ? 17.058  -34.933 23.550  1.00 54.57  ? 321 PHE A O   1 
ATOM   2430 C CB  . PHE A 1 320 ? 14.854  -34.367 21.950  1.00 56.22  ? 321 PHE A CB  1 
ATOM   2431 C CG  . PHE A 1 320 ? 13.510  -33.778 21.596  1.00 56.72  ? 321 PHE A CG  1 
ATOM   2432 C CD1 . PHE A 1 320 ? 12.720  -33.195 22.572  1.00 51.85  ? 321 PHE A CD1 1 
ATOM   2433 C CD2 . PHE A 1 320 ? 13.048  -33.796 20.289  1.00 53.75  ? 321 PHE A CD2 1 
ATOM   2434 C CE1 . PHE A 1 320 ? 11.485  -32.648 22.253  1.00 52.91  ? 321 PHE A CE1 1 
ATOM   2435 C CE2 . PHE A 1 320 ? 11.812  -33.247 19.959  1.00 56.22  ? 321 PHE A CE2 1 
ATOM   2436 C CZ  . PHE A 1 320 ? 11.027  -32.677 20.947  1.00 52.23  ? 321 PHE A CZ  1 
ATOM   2437 N N   . HIS A 1 321 ? 18.362  -33.424 22.477  1.00 62.93  ? 322 HIS A N   1 
ATOM   2438 C CA  . HIS A 1 321 ? 19.600  -33.822 23.159  1.00 59.75  ? 322 HIS A CA  1 
ATOM   2439 C C   . HIS A 1 321 ? 19.521  -33.518 24.653  1.00 57.33  ? 322 HIS A C   1 
ATOM   2440 O O   . HIS A 1 321 ? 19.115  -32.423 25.044  1.00 57.01  ? 322 HIS A O   1 
ATOM   2441 C CB  . HIS A 1 321 ? 20.822  -33.127 22.539  1.00 61.61  ? 322 HIS A CB  1 
ATOM   2442 C CG  . HIS A 1 321 ? 21.308  -33.784 21.285  1.00 53.05  ? 322 HIS A CG  1 
ATOM   2443 N ND1 . HIS A 1 321 ? 20.869  -33.413 20.033  1.00 56.42  ? 322 HIS A ND1 1 
ATOM   2444 C CD2 . HIS A 1 321 ? 22.153  -34.826 21.095  1.00 53.27  ? 322 HIS A CD2 1 
ATOM   2445 C CE1 . HIS A 1 321 ? 21.440  -34.182 19.122  1.00 55.79  ? 322 HIS A CE1 1 
ATOM   2446 N NE2 . HIS A 1 321 ? 22.223  -35.049 19.741  1.00 62.53  ? 322 HIS A NE2 1 
ATOM   2447 N N   . GLY A 1 322 ? 19.895  -34.496 25.478  1.00 56.80  ? 323 GLY A N   1 
ATOM   2448 C CA  . GLY A 1 322 ? 19.839  -34.354 26.927  1.00 58.70  ? 323 GLY A CA  1 
ATOM   2449 C C   . GLY A 1 322 ? 18.556  -34.867 27.574  1.00 56.06  ? 323 GLY A C   1 
ATOM   2450 O O   . GLY A 1 322 ? 18.418  -34.853 28.791  1.00 61.06  ? 323 GLY A O   1 
ATOM   2451 N N   . LEU A 1 323 ? 17.608  -35.318 26.763  1.00 55.99  ? 324 LEU A N   1 
ATOM   2452 C CA  . LEU A 1 323 ? 16.356  -35.843 27.291  1.00 55.64  ? 324 LEU A CA  1 
ATOM   2453 C C   . LEU A 1 323 ? 16.418  -37.363 27.357  1.00 48.79  ? 324 LEU A C   1 
ATOM   2454 O O   . LEU A 1 323 ? 16.924  -38.035 26.430  1.00 49.42  ? 324 LEU A O   1 
ATOM   2455 C CB  . LEU A 1 323 ? 15.170  -35.382 26.421  1.00 60.07  ? 324 LEU A CB  1 
ATOM   2456 C CG  . LEU A 1 323 ? 13.746  -35.913 26.667  1.00 45.44  ? 324 LEU A CG  1 
ATOM   2457 C CD1 . LEU A 1 323 ? 13.226  -35.548 28.045  1.00 44.60  ? 324 LEU A CD1 1 
ATOM   2458 C CD2 . LEU A 1 323 ? 12.781  -35.433 25.594  1.00 46.19  ? 324 LEU A CD2 1 
ATOM   2459 N N   . GLN A 1 324 ? 15.932  -37.911 28.464  1.00 41.38  ? 325 GLN A N   1 
ATOM   2460 C CA  . GLN A 1 324 ? 15.658  -39.349 28.516  1.00 49.00  ? 325 GLN A CA  1 
ATOM   2461 C C   . GLN A 1 324 ? 14.170  -39.594 28.733  1.00 49.72  ? 325 GLN A C   1 
ATOM   2462 O O   . GLN A 1 324 ? 13.534  -38.924 29.548  1.00 44.75  ? 325 GLN A O   1 
ATOM   2463 C CB  . GLN A 1 324 ? 16.483  -40.063 29.581  1.00 54.01  ? 325 GLN A CB  1 
ATOM   2464 C CG  . GLN A 1 324 ? 17.971  -39.943 29.375  1.00 61.92  ? 325 GLN A CG  1 
ATOM   2465 C CD  . GLN A 1 324 ? 18.524  -38.748 30.098  1.00 62.16  ? 325 GLN A CD  1 
ATOM   2466 O OE1 . GLN A 1 324 ? 18.200  -38.521 31.257  1.00 54.23  ? 325 GLN A OE1 1 
ATOM   2467 N NE2 . GLN A 1 324 ? 19.348  -37.962 29.412  1.00 63.92  ? 325 GLN A NE2 1 
ATOM   2468 N N   . VAL A 1 325 ? 13.629  -40.555 27.991  1.00 43.23  ? 326 VAL A N   1 
ATOM   2469 C CA  . VAL A 1 325 ? 12.199  -40.807 27.970  1.00 43.92  ? 326 VAL A CA  1 
ATOM   2470 C C   . VAL A 1 325 ? 11.964  -42.300 28.032  1.00 47.34  ? 326 VAL A C   1 
ATOM   2471 O O   . VAL A 1 325 ? 12.711  -43.078 27.422  1.00 50.50  ? 326 VAL A O   1 
ATOM   2472 C CB  . VAL A 1 325 ? 11.551  -40.315 26.645  1.00 52.83  ? 326 VAL A CB  1 
ATOM   2473 C CG1 . VAL A 1 325 ? 10.092  -40.033 26.857  1.00 44.72  ? 326 VAL A CG1 1 
ATOM   2474 C CG2 . VAL A 1 325 ? 12.232  -39.073 26.143  1.00 63.24  ? 326 VAL A CG2 1 
ATOM   2475 N N   . LEU A 1 326 ? 10.914  -42.693 28.744  1.00 44.20  ? 327 LEU A N   1 
ATOM   2476 C CA  . LEU A 1 326 ? 10.478  -44.088 28.819  1.00 44.16  ? 327 LEU A CA  1 
ATOM   2477 C C   . LEU A 1 326 ? 9.049   -44.138 28.280  1.00 44.79  ? 327 LEU A C   1 
ATOM   2478 O O   . LEU A 1 326 ? 8.171   -43.449 28.799  1.00 44.48  ? 327 LEU A O   1 
ATOM   2479 C CB  . LEU A 1 326 ? 10.521  -44.564 30.274  1.00 41.08  ? 327 LEU A CB  1 
ATOM   2480 C CG  . LEU A 1 326 ? 9.971   -45.958 30.597  1.00 47.17  ? 327 LEU A CG  1 
ATOM   2481 C CD1 . LEU A 1 326 ? 10.818  -47.039 29.978  1.00 44.96  ? 327 LEU A CD1 1 
ATOM   2482 C CD2 . LEU A 1 326 ? 9.870   -46.163 32.114  1.00 51.01  ? 327 LEU A CD2 1 
ATOM   2483 N N   . VAL A 1 327 ? 8.818   -44.905 27.216  1.00 47.37  ? 328 VAL A N   1 
ATOM   2484 C CA  . VAL A 1 327 ? 7.494   -44.955 26.589  1.00 41.07  ? 328 VAL A CA  1 
ATOM   2485 C C   . VAL A 1 327 ? 7.076   -46.395 26.379  1.00 43.76  ? 328 VAL A C   1 
ATOM   2486 O O   . VAL A 1 327 ? 7.916   -47.293 26.316  1.00 42.68  ? 328 VAL A O   1 
ATOM   2487 C CB  . VAL A 1 327 ? 7.439   -44.217 25.199  1.00 45.00  ? 328 VAL A CB  1 
ATOM   2488 C CG1 . VAL A 1 327 ? 7.942   -42.802 25.324  1.00 39.15  ? 328 VAL A CG1 1 
ATOM   2489 C CG2 . VAL A 1 327 ? 8.221   -44.987 24.145  1.00 35.01  ? 328 VAL A CG2 1 
ATOM   2490 N N   . GLY A 1 328 ? 5.775   -46.629 26.281  1.00 35.29  ? 329 GLY A N   1 
ATOM   2491 C CA  . GLY A 1 328 ? 5.313   -47.968 25.983  1.00 37.91  ? 329 GLY A CA  1 
ATOM   2492 C C   . GLY A 1 328 ? 3.813   -48.083 25.857  1.00 40.18  ? 329 GLY A C   1 
ATOM   2493 O O   . GLY A 1 328 ? 3.081   -47.084 25.988  1.00 36.35  ? 329 GLY A O   1 
ATOM   2494 N N   . VAL A 1 329 ? 3.360   -49.313 25.614  1.00 37.50  ? 330 VAL A N   1 
ATOM   2495 C CA  . VAL A 1 329 ? 1.953   -49.603 25.361  1.00 36.04  ? 330 VAL A CA  1 
ATOM   2496 C C   . VAL A 1 329 ? 1.578   -50.919 26.020  1.00 39.72  ? 330 VAL A C   1 
ATOM   2497 O O   . VAL A 1 329 ? 2.462   -51.717 26.346  1.00 39.57  ? 330 VAL A O   1 
ATOM   2498 C CB  . VAL A 1 329 ? 1.704   -49.737 23.827  1.00 45.05  ? 330 VAL A CB  1 
ATOM   2499 C CG1 . VAL A 1 329 ? 2.002   -48.419 23.114  1.00 39.28  ? 330 VAL A CG1 1 
ATOM   2500 C CG2 . VAL A 1 329 ? 2.571   -50.849 23.237  1.00 36.86  ? 330 VAL A CG2 1 
ATOM   2501 N N   . VAL A 1 330 ? 0.278   -51.164 26.213  1.00 40.03  ? 331 VAL A N   1 
ATOM   2502 C CA  . VAL A 1 330 ? -0.176  -52.515 26.575  1.00 40.45  ? 331 VAL A CA  1 
ATOM   2503 C C   . VAL A 1 330 ? -0.440  -53.361 25.316  1.00 44.01  ? 331 VAL A C   1 
ATOM   2504 O O   . VAL A 1 330 ? -0.431  -52.845 24.210  1.00 42.30  ? 331 VAL A O   1 
ATOM   2505 C CB  . VAL A 1 330 ? -1.427  -52.503 27.460  1.00 40.23  ? 331 VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 330 ? -1.128  -51.776 28.813  1.00 35.95  ? 331 VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 330 ? -2.589  -51.869 26.719  1.00 42.15  ? 331 VAL A CG2 1 
ATOM   2508 N N   . LYS A 1 331 ? -0.681  -54.654 25.509  1.00 48.60  ? 332 LYS A N   1 
ATOM   2509 C CA  . LYS A 1 331 ? -0.780  -55.609 24.414  1.00 51.56  ? 332 LYS A CA  1 
ATOM   2510 C C   . LYS A 1 331 ? -2.034  -55.397 23.581  1.00 47.74  ? 332 LYS A C   1 
ATOM   2511 O O   . LYS A 1 331 ? -2.014  -55.615 22.389  1.00 47.67  ? 332 LYS A O   1 
ATOM   2512 C CB  . LYS A 1 331 ? -0.726  -57.052 24.948  1.00 48.45  ? 332 LYS A CB  1 
ATOM   2513 C CG  . LYS A 1 331 ? -0.498  -58.132 23.877  1.00 52.22  ? 332 LYS A CG  1 
ATOM   2514 C CD  . LYS A 1 331 ? -0.427  -59.508 24.541  1.00 63.96  ? 332 LYS A CD  1 
ATOM   2515 C CE  . LYS A 1 331 ? -0.035  -60.608 23.565  1.00 67.20  ? 332 LYS A CE  1 
ATOM   2516 N NZ  . LYS A 1 331 ? -1.130  -60.980 22.603  1.00 58.06  ? 332 LYS A NZ  1 
ATOM   2517 N N   . ASP A 1 332 ? -3.120  -54.951 24.197  1.00 42.89  ? 333 ASP A N   1 
ATOM   2518 C CA  . ASP A 1 332 ? -4.350  -54.732 23.444  1.00 43.54  ? 333 ASP A CA  1 
ATOM   2519 C C   . ASP A 1 332 ? -4.961  -53.357 23.674  1.00 45.71  ? 333 ASP A C   1 
ATOM   2520 O O   . ASP A 1 332 ? -5.996  -53.235 24.332  1.00 45.13  ? 333 ASP A O   1 
ATOM   2521 C CB  . ASP A 1 332 ? -5.371  -55.831 23.754  1.00 43.37  ? 333 ASP A CB  1 
ATOM   2522 C CG  . ASP A 1 332 ? -4.806  -57.221 23.514  1.00 48.05  ? 333 ASP A CG  1 
ATOM   2523 O OD1 . ASP A 1 332 ? -4.863  -57.697 22.359  1.00 56.33  ? 333 ASP A OD1 1 
ATOM   2524 O OD2 . ASP A 1 332 ? -4.267  -57.813 24.476  1.00 45.08  ? 333 ASP A OD2 1 
ATOM   2525 N N   . GLU A 1 333 ? -4.336  -52.338 23.088  1.00 40.23  ? 334 GLU A N   1 
ATOM   2526 C CA  . GLU A 1 333 ? -4.756  -50.953 23.268  1.00 48.71  ? 334 GLU A CA  1 
ATOM   2527 C C   . GLU A 1 333 ? -6.180  -50.659 22.831  1.00 48.56  ? 334 GLU A C   1 
ATOM   2528 O O   . GLU A 1 333 ? -6.844  -49.825 23.438  1.00 47.88  ? 334 GLU A O   1 
ATOM   2529 C CB  . GLU A 1 333 ? -3.779  -49.988 22.582  1.00 38.62  ? 334 GLU A CB  1 
ATOM   2530 C CG  . GLU A 1 333 ? -2.393  -49.920 23.253  1.00 45.86  ? 334 GLU A CG  1 
ATOM   2531 C CD  . GLU A 1 333 ? -2.403  -49.164 24.599  1.00 48.35  ? 334 GLU A CD  1 
ATOM   2532 O OE1 . GLU A 1 333 ? -3.470  -48.635 24.991  1.00 48.36  ? 334 GLU A OE1 1 
ATOM   2533 O OE2 . GLU A 1 333 ? -1.335  -49.084 25.258  1.00 43.03  ? 334 GLU A OE2 1 
ATOM   2534 N N   . GLY A 1 334 ? -6.665  -51.332 21.792  1.00 46.13  ? 335 GLY A N   1 
ATOM   2535 C CA  . GLY A 1 334 ? -7.978  -50.987 21.271  1.00 43.65  ? 335 GLY A CA  1 
ATOM   2536 C C   . GLY A 1 334 ? -9.191  -51.619 21.944  1.00 47.57  ? 335 GLY A C   1 
ATOM   2537 O O   . GLY A 1 334 ? -10.307 -51.089 21.853  1.00 42.03  ? 335 GLY A O   1 
ATOM   2538 N N   . SER A 1 335 ? -8.985  -52.748 22.617  1.00 42.33  ? 336 SER A N   1 
ATOM   2539 C CA  . SER A 1 335 ? -10.102 -53.624 23.005  1.00 46.61  ? 336 SER A CA  1 
ATOM   2540 C C   . SER A 1 335 ? -11.164 -52.965 23.922  1.00 53.04  ? 336 SER A C   1 
ATOM   2541 O O   . SER A 1 335 ? -12.364 -53.084 23.683  1.00 48.61  ? 336 SER A O   1 
ATOM   2542 C CB  . SER A 1 335 ? -9.561  -54.916 23.621  1.00 47.61  ? 336 SER A CB  1 
ATOM   2543 O OG  . SER A 1 335 ? -8.976  -54.660 24.895  1.00 48.57  ? 336 SER A OG  1 
ATOM   2544 N N   . TYR A 1 336 ? -10.714 -52.255 24.949  1.00 45.00  ? 337 TYR A N   1 
ATOM   2545 C CA  . TYR A 1 336 ? -11.598 -51.546 25.886  1.00 48.38  ? 337 TYR A CA  1 
ATOM   2546 C C   . TYR A 1 336 ? -12.593 -50.609 25.197  1.00 48.39  ? 337 TYR A C   1 
ATOM   2547 O O   . TYR A 1 336 ? -13.755 -50.526 25.577  1.00 47.22  ? 337 TYR A O   1 
ATOM   2548 C CB  . TYR A 1 336 ? -10.723 -50.751 26.869  1.00 52.31  ? 337 TYR A CB  1 
ATOM   2549 C CG  . TYR A 1 336 ? -11.427 -49.867 27.871  1.00 48.17  ? 337 TYR A CG  1 
ATOM   2550 C CD1 . TYR A 1 336 ? -11.775 -50.357 29.130  1.00 65.83  ? 337 TYR A CD1 1 
ATOM   2551 C CD2 . TYR A 1 336 ? -11.678 -48.521 27.598  1.00 50.74  ? 337 TYR A CD2 1 
ATOM   2552 C CE1 . TYR A 1 336 ? -12.393 -49.550 30.077  1.00 57.56  ? 337 TYR A CE1 1 
ATOM   2553 C CE2 . TYR A 1 336 ? -12.308 -47.705 28.537  1.00 60.84  ? 337 TYR A CE2 1 
ATOM   2554 C CZ  . TYR A 1 336 ? -12.660 -48.230 29.780  1.00 62.70  ? 337 TYR A CZ  1 
ATOM   2555 O OH  . TYR A 1 336 ? -13.271 -47.441 30.741  1.00 78.50  ? 337 TYR A OH  1 
ATOM   2556 N N   . PHE A 1 337 ? -12.143 -49.912 24.168  1.00 44.94  ? 338 PHE A N   1 
ATOM   2557 C CA  . PHE A 1 337 ? -12.968 -48.881 23.561  1.00 48.46  ? 338 PHE A CA  1 
ATOM   2558 C C   . PHE A 1 337 ? -14.100 -49.427 22.693  1.00 48.55  ? 338 PHE A C   1 
ATOM   2559 O O   . PHE A 1 337 ? -15.095 -48.740 22.466  1.00 43.30  ? 338 PHE A O   1 
ATOM   2560 C CB  . PHE A 1 337 ? -12.082 -47.891 22.791  1.00 46.12  ? 338 PHE A CB  1 
ATOM   2561 C CG  . PHE A 1 337 ? -11.104 -47.196 23.676  1.00 44.83  ? 338 PHE A CG  1 
ATOM   2562 C CD1 . PHE A 1 337 ? -9.875  -47.769 23.949  1.00 44.68  ? 338 PHE A CD1 1 
ATOM   2563 C CD2 . PHE A 1 337 ? -11.451 -46.005 24.311  1.00 44.90  ? 338 PHE A CD2 1 
ATOM   2564 C CE1 . PHE A 1 337 ? -8.978  -47.144 24.828  1.00 46.93  ? 338 PHE A CE1 1 
ATOM   2565 C CE2 . PHE A 1 337 ? -10.571 -45.373 25.184  1.00 43.92  ? 338 PHE A CE2 1 
ATOM   2566 C CZ  . PHE A 1 337 ? -9.329  -45.945 25.443  1.00 41.38  ? 338 PHE A CZ  1 
ATOM   2567 N N   . LEU A 1 338 ? -13.962 -50.669 22.245  1.00 44.20  ? 339 LEU A N   1 
ATOM   2568 C CA  . LEU A 1 338 ? -14.916 -51.244 21.299  1.00 50.38  ? 339 LEU A CA  1 
ATOM   2569 C C   . LEU A 1 338 ? -16.321 -51.406 21.894  1.00 51.82  ? 339 LEU A C   1 
ATOM   2570 O O   . LEU A 1 338 ? -17.320 -51.326 21.172  1.00 49.32  ? 339 LEU A O   1 
ATOM   2571 C CB  . LEU A 1 338 ? -14.392 -52.585 20.762  1.00 48.49  ? 339 LEU A CB  1 
ATOM   2572 C CG  . LEU A 1 338 ? -13.078 -52.513 19.977  1.00 50.54  ? 339 LEU A CG  1 
ATOM   2573 C CD1 . LEU A 1 338 ? -12.561 -53.894 19.623  1.00 50.18  ? 339 LEU A CD1 1 
ATOM   2574 C CD2 . LEU A 1 338 ? -13.231 -51.663 18.720  1.00 48.31  ? 339 LEU A CD2 1 
ATOM   2575 N N   . VAL A 1 339 ? -16.406 -51.611 23.207  1.00 49.07  ? 340 VAL A N   1 
ATOM   2576 C CA  . VAL A 1 339 ? -17.712 -51.777 23.830  1.00 50.67  ? 340 VAL A CA  1 
ATOM   2577 C C   . VAL A 1 339 ? -18.459 -50.461 24.054  1.00 58.70  ? 340 VAL A C   1 
ATOM   2578 O O   . VAL A 1 339 ? -19.588 -50.473 24.534  1.00 56.61  ? 340 VAL A O   1 
ATOM   2579 C CB  . VAL A 1 339 ? -17.619 -52.559 25.132  1.00 59.87  ? 340 VAL A CB  1 
ATOM   2580 C CG1 . VAL A 1 339 ? -17.003 -53.939 24.860  1.00 56.77  ? 340 VAL A CG1 1 
ATOM   2581 C CG2 . VAL A 1 339 ? -16.810 -51.786 26.144  1.00 50.33  ? 340 VAL A CG2 1 
ATOM   2582 N N   . TYR A 1 340 ? -17.851 -49.334 23.682  1.00 52.14  ? 341 TYR A N   1 
ATOM   2583 C CA  . TYR A 1 340 ? -18.521 -48.033 23.817  1.00 46.55  ? 341 TYR A CA  1 
ATOM   2584 C C   . TYR A 1 340 ? -19.073 -47.448 22.506  1.00 57.87  ? 341 TYR A C   1 
ATOM   2585 O O   . TYR A 1 340 ? -19.209 -46.218 22.384  1.00 54.87  ? 341 TYR A O   1 
ATOM   2586 C CB  . TYR A 1 340 ? -17.592 -47.016 24.475  1.00 50.03  ? 341 TYR A CB  1 
ATOM   2587 C CG  . TYR A 1 340 ? -17.394 -47.271 25.947  1.00 52.15  ? 341 TYR A CG  1 
ATOM   2588 C CD1 . TYR A 1 340 ? -18.220 -46.666 26.894  1.00 50.10  ? 341 TYR A CD1 1 
ATOM   2589 C CD2 . TYR A 1 340 ? -16.404 -48.141 26.389  1.00 49.16  ? 341 TYR A CD2 1 
ATOM   2590 C CE1 . TYR A 1 340 ? -18.046 -46.900 28.253  1.00 52.15  ? 341 TYR A CE1 1 
ATOM   2591 C CE2 . TYR A 1 340 ? -16.225 -48.392 27.741  1.00 63.10  ? 341 TYR A CE2 1 
ATOM   2592 C CZ  . TYR A 1 340 ? -17.047 -47.768 28.666  1.00 58.52  ? 341 TYR A CZ  1 
ATOM   2593 O OH  . TYR A 1 340 ? -16.862 -48.023 29.997  1.00 61.97  ? 341 TYR A OH  1 
ATOM   2594 N N   . GLY A 1 341 ? -19.381 -48.303 21.529  1.00 53.06  ? 342 GLY A N   1 
ATOM   2595 C CA  . GLY A 1 341 ? -19.959 -47.805 20.286  1.00 51.00  ? 342 GLY A CA  1 
ATOM   2596 C C   . GLY A 1 341 ? -19.776 -48.602 19.006  1.00 56.70  ? 342 GLY A C   1 
ATOM   2597 O O   . GLY A 1 341 ? -20.456 -48.333 18.011  1.00 56.31  ? 342 GLY A O   1 
ATOM   2598 N N   . ALA A 1 342 ? -18.863 -49.568 19.006  1.00 60.06  ? 343 ALA A N   1 
ATOM   2599 C CA  . ALA A 1 342 ? -18.683 -50.403 17.822  1.00 58.84  ? 343 ALA A CA  1 
ATOM   2600 C C   . ALA A 1 342 ? -19.824 -51.423 17.784  1.00 57.37  ? 343 ALA A C   1 
ATOM   2601 O O   . ALA A 1 342 ? -20.065 -52.111 18.778  1.00 53.62  ? 343 ALA A O   1 
ATOM   2602 C CB  . ALA A 1 342 ? -17.332 -51.106 17.856  1.00 48.18  ? 343 ALA A CB  1 
ATOM   2603 N N   . PRO A 1 343 ? -20.543 -51.504 16.649  1.00 50.95  ? 344 PRO A N   1 
ATOM   2604 C CA  . PRO A 1 343 ? -21.662 -52.447 16.545  1.00 55.78  ? 344 PRO A CA  1 
ATOM   2605 C C   . PRO A 1 343 ? -21.215 -53.893 16.726  1.00 53.43  ? 344 PRO A C   1 
ATOM   2606 O O   . PRO A 1 343 ? -20.177 -54.291 16.199  1.00 58.56  ? 344 PRO A O   1 
ATOM   2607 C CB  . PRO A 1 343 ? -22.190 -52.219 15.120  1.00 58.31  ? 344 PRO A CB  1 
ATOM   2608 C CG  . PRO A 1 343 ? -21.097 -51.495 14.389  1.00 55.25  ? 344 PRO A CG  1 
ATOM   2609 C CD  . PRO A 1 343 ? -20.434 -50.653 15.449  1.00 58.13  ? 344 PRO A CD  1 
ATOM   2610 N N   . GLY A 1 344 ? -21.984 -54.660 17.489  1.00 54.86  ? 345 GLY A N   1 
ATOM   2611 C CA  . GLY A 1 344 ? -21.694 -56.068 17.690  1.00 56.31  ? 345 GLY A CA  1 
ATOM   2612 C C   . GLY A 1 344 ? -20.882 -56.391 18.930  1.00 58.02  ? 345 GLY A C   1 
ATOM   2613 O O   . GLY A 1 344 ? -20.734 -57.560 19.279  1.00 57.59  ? 345 GLY A O   1 
ATOM   2614 N N   . PHE A 1 345 ? -20.360 -55.372 19.609  1.00 60.64  ? 346 PHE A N   1 
ATOM   2615 C CA  . PHE A 1 345 ? -19.449 -55.611 20.739  1.00 53.30  ? 346 PHE A CA  1 
ATOM   2616 C C   . PHE A 1 345 ? -20.123 -55.572 22.108  1.00 53.17  ? 346 PHE A C   1 
ATOM   2617 O O   . PHE A 1 345 ? -21.091 -54.838 22.316  1.00 55.45  ? 346 PHE A O   1 
ATOM   2618 C CB  . PHE A 1 345 ? -18.269 -54.636 20.702  1.00 49.72  ? 346 PHE A CB  1 
ATOM   2619 C CG  . PHE A 1 345 ? -17.205 -55.022 19.722  1.00 49.36  ? 346 PHE A CG  1 
ATOM   2620 C CD1 . PHE A 1 345 ? -16.105 -55.763 20.136  1.00 48.99  ? 346 PHE A CD1 1 
ATOM   2621 C CD2 . PHE A 1 345 ? -17.303 -54.647 18.383  1.00 50.92  ? 346 PHE A CD2 1 
ATOM   2622 C CE1 . PHE A 1 345 ? -15.120 -56.127 19.242  1.00 52.06  ? 346 PHE A CE1 1 
ATOM   2623 C CE2 . PHE A 1 345 ? -16.320 -54.995 17.486  1.00 54.99  ? 346 PHE A CE2 1 
ATOM   2624 C CZ  . PHE A 1 345 ? -15.230 -55.740 17.908  1.00 52.63  ? 346 PHE A CZ  1 
ATOM   2625 N N   . SER A 1 346 ? -19.606 -56.376 23.031  1.00 58.56  ? 347 SER A N   1 
ATOM   2626 C CA  . SER A 1 346 ? -20.062 -56.365 24.422  1.00 54.09  ? 347 SER A CA  1 
ATOM   2627 C C   . SER A 1 346 ? -19.056 -57.096 25.291  1.00 50.04  ? 347 SER A C   1 
ATOM   2628 O O   . SER A 1 346 ? -18.463 -58.087 24.870  1.00 52.01  ? 347 SER A O   1 
ATOM   2629 C CB  . SER A 1 346 ? -21.456 -57.019 24.558  1.00 57.58  ? 347 SER A CB  1 
ATOM   2630 O OG  . SER A 1 346 ? -21.822 -57.217 25.923  1.00 64.44  ? 347 SER A OG  1 
ATOM   2631 N N   . LYS A 1 347 ? -18.874 -56.632 26.521  1.00 57.64  ? 348 LYS A N   1 
ATOM   2632 C CA  . LYS A 1 347 ? -18.010 -57.352 27.445  1.00 52.44  ? 348 LYS A CA  1 
ATOM   2633 C C   . LYS A 1 347 ? -18.626 -58.707 27.798  1.00 57.95  ? 348 LYS A C   1 
ATOM   2634 O O   . LYS A 1 347 ? -17.921 -59.616 28.247  1.00 52.13  ? 348 LYS A O   1 
ATOM   2635 C CB  . LYS A 1 347 ? -17.774 -56.536 28.730  1.00 55.14  ? 348 LYS A CB  1 
ATOM   2636 C CG  . LYS A 1 347 ? -18.824 -56.775 29.830  1.00 54.08  ? 348 LYS A CG  1 
ATOM   2637 C CD  . LYS A 1 347 ? -18.493 -56.038 31.145  1.00 55.80  ? 348 LYS A CD  1 
ATOM   2638 C CE  . LYS A 1 347 ? -19.464 -56.441 32.254  1.00 49.49  ? 348 LYS A CE  1 
ATOM   2639 N NZ  . LYS A 1 347 ? -19.262 -57.868 32.655  1.00 50.47  ? 348 LYS A NZ  1 
ATOM   2640 N N   . ASP A 1 348 ? -19.940 -58.834 27.598  1.00 51.44  ? 349 ASP A N   1 
ATOM   2641 C CA  . ASP A 1 348 ? -20.678 -60.013 28.064  1.00 56.41  ? 349 ASP A CA  1 
ATOM   2642 C C   . ASP A 1 348 ? -20.934 -61.094 27.008  1.00 67.24  ? 349 ASP A C   1 
ATOM   2643 O O   . ASP A 1 348 ? -21.676 -62.041 27.265  1.00 62.01  ? 349 ASP A O   1 
ATOM   2644 C CB  . ASP A 1 348 ? -22.000 -59.596 28.708  1.00 55.42  ? 349 ASP A CB  1 
ATOM   2645 C CG  . ASP A 1 348 ? -21.803 -58.955 30.066  1.00 56.08  ? 349 ASP A CG  1 
ATOM   2646 O OD1 . ASP A 1 348 ? -20.971 -59.463 30.860  1.00 48.34  ? 349 ASP A OD1 1 
ATOM   2647 O OD2 . ASP A 1 348 ? -22.475 -57.934 30.322  1.00 57.32  ? 349 ASP A OD2 1 
ATOM   2648 N N   . ASN A 1 349 ? -20.336 -60.947 25.827  1.00 59.87  ? 350 ASN A N   1 
ATOM   2649 C CA  . ASN A 1 349 ? -20.257 -62.060 24.878  1.00 60.22  ? 350 ASN A CA  1 
ATOM   2650 C C   . ASN A 1 349 ? -18.901 -62.098 24.163  1.00 62.79  ? 350 ASN A C   1 
ATOM   2651 O O   . ASN A 1 349 ? -17.988 -61.345 24.514  1.00 59.84  ? 350 ASN A O   1 
ATOM   2652 C CB  . ASN A 1 349 ? -21.457 -62.090 23.909  1.00 54.26  ? 350 ASN A CB  1 
ATOM   2653 C CG  . ASN A 1 349 ? -21.537 -60.871 23.021  1.00 61.59  ? 350 ASN A CG  1 
ATOM   2654 O OD1 . ASN A 1 349 ? -20.518 -60.363 22.548  1.00 62.00  ? 350 ASN A OD1 1 
ATOM   2655 N ND2 . ASN A 1 349 ? -22.759 -60.390 22.782  1.00 59.17  ? 350 ASN A ND2 1 
ATOM   2656 N N   . GLU A 1 350 ? -18.767 -62.977 23.179  1.00 55.76  ? 351 GLU A N   1 
ATOM   2657 C CA  . GLU A 1 350 ? -17.493 -63.157 22.496  1.00 58.01  ? 351 GLU A CA  1 
ATOM   2658 C C   . GLU A 1 350 ? -17.199 -62.047 21.476  1.00 53.69  ? 351 GLU A C   1 
ATOM   2659 O O   . GLU A 1 350 ? -16.095 -61.968 20.945  1.00 53.23  ? 351 GLU A O   1 
ATOM   2660 C CB  . GLU A 1 350 ? -17.431 -64.534 21.819  1.00 63.39  ? 351 GLU A CB  1 
ATOM   2661 C CG  . GLU A 1 350 ? -17.258 -65.691 22.780  1.00 65.76  ? 351 GLU A CG  1 
ATOM   2662 C CD  . GLU A 1 350 ? -16.067 -65.494 23.697  1.00 81.80  ? 351 GLU A CD  1 
ATOM   2663 O OE1 . GLU A 1 350 ? -14.925 -65.440 23.180  1.00 82.53  ? 351 GLU A OE1 1 
ATOM   2664 O OE2 . GLU A 1 350 ? -16.272 -65.381 24.930  1.00 78.40  ? 351 GLU A OE2 1 
ATOM   2665 N N   . SER A 1 351 ? -18.188 -61.202 21.220  1.00 47.11  ? 352 SER A N   1 
ATOM   2666 C CA  . SER A 1 351 ? -18.087 -60.137 20.223  1.00 53.51  ? 352 SER A CA  1 
ATOM   2667 C C   . SER A 1 351 ? -17.554 -60.631 18.873  1.00 61.51  ? 352 SER A C   1 
ATOM   2668 O O   . SER A 1 351 ? -16.735 -59.968 18.239  1.00 49.81  ? 352 SER A O   1 
ATOM   2669 C CB  . SER A 1 351 ? -17.226 -58.976 20.736  1.00 56.11  ? 352 SER A CB  1 
ATOM   2670 O OG  . SER A 1 351 ? -17.726 -58.458 21.953  1.00 55.53  ? 352 SER A OG  1 
ATOM   2671 N N   . LEU A 1 352 ? -18.015 -61.799 18.442  1.00 58.86  ? 353 LEU A N   1 
ATOM   2672 C CA  . LEU A 1 352 ? -17.607 -62.335 17.156  1.00 53.30  ? 353 LEU A CA  1 
ATOM   2673 C C   . LEU A 1 352 ? -18.417 -61.639 16.073  1.00 58.73  ? 353 LEU A C   1 
ATOM   2674 O O   . LEU A 1 352 ? -19.499 -62.101 15.720  1.00 59.10  ? 353 LEU A O   1 
ATOM   2675 C CB  . LEU A 1 352 ? -17.835 -63.847 17.137  1.00 55.10  ? 353 LEU A CB  1 
ATOM   2676 C CG  . LEU A 1 352 ? -16.907 -64.585 18.098  1.00 52.52  ? 353 LEU A CG  1 
ATOM   2677 C CD1 . LEU A 1 352 ? -17.338 -66.031 18.337  1.00 54.89  ? 353 LEU A CD1 1 
ATOM   2678 C CD2 . LEU A 1 352 ? -15.485 -64.515 17.587  1.00 56.76  ? 353 LEU A CD2 1 
ATOM   2679 N N   . ILE A 1 353 ? -17.903 -60.516 15.565  1.00 46.52  ? 354 ILE A N   1 
ATOM   2680 C CA  . ILE A 1 353 ? -18.668 -59.671 14.659  1.00 50.89  ? 354 ILE A CA  1 
ATOM   2681 C C   . ILE A 1 353 ? -18.672 -60.202 13.217  1.00 52.68  ? 354 ILE A C   1 
ATOM   2682 O O   . ILE A 1 353 ? -17.899 -61.092 12.859  1.00 49.70  ? 354 ILE A O   1 
ATOM   2683 C CB  . ILE A 1 353 ? -18.148 -58.210 14.635  1.00 56.12  ? 354 ILE A CB  1 
ATOM   2684 C CG1 . ILE A 1 353 ? -16.673 -58.170 14.209  1.00 44.82  ? 354 ILE A CG1 1 
ATOM   2685 C CG2 . ILE A 1 353 ? -18.363 -57.533 15.983  1.00 52.58  ? 354 ILE A CG2 1 
ATOM   2686 C CD1 . ILE A 1 353 ? -16.106 -56.776 14.063  1.00 47.89  ? 354 ILE A CD1 1 
ATOM   2687 N N   . SER A 1 354 ? -19.553 -59.626 12.409  1.00 50.41  ? 355 SER A N   1 
ATOM   2688 C CA  . SER A 1 354 ? -19.675 -59.946 10.991  1.00 54.71  ? 355 SER A CA  1 
ATOM   2689 C C   . SER A 1 354 ? -18.921 -58.892 10.174  1.00 55.77  ? 355 SER A C   1 
ATOM   2690 O O   . SER A 1 354 ? -18.513 -57.839 10.706  1.00 47.75  ? 355 SER A O   1 
ATOM   2691 C CB  . SER A 1 354 ? -21.154 -59.952 10.591  1.00 47.44  ? 355 SER A CB  1 
ATOM   2692 O OG  . SER A 1 354 ? -21.662 -58.629 10.529  1.00 51.20  ? 355 SER A OG  1 
ATOM   2693 N N   . ARG A 1 355 ? -18.739 -59.168 8.884   1.00 53.27  ? 356 ARG A N   1 
ATOM   2694 C CA  . ARG A 1 355 ? -17.962 -58.280 8.032   1.00 46.28  ? 356 ARG A CA  1 
ATOM   2695 C C   . ARG A 1 355 ? -18.632 -56.923 7.919   1.00 47.12  ? 356 ARG A C   1 
ATOM   2696 O O   . ARG A 1 355 ? -17.962 -55.888 7.948   1.00 51.90  ? 356 ARG A O   1 
ATOM   2697 C CB  . ARG A 1 355 ? -17.740 -58.890 6.638   1.00 56.66  ? 356 ARG A CB  1 
ATOM   2698 C CG  . ARG A 1 355 ? -17.096 -57.914 5.631   1.00 53.04  ? 356 ARG A CG  1 
ATOM   2699 C CD  . ARG A 1 355 ? -15.710 -58.361 5.252   1.00 55.48  ? 356 ARG A CD  1 
ATOM   2700 N NE  . ARG A 1 355 ? -14.984 -57.406 4.408   1.00 52.11  ? 356 ARG A NE  1 
ATOM   2701 C CZ  . ARG A 1 355 ? -13.724 -57.053 4.648   1.00 51.87  ? 356 ARG A CZ  1 
ATOM   2702 N NH1 . ARG A 1 355 ? -13.092 -57.579 5.698   1.00 47.77  ? 356 ARG A NH1 1 
ATOM   2703 N NH2 . ARG A 1 355 ? -13.093 -56.186 3.862   1.00 43.08  ? 356 ARG A NH2 1 
ATOM   2704 N N   . ALA A 1 356 ? -19.957 -56.930 7.795   1.00 52.26  ? 357 ALA A N   1 
ATOM   2705 C CA  . ALA A 1 356 ? -20.737 -55.693 7.763   1.00 55.77  ? 357 ALA A CA  1 
ATOM   2706 C C   . ALA A 1 356 ? -20.527 -54.859 9.043   1.00 46.01  ? 357 ALA A C   1 
ATOM   2707 O O   . ALA A 1 356 ? -20.373 -53.641 8.976   1.00 57.55  ? 357 ALA A O   1 
ATOM   2708 C CB  . ALA A 1 356 ? -22.216 -56.002 7.553   1.00 42.60  ? 357 ALA A CB  1 
ATOM   2709 N N   . GLU A 1 357 ? -20.519 -55.522 10.198  1.00 51.39  ? 358 GLU A N   1 
ATOM   2710 C CA  . GLU A 1 357 ? -20.276 -54.838 11.461  1.00 51.54  ? 358 GLU A CA  1 
ATOM   2711 C C   . GLU A 1 357 ? -18.840 -54.305 11.482  1.00 53.90  ? 358 GLU A C   1 
ATOM   2712 O O   . GLU A 1 357 ? -18.580 -53.184 11.921  1.00 50.97  ? 358 GLU A O   1 
ATOM   2713 C CB  . GLU A 1 357 ? -20.544 -55.777 12.650  1.00 51.34  ? 358 GLU A CB  1 
ATOM   2714 C CG  . GLU A 1 357 ? -22.036 -56.035 12.900  1.00 52.94  ? 358 GLU A CG  1 
ATOM   2715 C CD  . GLU A 1 357 ? -22.315 -57.150 13.916  1.00 58.27  ? 358 GLU A CD  1 
ATOM   2716 O OE1 . GLU A 1 357 ? -21.539 -58.131 14.002  1.00 54.76  ? 358 GLU A OE1 1 
ATOM   2717 O OE2 . GLU A 1 357 ? -23.330 -57.046 14.637  1.00 73.68  ? 358 GLU A OE2 1 
ATOM   2718 N N   . PHE A 1 358 ? -17.909 -55.099 10.971  1.00 50.09  ? 359 PHE A N   1 
ATOM   2719 C CA  . PHE A 1 358 ? -16.529 -54.647 10.921  1.00 53.07  ? 359 PHE A CA  1 
ATOM   2720 C C   . PHE A 1 358 ? -16.416 -53.376 10.094  1.00 51.00  ? 359 PHE A C   1 
ATOM   2721 O O   . PHE A 1 358 ? -15.775 -52.413 10.522  1.00 55.31  ? 359 PHE A O   1 
ATOM   2722 C CB  . PHE A 1 358 ? -15.596 -55.759 10.432  1.00 49.18  ? 359 PHE A CB  1 
ATOM   2723 C CG  . PHE A 1 358 ? -14.228 -55.282 10.037  1.00 53.64  ? 359 PHE A CG  1 
ATOM   2724 C CD1 . PHE A 1 358 ? -13.212 -55.196 10.975  1.00 44.76  ? 359 PHE A CD1 1 
ATOM   2725 C CD2 . PHE A 1 358 ? -13.952 -54.929 8.717   1.00 45.04  ? 359 PHE A CD2 1 
ATOM   2726 C CE1 . PHE A 1 358 ? -11.935 -54.769 10.606  1.00 46.66  ? 359 PHE A CE1 1 
ATOM   2727 C CE2 . PHE A 1 358 ? -12.685 -54.507 8.342   1.00 45.77  ? 359 PHE A CE2 1 
ATOM   2728 C CZ  . PHE A 1 358 ? -11.676 -54.425 9.282   1.00 49.20  ? 359 PHE A CZ  1 
ATOM   2729 N N   . LEU A 1 359 ? -17.085 -53.358 8.943   1.00 48.53  ? 360 LEU A N   1 
ATOM   2730 C CA  . LEU A 1 359 ? -17.065 -52.209 8.037   1.00 46.61  ? 360 LEU A CA  1 
ATOM   2731 C C   . LEU A 1 359 ? -17.710 -50.940 8.637   1.00 56.55  ? 360 LEU A C   1 
ATOM   2732 O O   . LEU A 1 359 ? -17.142 -49.842 8.576   1.00 48.38  ? 360 LEU A O   1 
ATOM   2733 C CB  . LEU A 1 359 ? -17.739 -52.580 6.707   1.00 48.34  ? 360 LEU A CB  1 
ATOM   2734 C CG  . LEU A 1 359 ? -17.017 -53.630 5.852   1.00 54.76  ? 360 LEU A CG  1 
ATOM   2735 C CD1 . LEU A 1 359 ? -17.815 -53.988 4.574   1.00 53.53  ? 360 LEU A CD1 1 
ATOM   2736 C CD2 . LEU A 1 359 ? -15.621 -53.128 5.487   1.00 48.93  ? 360 LEU A CD2 1 
ATOM   2737 N N   . ALA A 1 360 ? -18.904 -51.083 9.198   1.00 46.04  ? 361 ALA A N   1 
ATOM   2738 C CA  . ALA A 1 360 ? -19.498 -49.985 9.954   1.00 56.67  ? 361 ALA A CA  1 
ATOM   2739 C C   . ALA A 1 360 ? -18.580 -49.553 11.124  1.00 57.72  ? 361 ALA A C   1 
ATOM   2740 O O   . ALA A 1 360 ? -18.435 -48.367 11.404  1.00 52.07  ? 361 ALA A O   1 
ATOM   2741 C CB  . ALA A 1 360 ? -20.869 -50.390 10.473  1.00 51.60  ? 361 ALA A CB  1 
ATOM   2742 N N   . GLY A 1 361 ? -17.953 -50.520 11.786  1.00 45.50  ? 362 GLY A N   1 
ATOM   2743 C CA  . GLY A 1 361 ? -17.060 -50.232 12.901  1.00 50.01  ? 362 GLY A CA  1 
ATOM   2744 C C   . GLY A 1 361 ? -15.872 -49.351 12.535  1.00 55.25  ? 362 GLY A C   1 
ATOM   2745 O O   . GLY A 1 361 ? -15.447 -48.510 13.318  1.00 47.18  ? 362 GLY A O   1 
ATOM   2746 N N   . VAL A 1 362 ? -15.344 -49.531 11.330  1.00 47.68  ? 363 VAL A N   1 
ATOM   2747 C CA  . VAL A 1 362 ? -14.201 -48.758 10.875  1.00 39.03  ? 363 VAL A CA  1 
ATOM   2748 C C   . VAL A 1 362 ? -14.519 -47.264 10.824  1.00 42.99  ? 363 VAL A C   1 
ATOM   2749 O O   . VAL A 1 362 ? -13.658 -46.435 11.101  1.00 47.43  ? 363 VAL A O   1 
ATOM   2750 C CB  . VAL A 1 362 ? -13.766 -49.231 9.461   1.00 44.45  ? 363 VAL A CB  1 
ATOM   2751 C CG1 . VAL A 1 362 ? -12.996 -48.125 8.716   1.00 38.81  ? 363 VAL A CG1 1 
ATOM   2752 C CG2 . VAL A 1 362 ? -12.982 -50.528 9.555   1.00 42.04  ? 363 VAL A CG2 1 
ATOM   2753 N N   . ARG A 1 363 ? -15.747 -46.914 10.446  1.00 40.93  ? 364 ARG A N   1 
ATOM   2754 C CA  . ARG A 1 363 ? -16.131 -45.503 10.414  1.00 45.87  ? 364 ARG A CA  1 
ATOM   2755 C C   . ARG A 1 363 ? -16.319 -44.939 11.829  1.00 45.95  ? 364 ARG A C   1 
ATOM   2756 O O   . ARG A 1 363 ? -16.206 -43.730 12.030  1.00 46.81  ? 364 ARG A O   1 
ATOM   2757 C CB  . ARG A 1 363 ? -17.410 -45.278 9.606   1.00 55.86  ? 364 ARG A CB  1 
ATOM   2758 C CG  . ARG A 1 363 ? -17.383 -45.780 8.144   1.00 48.12  ? 364 ARG A CG  1 
ATOM   2759 C CD  . ARG A 1 363 ? -16.084 -45.439 7.403   1.00 49.87  ? 364 ARG A CD  1 
ATOM   2760 N NE  . ARG A 1 363 ? -15.879 -44.010 7.122   1.00 54.01  ? 364 ARG A NE  1 
ATOM   2761 C CZ  . ARG A 1 363 ? -16.220 -43.416 5.979   1.00 58.44  ? 364 ARG A CZ  1 
ATOM   2762 N NH1 . ARG A 1 363 ? -16.809 -44.121 5.022   1.00 54.02  ? 364 ARG A NH1 1 
ATOM   2763 N NH2 . ARG A 1 363 ? -15.980 -42.124 5.791   1.00 52.53  ? 364 ARG A NH2 1 
ATOM   2764 N N   . VAL A 1 364 ? -16.606 -45.810 12.798  1.00 43.65  ? 365 VAL A N   1 
ATOM   2765 C CA  . VAL A 1 364 ? -16.757 -45.383 14.199  1.00 46.63  ? 365 VAL A CA  1 
ATOM   2766 C C   . VAL A 1 364 ? -15.382 -45.215 14.844  1.00 43.95  ? 365 VAL A C   1 
ATOM   2767 O O   . VAL A 1 364 ? -15.128 -44.241 15.543  1.00 49.54  ? 365 VAL A O   1 
ATOM   2768 C CB  . VAL A 1 364 ? -17.630 -46.366 15.018  1.00 47.49  ? 365 VAL A CB  1 
ATOM   2769 C CG1 . VAL A 1 364 ? -17.589 -46.025 16.510  1.00 52.42  ? 365 VAL A CG1 1 
ATOM   2770 C CG2 . VAL A 1 364 ? -19.074 -46.318 14.533  1.00 51.03  ? 365 VAL A CG2 1 
ATOM   2771 N N   . GLY A 1 365 ? -14.490 -46.158 14.563  1.00 46.67  ? 366 GLY A N   1 
ATOM   2772 C CA  . GLY A 1 365 ? -13.139 -46.147 15.094  1.00 44.70  ? 366 GLY A CA  1 
ATOM   2773 C C   . GLY A 1 365 ? -12.184 -45.197 14.396  1.00 51.95  ? 366 GLY A C   1 
ATOM   2774 O O   . GLY A 1 365 ? -11.151 -44.842 14.959  1.00 48.23  ? 366 GLY A O   1 
ATOM   2775 N N   . VAL A 1 366 ? -12.505 -44.800 13.164  1.00 49.37  ? 367 VAL A N   1 
ATOM   2776 C CA  . VAL A 1 366 ? -11.695 -43.811 12.440  1.00 46.19  ? 367 VAL A CA  1 
ATOM   2777 C C   . VAL A 1 366 ? -12.603 -42.696 11.936  1.00 44.97  ? 367 VAL A C   1 
ATOM   2778 O O   . VAL A 1 366 ? -12.807 -42.537 10.725  1.00 52.49  ? 367 VAL A O   1 
ATOM   2779 C CB  . VAL A 1 366 ? -10.903 -44.439 11.255  1.00 49.59  ? 367 VAL A CB  1 
ATOM   2780 C CG1 . VAL A 1 366 ? -9.889  -43.436 10.684  1.00 40.66  ? 367 VAL A CG1 1 
ATOM   2781 C CG2 . VAL A 1 366 ? -10.200 -45.717 11.696  1.00 45.41  ? 367 VAL A CG2 1 
ATOM   2782 N N   . PRO A 1 367 ? -13.159 -41.912 12.873  1.00 53.85  ? 368 PRO A N   1 
ATOM   2783 C CA  . PRO A 1 367 ? -14.205 -40.941 12.538  1.00 49.47  ? 368 PRO A CA  1 
ATOM   2784 C C   . PRO A 1 367 ? -13.676 -39.778 11.718  1.00 47.85  ? 368 PRO A C   1 
ATOM   2785 O O   . PRO A 1 367 ? -12.483 -39.484 11.778  1.00 56.69  ? 368 PRO A O   1 
ATOM   2786 C CB  . PRO A 1 367 ? -14.648 -40.430 13.919  1.00 47.22  ? 368 PRO A CB  1 
ATOM   2787 C CG  . PRO A 1 367 ? -13.439 -40.590 14.774  1.00 46.16  ? 368 PRO A CG  1 
ATOM   2788 C CD  . PRO A 1 367 ? -12.826 -41.880 14.315  1.00 49.55  ? 368 PRO A CD  1 
ATOM   2789 N N   . GLN A 1 368 ? -14.553 -39.128 10.960  1.00 47.40  ? 369 GLN A N   1 
ATOM   2790 C CA  . GLN A 1 368 ? -14.201 -37.872 10.299  1.00 55.39  ? 369 GLN A CA  1 
ATOM   2791 C C   . GLN A 1 368 ? -13.121 -37.975 9.209   1.00 54.47  ? 369 GLN A C   1 
ATOM   2792 O O   . GLN A 1 368 ? -12.425 -37.000 8.943   1.00 52.59  ? 369 GLN A O   1 
ATOM   2793 C CB  . GLN A 1 368 ? -13.768 -36.837 11.341  1.00 60.49  ? 369 GLN A CB  1 
ATOM   2794 C CG  . GLN A 1 368 ? -14.813 -36.566 12.414  1.00 65.81  ? 369 GLN A CG  1 
ATOM   2795 C CD  . GLN A 1 368 ? -15.930 -35.686 11.900  1.00 76.82  ? 369 GLN A CD  1 
ATOM   2796 O OE1 . GLN A 1 368 ? -15.801 -34.457 11.871  1.00 75.97  ? 369 GLN A OE1 1 
ATOM   2797 N NE2 . GLN A 1 368 ? -17.033 -36.309 11.480  1.00 57.77  ? 369 GLN A NE2 1 
ATOM   2798 N N   . VAL A 1 369 ? -12.977 -39.132 8.570   1.00 51.66  ? 370 VAL A N   1 
ATOM   2799 C CA  . VAL A 1 369 ? -12.108 -39.199 7.396   1.00 44.43  ? 370 VAL A CA  1 
ATOM   2800 C C   . VAL A 1 369 ? -12.906 -39.512 6.125   1.00 48.19  ? 370 VAL A C   1 
ATOM   2801 O O   . VAL A 1 369 ? -14.049 -39.962 6.188   1.00 52.25  ? 370 VAL A O   1 
ATOM   2802 C CB  . VAL A 1 369 ? -10.955 -40.224 7.554   1.00 46.09  ? 370 VAL A CB  1 
ATOM   2803 C CG1 . VAL A 1 369 ? -10.100 -39.919 8.808   1.00 47.63  ? 370 VAL A CG1 1 
ATOM   2804 C CG2 . VAL A 1 369 ? -11.501 -41.656 7.574   1.00 38.44  ? 370 VAL A CG2 1 
ATOM   2805 N N   . SER A 1 370 ? -12.291 -39.293 4.967   1.00 49.14  ? 371 SER A N   1 
ATOM   2806 C CA  . SER A 1 370 ? -12.954 -39.545 3.689   1.00 41.80  ? 371 SER A CA  1 
ATOM   2807 C C   . SER A 1 370 ? -13.227 -41.025 3.503   1.00 51.20  ? 371 SER A C   1 
ATOM   2808 O O   . SER A 1 370 ? -12.613 -41.873 4.168   1.00 50.71  ? 371 SER A O   1 
ATOM   2809 C CB  . SER A 1 370 ? -12.073 -39.060 2.537   1.00 44.48  ? 371 SER A CB  1 
ATOM   2810 O OG  . SER A 1 370 ? -10.856 -39.789 2.527   1.00 52.33  ? 371 SER A OG  1 
ATOM   2811 N N   . ASP A 1 371 ? -14.140 -41.334 2.586   1.00 53.93  ? 372 ASP A N   1 
ATOM   2812 C CA  . ASP A 1 371 ? -14.423 -42.716 2.208   1.00 52.79  ? 372 ASP A CA  1 
ATOM   2813 C C   . ASP A 1 371 ? -13.165 -43.414 1.691   1.00 45.51  ? 372 ASP A C   1 
ATOM   2814 O O   . ASP A 1 371 ? -12.916 -44.585 1.995   1.00 51.02  ? 372 ASP A O   1 
ATOM   2815 C CB  . ASP A 1 371 ? -15.529 -42.772 1.145   1.00 63.44  ? 372 ASP A CB  1 
ATOM   2816 C CG  . ASP A 1 371 ? -16.907 -42.431 1.706   1.00 73.95  ? 372 ASP A CG  1 
ATOM   2817 O OD1 . ASP A 1 371 ? -17.089 -42.478 2.947   1.00 67.53  ? 372 ASP A OD1 1 
ATOM   2818 O OD2 . ASP A 1 371 ? -17.815 -42.124 0.902   1.00 72.44  ? 372 ASP A OD2 1 
ATOM   2819 N N   . LEU A 1 372 ? -12.374 -42.689 0.911   1.00 51.44  ? 373 LEU A N   1 
ATOM   2820 C CA  . LEU A 1 372 ? -11.122 -43.229 0.387   1.00 56.12  ? 373 LEU A CA  1 
ATOM   2821 C C   . LEU A 1 372 ? -10.188 -43.654 1.527   1.00 49.75  ? 373 LEU A C   1 
ATOM   2822 O O   . LEU A 1 372 ? -9.639  -44.761 1.518   1.00 49.98  ? 373 LEU A O   1 
ATOM   2823 C CB  . LEU A 1 372 ? -10.430 -42.200 -0.502  1.00 46.31  ? 373 LEU A CB  1 
ATOM   2824 C CG  . LEU A 1 372 ? -9.125  -42.638 -1.172  1.00 50.81  ? 373 LEU A CG  1 
ATOM   2825 C CD1 . LEU A 1 372 ? -9.337  -43.860 -2.048  1.00 50.66  ? 373 LEU A CD1 1 
ATOM   2826 C CD2 . LEU A 1 372 ? -8.552  -41.489 -1.984  1.00 50.14  ? 373 LEU A CD2 1 
ATOM   2827 N N   . ALA A 1 373 ? -10.028 -42.771 2.512   1.00 51.44  ? 374 ALA A N   1 
ATOM   2828 C CA  . ALA A 1 373 ? -9.209  -43.065 3.686   1.00 42.69  ? 374 ALA A CA  1 
ATOM   2829 C C   . ALA A 1 373 ? -9.696  -44.320 4.394   1.00 44.70  ? 374 ALA A C   1 
ATOM   2830 O O   . ALA A 1 373 ? -8.893  -45.191 4.762   1.00 48.52  ? 374 ALA A O   1 
ATOM   2831 C CB  . ALA A 1 373 ? -9.205  -41.881 4.634   1.00 40.73  ? 374 ALA A CB  1 
ATOM   2832 N N   . ALA A 1 374 ? -11.008 -44.410 4.595   1.00 46.32  ? 375 ALA A N   1 
ATOM   2833 C CA  . ALA A 1 374 ? -11.602 -45.593 5.216   1.00 39.87  ? 375 ALA A CA  1 
ATOM   2834 C C   . ALA A 1 374 ? -11.329 -46.856 4.406   1.00 51.04  ? 375 ALA A C   1 
ATOM   2835 O O   . ALA A 1 374 ? -11.094 -47.927 4.981   1.00 48.40  ? 375 ALA A O   1 
ATOM   2836 C CB  . ALA A 1 374 ? -13.102 -45.406 5.395   1.00 45.31  ? 375 ALA A CB  1 
ATOM   2837 N N   . GLU A 1 375 ? -11.379 -46.737 3.072   1.00 50.05  ? 376 GLU A N   1 
ATOM   2838 C CA  . GLU A 1 375 ? -11.133 -47.882 2.213   1.00 39.80  ? 376 GLU A CA  1 
ATOM   2839 C C   . GLU A 1 375 ? -9.724  -48.375 2.416   1.00 41.04  ? 376 GLU A C   1 
ATOM   2840 O O   . GLU A 1 375 ? -9.482  -49.574 2.455   1.00 41.98  ? 376 GLU A O   1 
ATOM   2841 C CB  . GLU A 1 375 ? -11.321 -47.523 0.723   1.00 47.83  ? 376 GLU A CB  1 
ATOM   2842 C CG  . GLU A 1 375 ? -12.767 -47.350 0.280   1.00 55.50  ? 376 GLU A CG  1 
ATOM   2843 C CD  . GLU A 1 375 ? -13.584 -48.613 0.456   1.00 64.60  ? 376 GLU A CD  1 
ATOM   2844 O OE1 . GLU A 1 375 ? -12.997 -49.721 0.495   1.00 68.06  ? 376 GLU A OE1 1 
ATOM   2845 O OE2 . GLU A 1 375 ? -14.824 -48.499 0.554   1.00 82.24  ? 376 GLU A OE2 1 
ATOM   2846 N N   . ALA A 1 376 ? -8.786  -47.439 2.505   1.00 37.31  ? 377 ALA A N   1 
ATOM   2847 C CA  . ALA A 1 376 ? -7.396  -47.795 2.759   1.00 43.29  ? 377 ALA A CA  1 
ATOM   2848 C C   . ALA A 1 376 ? -7.237  -48.526 4.093   1.00 46.50  ? 377 ALA A C   1 
ATOM   2849 O O   . ALA A 1 376 ? -6.446  -49.478 4.192   1.00 47.18  ? 377 ALA A O   1 
ATOM   2850 C CB  . ALA A 1 376 ? -6.485  -46.544 2.696   1.00 47.22  ? 377 ALA A CB  1 
ATOM   2851 N N   . VAL A 1 377 ? -7.990  -48.110 5.115   1.00 43.29  ? 378 VAL A N   1 
ATOM   2852 C CA  . VAL A 1 377 ? -7.926  -48.819 6.398   1.00 42.02  ? 378 VAL A CA  1 
ATOM   2853 C C   . VAL A 1 377 ? -8.391  -50.272 6.224   1.00 42.91  ? 378 VAL A C   1 
ATOM   2854 O O   . VAL A 1 377 ? -7.694  -51.215 6.619   1.00 41.09  ? 378 VAL A O   1 
ATOM   2855 C CB  . VAL A 1 377 ? -8.744  -48.114 7.511   1.00 42.37  ? 378 VAL A CB  1 
ATOM   2856 C CG1 . VAL A 1 377 ? -8.671  -48.907 8.817   1.00 42.51  ? 378 VAL A CG1 1 
ATOM   2857 C CG2 . VAL A 1 377 ? -8.240  -46.680 7.744   1.00 40.89  ? 378 VAL A CG2 1 
ATOM   2858 N N   . VAL A 1 378 ? -9.551  -50.443 5.595   1.00 45.97  ? 379 VAL A N   1 
ATOM   2859 C CA  . VAL A 1 378 ? -10.095 -51.768 5.281   1.00 49.34  ? 379 VAL A CA  1 
ATOM   2860 C C   . VAL A 1 378 ? -9.128  -52.665 4.489   1.00 54.34  ? 379 VAL A C   1 
ATOM   2861 O O   . VAL A 1 378 ? -9.050  -53.875 4.734   1.00 47.86  ? 379 VAL A O   1 
ATOM   2862 C CB  . VAL A 1 378 ? -11.420 -51.647 4.484   1.00 53.26  ? 379 VAL A CB  1 
ATOM   2863 C CG1 . VAL A 1 378 ? -11.938 -53.029 4.067   1.00 50.78  ? 379 VAL A CG1 1 
ATOM   2864 C CG2 . VAL A 1 378 ? -12.461 -50.895 5.293   1.00 42.47  ? 379 VAL A CG2 1 
ATOM   2865 N N   . LEU A 1 379 ? -8.394  -52.080 3.544   1.00 43.30  ? 380 LEU A N   1 
ATOM   2866 C CA  . LEU A 1 379 ? -7.386  -52.838 2.798   1.00 49.45  ? 380 LEU A CA  1 
ATOM   2867 C C   . LEU A 1 379 ? -6.268  -53.368 3.703   1.00 50.30  ? 380 LEU A C   1 
ATOM   2868 O O   . LEU A 1 379 ? -5.911  -54.552 3.656   1.00 47.35  ? 380 LEU A O   1 
ATOM   2869 C CB  . LEU A 1 379 ? -6.762  -51.979 1.686   1.00 38.59  ? 380 LEU A CB  1 
ATOM   2870 C CG  . LEU A 1 379 ? -5.581  -52.614 0.927   1.00 51.73  ? 380 LEU A CG  1 
ATOM   2871 C CD1 . LEU A 1 379 ? -6.080  -53.636 -0.112  1.00 49.54  ? 380 LEU A CD1 1 
ATOM   2872 C CD2 . LEU A 1 379 ? -4.680  -51.556 0.258   1.00 41.65  ? 380 LEU A CD2 1 
ATOM   2873 N N   A HIS A 1 380 ? -5.702  -52.481 4.511   0.49 46.87  ? 381 HIS A N   1 
ATOM   2874 N N   B HIS A 1 380 ? -5.706  -52.493 4.526   0.51 46.87  ? 381 HIS A N   1 
ATOM   2875 C CA  A HIS A 1 380 ? -4.573  -52.851 5.353   0.49 48.58  ? 381 HIS A CA  1 
ATOM   2876 C CA  B HIS A 1 380 ? -4.554  -52.881 5.333   0.51 48.58  ? 381 HIS A CA  1 
ATOM   2877 C C   A HIS A 1 380 ? -4.972  -53.928 6.356   0.49 49.09  ? 381 HIS A C   1 
ATOM   2878 C C   B HIS A 1 380 ? -4.913  -53.811 6.485   0.51 49.05  ? 381 HIS A C   1 
ATOM   2879 O O   A HIS A 1 380 ? -4.232  -54.886 6.591   0.49 44.86  ? 381 HIS A O   1 
ATOM   2880 O O   B HIS A 1 380 ? -4.071  -54.568 6.958   0.51 46.32  ? 381 HIS A O   1 
ATOM   2881 C CB  A HIS A 1 380 ? -4.026  -51.624 6.085   0.49 46.19  ? 381 HIS A CB  1 
ATOM   2882 C CB  B HIS A 1 380 ? -3.779  -51.647 5.802   0.51 47.08  ? 381 HIS A CB  1 
ATOM   2883 C CG  A HIS A 1 380 ? -2.588  -51.752 6.478   0.49 48.49  ? 381 HIS A CG  1 
ATOM   2884 C CG  B HIS A 1 380 ? -3.179  -50.875 4.671   0.51 48.20  ? 381 HIS A CG  1 
ATOM   2885 N ND1 A HIS A 1 380 ? -1.558  -51.669 5.566   0.49 47.78  ? 381 HIS A ND1 1 
ATOM   2886 N ND1 B HIS A 1 380 ? -3.837  -49.836 4.048   0.51 49.08  ? 381 HIS A ND1 1 
ATOM   2887 C CD2 A HIS A 1 380 ? -2.007  -51.972 7.682   0.49 50.08  ? 381 HIS A CD2 1 
ATOM   2888 C CD2 B HIS A 1 380 ? -2.013  -51.036 4.003   0.51 48.19  ? 381 HIS A CD2 1 
ATOM   2889 C CE1 A HIS A 1 380 ? -0.405  -51.828 6.191   0.49 49.24  ? 381 HIS A CE1 1 
ATOM   2890 C CE1 B HIS A 1 380 ? -3.091  -49.373 3.062   0.51 41.46  ? 381 HIS A CE1 1 
ATOM   2891 N NE2 A HIS A 1 380 ? -0.649  -52.011 7.476   0.49 50.93  ? 381 HIS A NE2 1 
ATOM   2892 N NE2 B HIS A 1 380 ? -1.979  -50.083 3.013   0.51 47.96  ? 381 HIS A NE2 1 
ATOM   2893 N N   . TYR A 1 381 ? -6.173  -53.785 6.907   1.00 48.21  ? 382 TYR A N   1 
ATOM   2894 C CA  . TYR A 1 381 ? -6.585  -54.579 8.063   1.00 46.95  ? 382 TYR A CA  1 
ATOM   2895 C C   . TYR A 1 381 ? -7.455  -55.790 7.742   1.00 49.32  ? 382 TYR A C   1 
ATOM   2896 O O   . TYR A 1 381 ? -7.887  -56.500 8.647   1.00 44.68  ? 382 TYR A O   1 
ATOM   2897 C CB  . TYR A 1 381 ? -7.257  -53.673 9.104   1.00 43.71  ? 382 TYR A CB  1 
ATOM   2898 C CG  . TYR A 1 381 ? -6.264  -52.853 9.884   1.00 46.51  ? 382 TYR A CG  1 
ATOM   2899 C CD1 . TYR A 1 381 ? -5.731  -53.328 11.084  1.00 40.51  ? 382 TYR A CD1 1 
ATOM   2900 C CD2 . TYR A 1 381 ? -5.852  -51.605 9.424   1.00 45.87  ? 382 TYR A CD2 1 
ATOM   2901 C CE1 . TYR A 1 381 ? -4.804  -52.582 11.802  1.00 37.83  ? 382 TYR A CE1 1 
ATOM   2902 C CE2 . TYR A 1 381 ? -4.935  -50.851 10.133  1.00 47.07  ? 382 TYR A CE2 1 
ATOM   2903 C CZ  . TYR A 1 381 ? -4.419  -51.344 11.334  1.00 44.87  ? 382 TYR A CZ  1 
ATOM   2904 O OH  . TYR A 1 381 ? -3.496  -50.604 12.033  1.00 42.84  ? 382 TYR A OH  1 
ATOM   2905 N N   . THR A 1 382 ? -7.707  -56.034 6.460   1.00 44.90  ? 383 THR A N   1 
ATOM   2906 C CA  . THR A 1 382 ? -8.369  -57.270 6.043   1.00 43.33  ? 383 THR A CA  1 
ATOM   2907 C C   . THR A 1 382 ? -7.330  -58.348 5.729   1.00 47.19  ? 383 THR A C   1 
ATOM   2908 O O   . THR A 1 382 ? -6.299  -58.068 5.131   1.00 44.71  ? 383 THR A O   1 
ATOM   2909 C CB  . THR A 1 382 ? -9.264  -57.035 4.803   1.00 51.21  ? 383 THR A CB  1 
ATOM   2910 O OG1 . THR A 1 382 ? -10.311 -56.119 5.145   1.00 45.57  ? 383 THR A OG1 1 
ATOM   2911 C CG2 . THR A 1 382 ? -9.883  -58.358 4.275   1.00 43.73  ? 383 THR A CG2 1 
ATOM   2912 N N   . ASP A 1 383 ? -7.587  -59.574 6.164   1.00 44.18  ? 384 ASP A N   1 
ATOM   2913 C CA  . ASP A 1 383 ? -6.847  -60.720 5.650   1.00 43.86  ? 384 ASP A CA  1 
ATOM   2914 C C   . ASP A 1 383 ? -7.647  -61.260 4.454   1.00 48.86  ? 384 ASP A C   1 
ATOM   2915 O O   . ASP A 1 383 ? -8.693  -61.887 4.631   1.00 46.02  ? 384 ASP A O   1 
ATOM   2916 C CB  . ASP A 1 383 ? -6.693  -61.783 6.745   1.00 51.69  ? 384 ASP A CB  1 
ATOM   2917 C CG  . ASP A 1 383 ? -5.983  -63.041 6.257   1.00 55.08  ? 384 ASP A CG  1 
ATOM   2918 O OD1 . ASP A 1 383 ? -5.939  -63.292 5.032   1.00 52.87  ? 384 ASP A OD1 1 
ATOM   2919 O OD2 . ASP A 1 383 ? -5.481  -63.798 7.106   1.00 48.72  ? 384 ASP A OD2 1 
ATOM   2920 N N   . TRP A 1 384 ? -7.151  -61.021 3.239   1.00 44.75  ? 385 TRP A N   1 
ATOM   2921 C CA  . TRP A 1 384 ? -7.912  -61.351 2.026   1.00 48.78  ? 385 TRP A CA  1 
ATOM   2922 C C   . TRP A 1 384 ? -8.067  -62.854 1.723   1.00 49.21  ? 385 TRP A C   1 
ATOM   2923 O O   . TRP A 1 384 ? -8.767  -63.234 0.773   1.00 53.46  ? 385 TRP A O   1 
ATOM   2924 C CB  . TRP A 1 384 ? -7.413  -60.527 0.825   1.00 43.91  ? 385 TRP A CB  1 
ATOM   2925 C CG  . TRP A 1 384 ? -7.630  -59.065 1.089   1.00 38.57  ? 385 TRP A CG  1 
ATOM   2926 C CD1 . TRP A 1 384 ? -6.723  -58.169 1.601   1.00 43.05  ? 385 TRP A CD1 1 
ATOM   2927 C CD2 . TRP A 1 384 ? -8.864  -58.347 0.945   1.00 41.24  ? 385 TRP A CD2 1 
ATOM   2928 N NE1 . TRP A 1 384 ? -7.313  -56.923 1.741   1.00 43.59  ? 385 TRP A NE1 1 
ATOM   2929 C CE2 . TRP A 1 384 ? -8.626  -57.012 1.354   1.00 40.29  ? 385 TRP A CE2 1 
ATOM   2930 C CE3 . TRP A 1 384 ? -10.144 -58.701 0.500   1.00 39.91  ? 385 TRP A CE3 1 
ATOM   2931 C CZ2 . TRP A 1 384 ? -9.623  -56.035 1.326   1.00 42.86  ? 385 TRP A CZ2 1 
ATOM   2932 C CZ3 . TRP A 1 384 ? -11.126 -57.726 0.460   1.00 44.78  ? 385 TRP A CZ3 1 
ATOM   2933 C CH2 . TRP A 1 384 ? -10.863 -56.410 0.879   1.00 43.07  ? 385 TRP A CH2 1 
ATOM   2934 N N   . LEU A 1 385 ? -7.432  -63.692 2.540   1.00 44.24  ? 386 LEU A N   1 
ATOM   2935 C CA  . LEU A 1 385 ? -7.684  -65.136 2.544   1.00 52.67  ? 386 LEU A CA  1 
ATOM   2936 C C   . LEU A 1 385 ? -8.804  -65.534 3.518   1.00 60.56  ? 386 LEU A C   1 
ATOM   2937 O O   . LEU A 1 385 ? -9.342  -66.648 3.439   1.00 51.60  ? 386 LEU A O   1 
ATOM   2938 C CB  . LEU A 1 385 ? -6.412  -65.909 2.893   1.00 49.31  ? 386 LEU A CB  1 
ATOM   2939 C CG  . LEU A 1 385 ? -5.378  -66.001 1.766   1.00 58.84  ? 386 LEU A CG  1 
ATOM   2940 C CD1 . LEU A 1 385 ? -4.166  -66.780 2.216   1.00 56.81  ? 386 LEU A CD1 1 
ATOM   2941 C CD2 . LEU A 1 385 ? -6.010  -66.651 0.560   1.00 50.62  ? 386 LEU A CD2 1 
ATOM   2942 N N   . HIS A 1 386 ? -9.127  -64.627 4.444   1.00 51.31  ? 387 HIS A N   1 
ATOM   2943 C CA  . HIS A 1 386 ? -10.187 -64.844 5.435   1.00 56.13  ? 387 HIS A CA  1 
ATOM   2944 C C   . HIS A 1 386 ? -11.002 -63.570 5.653   1.00 52.58  ? 387 HIS A C   1 
ATOM   2945 O O   . HIS A 1 386 ? -11.114 -63.096 6.783   1.00 57.25  ? 387 HIS A O   1 
ATOM   2946 C CB  . HIS A 1 386 ? -9.588  -65.311 6.776   1.00 47.97  ? 387 HIS A CB  1 
ATOM   2947 C CG  . HIS A 1 386 ? -8.730  -66.530 6.657   1.00 49.28  ? 387 HIS A CG  1 
ATOM   2948 N ND1 . HIS A 1 386 ? -9.254  -67.805 6.593   1.00 55.03  ? 387 HIS A ND1 1 
ATOM   2949 C CD2 . HIS A 1 386 ? -7.386  -66.667 6.548   1.00 50.30  ? 387 HIS A CD2 1 
ATOM   2950 C CE1 . HIS A 1 386 ? -8.268  -68.677 6.459   1.00 49.53  ? 387 HIS A CE1 1 
ATOM   2951 N NE2 . HIS A 1 386 ? -7.124  -68.013 6.423   1.00 49.80  ? 387 HIS A NE2 1 
ATOM   2952 N N   . PRO A 1 387 ? -11.582 -63.017 4.577   1.00 52.10  ? 388 PRO A N   1 
ATOM   2953 C CA  . PRO A 1 387 ? -12.224 -61.701 4.688   1.00 48.33  ? 388 PRO A CA  1 
ATOM   2954 C C   . PRO A 1 387 ? -13.396 -61.634 5.678   1.00 56.04  ? 388 PRO A C   1 
ATOM   2955 O O   . PRO A 1 387 ? -13.725 -60.530 6.123   1.00 52.41  ? 388 PRO A O   1 
ATOM   2956 C CB  . PRO A 1 387 ? -12.727 -61.426 3.258   1.00 46.11  ? 388 PRO A CB  1 
ATOM   2957 C CG  . PRO A 1 387 ? -12.870 -62.786 2.625   1.00 45.12  ? 388 PRO A CG  1 
ATOM   2958 C CD  . PRO A 1 387 ? -11.777 -63.625 3.242   1.00 50.64  ? 388 PRO A CD  1 
ATOM   2959 N N   . GLU A 1 388 ? -14.000 -62.769 6.029   1.00 51.96  ? 389 GLU A N   1 
ATOM   2960 C CA  . GLU A 1 388 ? -15.266 -62.727 6.768   1.00 55.54  ? 389 GLU A CA  1 
ATOM   2961 C C   . GLU A 1 388 ? -15.260 -63.491 8.076   1.00 54.18  ? 389 GLU A C   1 
ATOM   2962 O O   . GLU A 1 388 ? -16.309 -63.700 8.676   1.00 55.91  ? 389 GLU A O   1 
ATOM   2963 C CB  . GLU A 1 388 ? -16.420 -63.242 5.904   1.00 53.78  ? 389 GLU A CB  1 
ATOM   2964 C CG  . GLU A 1 388 ? -16.573 -62.497 4.588   1.00 64.33  ? 389 GLU A CG  1 
ATOM   2965 C CD  . GLU A 1 388 ? -18.015 -62.317 4.181   1.00 77.29  ? 389 GLU A CD  1 
ATOM   2966 O OE1 . GLU A 1 388 ? -18.849 -63.161 4.570   1.00 92.95  ? 389 GLU A OE1 1 
ATOM   2967 O OE2 . GLU A 1 388 ? -18.314 -61.326 3.478   1.00 87.44  ? 389 GLU A OE2 1 
ATOM   2968 N N   . ASP A 1 389 ? -14.087 -63.914 8.516   1.00 51.59  ? 390 ASP A N   1 
ATOM   2969 C CA  . ASP A 1 389 ? -13.986 -64.678 9.737   1.00 51.22  ? 390 ASP A CA  1 
ATOM   2970 C C   . ASP A 1 389 ? -14.149 -63.798 11.012  1.00 58.31  ? 390 ASP A C   1 
ATOM   2971 O O   . ASP A 1 389 ? -13.332 -62.920 11.280  1.00 48.09  ? 390 ASP A O   1 
ATOM   2972 C CB  . ASP A 1 389 ? -12.666 -65.437 9.753   1.00 49.43  ? 390 ASP A CB  1 
ATOM   2973 C CG  . ASP A 1 389 ? -12.413 -66.114 11.082  1.00 57.65  ? 390 ASP A CG  1 
ATOM   2974 O OD1 . ASP A 1 389 ? -13.397 -66.573 11.696  1.00 66.91  ? 390 ASP A OD1 1 
ATOM   2975 O OD2 . ASP A 1 389 ? -11.242 -66.179 11.518  1.00 66.90  ? 390 ASP A OD2 1 
ATOM   2976 N N   . PRO A 1 390 ? -15.219 -64.042 11.794  1.00 60.99  ? 391 PRO A N   1 
ATOM   2977 C CA  . PRO A 1 390 ? -15.559 -63.222 12.978  1.00 55.30  ? 391 PRO A CA  1 
ATOM   2978 C C   . PRO A 1 390 ? -14.412 -62.957 13.974  1.00 47.12  ? 391 PRO A C   1 
ATOM   2979 O O   . PRO A 1 390 ? -14.175 -61.802 14.326  1.00 48.91  ? 391 PRO A O   1 
ATOM   2980 C CB  . PRO A 1 390 ? -16.687 -64.023 13.634  1.00 54.65  ? 391 PRO A CB  1 
ATOM   2981 C CG  . PRO A 1 390 ? -17.401 -64.649 12.430  1.00 56.52  ? 391 PRO A CG  1 
ATOM   2982 C CD  . PRO A 1 390 ? -16.263 -65.047 11.500  1.00 45.79  ? 391 PRO A CD  1 
ATOM   2983 N N   . ALA A 1 391 ? -13.711 -63.993 14.410  1.00 46.35  ? 392 ALA A N   1 
ATOM   2984 C CA  . ALA A 1 391 ? -12.633 -63.806 15.370  1.00 50.74  ? 392 ALA A CA  1 
ATOM   2985 C C   . ALA A 1 391 ? -11.507 -62.916 14.825  1.00 56.89  ? 392 ALA A C   1 
ATOM   2986 O O   . ALA A 1 391 ? -11.000 -62.030 15.531  1.00 49.99  ? 392 ALA A O   1 
ATOM   2987 C CB  . ALA A 1 391 ? -12.093 -65.144 15.839  1.00 50.53  ? 392 ALA A CB  1 
ATOM   2988 N N   . ARG A 1 392 ? -11.119 -63.146 13.573  1.00 51.46  ? 393 ARG A N   1 
ATOM   2989 C CA  . ARG A 1 392 ? -10.120 -62.292 12.943  1.00 50.09  ? 393 ARG A CA  1 
ATOM   2990 C C   . ARG A 1 392 ? -10.629 -60.861 12.795  1.00 43.56  ? 393 ARG A C   1 
ATOM   2991 O O   . ARG A 1 392 ? -9.856  -59.918 12.953  1.00 50.55  ? 393 ARG A O   1 
ATOM   2992 C CB  . ARG A 1 392 ? -9.670  -62.850 11.590  1.00 48.89  ? 393 ARG A CB  1 
ATOM   2993 C CG  . ARG A 1 392 ? -8.701  -64.033 11.668  1.00 52.23  ? 393 ARG A CG  1 
ATOM   2994 C CD  . ARG A 1 392 ? -8.320  -64.410 10.219  1.00 49.60  ? 393 ARG A CD  1 
ATOM   2995 N NE  . ARG A 1 392 ? -7.332  -65.484 10.112  1.00 51.92  ? 393 ARG A NE  1 
ATOM   2996 C CZ  . ARG A 1 392 ? -7.632  -66.780 10.184  1.00 53.99  ? 393 ARG A CZ  1 
ATOM   2997 N NH1 . ARG A 1 392 ? -8.884  -67.157 10.418  1.00 52.37  ? 393 ARG A NH1 1 
ATOM   2998 N NH2 . ARG A 1 392 ? -6.687  -67.694 10.043  1.00 52.26  ? 393 ARG A NH2 1 
ATOM   2999 N N   . LEU A 1 393 ? -11.921 -60.694 12.503  1.00 38.83  ? 394 LEU A N   1 
ATOM   3000 C CA  . LEU A 1 393 ? -12.498 -59.347 12.361  1.00 41.36  ? 394 LEU A CA  1 
ATOM   3001 C C   . LEU A 1 393 ? -12.523 -58.594 13.706  1.00 49.14  ? 394 LEU A C   1 
ATOM   3002 O O   . LEU A 1 393 ? -12.301 -57.383 13.755  1.00 41.17  ? 394 LEU A O   1 
ATOM   3003 C CB  . LEU A 1 393 ? -13.912 -59.392 11.781  1.00 40.07  ? 394 LEU A CB  1 
ATOM   3004 C CG  . LEU A 1 393 ? -14.080 -59.844 10.324  1.00 54.81  ? 394 LEU A CG  1 
ATOM   3005 C CD1 . LEU A 1 393 ? -15.526 -60.236 10.034  1.00 43.87  ? 394 LEU A CD1 1 
ATOM   3006 C CD2 . LEU A 1 393 ? -13.638 -58.745 9.377   1.00 40.17  ? 394 LEU A CD2 1 
ATOM   3007 N N   . ARG A 1 394 ? -12.818 -59.317 14.781  1.00 44.44  ? 395 ARG A N   1 
ATOM   3008 C CA  . ARG A 1 394 ? -12.795 -58.739 16.117  1.00 44.29  ? 395 ARG A CA  1 
ATOM   3009 C C   . ARG A 1 394 ? -11.387 -58.239 16.417  1.00 43.32  ? 395 ARG A C   1 
ATOM   3010 O O   . ARG A 1 394 ? -11.205 -57.091 16.820  1.00 43.34  ? 395 ARG A O   1 
ATOM   3011 C CB  . ARG A 1 394 ? -13.218 -59.779 17.154  1.00 42.93  ? 395 ARG A CB  1 
ATOM   3012 C CG  . ARG A 1 394 ? -13.280 -59.281 18.609  1.00 42.73  ? 395 ARG A CG  1 
ATOM   3013 C CD  . ARG A 1 394 ? -13.568 -60.456 19.528  1.00 36.18  ? 395 ARG A CD  1 
ATOM   3014 N NE  . ARG A 1 394 ? -12.488 -61.442 19.502  1.00 44.31  ? 395 ARG A NE  1 
ATOM   3015 C CZ  . ARG A 1 394 ? -12.615 -62.716 19.883  1.00 53.79  ? 395 ARG A CZ  1 
ATOM   3016 N NH1 . ARG A 1 394 ? -13.786 -63.183 20.300  1.00 55.36  ? 395 ARG A NH1 1 
ATOM   3017 N NH2 . ARG A 1 394 ? -11.570 -63.537 19.840  1.00 51.71  ? 395 ARG A NH2 1 
ATOM   3018 N N   . GLU A 1 395 ? -10.395 -59.098 16.199  1.00 44.95  ? 396 GLU A N   1 
ATOM   3019 C CA  . GLU A 1 395 ? -9.004  -58.733 16.450  1.00 50.62  ? 396 GLU A CA  1 
ATOM   3020 C C   . GLU A 1 395 ? -8.528  -57.579 15.562  1.00 46.14  ? 396 GLU A C   1 
ATOM   3021 O O   . GLU A 1 395 ? -7.773  -56.718 16.009  1.00 45.41  ? 396 GLU A O   1 
ATOM   3022 C CB  . GLU A 1 395 ? -8.068  -59.948 16.326  1.00 43.38  ? 396 GLU A CB  1 
ATOM   3023 C CG  . GLU A 1 395 ? -7.637  -60.581 17.662  1.00 65.73  ? 396 GLU A CG  1 
ATOM   3024 C CD  . GLU A 1 395 ? -8.780  -61.269 18.425  1.00 75.32  ? 396 GLU A CD  1 
ATOM   3025 O OE1 . GLU A 1 395 ? -9.655  -60.558 18.977  1.00 81.93  ? 396 GLU A OE1 1 
ATOM   3026 O OE2 . GLU A 1 395 ? -8.799  -62.525 18.482  1.00 68.36  ? 396 GLU A OE2 1 
ATOM   3027 N N   . ALA A 1 396 ? -8.981  -57.540 14.314  1.00 46.94  ? 397 ALA A N   1 
ATOM   3028 C CA  . ALA A 1 396 ? -8.531  -56.502 13.394  1.00 37.93  ? 397 ALA A CA  1 
ATOM   3029 C C   . ALA A 1 396 ? -9.075  -55.118 13.767  1.00 41.90  ? 397 ALA A C   1 
ATOM   3030 O O   . ALA A 1 396 ? -8.342  -54.134 13.714  1.00 42.12  ? 397 ALA A O   1 
ATOM   3031 C CB  . ALA A 1 396 ? -8.888  -56.869 11.898  1.00 40.12  ? 397 ALA A CB  1 
ATOM   3032 N N   . LEU A 1 397 ? -10.354 -55.031 14.130  1.00 39.97  ? 398 LEU A N   1 
ATOM   3033 C CA  . LEU A 1 397 ? -10.926 -53.742 14.547  1.00 42.75  ? 398 LEU A CA  1 
ATOM   3034 C C   . LEU A 1 397 ? -10.287 -53.235 15.865  1.00 51.23  ? 398 LEU A C   1 
ATOM   3035 O O   . LEU A 1 397 ? -10.100 -52.024 16.060  1.00 42.35  ? 398 LEU A O   1 
ATOM   3036 C CB  . LEU A 1 397 ? -12.444 -53.848 14.724  1.00 45.02  ? 398 LEU A CB  1 
ATOM   3037 C CG  . LEU A 1 397 ? -13.141 -52.498 14.927  1.00 48.20  ? 398 LEU A CG  1 
ATOM   3038 C CD1 . LEU A 1 397 ? -12.970 -51.600 13.688  1.00 41.91  ? 398 LEU A CD1 1 
ATOM   3039 C CD2 . LEU A 1 397 ? -14.603 -52.671 15.254  1.00 47.26  ? 398 LEU A CD2 1 
ATOM   3040 N N   . SER A 1 398 ? -9.947  -54.166 16.758  1.00 40.66  ? 399 SER A N   1 
ATOM   3041 C CA  . SER A 1 398 ? -9.224  -53.830 17.979  1.00 43.50  ? 399 SER A CA  1 
ATOM   3042 C C   . SER A 1 398 ? -7.903  -53.130 17.620  1.00 47.61  ? 399 SER A C   1 
ATOM   3043 O O   . SER A 1 398 ? -7.576  -52.051 18.155  1.00 43.10  ? 399 SER A O   1 
ATOM   3044 C CB  . SER A 1 398 ? -8.972  -55.105 18.802  1.00 41.10  ? 399 SER A CB  1 
ATOM   3045 O OG  . SER A 1 398 ? -8.196  -54.861 19.970  1.00 50.10  ? 399 SER A OG  1 
ATOM   3046 N N   . ASP A 1 399 ? -7.169  -53.751 16.697  1.00 49.45  ? 400 ASP A N   1 
ATOM   3047 C CA  . ASP A 1 399 ? -5.930  -53.210 16.125  1.00 45.59  ? 400 ASP A CA  1 
ATOM   3048 C C   . ASP A 1 399 ? -6.101  -51.862 15.440  1.00 45.00  ? 400 ASP A C   1 
ATOM   3049 O O   . ASP A 1 399 ? -5.286  -50.961 15.626  1.00 43.52  ? 400 ASP A O   1 
ATOM   3050 C CB  . ASP A 1 399 ? -5.349  -54.182 15.093  1.00 51.63  ? 400 ASP A CB  1 
ATOM   3051 C CG  . ASP A 1 399 ? -4.714  -55.386 15.725  1.00 50.40  ? 400 ASP A CG  1 
ATOM   3052 O OD1 . ASP A 1 399 ? -4.365  -55.320 16.929  1.00 55.77  ? 400 ASP A OD1 1 
ATOM   3053 O OD2 . ASP A 1 399 ? -4.549  -56.398 15.013  1.00 60.20  ? 400 ASP A OD2 1 
ATOM   3054 N N   . VAL A 1 400 ? -7.137  -51.725 14.625  1.00 41.16  ? 401 VAL A N   1 
ATOM   3055 C CA  . VAL A 1 400 ? -7.418  -50.428 14.013  1.00 43.78  ? 401 VAL A CA  1 
ATOM   3056 C C   . VAL A 1 400 ? -7.494  -49.310 15.076  1.00 45.12  ? 401 VAL A C   1 
ATOM   3057 O O   . VAL A 1 400 ? -6.767  -48.314 15.002  1.00 45.99  ? 401 VAL A O   1 
ATOM   3058 C CB  . VAL A 1 400 ? -8.709  -50.457 13.159  1.00 42.71  ? 401 VAL A CB  1 
ATOM   3059 C CG1 . VAL A 1 400 ? -9.138  -49.047 12.793  1.00 43.23  ? 401 VAL A CG1 1 
ATOM   3060 C CG2 . VAL A 1 400 ? -8.501  -51.306 11.877  1.00 42.29  ? 401 VAL A CG2 1 
ATOM   3061 N N   . VAL A 1 401 ? -8.356  -49.494 16.069  1.00 40.10  ? 402 VAL A N   1 
ATOM   3062 C CA  . VAL A 1 401 ? -8.572  -48.480 17.090  1.00 41.78  ? 402 VAL A CA  1 
ATOM   3063 C C   . VAL A 1 401 ? -7.303  -48.251 17.919  1.00 41.67  ? 402 VAL A C   1 
ATOM   3064 O O   . VAL A 1 401 ? -6.914  -47.103 18.173  1.00 38.23  ? 402 VAL A O   1 
ATOM   3065 C CB  . VAL A 1 401 ? -9.779  -48.836 17.988  1.00 41.64  ? 402 VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 401 ? -9.817  -47.939 19.233  1.00 41.67  ? 402 VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 401 ? -11.077 -48.704 17.187  1.00 42.74  ? 402 VAL A CG2 1 
ATOM   3068 N N   . GLY A 1 402 ? -6.653  -49.345 18.309  1.00 39.84  ? 403 GLY A N   1 
ATOM   3069 C CA  . GLY A 1 402 ? -5.422  -49.273 19.091  1.00 49.36  ? 403 GLY A CA  1 
ATOM   3070 C C   . GLY A 1 402 ? -4.213  -48.666 18.391  1.00 44.53  ? 403 GLY A C   1 
ATOM   3071 O O   . GLY A 1 402 ? -3.449  -47.904 18.997  1.00 40.09  ? 403 GLY A O   1 
ATOM   3072 N N   . ASP A 1 403 ? -4.027  -49.004 17.115  1.00 39.46  ? 404 ASP A N   1 
ATOM   3073 C CA  . ASP A 1 403 ? -2.884  -48.514 16.346  1.00 36.54  ? 404 ASP A CA  1 
ATOM   3074 C C   . ASP A 1 403 ? -3.047  -47.029 16.079  1.00 40.73  ? 404 ASP A C   1 
ATOM   3075 O O   . ASP A 1 403 ? -2.124  -46.234 16.313  1.00 39.38  ? 404 ASP A O   1 
ATOM   3076 C CB  . ASP A 1 403 ? -2.744  -49.266 14.996  1.00 39.62  ? 404 ASP A CB  1 
ATOM   3077 C CG  . ASP A 1 403 ? -2.385  -50.743 15.175  1.00 43.18  ? 404 ASP A CG  1 
ATOM   3078 O OD1 . ASP A 1 403 ? -1.961  -51.124 16.290  1.00 45.47  ? 404 ASP A OD1 1 
ATOM   3079 O OD2 . ASP A 1 403 ? -2.533  -51.522 14.206  1.00 42.58  ? 404 ASP A OD2 1 
ATOM   3080 N N   . HIS A 1 404 ? -4.236  -46.670 15.599  1.00 37.22  ? 405 HIS A N   1 
ATOM   3081 C CA  . HIS A 1 404 ? -4.578  -45.295 15.227  1.00 40.39  ? 405 HIS A CA  1 
ATOM   3082 C C   . HIS A 1 404 ? -4.470  -44.323 16.420  1.00 41.39  ? 405 HIS A C   1 
ATOM   3083 O O   . HIS A 1 404 ? -3.880  -43.242 16.336  1.00 39.97  ? 405 HIS A O   1 
ATOM   3084 C CB  . HIS A 1 404 ? -5.997  -45.303 14.632  1.00 39.92  ? 405 HIS A CB  1 
ATOM   3085 C CG  . HIS A 1 404 ? -6.574  -43.946 14.366  1.00 41.61  ? 405 HIS A CG  1 
ATOM   3086 N ND1 . HIS A 1 404 ? -5.924  -42.985 13.622  1.00 42.62  ? 405 HIS A ND1 1 
ATOM   3087 C CD2 . HIS A 1 404 ? -7.760  -43.398 14.733  1.00 48.40  ? 405 HIS A CD2 1 
ATOM   3088 C CE1 . HIS A 1 404 ? -6.680  -41.902 13.543  1.00 34.15  ? 405 HIS A CE1 1 
ATOM   3089 N NE2 . HIS A 1 404 ? -7.802  -42.127 14.207  1.00 45.64  ? 405 HIS A NE2 1 
ATOM   3090 N N   . ASN A 1 405 ? -5.034  -44.721 17.541  1.00 36.02  ? 406 ASN A N   1 
ATOM   3091 C CA  . ASN A 1 405 ? -5.076  -43.841 18.705  1.00 46.75  ? 406 ASN A CA  1 
ATOM   3092 C C   . ASN A 1 405 ? -3.855  -43.869 19.626  1.00 41.00  ? 406 ASN A C   1 
ATOM   3093 O O   . ASN A 1 405 ? -3.542  -42.857 20.233  1.00 46.79  ? 406 ASN A O   1 
ATOM   3094 C CB  . ASN A 1 405 ? -6.362  -44.086 19.509  1.00 36.31  ? 406 ASN A CB  1 
ATOM   3095 C CG  . ASN A 1 405 ? -7.607  -43.639 18.749  1.00 40.36  ? 406 ASN A CG  1 
ATOM   3096 O OD1 . ASN A 1 405 ? -7.828  -42.441 18.527  1.00 39.03  ? 406 ASN A OD1 1 
ATOM   3097 N ND2 . ASN A 1 405 ? -8.412  -44.599 18.335  1.00 36.53  ? 406 ASN A ND2 1 
ATOM   3098 N N   . VAL A 1 406 ? -3.183  -45.015 19.741  1.00 41.92  ? 407 VAL A N   1 
ATOM   3099 C CA  . VAL A 1 406 ? -2.116  -45.171 20.739  1.00 41.58  ? 407 VAL A CA  1 
ATOM   3100 C C   . VAL A 1 406 ? -0.767  -45.655 20.204  1.00 43.55  ? 407 VAL A C   1 
ATOM   3101 O O   . VAL A 1 406 ? 0.228   -44.946 20.322  1.00 43.06  ? 407 VAL A O   1 
ATOM   3102 C CB  . VAL A 1 406 ? -2.529  -46.102 21.910  1.00 41.21  ? 407 VAL A CB  1 
ATOM   3103 C CG1 . VAL A 1 406 ? -1.372  -46.218 22.930  1.00 38.67  ? 407 VAL A CG1 1 
ATOM   3104 C CG2 . VAL A 1 406 ? -3.774  -45.572 22.609  1.00 40.99  ? 407 VAL A CG2 1 
ATOM   3105 N N   . VAL A 1 407 ? -0.738  -46.858 19.631  1.00 41.55  ? 408 VAL A N   1 
ATOM   3106 C CA  . VAL A 1 407 ? 0.517   -47.477 19.220  1.00 37.94  ? 408 VAL A CA  1 
ATOM   3107 C C   . VAL A 1 407 ? 1.311   -46.627 18.231  1.00 42.17  ? 408 VAL A C   1 
ATOM   3108 O O   . VAL A 1 407 ? 2.491   -46.320 18.461  1.00 41.47  ? 408 VAL A O   1 
ATOM   3109 C CB  . VAL A 1 407 ? 0.337   -48.922 18.665  1.00 45.32  ? 408 VAL A CB  1 
ATOM   3110 C CG1 . VAL A 1 407 ? 1.702   -49.502 18.247  1.00 44.48  ? 408 VAL A CG1 1 
ATOM   3111 C CG2 . VAL A 1 407 ? -0.323  -49.826 19.703  1.00 37.82  ? 408 VAL A CG2 1 
ATOM   3112 N N   . CYS A 1 408 ? 0.668   -46.238 17.136  1.00 40.42  ? 409 CYS A N   1 
ATOM   3113 C CA  . CYS A 1 408 ? 1.384   -45.493 16.104  1.00 43.37  ? 409 CYS A CA  1 
ATOM   3114 C C   . CYS A 1 408 ? 1.771   -44.051 16.514  1.00 41.66  ? 409 CYS A C   1 
ATOM   3115 O O   . CYS A 1 408 ? 2.869   -43.596 16.201  1.00 44.84  ? 409 CYS A O   1 
ATOM   3116 C CB  . CYS A 1 408 ? 0.676   -45.621 14.718  1.00 33.34  ? 409 CYS A CB  1 
ATOM   3117 S SG  . CYS A 1 408 ? 0.445   -47.400 14.246  1.00 41.80  ? 409 CYS A SG  1 
ATOM   3118 N N   . PRO A 1 409 ? 0.886   -43.328 17.221  1.00 36.06  ? 410 PRO A N   1 
ATOM   3119 C CA  . PRO A 1 409 ? 1.359   -42.050 17.790  1.00 42.77  ? 410 PRO A CA  1 
ATOM   3120 C C   . PRO A 1 409 ? 2.566   -42.201 18.764  1.00 45.02  ? 410 PRO A C   1 
ATOM   3121 O O   . PRO A 1 409 ? 3.494   -41.389 18.712  1.00 40.19  ? 410 PRO A O   1 
ATOM   3122 C CB  . PRO A 1 409 ? 0.125   -41.528 18.536  1.00 46.05  ? 410 PRO A CB  1 
ATOM   3123 C CG  . PRO A 1 409 ? -1.020  -42.067 17.749  1.00 42.34  ? 410 PRO A CG  1 
ATOM   3124 C CD  . PRO A 1 409 ? -0.581  -43.452 17.303  1.00 40.08  ? 410 PRO A CD  1 
ATOM   3125 N N   . VAL A 1 410 ? 2.559   -43.218 19.621  1.00 39.75  ? 411 VAL A N   1 
ATOM   3126 C CA  . VAL A 1 410 ? 3.702   -43.464 20.519  1.00 42.57  ? 411 VAL A CA  1 
ATOM   3127 C C   . VAL A 1 410 ? 4.984   -43.853 19.733  1.00 50.26  ? 411 VAL A C   1 
ATOM   3128 O O   . VAL A 1 410 ? 6.074   -43.346 20.014  1.00 42.02  ? 411 VAL A O   1 
ATOM   3129 C CB  . VAL A 1 410 ? 3.383   -44.515 21.625  1.00 44.25  ? 411 VAL A CB  1 
ATOM   3130 C CG1 . VAL A 1 410 ? 4.655   -44.962 22.330  1.00 41.63  ? 411 VAL A CG1 1 
ATOM   3131 C CG2 . VAL A 1 410 ? 2.399   -43.958 22.667  1.00 37.86  ? 411 VAL A CG2 1 
ATOM   3132 N N   . ALA A 1 411 ? 4.843   -44.729 18.740  1.00 40.48  ? 412 ALA A N   1 
ATOM   3133 C CA  . ALA A 1 411 ? 5.976   -45.108 17.890  1.00 42.59  ? 412 ALA A CA  1 
ATOM   3134 C C   . ALA A 1 411 ? 6.599   -43.924 17.162  1.00 41.99  ? 412 ALA A C   1 
ATOM   3135 O O   . ALA A 1 411 ? 7.830   -43.826 17.048  1.00 41.46  ? 412 ALA A O   1 
ATOM   3136 C CB  . ALA A 1 411 ? 5.575   -46.193 16.883  1.00 37.68  ? 412 ALA A CB  1 
ATOM   3137 N N   . GLN A 1 412 ? 5.757   -43.025 16.668  1.00 43.95  ? 413 GLN A N   1 
ATOM   3138 C CA  . GLN A 1 412 ? 6.252   -41.849 15.966  1.00 37.83  ? 413 GLN A CA  1 
ATOM   3139 C C   . GLN A 1 412 ? 6.959   -40.871 16.905  1.00 51.31  ? 413 GLN A C   1 
ATOM   3140 O O   . GLN A 1 412 ? 8.001   -40.308 16.561  1.00 49.80  ? 413 GLN A O   1 
ATOM   3141 C CB  . GLN A 1 412 ? 5.119   -41.134 15.235  1.00 48.25  ? 413 GLN A CB  1 
ATOM   3142 C CG  . GLN A 1 412 ? 5.440   -39.678 14.973  1.00 50.61  ? 413 GLN A CG  1 
ATOM   3143 C CD  . GLN A 1 412 ? 4.868   -39.174 13.691  1.00 57.63  ? 413 GLN A CD  1 
ATOM   3144 O OE1 . GLN A 1 412 ? 3.662   -38.959 13.583  1.00 70.97  ? 413 GLN A OE1 1 
ATOM   3145 N NE2 . GLN A 1 412 ? 5.730   -38.968 12.701  1.00 72.09  ? 413 GLN A NE2 1 
ATOM   3146 N N   . LEU A 1 413 ? 6.379   -40.647 18.083  1.00 47.51  ? 414 LEU A N   1 
ATOM   3147 C CA  . LEU A 1 413 ? 7.067   -39.879 19.128  1.00 42.22  ? 414 LEU A CA  1 
ATOM   3148 C C   . LEU A 1 413 ? 8.434   -40.487 19.460  1.00 37.99  ? 414 LEU A C   1 
ATOM   3149 O O   . LEU A 1 413 ? 9.435   -39.775 19.573  1.00 41.05  ? 414 LEU A O   1 
ATOM   3150 C CB  . LEU A 1 413 ? 6.221   -39.806 20.408  1.00 37.28  ? 414 LEU A CB  1 
ATOM   3151 C CG  . LEU A 1 413 ? 6.917   -39.166 21.638  1.00 44.21  ? 414 LEU A CG  1 
ATOM   3152 C CD1 . LEU A 1 413 ? 6.865   -37.666 21.576  1.00 51.69  ? 414 LEU A CD1 1 
ATOM   3153 C CD2 . LEU A 1 413 ? 6.289   -39.628 22.886  1.00 49.82  ? 414 LEU A CD2 1 
ATOM   3154 N N   . ALA A 1 414 ? 8.478   -41.803 19.621  1.00 39.10  ? 415 ALA A N   1 
ATOM   3155 C CA  . ALA A 1 414 ? 9.722   -42.471 20.003  1.00 42.83  ? 415 ALA A CA  1 
ATOM   3156 C C   . ALA A 1 414 ? 10.775  -42.367 18.890  1.00 49.33  ? 415 ALA A C   1 
ATOM   3157 O O   . ALA A 1 414 ? 11.950  -42.077 19.144  1.00 49.93  ? 415 ALA A O   1 
ATOM   3158 C CB  . ALA A 1 414 ? 9.455   -43.933 20.352  1.00 45.12  ? 415 ALA A CB  1 
ATOM   3159 N N   . GLY A 1 415 ? 10.343  -42.592 17.656  1.00 42.25  ? 416 GLY A N   1 
ATOM   3160 C CA  . GLY A 1 415 ? 11.248  -42.541 16.524  1.00 49.00  ? 416 GLY A CA  1 
ATOM   3161 C C   . GLY A 1 415 ? 11.855  -41.165 16.349  1.00 43.56  ? 416 GLY A C   1 
ATOM   3162 O O   . GLY A 1 415 ? 13.066  -41.006 16.183  1.00 49.50  ? 416 GLY A O   1 
ATOM   3163 N N   . ARG A 1 416 ? 11.009  -40.153 16.410  1.00 43.97  ? 417 ARG A N   1 
ATOM   3164 C CA  . ARG A 1 416 ? 11.473  -38.797 16.165  1.00 40.82  ? 417 ARG A CA  1 
ATOM   3165 C C   . ARG A 1 416 ? 12.343  -38.298 17.309  1.00 52.98  ? 417 ARG A C   1 
ATOM   3166 O O   . ARG A 1 416 ? 13.348  -37.626 17.072  1.00 53.30  ? 417 ARG A O   1 
ATOM   3167 C CB  . ARG A 1 416 ? 10.297  -37.841 15.905  1.00 37.57  ? 417 ARG A CB  1 
ATOM   3168 C CG  . ARG A 1 416 ? 9.641   -38.010 14.562  1.00 59.29  ? 417 ARG A CG  1 
ATOM   3169 C CD  . ARG A 1 416 ? 10.715  -38.086 13.494  1.00 57.12  ? 417 ARG A CD  1 
ATOM   3170 N NE  . ARG A 1 416 ? 10.269  -37.530 12.231  1.00 86.29  ? 417 ARG A NE  1 
ATOM   3171 C CZ  . ARG A 1 416 ? 10.580  -36.312 11.810  1.00 77.08  ? 417 ARG A CZ  1 
ATOM   3172 N NH1 . ARG A 1 416 ? 11.339  -35.521 12.556  1.00 78.25  ? 417 ARG A NH1 1 
ATOM   3173 N NH2 . ARG A 1 416 ? 10.127  -35.888 10.645  1.00 70.04  ? 417 ARG A NH2 1 
ATOM   3174 N N   . LEU A 1 417 ? 11.970  -38.614 18.550  1.00 48.62  ? 418 LEU A N   1 
ATOM   3175 C CA  . LEU A 1 417 ? 12.801  -38.200 19.689  1.00 49.79  ? 418 LEU A CA  1 
ATOM   3176 C C   . LEU A 1 417 ? 14.192  -38.828 19.639  1.00 40.96  ? 418 LEU A C   1 
ATOM   3177 O O   . LEU A 1 417 ? 15.189  -38.142 19.851  1.00 46.76  ? 418 LEU A O   1 
ATOM   3178 C CB  . LEU A 1 417 ? 12.144  -38.504 21.054  1.00 47.47  ? 418 LEU A CB  1 
ATOM   3179 C CG  . LEU A 1 417 ? 10.849  -37.771 21.433  1.00 53.00  ? 418 LEU A CG  1 
ATOM   3180 C CD1 . LEU A 1 417 ? 10.569  -37.851 22.925  1.00 51.15  ? 418 LEU A CD1 1 
ATOM   3181 C CD2 . LEU A 1 417 ? 10.848  -36.348 20.982  1.00 56.21  ? 418 LEU A CD2 1 
ATOM   3182 N N   . ALA A 1 418 ? 14.244  -40.135 19.399  1.00 39.42  ? 419 ALA A N   1 
ATOM   3183 C CA  . ALA A 1 418 ? 15.515  -40.857 19.330  1.00 46.05  ? 419 ALA A CA  1 
ATOM   3184 C C   . ALA A 1 418 ? 16.403  -40.313 18.202  1.00 53.47  ? 419 ALA A C   1 
ATOM   3185 O O   . ALA A 1 418 ? 17.610  -40.142 18.379  1.00 57.15  ? 419 ALA A O   1 
ATOM   3186 C CB  . ALA A 1 418 ? 15.275  -42.371 19.136  1.00 38.52  ? 419 ALA A CB  1 
ATOM   3187 N N   . ALA A 1 419 ? 15.799  -40.043 17.046  1.00 53.04  ? 420 ALA A N   1 
ATOM   3188 C CA  . ALA A 1 419 ? 16.545  -39.530 15.894  1.00 51.68  ? 420 ALA A CA  1 
ATOM   3189 C C   . ALA A 1 419 ? 16.994  -38.083 16.093  1.00 55.58  ? 420 ALA A C   1 
ATOM   3190 O O   . ALA A 1 419 ? 17.870  -37.607 15.385  1.00 57.65  ? 420 ALA A O   1 
ATOM   3191 C CB  . ALA A 1 419 ? 15.715  -39.645 14.630  1.00 46.93  ? 420 ALA A CB  1 
ATOM   3192 N N   . GLN A 1 420 ? 16.404  -37.385 17.057  1.00 47.83  ? 421 GLN A N   1 
ATOM   3193 C CA  . GLN A 1 420 ? 16.713  -35.970 17.247  1.00 47.68  ? 421 GLN A CA  1 
ATOM   3194 C C   . GLN A 1 420 ? 17.359  -35.666 18.587  1.00 54.09  ? 421 GLN A C   1 
ATOM   3195 O O   . GLN A 1 420 ? 17.235  -34.555 19.115  1.00 54.65  ? 421 GLN A O   1 
ATOM   3196 C CB  . GLN A 1 420 ? 15.475  -35.110 17.006  1.00 45.43  ? 421 GLN A CB  1 
ATOM   3197 C CG  . GLN A 1 420 ? 15.005  -35.230 15.554  1.00 55.87  ? 421 GLN A CG  1 
ATOM   3198 C CD  . GLN A 1 420 ? 13.596  -34.733 15.336  1.00 62.37  ? 421 GLN A CD  1 
ATOM   3199 O OE1 . GLN A 1 420 ? 12.862  -35.286 14.521  1.00 61.57  ? 421 GLN A OE1 1 
ATOM   3200 N NE2 . GLN A 1 420 ? 13.209  -33.688 16.061  1.00 56.05  ? 421 GLN A NE2 1 
ATOM   3201 N N   . GLY A 1 421 ? 18.051  -36.665 19.131  1.00 54.68  ? 422 GLY A N   1 
ATOM   3202 C CA  . GLY A 1 421 ? 18.924  -36.440 20.261  1.00 52.97  ? 422 GLY A CA  1 
ATOM   3203 C C   . GLY A 1 421 ? 18.589  -37.118 21.576  1.00 60.36  ? 422 GLY A C   1 
ATOM   3204 O O   . GLY A 1 421 ? 19.449  -37.189 22.449  1.00 49.28  ? 422 GLY A O   1 
ATOM   3205 N N   . ALA A 1 422 ? 17.368  -37.621 21.744  1.00 50.79  ? 423 ALA A N   1 
ATOM   3206 C CA  . ALA A 1 422 ? 16.996  -38.155 23.055  1.00 50.88  ? 423 ALA A CA  1 
ATOM   3207 C C   . ALA A 1 422 ? 17.368  -39.612 23.189  1.00 44.36  ? 423 ALA A C   1 
ATOM   3208 O O   . ALA A 1 422 ? 17.528  -40.308 22.197  1.00 55.06  ? 423 ALA A O   1 
ATOM   3209 C CB  . ALA A 1 422 ? 15.520  -37.966 23.326  1.00 45.94  ? 423 ALA A CB  1 
ATOM   3210 N N   . ARG A 1 423 ? 17.504  -40.069 24.428  1.00 47.07  ? 424 ARG A N   1 
ATOM   3211 C CA  . ARG A 1 423 ? 17.669  -41.487 24.688  1.00 51.60  ? 424 ARG A CA  1 
ATOM   3212 C C   . ARG A 1 423 ? 16.315  -42.069 25.112  1.00 48.77  ? 424 ARG A C   1 
ATOM   3213 O O   . ARG A 1 423 ? 15.746  -41.642 26.113  1.00 50.30  ? 424 ARG A O   1 
ATOM   3214 C CB  . ARG A 1 423 ? 18.747  -41.728 25.753  1.00 43.11  ? 424 ARG A CB  1 
ATOM   3215 C CG  . ARG A 1 423 ? 19.018  -43.210 26.007  1.00 54.42  ? 424 ARG A CG  1 
ATOM   3216 C CD  . ARG A 1 423 ? 20.418  -43.449 26.579  1.00 64.40  ? 424 ARG A CD  1 
ATOM   3217 N NE  . ARG A 1 423 ? 20.399  -43.611 28.037  1.00 79.84  ? 424 ARG A NE  1 
ATOM   3218 C CZ  . ARG A 1 423 ? 20.712  -42.659 28.909  1.00 67.17  ? 424 ARG A CZ  1 
ATOM   3219 N NH1 . ARG A 1 423 ? 21.074  -41.454 28.483  1.00 76.83  ? 424 ARG A NH1 1 
ATOM   3220 N NH2 . ARG A 1 423 ? 20.665  -42.912 30.207  1.00 69.22  ? 424 ARG A NH2 1 
ATOM   3221 N N   . VAL A 1 424 ? 15.815  -43.042 24.349  1.00 47.85  ? 425 VAL A N   1 
ATOM   3222 C CA  . VAL A 1 424 ? 14.453  -43.548 24.505  1.00 41.43  ? 425 VAL A CA  1 
ATOM   3223 C C   . VAL A 1 424 ? 14.474  -45.023 24.902  1.00 46.85  ? 425 VAL A C   1 
ATOM   3224 O O   . VAL A 1 424 ? 15.222  -45.804 24.320  1.00 48.92  ? 425 VAL A O   1 
ATOM   3225 C CB  . VAL A 1 424 ? 13.650  -43.408 23.160  1.00 49.21  ? 425 VAL A CB  1 
ATOM   3226 C CG1 . VAL A 1 424 ? 12.260  -44.061 23.264  1.00 38.68  ? 425 VAL A CG1 1 
ATOM   3227 C CG2 . VAL A 1 424 ? 13.534  -41.940 22.733  1.00 38.24  ? 425 VAL A CG2 1 
ATOM   3228 N N   . TYR A 1 425 ? 13.655  -45.400 25.886  1.00 43.25  ? 426 TYR A N   1 
ATOM   3229 C CA  . TYR A 1 425 ? 13.389  -46.808 26.170  1.00 45.57  ? 426 TYR A CA  1 
ATOM   3230 C C   . TYR A 1 425 ? 11.918  -47.151 25.877  1.00 50.57  ? 426 TYR A C   1 
ATOM   3231 O O   . TYR A 1 425 ? 11.024  -46.373 26.212  1.00 44.97  ? 426 TYR A O   1 
ATOM   3232 C CB  . TYR A 1 425 ? 13.755  -47.142 27.629  1.00 44.06  ? 426 TYR A CB  1 
ATOM   3233 C CG  . TYR A 1 425 ? 15.226  -46.927 27.923  1.00 44.00  ? 426 TYR A CG  1 
ATOM   3234 C CD1 . TYR A 1 425 ? 16.143  -47.965 27.772  1.00 42.27  ? 426 TYR A CD1 1 
ATOM   3235 C CD2 . TYR A 1 425 ? 15.705  -45.678 28.322  1.00 43.86  ? 426 TYR A CD2 1 
ATOM   3236 C CE1 . TYR A 1 425 ? 17.509  -47.767 28.023  1.00 44.78  ? 426 TYR A CE1 1 
ATOM   3237 C CE2 . TYR A 1 425 ? 17.072  -45.469 28.595  1.00 46.35  ? 426 TYR A CE2 1 
ATOM   3238 C CZ  . TYR A 1 425 ? 17.962  -46.519 28.437  1.00 47.48  ? 426 TYR A CZ  1 
ATOM   3239 O OH  . TYR A 1 425 ? 19.303  -46.329 28.698  1.00 48.60  ? 426 TYR A OH  1 
ATOM   3240 N N   . ALA A 1 426 ? 11.672  -48.314 25.269  1.00 39.05  ? 427 ALA A N   1 
ATOM   3241 C CA  . ALA A 1 426 ? 10.321  -48.695 24.849  1.00 38.66  ? 427 ALA A CA  1 
ATOM   3242 C C   . ALA A 1 426 ? 9.923   -50.050 25.400  1.00 42.04  ? 427 ALA A C   1 
ATOM   3243 O O   . ALA A 1 426 ? 10.758  -50.953 25.497  1.00 42.44  ? 427 ALA A O   1 
ATOM   3244 C CB  . ALA A 1 426 ? 10.225  -48.712 23.291  1.00 39.83  ? 427 ALA A CB  1 
ATOM   3245 N N   . TYR A 1 427 ? 8.646   -50.208 25.741  1.00 35.65  ? 428 TYR A N   1 
ATOM   3246 C CA  . TYR A 1 427 ? 8.169   -51.492 26.232  1.00 39.08  ? 428 TYR A CA  1 
ATOM   3247 C C   . TYR A 1 427 ? 6.813   -51.842 25.678  1.00 41.49  ? 428 TYR A C   1 
ATOM   3248 O O   . TYR A 1 427 ? 6.026   -50.961 25.291  1.00 41.25  ? 428 TYR A O   1 
ATOM   3249 C CB  . TYR A 1 427 ? 8.069   -51.504 27.784  1.00 41.16  ? 428 TYR A CB  1 
ATOM   3250 C CG  . TYR A 1 427 ? 6.986   -50.576 28.306  1.00 37.48  ? 428 TYR A CG  1 
ATOM   3251 C CD1 . TYR A 1 427 ? 5.652   -50.982 28.368  1.00 35.71  ? 428 TYR A CD1 1 
ATOM   3252 C CD2 . TYR A 1 427 ? 7.300   -49.297 28.733  1.00 38.14  ? 428 TYR A CD2 1 
ATOM   3253 C CE1 . TYR A 1 427 ? 4.656   -50.125 28.828  1.00 38.81  ? 428 TYR A CE1 1 
ATOM   3254 C CE2 . TYR A 1 427 ? 6.312   -48.428 29.198  1.00 40.32  ? 428 TYR A CE2 1 
ATOM   3255 C CZ  . TYR A 1 427 ? 4.999   -48.841 29.241  1.00 43.65  ? 428 TYR A CZ  1 
ATOM   3256 O OH  . TYR A 1 427 ? 4.034   -47.962 29.698  1.00 37.96  ? 428 TYR A OH  1 
ATOM   3257 N N   . VAL A 1 428 ? 6.515   -53.136 25.693  1.00 37.76  ? 429 VAL A N   1 
ATOM   3258 C CA  . VAL A 1 428 ? 5.139   -53.584 25.545  1.00 41.82  ? 429 VAL A CA  1 
ATOM   3259 C C   . VAL A 1 428 ? 4.769   -54.393 26.770  1.00 43.68  ? 429 VAL A C   1 
ATOM   3260 O O   . VAL A 1 428 ? 5.491   -55.313 27.161  1.00 47.98  ? 429 VAL A O   1 
ATOM   3261 C CB  . VAL A 1 428 ? 4.927   -54.402 24.243  1.00 40.04  ? 429 VAL A CB  1 
ATOM   3262 C CG1 . VAL A 1 428 ? 3.495   -54.894 24.160  1.00 41.15  ? 429 VAL A CG1 1 
ATOM   3263 C CG2 . VAL A 1 428 ? 5.222   -53.507 23.054  1.00 48.51  ? 429 VAL A CG2 1 
ATOM   3264 N N   . PHE A 1 429 ? 3.654   -54.035 27.388  1.00 44.49  ? 430 PHE A N   1 
ATOM   3265 C CA  . PHE A 1 429 ? 3.230   -54.683 28.616  1.00 46.37  ? 430 PHE A CA  1 
ATOM   3266 C C   . PHE A 1 429 ? 2.265   -55.803 28.270  1.00 36.21  ? 430 PHE A C   1 
ATOM   3267 O O   . PHE A 1 429 ? 1.204   -55.561 27.712  1.00 47.95  ? 430 PHE A O   1 
ATOM   3268 C CB  . PHE A 1 429 ? 2.608   -53.653 29.571  1.00 40.77  ? 430 PHE A CB  1 
ATOM   3269 C CG  . PHE A 1 429 ? 2.219   -54.218 30.900  1.00 45.72  ? 430 PHE A CG  1 
ATOM   3270 C CD1 . PHE A 1 429 ? 3.119   -54.234 31.946  1.00 45.93  ? 430 PHE A CD1 1 
ATOM   3271 C CD2 . PHE A 1 429 ? 0.946   -54.727 31.107  1.00 46.56  ? 430 PHE A CD2 1 
ATOM   3272 C CE1 . PHE A 1 429 ? 2.754   -54.755 33.177  1.00 55.80  ? 430 PHE A CE1 1 
ATOM   3273 C CE2 . PHE A 1 429 ? 0.582   -55.252 32.327  1.00 45.70  ? 430 PHE A CE2 1 
ATOM   3274 C CZ  . PHE A 1 429 ? 1.482   -55.267 33.362  1.00 46.80  ? 430 PHE A CZ  1 
ATOM   3275 N N   . GLU A 1 430 ? 2.639   -57.030 28.599  1.00 44.00  ? 431 GLU A N   1 
ATOM   3276 C CA  . GLU A 1 430 ? 1.972   -58.203 28.044  1.00 51.89  ? 431 GLU A CA  1 
ATOM   3277 C C   . GLU A 1 430 ? 1.386   -59.161 29.078  1.00 54.81  ? 431 GLU A C   1 
ATOM   3278 O O   . GLU A 1 430 ? 0.999   -60.281 28.734  1.00 50.08  ? 431 GLU A O   1 
ATOM   3279 C CB  . GLU A 1 430 ? 2.942   -58.980 27.137  1.00 46.62  ? 431 GLU A CB  1 
ATOM   3280 C CG  . GLU A 1 430 ? 3.201   -58.303 25.792  1.00 54.97  ? 431 GLU A CG  1 
ATOM   3281 C CD  . GLU A 1 430 ? 3.956   -59.191 24.798  1.00 53.90  ? 431 GLU A CD  1 
ATOM   3282 O OE1 . GLU A 1 430 ? 3.601   -59.167 23.608  1.00 74.98  ? 431 GLU A OE1 1 
ATOM   3283 O OE2 . GLU A 1 430 ? 4.909   -59.895 25.196  1.00 63.83  ? 431 GLU A OE2 1 
ATOM   3284 N N   . HIS A 1 431 ? 1.321   -58.740 30.336  1.00 45.47  ? 432 HIS A N   1 
ATOM   3285 C CA  . HIS A 1 431 ? 0.783   -59.615 31.373  1.00 44.55  ? 432 HIS A CA  1 
ATOM   3286 C C   . HIS A 1 431 ? -0.681  -59.318 31.634  1.00 49.20  ? 432 HIS A C   1 
ATOM   3287 O O   . HIS A 1 431 ? -1.054  -58.172 31.880  1.00 49.57  ? 432 HIS A O   1 
ATOM   3288 C CB  . HIS A 1 431 ? 1.567   -59.491 32.685  1.00 47.44  ? 432 HIS A CB  1 
ATOM   3289 C CG  . HIS A 1 431 ? 0.988   -60.306 33.798  1.00 49.39  ? 432 HIS A CG  1 
ATOM   3290 N ND1 . HIS A 1 431 ? 1.031   -61.684 33.809  1.00 55.36  ? 432 HIS A ND1 1 
ATOM   3291 C CD2 . HIS A 1 431 ? 0.320   -59.941 34.920  1.00 53.00  ? 432 HIS A CD2 1 
ATOM   3292 C CE1 . HIS A 1 431 ? 0.432   -62.134 34.900  1.00 54.30  ? 432 HIS A CE1 1 
ATOM   3293 N NE2 . HIS A 1 431 ? -0.012  -61.097 35.589  1.00 51.97  ? 432 HIS A NE2 1 
ATOM   3294 N N   . ARG A 1 432 ? -1.514  -60.352 31.590  1.00 49.16  ? 433 ARG A N   1 
ATOM   3295 C CA  . ARG A 1 432 ? -2.918  -60.172 31.937  1.00 50.75  ? 433 ARG A CA  1 
ATOM   3296 C C   . ARG A 1 432 ? -3.099  -60.507 33.416  1.00 50.43  ? 433 ARG A C   1 
ATOM   3297 O O   . ARG A 1 432 ? -2.797  -61.616 33.840  1.00 56.33  ? 433 ARG A O   1 
ATOM   3298 C CB  . ARG A 1 432 ? -3.812  -61.051 31.060  1.00 49.12  ? 433 ARG A CB  1 
ATOM   3299 C CG  . ARG A 1 432 ? -5.285  -60.827 31.311  1.00 53.85  ? 433 ARG A CG  1 
ATOM   3300 C CD  . ARG A 1 432 ? -6.175  -61.736 30.462  1.00 51.74  ? 433 ARG A CD  1 
ATOM   3301 N NE  . ARG A 1 432 ? -7.508  -61.818 31.064  1.00 47.74  ? 433 ARG A NE  1 
ATOM   3302 C CZ  . ARG A 1 432 ? -8.575  -61.174 30.604  1.00 61.60  ? 433 ARG A CZ  1 
ATOM   3303 N NH1 . ARG A 1 432 ? -8.487  -60.414 29.503  1.00 51.06  ? 433 ARG A NH1 1 
ATOM   3304 N NH2 . ARG A 1 432 ? -9.736  -61.312 31.233  1.00 47.90  ? 433 ARG A NH2 1 
ATOM   3305 N N   . ALA A 1 433 ? -3.569  -59.540 34.199  1.00 51.97  ? 434 ALA A N   1 
ATOM   3306 C CA  . ALA A 1 433 ? -3.684  -59.707 35.644  1.00 53.30  ? 434 ALA A CA  1 
ATOM   3307 C C   . ALA A 1 433 ? -4.633  -60.849 36.010  1.00 58.66  ? 434 ALA A C   1 
ATOM   3308 O O   . ALA A 1 433 ? -5.721  -60.966 35.436  1.00 51.99  ? 434 ALA A O   1 
ATOM   3309 C CB  . ALA A 1 433 ? -4.155  -58.413 36.283  1.00 48.36  ? 434 ALA A CB  1 
ATOM   3310 N N   . SER A 1 434 ? -4.228  -61.669 36.982  1.00 56.09  ? 435 SER A N   1 
ATOM   3311 C CA  . SER A 1 434 ? -5.066  -62.776 37.455  1.00 57.05  ? 435 SER A CA  1 
ATOM   3312 C C   . SER A 1 434 ? -6.419  -62.273 37.950  1.00 57.79  ? 435 SER A C   1 
ATOM   3313 O O   . SER A 1 434 ? -7.399  -63.007 37.953  1.00 57.46  ? 435 SER A O   1 
ATOM   3314 C CB  . SER A 1 434 ? -4.359  -63.593 38.552  1.00 56.02  ? 435 SER A CB  1 
ATOM   3315 O OG  . SER A 1 434 ? -4.016  -62.796 39.676  1.00 54.05  ? 435 SER A OG  1 
ATOM   3316 N N   . THR A 1 435 ? -6.477  -61.002 38.328  1.00 57.45  ? 436 THR A N   1 
ATOM   3317 C CA  . THR A 1 435 ? -7.689  -60.442 38.908  1.00 54.47  ? 436 THR A CA  1 
ATOM   3318 C C   . THR A 1 435 ? -8.556  -59.704 37.904  1.00 48.28  ? 436 THR A C   1 
ATOM   3319 O O   . THR A 1 435 ? -9.568  -59.128 38.276  1.00 52.97  ? 436 THR A O   1 
ATOM   3320 C CB  . THR A 1 435 ? -7.349  -59.455 40.038  1.00 62.82  ? 436 THR A CB  1 
ATOM   3321 O OG1 . THR A 1 435 ? -6.482  -58.424 39.533  1.00 55.30  ? 436 THR A OG1 1 
ATOM   3322 C CG2 . THR A 1 435 ? -6.660  -60.178 41.182  1.00 57.26  ? 436 THR A CG2 1 
ATOM   3323 N N   . LEU A 1 436 ? -8.168  -59.698 36.635  1.00 49.77  ? 437 LEU A N   1 
ATOM   3324 C CA  . LEU A 1 436 ? -8.895  -58.879 35.662  1.00 50.41  ? 437 LEU A CA  1 
ATOM   3325 C C   . LEU A 1 436 ? -10.362 -59.300 35.530  1.00 44.21  ? 437 LEU A C   1 
ATOM   3326 O O   . LEU A 1 436 ? -10.664 -60.480 35.418  1.00 50.80  ? 437 LEU A O   1 
ATOM   3327 C CB  . LEU A 1 436 ? -8.189  -58.902 34.298  1.00 56.94  ? 437 LEU A CB  1 
ATOM   3328 C CG  . LEU A 1 436 ? -8.573  -57.810 33.297  1.00 61.37  ? 437 LEU A CG  1 
ATOM   3329 C CD1 . LEU A 1 436 ? -8.197  -56.447 33.830  1.00 52.22  ? 437 LEU A CD1 1 
ATOM   3330 C CD2 . LEU A 1 436 ? -7.900  -58.068 31.968  1.00 52.17  ? 437 LEU A CD2 1 
ATOM   3331 N N   . SER A 1 437 ? -11.264 -58.325 35.566  1.00 46.74  ? 438 SER A N   1 
ATOM   3332 C CA  . SER A 1 437 ? -12.697 -58.582 35.450  1.00 53.28  ? 438 SER A CA  1 
ATOM   3333 C C   . SER A 1 437 ? -13.264 -58.444 34.035  1.00 57.20  ? 438 SER A C   1 
ATOM   3334 O O   . SER A 1 437 ? -14.426 -58.796 33.799  1.00 53.06  ? 438 SER A O   1 
ATOM   3335 C CB  . SER A 1 437 ? -13.460 -57.639 36.375  1.00 55.71  ? 438 SER A CB  1 
ATOM   3336 O OG  . SER A 1 437 ? -13.001 -56.308 36.194  1.00 59.89  ? 438 SER A OG  1 
ATOM   3337 N N   . TRP A 1 438 ? -12.473 -57.902 33.107  1.00 52.23  ? 439 TRP A N   1 
ATOM   3338 C CA  . TRP A 1 438 ? -12.887 -57.846 31.707  1.00 47.48  ? 439 TRP A CA  1 
ATOM   3339 C C   . TRP A 1 438 ? -12.707 -59.234 31.094  1.00 51.21  ? 439 TRP A C   1 
ATOM   3340 O O   . TRP A 1 438 ? -11.815 -59.980 31.506  1.00 46.48  ? 439 TRP A O   1 
ATOM   3341 C CB  . TRP A 1 438 ? -12.091 -56.785 30.914  1.00 52.36  ? 439 TRP A CB  1 
ATOM   3342 C CG  . TRP A 1 438 ? -12.354 -55.357 31.365  1.00 51.11  ? 439 TRP A CG  1 
ATOM   3343 C CD1 . TRP A 1 438 ? -11.625 -54.633 32.271  1.00 44.80  ? 439 TRP A CD1 1 
ATOM   3344 C CD2 . TRP A 1 438 ? -13.422 -54.503 30.946  1.00 43.75  ? 439 TRP A CD2 1 
ATOM   3345 N NE1 . TRP A 1 438 ? -12.174 -53.388 32.441  1.00 47.13  ? 439 TRP A NE1 1 
ATOM   3346 C CE2 . TRP A 1 438 ? -13.277 -53.279 31.637  1.00 45.92  ? 439 TRP A CE2 1 
ATOM   3347 C CE3 . TRP A 1 438 ? -14.497 -54.657 30.073  1.00 47.71  ? 439 TRP A CE3 1 
ATOM   3348 C CZ2 . TRP A 1 438 ? -14.156 -52.213 31.464  1.00 47.26  ? 439 TRP A CZ2 1 
ATOM   3349 C CZ3 . TRP A 1 438 ? -15.367 -53.585 29.894  1.00 50.01  ? 439 TRP A CZ3 1 
ATOM   3350 C CH2 . TRP A 1 438 ? -15.188 -52.383 30.586  1.00 48.60  ? 439 TRP A CH2 1 
ATOM   3351 N N   . PRO A 1 439 ? -13.541 -59.578 30.094  1.00 53.81  ? 440 PRO A N   1 
ATOM   3352 C CA  . PRO A 1 439 ? -13.488 -60.905 29.472  1.00 48.90  ? 440 PRO A CA  1 
ATOM   3353 C C   . PRO A 1 439 ? -12.149 -61.200 28.826  1.00 52.08  ? 440 PRO A C   1 
ATOM   3354 O O   . PRO A 1 439 ? -11.391 -60.286 28.507  1.00 50.35  ? 440 PRO A O   1 
ATOM   3355 C CB  . PRO A 1 439 ? -14.588 -60.847 28.402  1.00 47.00  ? 440 PRO A CB  1 
ATOM   3356 C CG  . PRO A 1 439 ? -14.778 -59.401 28.124  1.00 55.63  ? 440 PRO A CG  1 
ATOM   3357 C CD  . PRO A 1 439 ? -14.531 -58.706 29.444  1.00 46.56  ? 440 PRO A CD  1 
ATOM   3358 N N   . LEU A 1 440 ? -11.875 -62.484 28.640  1.00 51.82  ? 441 LEU A N   1 
ATOM   3359 C CA  . LEU A 1 440 ? -10.633 -62.949 28.043  1.00 54.93  ? 441 LEU A CA  1 
ATOM   3360 C C   . LEU A 1 440 ? -10.360 -62.405 26.632  1.00 51.47  ? 441 LEU A C   1 
ATOM   3361 O O   . LEU A 1 440 ? -9.196  -62.218 26.258  1.00 51.41  ? 441 LEU A O   1 
ATOM   3362 C CB  . LEU A 1 440 ? -10.612 -64.477 28.021  1.00 56.39  ? 441 LEU A CB  1 
ATOM   3363 C CG  . LEU A 1 440 ? -9.235  -65.135 28.018  1.00 67.57  ? 441 LEU A CG  1 
ATOM   3364 C CD1 . LEU A 1 440 ? -8.668  -65.148 29.424  1.00 68.95  ? 441 LEU A CD1 1 
ATOM   3365 C CD2 . LEU A 1 440 ? -9.314  -66.546 27.451  1.00 66.49  ? 441 LEU A CD2 1 
ATOM   3366 N N   . TRP A 1 441 ? -11.404 -62.153 25.843  1.00 48.89  ? 442 TRP A N   1 
ATOM   3367 C CA  . TRP A 1 441 ? -11.164 -61.720 24.459  1.00 47.51  ? 442 TRP A CA  1 
ATOM   3368 C C   . TRP A 1 441 ? -10.499 -60.335 24.385  1.00 54.12  ? 442 TRP A C   1 
ATOM   3369 O O   . TRP A 1 441 ? -9.874  -59.994 23.372  1.00 54.06  ? 442 TRP A O   1 
ATOM   3370 C CB  . TRP A 1 441 ? -12.425 -61.793 23.564  1.00 50.55  ? 442 TRP A CB  1 
ATOM   3371 C CG  . TRP A 1 441 ? -13.508 -60.760 23.850  1.00 43.84  ? 442 TRP A CG  1 
ATOM   3372 C CD1 . TRP A 1 441 ? -14.660 -60.962 24.554  1.00 43.48  ? 442 TRP A CD1 1 
ATOM   3373 C CD2 . TRP A 1 441 ? -13.537 -59.386 23.425  1.00 42.06  ? 442 TRP A CD2 1 
ATOM   3374 N NE1 . TRP A 1 441 ? -15.396 -59.802 24.608  1.00 48.99  ? 442 TRP A NE1 1 
ATOM   3375 C CE2 . TRP A 1 441 ? -14.731 -58.820 23.921  1.00 43.19  ? 442 TRP A CE2 1 
ATOM   3376 C CE3 . TRP A 1 441 ? -12.671 -58.582 22.667  1.00 45.15  ? 442 TRP A CE3 1 
ATOM   3377 C CZ2 . TRP A 1 441 ? -15.082 -57.488 23.689  1.00 47.17  ? 442 TRP A CZ2 1 
ATOM   3378 C CZ3 . TRP A 1 441 ? -13.018 -57.265 22.440  1.00 40.50  ? 442 TRP A CZ3 1 
ATOM   3379 C CH2 . TRP A 1 441 ? -14.215 -56.729 22.945  1.00 50.46  ? 442 TRP A CH2 1 
ATOM   3380 N N   . MET A 1 442 ? -10.621 -59.549 25.457  1.00 51.05  ? 443 MET A N   1 
ATOM   3381 C CA  . MET A 1 442 ? -10.022 -58.217 25.490  1.00 50.49  ? 443 MET A CA  1 
ATOM   3382 C C   . MET A 1 442 ? -8.509  -58.222 25.734  1.00 51.35  ? 443 MET A C   1 
ATOM   3383 O O   . MET A 1 442 ? -7.849  -57.199 25.553  1.00 47.36  ? 443 MET A O   1 
ATOM   3384 C CB  . MET A 1 442 ? -10.711 -57.327 26.518  1.00 49.62  ? 443 MET A CB  1 
ATOM   3385 C CG  . MET A 1 442 ? -12.136 -56.945 26.176  1.00 57.09  ? 443 MET A CG  1 
ATOM   3386 S SD  . MET A 1 442 ? -12.655 -55.569 27.235  1.00 55.42  ? 443 MET A SD  1 
ATOM   3387 C CE  . MET A 1 442 ? -14.357 -55.353 26.757  1.00 52.34  ? 443 MET A CE  1 
ATOM   3388 N N   . GLY A 1 443 ? -7.962  -59.364 26.138  1.00 49.51  ? 444 GLY A N   1 
ATOM   3389 C CA  . GLY A 1 443 ? -6.529  -59.475 26.361  1.00 51.81  ? 444 GLY A CA  1 
ATOM   3390 C C   . GLY A 1 443 ? -6.006  -58.598 27.494  1.00 51.14  ? 444 GLY A C   1 
ATOM   3391 O O   . GLY A 1 443 ? -6.517  -58.648 28.615  1.00 47.14  ? 444 GLY A O   1 
ATOM   3392 N N   . VAL A 1 444 ? -4.964  -57.815 27.212  1.00 48.93  ? 445 VAL A N   1 
ATOM   3393 C CA  . VAL A 1 444 ? -4.447  -56.842 28.182  1.00 44.60  ? 445 VAL A CA  1 
ATOM   3394 C C   . VAL A 1 444 ? -4.931  -55.431 27.813  1.00 41.84  ? 445 VAL A C   1 
ATOM   3395 O O   . VAL A 1 444 ? -4.328  -54.749 26.980  1.00 40.03  ? 445 VAL A O   1 
ATOM   3396 C CB  . VAL A 1 444 ? -2.899  -56.858 28.228  1.00 48.54  ? 445 VAL A CB  1 
ATOM   3397 C CG1 . VAL A 1 444 ? -2.381  -55.987 29.367  1.00 44.05  ? 445 VAL A CG1 1 
ATOM   3398 C CG2 . VAL A 1 444 ? -2.382  -58.277 28.359  1.00 47.04  ? 445 VAL A CG2 1 
ATOM   3399 N N   . PRO A 1 445 ? -6.026  -54.978 28.427  1.00 44.49  ? 446 PRO A N   1 
ATOM   3400 C CA  . PRO A 1 445 ? -6.606  -53.731 27.921  1.00 44.54  ? 446 PRO A CA  1 
ATOM   3401 C C   . PRO A 1 445 ? -5.901  -52.464 28.420  1.00 42.56  ? 446 PRO A C   1 
ATOM   3402 O O   . PRO A 1 445 ? -5.117  -52.491 29.377  1.00 39.49  ? 446 PRO A O   1 
ATOM   3403 C CB  . PRO A 1 445 ? -8.063  -53.778 28.432  1.00 44.64  ? 446 PRO A CB  1 
ATOM   3404 C CG  . PRO A 1 445 ? -8.225  -55.143 29.116  1.00 46.45  ? 446 PRO A CG  1 
ATOM   3405 C CD  . PRO A 1 445 ? -6.827  -55.552 29.517  1.00 46.71  ? 446 PRO A CD  1 
ATOM   3406 N N   . HIS A 1 446 ? -6.189  -51.366 27.734  1.00 44.93  ? 447 HIS A N   1 
ATOM   3407 C CA  . HIS A 1 446 ? -5.788  -50.009 28.103  1.00 43.35  ? 447 HIS A CA  1 
ATOM   3408 C C   . HIS A 1 446 ? -5.962  -49.747 29.597  1.00 45.30  ? 447 HIS A C   1 
ATOM   3409 O O   . HIS A 1 446 ? -7.049  -49.948 30.140  1.00 45.06  ? 447 HIS A O   1 
ATOM   3410 C CB  . HIS A 1 446 ? -6.701  -49.052 27.349  1.00 41.11  ? 447 HIS A CB  1 
ATOM   3411 C CG  . HIS A 1 446 ? -6.238  -47.624 27.323  1.00 50.19  ? 447 HIS A CG  1 
ATOM   3412 N ND1 . HIS A 1 446 ? -5.101  -47.216 26.654  1.00 49.08  ? 447 HIS A ND1 1 
ATOM   3413 C CD2 . HIS A 1 446 ? -6.804  -46.498 27.824  1.00 46.76  ? 447 HIS A CD2 1 
ATOM   3414 C CE1 . HIS A 1 446 ? -4.981  -45.902 26.751  1.00 39.41  ? 447 HIS A CE1 1 
ATOM   3415 N NE2 . HIS A 1 446 ? -6.002  -45.442 27.455  1.00 50.22  ? 447 HIS A NE2 1 
ATOM   3416 N N   . GLY A 1 447 ? -4.899  -49.296 30.253  1.00 41.83  ? 448 GLY A N   1 
ATOM   3417 C CA  . GLY A 1 447 ? -4.979  -48.936 31.665  1.00 40.89  ? 448 GLY A CA  1 
ATOM   3418 C C   . GLY A 1 447 ? -4.524  -49.998 32.651  1.00 44.23  ? 448 GLY A C   1 
ATOM   3419 O O   . GLY A 1 447 ? -4.370  -49.722 33.836  1.00 45.71  ? 448 GLY A O   1 
ATOM   3420 N N   . TYR A 1 448 ? -4.286  -51.216 32.180  1.00 44.52  ? 449 TYR A N   1 
ATOM   3421 C CA  . TYR A 1 448 ? -4.094  -52.320 33.116  1.00 42.75  ? 449 TYR A CA  1 
ATOM   3422 C C   . TYR A 1 448 ? -2.652  -52.698 33.438  1.00 43.85  ? 449 TYR A C   1 
ATOM   3423 O O   . TYR A 1 448 ? -2.412  -53.722 34.086  1.00 47.78  ? 449 TYR A O   1 
ATOM   3424 C CB  . TYR A 1 448 ? -5.003  -53.530 32.762  1.00 42.59  ? 449 TYR A CB  1 
ATOM   3425 C CG  . TYR A 1 448 ? -6.425  -53.164 33.105  1.00 44.00  ? 449 TYR A CG  1 
ATOM   3426 C CD1 . TYR A 1 448 ? -6.925  -53.354 34.392  1.00 41.35  ? 449 TYR A CD1 1 
ATOM   3427 C CD2 . TYR A 1 448 ? -7.230  -52.518 32.183  1.00 44.24  ? 449 TYR A CD2 1 
ATOM   3428 C CE1 . TYR A 1 448 ? -8.218  -52.959 34.718  1.00 43.60  ? 449 TYR A CE1 1 
ATOM   3429 C CE2 . TYR A 1 448 ? -8.512  -52.123 32.501  1.00 42.71  ? 449 TYR A CE2 1 
ATOM   3430 C CZ  . TYR A 1 448 ? -9.000  -52.339 33.768  1.00 44.74  ? 449 TYR A CZ  1 
ATOM   3431 O OH  . TYR A 1 448 ? -10.286 -51.928 34.065  1.00 48.33  ? 449 TYR A OH  1 
ATOM   3432 N N   . GLU A 1 449 ? -1.704  -51.850 33.040  1.00 42.93  ? 450 GLU A N   1 
ATOM   3433 C CA  . GLU A 1 449 ? -0.337  -51.942 33.583  1.00 43.13  ? 450 GLU A CA  1 
ATOM   3434 C C   . GLU A 1 449 ? -0.196  -51.083 34.850  1.00 43.37  ? 450 GLU A C   1 
ATOM   3435 O O   . GLU A 1 449 ? 0.652   -51.358 35.693  1.00 41.21  ? 450 GLU A O   1 
ATOM   3436 C CB  . GLU A 1 449 ? 0.712   -51.501 32.548  1.00 40.34  ? 450 GLU A CB  1 
ATOM   3437 C CG  . GLU A 1 449 ? 1.011   -49.987 32.483  1.00 38.65  ? 450 GLU A CG  1 
ATOM   3438 C CD  . GLU A 1 449 ? -0.120  -49.150 31.883  1.00 44.23  ? 450 GLU A CD  1 
ATOM   3439 O OE1 . GLU A 1 449 ? -1.246  -49.669 31.722  1.00 43.49  ? 450 GLU A OE1 1 
ATOM   3440 O OE2 . GLU A 1 449 ? 0.116   -47.954 31.573  1.00 47.30  ? 450 GLU A OE2 1 
ATOM   3441 N N   . ILE A 1 450 ? -1.011  -50.035 34.958  1.00 42.11  ? 451 ILE A N   1 
ATOM   3442 C CA  . ILE A 1 450 ? -0.886  -49.057 36.045  1.00 44.51  ? 451 ILE A CA  1 
ATOM   3443 C C   . ILE A 1 450 ? -0.826  -49.691 37.456  1.00 48.02  ? 451 ILE A C   1 
ATOM   3444 O O   . ILE A 1 450 ? 0.049   -49.348 38.251  1.00 43.35  ? 451 ILE A O   1 
ATOM   3445 C CB  . ILE A 1 450 ? -2.023  -48.002 35.998  1.00 42.52  ? 451 ILE A CB  1 
ATOM   3446 C CG1 . ILE A 1 450 ? -2.097  -47.320 34.627  1.00 37.11  ? 451 ILE A CG1 1 
ATOM   3447 C CG2 . ILE A 1 450 ? -1.851  -46.955 37.106  1.00 35.91  ? 451 ILE A CG2 1 
ATOM   3448 C CD1 . ILE A 1 450 ? -3.288  -46.351 34.502  1.00 36.83  ? 451 ILE A CD1 1 
ATOM   3449 N N   . GLU A 1 451 ? -1.728  -50.628 37.753  1.00 46.60  ? 452 GLU A N   1 
ATOM   3450 C CA  . GLU A 1 451 ? -1.715  -51.289 39.069  1.00 46.19  ? 452 GLU A CA  1 
ATOM   3451 C C   . GLU A 1 451 ? -0.395  -52.026 39.335  1.00 47.38  ? 452 GLU A C   1 
ATOM   3452 O O   . GLU A 1 451 ? 0.033   -52.155 40.488  1.00 44.16  ? 452 GLU A O   1 
ATOM   3453 C CB  . GLU A 1 451 ? -2.927  -52.229 39.255  1.00 43.47  ? 452 GLU A CB  1 
ATOM   3454 C CG  . GLU A 1 451 ? -2.896  -53.457 38.342  1.00 52.61  ? 452 GLU A CG  1 
ATOM   3455 C CD  . GLU A 1 451 ? -4.288  -53.944 37.937  1.00 55.27  ? 452 GLU A CD  1 
ATOM   3456 O OE1 . GLU A 1 451 ? -4.518  -55.169 37.964  1.00 56.37  ? 452 GLU A OE1 1 
ATOM   3457 O OE2 . GLU A 1 451 ? -5.147  -53.105 37.594  1.00 55.46  ? 452 GLU A OE2 1 
ATOM   3458 N N   . PHE A 1 452 ? 0.279   -52.476 38.279  1.00 43.70  ? 453 PHE A N   1 
ATOM   3459 C CA  . PHE A 1 452 ? 1.583   -53.109 38.480  1.00 44.49  ? 453 PHE A CA  1 
ATOM   3460 C C   . PHE A 1 452 ? 2.708   -52.111 38.732  1.00 50.20  ? 453 PHE A C   1 
ATOM   3461 O O   . PHE A 1 452 ? 3.590   -52.365 39.557  1.00 45.08  ? 453 PHE A O   1 
ATOM   3462 C CB  . PHE A 1 452 ? 1.914   -54.092 37.349  1.00 42.78  ? 453 PHE A CB  1 
ATOM   3463 C CG  . PHE A 1 452 ? 1.063   -55.319 37.391  1.00 50.75  ? 453 PHE A CG  1 
ATOM   3464 C CD1 . PHE A 1 452 ? -0.152  -55.364 36.708  1.00 49.10  ? 453 PHE A CD1 1 
ATOM   3465 C CD2 . PHE A 1 452 ? 1.437   -56.406 38.172  1.00 47.55  ? 453 PHE A CD2 1 
ATOM   3466 C CE1 . PHE A 1 452 ? -0.961  -56.495 36.772  1.00 53.94  ? 453 PHE A CE1 1 
ATOM   3467 C CE2 . PHE A 1 452 ? 0.634   -57.542 38.239  1.00 51.41  ? 453 PHE A CE2 1 
ATOM   3468 C CZ  . PHE A 1 452 ? -0.574  -57.582 37.546  1.00 48.62  ? 453 PHE A CZ  1 
ATOM   3469 N N   . ILE A 1 453 ? 2.657   -50.972 38.045  1.00 44.21  ? 454 ILE A N   1 
ATOM   3470 C CA  . ILE A 1 453 ? 3.642   -49.921 38.249  1.00 45.05  ? 454 ILE A CA  1 
ATOM   3471 C C   . ILE A 1 453 ? 3.551   -49.378 39.691  1.00 41.37  ? 454 ILE A C   1 
ATOM   3472 O O   . ILE A 1 453 ? 4.574   -49.089 40.310  1.00 45.87  ? 454 ILE A O   1 
ATOM   3473 C CB  . ILE A 1 453 ? 3.470   -48.758 37.219  1.00 44.74  ? 454 ILE A CB  1 
ATOM   3474 C CG1 . ILE A 1 453 ? 3.526   -49.259 35.752  1.00 40.62  ? 454 ILE A CG1 1 
ATOM   3475 C CG2 . ILE A 1 453 ? 4.499   -47.645 37.462  1.00 43.71  ? 454 ILE A CG2 1 
ATOM   3476 C CD1 . ILE A 1 453 ? 4.714   -50.078 35.410  1.00 44.80  ? 454 ILE A CD1 1 
ATOM   3477 N N   . PHE A 1 454 ? 2.333   -49.233 40.217  1.00 43.00  ? 455 PHE A N   1 
ATOM   3478 C CA  . PHE A 1 454 ? 2.134   -48.643 41.557  1.00 38.36  ? 455 PHE A CA  1 
ATOM   3479 C C   . PHE A 1 454 ? 2.281   -49.673 42.687  1.00 39.32  ? 455 PHE A C   1 
ATOM   3480 O O   . PHE A 1 454 ? 2.095   -49.356 43.860  1.00 48.54  ? 455 PHE A O   1 
ATOM   3481 C CB  . PHE A 1 454 ? 0.776   -47.922 41.654  1.00 37.42  ? 455 PHE A CB  1 
ATOM   3482 C CG  . PHE A 1 454 ? 0.798   -46.503 41.142  1.00 39.77  ? 455 PHE A CG  1 
ATOM   3483 C CD1 . PHE A 1 454 ? 0.688   -46.230 39.776  1.00 40.43  ? 455 PHE A CD1 1 
ATOM   3484 C CD2 . PHE A 1 454 ? 0.959   -45.443 42.010  1.00 40.01  ? 455 PHE A CD2 1 
ATOM   3485 C CE1 . PHE A 1 454 ? 0.728   -44.923 39.310  1.00 36.84  ? 455 PHE A CE1 1 
ATOM   3486 C CE2 . PHE A 1 454 ? 0.996   -44.130 41.545  1.00 43.96  ? 455 PHE A CE2 1 
ATOM   3487 C CZ  . PHE A 1 454 ? 0.875   -43.868 40.199  1.00 40.81  ? 455 PHE A CZ  1 
ATOM   3488 N N   . GLY A 1 455 ? 2.616   -50.907 42.333  1.00 44.34  ? 456 GLY A N   1 
ATOM   3489 C CA  . GLY A 1 455 ? 2.831   -51.945 43.324  1.00 48.13  ? 456 GLY A CA  1 
ATOM   3490 C C   . GLY A 1 455 ? 1.575   -52.413 44.049  1.00 48.47  ? 456 GLY A C   1 
ATOM   3491 O O   . GLY A 1 455 ? 1.673   -53.041 45.104  1.00 42.37  ? 456 GLY A O   1 
ATOM   3492 N N   . ILE A 1 456 ? 0.404   -52.127 43.479  1.00 50.88  ? 457 ILE A N   1 
ATOM   3493 C CA  . ILE A 1 456 ? -0.888  -52.536 44.060  1.00 43.49  ? 457 ILE A CA  1 
ATOM   3494 C C   . ILE A 1 456 ? -0.977  -54.034 44.418  1.00 51.39  ? 457 ILE A C   1 
ATOM   3495 O O   . ILE A 1 456 ? -1.581  -54.388 45.434  1.00 54.24  ? 457 ILE A O   1 
ATOM   3496 C CB  . ILE A 1 456 ? -2.085  -52.108 43.159  1.00 51.12  ? 457 ILE A CB  1 
ATOM   3497 C CG1 . ILE A 1 456 ? -2.048  -50.599 42.878  1.00 40.58  ? 457 ILE A CG1 1 
ATOM   3498 C CG2 . ILE A 1 456 ? -3.409  -52.465 43.803  1.00 41.07  ? 457 ILE A CG2 1 
ATOM   3499 C CD1 . ILE A 1 456 ? -2.084  -49.745 44.160  1.00 44.14  ? 457 ILE A CD1 1 
ATOM   3500 N N   . PRO A 1 457 ? -0.343  -54.918 43.617  1.00 49.84  ? 458 PRO A N   1 
ATOM   3501 C CA  . PRO A 1 457 ? -0.364  -56.328 44.028  1.00 51.56  ? 458 PRO A CA  1 
ATOM   3502 C C   . PRO A 1 457 ? 0.250   -56.661 45.388  1.00 58.01  ? 458 PRO A C   1 
ATOM   3503 O O   . PRO A 1 457 ? 0.032   -57.783 45.847  1.00 57.44  ? 458 PRO A O   1 
ATOM   3504 C CB  . PRO A 1 457 ? 0.425   -57.020 42.914  1.00 48.54  ? 458 PRO A CB  1 
ATOM   3505 C CG  . PRO A 1 457 ? 0.083   -56.214 41.697  1.00 51.82  ? 458 PRO A CG  1 
ATOM   3506 C CD  . PRO A 1 457 ? 0.099   -54.784 42.212  1.00 50.52  ? 458 PRO A CD  1 
ATOM   3507 N N   . LEU A 1 458 ? 0.987   -55.743 46.013  1.00 55.62  ? 459 LEU A N   1 
ATOM   3508 C CA  . LEU A 1 458 ? 1.615   -56.033 47.304  1.00 51.58  ? 459 LEU A CA  1 
ATOM   3509 C C   . LEU A 1 458 ? 0.599   -55.887 48.438  1.00 49.12  ? 459 LEU A C   1 
ATOM   3510 O O   . LEU A 1 458 ? 0.851   -56.296 49.564  1.00 60.42  ? 459 LEU A O   1 
ATOM   3511 C CB  . LEU A 1 458 ? 2.831   -55.134 47.567  1.00 47.87  ? 459 LEU A CB  1 
ATOM   3512 C CG  . LEU A 1 458 ? 4.055   -55.195 46.646  1.00 58.08  ? 459 LEU A CG  1 
ATOM   3513 C CD1 . LEU A 1 458 ? 5.145   -54.287 47.197  1.00 59.54  ? 459 LEU A CD1 1 
ATOM   3514 C CD2 . LEU A 1 458 ? 4.579   -56.604 46.484  1.00 55.61  ? 459 LEU A CD2 1 
ATOM   3515 N N   . ASP A 1 459 ? -0.545  -55.293 48.130  1.00 53.59  ? 460 ASP A N   1 
ATOM   3516 C CA  . ASP A 1 459 ? -1.610  -55.137 49.103  1.00 48.32  ? 460 ASP A CA  1 
ATOM   3517 C C   . ASP A 1 459 ? -2.166  -56.504 49.482  1.00 65.47  ? 460 ASP A C   1 
ATOM   3518 O O   . ASP A 1 459 ? -2.779  -57.176 48.650  1.00 52.84  ? 460 ASP A O   1 
ATOM   3519 C CB  . ASP A 1 459 ? -2.723  -54.251 48.549  1.00 48.52  ? 460 ASP A CB  1 
ATOM   3520 C CG  . ASP A 1 459 ? -3.763  -53.878 49.602  1.00 64.32  ? 460 ASP A CG  1 
ATOM   3521 O OD1 . ASP A 1 459 ? -3.892  -54.596 50.620  1.00 59.14  ? 460 ASP A OD1 1 
ATOM   3522 O OD2 . ASP A 1 459 ? -4.464  -52.863 49.402  1.00 65.05  ? 460 ASP A OD2 1 
ATOM   3523 N N   . PRO A 1 460 ? -1.979  -56.900 50.756  1.00 59.36  ? 461 PRO A N   1 
ATOM   3524 C CA  . PRO A 1 460 ? -2.397  -58.212 51.275  1.00 71.22  ? 461 PRO A CA  1 
ATOM   3525 C C   . PRO A 1 460 ? -3.900  -58.467 51.099  1.00 64.37  ? 461 PRO A C   1 
ATOM   3526 O O   . PRO A 1 460 ? -4.294  -59.580 50.748  1.00 77.49  ? 461 PRO A O   1 
ATOM   3527 C CB  . PRO A 1 460 ? -2.038  -58.133 52.767  1.00 64.74  ? 461 PRO A CB  1 
ATOM   3528 C CG  . PRO A 1 460 ? -0.994  -57.068 52.852  1.00 73.04  ? 461 PRO A CG  1 
ATOM   3529 C CD  . PRO A 1 460 ? -1.385  -56.058 51.806  1.00 62.93  ? 461 PRO A CD  1 
ATOM   3530 N N   . SER A 1 461 ? -4.719  -57.442 51.319  1.00 62.25  ? 462 SER A N   1 
ATOM   3531 C CA  . SER A 1 461 ? -6.168  -57.557 51.147  1.00 59.27  ? 462 SER A CA  1 
ATOM   3532 C C   . SER A 1 461 ? -6.614  -57.848 49.707  1.00 70.46  ? 462 SER A C   1 
ATOM   3533 O O   . SER A 1 461 ? -7.796  -58.083 49.462  1.00 73.10  ? 462 SER A O   1 
ATOM   3534 C CB  . SER A 1 461 ? -6.858  -56.289 51.636  1.00 60.49  ? 462 SER A CB  1 
ATOM   3535 O OG  . SER A 1 461 ? -6.606  -55.212 50.757  1.00 70.56  ? 462 SER A OG  1 
ATOM   3536 N N   . ARG A 1 462 ? -5.688  -57.825 48.753  1.00 60.91  ? 463 ARG A N   1 
ATOM   3537 C CA  . ARG A 1 462 ? -6.048  -58.155 47.372  1.00 64.18  ? 463 ARG A CA  1 
ATOM   3538 C C   . ARG A 1 462 ? -5.524  -59.527 46.964  1.00 63.22  ? 463 ARG A C   1 
ATOM   3539 O O   . ARG A 1 462 ? -4.762  -60.152 47.704  1.00 67.22  ? 463 ARG A O   1 
ATOM   3540 C CB  . ARG A 1 462 ? -5.584  -57.069 46.399  1.00 60.11  ? 463 ARG A CB  1 
ATOM   3541 C CG  . ARG A 1 462 ? -6.200  -55.717 46.685  1.00 56.07  ? 463 ARG A CG  1 
ATOM   3542 C CD  . ARG A 1 462 ? -5.863  -54.721 45.605  1.00 62.18  ? 463 ARG A CD  1 
ATOM   3543 N NE  . ARG A 1 462 ? -6.281  -53.383 45.995  1.00 60.14  ? 463 ARG A NE  1 
ATOM   3544 C CZ  . ARG A 1 462 ? -7.392  -52.796 45.574  1.00 62.09  ? 463 ARG A CZ  1 
ATOM   3545 N NH1 . ARG A 1 462 ? -8.198  -53.427 44.728  1.00 65.04  ? 463 ARG A NH1 1 
ATOM   3546 N NH2 . ARG A 1 462 ? -7.690  -51.576 45.998  1.00 59.86  ? 463 ARG A NH2 1 
ATOM   3547 N N   . ASN A 1 463 ? -5.919  -59.974 45.775  1.00 62.06  ? 464 ASN A N   1 
ATOM   3548 C CA  . ASN A 1 463 ? -5.833  -61.385 45.414  1.00 68.16  ? 464 ASN A CA  1 
ATOM   3549 C C   . ASN A 1 463 ? -4.748  -61.775 44.412  1.00 62.21  ? 464 ASN A C   1 
ATOM   3550 O O   . ASN A 1 463 ? -4.870  -62.798 43.752  1.00 68.77  ? 464 ASN A O   1 
ATOM   3551 C CB  . ASN A 1 463 ? -7.199  -61.877 44.901  1.00 59.17  ? 464 ASN A CB  1 
ATOM   3552 C CG  . ASN A 1 463 ? -8.246  -61.950 46.002  1.00 79.26  ? 464 ASN A CG  1 
ATOM   3553 O OD1 . ASN A 1 463 ? -7.913  -62.106 47.180  1.00 75.76  ? 464 ASN A OD1 1 
ATOM   3554 N ND2 . ASN A 1 463 ? -9.518  -61.840 45.625  1.00 75.23  ? 464 ASN A ND2 1 
ATOM   3555 N N   . TYR A 1 464 ? -3.687  -60.986 44.300  1.00 56.58  ? 465 TYR A N   1 
ATOM   3556 C CA  . TYR A 1 464 ? -2.678  -61.263 43.275  1.00 61.24  ? 465 TYR A CA  1 
ATOM   3557 C C   . TYR A 1 464 ? -1.800  -62.439 43.692  1.00 55.22  ? 465 TYR A C   1 
ATOM   3558 O O   . TYR A 1 464 ? -1.616  -62.677 44.871  1.00 56.59  ? 465 TYR A O   1 
ATOM   3559 C CB  . TYR A 1 464 ? -1.815  -60.024 43.009  1.00 51.60  ? 465 TYR A CB  1 
ATOM   3560 C CG  . TYR A 1 464 ? -2.550  -58.855 42.377  1.00 48.59  ? 465 TYR A CG  1 
ATOM   3561 C CD1 . TYR A 1 464 ? -3.222  -57.922 43.156  1.00 42.45  ? 465 TYR A CD1 1 
ATOM   3562 C CD2 . TYR A 1 464 ? -2.546  -58.676 40.996  1.00 49.11  ? 465 TYR A CD2 1 
ATOM   3563 C CE1 . TYR A 1 464 ? -3.875  -56.840 42.581  1.00 47.61  ? 465 TYR A CE1 1 
ATOM   3564 C CE2 . TYR A 1 464 ? -3.201  -57.601 40.412  1.00 43.53  ? 465 TYR A CE2 1 
ATOM   3565 C CZ  . TYR A 1 464 ? -3.855  -56.684 41.204  1.00 46.86  ? 465 TYR A CZ  1 
ATOM   3566 O OH  . TYR A 1 464 ? -4.505  -55.619 40.600  1.00 52.34  ? 465 TYR A OH  1 
ATOM   3567 N N   . THR A 1 465 ? -1.257  -63.169 42.727  1.00 56.93  ? 466 THR A N   1 
ATOM   3568 C CA  . THR A 1 465 ? -0.377  -64.301 43.027  1.00 51.22  ? 466 THR A CA  1 
ATOM   3569 C C   . THR A 1 465 ? 0.995   -63.860 43.516  1.00 55.88  ? 466 THR A C   1 
ATOM   3570 O O   . THR A 1 465 ? 1.379   -62.696 43.372  1.00 55.79  ? 466 THR A O   1 
ATOM   3571 C CB  . THR A 1 465 ? -0.123  -65.168 41.777  1.00 56.96  ? 466 THR A CB  1 
ATOM   3572 O OG1 . THR A 1 465 ? 0.867   -64.538 40.954  1.00 58.10  ? 466 THR A OG1 1 
ATOM   3573 C CG2 . THR A 1 465 ? -1.396  -65.363 40.977  1.00 48.56  ? 466 THR A CG2 1 
ATOM   3574 N N   . ALA A 1 466 ? 1.744   -64.816 44.062  1.00 63.06  ? 467 ALA A N   1 
ATOM   3575 C CA  . ALA A 1 466 ? 3.123   -64.595 44.476  1.00 61.41  ? 467 ALA A CA  1 
ATOM   3576 C C   . ALA A 1 466 ? 4.009   -64.123 43.311  1.00 53.87  ? 467 ALA A C   1 
ATOM   3577 O O   . ALA A 1 466 ? 4.834   -63.230 43.481  1.00 56.81  ? 467 ALA A O   1 
ATOM   3578 C CB  . ALA A 1 466 ? 3.697   -65.871 45.128  1.00 46.98  ? 467 ALA A CB  1 
ATOM   3579 N N   . GLU A 1 467 ? 3.834   -64.723 42.133  1.00 58.20  ? 468 GLU A N   1 
ATOM   3580 C CA  . GLU A 1 467 ? 4.571   -64.312 40.934  1.00 58.45  ? 468 GLU A CA  1 
ATOM   3581 C C   . GLU A 1 467 ? 4.262   -62.863 40.556  1.00 55.57  ? 468 GLU A C   1 
ATOM   3582 O O   . GLU A 1 467 ? 5.140   -62.118 40.091  1.00 47.40  ? 468 GLU A O   1 
ATOM   3583 C CB  . GLU A 1 467 ? 4.209   -65.188 39.732  1.00 59.98  ? 468 GLU A CB  1 
ATOM   3584 C CG  . GLU A 1 467 ? 4.458   -66.679 39.867  1.00 76.37  ? 468 GLU A CG  1 
ATOM   3585 C CD  . GLU A 1 467 ? 3.926   -67.448 38.649  1.00 101.52 ? 468 GLU A CD  1 
ATOM   3586 O OE1 . GLU A 1 467 ? 2.729   -67.287 38.298  1.00 88.80  ? 468 GLU A OE1 1 
ATOM   3587 O OE2 . GLU A 1 467 ? 4.710   -68.198 38.027  1.00 103.70 ? 468 GLU A OE2 1 
ATOM   3588 N N   . GLU A 1 468 ? 3.005   -62.478 40.736  1.00 44.41  ? 469 GLU A N   1 
ATOM   3589 C CA  . GLU A 1 468 ? 2.567   -61.151 40.344  1.00 53.25  ? 469 GLU A CA  1 
ATOM   3590 C C   . GLU A 1 468 ? 3.185   -60.066 41.218  1.00 57.06  ? 469 GLU A C   1 
ATOM   3591 O O   . GLU A 1 468 ? 3.499   -58.971 40.710  1.00 45.63  ? 469 GLU A O   1 
ATOM   3592 C CB  . GLU A 1 468 ? 1.040   -61.065 40.291  1.00 39.63  ? 469 GLU A CB  1 
ATOM   3593 C CG  . GLU A 1 468 ? 0.476   -61.568 38.955  1.00 46.93  ? 469 GLU A CG  1 
ATOM   3594 C CD  . GLU A 1 468 ? -1.043  -61.667 38.944  1.00 57.01  ? 469 GLU A CD  1 
ATOM   3595 O OE1 . GLU A 1 468 ? -1.641  -61.928 40.012  1.00 52.89  ? 469 GLU A OE1 1 
ATOM   3596 O OE2 . GLU A 1 468 ? -1.646  -61.479 37.869  1.00 52.85  ? 469 GLU A OE2 1 
ATOM   3597 N N   . LYS A 1 469 ? 3.389   -60.384 42.506  1.00 44.46  ? 470 LYS A N   1 
ATOM   3598 C CA  . LYS A 1 469 ? 4.033   -59.469 43.450  1.00 44.12  ? 470 LYS A CA  1 
ATOM   3599 C C   . LYS A 1 469 ? 5.490   -59.239 43.086  1.00 46.99  ? 470 LYS A C   1 
ATOM   3600 O O   . LYS A 1 469 ? 5.970   -58.112 43.092  1.00 49.46  ? 470 LYS A O   1 
ATOM   3601 C CB  . LYS A 1 469 ? 3.948   -60.001 44.901  1.00 44.34  ? 470 LYS A CB  1 
ATOM   3602 C CG  . LYS A 1 469 ? 2.531   -60.092 45.422  1.00 45.63  ? 470 LYS A CG  1 
ATOM   3603 C CD  . LYS A 1 469 ? 2.494   -60.655 46.847  1.00 55.81  ? 470 LYS A CD  1 
ATOM   3604 C CE  . LYS A 1 469 ? 1.058   -60.769 47.345  1.00 51.66  ? 470 LYS A CE  1 
ATOM   3605 N NZ  . LYS A 1 469 ? 0.984   -61.159 48.780  1.00 74.99  ? 470 LYS A NZ  1 
ATOM   3606 N N   . ILE A 1 470 ? 6.191   -60.322 42.774  1.00 50.47  ? 471 ILE A N   1 
ATOM   3607 C CA  . ILE A 1 470 ? 7.569   -60.236 42.313  1.00 54.75  ? 471 ILE A CA  1 
ATOM   3608 C C   . ILE A 1 470 ? 7.678   -59.429 41.008  1.00 53.10  ? 471 ILE A C   1 
ATOM   3609 O O   . ILE A 1 470 ? 8.635   -58.688 40.812  1.00 51.93  ? 471 ILE A O   1 
ATOM   3610 C CB  . ILE A 1 470 ? 8.176   -61.649 42.148  1.00 53.86  ? 471 ILE A CB  1 
ATOM   3611 C CG1 . ILE A 1 470 ? 8.389   -62.282 43.532  1.00 59.68  ? 471 ILE A CG1 1 
ATOM   3612 C CG2 . ILE A 1 470 ? 9.483   -61.603 41.364  1.00 50.60  ? 471 ILE A CG2 1 
ATOM   3613 C CD1 . ILE A 1 470 ? 8.731   -63.755 43.480  1.00 53.65  ? 471 ILE A CD1 1 
ATOM   3614 N N   . PHE A 1 471 ? 6.678   -59.560 40.142  1.00 49.09  ? 472 PHE A N   1 
ATOM   3615 C CA  . PHE A 1 471 ? 6.661   -58.849 38.858  1.00 55.45  ? 472 PHE A CA  1 
ATOM   3616 C C   . PHE A 1 471 ? 6.461   -57.353 39.111  1.00 49.94  ? 472 PHE A C   1 
ATOM   3617 O O   . PHE A 1 471 ? 7.157   -56.515 38.532  1.00 48.64  ? 472 PHE A O   1 
ATOM   3618 C CB  . PHE A 1 471 ? 5.545   -59.417 37.971  1.00 49.08  ? 472 PHE A CB  1 
ATOM   3619 C CG  . PHE A 1 471 ? 5.343   -58.694 36.661  1.00 47.57  ? 472 PHE A CG  1 
ATOM   3620 C CD1 . PHE A 1 471 ? 6.411   -58.423 35.811  1.00 43.01  ? 472 PHE A CD1 1 
ATOM   3621 C CD2 . PHE A 1 471 ? 4.056   -58.352 36.242  1.00 50.32  ? 472 PHE A CD2 1 
ATOM   3622 C CE1 . PHE A 1 471 ? 6.195   -57.793 34.565  1.00 49.45  ? 472 PHE A CE1 1 
ATOM   3623 C CE2 . PHE A 1 471 ? 3.836   -57.714 35.000  1.00 47.64  ? 472 PHE A CE2 1 
ATOM   3624 C CZ  . PHE A 1 471 ? 4.900   -57.447 34.167  1.00 40.18  ? 472 PHE A CZ  1 
ATOM   3625 N N   . ALA A 1 472 ? 5.533   -57.033 40.010  1.00 51.10  ? 473 ALA A N   1 
ATOM   3626 C CA  . ALA A 1 472 ? 5.298   -55.647 40.386  1.00 47.96  ? 473 ALA A CA  1 
ATOM   3627 C C   . ALA A 1 472 ? 6.566   -55.046 40.968  1.00 50.94  ? 473 ALA A C   1 
ATOM   3628 O O   . ALA A 1 472 ? 6.878   -53.877 40.719  1.00 49.07  ? 473 ALA A O   1 
ATOM   3629 C CB  . ALA A 1 472 ? 4.158   -55.540 41.380  1.00 40.26  ? 473 ALA A CB  1 
ATOM   3630 N N   . GLN A 1 473 ? 7.309   -55.844 41.730  1.00 48.09  ? 474 GLN A N   1 
ATOM   3631 C CA  . GLN A 1 473 ? 8.528   -55.331 42.336  1.00 46.85  ? 474 GLN A CA  1 
ATOM   3632 C C   . GLN A 1 473 ? 9.580   -55.020 41.277  1.00 46.73  ? 474 GLN A C   1 
ATOM   3633 O O   . GLN A 1 473 ? 10.283  -54.016 41.381  1.00 51.69  ? 474 GLN A O   1 
ATOM   3634 C CB  . GLN A 1 473 ? 9.060   -56.288 43.401  1.00 48.64  ? 474 GLN A CB  1 
ATOM   3635 C CG  . GLN A 1 473 ? 8.236   -56.276 44.686  1.00 51.90  ? 474 GLN A CG  1 
ATOM   3636 C CD  . GLN A 1 473 ? 8.689   -57.333 45.668  1.00 56.54  ? 474 GLN A CD  1 
ATOM   3637 O OE1 . GLN A 1 473 ? 9.052   -58.450 45.277  1.00 53.45  ? 474 GLN A OE1 1 
ATOM   3638 N NE2 . GLN A 1 473 ? 8.692   -56.982 46.955  1.00 51.82  ? 474 GLN A NE2 1 
ATOM   3639 N N   . ARG A 1 474 ? 9.676   -55.880 40.261  1.00 44.07  ? 475 ARG A N   1 
ATOM   3640 C CA  . ARG A 1 474 ? 10.553  -55.645 39.113  1.00 52.95  ? 475 ARG A CA  1 
ATOM   3641 C C   . ARG A 1 474 ? 10.208  -54.353 38.366  1.00 47.93  ? 475 ARG A C   1 
ATOM   3642 O O   . ARG A 1 474 ? 11.095  -53.617 37.941  1.00 48.86  ? 475 ARG A O   1 
ATOM   3643 C CB  . ARG A 1 474 ? 10.437  -56.787 38.106  1.00 56.08  ? 475 ARG A CB  1 
ATOM   3644 C CG  . ARG A 1 474 ? 11.169  -58.056 38.437  1.00 59.55  ? 475 ARG A CG  1 
ATOM   3645 C CD  . ARG A 1 474 ? 10.927  -59.075 37.322  1.00 61.12  ? 475 ARG A CD  1 
ATOM   3646 N NE  . ARG A 1 474 ? 11.355  -58.544 36.031  1.00 54.05  ? 475 ARG A NE  1 
ATOM   3647 C CZ  . ARG A 1 474 ? 10.765  -58.807 34.868  1.00 58.07  ? 475 ARG A CZ  1 
ATOM   3648 N NH1 . ARG A 1 474 ? 9.707   -59.605 34.842  1.00 49.39  ? 475 ARG A NH1 1 
ATOM   3649 N NH2 . ARG A 1 474 ? 11.232  -58.262 33.731  1.00 42.34  ? 475 ARG A NH2 1 
ATOM   3650 N N   . LEU A 1 475 ? 8.916   -54.112 38.175  1.00 42.34  ? 476 LEU A N   1 
ATOM   3651 C CA  . LEU A 1 475 ? 8.453   -52.953 37.419  1.00 46.40  ? 476 LEU A CA  1 
ATOM   3652 C C   . LEU A 1 475 ? 8.717   -51.666 38.199  1.00 47.85  ? 476 LEU A C   1 
ATOM   3653 O O   . LEU A 1 475 ? 9.175   -50.660 37.640  1.00 48.43  ? 476 LEU A O   1 
ATOM   3654 C CB  . LEU A 1 475 ? 6.965   -53.094 37.077  1.00 49.61  ? 476 LEU A CB  1 
ATOM   3655 C CG  . LEU A 1 475 ? 6.614   -54.129 35.997  1.00 57.62  ? 476 LEU A CG  1 
ATOM   3656 C CD1 . LEU A 1 475 ? 5.202   -53.957 35.504  1.00 54.64  ? 476 LEU A CD1 1 
ATOM   3657 C CD2 . LEU A 1 475 ? 7.554   -54.024 34.826  1.00 46.52  ? 476 LEU A CD2 1 
ATOM   3658 N N   . MET A 1 476 ? 8.449   -51.716 39.501  1.00 42.36  ? 477 MET A N   1 
ATOM   3659 C CA  . MET A 1 476 ? 8.708   -50.584 40.367  1.00 42.10  ? 477 MET A CA  1 
ATOM   3660 C C   . MET A 1 476 ? 10.189  -50.217 40.311  1.00 42.74  ? 477 MET A C   1 
ATOM   3661 O O   . MET A 1 476 ? 10.536  -49.034 40.233  1.00 43.18  ? 477 MET A O   1 
ATOM   3662 C CB  . MET A 1 476 ? 8.250   -50.882 41.802  1.00 46.24  ? 477 MET A CB  1 
ATOM   3663 C CG  . MET A 1 476 ? 6.731   -50.750 42.010  1.00 40.60  ? 477 MET A CG  1 
ATOM   3664 S SD  . MET A 1 476 ? 6.313   -50.671 43.760  1.00 51.17  ? 477 MET A SD  1 
ATOM   3665 C CE  . MET A 1 476 ? 7.013   -52.240 44.296  1.00 47.34  ? 477 MET A CE  1 
ATOM   3666 N N   . ARG A 1 477 ? 11.055  -51.230 40.297  1.00 42.37  ? 478 ARG A N   1 
ATOM   3667 C CA  . ARG A 1 477 ? 12.511  -51.008 40.180  1.00 45.76  ? 478 ARG A CA  1 
ATOM   3668 C C   . ARG A 1 477 ? 12.899  -50.376 38.828  1.00 49.95  ? 478 ARG A C   1 
ATOM   3669 O O   . ARG A 1 477 ? 13.705  -49.428 38.789  1.00 44.79  ? 478 ARG A O   1 
ATOM   3670 C CB  . ARG A 1 477 ? 13.278  -52.329 40.424  1.00 41.09  ? 478 ARG A CB  1 
ATOM   3671 C CG  . ARG A 1 477 ? 14.818  -52.276 40.391  1.00 45.10  ? 478 ARG A CG  1 
ATOM   3672 C CD  . ARG A 1 477 ? 15.421  -51.324 41.431  1.00 46.65  ? 478 ARG A CD  1 
ATOM   3673 N NE  . ARG A 1 477 ? 14.991  -51.656 42.790  1.00 53.61  ? 478 ARG A NE  1 
ATOM   3674 C CZ  . ARG A 1 477 ? 15.542  -52.619 43.523  1.00 57.11  ? 478 ARG A CZ  1 
ATOM   3675 N NH1 . ARG A 1 477 ? 16.546  -53.336 43.027  1.00 46.82  ? 478 ARG A NH1 1 
ATOM   3676 N NH2 . ARG A 1 477 ? 15.092  -52.870 44.745  1.00 50.14  ? 478 ARG A NH2 1 
ATOM   3677 N N   . TYR A 1 478 ? 12.349  -50.889 37.719  1.00 40.53  ? 479 TYR A N   1 
ATOM   3678 C CA  . TYR A 1 478 ? 12.664  -50.282 36.413  1.00 44.98  ? 479 TYR A CA  1 
ATOM   3679 C C   . TYR A 1 478 ? 12.300  -48.796 36.418  1.00 41.53  ? 479 TYR A C   1 
ATOM   3680 O O   . TYR A 1 478 ? 13.099  -47.947 36.020  1.00 46.08  ? 479 TYR A O   1 
ATOM   3681 C CB  . TYR A 1 478 ? 11.921  -50.962 35.242  1.00 44.63  ? 479 TYR A CB  1 
ATOM   3682 C CG  . TYR A 1 478 ? 12.366  -52.367 34.904  1.00 43.27  ? 479 TYR A CG  1 
ATOM   3683 C CD1 . TYR A 1 478 ? 13.716  -52.712 34.845  1.00 50.10  ? 479 TYR A CD1 1 
ATOM   3684 C CD2 . TYR A 1 478 ? 11.427  -53.355 34.644  1.00 40.04  ? 479 TYR A CD2 1 
ATOM   3685 C CE1 . TYR A 1 478 ? 14.110  -54.013 34.517  1.00 44.02  ? 479 TYR A CE1 1 
ATOM   3686 C CE2 . TYR A 1 478 ? 11.805  -54.646 34.318  1.00 43.94  ? 479 TYR A CE2 1 
ATOM   3687 C CZ  . TYR A 1 478 ? 13.138  -54.975 34.263  1.00 48.52  ? 479 TYR A CZ  1 
ATOM   3688 O OH  . TYR A 1 478 ? 13.466  -56.271 33.936  1.00 50.51  ? 479 TYR A OH  1 
ATOM   3689 N N   . TRP A 1 479 ? 11.092  -48.490 36.886  1.00 41.03  ? 480 TRP A N   1 
ATOM   3690 C CA  . TRP A 1 479 ? 10.580  -47.121 36.838  1.00 44.65  ? 480 TRP A CA  1 
ATOM   3691 C C   . TRP A 1 479 ? 11.394  -46.172 37.720  1.00 53.12  ? 480 TRP A C   1 
ATOM   3692 O O   . TRP A 1 479 ? 11.710  -45.043 37.319  1.00 43.80  ? 480 TRP A O   1 
ATOM   3693 C CB  . TRP A 1 479 ? 9.093   -47.091 37.235  1.00 36.41  ? 480 TRP A CB  1 
ATOM   3694 C CG  . TRP A 1 479 ? 8.115   -46.970 36.045  1.00 46.16  ? 480 TRP A CG  1 
ATOM   3695 C CD1 . TRP A 1 479 ? 7.211   -45.964 35.825  1.00 43.42  ? 480 TRP A CD1 1 
ATOM   3696 C CD2 . TRP A 1 479 ? 7.959   -47.892 34.949  1.00 39.22  ? 480 TRP A CD2 1 
ATOM   3697 N NE1 . TRP A 1 479 ? 6.510   -46.200 34.657  1.00 41.58  ? 480 TRP A NE1 1 
ATOM   3698 C CE2 . TRP A 1 479 ? 6.943   -47.380 34.110  1.00 41.27  ? 480 TRP A CE2 1 
ATOM   3699 C CE3 . TRP A 1 479 ? 8.566   -49.111 34.608  1.00 39.04  ? 480 TRP A CE3 1 
ATOM   3700 C CZ2 . TRP A 1 479 ? 6.527   -48.037 32.948  1.00 37.69  ? 480 TRP A CZ2 1 
ATOM   3701 C CZ3 . TRP A 1 479 ? 8.158   -49.753 33.450  1.00 43.53  ? 480 TRP A CZ3 1 
ATOM   3702 C CH2 . TRP A 1 479 ? 7.151   -49.214 32.632  1.00 41.04  ? 480 TRP A CH2 1 
ATOM   3703 N N   . ALA A 1 480 ? 11.737  -46.640 38.920  1.00 42.54  ? 481 ALA A N   1 
ATOM   3704 C CA  . ALA A 1 480 ? 12.495  -45.831 39.853  1.00 43.50  ? 481 ALA A CA  1 
ATOM   3705 C C   . ALA A 1 480 ? 13.960  -45.682 39.416  1.00 45.99  ? 481 ALA A C   1 
ATOM   3706 O O   . ALA A 1 480 ? 14.547  -44.607 39.580  1.00 46.09  ? 481 ALA A O   1 
ATOM   3707 C CB  . ALA A 1 480 ? 12.382  -46.405 41.266  1.00 36.84  ? 481 ALA A CB  1 
ATOM   3708 N N   . ASN A 1 481 ? 14.534  -46.738 38.831  1.00 40.76  ? 482 ASN A N   1 
ATOM   3709 C CA  . ASN A 1 481 ? 15.890  -46.636 38.263  1.00 45.99  ? 482 ASN A CA  1 
ATOM   3710 C C   . ASN A 1 481 ? 15.926  -45.549 37.203  1.00 47.41  ? 482 ASN A C   1 
ATOM   3711 O O   . ASN A 1 481 ? 16.886  -44.765 37.126  1.00 42.51  ? 482 ASN A O   1 
ATOM   3712 C CB  . ASN A 1 481 ? 16.368  -47.959 37.633  1.00 41.67  ? 482 ASN A CB  1 
ATOM   3713 C CG  . ASN A 1 481 ? 16.849  -48.979 38.666  1.00 46.43  ? 482 ASN A CG  1 
ATOM   3714 O OD1 . ASN A 1 481 ? 17.023  -48.660 39.843  1.00 50.93  ? 482 ASN A OD1 1 
ATOM   3715 N ND2 . ASN A 1 481 ? 17.081  -50.208 38.220  1.00 47.06  ? 482 ASN A ND2 1 
ATOM   3716 N N   . PHE A 1 482 ? 14.875  -45.518 36.379  1.00 46.70  ? 483 PHE A N   1 
ATOM   3717 C CA  . PHE A 1 482 ? 14.771  -44.524 35.309  1.00 46.65  ? 483 PHE A CA  1 
ATOM   3718 C C   . PHE A 1 482 ? 14.668  -43.131 35.905  1.00 44.23  ? 483 PHE A C   1 
ATOM   3719 O O   . PHE A 1 482 ? 15.337  -42.228 35.446  1.00 47.18  ? 483 PHE A O   1 
ATOM   3720 C CB  . PHE A 1 482 ? 13.582  -44.785 34.360  1.00 43.47  ? 483 PHE A CB  1 
ATOM   3721 C CG  . PHE A 1 482 ? 13.428  -43.731 33.292  1.00 44.88  ? 483 PHE A CG  1 
ATOM   3722 C CD1 . PHE A 1 482 ? 14.240  -43.750 32.168  1.00 40.90  ? 483 PHE A CD1 1 
ATOM   3723 C CD2 . PHE A 1 482 ? 12.516  -42.686 33.445  1.00 42.60  ? 483 PHE A CD2 1 
ATOM   3724 C CE1 . PHE A 1 482 ? 14.127  -42.765 31.177  1.00 44.78  ? 483 PHE A CE1 1 
ATOM   3725 C CE2 . PHE A 1 482 ? 12.398  -41.710 32.487  1.00 45.06  ? 483 PHE A CE2 1 
ATOM   3726 C CZ  . PHE A 1 482 ? 13.203  -41.747 31.331  1.00 41.37  ? 483 PHE A CZ  1 
ATOM   3727 N N   . ALA A 1 483 ? 13.819  -42.962 36.921  1.00 43.75  ? 484 ALA A N   1 
ATOM   3728 C CA  . ALA A 1 483 ? 13.723  -41.688 37.635  1.00 49.88  ? 484 ALA A CA  1 
ATOM   3729 C C   . ALA A 1 483 ? 15.076  -41.202 38.218  1.00 53.34  ? 484 ALA A C   1 
ATOM   3730 O O   . ALA A 1 483 ? 15.396  -40.008 38.178  1.00 47.33  ? 484 ALA A O   1 
ATOM   3731 C CB  . ALA A 1 483 ? 12.678  -41.783 38.749  1.00 40.38  ? 484 ALA A CB  1 
ATOM   3732 N N   . ARG A 1 484 ? 15.861  -42.129 38.760  1.00 51.39  ? 485 ARG A N   1 
ATOM   3733 C CA  . ARG A 1 484 ? 17.119  -41.769 39.424  1.00 45.26  ? 485 ARG A CA  1 
ATOM   3734 C C   . ARG A 1 484 ? 18.257  -41.538 38.455  1.00 50.83  ? 485 ARG A C   1 
ATOM   3735 O O   . ARG A 1 484 ? 19.100  -40.694 38.716  1.00 53.78  ? 485 ARG A O   1 
ATOM   3736 C CB  . ARG A 1 484 ? 17.543  -42.841 40.433  1.00 48.57  ? 485 ARG A CB  1 
ATOM   3737 C CG  . ARG A 1 484 ? 16.725  -42.851 41.715  1.00 43.49  ? 485 ARG A CG  1 
ATOM   3738 C CD  . ARG A 1 484 ? 17.203  -43.962 42.657  1.00 49.53  ? 485 ARG A CD  1 
ATOM   3739 N NE  . ARG A 1 484 ? 17.051  -45.290 42.066  1.00 50.10  ? 485 ARG A NE  1 
ATOM   3740 C CZ  . ARG A 1 484 ? 16.161  -46.190 42.467  1.00 43.96  ? 485 ARG A CZ  1 
ATOM   3741 N NH1 . ARG A 1 484 ? 15.341  -45.913 43.472  1.00 41.09  ? 485 ARG A NH1 1 
ATOM   3742 N NH2 . ARG A 1 484 ? 16.102  -47.371 41.875  1.00 48.28  ? 485 ARG A NH2 1 
ATOM   3743 N N   . THR A 1 485 ? 18.297  -42.284 37.346  1.00 48.14  ? 486 THR A N   1 
ATOM   3744 C CA  . THR A 1 485 ? 19.469  -42.231 36.457  1.00 49.15  ? 486 THR A CA  1 
ATOM   3745 C C   . THR A 1 485 ? 19.203  -41.971 34.974  1.00 54.13  ? 486 THR A C   1 
ATOM   3746 O O   . THR A 1 485 ? 20.143  -41.713 34.225  1.00 48.56  ? 486 THR A O   1 
ATOM   3747 C CB  . THR A 1 485 ? 20.312  -43.531 36.513  1.00 48.22  ? 486 THR A CB  1 
ATOM   3748 O OG1 . THR A 1 485 ? 19.611  -44.587 35.840  1.00 55.11  ? 486 THR A OG1 1 
ATOM   3749 C CG2 . THR A 1 485 ? 20.642  -43.935 37.957  1.00 45.49  ? 486 THR A CG2 1 
ATOM   3750 N N   . GLY A 1 486 ? 17.951  -42.051 34.538  1.00 45.30  ? 487 GLY A N   1 
ATOM   3751 C CA  . GLY A 1 486 ? 17.668  -41.988 33.107  1.00 50.54  ? 487 GLY A CA  1 
ATOM   3752 C C   . GLY A 1 486 ? 17.809  -43.327 32.396  1.00 45.31  ? 487 GLY A C   1 
ATOM   3753 O O   . GLY A 1 486 ? 17.809  -43.409 31.167  1.00 50.90  ? 487 GLY A O   1 
ATOM   3754 N N   . ASP A 1 487 ? 17.899  -44.399 33.168  1.00 50.40  ? 488 ASP A N   1 
ATOM   3755 C CA  . ASP A 1 487 ? 18.134  -45.717 32.582  1.00 52.31  ? 488 ASP A CA  1 
ATOM   3756 C C   . ASP A 1 487 ? 17.455  -46.763 33.475  1.00 52.35  ? 488 ASP A C   1 
ATOM   3757 O O   . ASP A 1 487 ? 17.774  -46.863 34.660  1.00 50.60  ? 488 ASP A O   1 
ATOM   3758 C CB  . ASP A 1 487 ? 19.653  -45.935 32.502  1.00 53.49  ? 488 ASP A CB  1 
ATOM   3759 C CG  . ASP A 1 487 ? 20.050  -47.266 31.905  1.00 53.36  ? 488 ASP A CG  1 
ATOM   3760 O OD1 . ASP A 1 487 ? 19.195  -48.158 31.707  1.00 56.33  ? 488 ASP A OD1 1 
ATOM   3761 O OD2 . ASP A 1 487 ? 21.258  -47.419 31.642  1.00 59.38  ? 488 ASP A OD2 1 
ATOM   3762 N N   . PRO A 1 488 ? 16.504  -47.538 32.917  1.00 44.28  ? 489 PRO A N   1 
ATOM   3763 C CA  . PRO A 1 488 ? 15.793  -48.454 33.820  1.00 42.60  ? 489 PRO A CA  1 
ATOM   3764 C C   . PRO A 1 488 ? 16.625  -49.670 34.233  1.00 42.55  ? 489 PRO A C   1 
ATOM   3765 O O   . PRO A 1 488 ? 16.263  -50.337 35.200  1.00 48.61  ? 489 PRO A O   1 
ATOM   3766 C CB  . PRO A 1 488 ? 14.593  -48.909 32.984  1.00 41.82  ? 489 PRO A CB  1 
ATOM   3767 C CG  . PRO A 1 488 ? 15.144  -48.855 31.530  1.00 43.75  ? 489 PRO A CG  1 
ATOM   3768 C CD  . PRO A 1 488 ? 16.009  -47.610 31.526  1.00 42.03  ? 489 PRO A CD  1 
ATOM   3769 N N   . ASN A 1 489 ? 17.713  -49.954 33.525  1.00 49.82  ? 490 ASN A N   1 
ATOM   3770 C CA  . ASN A 1 489 ? 18.481  -51.182 33.781  1.00 46.09  ? 490 ASN A CA  1 
ATOM   3771 C C   . ASN A 1 489 ? 19.062  -51.323 35.186  1.00 54.77  ? 490 ASN A C   1 
ATOM   3772 O O   . ASN A 1 489 ? 19.610  -50.375 35.747  1.00 56.15  ? 490 ASN A O   1 
ATOM   3773 C CB  . ASN A 1 489 ? 19.614  -51.346 32.770  1.00 49.20  ? 490 ASN A CB  1 
ATOM   3774 C CG  . ASN A 1 489 ? 19.115  -51.633 31.379  1.00 50.68  ? 490 ASN A CG  1 
ATOM   3775 O OD1 . ASN A 1 489 ? 18.688  -52.749 31.081  1.00 51.65  ? 490 ASN A OD1 1 
ATOM   3776 N ND2 . ASN A 1 489 ? 19.183  -50.632 30.510  1.00 42.76  ? 490 ASN A ND2 1 
ATOM   3777 N N   . GLU A 1 490 ? 18.909  -52.524 35.737  1.00 57.73  ? 491 GLU A N   1 
ATOM   3778 C CA  . GLU A 1 490 ? 19.668  -53.005 36.877  1.00 65.10  ? 491 GLU A CA  1 
ATOM   3779 C C   . GLU A 1 490 ? 21.109  -53.318 36.441  1.00 78.77  ? 491 GLU A C   1 
ATOM   3780 O O   . GLU A 1 490 ? 21.387  -53.389 35.239  1.00 79.66  ? 491 GLU A O   1 
ATOM   3781 C CB  . GLU A 1 490 ? 18.999  -54.280 37.401  1.00 68.28  ? 491 GLU A CB  1 
ATOM   3782 C CG  . GLU A 1 490 ? 17.723  -54.048 38.211  1.00 68.70  ? 491 GLU A CG  1 
ATOM   3783 C CD  . GLU A 1 490 ? 18.015  -53.578 39.635  1.00 69.96  ? 491 GLU A CD  1 
ATOM   3784 O OE1 . GLU A 1 490 ? 18.630  -52.504 39.799  1.00 70.47  ? 491 GLU A OE1 1 
ATOM   3785 O OE2 . GLU A 1 490 ? 17.637  -54.288 40.592  1.00 78.52  ? 491 GLU A OE2 1 
ATOM   3786 N N   . PRO A 1 491 ? 22.029  -53.505 37.411  1.00 87.30  ? 492 PRO A N   1 
ATOM   3787 C CA  . PRO A 1 491 ? 23.385  -53.995 37.109  1.00 87.95  ? 492 PRO A CA  1 
ATOM   3788 C C   . PRO A 1 491 ? 23.388  -55.292 36.293  1.00 95.80  ? 492 PRO A C   1 
ATOM   3789 O O   . PRO A 1 491 ? 22.534  -56.159 36.497  1.00 94.86  ? 492 PRO A O   1 
ATOM   3790 C CB  . PRO A 1 491 ? 23.971  -54.267 38.496  1.00 83.17  ? 492 PRO A CB  1 
ATOM   3791 C CG  . PRO A 1 491 ? 23.279  -53.283 39.384  1.00 79.19  ? 492 PRO A CG  1 
ATOM   3792 C CD  . PRO A 1 491 ? 21.879  -53.149 38.838  1.00 80.83  ? 492 PRO A CD  1 
ATOM   3793 N N   . ARG A 1 492 ? 24.359  -55.418 35.393  1.00 99.32  ? 493 ARG A N   1 
ATOM   3794 C CA  . ARG A 1 492 ? 24.411  -56.528 34.442  1.00 101.92 ? 493 ARG A CA  1 
ATOM   3795 C C   . ARG A 1 492 ? 24.324  -57.914 35.090  1.00 105.33 ? 493 ARG A C   1 
ATOM   3796 O O   . ARG A 1 492 ? 24.888  -58.154 36.166  1.00 92.00  ? 493 ARG A O   1 
ATOM   3797 C CB  . ARG A 1 492 ? 25.656  -56.416 33.551  1.00 98.91  ? 493 ARG A CB  1 
ATOM   3798 C CG  . ARG A 1 492 ? 25.837  -57.569 32.586  1.00 101.77 ? 493 ARG A CG  1 
ATOM   3799 C CD  . ARG A 1 492 ? 26.855  -57.238 31.518  1.00 120.40 ? 493 ARG A CD  1 
ATOM   3800 N NE  . ARG A 1 492 ? 26.416  -56.124 30.682  1.00 129.48 ? 493 ARG A NE  1 
ATOM   3801 C CZ  . ARG A 1 492 ? 27.031  -55.737 29.568  1.00 128.65 ? 493 ARG A CZ  1 
ATOM   3802 N NH1 . ARG A 1 492 ? 28.117  -56.378 29.151  1.00 122.05 ? 493 ARG A NH1 1 
ATOM   3803 N NH2 . ARG A 1 492 ? 26.559  -54.712 28.870  1.00 126.74 ? 493 ARG A NH2 1 
ATOM   3804 N N   . ASP A 1 493 ? 23.596  -58.807 34.418  1.00 107.67 ? 494 ASP A N   1 
ATOM   3805 C CA  . ASP A 1 493 ? 23.396  -60.182 34.867  1.00 114.85 ? 494 ASP A CA  1 
ATOM   3806 C C   . ASP A 1 493 ? 23.160  -61.103 33.668  1.00 108.09 ? 494 ASP A C   1 
ATOM   3807 O O   . ASP A 1 493 ? 23.329  -62.321 33.757  1.00 97.30  ? 494 ASP A O   1 
ATOM   3808 C CB  . ASP A 1 493 ? 22.203  -60.259 35.823  1.00 119.93 ? 494 ASP A CB  1 
ATOM   3809 C CG  . ASP A 1 493 ? 22.060  -61.624 36.469  1.00 114.68 ? 494 ASP A CG  1 
ATOM   3810 O OD1 . ASP A 1 493 ? 23.096  -62.232 36.806  1.00 115.35 ? 494 ASP A OD1 1 
ATOM   3811 O OD2 . ASP A 1 493 ? 20.913  -62.088 36.641  1.00 117.24 ? 494 ASP A OD2 1 
ATOM   3812 N N   . PRO A 1 497 ? 19.420  -59.969 31.458  1.00 74.85  ? 498 PRO A N   1 
ATOM   3813 C CA  . PRO A 1 497 ? 19.238  -59.491 30.074  1.00 83.69  ? 498 PRO A CA  1 
ATOM   3814 C C   . PRO A 1 497 ? 18.949  -57.991 30.054  1.00 75.33  ? 498 PRO A C   1 
ATOM   3815 O O   . PRO A 1 497 ? 18.085  -57.522 30.805  1.00 72.21  ? 498 PRO A O   1 
ATOM   3816 C CB  . PRO A 1 497 ? 18.037  -60.296 29.562  1.00 76.87  ? 498 PRO A CB  1 
ATOM   3817 C CG  . PRO A 1 497 ? 17.308  -60.738 30.809  1.00 80.50  ? 498 PRO A CG  1 
ATOM   3818 C CD  . PRO A 1 497 ? 18.349  -60.886 31.889  1.00 79.82  ? 498 PRO A CD  1 
ATOM   3819 N N   . GLN A 1 498 ? 19.682  -57.244 29.232  1.00 56.99  ? 499 GLN A N   1 
ATOM   3820 C CA  . GLN A 1 498 ? 19.636  -55.792 29.313  1.00 59.95  ? 499 GLN A CA  1 
ATOM   3821 C C   . GLN A 1 498 ? 18.525  -55.188 28.443  1.00 62.16  ? 499 GLN A C   1 
ATOM   3822 O O   . GLN A 1 498 ? 18.158  -55.745 27.411  1.00 62.70  ? 499 GLN A O   1 
ATOM   3823 C CB  . GLN A 1 498 ? 20.996  -55.189 28.954  1.00 55.96  ? 499 GLN A CB  1 
ATOM   3824 C CG  . GLN A 1 498 ? 22.094  -55.484 29.960  1.00 68.27  ? 499 GLN A CG  1 
ATOM   3825 C CD  . GLN A 1 498 ? 21.823  -54.887 31.337  1.00 73.58  ? 499 GLN A CD  1 
ATOM   3826 O OE1 . GLN A 1 498 ? 21.893  -53.669 31.528  1.00 67.96  ? 499 GLN A OE1 1 
ATOM   3827 N NE2 . GLN A 1 498 ? 21.519  -55.745 32.304  1.00 67.39  ? 499 GLN A NE2 1 
ATOM   3828 N N   . TRP A 1 499 ? 17.999  -54.052 28.892  1.00 59.81  ? 500 TRP A N   1 
ATOM   3829 C CA  . TRP A 1 499 ? 16.968  -53.300 28.186  1.00 48.20  ? 500 TRP A CA  1 
ATOM   3830 C C   . TRP A 1 499 ? 17.655  -52.266 27.304  1.00 47.41  ? 500 TRP A C   1 
ATOM   3831 O O   . TRP A 1 499 ? 18.131  -51.262 27.798  1.00 52.74  ? 500 TRP A O   1 
ATOM   3832 C CB  . TRP A 1 499 ? 16.045  -52.620 29.216  1.00 47.67  ? 500 TRP A CB  1 
ATOM   3833 C CG  . TRP A 1 499 ? 14.819  -51.922 28.666  1.00 52.00  ? 500 TRP A CG  1 
ATOM   3834 C CD1 . TRP A 1 499 ? 14.601  -51.506 27.365  1.00 46.27  ? 500 TRP A CD1 1 
ATOM   3835 C CD2 . TRP A 1 499 ? 13.638  -51.565 29.402  1.00 45.74  ? 500 TRP A CD2 1 
ATOM   3836 N NE1 . TRP A 1 499 ? 13.366  -50.916 27.262  1.00 45.53  ? 500 TRP A NE1 1 
ATOM   3837 C CE2 . TRP A 1 499 ? 12.752  -50.937 28.491  1.00 47.70  ? 500 TRP A CE2 1 
ATOM   3838 C CE3 . TRP A 1 499 ? 13.238  -51.728 30.738  1.00 40.17  ? 500 TRP A CE3 1 
ATOM   3839 C CZ2 . TRP A 1 499 ? 11.495  -50.462 28.877  1.00 44.42  ? 500 TRP A CZ2 1 
ATOM   3840 C CZ3 . TRP A 1 499 ? 11.990  -51.242 31.129  1.00 40.61  ? 500 TRP A CZ3 1 
ATOM   3841 C CH2 . TRP A 1 499 ? 11.128  -50.620 30.197  1.00 41.24  ? 500 TRP A CH2 1 
ATOM   3842 N N   . PRO A 1 500 ? 17.714  -52.517 25.986  1.00 52.05  ? 501 PRO A N   1 
ATOM   3843 C CA  . PRO A 1 500 ? 18.395  -51.604 25.060  1.00 48.07  ? 501 PRO A CA  1 
ATOM   3844 C C   . PRO A 1 500 ? 17.546  -50.383 24.696  1.00 49.90  ? 501 PRO A C   1 
ATOM   3845 O O   . PRO A 1 500 ? 16.314  -50.463 24.669  1.00 49.85  ? 501 PRO A O   1 
ATOM   3846 C CB  . PRO A 1 500 ? 18.608  -52.475 23.818  1.00 51.97  ? 501 PRO A CB  1 
ATOM   3847 C CG  . PRO A 1 500 ? 17.465  -53.410 23.836  1.00 53.05  ? 501 PRO A CG  1 
ATOM   3848 C CD  . PRO A 1 500 ? 17.177  -53.700 25.292  1.00 45.70  ? 501 PRO A CD  1 
ATOM   3849 N N   . PRO A 1 501 ? 18.205  -49.256 24.420  1.00 47.10  ? 502 PRO A N   1 
ATOM   3850 C CA  . PRO A 1 501 ? 17.549  -48.041 23.930  1.00 46.90  ? 502 PRO A CA  1 
ATOM   3851 C C   . PRO A 1 501 ? 16.855  -48.253 22.582  1.00 54.37  ? 502 PRO A C   1 
ATOM   3852 O O   . PRO A 1 501 ? 17.339  -49.006 21.729  1.00 49.46  ? 502 PRO A O   1 
ATOM   3853 C CB  . PRO A 1 501 ? 18.709  -47.056 23.767  1.00 49.55  ? 502 PRO A CB  1 
ATOM   3854 C CG  . PRO A 1 501 ? 19.779  -47.569 24.674  1.00 52.00  ? 502 PRO A CG  1 
ATOM   3855 C CD  . PRO A 1 501 ? 19.648  -49.060 24.641  1.00 52.28  ? 502 PRO A CD  1 
ATOM   3856 N N   . TYR A 1 502 ? 15.714  -47.591 22.412  1.00 48.80  ? 503 TYR A N   1 
ATOM   3857 C CA  . TYR A 1 502 ? 14.959  -47.641 21.172  1.00 47.77  ? 503 TYR A CA  1 
ATOM   3858 C C   . TYR A 1 502 ? 15.534  -46.632 20.199  1.00 48.30  ? 503 TYR A C   1 
ATOM   3859 O O   . TYR A 1 502 ? 15.837  -45.503 20.579  1.00 45.60  ? 503 TYR A O   1 
ATOM   3860 C CB  . TYR A 1 502 ? 13.493  -47.304 21.440  1.00 48.72  ? 503 TYR A CB  1 
ATOM   3861 C CG  . TYR A 1 502 ? 12.595  -47.298 20.211  1.00 50.72  ? 503 TYR A CG  1 
ATOM   3862 C CD1 . TYR A 1 502 ? 12.452  -46.155 19.421  1.00 49.74  ? 503 TYR A CD1 1 
ATOM   3863 C CD2 . TYR A 1 502 ? 11.866  -48.426 19.864  1.00 42.82  ? 503 TYR A CD2 1 
ATOM   3864 C CE1 . TYR A 1 502 ? 11.622  -46.154 18.311  1.00 43.11  ? 503 TYR A CE1 1 
ATOM   3865 C CE2 . TYR A 1 502 ? 11.033  -48.431 18.772  1.00 48.04  ? 503 TYR A CE2 1 
ATOM   3866 C CZ  . TYR A 1 502 ? 10.914  -47.297 17.994  1.00 50.10  ? 503 TYR A CZ  1 
ATOM   3867 O OH  . TYR A 1 502 ? 10.083  -47.324 16.891  1.00 50.82  ? 503 TYR A OH  1 
ATOM   3868 N N   . THR A 1 503 ? 15.691  -47.043 18.945  1.00 42.34  ? 504 THR A N   1 
ATOM   3869 C CA  . THR A 1 503 ? 16.183  -46.151 17.890  1.00 54.77  ? 504 THR A CA  1 
ATOM   3870 C C   . THR A 1 503 ? 15.328  -46.296 16.627  1.00 51.61  ? 504 THR A C   1 
ATOM   3871 O O   . THR A 1 503 ? 14.656  -47.325 16.430  1.00 47.03  ? 504 THR A O   1 
ATOM   3872 C CB  . THR A 1 503 ? 17.676  -46.419 17.556  1.00 52.74  ? 504 THR A CB  1 
ATOM   3873 O OG1 . THR A 1 503 ? 17.829  -47.785 17.183  1.00 51.74  ? 504 THR A OG1 1 
ATOM   3874 C CG2 . THR A 1 503 ? 18.572  -46.150 18.788  1.00 49.28  ? 504 THR A CG2 1 
ATOM   3875 N N   . ALA A 1 504 ? 15.335  -45.266 15.783  1.00 51.56  ? 505 ALA A N   1 
ATOM   3876 C CA  . ALA A 1 504 ? 14.471  -45.256 14.596  1.00 50.76  ? 505 ALA A CA  1 
ATOM   3877 C C   . ALA A 1 504 ? 14.771  -46.388 13.610  1.00 48.09  ? 505 ALA A C   1 
ATOM   3878 O O   . ALA A 1 504 ? 13.873  -46.860 12.922  1.00 48.83  ? 505 ALA A O   1 
ATOM   3879 C CB  . ALA A 1 504 ? 14.516  -43.908 13.897  1.00 46.80  ? 505 ALA A CB  1 
ATOM   3880 N N   . GLY A 1 505 ? 16.016  -46.841 13.558  1.00 48.06  ? 506 GLY A N   1 
ATOM   3881 C CA  . GLY A 1 505 ? 16.364  -47.931 12.660  1.00 44.48  ? 506 GLY A CA  1 
ATOM   3882 C C   . GLY A 1 505 ? 16.165  -49.314 13.248  1.00 50.78  ? 506 GLY A C   1 
ATOM   3883 O O   . GLY A 1 505 ? 15.384  -50.104 12.728  1.00 48.31  ? 506 GLY A O   1 
ATOM   3884 N N   . ALA A 1 506 ? 16.864  -49.620 14.340  1.00 45.90  ? 507 ALA A N   1 
ATOM   3885 C CA  . ALA A 1 506 ? 16.720  -50.938 14.963  1.00 46.08  ? 507 ALA A CA  1 
ATOM   3886 C C   . ALA A 1 506 ? 15.368  -51.159 15.667  1.00 47.35  ? 507 ALA A C   1 
ATOM   3887 O O   . ALA A 1 506 ? 14.895  -52.290 15.734  1.00 46.43  ? 507 ALA A O   1 
ATOM   3888 C CB  . ALA A 1 506 ? 17.907  -51.249 15.906  1.00 42.72  ? 507 ALA A CB  1 
ATOM   3889 N N   . GLN A 1 507 ? 14.768  -50.092 16.200  1.00 46.09  ? 508 GLN A N   1 
ATOM   3890 C CA  . GLN A 1 507 ? 13.404  -50.148 16.767  1.00 48.25  ? 508 GLN A CA  1 
ATOM   3891 C C   . GLN A 1 507 ? 13.201  -51.171 17.892  1.00 50.35  ? 508 GLN A C   1 
ATOM   3892 O O   . GLN A 1 507 ? 12.144  -51.806 17.978  1.00 45.56  ? 508 GLN A O   1 
ATOM   3893 C CB  . GLN A 1 507 ? 12.369  -50.420 15.660  1.00 48.01  ? 508 GLN A CB  1 
ATOM   3894 C CG  . GLN A 1 507 ? 12.306  -49.360 14.578  1.00 45.93  ? 508 GLN A CG  1 
ATOM   3895 C CD  . GLN A 1 507 ? 11.498  -49.819 13.374  1.00 52.04  ? 508 GLN A CD  1 
ATOM   3896 O OE1 . GLN A 1 507 ? 10.292  -50.029 13.472  1.00 45.58  ? 508 GLN A OE1 1 
ATOM   3897 N NE2 . GLN A 1 507 ? 12.167  -50.008 12.240  1.00 49.45  ? 508 GLN A NE2 1 
ATOM   3898 N N   . GLN A 1 508 ? 14.205  -51.335 18.747  1.00 47.22  ? 509 GLN A N   1 
ATOM   3899 C CA  . GLN A 1 508 ? 14.146  -52.334 19.815  1.00 50.48  ? 509 GLN A CA  1 
ATOM   3900 C C   . GLN A 1 508 ? 13.318  -51.883 21.016  1.00 48.16  ? 509 GLN A C   1 
ATOM   3901 O O   . GLN A 1 508 ? 13.393  -50.725 21.432  1.00 45.15  ? 509 GLN A O   1 
ATOM   3902 C CB  . GLN A 1 508 ? 15.561  -52.724 20.275  1.00 52.24  ? 509 GLN A CB  1 
ATOM   3903 C CG  . GLN A 1 508 ? 16.303  -53.598 19.268  1.00 52.36  ? 509 GLN A CG  1 
ATOM   3904 C CD  . GLN A 1 508 ? 17.788  -53.700 19.566  1.00 49.73  ? 509 GLN A CD  1 
ATOM   3905 O OE1 . GLN A 1 508 ? 18.476  -52.690 19.654  1.00 50.75  ? 509 GLN A OE1 1 
ATOM   3906 N NE2 . GLN A 1 508 ? 18.285  -54.921 19.712  1.00 46.92  ? 509 GLN A NE2 1 
ATOM   3907 N N   . TYR A 1 509 ? 12.530  -52.813 21.555  1.00 47.09  ? 510 TYR A N   1 
ATOM   3908 C CA  . TYR A 1 509 ? 11.760  -52.596 22.783  1.00 48.56  ? 510 TYR A CA  1 
ATOM   3909 C C   . TYR A 1 509 ? 11.730  -53.909 23.566  1.00 50.70  ? 510 TYR A C   1 
ATOM   3910 O O   . TYR A 1 509 ? 12.117  -54.942 23.025  1.00 47.86  ? 510 TYR A O   1 
ATOM   3911 C CB  . TYR A 1 509 ? 10.337  -52.178 22.427  1.00 39.56  ? 510 TYR A CB  1 
ATOM   3912 C CG  . TYR A 1 509 ? 9.561   -53.247 21.699  1.00 49.08  ? 510 TYR A CG  1 
ATOM   3913 C CD1 . TYR A 1 509 ? 9.601   -53.346 20.303  1.00 46.19  ? 510 TYR A CD1 1 
ATOM   3914 C CD2 . TYR A 1 509 ? 8.776   -54.160 22.401  1.00 41.00  ? 510 TYR A CD2 1 
ATOM   3915 C CE1 . TYR A 1 509 ? 8.879   -54.329 19.639  1.00 41.86  ? 510 TYR A CE1 1 
ATOM   3916 C CE2 . TYR A 1 509 ? 8.057   -55.138 21.740  1.00 46.80  ? 510 TYR A CE2 1 
ATOM   3917 C CZ  . TYR A 1 509 ? 8.117   -55.224 20.370  1.00 45.25  ? 510 TYR A CZ  1 
ATOM   3918 O OH  . TYR A 1 509 ? 7.398   -56.211 19.746  1.00 53.34  ? 510 TYR A OH  1 
ATOM   3919 N N   . VAL A 1 510 ? 11.269  -53.894 24.820  1.00 45.72  ? 511 VAL A N   1 
ATOM   3920 C CA  . VAL A 1 510 ? 11.160  -55.141 25.571  1.00 35.83  ? 511 VAL A CA  1 
ATOM   3921 C C   . VAL A 1 510 ? 9.719   -55.521 25.899  1.00 45.39  ? 511 VAL A C   1 
ATOM   3922 O O   . VAL A 1 510 ? 8.847   -54.656 26.040  1.00 40.30  ? 511 VAL A O   1 
ATOM   3923 C CB  . VAL A 1 510 ? 11.991  -55.114 26.904  1.00 46.10  ? 511 VAL A CB  1 
ATOM   3924 C CG1 . VAL A 1 510 ? 13.489  -55.036 26.619  1.00 43.46  ? 511 VAL A CG1 1 
ATOM   3925 C CG2 . VAL A 1 510 ? 11.535  -53.977 27.809  1.00 39.80  ? 511 VAL A CG2 1 
ATOM   3926 N N   . SER A 1 511 ? 9.470   -56.823 26.025  1.00 41.27  ? 512 SER A N   1 
ATOM   3927 C CA  . SER A 1 511 ? 8.199   -57.296 26.560  1.00 41.15  ? 512 SER A CA  1 
ATOM   3928 C C   . SER A 1 511 ? 8.280   -57.325 28.093  1.00 42.74  ? 512 SER A C   1 
ATOM   3929 O O   . SER A 1 511 ? 9.225   -57.860 28.650  1.00 45.52  ? 512 SER A O   1 
ATOM   3930 C CB  . SER A 1 511 ? 7.883   -58.698 26.035  1.00 50.28  ? 512 SER A CB  1 
ATOM   3931 O OG  . SER A 1 511 ? 8.929   -59.611 26.353  1.00 54.97  ? 512 SER A OG  1 
ATOM   3932 N N   . LEU A 1 512 ? 7.294   -56.739 28.761  1.00 49.71  ? 513 LEU A N   1 
ATOM   3933 C CA  . LEU A 1 512 ? 7.189   -56.797 30.217  1.00 46.30  ? 513 LEU A CA  1 
ATOM   3934 C C   . LEU A 1 512 ? 6.108   -57.794 30.636  1.00 47.20  ? 513 LEU A C   1 
ATOM   3935 O O   . LEU A 1 512 ? 4.915   -57.524 30.487  1.00 51.42  ? 513 LEU A O   1 
ATOM   3936 C CB  . LEU A 1 512 ? 6.838   -55.415 30.776  1.00 39.46  ? 513 LEU A CB  1 
ATOM   3937 C CG  . LEU A 1 512 ? 7.845   -54.295 30.522  1.00 46.65  ? 513 LEU A CG  1 
ATOM   3938 C CD1 . LEU A 1 512 ? 7.300   -52.971 31.038  1.00 37.76  ? 513 LEU A CD1 1 
ATOM   3939 C CD2 . LEU A 1 512 ? 9.197   -54.622 31.149  1.00 36.82  ? 513 LEU A CD2 1 
ATOM   3940 N N   . ASP A 1 513 ? 6.528   -58.954 31.128  1.00 45.07  ? 514 ASP A N   1 
ATOM   3941 C CA  . ASP A 1 513 ? 5.605   -59.942 31.674  1.00 53.29  ? 514 ASP A CA  1 
ATOM   3942 C C   . ASP A 1 513 ? 6.326   -60.786 32.728  1.00 50.99  ? 514 ASP A C   1 
ATOM   3943 O O   . ASP A 1 513 ? 7.385   -60.392 33.219  1.00 55.36  ? 514 ASP A O   1 
ATOM   3944 C CB  . ASP A 1 513 ? 4.979   -60.806 30.571  1.00 51.35  ? 514 ASP A CB  1 
ATOM   3945 C CG  . ASP A 1 513 ? 6.007   -61.559 29.757  1.00 58.63  ? 514 ASP A CG  1 
ATOM   3946 O OD1 . ASP A 1 513 ? 7.175   -61.669 30.197  1.00 64.45  ? 514 ASP A OD1 1 
ATOM   3947 O OD2 . ASP A 1 513 ? 5.647   -62.053 28.666  1.00 67.36  ? 514 ASP A OD2 1 
ATOM   3948 N N   . LEU A 1 514 ? 5.774   -61.942 33.070  1.00 47.91  ? 515 LEU A N   1 
ATOM   3949 C CA  . LEU A 1 514 ? 6.332   -62.732 34.182  1.00 58.01  ? 515 LEU A CA  1 
ATOM   3950 C C   . LEU A 1 514 ? 7.661   -63.389 33.838  1.00 59.40  ? 515 LEU A C   1 
ATOM   3951 O O   . LEU A 1 514 ? 8.394   -63.793 34.734  1.00 61.11  ? 515 LEU A O   1 
ATOM   3952 C CB  . LEU A 1 514 ? 5.359   -63.806 34.655  1.00 47.98  ? 515 LEU A CB  1 
ATOM   3953 C CG  . LEU A 1 514 ? 3.981   -63.379 35.157  1.00 54.77  ? 515 LEU A CG  1 
ATOM   3954 C CD1 . LEU A 1 514 ? 3.168   -64.621 35.494  1.00 51.79  ? 515 LEU A CD1 1 
ATOM   3955 C CD2 . LEU A 1 514 ? 4.084   -62.469 36.370  1.00 49.04  ? 515 LEU A CD2 1 
ATOM   3956 N N   . ARG A 1 515 ? 7.961   -63.498 32.545  1.00 51.55  ? 516 ARG A N   1 
ATOM   3957 C CA  . ARG A 1 515 ? 9.213   -64.081 32.080  1.00 47.63  ? 516 ARG A CA  1 
ATOM   3958 C C   . ARG A 1 515 ? 10.271  -62.999 32.101  1.00 54.38  ? 516 ARG A C   1 
ATOM   3959 O O   . ARG A 1 515 ? 9.938   -61.821 32.146  1.00 57.52  ? 516 ARG A O   1 
ATOM   3960 C CB  . ARG A 1 515 ? 9.077   -64.571 30.633  1.00 52.90  ? 516 ARG A CB  1 
ATOM   3961 C CG  . ARG A 1 515 ? 7.954   -65.549 30.343  1.00 64.61  ? 516 ARG A CG  1 
ATOM   3962 C CD  . ARG A 1 515 ? 7.844   -65.784 28.826  1.00 67.55  ? 516 ARG A CD  1 
ATOM   3963 N NE  . ARG A 1 515 ? 7.557   -64.542 28.099  1.00 78.52  ? 516 ARG A NE  1 
ATOM   3964 C CZ  . ARG A 1 515 ? 8.248   -64.077 27.054  1.00 81.54  ? 516 ARG A CZ  1 
ATOM   3965 N NH1 . ARG A 1 515 ? 9.289   -64.747 26.570  1.00 81.82  ? 516 ARG A NH1 1 
ATOM   3966 N NH2 . ARG A 1 515 ? 7.888   -62.934 26.483  1.00 66.13  ? 516 ARG A NH2 1 
ATOM   3967 N N   . PRO A 1 516 ? 11.557  -63.387 32.046  1.00 55.30  ? 517 PRO A N   1 
ATOM   3968 C CA  . PRO A 1 516 ? 12.612  -62.377 31.910  1.00 58.41  ? 517 PRO A CA  1 
ATOM   3969 C C   . PRO A 1 516 ? 12.404  -61.540 30.642  1.00 60.02  ? 517 PRO A C   1 
ATOM   3970 O O   . PRO A 1 516 ? 11.717  -61.997 29.716  1.00 56.84  ? 517 PRO A O   1 
ATOM   3971 C CB  . PRO A 1 516 ? 13.884  -63.221 31.761  1.00 54.09  ? 517 PRO A CB  1 
ATOM   3972 C CG  . PRO A 1 516 ? 13.550  -64.519 32.425  1.00 62.24  ? 517 PRO A CG  1 
ATOM   3973 C CD  . PRO A 1 516 ? 12.101  -64.752 32.166  1.00 54.96  ? 517 PRO A CD  1 
ATOM   3974 N N   . LEU A 1 517 ? 12.985  -60.340 30.620  1.00 51.41  ? 518 LEU A N   1 
ATOM   3975 C CA  . LEU A 1 517 ? 12.929  -59.449 29.467  1.00 54.37  ? 518 LEU A CA  1 
ATOM   3976 C C   . LEU A 1 517 ? 13.277  -60.139 28.151  1.00 59.43  ? 518 LEU A C   1 
ATOM   3977 O O   . LEU A 1 517 ? 14.275  -60.857 28.052  1.00 58.78  ? 518 LEU A O   1 
ATOM   3978 C CB  . LEU A 1 517 ? 13.896  -58.285 29.648  1.00 55.96  ? 518 LEU A CB  1 
ATOM   3979 C CG  . LEU A 1 517 ? 13.692  -57.259 30.752  1.00 57.88  ? 518 LEU A CG  1 
ATOM   3980 C CD1 . LEU A 1 517 ? 14.817  -56.229 30.648  1.00 48.21  ? 518 LEU A CD1 1 
ATOM   3981 C CD2 . LEU A 1 517 ? 12.313  -56.606 30.644  1.00 56.56  ? 518 LEU A CD2 1 
ATOM   3982 N N   . GLU A 1 518 ? 12.450  -59.901 27.142  1.00 56.88  ? 519 GLU A N   1 
ATOM   3983 C CA  . GLU A 1 518 ? 12.733  -60.366 25.793  1.00 49.99  ? 519 GLU A CA  1 
ATOM   3984 C C   . GLU A 1 518 ? 12.811  -59.146 24.900  1.00 47.82  ? 519 GLU A C   1 
ATOM   3985 O O   . GLU A 1 518 ? 11.900  -58.320 24.886  1.00 47.57  ? 519 GLU A O   1 
ATOM   3986 C CB  . GLU A 1 518 ? 11.643  -61.326 25.301  1.00 50.18  ? 519 GLU A CB  1 
ATOM   3987 C CG  . GLU A 1 518 ? 11.799  -61.730 23.824  1.00 65.80  ? 519 GLU A CG  1 
ATOM   3988 C CD  . GLU A 1 518 ? 10.592  -62.496 23.281  1.00 73.56  ? 519 GLU A CD  1 
ATOM   3989 O OE1 . GLU A 1 518 ? 9.887   -63.155 24.080  1.00 79.92  ? 519 GLU A OE1 1 
ATOM   3990 O OE2 . GLU A 1 518 ? 10.347  -62.429 22.052  1.00 75.89  ? 519 GLU A OE2 1 
ATOM   3991 N N   . VAL A 1 519 ? 13.915  -59.026 24.173  1.00 46.17  ? 520 VAL A N   1 
ATOM   3992 C CA  . VAL A 1 519 ? 14.129  -57.909 23.281  1.00 40.82  ? 520 VAL A CA  1 
ATOM   3993 C C   . VAL A 1 519 ? 13.527  -58.227 21.920  1.00 49.74  ? 520 VAL A C   1 
ATOM   3994 O O   . VAL A 1 519 ? 13.750  -59.307 21.390  1.00 50.30  ? 520 VAL A O   1 
ATOM   3995 C CB  . VAL A 1 519 ? 15.620  -57.631 23.099  1.00 47.56  ? 520 VAL A CB  1 
ATOM   3996 C CG1 . VAL A 1 519 ? 15.830  -56.485 22.118  1.00 50.55  ? 520 VAL A CG1 1 
ATOM   3997 C CG2 . VAL A 1 519 ? 16.258  -57.331 24.448  1.00 48.82  ? 520 VAL A CG2 1 
ATOM   3998 N N   . ARG A 1 520 ? 12.748  -57.291 21.376  1.00 52.45  ? 521 ARG A N   1 
ATOM   3999 C CA  . ARG A 1 520 ? 12.119  -57.449 20.057  1.00 52.88  ? 521 ARG A CA  1 
ATOM   4000 C C   . ARG A 1 520 ? 12.275  -56.190 19.230  1.00 50.80  ? 521 ARG A C   1 
ATOM   4001 O O   . ARG A 1 520 ? 12.772  -55.182 19.732  1.00 54.95  ? 521 ARG A O   1 
ATOM   4002 C CB  . ARG A 1 520 ? 10.636  -57.777 20.197  1.00 49.77  ? 521 ARG A CB  1 
ATOM   4003 C CG  . ARG A 1 520 ? 10.371  -59.035 20.977  1.00 53.76  ? 521 ARG A CG  1 
ATOM   4004 C CD  . ARG A 1 520 ? 8.897   -59.220 21.194  1.00 61.43  ? 521 ARG A CD  1 
ATOM   4005 N NE  . ARG A 1 520 ? 8.656   -60.335 22.091  1.00 59.93  ? 521 ARG A NE  1 
ATOM   4006 C CZ  . ARG A 1 520 ? 7.541   -60.500 22.791  1.00 68.29  ? 521 ARG A CZ  1 
ATOM   4007 N NH1 . ARG A 1 520 ? 6.559   -59.615 22.688  1.00 63.02  ? 521 ARG A NH1 1 
ATOM   4008 N NH2 . ARG A 1 520 ? 7.409   -61.551 23.593  1.00 64.07  ? 521 ARG A NH2 1 
ATOM   4009 N N   . ARG A 1 521 ? 11.842  -56.256 17.968  1.00 51.56  ? 522 ARG A N   1 
ATOM   4010 C CA  . ARG A 1 521 ? 12.002  -55.160 17.007  1.00 54.27  ? 522 ARG A CA  1 
ATOM   4011 C C   . ARG A 1 521 ? 10.660  -54.712 16.417  1.00 55.00  ? 522 ARG A C   1 
ATOM   4012 O O   . ARG A 1 521 ? 9.849   -55.536 15.996  1.00 49.23  ? 522 ARG A O   1 
ATOM   4013 C CB  . ARG A 1 521 ? 12.917  -55.577 15.840  1.00 56.94  ? 522 ARG A CB  1 
ATOM   4014 C CG  . ARG A 1 521 ? 14.387  -55.855 16.184  1.00 51.75  ? 522 ARG A CG  1 
ATOM   4015 C CD  . ARG A 1 521 ? 15.253  -55.888 14.894  1.00 50.42  ? 522 ARG A CD  1 
ATOM   4016 N NE  . ARG A 1 521 ? 15.259  -54.592 14.214  1.00 48.83  ? 522 ARG A NE  1 
ATOM   4017 C CZ  . ARG A 1 521 ? 14.968  -54.403 12.925  1.00 60.57  ? 522 ARG A CZ  1 
ATOM   4018 N NH1 . ARG A 1 521 ? 14.672  -55.435 12.134  1.00 49.81  ? 522 ARG A NH1 1 
ATOM   4019 N NH2 . ARG A 1 521 ? 14.990  -53.175 12.421  1.00 49.82  ? 522 ARG A NH2 1 
ATOM   4020 N N   . GLY A 1 522 ? 10.437  -53.403 16.381  1.00 51.03  ? 523 GLY A N   1 
ATOM   4021 C CA  . GLY A 1 522 ? 9.289   -52.842 15.691  1.00 49.43  ? 523 GLY A CA  1 
ATOM   4022 C C   . GLY A 1 522 ? 8.012   -52.738 16.503  1.00 49.90  ? 523 GLY A C   1 
ATOM   4023 O O   . GLY A 1 522 ? 7.429   -53.748 16.894  1.00 51.59  ? 523 GLY A O   1 
ATOM   4024 N N   . LEU A 1 523 ? 7.581   -51.506 16.755  1.00 45.82  ? 524 LEU A N   1 
ATOM   4025 C CA  . LEU A 1 523 ? 6.279   -51.254 17.357  1.00 49.32  ? 524 LEU A CA  1 
ATOM   4026 C C   . LEU A 1 523 ? 5.205   -51.255 16.266  1.00 49.64  ? 524 LEU A C   1 
ATOM   4027 O O   . LEU A 1 523 ? 4.800   -50.185 15.791  1.00 46.79  ? 524 LEU A O   1 
ATOM   4028 C CB  . LEU A 1 523 ? 6.271   -49.908 18.079  1.00 42.95  ? 524 LEU A CB  1 
ATOM   4029 C CG  . LEU A 1 523 ? 7.140   -49.781 19.337  1.00 52.19  ? 524 LEU A CG  1 
ATOM   4030 C CD1 . LEU A 1 523 ? 7.270   -48.322 19.812  1.00 42.22  ? 524 LEU A CD1 1 
ATOM   4031 C CD2 . LEU A 1 523 ? 6.564   -50.651 20.435  1.00 44.44  ? 524 LEU A CD2 1 
ATOM   4032 N N   A ARG A 1 524 ? 4.755   -52.453 15.896  0.34 45.08  ? 525 ARG A N   1 
ATOM   4033 N N   B ARG A 1 524 ? 4.744   -52.446 15.887  0.66 44.97  ? 525 ARG A N   1 
ATOM   4034 C CA  A ARG A 1 524 ? 3.788   -52.647 14.823  0.34 49.55  ? 525 ARG A CA  1 
ATOM   4035 C CA  B ARG A 1 524 ? 3.758   -52.601 14.827  0.66 49.65  ? 525 ARG A CA  1 
ATOM   4036 C C   A ARG A 1 524 ? 4.186   -51.823 13.602  0.34 48.16  ? 525 ARG A C   1 
ATOM   4037 C C   B ARG A 1 524 ? 4.190   -51.797 13.603  0.66 48.21  ? 525 ARG A C   1 
ATOM   4038 O O   A ARG A 1 524 ? 3.398   -51.030 13.079  0.34 44.84  ? 525 ARG A O   1 
ATOM   4039 O O   B ARG A 1 524 ? 3.424   -50.977 13.080  0.66 44.73  ? 525 ARG A O   1 
ATOM   4040 C CB  A ARG A 1 524 ? 2.367   -52.321 15.305  0.34 46.63  ? 525 ARG A CB  1 
ATOM   4041 C CB  B ARG A 1 524 ? 2.375   -52.145 15.309  0.66 46.50  ? 525 ARG A CB  1 
ATOM   4042 C CG  A ARG A 1 524 ? 1.984   -53.077 16.577  0.34 49.09  ? 525 ARG A CG  1 
ATOM   4043 C CG  B ARG A 1 524 ? 1.868   -52.859 16.555  0.66 49.35  ? 525 ARG A CG  1 
ATOM   4044 C CD  A ARG A 1 524 ? 0.473   -53.150 16.809  0.34 45.30  ? 525 ARG A CD  1 
ATOM   4045 C CD  B ARG A 1 524 ? 0.956   -54.030 16.204  0.66 50.31  ? 525 ARG A CD  1 
ATOM   4046 N NE  A ARG A 1 524 ? 0.158   -53.999 17.957  0.34 42.26  ? 525 ARG A NE  1 
ATOM   4047 N NE  B ARG A 1 524 ? -0.114  -53.624 15.296  0.66 53.28  ? 525 ARG A NE  1 
ATOM   4048 C CZ  A ARG A 1 524 ? -1.052  -54.471 18.241  0.34 45.06  ? 525 ARG A CZ  1 
ATOM   4049 C CZ  B ARG A 1 524 ? -0.733  -54.443 14.452  0.66 47.44  ? 525 ARG A CZ  1 
ATOM   4050 N NH1 A ARG A 1 524 ? -2.083  -54.184 17.456  0.34 40.31  ? 525 ARG A NH1 1 
ATOM   4051 N NH1 B ARG A 1 524 ? -0.399  -55.724 14.411  0.66 54.25  ? 525 ARG A NH1 1 
ATOM   4052 N NH2 A ARG A 1 524 ? -1.230  -55.233 19.314  0.34 47.40  ? 525 ARG A NH2 1 
ATOM   4053 N NH2 B ARG A 1 524 ? -1.683  -53.979 13.653  0.66 35.43  ? 525 ARG A NH2 1 
ATOM   4054 N N   . ALA A 1 525 ? 5.434   -52.012 13.179  1.00 46.61  ? 526 ALA A N   1 
ATOM   4055 C CA  . ALA A 1 525 ? 6.039   -51.228 12.097  1.00 47.99  ? 526 ALA A CA  1 
ATOM   4056 C C   . ALA A 1 525 ? 5.270   -51.218 10.767  1.00 46.89  ? 526 ALA A C   1 
ATOM   4057 O O   . ALA A 1 525 ? 5.135   -50.167 10.135  1.00 43.42  ? 526 ALA A O   1 
ATOM   4058 C CB  . ALA A 1 525 ? 7.494   -51.668 11.875  1.00 47.21  ? 526 ALA A CB  1 
ATOM   4059 N N   . GLN A 1 526 ? 4.788   -52.379 10.334  1.00 45.18  ? 527 GLN A N   1 
ATOM   4060 C CA  . GLN A 1 526 ? 4.031   -52.437 9.087   1.00 51.56  ? 527 GLN A CA  1 
ATOM   4061 C C   . GLN A 1 526 ? 2.740   -51.616 9.185   1.00 48.78  ? 527 GLN A C   1 
ATOM   4062 O O   . GLN A 1 526 ? 2.429   -50.852 8.294   1.00 47.93  ? 527 GLN A O   1 
ATOM   4063 C CB  . GLN A 1 526 ? 3.734   -53.885 8.675   1.00 47.85  ? 527 GLN A CB  1 
ATOM   4064 C CG  . GLN A 1 526 ? 4.974   -54.688 8.278   1.00 49.75  ? 527 GLN A CG  1 
ATOM   4065 C CD  . GLN A 1 526 ? 5.770   -54.033 7.148   1.00 52.96  ? 527 GLN A CD  1 
ATOM   4066 O OE1 . GLN A 1 526 ? 6.933   -53.688 7.322   1.00 57.53  ? 527 GLN A OE1 1 
ATOM   4067 N NE2 . GLN A 1 526 ? 5.139   -53.864 5.981   1.00 56.69  ? 527 GLN A NE2 1 
ATOM   4068 N N   . ALA A 1 527 ? 2.005   -51.746 10.281  1.00 50.42  ? 528 ALA A N   1 
ATOM   4069 C CA  . ALA A 1 527 ? 0.765   -50.977 10.432  1.00 46.16  ? 528 ALA A CA  1 
ATOM   4070 C C   . ALA A 1 527 ? 1.055   -49.492 10.615  1.00 44.65  ? 528 ALA A C   1 
ATOM   4071 O O   . ALA A 1 527 ? 0.381   -48.638 10.032  1.00 49.01  ? 528 ALA A O   1 
ATOM   4072 C CB  . ALA A 1 527 ? -0.070  -51.508 11.616  1.00 44.56  ? 528 ALA A CB  1 
ATOM   4073 N N   . CYS A 1 528 ? 2.059   -49.185 11.432  1.00 42.62  ? 529 CYS A N   1 
ATOM   4074 C CA  . CYS A 1 528 ? 2.395   -47.804 11.732  1.00 37.17  ? 529 CYS A CA  1 
ATOM   4075 C C   . CYS A 1 528 ? 2.991   -47.016 10.559  1.00 44.77  ? 529 CYS A C   1 
ATOM   4076 O O   . CYS A 1 528 ? 2.888   -45.786 10.510  1.00 44.06  ? 529 CYS A O   1 
ATOM   4077 C CB  . CYS A 1 528 ? 3.262   -47.729 12.988  1.00 47.28  ? 529 CYS A CB  1 
ATOM   4078 S SG  . CYS A 1 528 ? 2.310   -48.167 14.496  1.00 45.48  ? 529 CYS A SG  1 
ATOM   4079 N N   . ALA A 1 529 ? 3.583   -47.717 9.598   1.00 41.11  ? 530 ALA A N   1 
ATOM   4080 C CA  . ALA A 1 529 ? 3.980   -47.060 8.356   1.00 47.54  ? 530 ALA A CA  1 
ATOM   4081 C C   . ALA A 1 529 ? 2.740   -46.489 7.677   1.00 43.73  ? 530 ALA A C   1 
ATOM   4082 O O   . ALA A 1 529 ? 2.759   -45.367 7.158   1.00 43.40  ? 530 ALA A O   1 
ATOM   4083 C CB  . ALA A 1 529 ? 4.702   -48.027 7.442   1.00 41.07  ? 530 ALA A CB  1 
ATOM   4084 N N   . PHE A 1 530 ? 1.654   -47.260 7.695   1.00 41.09  ? 531 PHE A N   1 
ATOM   4085 C CA  . PHE A 1 530 ? 0.383   -46.774 7.159   1.00 41.52  ? 531 PHE A CA  1 
ATOM   4086 C C   . PHE A 1 530 ? -0.098  -45.473 7.856   1.00 42.90  ? 531 PHE A C   1 
ATOM   4087 O O   . PHE A 1 530 ? -0.296  -44.455 7.197   1.00 42.37  ? 531 PHE A O   1 
ATOM   4088 C CB  . PHE A 1 530 ? -0.700  -47.882 7.197   1.00 39.43  ? 531 PHE A CB  1 
ATOM   4089 C CG  . PHE A 1 530 ? -2.084  -47.381 6.871   1.00 42.14  ? 531 PHE A CG  1 
ATOM   4090 C CD1 . PHE A 1 530 ? -2.449  -47.114 5.551   1.00 46.47  ? 531 PHE A CD1 1 
ATOM   4091 C CD2 . PHE A 1 530 ? -3.008  -47.152 7.875   1.00 41.11  ? 531 PHE A CD2 1 
ATOM   4092 C CE1 . PHE A 1 530 ? -3.718  -46.632 5.244   1.00 43.90  ? 531 PHE A CE1 1 
ATOM   4093 C CE2 . PHE A 1 530 ? -4.265  -46.669 7.584   1.00 44.94  ? 531 PHE A CE2 1 
ATOM   4094 C CZ  . PHE A 1 530 ? -4.625  -46.407 6.249   1.00 49.45  ? 531 PHE A CZ  1 
ATOM   4095 N N   . TRP A 1 531 ? -0.257  -45.498 9.184   1.00 38.44  ? 532 TRP A N   1 
ATOM   4096 C CA  . TRP A 1 531 ? -0.845  -44.359 9.896   1.00 36.73  ? 532 TRP A CA  1 
ATOM   4097 C C   . TRP A 1 531 ? 0.071   -43.144 9.902   1.00 41.18  ? 532 TRP A C   1 
ATOM   4098 O O   . TRP A 1 531 ? -0.398  -42.005 9.859   1.00 44.00  ? 532 TRP A O   1 
ATOM   4099 C CB  . TRP A 1 531 ? -1.207  -44.730 11.372  1.00 38.38  ? 532 TRP A CB  1 
ATOM   4100 C CG  . TRP A 1 531 ? -2.272  -45.793 11.450  1.00 36.50  ? 532 TRP A CG  1 
ATOM   4101 C CD1 . TRP A 1 531 ? -2.094  -47.122 11.703  1.00 36.04  ? 532 TRP A CD1 1 
ATOM   4102 C CD2 . TRP A 1 531 ? -3.673  -45.609 11.234  1.00 37.18  ? 532 TRP A CD2 1 
ATOM   4103 N NE1 . TRP A 1 531 ? -3.299  -47.779 11.655  1.00 39.61  ? 532 TRP A NE1 1 
ATOM   4104 C CE2 . TRP A 1 531 ? -4.286  -46.871 11.374  1.00 39.77  ? 532 TRP A CE2 1 
ATOM   4105 C CE3 . TRP A 1 531 ? -4.472  -44.496 10.947  1.00 38.12  ? 532 TRP A CE3 1 
ATOM   4106 C CZ2 . TRP A 1 531 ? -5.668  -47.049 11.246  1.00 43.21  ? 532 TRP A CZ2 1 
ATOM   4107 C CZ3 . TRP A 1 531 ? -5.840  -44.675 10.795  1.00 35.75  ? 532 TRP A CZ3 1 
ATOM   4108 C CH2 . TRP A 1 531 ? -6.422  -45.940 10.948  1.00 39.20  ? 532 TRP A CH2 1 
ATOM   4109 N N   . ASN A 1 532 ? 1.375   -43.393 9.988   1.00 40.82  ? 533 ASN A N   1 
ATOM   4110 C CA  . ASN A 1 532 ? 2.356   -42.325 10.174  1.00 40.41  ? 533 ASN A CA  1 
ATOM   4111 C C   . ASN A 1 532 ? 2.948   -41.797 8.864   1.00 41.66  ? 533 ASN A C   1 
ATOM   4112 O O   . ASN A 1 532 ? 3.316   -40.629 8.776   1.00 49.03  ? 533 ASN A O   1 
ATOM   4113 C CB  . ASN A 1 532 ? 3.484   -42.773 11.146  1.00 35.86  ? 533 ASN A CB  1 
ATOM   4114 C CG  . ASN A 1 532 ? 2.976   -42.999 12.564  1.00 42.99  ? 533 ASN A CG  1 
ATOM   4115 O OD1 . ASN A 1 532 ? 1.952   -42.448 12.949  1.00 48.69  ? 533 ASN A OD1 1 
ATOM   4116 N ND2 . ASN A 1 532 ? 3.685   -43.815 13.341  1.00 36.20  ? 533 ASN A ND2 1 
ATOM   4117 N N   . ARG A 1 533 ? 3.035   -42.645 7.842   1.00 40.36  ? 534 ARG A N   1 
ATOM   4118 C CA  . ARG A 1 533 ? 3.708   -42.225 6.605   1.00 47.75  ? 534 ARG A CA  1 
ATOM   4119 C C   . ARG A 1 533 ? 2.752   -42.007 5.439   1.00 47.37  ? 534 ARG A C   1 
ATOM   4120 O O   . ARG A 1 533 ? 2.763   -40.962 4.813   1.00 48.63  ? 534 ARG A O   1 
ATOM   4121 C CB  . ARG A 1 533 ? 4.812   -43.212 6.206   1.00 45.69  ? 534 ARG A CB  1 
ATOM   4122 C CG  . ARG A 1 533 ? 6.008   -43.228 7.164   1.00 41.78  ? 534 ARG A CG  1 
ATOM   4123 C CD  . ARG A 1 533 ? 6.969   -44.357 6.815   1.00 50.49  ? 534 ARG A CD  1 
ATOM   4124 N NE  . ARG A 1 533 ? 7.819   -44.687 7.954   1.00 59.37  ? 534 ARG A NE  1 
ATOM   4125 C CZ  . ARG A 1 533 ? 8.997   -44.117 8.204   1.00 58.99  ? 534 ARG A CZ  1 
ATOM   4126 N NH1 . ARG A 1 533 ? 9.478   -43.184 7.390   1.00 55.73  ? 534 ARG A NH1 1 
ATOM   4127 N NH2 . ARG A 1 533 ? 9.692   -44.484 9.272   1.00 63.40  ? 534 ARG A NH2 1 
ATOM   4128 N N   . PHE A 1 534 ? 1.914   -42.993 5.155   1.00 45.73  ? 535 PHE A N   1 
ATOM   4129 C CA  . PHE A 1 534 ? 1.034   -42.897 4.001   1.00 47.03  ? 535 PHE A CA  1 
ATOM   4130 C C   . PHE A 1 534 ? -0.241  -42.100 4.257   1.00 49.27  ? 535 PHE A C   1 
ATOM   4131 O O   . PHE A 1 534 ? -0.574  -41.218 3.491   1.00 44.80  ? 535 PHE A O   1 
ATOM   4132 C CB  . PHE A 1 534 ? 0.643   -44.284 3.465   1.00 49.68  ? 535 PHE A CB  1 
ATOM   4133 C CG  . PHE A 1 534 ? -0.242  -44.213 2.257   1.00 44.08  ? 535 PHE A CG  1 
ATOM   4134 C CD1 . PHE A 1 534 ? 0.271   -43.789 1.041   1.00 43.69  ? 535 PHE A CD1 1 
ATOM   4135 C CD2 . PHE A 1 534 ? -1.586  -44.534 2.340   1.00 44.33  ? 535 PHE A CD2 1 
ATOM   4136 C CE1 . PHE A 1 534 ? -0.547  -43.692 -0.080  1.00 45.37  ? 535 PHE A CE1 1 
ATOM   4137 C CE2 . PHE A 1 534 ? -2.403  -44.451 1.228   1.00 51.33  ? 535 PHE A CE2 1 
ATOM   4138 C CZ  . PHE A 1 534 ? -1.885  -44.029 0.020   1.00 44.08  ? 535 PHE A CZ  1 
ATOM   4139 N N   . LEU A 1 535 ? -0.978  -42.437 5.311   1.00 47.98  ? 536 LEU A N   1 
ATOM   4140 C CA  . LEU A 1 535 ? -2.292  -41.825 5.497   1.00 47.91  ? 536 LEU A CA  1 
ATOM   4141 C C   . LEU A 1 535 ? -2.299  -40.274 5.506   1.00 48.80  ? 536 LEU A C   1 
ATOM   4142 O O   . LEU A 1 535 ? -3.197  -39.667 4.923   1.00 53.33  ? 536 LEU A O   1 
ATOM   4143 C CB  . LEU A 1 535 ? -3.024  -42.405 6.719   1.00 51.56  ? 536 LEU A CB  1 
ATOM   4144 C CG  . LEU A 1 535 ? -4.528  -42.096 6.673   1.00 56.52  ? 536 LEU A CG  1 
ATOM   4145 C CD1 . LEU A 1 535 ? -5.112  -42.730 5.427   1.00 54.98  ? 536 LEU A CD1 1 
ATOM   4146 C CD2 . LEU A 1 535 ? -5.251  -42.592 7.908   1.00 52.97  ? 536 LEU A CD2 1 
ATOM   4147 N N   . PRO A 1 536 ? -1.308  -39.629 6.159   1.00 50.63  ? 537 PRO A N   1 
ATOM   4148 C CA  . PRO A 1 536 ? -1.297  -38.164 6.076   1.00 49.91  ? 537 PRO A CA  1 
ATOM   4149 C C   . PRO A 1 536 ? -1.203  -37.633 4.646   1.00 62.15  ? 537 PRO A C   1 
ATOM   4150 O O   . PRO A 1 536 ? -1.816  -36.607 4.357   1.00 59.66  ? 537 PRO A O   1 
ATOM   4151 C CB  . PRO A 1 536 ? -0.029  -37.784 6.841   1.00 48.67  ? 537 PRO A CB  1 
ATOM   4152 C CG  . PRO A 1 536 ? 0.149   -38.880 7.841   1.00 51.55  ? 537 PRO A CG  1 
ATOM   4153 C CD  . PRO A 1 536 ? -0.303  -40.127 7.124   1.00 58.25  ? 537 PRO A CD  1 
ATOM   4154 N N   . LYS A 1 537 ? -0.445  -38.300 3.773   1.00 59.59  ? 538 LYS A N   1 
ATOM   4155 C CA  . LYS A 1 537 ? -0.328  -37.848 2.381   1.00 55.35  ? 538 LYS A CA  1 
ATOM   4156 C C   . LYS A 1 537 ? -1.684  -37.927 1.686   1.00 57.47  ? 538 LYS A C   1 
ATOM   4157 O O   . LYS A 1 537 ? -2.089  -37.011 0.975   1.00 61.07  ? 538 LYS A O   1 
ATOM   4158 C CB  . LYS A 1 537 ? 0.711   -38.669 1.616   1.00 55.04  ? 538 LYS A CB  1 
ATOM   4159 C CG  . LYS A 1 537 ? 2.149   -38.463 2.073   1.00 56.40  ? 538 LYS A CG  1 
ATOM   4160 C CD  . LYS A 1 537 ? 3.077   -39.461 1.396   1.00 52.69  ? 538 LYS A CD  1 
ATOM   4161 C CE  . LYS A 1 537 ? 4.531   -39.021 1.457   1.00 58.70  ? 538 LYS A CE  1 
ATOM   4162 N NZ  . LYS A 1 537 ? 5.246   -39.391 2.707   1.00 63.44  ? 538 LYS A NZ  1 
ATOM   4163 N N   . LEU A 1 538 ? -2.392  -39.025 1.914   1.00 57.32  ? 539 LEU A N   1 
ATOM   4164 C CA  . LEU A 1 538 ? -3.706  -39.221 1.325   1.00 60.58  ? 539 LEU A CA  1 
ATOM   4165 C C   . LEU A 1 538 ? -4.681  -38.134 1.767   1.00 62.44  ? 539 LEU A C   1 
ATOM   4166 O O   . LEU A 1 538 ? -5.366  -37.536 0.938   1.00 60.18  ? 539 LEU A O   1 
ATOM   4167 C CB  . LEU A 1 538 ? -4.235  -40.620 1.661   1.00 52.79  ? 539 LEU A CB  1 
ATOM   4168 C CG  . LEU A 1 538 ? -5.593  -41.050 1.107   1.00 58.43  ? 539 LEU A CG  1 
ATOM   4169 C CD1 . LEU A 1 538 ? -5.618  -42.543 0.908   1.00 62.05  ? 539 LEU A CD1 1 
ATOM   4170 C CD2 . LEU A 1 538 ? -6.718  -40.644 2.039   1.00 57.71  ? 539 LEU A CD2 1 
ATOM   4171 N N   . LEU A 1 539 ? -4.731  -37.874 3.071   1.00 67.13  ? 540 LEU A N   1 
ATOM   4172 C CA  . LEU A 1 539 ? -5.631  -36.857 3.635   1.00 70.28  ? 540 LEU A CA  1 
ATOM   4173 C C   . LEU A 1 539 ? -5.378  -35.436 3.108   1.00 67.42  ? 540 LEU A C   1 
ATOM   4174 O O   . LEU A 1 539 ? -6.289  -34.609 3.110   1.00 82.79  ? 540 LEU A O   1 
ATOM   4175 C CB  . LEU A 1 539 ? -5.591  -36.878 5.176   1.00 61.71  ? 540 LEU A CB  1 
ATOM   4176 C CG  . LEU A 1 539 ? -6.210  -38.119 5.827   1.00 60.19  ? 540 LEU A CG  1 
ATOM   4177 C CD1 . LEU A 1 539 ? -6.034  -38.102 7.336   1.00 56.58  ? 540 LEU A CD1 1 
ATOM   4178 C CD2 . LEU A 1 539 ? -7.681  -38.236 5.477   1.00 61.39  ? 540 LEU A CD2 1 
ATOM   4179 N N   . SER A 1 540 ? -4.152  -35.165 2.658   1.00 68.20  ? 541 SER A N   1 
ATOM   4180 C CA  . SER A 1 540 ? -3.770  -33.848 2.133   1.00 67.79  ? 541 SER A CA  1 
ATOM   4181 C C   . SER A 1 540 ? -4.115  -33.666 0.657   1.00 85.54  ? 541 SER A C   1 
ATOM   4182 O O   . SER A 1 540 ? -4.048  -32.550 0.133   1.00 82.80  ? 541 SER A O   1 
ATOM   4183 C CB  . SER A 1 540 ? -2.271  -33.627 2.295   1.00 61.90  ? 541 SER A CB  1 
ATOM   4184 O OG  . SER A 1 540 ? -1.866  -33.920 3.617   1.00 84.46  ? 541 SER A OG  1 
ATOM   4185 N N   . ALA A 1 541 ? -4.458  -34.764 -0.013  1.00 77.49  ? 542 ALA A N   1 
ATOM   4186 C CA  . ALA A 1 541 ? -4.808  -34.728 -1.431  1.00 79.49  ? 542 ALA A CA  1 
ATOM   4187 C C   . ALA A 1 541 ? -6.284  -35.059 -1.655  1.00 85.26  ? 542 ALA A C   1 
ATOM   4188 O O   . ALA A 1 541 ? -7.136  -34.766 -0.809  1.00 85.52  ? 542 ALA A O   1 
ATOM   4189 C CB  . ALA A 1 541 ? -3.927  -35.682 -2.209  1.00 69.22  ? 542 ALA A CB  1 
ATOM   4190 N N   . GLU B 1 3   ? 4.068   -89.876 -54.736 1.00 76.45  ? 4   GLU B N   1 
ATOM   4191 C CA  . GLU B 1 3   ? 3.370   -89.012 -53.782 1.00 76.36  ? 4   GLU B CA  1 
ATOM   4192 C C   . GLU B 1 3   ? 2.819   -89.801 -52.562 1.00 80.05  ? 4   GLU B C   1 
ATOM   4193 O O   . GLU B 1 3   ? 2.464   -90.976 -52.686 1.00 75.98  ? 4   GLU B O   1 
ATOM   4194 C CB  . GLU B 1 3   ? 2.269   -88.226 -54.512 1.00 78.47  ? 4   GLU B CB  1 
ATOM   4195 C CG  . GLU B 1 3   ? 1.873   -86.891 -53.862 1.00 89.94  ? 4   GLU B CG  1 
ATOM   4196 C CD  . GLU B 1 3   ? 2.610   -85.648 -54.401 1.00 84.28  ? 4   GLU B CD  1 
ATOM   4197 O OE1 . GLU B 1 3   ? 3.533   -85.169 -53.705 1.00 73.78  ? 4   GLU B OE1 1 
ATOM   4198 O OE2 . GLU B 1 3   ? 2.243   -85.121 -55.484 1.00 69.58  ? 4   GLU B OE2 1 
ATOM   4199 N N   . ASP B 1 4   ? 2.788   -89.160 -51.387 1.00 77.86  ? 5   ASP B N   1 
ATOM   4200 C CA  . ASP B 1 4   ? 2.281   -89.771 -50.141 1.00 64.91  ? 5   ASP B CA  1 
ATOM   4201 C C   . ASP B 1 4   ? 0.902   -89.199 -49.817 1.00 67.87  ? 5   ASP B C   1 
ATOM   4202 O O   . ASP B 1 4   ? 0.761   -88.001 -49.570 1.00 70.36  ? 5   ASP B O   1 
ATOM   4203 C CB  . ASP B 1 4   ? 3.255   -89.510 -48.980 1.00 57.55  ? 5   ASP B CB  1 
ATOM   4204 C CG  . ASP B 1 4   ? 2.844   -90.207 -47.665 1.00 69.46  ? 5   ASP B CG  1 
ATOM   4205 O OD1 . ASP B 1 4   ? 1.654   -90.544 -47.470 1.00 75.50  ? 5   ASP B OD1 1 
ATOM   4206 O OD2 . ASP B 1 4   ? 3.728   -90.406 -46.799 1.00 62.10  ? 5   ASP B OD2 1 
ATOM   4207 N N   . ALA B 1 5   ? -0.112  -90.059 -49.807 1.00 62.40  ? 6   ALA B N   1 
ATOM   4208 C CA  . ALA B 1 5   ? -1.496  -89.627 -49.600 1.00 67.33  ? 6   ALA B CA  1 
ATOM   4209 C C   . ALA B 1 5   ? -1.733  -88.923 -48.259 1.00 69.34  ? 6   ALA B C   1 
ATOM   4210 O O   . ALA B 1 5   ? -2.638  -88.086 -48.140 1.00 63.27  ? 6   ALA B O   1 
ATOM   4211 C CB  . ALA B 1 5   ? -2.443  -90.811 -49.733 1.00 61.69  ? 6   ALA B CB  1 
ATOM   4212 N N   . GLU B 1 6   ? -0.943  -89.281 -47.249 1.00 62.72  ? 7   GLU B N   1 
ATOM   4213 C CA  . GLU B 1 6   ? -1.088  -88.670 -45.925 1.00 69.31  ? 7   GLU B CA  1 
ATOM   4214 C C   . GLU B 1 6   ? -0.700  -87.200 -45.971 1.00 67.13  ? 7   GLU B C   1 
ATOM   4215 O O   . GLU B 1 6   ? -1.216  -86.388 -45.198 1.00 59.73  ? 7   GLU B O   1 
ATOM   4216 C CB  . GLU B 1 6   ? -0.237  -89.398 -44.882 1.00 65.72  ? 7   GLU B CB  1 
ATOM   4217 C CG  . GLU B 1 6   ? -0.746  -90.783 -44.497 1.00 75.42  ? 7   GLU B CG  1 
ATOM   4218 C CD  . GLU B 1 6   ? -2.054  -90.739 -43.722 1.00 78.29  ? 7   GLU B CD  1 
ATOM   4219 O OE1 . GLU B 1 6   ? -2.410  -89.657 -43.212 1.00 81.75  ? 7   GLU B OE1 1 
ATOM   4220 O OE2 . GLU B 1 6   ? -2.727  -91.786 -43.619 1.00 87.03  ? 7   GLU B OE2 1 
ATOM   4221 N N   . LEU B 1 7   ? 0.191   -86.867 -46.906 1.00 51.59  ? 8   LEU B N   1 
ATOM   4222 C CA  . LEU B 1 7   ? 0.748   -85.531 -47.000 1.00 47.99  ? 8   LEU B CA  1 
ATOM   4223 C C   . LEU B 1 7   ? 0.023   -84.628 -47.983 1.00 53.80  ? 8   LEU B C   1 
ATOM   4224 O O   . LEU B 1 7   ? 0.515   -83.542 -48.291 1.00 50.09  ? 8   LEU B O   1 
ATOM   4225 C CB  . LEU B 1 7   ? 2.229   -85.594 -47.361 1.00 49.36  ? 8   LEU B CB  1 
ATOM   4226 C CG  . LEU B 1 7   ? 3.105   -86.411 -46.418 1.00 54.69  ? 8   LEU B CG  1 
ATOM   4227 C CD1 . LEU B 1 7   ? 4.529   -86.330 -46.901 1.00 51.85  ? 8   LEU B CD1 1 
ATOM   4228 C CD2 . LEU B 1 7   ? 2.975   -85.940 -44.942 1.00 60.08  ? 8   LEU B CD2 1 
ATOM   4229 N N   . LEU B 1 8   ? -1.139  -85.068 -48.469 1.00 49.64  ? 9   LEU B N   1 
ATOM   4230 C CA  . LEU B 1 8   ? -1.927  -84.263 -49.391 1.00 52.54  ? 9   LEU B CA  1 
ATOM   4231 C C   . LEU B 1 8   ? -3.291  -83.969 -48.814 1.00 54.28  ? 9   LEU B C   1 
ATOM   4232 O O   . LEU B 1 8   ? -3.979  -84.871 -48.330 1.00 55.72  ? 9   LEU B O   1 
ATOM   4233 C CB  . LEU B 1 8   ? -2.104  -84.973 -50.735 1.00 50.46  ? 9   LEU B CB  1 
ATOM   4234 C CG  . LEU B 1 8   ? -0.843  -85.191 -51.551 1.00 55.71  ? 9   LEU B CG  1 
ATOM   4235 C CD1 . LEU B 1 8   ? -1.178  -86.134 -52.693 1.00 62.13  ? 9   LEU B CD1 1 
ATOM   4236 C CD2 . LEU B 1 8   ? -0.308  -83.861 -52.074 1.00 54.59  ? 9   LEU B CD2 1 
ATOM   4237 N N   . VAL B 1 9   ? -3.693  -82.705 -48.894 1.00 46.80  ? 10  VAL B N   1 
ATOM   4238 C CA  . VAL B 1 9   ? -4.934  -82.269 -48.292 1.00 48.05  ? 10  VAL B CA  1 
ATOM   4239 C C   . VAL B 1 9   ? -5.519  -81.172 -49.139 1.00 43.94  ? 10  VAL B C   1 
ATOM   4240 O O   . VAL B 1 9   ? -4.779  -80.332 -49.662 1.00 50.84  ? 10  VAL B O   1 
ATOM   4241 C CB  . VAL B 1 9   ? -4.680  -81.700 -46.857 1.00 50.89  ? 10  VAL B CB  1 
ATOM   4242 C CG1 . VAL B 1 9   ? -5.932  -80.997 -46.300 1.00 49.63  ? 10  VAL B CG1 1 
ATOM   4243 C CG2 . VAL B 1 9   ? -4.229  -82.803 -45.906 1.00 53.95  ? 10  VAL B CG2 1 
ATOM   4244 N N   . THR B 1 10  ? -6.844  -81.174 -49.272 1.00 44.74  ? 11  THR B N   1 
ATOM   4245 C CA  . THR B 1 10  ? -7.554  -80.099 -49.955 1.00 50.45  ? 11  THR B CA  1 
ATOM   4246 C C   . THR B 1 10  ? -8.329  -79.248 -48.964 1.00 53.94  ? 11  THR B C   1 
ATOM   4247 O O   . THR B 1 10  ? -9.128  -79.765 -48.189 1.00 53.23  ? 11  THR B O   1 
ATOM   4248 C CB  . THR B 1 10  ? -8.547  -80.649 -51.014 1.00 54.35  ? 11  THR B CB  1 
ATOM   4249 O OG1 . THR B 1 10  ? -7.839  -81.462 -51.951 1.00 49.18  ? 11  THR B OG1 1 
ATOM   4250 C CG2 . THR B 1 10  ? -9.206  -79.526 -51.751 1.00 49.60  ? 11  THR B CG2 1 
ATOM   4251 N N   . VAL B 1 11  ? -8.099  -77.941 -48.991 1.00 51.24  ? 12  VAL B N   1 
ATOM   4252 C CA  . VAL B 1 11  ? -8.853  -77.027 -48.137 1.00 50.77  ? 12  VAL B CA  1 
ATOM   4253 C C   . VAL B 1 11  ? -9.653  -76.161 -49.072 1.00 56.55  ? 12  VAL B C   1 
ATOM   4254 O O   . VAL B 1 11  ? -9.478  -76.264 -50.284 1.00 56.41  ? 12  VAL B O   1 
ATOM   4255 C CB  . VAL B 1 11  ? -7.929  -76.140 -47.298 1.00 53.52  ? 12  VAL B CB  1 
ATOM   4256 C CG1 . VAL B 1 11  ? -7.209  -76.972 -46.255 1.00 44.73  ? 12  VAL B CG1 1 
ATOM   4257 C CG2 . VAL B 1 11  ? -6.932  -75.424 -48.202 1.00 47.14  ? 12  VAL B CG2 1 
ATOM   4258 N N   . ARG B 1 12  ? -10.521 -75.309 -48.534 1.00 54.02  ? 13  ARG B N   1 
ATOM   4259 C CA  . ARG B 1 12  ? -11.406 -74.514 -49.386 1.00 55.84  ? 13  ARG B CA  1 
ATOM   4260 C C   . ARG B 1 12  ? -10.666 -73.724 -50.462 1.00 54.93  ? 13  ARG B C   1 
ATOM   4261 O O   . ARG B 1 12  ? -11.228 -73.431 -51.504 1.00 50.99  ? 13  ARG B O   1 
ATOM   4262 C CB  . ARG B 1 12  ? -12.295 -73.575 -48.561 1.00 55.67  ? 13  ARG B CB  1 
ATOM   4263 C CG  . ARG B 1 12  ? -13.435 -74.286 -47.832 1.00 59.71  ? 13  ARG B CG  1 
ATOM   4264 C CD  . ARG B 1 12  ? -14.557 -73.320 -47.466 1.00 74.53  ? 13  ARG B CD  1 
ATOM   4265 N NE  . ARG B 1 12  ? -15.372 -73.833 -46.364 1.00 78.17  ? 13  ARG B NE  1 
ATOM   4266 C CZ  . ARG B 1 12  ? -16.424 -73.199 -45.852 1.00 85.60  ? 13  ARG B CZ  1 
ATOM   4267 N NH1 . ARG B 1 12  ? -16.798 -72.027 -46.349 1.00 92.44  ? 13  ARG B NH1 1 
ATOM   4268 N NH2 . ARG B 1 12  ? -17.108 -73.737 -44.846 1.00 83.81  ? 13  ARG B NH2 1 
ATOM   4269 N N   . GLY B 1 13  ? -9.406  -73.386 -50.207 1.00 52.28  ? 14  GLY B N   1 
ATOM   4270 C CA  . GLY B 1 13  ? -8.671  -72.526 -51.113 1.00 56.53  ? 14  GLY B CA  1 
ATOM   4271 C C   . GLY B 1 13  ? -8.005  -73.265 -52.264 1.00 56.74  ? 14  GLY B C   1 
ATOM   4272 O O   . GLY B 1 13  ? -7.713  -72.677 -53.306 1.00 51.71  ? 14  GLY B O   1 
ATOM   4273 N N   . GLY B 1 14  ? -7.747  -74.554 -52.066 1.00 53.73  ? 15  GLY B N   1 
ATOM   4274 C CA  . GLY B 1 14  ? -7.011  -75.333 -53.037 1.00 42.00  ? 15  GLY B CA  1 
ATOM   4275 C C   . GLY B 1 14  ? -6.221  -76.447 -52.389 1.00 55.42  ? 15  GLY B C   1 
ATOM   4276 O O   . GLY B 1 14  ? -6.437  -76.789 -51.220 1.00 51.98  ? 15  GLY B O   1 
ATOM   4277 N N   . ARG B 1 15  ? -5.279  -77.000 -53.144 1.00 49.62  ? 16  ARG B N   1 
ATOM   4278 C CA  . ARG B 1 15  ? -4.548  -78.181 -52.711 1.00 50.39  ? 16  ARG B CA  1 
ATOM   4279 C C   . ARG B 1 15  ? -3.257  -77.833 -51.985 1.00 49.36  ? 16  ARG B C   1 
ATOM   4280 O O   . ARG B 1 15  ? -2.589  -76.863 -52.337 1.00 52.85  ? 16  ARG B O   1 
ATOM   4281 C CB  . ARG B 1 15  ? -4.261  -79.089 -53.914 1.00 48.04  ? 16  ARG B CB  1 
ATOM   4282 C CG  . ARG B 1 15  ? -5.368  -80.094 -54.207 1.00 56.85  ? 16  ARG B CG  1 
ATOM   4283 C CD  . ARG B 1 15  ? -4.937  -81.062 -55.314 1.00 60.83  ? 16  ARG B CD  1 
ATOM   4284 N NE  . ARG B 1 15  ? -4.754  -80.332 -56.557 1.00 64.50  ? 16  ARG B NE  1 
ATOM   4285 C CZ  . ARG B 1 15  ? -4.036  -80.768 -57.589 1.00 78.34  ? 16  ARG B CZ  1 
ATOM   4286 N NH1 . ARG B 1 15  ? -3.426  -81.947 -57.527 1.00 67.72  ? 16  ARG B NH1 1 
ATOM   4287 N NH2 . ARG B 1 15  ? -3.927  -80.017 -58.684 1.00 57.90  ? 16  ARG B NH2 1 
ATOM   4288 N N   . LEU B 1 16  ? -2.919  -78.642 -50.980 1.00 45.05  ? 17  LEU B N   1 
ATOM   4289 C CA  . LEU B 1 16  ? -1.711  -78.463 -50.186 1.00 49.15  ? 17  LEU B CA  1 
ATOM   4290 C C   . LEU B 1 16  ? -0.886  -79.738 -50.167 1.00 45.00  ? 17  LEU B C   1 
ATOM   4291 O O   . LEU B 1 16  ? -1.425  -80.840 -50.202 1.00 48.98  ? 17  LEU B O   1 
ATOM   4292 C CB  . LEU B 1 16  ? -2.072  -78.099 -48.721 1.00 48.62  ? 17  LEU B CB  1 
ATOM   4293 C CG  . LEU B 1 16  ? -2.792  -76.772 -48.428 1.00 48.44  ? 17  LEU B CG  1 
ATOM   4294 C CD1 . LEU B 1 16  ? -3.244  -76.699 -46.968 1.00 54.85  ? 17  LEU B CD1 1 
ATOM   4295 C CD2 . LEU B 1 16  ? -1.886  -75.578 -48.770 1.00 41.01  ? 17  LEU B CD2 1 
ATOM   4296 N N   . ARG B 1 17  ? 0.422   -79.570 -50.045 1.00 48.19  ? 18  ARG B N   1 
ATOM   4297 C CA  . ARG B 1 17  ? 1.359   -80.670 -49.857 1.00 48.40  ? 18  ARG B CA  1 
ATOM   4298 C C   . ARG B 1 17  ? 2.127   -80.385 -48.567 1.00 43.56  ? 18  ARG B C   1 
ATOM   4299 O O   . ARG B 1 17  ? 2.644   -79.278 -48.383 1.00 44.74  ? 18  ARG B O   1 
ATOM   4300 C CB  . ARG B 1 17  ? 2.345   -80.718 -51.038 1.00 48.70  ? 18  ARG B CB  1 
ATOM   4301 C CG  . ARG B 1 17  ? 3.396   -81.811 -50.956 1.00 47.74  ? 18  ARG B CG  1 
ATOM   4302 C CD  . ARG B 1 17  ? 4.263   -81.866 -52.229 1.00 54.50  ? 18  ARG B CD  1 
ATOM   4303 N NE  . ARG B 1 17  ? 3.521   -82.284 -53.423 1.00 54.35  ? 18  ARG B NE  1 
ATOM   4304 C CZ  . ARG B 1 17  ? 3.252   -81.504 -54.480 1.00 63.71  ? 18  ARG B CZ  1 
ATOM   4305 N NH1 . ARG B 1 17  ? 3.660   -80.236 -54.534 1.00 55.95  ? 18  ARG B NH1 1 
ATOM   4306 N NH2 . ARG B 1 17  ? 2.566   -81.998 -55.504 1.00 54.23  ? 18  ARG B NH2 1 
ATOM   4307 N N   . GLY B 1 18  ? 2.230   -81.377 -47.690 1.00 47.91  ? 19  GLY B N   1 
ATOM   4308 C CA  . GLY B 1 18  ? 2.891   -81.187 -46.407 1.00 46.97  ? 19  GLY B CA  1 
ATOM   4309 C C   . GLY B 1 18  ? 4.178   -81.978 -46.282 1.00 50.76  ? 19  GLY B C   1 
ATOM   4310 O O   . GLY B 1 18  ? 4.732   -82.435 -47.276 1.00 51.74  ? 19  GLY B O   1 
ATOM   4311 N N   . ILE B 1 19  ? 4.644   -82.156 -45.052 1.00 44.43  ? 20  ILE B N   1 
ATOM   4312 C CA  . ILE B 1 19  ? 5.901   -82.833 -44.798 1.00 45.78  ? 20  ILE B CA  1 
ATOM   4313 C C   . ILE B 1 19  ? 5.757   -83.820 -43.619 1.00 58.95  ? 20  ILE B C   1 
ATOM   4314 O O   . ILE B 1 19  ? 5.006   -83.566 -42.666 1.00 51.87  ? 20  ILE B O   1 
ATOM   4315 C CB  . ILE B 1 19  ? 7.032   -81.782 -44.568 1.00 58.93  ? 20  ILE B CB  1 
ATOM   4316 C CG1 . ILE B 1 19  ? 8.407   -82.368 -44.876 1.00 66.09  ? 20  ILE B CG1 1 
ATOM   4317 C CG2 . ILE B 1 19  ? 6.972   -81.162 -43.149 1.00 56.37  ? 20  ILE B CG2 1 
ATOM   4318 C CD1 . ILE B 1 19  ? 9.546   -81.396 -44.640 1.00 66.84  ? 20  ILE B CD1 1 
ATOM   4319 N N   . ARG B 1 20  ? 6.438   -84.961 -43.694 1.00 52.61  ? 21  ARG B N   1 
ATOM   4320 C CA  . ARG B 1 20  ? 6.440   -85.904 -42.574 1.00 58.65  ? 21  ARG B CA  1 
ATOM   4321 C C   . ARG B 1 20  ? 7.595   -85.616 -41.611 1.00 62.10  ? 21  ARG B C   1 
ATOM   4322 O O   . ARG B 1 20  ? 8.754   -85.588 -42.025 1.00 58.33  ? 21  ARG B O   1 
ATOM   4323 C CB  . ARG B 1 20  ? 6.524   -87.352 -43.060 1.00 58.42  ? 21  ARG B CB  1 
ATOM   4324 C CG  . ARG B 1 20  ? 6.589   -88.378 -41.922 1.00 63.98  ? 21  ARG B CG  1 
ATOM   4325 C CD  . ARG B 1 20  ? 7.435   -89.600 -42.295 1.00 74.54  ? 21  ARG B CD  1 
ATOM   4326 N NE  . ARG B 1 20  ? 6.633   -90.820 -42.439 1.00 83.62  ? 21  ARG B NE  1 
ATOM   4327 C CZ  . ARG B 1 20  ? 6.799   -91.939 -41.727 1.00 81.31  ? 21  ARG B CZ  1 
ATOM   4328 N NH1 . ARG B 1 20  ? 7.751   -92.027 -40.802 1.00 71.76  ? 21  ARG B NH1 1 
ATOM   4329 N NH2 . ARG B 1 20  ? 6.008   -92.985 -41.944 1.00 86.04  ? 21  ARG B NH2 1 
ATOM   4330 N N   . LEU B 1 21  ? 7.273   -85.407 -40.333 1.00 53.97  ? 22  LEU B N   1 
ATOM   4331 C CA  . LEU B 1 21  ? 8.279   -85.092 -39.317 1.00 56.38  ? 22  LEU B CA  1 
ATOM   4332 C C   . LEU B 1 21  ? 8.620   -86.271 -38.416 1.00 56.04  ? 22  LEU B C   1 
ATOM   4333 O O   . LEU B 1 21  ? 7.726   -86.967 -37.936 1.00 65.52  ? 22  LEU B O   1 
ATOM   4334 C CB  . LEU B 1 21  ? 7.785   -83.959 -38.423 1.00 57.06  ? 22  LEU B CB  1 
ATOM   4335 C CG  . LEU B 1 21  ? 7.599   -82.606 -39.089 1.00 62.78  ? 22  LEU B CG  1 
ATOM   4336 C CD1 . LEU B 1 21  ? 7.217   -81.593 -38.028 1.00 63.43  ? 22  LEU B CD1 1 
ATOM   4337 C CD2 . LEU B 1 21  ? 8.871   -82.204 -39.813 1.00 50.70  ? 22  LEU B CD2 1 
ATOM   4338 N N   . LYS B 1 22  ? 9.910   -86.478 -38.165 1.00 56.99  ? 23  LYS B N   1 
ATOM   4339 C CA  . LYS B 1 22  ? 10.338  -87.447 -37.153 1.00 64.26  ? 23  LYS B CA  1 
ATOM   4340 C C   . LYS B 1 22  ? 10.171  -86.874 -35.752 1.00 66.78  ? 23  LYS B C   1 
ATOM   4341 O O   . LYS B 1 22  ? 10.506  -85.714 -35.502 1.00 62.56  ? 23  LYS B O   1 
ATOM   4342 C CB  . LYS B 1 22  ? 11.805  -87.842 -37.341 1.00 60.18  ? 23  LYS B CB  1 
ATOM   4343 C CG  . LYS B 1 22  ? 12.128  -88.551 -38.651 1.00 75.85  ? 23  LYS B CG  1 
ATOM   4344 C CD  . LYS B 1 22  ? 13.618  -88.917 -38.719 1.00 80.25  ? 23  LYS B CD  1 
ATOM   4345 C CE  . LYS B 1 22  ? 13.930  -89.863 -39.876 1.00 84.04  ? 23  LYS B CE  1 
ATOM   4346 N NZ  . LYS B 1 22  ? 13.735  -89.220 -41.206 1.00 95.20  ? 23  LYS B NZ  1 
ATOM   4347 N N   . THR B 1 23  ? 9.645   -87.684 -34.839 1.00 64.20  ? 24  THR B N   1 
ATOM   4348 C CA  . THR B 1 23  ? 9.682   -87.353 -33.416 1.00 69.11  ? 24  THR B CA  1 
ATOM   4349 C C   . THR B 1 23  ? 10.132  -88.587 -32.643 1.00 65.27  ? 24  THR B C   1 
ATOM   4350 O O   . THR B 1 23  ? 9.887   -89.710 -33.078 1.00 63.79  ? 24  THR B O   1 
ATOM   4351 C CB  . THR B 1 23  ? 8.300   -86.918 -32.867 1.00 68.40  ? 24  THR B CB  1 
ATOM   4352 O OG1 . THR B 1 23  ? 7.559   -88.079 -32.479 1.00 63.97  ? 24  THR B OG1 1 
ATOM   4353 C CG2 . THR B 1 23  ? 7.505   -86.118 -33.908 1.00 65.50  ? 24  THR B CG2 1 
ATOM   4354 N N   . PRO B 1 24  ? 10.789  -88.383 -31.491 1.00 75.28  ? 25  PRO B N   1 
ATOM   4355 C CA  . PRO B 1 24  ? 11.183  -89.456 -30.570 1.00 74.60  ? 25  PRO B CA  1 
ATOM   4356 C C   . PRO B 1 24  ? 10.141  -90.558 -30.379 1.00 70.13  ? 25  PRO B C   1 
ATOM   4357 O O   . PRO B 1 24  ? 10.535  -91.693 -30.141 1.00 81.82  ? 25  PRO B O   1 
ATOM   4358 C CB  . PRO B 1 24  ? 11.402  -88.703 -29.264 1.00 71.19  ? 25  PRO B CB  1 
ATOM   4359 C CG  . PRO B 1 24  ? 11.990  -87.406 -29.726 1.00 77.69  ? 25  PRO B CG  1 
ATOM   4360 C CD  . PRO B 1 24  ? 11.334  -87.082 -31.056 1.00 66.10  ? 25  PRO B CD  1 
ATOM   4361 N N   . GLY B 1 25  ? 8.855   -90.251 -30.509 1.00 66.22  ? 26  GLY B N   1 
ATOM   4362 C CA  . GLY B 1 25  ? 7.834   -91.265 -30.317 1.00 62.32  ? 26  GLY B CA  1 
ATOM   4363 C C   . GLY B 1 25  ? 7.138   -91.753 -31.576 1.00 74.59  ? 26  GLY B C   1 
ATOM   4364 O O   . GLY B 1 25  ? 6.223   -92.571 -31.490 1.00 81.13  ? 26  GLY B O   1 
ATOM   4365 N N   . GLY B 1 26  ? 7.552   -91.265 -32.744 1.00 72.63  ? 27  GLY B N   1 
ATOM   4366 C CA  . GLY B 1 26  ? 6.898   -91.643 -33.993 1.00 68.90  ? 27  GLY B CA  1 
ATOM   4367 C C   . GLY B 1 26  ? 6.590   -90.462 -34.910 1.00 73.13  ? 27  GLY B C   1 
ATOM   4368 O O   . GLY B 1 26  ? 6.741   -89.306 -34.507 1.00 64.77  ? 27  GLY B O   1 
ATOM   4369 N N   . PRO B 1 27  ? 6.144   -90.747 -36.149 1.00 70.39  ? 28  PRO B N   1 
ATOM   4370 C CA  . PRO B 1 27  ? 5.911   -89.722 -37.183 1.00 64.09  ? 28  PRO B CA  1 
ATOM   4371 C C   . PRO B 1 27  ? 4.679   -88.832 -36.965 1.00 65.17  ? 28  PRO B C   1 
ATOM   4372 O O   . PRO B 1 27  ? 3.650   -89.271 -36.446 1.00 57.39  ? 28  PRO B O   1 
ATOM   4373 C CB  . PRO B 1 27  ? 5.715   -90.556 -38.455 1.00 58.71  ? 28  PRO B CB  1 
ATOM   4374 C CG  . PRO B 1 27  ? 5.176   -91.865 -37.956 1.00 64.56  ? 28  PRO B CG  1 
ATOM   4375 C CD  . PRO B 1 27  ? 5.901   -92.110 -36.661 1.00 63.35  ? 28  PRO B CD  1 
ATOM   4376 N N   . VAL B 1 28  ? 4.795   -87.580 -37.397 1.00 58.80  ? 29  VAL B N   1 
ATOM   4377 C CA  . VAL B 1 28  ? 3.695   -86.626 -37.366 1.00 45.08  ? 29  VAL B CA  1 
ATOM   4378 C C   . VAL B 1 28  ? 3.609   -85.992 -38.756 1.00 48.56  ? 29  VAL B C   1 
ATOM   4379 O O   . VAL B 1 28  ? 4.628   -85.828 -39.413 1.00 51.64  ? 29  VAL B O   1 
ATOM   4380 C CB  . VAL B 1 28  ? 3.964   -85.534 -36.289 1.00 54.32  ? 29  VAL B CB  1 
ATOM   4381 C CG1 . VAL B 1 28  ? 3.028   -84.370 -36.435 1.00 56.24  ? 29  VAL B CG1 1 
ATOM   4382 C CG2 . VAL B 1 28  ? 3.845   -86.114 -34.883 1.00 47.09  ? 29  VAL B CG2 1 
ATOM   4383 N N   . SER B 1 29  ? 2.407   -85.656 -39.215 1.00 46.03  ? 30  SER B N   1 
ATOM   4384 C CA  . SER B 1 29  ? 2.250   -84.857 -40.424 1.00 51.97  ? 30  SER B CA  1 
ATOM   4385 C C   . SER B 1 29  ? 2.243   -83.364 -40.085 1.00 56.62  ? 30  SER B C   1 
ATOM   4386 O O   . SER B 1 29  ? 1.610   -82.941 -39.123 1.00 54.65  ? 30  SER B O   1 
ATOM   4387 C CB  . SER B 1 29  ? 0.951   -85.215 -41.162 1.00 51.67  ? 30  SER B CB  1 
ATOM   4388 O OG  . SER B 1 29  ? 0.942   -86.571 -41.574 1.00 55.79  ? 30  SER B OG  1 
ATOM   4389 N N   . ALA B 1 30  ? 2.942   -82.570 -40.889 1.00 49.46  ? 31  ALA B N   1 
ATOM   4390 C CA  . ALA B 1 30  ? 2.981   -81.129 -40.692 1.00 43.12  ? 31  ALA B CA  1 
ATOM   4391 C C   . ALA B 1 30  ? 2.714   -80.399 -41.991 1.00 48.35  ? 31  ALA B C   1 
ATOM   4392 O O   . ALA B 1 30  ? 3.246   -80.757 -43.044 1.00 49.61  ? 31  ALA B O   1 
ATOM   4393 C CB  . ALA B 1 30  ? 4.319   -80.705 -40.139 1.00 44.32  ? 31  ALA B CB  1 
ATOM   4394 N N   . PHE B 1 31  ? 1.890   -79.368 -41.906 1.00 44.51  ? 32  PHE B N   1 
ATOM   4395 C CA  . PHE B 1 31  ? 1.645   -78.480 -43.020 1.00 45.26  ? 32  PHE B CA  1 
ATOM   4396 C C   . PHE B 1 31  ? 1.993   -77.086 -42.519 1.00 47.74  ? 32  PHE B C   1 
ATOM   4397 O O   . PHE B 1 31  ? 1.202   -76.432 -41.828 1.00 46.31  ? 32  PHE B O   1 
ATOM   4398 C CB  . PHE B 1 31  ? 0.185   -78.580 -43.471 1.00 42.52  ? 32  PHE B CB  1 
ATOM   4399 C CG  . PHE B 1 31  ? -0.214  -79.961 -43.889 1.00 54.95  ? 32  PHE B CG  1 
ATOM   4400 C CD1 . PHE B 1 31  ? -0.505  -80.940 -42.934 1.00 51.34  ? 32  PHE B CD1 1 
ATOM   4401 C CD2 . PHE B 1 31  ? -0.282  -80.298 -45.240 1.00 50.18  ? 32  PHE B CD2 1 
ATOM   4402 C CE1 . PHE B 1 31  ? -0.855  -82.230 -43.320 1.00 47.04  ? 32  PHE B CE1 1 
ATOM   4403 C CE2 . PHE B 1 31  ? -0.636  -81.587 -45.631 1.00 51.31  ? 32  PHE B CE2 1 
ATOM   4404 C CZ  . PHE B 1 31  ? -0.927  -82.552 -44.666 1.00 55.75  ? 32  PHE B CZ  1 
ATOM   4405 N N   . LEU B 1 32  ? 3.202   -76.657 -42.850 1.00 45.37  ? 33  LEU B N   1 
ATOM   4406 C CA  . LEU B 1 32  ? 3.764   -75.407 -42.357 1.00 42.29  ? 33  LEU B CA  1 
ATOM   4407 C C   . LEU B 1 32  ? 3.678   -74.321 -43.408 1.00 48.60  ? 33  LEU B C   1 
ATOM   4408 O O   . LEU B 1 32  ? 3.985   -74.557 -44.564 1.00 48.10  ? 33  LEU B O   1 
ATOM   4409 C CB  . LEU B 1 32  ? 5.232   -75.644 -42.018 1.00 42.65  ? 33  LEU B CB  1 
ATOM   4410 C CG  . LEU B 1 32  ? 5.476   -76.801 -41.050 1.00 46.55  ? 33  LEU B CG  1 
ATOM   4411 C CD1 . LEU B 1 32  ? 6.948   -76.835 -40.626 1.00 41.57  ? 33  LEU B CD1 1 
ATOM   4412 C CD2 . LEU B 1 32  ? 4.557   -76.632 -39.832 1.00 39.90  ? 33  LEU B CD2 1 
ATOM   4413 N N   . GLY B 1 33  ? 3.267   -73.125 -43.024 1.00 42.20  ? 34  GLY B N   1 
ATOM   4414 C CA  . GLY B 1 33  ? 3.232   -72.033 -43.973 1.00 42.23  ? 34  GLY B CA  1 
ATOM   4415 C C   . GLY B 1 33  ? 2.064   -72.043 -44.942 1.00 47.38  ? 34  GLY B C   1 
ATOM   4416 O O   . GLY B 1 33  ? 2.235   -71.829 -46.158 1.00 47.01  ? 34  GLY B O   1 
ATOM   4417 N N   . ILE B 1 34  ? 0.866   -72.277 -44.415 1.00 42.70  ? 35  ILE B N   1 
ATOM   4418 C CA  . ILE B 1 34  ? -0.356  -72.187 -45.219 1.00 39.26  ? 35  ILE B CA  1 
ATOM   4419 C C   . ILE B 1 34  ? -0.871  -70.752 -45.228 1.00 47.27  ? 35  ILE B C   1 
ATOM   4420 O O   . ILE B 1 34  ? -1.097  -70.165 -44.170 1.00 45.84  ? 35  ILE B O   1 
ATOM   4421 C CB  . ILE B 1 34  ? -1.457  -73.066 -44.635 1.00 41.30  ? 35  ILE B CB  1 
ATOM   4422 C CG1 . ILE B 1 34  ? -0.940  -74.496 -44.422 1.00 37.61  ? 35  ILE B CG1 1 
ATOM   4423 C CG2 . ILE B 1 34  ? -2.713  -72.991 -45.488 1.00 40.23  ? 35  ILE B CG2 1 
ATOM   4424 C CD1 . ILE B 1 34  ? -1.893  -75.363 -43.647 1.00 42.66  ? 35  ILE B CD1 1 
ATOM   4425 N N   . PRO B 1 35  ? -1.052  -70.173 -46.423 1.00 40.35  ? 36  PRO B N   1 
ATOM   4426 C CA  . PRO B 1 35  ? -1.518  -68.789 -46.505 1.00 43.86  ? 36  PRO B CA  1 
ATOM   4427 C C   . PRO B 1 35  ? -2.997  -68.685 -46.125 1.00 49.44  ? 36  PRO B C   1 
ATOM   4428 O O   . PRO B 1 35  ? -3.801  -69.484 -46.617 1.00 47.26  ? 36  PRO B O   1 
ATOM   4429 C CB  . PRO B 1 35  ? -1.324  -68.451 -47.995 1.00 50.86  ? 36  PRO B CB  1 
ATOM   4430 C CG  . PRO B 1 35  ? -1.446  -69.800 -48.701 1.00 41.86  ? 36  PRO B CG  1 
ATOM   4431 C CD  . PRO B 1 35  ? -0.796  -70.769 -47.754 1.00 44.27  ? 36  PRO B CD  1 
ATOM   4432 N N   . PHE B 1 36  ? -3.355  -67.729 -45.264 1.00 44.22  ? 37  PHE B N   1 
ATOM   4433 C CA  . PHE B 1 36  ? -4.751  -67.610 -44.852 1.00 41.94  ? 37  PHE B CA  1 
ATOM   4434 C C   . PHE B 1 36  ? -5.334  -66.235 -45.135 1.00 44.00  ? 37  PHE B C   1 
ATOM   4435 O O   . PHE B 1 36  ? -6.546  -66.042 -45.067 1.00 47.59  ? 37  PHE B O   1 
ATOM   4436 C CB  . PHE B 1 36  ? -4.953  -68.044 -43.376 1.00 46.00  ? 37  PHE B CB  1 
ATOM   4437 C CG  . PHE B 1 36  ? -4.390  -67.084 -42.359 1.00 44.36  ? 37  PHE B CG  1 
ATOM   4438 C CD1 . PHE B 1 36  ? -5.134  -65.988 -41.921 1.00 44.12  ? 37  PHE B CD1 1 
ATOM   4439 C CD2 . PHE B 1 36  ? -3.139  -67.295 -41.815 1.00 40.11  ? 37  PHE B CD2 1 
ATOM   4440 C CE1 . PHE B 1 36  ? -4.631  -65.107 -40.963 1.00 42.87  ? 37  PHE B CE1 1 
ATOM   4441 C CE2 . PHE B 1 36  ? -2.616  -66.420 -40.844 1.00 46.34  ? 37  PHE B CE2 1 
ATOM   4442 C CZ  . PHE B 1 36  ? -3.362  -65.326 -40.418 1.00 41.67  ? 37  PHE B CZ  1 
ATOM   4443 N N   . ALA B 1 37  ? -4.462  -65.284 -45.455 1.00 42.42  ? 38  ALA B N   1 
ATOM   4444 C CA  . ALA B 1 37  ? -4.899  -63.979 -45.933 1.00 47.44  ? 38  ALA B CA  1 
ATOM   4445 C C   . ALA B 1 37  ? -4.100  -63.553 -47.174 1.00 51.06  ? 38  ALA B C   1 
ATOM   4446 O O   . ALA B 1 37  ? -3.030  -64.096 -47.453 1.00 47.66  ? 38  ALA B O   1 
ATOM   4447 C CB  . ALA B 1 37  ? -4.752  -62.936 -44.836 1.00 39.56  ? 38  ALA B CB  1 
ATOM   4448 N N   . GLU B 1 38  ? -4.633  -62.593 -47.925 1.00 46.48  ? 39  GLU B N   1 
ATOM   4449 C CA  . GLU B 1 38  ? -3.843  -61.899 -48.932 1.00 50.00  ? 39  GLU B CA  1 
ATOM   4450 C C   . GLU B 1 38  ? -2.754  -61.102 -48.213 1.00 49.89  ? 39  GLU B C   1 
ATOM   4451 O O   . GLU B 1 38  ? -3.037  -60.462 -47.200 1.00 49.19  ? 39  GLU B O   1 
ATOM   4452 C CB  . GLU B 1 38  ? -4.733  -60.948 -49.743 1.00 46.85  ? 39  GLU B CB  1 
ATOM   4453 C CG  . GLU B 1 38  ? -5.774  -61.662 -50.592 1.00 56.02  ? 39  GLU B CG  1 
ATOM   4454 C CD  . GLU B 1 38  ? -5.140  -62.449 -51.727 1.00 48.90  ? 39  GLU B CD  1 
ATOM   4455 O OE1 . GLU B 1 38  ? -4.225  -61.903 -52.373 1.00 56.00  ? 39  GLU B OE1 1 
ATOM   4456 O OE2 . GLU B 1 38  ? -5.541  -63.612 -51.951 1.00 54.45  ? 39  GLU B OE2 1 
ATOM   4457 N N   . PRO B 1 39  ? -1.513  -61.128 -48.737 1.00 47.10  ? 40  PRO B N   1 
ATOM   4458 C CA  . PRO B 1 39  ? -0.400  -60.375 -48.130 1.00 41.70  ? 40  PRO B CA  1 
ATOM   4459 C C   . PRO B 1 39  ? -0.763  -58.888 -47.913 1.00 50.42  ? 40  PRO B C   1 
ATOM   4460 O O   . PRO B 1 39  ? -1.200  -58.207 -48.850 1.00 48.89  ? 40  PRO B O   1 
ATOM   4461 C CB  . PRO B 1 39  ? 0.742   -60.533 -49.161 1.00 41.07  ? 40  PRO B CB  1 
ATOM   4462 C CG  . PRO B 1 39  ? 0.388   -61.796 -49.923 1.00 45.34  ? 40  PRO B CG  1 
ATOM   4463 C CD  . PRO B 1 39  ? -1.124  -61.765 -50.013 1.00 49.02  ? 40  PRO B CD  1 
ATOM   4464 N N   . PRO B 1 40  ? -0.618  -58.394 -46.673 1.00 53.47  ? 41  PRO B N   1 
ATOM   4465 C CA  . PRO B 1 40  ? -0.999  -57.006 -46.356 1.00 48.52  ? 41  PRO B CA  1 
ATOM   4466 C C   . PRO B 1 40  ? 0.029   -55.994 -46.862 1.00 56.63  ? 41  PRO B C   1 
ATOM   4467 O O   . PRO B 1 40  ? 0.508   -55.163 -46.079 1.00 56.28  ? 41  PRO B O   1 
ATOM   4468 C CB  . PRO B 1 40  ? -1.027  -56.984 -44.822 1.00 50.59  ? 41  PRO B CB  1 
ATOM   4469 C CG  . PRO B 1 40  ? -0.947  -58.397 -44.389 1.00 46.82  ? 41  PRO B CG  1 
ATOM   4470 C CD  . PRO B 1 40  ? -0.226  -59.144 -45.470 1.00 43.13  ? 41  PRO B CD  1 
ATOM   4471 N N   . MET B 1 41  ? 0.347   -56.070 -48.155 1.00 56.25  ? 42  MET B N   1 
ATOM   4472 C CA  . MET B 1 41  ? 1.413   -55.276 -48.766 1.00 59.18  ? 42  MET B CA  1 
ATOM   4473 C C   . MET B 1 41  ? 0.920   -53.908 -49.193 1.00 51.49  ? 42  MET B C   1 
ATOM   4474 O O   . MET B 1 41  ? -0.244  -53.752 -49.546 1.00 47.54  ? 42  MET B O   1 
ATOM   4475 C CB  . MET B 1 41  ? 1.951   -55.971 -50.036 1.00 60.09  ? 42  MET B CB  1 
ATOM   4476 C CG  . MET B 1 41  ? 2.494   -57.367 -49.829 1.00 60.85  ? 42  MET B CG  1 
ATOM   4477 S SD  . MET B 1 41  ? 3.656   -57.421 -48.464 1.00 66.30  ? 42  MET B SD  1 
ATOM   4478 C CE  . MET B 1 41  ? 4.906   -56.269 -49.040 1.00 59.75  ? 42  MET B CE  1 
ATOM   4479 N N   . GLY B 1 42  ? 1.831   -52.936 -49.184 1.00 52.65  ? 43  GLY B N   1 
ATOM   4480 C CA  . GLY B 1 42  ? 1.629   -51.674 -49.869 1.00 50.65  ? 43  GLY B CA  1 
ATOM   4481 C C   . GLY B 1 42  ? 0.391   -50.924 -49.431 1.00 54.91  ? 43  GLY B C   1 
ATOM   4482 O O   . GLY B 1 42  ? 0.336   -50.422 -48.301 1.00 50.81  ? 43  GLY B O   1 
ATOM   4483 N N   . PRO B 1 43  ? -0.603  -50.843 -50.330 1.00 50.18  ? 44  PRO B N   1 
ATOM   4484 C CA  . PRO B 1 43  ? -1.908  -50.221 -50.059 1.00 54.08  ? 44  PRO B CA  1 
ATOM   4485 C C   . PRO B 1 43  ? -2.674  -50.890 -48.905 1.00 59.59  ? 44  PRO B C   1 
ATOM   4486 O O   . PRO B 1 43  ? -3.536  -50.247 -48.313 1.00 51.83  ? 44  PRO B O   1 
ATOM   4487 C CB  . PRO B 1 43  ? -2.677  -50.388 -51.393 1.00 52.13  ? 44  PRO B CB  1 
ATOM   4488 C CG  . PRO B 1 43  ? -1.856  -51.379 -52.227 1.00 46.68  ? 44  PRO B CG  1 
ATOM   4489 C CD  . PRO B 1 43  ? -0.450  -51.257 -51.745 1.00 49.51  ? 44  PRO B CD  1 
ATOM   4490 N N   . ARG B 1 44  ? -2.361  -52.149 -48.601 1.00 54.79  ? 45  ARG B N   1 
ATOM   4491 C CA  . ARG B 1 44  ? -3.090  -52.912 -47.589 1.00 53.99  ? 45  ARG B CA  1 
ATOM   4492 C C   . ARG B 1 44  ? -2.467  -52.835 -46.189 1.00 47.24  ? 45  ARG B C   1 
ATOM   4493 O O   . ARG B 1 44  ? -2.996  -53.413 -45.251 1.00 47.72  ? 45  ARG B O   1 
ATOM   4494 C CB  . ARG B 1 44  ? -3.223  -54.382 -47.999 1.00 51.13  ? 45  ARG B CB  1 
ATOM   4495 C CG  . ARG B 1 44  ? -4.090  -54.654 -49.218 1.00 54.76  ? 45  ARG B CG  1 
ATOM   4496 C CD  . ARG B 1 44  ? -4.037  -56.155 -49.528 1.00 64.24  ? 45  ARG B CD  1 
ATOM   4497 N NE  . ARG B 1 44  ? -4.589  -56.517 -50.834 1.00 83.27  ? 45  ARG B NE  1 
ATOM   4498 C CZ  . ARG B 1 44  ? -5.816  -56.999 -51.025 1.00 84.08  ? 45  ARG B CZ  1 
ATOM   4499 N NH1 . ARG B 1 44  ? -6.635  -57.178 -49.992 1.00 74.04  ? 45  ARG B NH1 1 
ATOM   4500 N NH2 . ARG B 1 44  ? -6.226  -57.301 -52.250 1.00 75.58  ? 45  ARG B NH2 1 
ATOM   4501 N N   . ARG B 1 45  ? -1.338  -52.146 -46.056 1.00 49.36  ? 46  ARG B N   1 
ATOM   4502 C CA  . ARG B 1 45  ? -0.743  -51.903 -44.744 1.00 49.70  ? 46  ARG B CA  1 
ATOM   4503 C C   . ARG B 1 45  ? -1.761  -51.182 -43.845 1.00 54.68  ? 46  ARG B C   1 
ATOM   4504 O O   . ARG B 1 45  ? -2.425  -50.246 -44.297 1.00 50.32  ? 46  ARG B O   1 
ATOM   4505 C CB  . ARG B 1 45  ? 0.540   -51.076 -44.878 1.00 44.17  ? 46  ARG B CB  1 
ATOM   4506 C CG  . ARG B 1 45  ? 1.372   -51.019 -43.604 1.00 41.55  ? 46  ARG B CG  1 
ATOM   4507 C CD  . ARG B 1 45  ? 2.548   -50.025 -43.682 1.00 49.56  ? 46  ARG B CD  1 
ATOM   4508 N NE  . ARG B 1 45  ? 3.765   -50.604 -44.266 1.00 46.24  ? 46  ARG B NE  1 
ATOM   4509 C CZ  . ARG B 1 45  ? 4.853   -49.897 -44.587 1.00 55.74  ? 46  ARG B CZ  1 
ATOM   4510 N NH1 . ARG B 1 45  ? 4.879   -48.580 -44.396 1.00 39.69  ? 46  ARG B NH1 1 
ATOM   4511 N NH2 . ARG B 1 45  ? 5.920   -50.494 -45.111 1.00 42.85  ? 46  ARG B NH2 1 
ATOM   4512 N N   . PHE B 1 46  ? -1.887  -51.645 -42.598 1.00 46.40  ? 47  PHE B N   1 
ATOM   4513 C CA  . PHE B 1 46  ? -2.795  -51.074 -41.580 1.00 47.65  ? 47  PHE B CA  1 
ATOM   4514 C C   . PHE B 1 46  ? -4.265  -51.458 -41.773 1.00 51.50  ? 47  PHE B C   1 
ATOM   4515 O O   . PHE B 1 46  ? -5.105  -51.115 -40.943 1.00 46.42  ? 47  PHE B O   1 
ATOM   4516 C CB  . PHE B 1 46  ? -2.702  -49.547 -41.500 1.00 41.77  ? 47  PHE B CB  1 
ATOM   4517 C CG  . PHE B 1 46  ? -1.312  -49.018 -41.269 1.00 49.69  ? 47  PHE B CG  1 
ATOM   4518 C CD1 . PHE B 1 46  ? -0.550  -49.457 -40.192 1.00 48.10  ? 47  PHE B CD1 1 
ATOM   4519 C CD2 . PHE B 1 46  ? -0.776  -48.056 -42.122 1.00 49.35  ? 47  PHE B CD2 1 
ATOM   4520 C CE1 . PHE B 1 46  ? 0.727   -48.949 -39.967 1.00 42.58  ? 47  PHE B CE1 1 
ATOM   4521 C CE2 . PHE B 1 46  ? 0.503   -47.542 -41.910 1.00 43.39  ? 47  PHE B CE2 1 
ATOM   4522 C CZ  . PHE B 1 46  ? 1.249   -47.981 -40.828 1.00 50.03  ? 47  PHE B CZ  1 
ATOM   4523 N N   . LEU B 1 47  ? -4.578  -52.170 -42.853 1.00 42.08  ? 48  LEU B N   1 
ATOM   4524 C CA  . LEU B 1 47  ? -5.964  -52.535 -43.142 1.00 41.47  ? 48  LEU B CA  1 
ATOM   4525 C C   . LEU B 1 47  ? -6.294  -53.935 -42.605 1.00 47.34  ? 48  LEU B C   1 
ATOM   4526 O O   . LEU B 1 47  ? -5.399  -54.773 -42.462 1.00 43.69  ? 48  LEU B O   1 
ATOM   4527 C CB  . LEU B 1 47  ? -6.210  -52.520 -44.666 1.00 48.94  ? 48  LEU B CB  1 
ATOM   4528 C CG  . LEU B 1 47  ? -6.169  -51.188 -45.431 1.00 53.73  ? 48  LEU B CG  1 
ATOM   4529 C CD1 . LEU B 1 47  ? -6.601  -51.402 -46.883 1.00 51.34  ? 48  LEU B CD1 1 
ATOM   4530 C CD2 . LEU B 1 47  ? -7.045  -50.127 -44.760 1.00 52.00  ? 48  LEU B CD2 1 
ATOM   4531 N N   . PRO B 1 48  ? -7.585  -54.209 -42.352 1.00 41.15  ? 49  PRO B N   1 
ATOM   4532 C CA  . PRO B 1 48  ? -8.017  -55.548 -41.938 1.00 44.21  ? 49  PRO B CA  1 
ATOM   4533 C C   . PRO B 1 48  ? -7.620  -56.605 -42.964 1.00 52.38  ? 49  PRO B C   1 
ATOM   4534 O O   . PRO B 1 48  ? -7.522  -56.313 -44.149 1.00 51.00  ? 49  PRO B O   1 
ATOM   4535 C CB  . PRO B 1 48  ? -9.547  -55.420 -41.885 1.00 46.58  ? 49  PRO B CB  1 
ATOM   4536 C CG  . PRO B 1 48  ? -9.788  -53.967 -41.592 1.00 49.65  ? 49  PRO B CG  1 
ATOM   4537 C CD  . PRO B 1 48  ? -8.717  -53.265 -42.412 1.00 43.03  ? 49  PRO B CD  1 
ATOM   4538 N N   . PRO B 1 49  ? -7.383  -57.836 -42.508 1.00 55.25  ? 50  PRO B N   1 
ATOM   4539 C CA  . PRO B 1 49  ? -6.960  -58.889 -43.440 1.00 42.40  ? 50  PRO B CA  1 
ATOM   4540 C C   . PRO B 1 49  ? -8.092  -59.287 -44.408 1.00 48.37  ? 50  PRO B C   1 
ATOM   4541 O O   . PRO B 1 49  ? -9.258  -59.330 -44.016 1.00 49.80  ? 50  PRO B O   1 
ATOM   4542 C CB  . PRO B 1 49  ? -6.596  -60.050 -42.507 1.00 45.60  ? 50  PRO B CB  1 
ATOM   4543 C CG  . PRO B 1 49  ? -7.486  -59.821 -41.266 1.00 39.64  ? 50  PRO B CG  1 
ATOM   4544 C CD  . PRO B 1 49  ? -7.567  -58.322 -41.127 1.00 43.89  ? 50  PRO B CD  1 
ATOM   4545 N N   . GLU B 1 50  ? -7.744  -59.540 -45.669 1.00 44.24  ? 51  GLU B N   1 
ATOM   4546 C CA  . GLU B 1 50  ? -8.695  -60.075 -46.633 1.00 51.49  ? 51  GLU B CA  1 
ATOM   4547 C C   . GLU B 1 50  ? -8.423  -61.575 -46.696 1.00 48.90  ? 51  GLU B C   1 
ATOM   4548 O O   . GLU B 1 50  ? -7.272  -61.990 -46.676 1.00 52.55  ? 51  GLU B O   1 
ATOM   4549 C CB  . GLU B 1 50  ? -8.484  -59.437 -48.023 1.00 50.23  ? 51  GLU B CB  1 
ATOM   4550 C CG  . GLU B 1 50  ? -9.717  -59.540 -48.938 1.00 81.76  ? 51  GLU B CG  1 
ATOM   4551 C CD  . GLU B 1 50  ? -9.407  -59.964 -50.390 1.00 86.54  ? 51  GLU B CD  1 
ATOM   4552 O OE1 . GLU B 1 50  ? -8.753  -59.186 -51.130 1.00 82.65  ? 51  GLU B OE1 1 
ATOM   4553 O OE2 . GLU B 1 50  ? -9.839  -61.076 -50.794 1.00 79.25  ? 51  GLU B OE2 1 
ATOM   4554 N N   . PRO B 1 51  ? -9.475  -62.396 -46.756 1.00 45.54  ? 52  PRO B N   1 
ATOM   4555 C CA  . PRO B 1 51  ? -9.265  -63.833 -46.964 1.00 49.26  ? 52  PRO B CA  1 
ATOM   4556 C C   . PRO B 1 51  ? -8.407  -64.147 -48.203 1.00 52.01  ? 52  PRO B C   1 
ATOM   4557 O O   . PRO B 1 51  ? -8.512  -63.488 -49.238 1.00 53.06  ? 52  PRO B O   1 
ATOM   4558 C CB  . PRO B 1 51  ? -10.685 -64.359 -47.164 1.00 50.20  ? 52  PRO B CB  1 
ATOM   4559 C CG  . PRO B 1 51  ? -11.552 -63.372 -46.410 1.00 57.88  ? 52  PRO B CG  1 
ATOM   4560 C CD  . PRO B 1 51  ? -10.904 -62.047 -46.662 1.00 53.12  ? 52  PRO B CD  1 
ATOM   4561 N N   . LYS B 1 52  ? -7.558  -65.159 -48.071 1.00 48.62  ? 53  LYS B N   1 
ATOM   4562 C CA  . LYS B 1 52  ? -6.729  -65.636 -49.162 1.00 48.57  ? 53  LYS B CA  1 
ATOM   4563 C C   . LYS B 1 52  ? -7.578  -66.130 -50.344 1.00 51.03  ? 53  LYS B C   1 
ATOM   4564 O O   . LYS B 1 52  ? -8.452  -66.981 -50.175 1.00 48.48  ? 53  LYS B O   1 
ATOM   4565 C CB  . LYS B 1 52  ? -5.833  -66.772 -48.658 1.00 47.87  ? 53  LYS B CB  1 
ATOM   4566 C CG  . LYS B 1 52  ? -5.041  -67.468 -49.761 1.00 50.88  ? 53  LYS B CG  1 
ATOM   4567 C CD  . LYS B 1 52  ? -3.870  -66.605 -50.202 1.00 41.78  ? 53  LYS B CD  1 
ATOM   4568 C CE  . LYS B 1 52  ? -3.159  -67.185 -51.407 1.00 49.37  ? 53  LYS B CE  1 
ATOM   4569 N NZ  . LYS B 1 52  ? -1.910  -66.402 -51.665 1.00 52.07  ? 53  LYS B NZ  1 
ATOM   4570 N N   . GLN B 1 53  ? -7.313  -65.608 -51.540 1.00 46.34  ? 54  GLN B N   1 
ATOM   4571 C CA  . GLN B 1 53  ? -8.006  -66.081 -52.749 1.00 59.72  ? 54  GLN B CA  1 
ATOM   4572 C C   . GLN B 1 53  ? -7.642  -67.526 -53.138 1.00 48.63  ? 54  GLN B C   1 
ATOM   4573 O O   . GLN B 1 53  ? -6.504  -67.954 -52.963 1.00 48.32  ? 54  GLN B O   1 
ATOM   4574 C CB  . GLN B 1 53  ? -7.733  -65.133 -53.923 1.00 55.75  ? 54  GLN B CB  1 
ATOM   4575 C CG  . GLN B 1 53  ? -8.501  -63.819 -53.845 1.00 67.44  ? 54  GLN B CG  1 
ATOM   4576 C CD  . GLN B 1 53  ? -9.995  -64.009 -54.104 1.00 89.90  ? 54  GLN B CD  1 
ATOM   4577 O OE1 . GLN B 1 53  ? -10.805 -63.980 -53.171 1.00 86.67  ? 54  GLN B OE1 1 
ATOM   4578 N NE2 . GLN B 1 53  ? -10.364 -64.212 -55.376 1.00 79.72  ? 54  GLN B NE2 1 
ATOM   4579 N N   . PRO B 1 54  ? -8.613  -68.281 -53.672 1.00 53.94  ? 55  PRO B N   1 
ATOM   4580 C CA  . PRO B 1 54  ? -8.349  -69.670 -54.072 1.00 53.53  ? 55  PRO B CA  1 
ATOM   4581 C C   . PRO B 1 54  ? -7.244  -69.765 -55.135 1.00 55.52  ? 55  PRO B C   1 
ATOM   4582 O O   . PRO B 1 54  ? -7.065  -68.837 -55.914 1.00 45.24  ? 55  PRO B O   1 
ATOM   4583 C CB  . PRO B 1 54  ? -9.688  -70.126 -54.653 1.00 56.49  ? 55  PRO B CB  1 
ATOM   4584 C CG  . PRO B 1 54  ? -10.697 -69.188 -54.075 1.00 63.45  ? 55  PRO B CG  1 
ATOM   4585 C CD  . PRO B 1 54  ? -10.001 -67.879 -53.951 1.00 57.09  ? 55  PRO B CD  1 
ATOM   4586 N N   . TRP B 1 55  ? -6.509  -70.871 -55.142 1.00 54.77  ? 56  TRP B N   1 
ATOM   4587 C CA  . TRP B 1 55  ? -5.383  -71.049 -56.053 1.00 50.34  ? 56  TRP B CA  1 
ATOM   4588 C C   . TRP B 1 55  ? -5.497  -72.356 -56.845 1.00 55.98  ? 56  TRP B C   1 
ATOM   4589 O O   . TRP B 1 55  ? -6.124  -73.318 -56.392 1.00 48.72  ? 56  TRP B O   1 
ATOM   4590 C CB  . TRP B 1 55  ? -4.062  -71.038 -55.272 1.00 49.32  ? 56  TRP B CB  1 
ATOM   4591 C CG  . TRP B 1 55  ? -3.961  -72.152 -54.258 1.00 55.10  ? 56  TRP B CG  1 
ATOM   4592 C CD1 . TRP B 1 55  ? -3.508  -73.421 -54.481 1.00 55.25  ? 56  TRP B CD1 1 
ATOM   4593 C CD2 . TRP B 1 55  ? -4.324  -72.095 -52.864 1.00 48.48  ? 56  TRP B CD2 1 
ATOM   4594 N NE1 . TRP B 1 55  ? -3.567  -74.157 -53.319 1.00 49.02  ? 56  TRP B NE1 1 
ATOM   4595 C CE2 . TRP B 1 55  ? -4.065  -73.368 -52.315 1.00 53.10  ? 56  TRP B CE2 1 
ATOM   4596 C CE3 . TRP B 1 55  ? -4.837  -71.093 -52.032 1.00 52.54  ? 56  TRP B CE3 1 
ATOM   4597 C CZ2 . TRP B 1 55  ? -4.308  -73.671 -50.971 1.00 45.10  ? 56  TRP B CZ2 1 
ATOM   4598 C CZ3 . TRP B 1 55  ? -5.081  -71.399 -50.672 1.00 47.46  ? 56  TRP B CZ3 1 
ATOM   4599 C CH2 . TRP B 1 55  ? -4.815  -72.675 -50.171 1.00 50.30  ? 56  TRP B CH2 1 
ATOM   4600 N N   . SER B 1 56  ? -4.877  -72.392 -58.024 1.00 52.15  ? 57  SER B N   1 
ATOM   4601 C CA  . SER B 1 56  ? -4.846  -73.619 -58.815 1.00 53.42  ? 57  SER B CA  1 
ATOM   4602 C C   . SER B 1 56  ? -3.530  -74.328 -58.520 1.00 52.17  ? 57  SER B C   1 
ATOM   4603 O O   . SER B 1 56  ? -2.570  -73.696 -58.071 1.00 52.62  ? 57  SER B O   1 
ATOM   4604 C CB  . SER B 1 56  ? -4.997  -73.313 -60.323 1.00 48.48  ? 57  SER B CB  1 
ATOM   4605 O OG  . SER B 1 56  ? -3.887  -72.565 -60.803 1.00 51.99  ? 57  SER B OG  1 
ATOM   4606 N N   . GLY B 1 57  ? -3.480  -75.634 -58.753 1.00 47.35  ? 58  GLY B N   1 
ATOM   4607 C CA  . GLY B 1 57  ? -2.272  -76.400 -58.483 1.00 49.47  ? 58  GLY B CA  1 
ATOM   4608 C C   . GLY B 1 57  ? -2.094  -76.681 -56.989 1.00 59.91  ? 58  GLY B C   1 
ATOM   4609 O O   . GLY B 1 57  ? -3.048  -76.601 -56.202 1.00 52.11  ? 58  GLY B O   1 
ATOM   4610 N N   . VAL B 1 58  ? -0.865  -77.012 -56.604 1.00 49.62  ? 59  VAL B N   1 
ATOM   4611 C CA  . VAL B 1 58  ? -0.557  -77.435 -55.248 1.00 53.27  ? 59  VAL B CA  1 
ATOM   4612 C C   . VAL B 1 58  ? 0.438   -76.495 -54.573 1.00 57.98  ? 59  VAL B C   1 
ATOM   4613 O O   . VAL B 1 58  ? 1.522   -76.249 -55.105 1.00 48.26  ? 59  VAL B O   1 
ATOM   4614 C CB  . VAL B 1 58  ? 0.048   -78.850 -55.218 1.00 51.18  ? 59  VAL B CB  1 
ATOM   4615 C CG1 . VAL B 1 58  ? 0.075   -79.373 -53.762 1.00 54.16  ? 59  VAL B CG1 1 
ATOM   4616 C CG2 . VAL B 1 58  ? -0.730  -79.798 -56.123 1.00 48.00  ? 59  VAL B CG2 1 
ATOM   4617 N N   . VAL B 1 59  ? 0.055   -75.975 -53.406 1.00 51.49  ? 60  VAL B N   1 
ATOM   4618 C CA  . VAL B 1 59  ? 0.924   -75.138 -52.576 1.00 51.47  ? 60  VAL B CA  1 
ATOM   4619 C C   . VAL B 1 59  ? 1.744   -76.018 -51.643 1.00 49.56  ? 60  VAL B C   1 
ATOM   4620 O O   . VAL B 1 59  ? 1.180   -76.857 -50.937 1.00 45.37  ? 60  VAL B O   1 
ATOM   4621 C CB  . VAL B 1 59  ? 0.086   -74.144 -51.718 1.00 49.53  ? 60  VAL B CB  1 
ATOM   4622 C CG1 . VAL B 1 59  ? 0.908   -73.576 -50.572 1.00 44.88  ? 60  VAL B CG1 1 
ATOM   4623 C CG2 . VAL B 1 59  ? -0.463  -73.024 -52.586 1.00 53.19  ? 60  VAL B CG2 1 
ATOM   4624 N N   . ASP B 1 60  ? 3.067   -75.851 -51.651 1.00 44.95  ? 61  ASP B N   1 
ATOM   4625 C CA  . ASP B 1 60  ? 3.932   -76.600 -50.736 1.00 44.11  ? 61  ASP B CA  1 
ATOM   4626 C C   . ASP B 1 60  ? 3.918   -75.932 -49.352 1.00 49.15  ? 61  ASP B C   1 
ATOM   4627 O O   . ASP B 1 60  ? 4.493   -74.850 -49.168 1.00 42.50  ? 61  ASP B O   1 
ATOM   4628 C CB  . ASP B 1 60  ? 5.384   -76.695 -51.246 1.00 44.54  ? 61  ASP B CB  1 
ATOM   4629 C CG  . ASP B 1 60  ? 5.512   -77.556 -52.494 1.00 58.97  ? 61  ASP B CG  1 
ATOM   4630 O OD1 . ASP B 1 60  ? 5.427   -78.794 -52.380 1.00 60.51  ? 61  ASP B OD1 1 
ATOM   4631 O OD2 . ASP B 1 60  ? 5.696   -76.989 -53.591 1.00 57.67  ? 61  ASP B OD2 1 
ATOM   4632 N N   . ALA B 1 61  ? 3.242   -76.572 -48.401 1.00 44.03  ? 62  ALA B N   1 
ATOM   4633 C CA  . ALA B 1 61  ? 3.273   -76.157 -46.993 1.00 40.70  ? 62  ALA B CA  1 
ATOM   4634 C C   . ALA B 1 61  ? 4.345   -76.935 -46.272 1.00 45.77  ? 62  ALA B C   1 
ATOM   4635 O O   . ALA B 1 61  ? 4.037   -77.777 -45.443 1.00 41.31  ? 62  ALA B O   1 
ATOM   4636 C CB  . ALA B 1 61  ? 1.924   -76.424 -46.322 1.00 42.40  ? 62  ALA B CB  1 
ATOM   4637 N N   . THR B 1 62  ? 5.607   -76.651 -46.571 1.00 43.29  ? 63  THR B N   1 
ATOM   4638 C CA  . THR B 1 62  ? 6.670   -77.543 -46.149 1.00 38.78  ? 63  THR B CA  1 
ATOM   4639 C C   . THR B 1 62  ? 7.731   -76.860 -45.292 1.00 45.89  ? 63  THR B C   1 
ATOM   4640 O O   . THR B 1 62  ? 8.708   -77.499 -44.892 1.00 48.78  ? 63  THR B O   1 
ATOM   4641 C CB  . THR B 1 62  ? 7.348   -78.157 -47.381 1.00 47.13  ? 63  THR B CB  1 
ATOM   4642 O OG1 . THR B 1 62  ? 7.770   -77.090 -48.228 1.00 42.80  ? 63  THR B OG1 1 
ATOM   4643 C CG2 . THR B 1 62  ? 6.365   -79.066 -48.153 1.00 37.69  ? 63  THR B CG2 1 
ATOM   4644 N N   . THR B 1 63  ? 7.558   -75.568 -45.015 1.00 43.82  ? 64  THR B N   1 
ATOM   4645 C CA  . THR B 1 63  ? 8.446   -74.879 -44.061 1.00 42.70  ? 64  THR B CA  1 
ATOM   4646 C C   . THR B 1 63  ? 7.744   -73.633 -43.537 1.00 44.19  ? 64  THR B C   1 
ATOM   4647 O O   . THR B 1 63  ? 6.789   -73.149 -44.165 1.00 40.44  ? 64  THR B O   1 
ATOM   4648 C CB  . THR B 1 63  ? 9.814   -74.489 -44.692 1.00 49.11  ? 64  THR B CB  1 
ATOM   4649 O OG1 . THR B 1 63  ? 10.811  -74.344 -43.674 1.00 47.10  ? 64  THR B OG1 1 
ATOM   4650 C CG2 . THR B 1 63  ? 9.710   -73.188 -45.507 1.00 43.32  ? 64  THR B CG2 1 
ATOM   4651 N N   . PHE B 1 64  ? 8.173   -73.145 -42.369 1.00 42.88  ? 65  PHE B N   1 
ATOM   4652 C CA  . PHE B 1 64  ? 7.629   -71.898 -41.823 1.00 43.87  ? 65  PHE B CA  1 
ATOM   4653 C C   . PHE B 1 64  ? 7.848   -70.728 -42.795 1.00 45.33  ? 65  PHE B C   1 
ATOM   4654 O O   . PHE B 1 64  ? 8.923   -70.580 -43.376 1.00 40.26  ? 65  PHE B O   1 
ATOM   4655 C CB  . PHE B 1 64  ? 8.281   -71.555 -40.476 1.00 43.19  ? 65  PHE B CB  1 
ATOM   4656 C CG  . PHE B 1 64  ? 7.929   -72.517 -39.349 1.00 38.77  ? 65  PHE B CG  1 
ATOM   4657 C CD1 . PHE B 1 64  ? 6.619   -72.633 -38.894 1.00 41.40  ? 65  PHE B CD1 1 
ATOM   4658 C CD2 . PHE B 1 64  ? 8.921   -73.270 -38.728 1.00 41.97  ? 65  PHE B CD2 1 
ATOM   4659 C CE1 . PHE B 1 64  ? 6.298   -73.499 -37.831 1.00 44.35  ? 65  PHE B CE1 1 
ATOM   4660 C CE2 . PHE B 1 64  ? 8.616   -74.141 -37.664 1.00 46.58  ? 65  PHE B CE2 1 
ATOM   4661 C CZ  . PHE B 1 64  ? 7.299   -74.260 -37.227 1.00 35.40  ? 65  PHE B CZ  1 
ATOM   4662 N N   . GLN B 1 65  ? 6.826   -69.894 -42.945 1.00 46.42  ? 66  GLN B N   1 
ATOM   4663 C CA  . GLN B 1 65  ? 6.945   -68.624 -43.652 1.00 39.14  ? 66  GLN B CA  1 
ATOM   4664 C C   . GLN B 1 65  ? 7.591   -67.523 -42.811 1.00 44.51  ? 66  GLN B C   1 
ATOM   4665 O O   . GLN B 1 65  ? 7.871   -67.715 -41.622 1.00 44.13  ? 66  GLN B O   1 
ATOM   4666 C CB  . GLN B 1 65  ? 5.574   -68.168 -44.172 1.00 37.88  ? 66  GLN B CB  1 
ATOM   4667 C CG  . GLN B 1 65  ? 5.316   -68.575 -45.637 1.00 41.42  ? 66  GLN B CG  1 
ATOM   4668 C CD  . GLN B 1 65  ? 6.007   -67.643 -46.614 1.00 48.38  ? 66  GLN B CD  1 
ATOM   4669 O OE1 . GLN B 1 65  ? 6.794   -66.778 -46.217 1.00 51.23  ? 66  GLN B OE1 1 
ATOM   4670 N NE2 . GLN B 1 65  ? 5.716   -67.812 -47.901 1.00 46.75  ? 66  GLN B NE2 1 
ATOM   4671 N N   . SER B 1 66  ? 7.784   -66.363 -43.440 1.00 40.24  ? 67  SER B N   1 
ATOM   4672 C CA  . SER B 1 66  ? 8.484   -65.217 -42.847 1.00 42.85  ? 67  SER B CA  1 
ATOM   4673 C C   . SER B 1 66  ? 7.861   -64.728 -41.546 1.00 45.09  ? 67  SER B C   1 
ATOM   4674 O O   . SER B 1 66  ? 6.666   -64.903 -41.311 1.00 43.94  ? 67  SER B O   1 
ATOM   4675 C CB  . SER B 1 66  ? 8.493   -64.036 -43.836 1.00 38.79  ? 67  SER B CB  1 
ATOM   4676 O OG  . SER B 1 66  ? 9.040   -64.403 -45.086 1.00 50.93  ? 67  SER B OG  1 
ATOM   4677 N N   . VAL B 1 67  ? 8.684   -64.089 -40.724 1.00 44.87  ? 68  VAL B N   1 
ATOM   4678 C CA  . VAL B 1 67  ? 8.243   -63.461 -39.487 1.00 44.06  ? 68  VAL B CA  1 
ATOM   4679 C C   . VAL B 1 67  ? 7.642   -62.066 -39.783 1.00 49.52  ? 68  VAL B C   1 
ATOM   4680 O O   . VAL B 1 67  ? 8.216   -61.316 -40.573 1.00 47.50  ? 68  VAL B O   1 
ATOM   4681 C CB  . VAL B 1 67  ? 9.448   -63.329 -38.529 1.00 49.87  ? 68  VAL B CB  1 
ATOM   4682 C CG1 . VAL B 1 67  ? 9.138   -62.406 -37.384 1.00 52.82  ? 68  VAL B CG1 1 
ATOM   4683 C CG2 . VAL B 1 67  ? 9.902   -64.717 -38.021 1.00 42.53  ? 68  VAL B CG2 1 
ATOM   4684 N N   . CYS B 1 68  ? 6.493   -61.712 -39.186 1.00 39.02  ? 69  CYS B N   1 
ATOM   4685 C CA  . CYS B 1 68  ? 5.950   -60.357 -39.398 1.00 41.22  ? 69  CYS B CA  1 
ATOM   4686 C C   . CYS B 1 68  ? 6.955   -59.305 -38.945 1.00 41.74  ? 69  CYS B C   1 
ATOM   4687 O O   . CYS B 1 68  ? 7.642   -59.507 -37.943 1.00 44.10  ? 69  CYS B O   1 
ATOM   4688 C CB  . CYS B 1 68  ? 4.622   -60.142 -38.675 1.00 41.14  ? 69  CYS B CB  1 
ATOM   4689 S SG  . CYS B 1 68  ? 3.256   -61.188 -39.215 1.00 46.02  ? 69  CYS B SG  1 
ATOM   4690 N N   . TYR B 1 69  ? 7.052   -58.194 -39.680 1.00 42.76  ? 70  TYR B N   1 
ATOM   4691 C CA  . TYR B 1 69  ? 8.055   -57.165 -39.359 1.00 42.71  ? 70  TYR B CA  1 
ATOM   4692 C C   . TYR B 1 69  ? 8.023   -56.712 -37.903 1.00 44.87  ? 70  TYR B C   1 
ATOM   4693 O O   . TYR B 1 69  ? 6.953   -56.439 -37.361 1.00 40.25  ? 70  TYR B O   1 
ATOM   4694 C CB  . TYR B 1 69  ? 7.886   -55.951 -40.258 1.00 50.26  ? 70  TYR B CB  1 
ATOM   4695 C CG  . TYR B 1 69  ? 9.082   -55.720 -41.128 1.00 50.81  ? 70  TYR B CG  1 
ATOM   4696 C CD1 . TYR B 1 69  ? 9.068   -56.103 -42.469 1.00 54.30  ? 70  TYR B CD1 1 
ATOM   4697 C CD2 . TYR B 1 69  ? 10.237  -55.141 -40.616 1.00 48.78  ? 70  TYR B CD2 1 
ATOM   4698 C CE1 . TYR B 1 69  ? 10.164  -55.898 -43.282 1.00 53.27  ? 70  TYR B CE1 1 
ATOM   4699 C CE2 . TYR B 1 69  ? 11.352  -54.943 -41.429 1.00 58.64  ? 70  TYR B CE2 1 
ATOM   4700 C CZ  . TYR B 1 69  ? 11.304  -55.328 -42.756 1.00 54.85  ? 70  TYR B CZ  1 
ATOM   4701 O OH  . TYR B 1 69  ? 12.389  -55.133 -43.585 1.00 87.85  ? 70  TYR B OH  1 
ATOM   4702 N N   . GLN B 1 70  ? 9.195   -56.641 -37.279 1.00 43.00  ? 71  GLN B N   1 
ATOM   4703 C CA  . GLN B 1 70  ? 9.265   -56.350 -35.856 1.00 42.50  ? 71  GLN B CA  1 
ATOM   4704 C C   . GLN B 1 70  ? 10.655  -55.930 -35.402 1.00 49.97  ? 71  GLN B C   1 
ATOM   4705 O O   . GLN B 1 70  ? 11.671  -56.238 -36.036 1.00 51.08  ? 71  GLN B O   1 
ATOM   4706 C CB  . GLN B 1 70  ? 8.794   -57.559 -35.033 1.00 41.86  ? 71  GLN B CB  1 
ATOM   4707 C CG  . GLN B 1 70  ? 9.654   -58.829 -35.147 1.00 45.01  ? 71  GLN B CG  1 
ATOM   4708 C CD  . GLN B 1 70  ? 8.955   -60.097 -34.598 1.00 44.99  ? 71  GLN B CD  1 
ATOM   4709 O OE1 . GLN B 1 70  ? 9.417   -60.701 -33.629 1.00 45.63  ? 71  GLN B OE1 1 
ATOM   4710 N NE2 . GLN B 1 70  ? 7.846   -60.497 -35.226 1.00 37.80  ? 71  GLN B NE2 1 
ATOM   4711 N N   . TYR B 1 71  ? 10.677  -55.232 -34.279 1.00 51.84  ? 72  TYR B N   1 
ATOM   4712 C CA  . TYR B 1 71  ? 11.903  -54.893 -33.594 1.00 48.81  ? 72  TYR B CA  1 
ATOM   4713 C C   . TYR B 1 71  ? 12.665  -56.157 -33.164 1.00 55.17  ? 72  TYR B C   1 
ATOM   4714 O O   . TYR B 1 71  ? 12.063  -57.161 -32.768 1.00 53.68  ? 72  TYR B O   1 
ATOM   4715 C CB  . TYR B 1 71  ? 11.559  -54.034 -32.383 1.00 51.23  ? 72  TYR B CB  1 
ATOM   4716 C CG  . TYR B 1 71  ? 12.738  -53.696 -31.502 1.00 53.56  ? 72  TYR B CG  1 
ATOM   4717 C CD1 . TYR B 1 71  ? 13.599  -52.654 -31.835 1.00 54.27  ? 72  TYR B CD1 1 
ATOM   4718 C CD2 . TYR B 1 71  ? 12.980  -54.404 -30.334 1.00 44.51  ? 72  TYR B CD2 1 
ATOM   4719 C CE1 . TYR B 1 71  ? 14.667  -52.333 -31.032 1.00 54.95  ? 72  TYR B CE1 1 
ATOM   4720 C CE2 . TYR B 1 71  ? 14.051  -54.092 -29.526 1.00 54.00  ? 72  TYR B CE2 1 
ATOM   4721 C CZ  . TYR B 1 71  ? 14.891  -53.052 -29.883 1.00 58.64  ? 72  TYR B CZ  1 
ATOM   4722 O OH  . TYR B 1 71  ? 15.964  -52.728 -29.092 1.00 64.42  ? 72  TYR B OH  1 
ATOM   4723 N N   . VAL B 1 72  ? 13.990  -56.099 -33.256 1.00 51.78  ? 73  VAL B N   1 
ATOM   4724 C CA  . VAL B 1 72  ? 14.846  -57.218 -32.886 1.00 46.21  ? 73  VAL B CA  1 
ATOM   4725 C C   . VAL B 1 72  ? 15.691  -56.830 -31.677 1.00 50.81  ? 73  VAL B C   1 
ATOM   4726 O O   . VAL B 1 72  ? 16.386  -55.814 -31.689 1.00 53.03  ? 73  VAL B O   1 
ATOM   4727 C CB  . VAL B 1 72  ? 15.773  -57.645 -34.057 1.00 53.98  ? 73  VAL B CB  1 
ATOM   4728 C CG1 . VAL B 1 72  ? 16.702  -58.760 -33.616 1.00 49.75  ? 73  VAL B CG1 1 
ATOM   4729 C CG2 . VAL B 1 72  ? 14.955  -58.091 -35.246 1.00 41.52  ? 73  VAL B CG2 1 
ATOM   4730 N N   . ASP B 1 73  ? 15.598  -57.642 -30.631 1.00 53.84  ? 74  ASP B N   1 
ATOM   4731 C CA  . ASP B 1 73  ? 16.291  -57.407 -29.364 1.00 59.50  ? 74  ASP B CA  1 
ATOM   4732 C C   . ASP B 1 73  ? 17.807  -57.534 -29.544 1.00 58.63  ? 74  ASP B C   1 
ATOM   4733 O O   . ASP B 1 73  ? 18.301  -58.521 -30.098 1.00 60.37  ? 74  ASP B O   1 
ATOM   4734 C CB  . ASP B 1 73  ? 15.777  -58.409 -28.314 1.00 54.50  ? 74  ASP B CB  1 
ATOM   4735 C CG  . ASP B 1 73  ? 16.054  -57.978 -26.876 1.00 63.26  ? 74  ASP B CG  1 
ATOM   4736 O OD1 . ASP B 1 73  ? 17.184  -57.554 -26.562 1.00 60.23  ? 74  ASP B OD1 1 
ATOM   4737 O OD2 . ASP B 1 73  ? 15.128  -58.092 -26.046 1.00 73.35  ? 74  ASP B OD2 1 
ATOM   4738 N N   . THR B 1 74  ? 18.536  -56.521 -29.085 1.00 59.25  ? 75  THR B N   1 
ATOM   4739 C CA  . THR B 1 74  ? 19.994  -56.530 -29.153 1.00 66.45  ? 75  THR B CA  1 
ATOM   4740 C C   . THR B 1 74  ? 20.670  -56.226 -27.804 1.00 66.57  ? 75  THR B C   1 
ATOM   4741 O O   . THR B 1 74  ? 21.884  -56.075 -27.751 1.00 67.98  ? 75  THR B O   1 
ATOM   4742 C CB  . THR B 1 74  ? 20.509  -55.531 -30.212 1.00 71.12  ? 75  THR B CB  1 
ATOM   4743 O OG1 . THR B 1 74  ? 19.851  -54.273 -30.030 1.00 65.53  ? 75  THR B OG1 1 
ATOM   4744 C CG2 . THR B 1 74  ? 20.239  -56.047 -31.624 1.00 52.85  ? 75  THR B CG2 1 
ATOM   4745 N N   . LEU B 1 75  ? 19.882  -56.154 -26.730 1.00 63.19  ? 76  LEU B N   1 
ATOM   4746 C CA  . LEU B 1 75  ? 20.389  -55.873 -25.377 1.00 68.01  ? 76  LEU B CA  1 
ATOM   4747 C C   . LEU B 1 75  ? 21.559  -56.775 -24.943 1.00 71.63  ? 76  LEU B C   1 
ATOM   4748 O O   . LEU B 1 75  ? 22.478  -56.328 -24.243 1.00 65.13  ? 76  LEU B O   1 
ATOM   4749 C CB  . LEU B 1 75  ? 19.253  -55.972 -24.345 1.00 65.48  ? 76  LEU B CB  1 
ATOM   4750 C CG  . LEU B 1 75  ? 19.564  -55.588 -22.884 1.00 73.38  ? 76  LEU B CG  1 
ATOM   4751 C CD1 . LEU B 1 75  ? 19.804  -54.085 -22.733 1.00 62.13  ? 76  LEU B CD1 1 
ATOM   4752 C CD2 . LEU B 1 75  ? 18.462  -56.030 -21.943 1.00 67.54  ? 76  LEU B CD2 1 
ATOM   4753 N N   . TYR B 1 76  ? 21.510  -58.043 -25.346 1.00 68.38  ? 77  TYR B N   1 
ATOM   4754 C CA  . TYR B 1 76  ? 22.590  -58.989 -25.067 1.00 64.00  ? 77  TYR B CA  1 
ATOM   4755 C C   . TYR B 1 76  ? 22.886  -59.851 -26.298 1.00 64.59  ? 77  TYR B C   1 
ATOM   4756 O O   . TYR B 1 76  ? 22.430  -60.997 -26.395 1.00 63.52  ? 77  TYR B O   1 
ATOM   4757 C CB  . TYR B 1 76  ? 22.230  -59.889 -23.891 1.00 52.18  ? 77  TYR B CB  1 
ATOM   4758 C CG  . TYR B 1 76  ? 22.013  -59.184 -22.559 1.00 71.04  ? 77  TYR B CG  1 
ATOM   4759 C CD1 . TYR B 1 76  ? 23.074  -58.605 -21.868 1.00 65.43  ? 77  TYR B CD1 1 
ATOM   4760 C CD2 . TYR B 1 76  ? 20.751  -59.140 -21.971 1.00 70.85  ? 77  TYR B CD2 1 
ATOM   4761 C CE1 . TYR B 1 76  ? 22.881  -57.984 -20.648 1.00 66.26  ? 77  TYR B CE1 1 
ATOM   4762 C CE2 . TYR B 1 76  ? 20.548  -58.518 -20.744 1.00 66.79  ? 77  TYR B CE2 1 
ATOM   4763 C CZ  . TYR B 1 76  ? 21.614  -57.940 -20.083 1.00 71.25  ? 77  TYR B CZ  1 
ATOM   4764 O OH  . TYR B 1 76  ? 21.414  -57.328 -18.851 1.00 70.19  ? 77  TYR B OH  1 
ATOM   4765 N N   . PRO B 1 77  ? 23.663  -59.305 -27.243 1.00 71.52  ? 78  PRO B N   1 
ATOM   4766 C CA  . PRO B 1 77  ? 23.928  -59.963 -28.534 1.00 71.56  ? 78  PRO B CA  1 
ATOM   4767 C C   . PRO B 1 77  ? 24.534  -61.359 -28.378 1.00 69.82  ? 78  PRO B C   1 
ATOM   4768 O O   . PRO B 1 77  ? 25.501  -61.517 -27.642 1.00 71.69  ? 78  PRO B O   1 
ATOM   4769 C CB  . PRO B 1 77  ? 24.923  -59.011 -29.213 1.00 74.37  ? 78  PRO B CB  1 
ATOM   4770 C CG  . PRO B 1 77  ? 24.661  -57.671 -28.582 1.00 77.18  ? 78  PRO B CG  1 
ATOM   4771 C CD  . PRO B 1 77  ? 24.333  -57.996 -27.137 1.00 71.06  ? 78  PRO B CD  1 
ATOM   4772 N N   . GLY B 1 78  ? 23.954  -62.357 -29.043 1.00 70.87  ? 79  GLY B N   1 
ATOM   4773 C CA  . GLY B 1 78  ? 24.441  -63.725 -28.949 1.00 60.84  ? 79  GLY B CA  1 
ATOM   4774 C C   . GLY B 1 78  ? 24.003  -64.520 -27.721 1.00 69.84  ? 79  GLY B C   1 
ATOM   4775 O O   . GLY B 1 78  ? 24.219  -65.733 -27.657 1.00 61.81  ? 79  GLY B O   1 
ATOM   4776 N N   . PHE B 1 79  ? 23.391  -63.850 -26.744 1.00 65.77  ? 80  PHE B N   1 
ATOM   4777 C CA  . PHE B 1 79  ? 22.900  -64.527 -25.535 1.00 51.00  ? 80  PHE B CA  1 
ATOM   4778 C C   . PHE B 1 79  ? 21.663  -65.396 -25.845 1.00 56.11  ? 80  PHE B C   1 
ATOM   4779 O O   . PHE B 1 79  ? 20.675  -64.924 -26.417 1.00 53.40  ? 80  PHE B O   1 
ATOM   4780 C CB  . PHE B 1 79  ? 22.611  -63.482 -24.441 1.00 51.25  ? 80  PHE B CB  1 
ATOM   4781 C CG  . PHE B 1 79  ? 22.007  -64.041 -23.180 1.00 56.46  ? 80  PHE B CG  1 
ATOM   4782 C CD1 . PHE B 1 79  ? 22.678  -64.993 -22.427 1.00 52.86  ? 80  PHE B CD1 1 
ATOM   4783 C CD2 . PHE B 1 79  ? 20.790  -63.561 -22.715 1.00 58.84  ? 80  PHE B CD2 1 
ATOM   4784 C CE1 . PHE B 1 79  ? 22.128  -65.492 -21.257 1.00 56.82  ? 80  PHE B CE1 1 
ATOM   4785 C CE2 . PHE B 1 79  ? 20.230  -64.047 -21.539 1.00 50.89  ? 80  PHE B CE2 1 
ATOM   4786 C CZ  . PHE B 1 79  ? 20.899  -65.013 -20.806 1.00 55.49  ? 80  PHE B CZ  1 
ATOM   4787 N N   . GLU B 1 80  ? 21.734  -66.668 -25.475 1.00 49.99  ? 81  GLU B N   1 
ATOM   4788 C CA  . GLU B 1 80  ? 20.643  -67.615 -25.694 1.00 53.71  ? 81  GLU B CA  1 
ATOM   4789 C C   . GLU B 1 80  ? 19.290  -67.153 -25.116 1.00 61.33  ? 81  GLU B C   1 
ATOM   4790 O O   . GLU B 1 80  ? 18.264  -67.233 -25.792 1.00 57.66  ? 81  GLU B O   1 
ATOM   4791 C CB  . GLU B 1 80  ? 21.024  -68.980 -25.121 1.00 62.48  ? 81  GLU B CB  1 
ATOM   4792 C CG  . GLU B 1 80  ? 20.583  -70.154 -25.969 1.00 80.92  ? 81  GLU B CG  1 
ATOM   4793 C CD  . GLU B 1 80  ? 19.239  -70.701 -25.544 1.00 79.16  ? 81  GLU B CD  1 
ATOM   4794 O OE1 . GLU B 1 80  ? 18.978  -70.728 -24.322 1.00 88.06  ? 81  GLU B OE1 1 
ATOM   4795 O OE2 . GLU B 1 80  ? 18.448  -71.104 -26.430 1.00 89.43  ? 81  GLU B OE2 1 
ATOM   4796 N N   . GLY B 1 81  ? 19.298  -66.663 -23.877 1.00 53.54  ? 82  GLY B N   1 
ATOM   4797 C CA  . GLY B 1 81  ? 18.084  -66.205 -23.219 1.00 55.16  ? 82  GLY B CA  1 
ATOM   4798 C C   . GLY B 1 81  ? 17.276  -65.144 -23.961 1.00 56.10  ? 82  GLY B C   1 
ATOM   4799 O O   . GLY B 1 81  ? 16.058  -65.068 -23.814 1.00 53.69  ? 82  GLY B O   1 
ATOM   4800 N N   . THR B 1 82  ? 17.939  -64.325 -24.768 1.00 55.75  ? 83  THR B N   1 
ATOM   4801 C CA  . THR B 1 82  ? 17.218  -63.361 -25.594 1.00 53.58  ? 83  THR B CA  1 
ATOM   4802 C C   . THR B 1 82  ? 17.050  -63.814 -27.052 1.00 53.08  ? 83  THR B C   1 
ATOM   4803 O O   . THR B 1 82  ? 16.010  -63.555 -27.661 1.00 58.44  ? 83  THR B O   1 
ATOM   4804 C CB  . THR B 1 82  ? 17.869  -61.976 -25.547 1.00 58.22  ? 83  THR B CB  1 
ATOM   4805 O OG1 . THR B 1 82  ? 19.262  -62.097 -25.854 1.00 53.16  ? 83  THR B OG1 1 
ATOM   4806 C CG2 . THR B 1 82  ? 17.718  -61.372 -24.149 1.00 55.04  ? 83  THR B CG2 1 
ATOM   4807 N N   . GLU B 1 83  ? 18.049  -64.492 -27.615 1.00 49.81  ? 84  GLU B N   1 
ATOM   4808 C CA  . GLU B 1 83  ? 17.969  -64.863 -29.027 1.00 50.16  ? 84  GLU B CA  1 
ATOM   4809 C C   . GLU B 1 83  ? 16.844  -65.860 -29.306 1.00 47.91  ? 84  GLU B C   1 
ATOM   4810 O O   . GLU B 1 83  ? 16.330  -65.917 -30.425 1.00 51.13  ? 84  GLU B O   1 
ATOM   4811 C CB  . GLU B 1 83  ? 19.310  -65.396 -29.570 1.00 52.81  ? 84  GLU B CB  1 
ATOM   4812 C CG  . GLU B 1 83  ? 20.510  -64.440 -29.417 1.00 63.32  ? 84  GLU B CG  1 
ATOM   4813 C CD  . GLU B 1 83  ? 20.440  -63.199 -30.305 1.00 71.79  ? 84  GLU B CD  1 
ATOM   4814 O OE1 . GLU B 1 83  ? 19.467  -63.058 -31.084 1.00 71.56  ? 84  GLU B OE1 1 
ATOM   4815 O OE2 . GLU B 1 83  ? 21.377  -62.365 -30.230 1.00 71.81  ? 84  GLU B OE2 1 
ATOM   4816 N N   . MET B 1 84  ? 16.458  -66.632 -28.286 1.00 49.00  ? 85  MET B N   1 
ATOM   4817 C CA  . MET B 1 84  ? 15.416  -67.653 -28.440 1.00 42.83  ? 85  MET B CA  1 
ATOM   4818 C C   . MET B 1 84  ? 14.062  -67.043 -28.791 1.00 47.47  ? 85  MET B C   1 
ATOM   4819 O O   . MET B 1 84  ? 13.184  -67.727 -29.317 1.00 43.22  ? 85  MET B O   1 
ATOM   4820 C CB  . MET B 1 84  ? 15.292  -68.500 -27.169 1.00 53.49  ? 85  MET B CB  1 
ATOM   4821 C CG  . MET B 1 84  ? 14.852  -67.734 -25.916 1.00 48.75  ? 85  MET B CG  1 
ATOM   4822 S SD  . MET B 1 84  ? 14.705  -68.859 -24.500 1.00 54.22  ? 85  MET B SD  1 
ATOM   4823 C CE  . MET B 1 84  ? 13.219  -69.760 -24.957 1.00 44.39  ? 85  MET B CE  1 
ATOM   4824 N N   . TRP B 1 85  ? 13.906  -65.755 -28.488 1.00 43.10  ? 86  TRP B N   1 
ATOM   4825 C CA  . TRP B 1 85  ? 12.672  -65.025 -28.762 1.00 44.27  ? 86  TRP B CA  1 
ATOM   4826 C C   . TRP B 1 85  ? 12.754  -64.229 -30.077 1.00 48.40  ? 86  TRP B C   1 
ATOM   4827 O O   . TRP B 1 85  ? 11.743  -63.734 -30.584 1.00 45.56  ? 86  TRP B O   1 
ATOM   4828 C CB  . TRP B 1 85  ? 12.343  -64.086 -27.577 1.00 44.80  ? 86  TRP B CB  1 
ATOM   4829 C CG  . TRP B 1 85  ? 12.240  -64.796 -26.233 1.00 44.66  ? 86  TRP B CG  1 
ATOM   4830 C CD1 . TRP B 1 85  ? 13.057  -64.620 -25.149 1.00 47.77  ? 86  TRP B CD1 1 
ATOM   4831 C CD2 . TRP B 1 85  ? 11.282  -65.806 -25.851 1.00 39.49  ? 86  TRP B CD2 1 
ATOM   4832 N NE1 . TRP B 1 85  ? 12.658  -65.435 -24.117 1.00 47.44  ? 86  TRP B NE1 1 
ATOM   4833 C CE2 . TRP B 1 85  ? 11.571  -66.171 -24.518 1.00 49.10  ? 86  TRP B CE2 1 
ATOM   4834 C CE3 . TRP B 1 85  ? 10.194  -66.413 -26.497 1.00 43.47  ? 86  TRP B CE3 1 
ATOM   4835 C CZ2 . TRP B 1 85  ? 10.820  -67.133 -23.817 1.00 44.19  ? 86  TRP B CZ2 1 
ATOM   4836 C CZ3 . TRP B 1 85  ? 9.441   -67.370 -25.798 1.00 41.58  ? 86  TRP B CZ3 1 
ATOM   4837 C CH2 . TRP B 1 85  ? 9.766   -67.722 -24.470 1.00 39.44  ? 86  TRP B CH2 1 
ATOM   4838 N N   . ASN B 1 86  ? 13.959  -64.118 -30.629 1.00 43.75  ? 87  ASN B N   1 
ATOM   4839 C CA  . ASN B 1 86  ? 14.182  -63.325 -31.837 1.00 46.01  ? 87  ASN B CA  1 
ATOM   4840 C C   . ASN B 1 86  ? 13.728  -64.043 -33.113 1.00 46.22  ? 87  ASN B C   1 
ATOM   4841 O O   . ASN B 1 86  ? 13.606  -65.272 -33.125 1.00 44.84  ? 87  ASN B O   1 
ATOM   4842 C CB  . ASN B 1 86  ? 15.655  -62.884 -31.925 1.00 54.82  ? 87  ASN B CB  1 
ATOM   4843 C CG  . ASN B 1 86  ? 15.928  -61.599 -31.146 1.00 56.54  ? 87  ASN B CG  1 
ATOM   4844 O OD1 . ASN B 1 86  ? 15.008  -60.829 -30.856 1.00 54.78  ? 87  ASN B OD1 1 
ATOM   4845 N ND2 . ASN B 1 86  ? 17.194  -61.359 -30.814 1.00 56.13  ? 87  ASN B ND2 1 
ATOM   4846 N N   . PRO B 1 87  ? 13.446  -63.279 -34.184 1.00 48.07  ? 88  PRO B N   1 
ATOM   4847 C CA  . PRO B 1 87  ? 12.987  -63.888 -35.441 1.00 50.06  ? 88  PRO B CA  1 
ATOM   4848 C C   . PRO B 1 87  ? 13.940  -64.947 -35.980 1.00 45.75  ? 88  PRO B C   1 
ATOM   4849 O O   . PRO B 1 87  ? 15.146  -64.729 -36.036 1.00 46.18  ? 88  PRO B O   1 
ATOM   4850 C CB  . PRO B 1 87  ? 12.947  -62.697 -36.405 1.00 43.96  ? 88  PRO B CB  1 
ATOM   4851 C CG  . PRO B 1 87  ? 12.678  -61.528 -35.495 1.00 41.05  ? 88  PRO B CG  1 
ATOM   4852 C CD  . PRO B 1 87  ? 13.500  -61.810 -34.283 1.00 37.24  ? 88  PRO B CD  1 
ATOM   4853 N N   . ASN B 1 88  ? 13.393  -66.084 -36.390 1.00 52.48  ? 89  ASN B N   1 
ATOM   4854 C CA  . ASN B 1 88  ? 14.206  -67.121 -37.000 1.00 48.87  ? 89  ASN B CA  1 
ATOM   4855 C C   . ASN B 1 88  ? 13.867  -67.391 -38.473 1.00 45.88  ? 89  ASN B C   1 
ATOM   4856 O O   . ASN B 1 88  ? 14.239  -68.424 -39.019 1.00 49.35  ? 89  ASN B O   1 
ATOM   4857 C CB  . ASN B 1 88  ? 14.176  -68.402 -36.158 1.00 50.46  ? 89  ASN B CB  1 
ATOM   4858 C CG  . ASN B 1 88  ? 12.836  -69.095 -36.201 1.00 50.59  ? 89  ASN B CG  1 
ATOM   4859 O OD1 . ASN B 1 88  ? 11.808  -68.485 -36.528 1.00 47.26  ? 89  ASN B OD1 1 
ATOM   4860 N ND2 . ASN B 1 88  ? 12.835  -70.384 -35.879 1.00 50.50  ? 89  ASN B ND2 1 
ATOM   4861 N N   . ARG B 1 89  ? 13.139  -66.460 -39.089 1.00 47.91  ? 90  ARG B N   1 
ATOM   4862 C CA  . ARG B 1 89  ? 13.016  -66.360 -40.544 1.00 46.92  ? 90  ARG B CA  1 
ATOM   4863 C C   . ARG B 1 89  ? 13.176  -64.892 -40.896 1.00 53.88  ? 90  ARG B C   1 
ATOM   4864 O O   . ARG B 1 89  ? 13.149  -64.035 -40.014 1.00 47.75  ? 90  ARG B O   1 
ATOM   4865 C CB  . ARG B 1 89  ? 11.647  -66.822 -41.048 1.00 47.42  ? 90  ARG B CB  1 
ATOM   4866 C CG  . ARG B 1 89  ? 11.379  -68.289 -40.864 1.00 53.24  ? 90  ARG B CG  1 
ATOM   4867 C CD  . ARG B 1 89  ? 12.177  -69.093 -41.886 1.00 58.15  ? 90  ARG B CD  1 
ATOM   4868 N NE  . ARG B 1 89  ? 11.731  -70.479 -41.927 1.00 58.02  ? 90  ARG B NE  1 
ATOM   4869 C CZ  . ARG B 1 89  ? 12.150  -71.400 -41.074 1.00 52.24  ? 90  ARG B CZ  1 
ATOM   4870 N NH1 . ARG B 1 89  ? 13.020  -71.063 -40.135 1.00 50.40  ? 90  ARG B NH1 1 
ATOM   4871 N NH2 . ARG B 1 89  ? 11.697  -72.647 -41.163 1.00 56.71  ? 90  ARG B NH2 1 
ATOM   4872 N N   . GLU B 1 90  ? 13.329  -64.596 -42.181 1.00 44.90  ? 91  GLU B N   1 
ATOM   4873 C CA  . GLU B 1 90  ? 13.488  -63.225 -42.616 1.00 44.26  ? 91  GLU B CA  1 
ATOM   4874 C C   . GLU B 1 90  ? 12.240  -62.429 -42.275 1.00 49.80  ? 91  GLU B C   1 
ATOM   4875 O O   . GLU B 1 90  ? 11.128  -62.977 -42.221 1.00 42.60  ? 91  GLU B O   1 
ATOM   4876 C CB  . GLU B 1 90  ? 13.741  -63.170 -44.129 1.00 51.71  ? 91  GLU B CB  1 
ATOM   4877 C CG  . GLU B 1 90  ? 12.594  -63.647 -44.954 1.00 49.43  ? 91  GLU B CG  1 
ATOM   4878 C CD  . GLU B 1 90  ? 12.797  -63.385 -46.448 1.00 83.99  ? 91  GLU B CD  1 
ATOM   4879 O OE1 . GLU B 1 90  ? 13.766  -63.929 -47.036 1.00 80.88  ? 91  GLU B OE1 1 
ATOM   4880 O OE2 . GLU B 1 90  ? 11.983  -62.628 -47.032 1.00 80.50  ? 91  GLU B OE2 1 
ATOM   4881 N N   . LEU B 1 91  ? 12.428  -61.135 -42.039 1.00 41.53  ? 92  LEU B N   1 
ATOM   4882 C CA  . LEU B 1 91  ? 11.310  -60.239 -41.791 1.00 45.85  ? 92  LEU B CA  1 
ATOM   4883 C C   . LEU B 1 91  ? 10.560  -59.881 -43.073 1.00 55.87  ? 92  LEU B C   1 
ATOM   4884 O O   . LEU B 1 91  ? 11.167  -59.583 -44.090 1.00 48.87  ? 92  LEU B O   1 
ATOM   4885 C CB  . LEU B 1 91  ? 11.814  -58.962 -41.126 1.00 46.68  ? 92  LEU B CB  1 
ATOM   4886 C CG  . LEU B 1 91  ? 12.510  -59.139 -39.781 1.00 51.74  ? 92  LEU B CG  1 
ATOM   4887 C CD1 . LEU B 1 91  ? 13.011  -57.791 -39.289 1.00 41.82  ? 92  LEU B CD1 1 
ATOM   4888 C CD2 . LEU B 1 91  ? 11.552  -59.786 -38.768 1.00 49.57  ? 92  LEU B CD2 1 
ATOM   4889 N N   . SER B 1 92  ? 9.236   -59.889 -43.017 1.00 50.89  ? 93  SER B N   1 
ATOM   4890 C CA  . SER B 1 92  ? 8.458   -59.437 -44.150 1.00 47.80  ? 93  SER B CA  1 
ATOM   4891 C C   . SER B 1 92  ? 7.060   -58.981 -43.719 1.00 51.71  ? 93  SER B C   1 
ATOM   4892 O O   . SER B 1 92  ? 6.520   -59.475 -42.730 1.00 50.77  ? 93  SER B O   1 
ATOM   4893 C CB  . SER B 1 92  ? 8.359   -60.563 -45.188 1.00 46.49  ? 93  SER B CB  1 
ATOM   4894 O OG  . SER B 1 92  ? 7.440   -60.215 -46.207 1.00 41.66  ? 93  SER B OG  1 
ATOM   4895 N N   . GLU B 1 93  ? 6.466   -58.053 -44.464 1.00 49.20  ? 94  GLU B N   1 
ATOM   4896 C CA  . GLU B 1 93  ? 5.057   -57.731 -44.265 1.00 51.12  ? 94  GLU B CA  1 
ATOM   4897 C C   . GLU B 1 93  ? 4.172   -58.832 -44.850 1.00 51.53  ? 94  GLU B C   1 
ATOM   4898 O O   . GLU B 1 93  ? 2.996   -58.949 -44.502 1.00 50.65  ? 94  GLU B O   1 
ATOM   4899 C CB  . GLU B 1 93  ? 4.704   -56.378 -44.887 1.00 43.72  ? 94  GLU B CB  1 
ATOM   4900 C CG  . GLU B 1 93  ? 5.302   -55.190 -44.142 1.00 48.67  ? 94  GLU B CG  1 
ATOM   4901 C CD  . GLU B 1 93  ? 4.849   -53.856 -44.718 1.00 55.13  ? 94  GLU B CD  1 
ATOM   4902 O OE1 . GLU B 1 93  ? 3.743   -53.383 -44.377 1.00 56.23  ? 94  GLU B OE1 1 
ATOM   4903 O OE2 . GLU B 1 93  ? 5.597   -53.280 -45.525 1.00 52.98  ? 94  GLU B OE2 1 
ATOM   4904 N N   . ASP B 1 94  ? 4.744   -59.616 -45.761 1.00 44.76  ? 95  ASP B N   1 
ATOM   4905 C CA  . ASP B 1 94  ? 4.086   -60.799 -46.313 1.00 43.53  ? 95  ASP B CA  1 
ATOM   4906 C C   . ASP B 1 94  ? 4.246   -61.938 -45.294 1.00 50.70  ? 95  ASP B C   1 
ATOM   4907 O O   . ASP B 1 94  ? 5.139   -62.777 -45.432 1.00 41.96  ? 95  ASP B O   1 
ATOM   4908 C CB  . ASP B 1 94  ? 4.743   -61.143 -47.658 1.00 43.73  ? 95  ASP B CB  1 
ATOM   4909 C CG  . ASP B 1 94  ? 4.072   -62.303 -48.391 1.00 44.65  ? 95  ASP B CG  1 
ATOM   4910 O OD1 . ASP B 1 94  ? 3.187   -62.979 -47.838 1.00 50.10  ? 95  ASP B OD1 1 
ATOM   4911 O OD2 . ASP B 1 94  ? 4.448   -62.544 -49.555 1.00 57.50  ? 95  ASP B OD2 1 
ATOM   4912 N N   . CYS B 1 95  ? 3.399   -61.958 -44.255 1.00 46.16  ? 96  CYS B N   1 
ATOM   4913 C CA  . CYS B 1 95  ? 3.620   -62.882 -43.130 1.00 39.93  ? 96  CYS B CA  1 
ATOM   4914 C C   . CYS B 1 95  ? 2.385   -63.610 -42.612 1.00 42.86  ? 96  CYS B C   1 
ATOM   4915 O O   . CYS B 1 95  ? 2.450   -64.279 -41.578 1.00 40.72  ? 96  CYS B O   1 
ATOM   4916 C CB  . CYS B 1 95  ? 4.260   -62.136 -41.951 1.00 46.49  ? 96  CYS B CB  1 
ATOM   4917 S SG  . CYS B 1 95  ? 3.226   -60.802 -41.259 1.00 44.80  ? 96  CYS B SG  1 
ATOM   4918 N N   . LEU B 1 96  ? 1.256   -63.469 -43.293 1.00 38.12  ? 97  LEU B N   1 
ATOM   4919 C CA  . LEU B 1 96  ? 0.016   -64.030 -42.761 1.00 40.88  ? 97  LEU B CA  1 
ATOM   4920 C C   . LEU B 1 96  ? -0.182  -65.494 -43.195 1.00 43.40  ? 97  LEU B C   1 
ATOM   4921 O O   . LEU B 1 96  ? -0.937  -65.792 -44.123 1.00 43.08  ? 97  LEU B O   1 
ATOM   4922 C CB  . LEU B 1 96  ? -1.182  -63.140 -43.144 1.00 40.15  ? 97  LEU B CB  1 
ATOM   4923 C CG  . LEU B 1 96  ? -1.228  -61.766 -42.438 1.00 48.50  ? 97  LEU B CG  1 
ATOM   4924 C CD1 . LEU B 1 96  ? -2.551  -61.060 -42.693 1.00 46.26  ? 97  LEU B CD1 1 
ATOM   4925 C CD2 . LEU B 1 96  ? -0.982  -61.869 -40.888 1.00 36.22  ? 97  LEU B CD2 1 
ATOM   4926 N N   . TYR B 1 97  ? 0.529   -66.393 -42.522 1.00 40.55  ? 98  TYR B N   1 
ATOM   4927 C CA  . TYR B 1 97  ? 0.462   -67.827 -42.779 1.00 35.68  ? 98  TYR B CA  1 
ATOM   4928 C C   . TYR B 1 97  ? 0.199   -68.574 -41.464 1.00 44.49  ? 98  TYR B C   1 
ATOM   4929 O O   . TYR B 1 97  ? 0.546   -68.073 -40.400 1.00 40.28  ? 98  TYR B O   1 
ATOM   4930 C CB  . TYR B 1 97  ? 1.790   -68.302 -43.387 1.00 45.37  ? 98  TYR B CB  1 
ATOM   4931 C CG  . TYR B 1 97  ? 2.133   -67.600 -44.690 1.00 45.19  ? 98  TYR B CG  1 
ATOM   4932 C CD1 . TYR B 1 97  ? 1.825   -68.183 -45.925 1.00 44.92  ? 98  TYR B CD1 1 
ATOM   4933 C CD2 . TYR B 1 97  ? 2.741   -66.349 -44.685 1.00 40.13  ? 98  TYR B CD2 1 
ATOM   4934 C CE1 . TYR B 1 97  ? 2.127   -67.531 -47.148 1.00 41.59  ? 98  TYR B CE1 1 
ATOM   4935 C CE2 . TYR B 1 97  ? 3.039   -65.690 -45.882 1.00 39.18  ? 98  TYR B CE2 1 
ATOM   4936 C CZ  . TYR B 1 97  ? 2.732   -66.286 -47.104 1.00 51.36  ? 98  TYR B CZ  1 
ATOM   4937 O OH  . TYR B 1 97  ? 3.037   -65.617 -48.272 1.00 45.15  ? 98  TYR B OH  1 
ATOM   4938 N N   . LEU B 1 98  ? -0.392  -69.768 -41.542 1.00 40.16  ? 99  LEU B N   1 
ATOM   4939 C CA  . LEU B 1 98  ? -0.602  -70.604 -40.362 1.00 47.97  ? 99  LEU B CA  1 
ATOM   4940 C C   . LEU B 1 98  ? -0.057  -72.022 -40.560 1.00 47.68  ? 99  LEU B C   1 
ATOM   4941 O O   . LEU B 1 98  ? 0.308   -72.417 -41.674 1.00 47.05  ? 99  LEU B O   1 
ATOM   4942 C CB  . LEU B 1 98  ? -2.090  -70.619 -39.952 1.00 42.98  ? 99  LEU B CB  1 
ATOM   4943 C CG  . LEU B 1 98  ? -3.164  -71.097 -40.938 1.00 44.65  ? 99  LEU B CG  1 
ATOM   4944 C CD1 . LEU B 1 98  ? -3.201  -72.637 -41.089 1.00 42.02  ? 99  LEU B CD1 1 
ATOM   4945 C CD2 . LEU B 1 98  ? -4.539  -70.567 -40.505 1.00 41.00  ? 99  LEU B CD2 1 
ATOM   4946 N N   . ASN B 1 99  ? -0.013  -72.781 -39.470 1.00 46.59  ? 100 ASN B N   1 
ATOM   4947 C CA  . ASN B 1 99  ? 0.591   -74.113 -39.444 1.00 46.33  ? 100 ASN B CA  1 
ATOM   4948 C C   . ASN B 1 99  ? -0.341  -75.114 -38.808 1.00 46.67  ? 100 ASN B C   1 
ATOM   4949 O O   . ASN B 1 99  ? -0.950  -74.811 -37.784 1.00 41.01  ? 100 ASN B O   1 
ATOM   4950 C CB  . ASN B 1 99  ? 1.889   -74.082 -38.635 1.00 40.84  ? 100 ASN B CB  1 
ATOM   4951 C CG  . ASN B 1 99  ? 2.733   -72.876 -38.963 1.00 52.42  ? 100 ASN B CG  1 
ATOM   4952 O OD1 . ASN B 1 99  ? 3.278   -72.763 -40.074 1.00 46.11  ? 100 ASN B OD1 1 
ATOM   4953 N ND2 . ASN B 1 99  ? 2.828   -71.942 -38.012 1.00 43.02  ? 100 ASN B ND2 1 
ATOM   4954 N N   . VAL B 1 100 ? -0.444  -76.303 -39.407 1.00 43.67  ? 101 VAL B N   1 
ATOM   4955 C CA  . VAL B 1 100 ? -1.180  -77.421 -38.809 1.00 38.33  ? 101 VAL B CA  1 
ATOM   4956 C C   . VAL B 1 100 ? -0.278  -78.647 -38.558 1.00 51.45  ? 101 VAL B C   1 
ATOM   4957 O O   . VAL B 1 100 ? 0.435   -79.109 -39.459 1.00 44.75  ? 101 VAL B O   1 
ATOM   4958 C CB  . VAL B 1 100 ? -2.366  -77.840 -39.688 1.00 43.78  ? 101 VAL B CB  1 
ATOM   4959 C CG1 . VAL B 1 100 ? -3.156  -78.983 -39.037 1.00 38.98  ? 101 VAL B CG1 1 
ATOM   4960 C CG2 . VAL B 1 100 ? -3.264  -76.654 -39.970 1.00 43.10  ? 101 VAL B CG2 1 
ATOM   4961 N N   . TRP B 1 101 ? -0.276  -79.167 -37.333 1.00 40.48  ? 102 TRP B N   1 
ATOM   4962 C CA  . TRP B 1 101 ? 0.342   -80.474 -37.104 1.00 43.09  ? 102 TRP B CA  1 
ATOM   4963 C C   . TRP B 1 101 ? -0.737  -81.517 -36.800 1.00 51.20  ? 102 TRP B C   1 
ATOM   4964 O O   . TRP B 1 101 ? -1.689  -81.240 -36.066 1.00 48.68  ? 102 TRP B O   1 
ATOM   4965 C CB  . TRP B 1 101 ? 1.332   -80.457 -35.955 1.00 39.85  ? 102 TRP B CB  1 
ATOM   4966 C CG  . TRP B 1 101 ? 2.580   -79.613 -36.073 1.00 40.71  ? 102 TRP B CG  1 
ATOM   4967 C CD1 . TRP B 1 101 ? 3.849   -80.061 -36.322 1.00 41.20  ? 102 TRP B CD1 1 
ATOM   4968 C CD2 . TRP B 1 101 ? 2.697   -78.203 -35.821 1.00 41.35  ? 102 TRP B CD2 1 
ATOM   4969 N NE1 . TRP B 1 101 ? 4.744   -79.011 -36.271 1.00 45.34  ? 102 TRP B NE1 1 
ATOM   4970 C CE2 . TRP B 1 101 ? 4.059   -77.861 -35.964 1.00 45.08  ? 102 TRP B CE2 1 
ATOM   4971 C CE3 . TRP B 1 101 ? 1.779   -77.196 -35.491 1.00 44.96  ? 102 TRP B CE3 1 
ATOM   4972 C CZ2 . TRP B 1 101 ? 4.524   -76.554 -35.792 1.00 37.50  ? 102 TRP B CZ2 1 
ATOM   4973 C CZ3 . TRP B 1 101 ? 2.238   -75.900 -35.325 1.00 37.25  ? 102 TRP B CZ3 1 
ATOM   4974 C CH2 . TRP B 1 101 ? 3.604   -75.589 -35.472 1.00 38.37  ? 102 TRP B CH2 1 
ATOM   4975 N N   . THR B 1 102 ? -0.587  -82.717 -37.365 1.00 49.85  ? 103 THR B N   1 
ATOM   4976 C CA  . THR B 1 102 ? -1.582  -83.773 -37.187 1.00 41.85  ? 103 THR B CA  1 
ATOM   4977 C C   . THR B 1 102 ? -0.899  -85.141 -37.078 1.00 48.94  ? 103 THR B C   1 
ATOM   4978 O O   . THR B 1 102 ? 0.211   -85.315 -37.573 1.00 58.05  ? 103 THR B O   1 
ATOM   4979 C CB  . THR B 1 102 ? -2.677  -83.726 -38.297 1.00 57.80  ? 103 THR B CB  1 
ATOM   4980 O OG1 . THR B 1 102 ? -3.858  -84.398 -37.839 1.00 57.80  ? 103 THR B OG1 1 
ATOM   4981 C CG2 . THR B 1 102 ? -2.190  -84.366 -39.613 1.00 48.25  ? 103 THR B CG2 1 
ATOM   4982 N N   . PRO B 1 103 ? -1.523  -86.096 -36.363 1.00 52.43  ? 104 PRO B N   1 
ATOM   4983 C CA  . PRO B 1 103 ? -0.948  -87.447 -36.279 1.00 57.30  ? 104 PRO B CA  1 
ATOM   4984 C C   . PRO B 1 103 ? -0.803  -88.130 -37.651 1.00 59.48  ? 104 PRO B C   1 
ATOM   4985 O O   . PRO B 1 103 ? -1.529  -87.796 -38.591 1.00 55.13  ? 104 PRO B O   1 
ATOM   4986 C CB  . PRO B 1 103 ? -1.960  -88.204 -35.418 1.00 61.54  ? 104 PRO B CB  1 
ATOM   4987 C CG  . PRO B 1 103 ? -2.579  -87.136 -34.560 1.00 60.87  ? 104 PRO B CG  1 
ATOM   4988 C CD  . PRO B 1 103 ? -2.662  -85.920 -35.442 1.00 55.86  ? 104 PRO B CD  1 
ATOM   4989 N N   . TYR B 1 104 ? 0.145   -89.061 -37.746 1.00 65.94  ? 105 TYR B N   1 
ATOM   4990 C CA  . TYR B 1 104 ? 0.407   -89.831 -38.967 1.00 67.23  ? 105 TYR B CA  1 
ATOM   4991 C C   . TYR B 1 104 ? 0.289   -91.314 -38.605 1.00 69.06  ? 105 TYR B C   1 
ATOM   4992 O O   . TYR B 1 104 ? 1.094   -91.826 -37.828 1.00 71.03  ? 105 TYR B O   1 
ATOM   4993 C CB  . TYR B 1 104 ? 1.819   -89.518 -39.483 1.00 63.06  ? 105 TYR B CB  1 
ATOM   4994 C CG  . TYR B 1 104 ? 2.185   -90.077 -40.848 1.00 69.80  ? 105 TYR B CG  1 
ATOM   4995 C CD1 . TYR B 1 104 ? 2.364   -91.447 -41.048 1.00 71.94  ? 105 TYR B CD1 1 
ATOM   4996 C CD2 . TYR B 1 104 ? 2.404   -89.225 -41.929 1.00 74.29  ? 105 TYR B CD2 1 
ATOM   4997 C CE1 . TYR B 1 104 ? 2.718   -91.954 -42.297 1.00 68.67  ? 105 TYR B CE1 1 
ATOM   4998 C CE2 . TYR B 1 104 ? 2.760   -89.725 -43.187 1.00 68.79  ? 105 TYR B CE2 1 
ATOM   4999 C CZ  . TYR B 1 104 ? 2.915   -91.086 -43.362 1.00 71.91  ? 105 TYR B CZ  1 
ATOM   5000 O OH  . TYR B 1 104 ? 3.262   -91.576 -44.602 1.00 70.24  ? 105 TYR B OH  1 
ATOM   5001 N N   . PRO B 1 105 ? -0.706  -92.018 -39.169 1.00 69.30  ? 106 PRO B N   1 
ATOM   5002 C CA  . PRO B 1 105 ? -1.650  -91.581 -40.202 1.00 74.25  ? 106 PRO B CA  1 
ATOM   5003 C C   . PRO B 1 105 ? -2.709  -90.622 -39.665 1.00 70.17  ? 106 PRO B C   1 
ATOM   5004 O O   . PRO B 1 105 ? -2.903  -90.520 -38.452 1.00 72.25  ? 106 PRO B O   1 
ATOM   5005 C CB  . PRO B 1 105 ? -2.313  -92.893 -40.629 1.00 73.81  ? 106 PRO B CB  1 
ATOM   5006 C CG  . PRO B 1 105 ? -2.323  -93.703 -39.380 1.00 65.65  ? 106 PRO B CG  1 
ATOM   5007 C CD  . PRO B 1 105 ? -1.031  -93.369 -38.674 1.00 72.12  ? 106 PRO B CD  1 
ATOM   5008 N N   . ARG B 1 106 ? -3.377  -89.926 -40.575 1.00 64.47  ? 107 ARG B N   1 
ATOM   5009 C CA  . ARG B 1 106 ? -4.414  -88.971 -40.213 1.00 66.91  ? 107 ARG B CA  1 
ATOM   5010 C C   . ARG B 1 106 ? -5.502  -89.644 -39.382 1.00 68.95  ? 107 ARG B C   1 
ATOM   5011 O O   . ARG B 1 106 ? -5.884  -90.777 -39.661 1.00 70.43  ? 107 ARG B O   1 
ATOM   5012 C CB  . ARG B 1 106 ? -5.014  -88.381 -41.481 1.00 66.98  ? 107 ARG B CB  1 
ATOM   5013 C CG  . ARG B 1 106 ? -5.444  -86.953 -41.370 1.00 60.72  ? 107 ARG B CG  1 
ATOM   5014 C CD  . ARG B 1 106 ? -5.831  -86.420 -42.734 1.00 74.48  ? 107 ARG B CD  1 
ATOM   5015 N NE  . ARG B 1 106 ? -4.682  -86.379 -43.633 1.00 78.32  ? 107 ARG B NE  1 
ATOM   5016 C CZ  . ARG B 1 106 ? -4.755  -86.075 -44.926 1.00 76.01  ? 107 ARG B CZ  1 
ATOM   5017 N NH1 . ARG B 1 106 ? -5.928  -85.774 -45.478 1.00 64.56  ? 107 ARG B NH1 1 
ATOM   5018 N NH2 . ARG B 1 106 ? -3.653  -86.069 -45.669 1.00 60.89  ? 107 ARG B NH2 1 
ATOM   5019 N N   . PRO B 1 107 ? -5.975  -88.959 -38.332 1.00 79.08  ? 108 PRO B N   1 
ATOM   5020 C CA  . PRO B 1 107 ? -7.046  -89.465 -37.466 1.00 71.37  ? 108 PRO B CA  1 
ATOM   5021 C C   . PRO B 1 107 ? -8.263  -89.922 -38.254 1.00 74.44  ? 108 PRO B C   1 
ATOM   5022 O O   . PRO B 1 107 ? -8.638  -89.298 -39.252 1.00 72.76  ? 108 PRO B O   1 
ATOM   5023 C CB  . PRO B 1 107 ? -7.406  -88.244 -36.619 1.00 68.86  ? 108 PRO B CB  1 
ATOM   5024 C CG  . PRO B 1 107 ? -6.109  -87.523 -36.474 1.00 65.49  ? 108 PRO B CG  1 
ATOM   5025 C CD  . PRO B 1 107 ? -5.416  -87.694 -37.819 1.00 73.49  ? 108 PRO B CD  1 
ATOM   5026 N N   . THR B 1 108 ? -8.871  -91.011 -37.797 1.00 77.04  ? 109 THR B N   1 
ATOM   5027 C CA  . THR B 1 108 ? -10.043 -91.570 -38.463 1.00 84.68  ? 109 THR B CA  1 
ATOM   5028 C C   . THR B 1 108 ? -11.331 -90.915 -37.970 1.00 72.85  ? 109 THR B C   1 
ATOM   5029 O O   . THR B 1 108 ? -12.262 -90.708 -38.745 1.00 75.12  ? 109 THR B O   1 
ATOM   5030 C CB  . THR B 1 108 ? -10.108 -93.092 -38.272 1.00 76.49  ? 109 THR B CB  1 
ATOM   5031 O OG1 . THR B 1 108 ? -9.798  -93.406 -36.909 1.00 89.71  ? 109 THR B OG1 1 
ATOM   5032 C CG2 . THR B 1 108 ? -9.091  -93.769 -39.168 1.00 77.17  ? 109 THR B CG2 1 
ATOM   5033 N N   . SER B 1 109 ? -11.375 -90.581 -36.683 1.00 69.96  ? 110 SER B N   1 
ATOM   5034 C CA  . SER B 1 109 ? -12.514 -89.855 -36.114 1.00 71.29  ? 110 SER B CA  1 
ATOM   5035 C C   . SER B 1 109 ? -12.082 -88.448 -35.674 1.00 63.65  ? 110 SER B C   1 
ATOM   5036 O O   . SER B 1 109 ? -10.905 -88.224 -35.405 1.00 63.39  ? 110 SER B O   1 
ATOM   5037 C CB  . SER B 1 109 ? -13.118 -90.652 -34.954 1.00 70.08  ? 110 SER B CB  1 
ATOM   5038 O OG  . SER B 1 109 ? -12.103 -91.222 -34.144 1.00 77.20  ? 110 SER B OG  1 
ATOM   5039 N N   . PRO B 1 110 ? -13.023 -87.488 -35.629 1.00 64.89  ? 111 PRO B N   1 
ATOM   5040 C CA  . PRO B 1 110 ? -12.669 -86.095 -35.305 1.00 65.09  ? 111 PRO B CA  1 
ATOM   5041 C C   . PRO B 1 110 ? -11.867 -85.933 -34.006 1.00 68.65  ? 111 PRO B C   1 
ATOM   5042 O O   . PRO B 1 110 ? -12.236 -86.472 -32.962 1.00 63.93  ? 111 PRO B O   1 
ATOM   5043 C CB  . PRO B 1 110 ? -14.029 -85.409 -35.194 1.00 62.47  ? 111 PRO B CB  1 
ATOM   5044 C CG  . PRO B 1 110 ? -14.894 -86.187 -36.148 1.00 65.40  ? 111 PRO B CG  1 
ATOM   5045 C CD  . PRO B 1 110 ? -14.447 -87.618 -35.987 1.00 65.85  ? 111 PRO B CD  1 
ATOM   5046 N N   . THR B 1 111 ? -10.767 -85.190 -34.107 1.00 67.57  ? 112 THR B N   1 
ATOM   5047 C CA  . THR B 1 111 ? -9.777  -85.045 -33.040 1.00 66.51  ? 112 THR B CA  1 
ATOM   5048 C C   . THR B 1 111 ? -9.772  -83.607 -32.492 1.00 62.32  ? 112 THR B C   1 
ATOM   5049 O O   . THR B 1 111 ? -9.786  -82.642 -33.268 1.00 53.71  ? 112 THR B O   1 
ATOM   5050 C CB  . THR B 1 111 ? -8.373  -85.394 -33.592 1.00 62.50  ? 112 THR B CB  1 
ATOM   5051 O OG1 . THR B 1 111 ? -8.339  -86.774 -33.968 1.00 64.76  ? 112 THR B OG1 1 
ATOM   5052 C CG2 . THR B 1 111 ? -7.302  -85.145 -32.572 1.00 58.70  ? 112 THR B CG2 1 
ATOM   5053 N N   . PRO B 1 112 ? -9.762  -83.456 -31.155 1.00 53.98  ? 113 PRO B N   1 
ATOM   5054 C CA  . PRO B 1 112 ? -9.758  -82.122 -30.532 1.00 50.63  ? 113 PRO B CA  1 
ATOM   5055 C C   . PRO B 1 112 ? -8.565  -81.260 -30.973 1.00 51.73  ? 113 PRO B C   1 
ATOM   5056 O O   . PRO B 1 112 ? -7.448  -81.767 -31.165 1.00 43.20  ? 113 PRO B O   1 
ATOM   5057 C CB  . PRO B 1 112 ? -9.670  -82.431 -29.023 1.00 55.27  ? 113 PRO B CB  1 
ATOM   5058 C CG  . PRO B 1 112 ? -9.213  -83.858 -28.939 1.00 62.95  ? 113 PRO B CG  1 
ATOM   5059 C CD  . PRO B 1 112 ? -9.785  -84.530 -30.152 1.00 58.97  ? 113 PRO B CD  1 
ATOM   5060 N N   . VAL B 1 113 ? -8.815  -79.962 -31.121 1.00 48.97  ? 114 VAL B N   1 
ATOM   5061 C CA  . VAL B 1 113 ? -7.823  -79.028 -31.655 1.00 48.27  ? 114 VAL B CA  1 
ATOM   5062 C C   . VAL B 1 113 ? -7.298  -78.018 -30.620 1.00 48.21  ? 114 VAL B C   1 
ATOM   5063 O O   . VAL B 1 113 ? -8.083  -77.324 -29.978 1.00 51.86  ? 114 VAL B O   1 
ATOM   5064 C CB  . VAL B 1 113 ? -8.433  -78.219 -32.798 1.00 47.39  ? 114 VAL B CB  1 
ATOM   5065 C CG1 . VAL B 1 113 ? -7.406  -77.252 -33.374 1.00 44.10  ? 114 VAL B CG1 1 
ATOM   5066 C CG2 . VAL B 1 113 ? -8.989  -79.160 -33.880 1.00 49.62  ? 114 VAL B CG2 1 
ATOM   5067 N N   . LEU B 1 114 ? -5.975  -77.940 -30.475 1.00 42.16  ? 115 LEU B N   1 
ATOM   5068 C CA  . LEU B 1 114 ? -5.322  -76.847 -29.747 1.00 44.92  ? 115 LEU B CA  1 
ATOM   5069 C C   . LEU B 1 114 ? -4.828  -75.750 -30.708 1.00 49.75  ? 115 LEU B C   1 
ATOM   5070 O O   . LEU B 1 114 ? -4.118  -76.048 -31.670 1.00 51.76  ? 115 LEU B O   1 
ATOM   5071 C CB  . LEU B 1 114 ? -4.144  -77.402 -28.942 1.00 41.18  ? 115 LEU B CB  1 
ATOM   5072 C CG  . LEU B 1 114 ? -4.529  -78.102 -27.640 1.00 48.62  ? 115 LEU B CG  1 
ATOM   5073 C CD1 . LEU B 1 114 ? -3.381  -78.941 -27.090 1.00 48.76  ? 115 LEU B CD1 1 
ATOM   5074 C CD2 . LEU B 1 114 ? -4.915  -77.046 -26.632 1.00 44.94  ? 115 LEU B CD2 1 
ATOM   5075 N N   . VAL B 1 115 ? -5.190  -74.491 -30.458 1.00 46.38  ? 116 VAL B N   1 
ATOM   5076 C CA  . VAL B 1 115 ? -4.695  -73.371 -31.283 1.00 40.21  ? 116 VAL B CA  1 
ATOM   5077 C C   . VAL B 1 115 ? -3.786  -72.422 -30.481 1.00 47.76  ? 116 VAL B C   1 
ATOM   5078 O O   . VAL B 1 115 ? -4.264  -71.739 -29.569 1.00 49.04  ? 116 VAL B O   1 
ATOM   5079 C CB  . VAL B 1 115 ? -5.870  -72.550 -31.871 1.00 38.16  ? 116 VAL B CB  1 
ATOM   5080 C CG1 . VAL B 1 115 ? -5.359  -71.450 -32.782 1.00 38.74  ? 116 VAL B CG1 1 
ATOM   5081 C CG2 . VAL B 1 115 ? -6.842  -73.473 -32.618 1.00 36.89  ? 116 VAL B CG2 1 
ATOM   5082 N N   . TRP B 1 116 ? -2.492  -72.377 -30.818 1.00 39.26  ? 117 TRP B N   1 
ATOM   5083 C CA  . TRP B 1 116 ? -1.511  -71.508 -30.143 1.00 41.74  ? 117 TRP B CA  1 
ATOM   5084 C C   . TRP B 1 116 ? -1.491  -70.069 -30.631 1.00 44.85  ? 117 TRP B C   1 
ATOM   5085 O O   . TRP B 1 116 ? -1.468  -69.816 -31.834 1.00 44.64  ? 117 TRP B O   1 
ATOM   5086 C CB  . TRP B 1 116 ? -0.099  -72.090 -30.258 1.00 38.82  ? 117 TRP B CB  1 
ATOM   5087 C CG  . TRP B 1 116 ? 1.000   -71.273 -29.563 1.00 44.38  ? 117 TRP B CG  1 
ATOM   5088 C CD1 . TRP B 1 116 ? 2.030   -70.582 -30.174 1.00 40.99  ? 117 TRP B CD1 1 
ATOM   5089 C CD2 . TRP B 1 116 ? 1.193   -71.092 -28.139 1.00 41.02  ? 117 TRP B CD2 1 
ATOM   5090 N NE1 . TRP B 1 116 ? 2.836   -69.984 -29.222 1.00 43.03  ? 117 TRP B NE1 1 
ATOM   5091 C CE2 . TRP B 1 116 ? 2.346   -70.272 -27.971 1.00 39.65  ? 117 TRP B CE2 1 
ATOM   5092 C CE3 . TRP B 1 116 ? 0.496   -71.521 -27.000 1.00 35.46  ? 117 TRP B CE3 1 
ATOM   5093 C CZ2 . TRP B 1 116 ? 2.817   -69.882 -26.698 1.00 41.97  ? 117 TRP B CZ2 1 
ATOM   5094 C CZ3 . TRP B 1 116 ? 0.966   -71.139 -25.731 1.00 38.63  ? 117 TRP B CZ3 1 
ATOM   5095 C CH2 . TRP B 1 116 ? 2.125   -70.331 -25.596 1.00 36.99  ? 117 TRP B CH2 1 
ATOM   5096 N N   . ILE B 1 117 ? -1.477  -69.124 -29.696 1.00 40.13  ? 118 ILE B N   1 
ATOM   5097 C CA  . ILE B 1 117 ? -1.276  -67.711 -30.031 1.00 43.62  ? 118 ILE B CA  1 
ATOM   5098 C C   . ILE B 1 117 ? -0.045  -67.198 -29.283 1.00 47.43  ? 118 ILE B C   1 
ATOM   5099 O O   . ILE B 1 117 ? -0.075  -67.100 -28.052 1.00 40.55  ? 118 ILE B O   1 
ATOM   5100 C CB  . ILE B 1 117 ? -2.516  -66.838 -29.660 1.00 41.44  ? 118 ILE B CB  1 
ATOM   5101 C CG1 . ILE B 1 117 ? -3.786  -67.416 -30.275 1.00 43.85  ? 118 ILE B CG1 1 
ATOM   5102 C CG2 . ILE B 1 117 ? -2.352  -65.409 -30.149 1.00 37.18  ? 118 ILE B CG2 1 
ATOM   5103 C CD1 . ILE B 1 117 ? -5.031  -66.618 -29.963 1.00 43.71  ? 118 ILE B CD1 1 
ATOM   5104 N N   . TYR B 1 118 ? 1.042   -66.888 -30.001 1.00 44.73  ? 119 TYR B N   1 
ATOM   5105 C CA  . TYR B 1 118 ? 2.270   -66.457 -29.313 1.00 45.27  ? 119 TYR B CA  1 
ATOM   5106 C C   . TYR B 1 118 ? 2.154   -65.077 -28.676 1.00 41.14  ? 119 TYR B C   1 
ATOM   5107 O O   . TYR B 1 118 ? 1.338   -64.249 -29.093 1.00 39.68  ? 119 TYR B O   1 
ATOM   5108 C CB  . TYR B 1 118 ? 3.483   -66.440 -30.244 1.00 38.20  ? 119 TYR B CB  1 
ATOM   5109 C CG  . TYR B 1 118 ? 3.337   -65.555 -31.483 1.00 42.45  ? 119 TYR B CG  1 
ATOM   5110 C CD1 . TYR B 1 118 ? 3.402   -64.149 -31.407 1.00 41.42  ? 119 TYR B CD1 1 
ATOM   5111 C CD2 . TYR B 1 118 ? 3.165   -66.130 -32.731 1.00 37.78  ? 119 TYR B CD2 1 
ATOM   5112 C CE1 . TYR B 1 118 ? 3.270   -63.351 -32.556 1.00 38.36  ? 119 TYR B CE1 1 
ATOM   5113 C CE2 . TYR B 1 118 ? 3.025   -65.345 -33.892 1.00 42.03  ? 119 TYR B CE2 1 
ATOM   5114 C CZ  . TYR B 1 118 ? 3.095   -63.964 -33.803 1.00 43.06  ? 119 TYR B CZ  1 
ATOM   5115 O OH  . TYR B 1 118 ? 2.961   -63.224 -34.967 1.00 42.95  ? 119 TYR B OH  1 
ATOM   5116 N N   . GLY B 1 119 ? 3.019   -64.834 -27.699 1.00 39.70  ? 120 GLY B N   1 
ATOM   5117 C CA  . GLY B 1 119 ? 3.155   -63.530 -27.065 1.00 42.93  ? 120 GLY B CA  1 
ATOM   5118 C C   . GLY B 1 119 ? 4.359   -62.760 -27.580 1.00 45.28  ? 120 GLY B C   1 
ATOM   5119 O O   . GLY B 1 119 ? 4.896   -63.074 -28.646 1.00 44.27  ? 120 GLY B O   1 
ATOM   5120 N N   . GLY B 1 120 ? 4.779   -61.740 -26.831 1.00 42.89  ? 121 GLY B N   1 
ATOM   5121 C CA  . GLY B 1 120 ? 5.832   -60.830 -27.271 1.00 40.63  ? 121 GLY B CA  1 
ATOM   5122 C C   . GLY B 1 120 ? 5.400   -59.361 -27.259 1.00 49.07  ? 121 GLY B C   1 
ATOM   5123 O O   . GLY B 1 120 ? 5.876   -58.542 -28.072 1.00 45.60  ? 121 GLY B O   1 
ATOM   5124 N N   . GLY B 1 121 ? 4.474   -59.040 -26.352 1.00 42.24  ? 122 GLY B N   1 
ATOM   5125 C CA  . GLY B 1 121 ? 4.071   -57.671 -26.061 1.00 40.38  ? 122 GLY B CA  1 
ATOM   5126 C C   . GLY B 1 121 ? 3.336   -56.940 -27.176 1.00 42.23  ? 122 GLY B C   1 
ATOM   5127 O O   . GLY B 1 121 ? 3.295   -55.714 -27.185 1.00 43.03  ? 122 GLY B O   1 
ATOM   5128 N N   . PHE B 1 122 ? 2.756   -57.699 -28.107 1.00 40.63  ? 123 PHE B N   1 
ATOM   5129 C CA  . PHE B 1 122 ? 2.107   -57.169 -29.281 1.00 37.73  ? 123 PHE B CA  1 
ATOM   5130 C C   . PHE B 1 122 ? 3.088   -56.467 -30.237 1.00 39.43  ? 123 PHE B C   1 
ATOM   5131 O O   . PHE B 1 122 ? 2.672   -55.923 -31.253 1.00 40.43  ? 123 PHE B O   1 
ATOM   5132 C CB  . PHE B 1 122 ? 0.913   -56.273 -28.937 1.00 43.59  ? 123 PHE B CB  1 
ATOM   5133 C CG  . PHE B 1 122 ? -0.239  -57.005 -28.282 1.00 42.60  ? 123 PHE B CG  1 
ATOM   5134 C CD1 . PHE B 1 122 ? -1.025  -57.895 -29.016 1.00 41.39  ? 123 PHE B CD1 1 
ATOM   5135 C CD2 . PHE B 1 122 ? -0.561  -56.766 -26.940 1.00 37.22  ? 123 PHE B CD2 1 
ATOM   5136 C CE1 . PHE B 1 122 ? -2.097  -58.574 -28.418 1.00 41.31  ? 123 PHE B CE1 1 
ATOM   5137 C CE2 . PHE B 1 122 ? -1.641  -57.430 -26.316 1.00 35.01  ? 123 PHE B CE2 1 
ATOM   5138 C CZ  . PHE B 1 122 ? -2.407  -58.340 -27.050 1.00 42.01  ? 123 PHE B CZ  1 
ATOM   5139 N N   . TYR B 1 123 ? 4.385   -56.516 -29.927 1.00 39.00  ? 124 TYR B N   1 
ATOM   5140 C CA  . TYR B 1 123 ? 5.411   -55.922 -30.790 1.00 45.44  ? 124 TYR B CA  1 
ATOM   5141 C C   . TYR B 1 123 ? 6.364   -56.916 -31.467 1.00 41.57  ? 124 TYR B C   1 
ATOM   5142 O O   . TYR B 1 123 ? 7.175   -56.515 -32.305 1.00 43.24  ? 124 TYR B O   1 
ATOM   5143 C CB  . TYR B 1 123 ? 6.243   -54.890 -30.029 1.00 47.94  ? 124 TYR B CB  1 
ATOM   5144 C CG  . TYR B 1 123 ? 7.293   -55.459 -29.077 1.00 41.61  ? 124 TYR B CG  1 
ATOM   5145 C CD1 . TYR B 1 123 ? 8.598   -55.698 -29.508 1.00 42.17  ? 124 TYR B CD1 1 
ATOM   5146 C CD2 . TYR B 1 123 ? 6.988   -55.707 -27.751 1.00 44.11  ? 124 TYR B CD2 1 
ATOM   5147 C CE1 . TYR B 1 123 ? 9.555   -56.188 -28.651 1.00 41.55  ? 124 TYR B CE1 1 
ATOM   5148 C CE2 . TYR B 1 123 ? 7.947   -56.212 -26.874 1.00 46.62  ? 124 TYR B CE2 1 
ATOM   5149 C CZ  . TYR B 1 123 ? 9.228   -56.438 -27.338 1.00 46.26  ? 124 TYR B CZ  1 
ATOM   5150 O OH  . TYR B 1 123 ? 10.178  -56.926 -26.497 1.00 45.79  ? 124 TYR B OH  1 
ATOM   5151 N N   . SER B 1 124 ? 6.264   -58.194 -31.103 1.00 41.04  ? 125 SER B N   1 
ATOM   5152 C CA  . SER B 1 124 ? 7.241   -59.203 -31.500 1.00 35.03  ? 125 SER B CA  1 
ATOM   5153 C C   . SER B 1 124 ? 6.624   -60.585 -31.408 1.00 42.61  ? 125 SER B C   1 
ATOM   5154 O O   . SER B 1 124 ? 5.518   -60.744 -30.904 1.00 43.04  ? 125 SER B O   1 
ATOM   5155 C CB  . SER B 1 124 ? 8.468   -59.158 -30.583 1.00 42.02  ? 125 SER B CB  1 
ATOM   5156 O OG  . SER B 1 124 ? 8.108   -59.435 -29.235 1.00 40.69  ? 125 SER B OG  1 
ATOM   5157 N N   . GLY B 1 125 ? 7.363   -61.583 -31.878 1.00 37.82  ? 126 GLY B N   1 
ATOM   5158 C CA  . GLY B 1 125 ? 6.942   -62.966 -31.780 1.00 38.30  ? 126 GLY B CA  1 
ATOM   5159 C C   . GLY B 1 125 ? 6.718   -63.583 -33.146 1.00 43.16  ? 126 GLY B C   1 
ATOM   5160 O O   . GLY B 1 125 ? 6.619   -62.856 -34.163 1.00 40.40  ? 126 GLY B O   1 
ATOM   5161 N N   . ALA B 1 126 ? 6.615   -64.915 -33.174 1.00 46.18  ? 127 ALA B N   1 
ATOM   5162 C CA  . ALA B 1 126 ? 6.357   -65.641 -34.424 1.00 41.08  ? 127 ALA B CA  1 
ATOM   5163 C C   . ALA B 1 126 ? 5.965   -67.091 -34.135 1.00 43.94  ? 127 ALA B C   1 
ATOM   5164 O O   . ALA B 1 126 ? 6.357   -67.655 -33.109 1.00 43.31  ? 127 ALA B O   1 
ATOM   5165 C CB  . ALA B 1 126 ? 7.587   -65.592 -35.325 1.00 40.26  ? 127 ALA B CB  1 
ATOM   5166 N N   . SER B 1 127 ? 5.192   -67.704 -35.027 1.00 39.90  ? 128 SER B N   1 
ATOM   5167 C CA  . SER B 1 127 ? 4.809   -69.107 -34.802 1.00 41.29  ? 128 SER B CA  1 
ATOM   5168 C C   . SER B 1 127 ? 5.935   -70.096 -35.131 1.00 44.29  ? 128 SER B C   1 
ATOM   5169 O O   . SER B 1 127 ? 5.855   -71.288 -34.813 1.00 42.04  ? 128 SER B O   1 
ATOM   5170 C CB  . SER B 1 127 ? 3.509   -69.464 -35.524 1.00 41.30  ? 128 SER B CB  1 
ATOM   5171 O OG  . SER B 1 127 ? 3.628   -69.272 -36.930 1.00 41.91  ? 128 SER B OG  1 
ATOM   5172 N N   . SER B 1 128 ? 7.015   -69.579 -35.703 1.00 44.33  ? 129 SER B N   1 
ATOM   5173 C CA  . SER B 1 128 ? 8.123   -70.421 -36.132 1.00 47.90  ? 129 SER B CA  1 
ATOM   5174 C C   . SER B 1 128 ? 9.189   -70.708 -35.063 1.00 48.03  ? 129 SER B C   1 
ATOM   5175 O O   . SER B 1 128 ? 10.043  -71.567 -35.270 1.00 46.14  ? 129 SER B O   1 
ATOM   5176 C CB  . SER B 1 128 ? 8.769   -69.826 -37.391 1.00 42.57  ? 129 SER B CB  1 
ATOM   5177 O OG  . SER B 1 128 ? 9.219   -68.496 -37.175 1.00 46.98  ? 129 SER B OG  1 
ATOM   5178 N N   . LEU B 1 129 ? 9.152   -70.008 -33.929 1.00 49.77  ? 130 LEU B N   1 
ATOM   5179 C CA  . LEU B 1 129 ? 10.166  -70.228 -32.883 1.00 47.37  ? 130 LEU B CA  1 
ATOM   5180 C C   . LEU B 1 129 ? 10.253  -71.694 -32.436 1.00 44.46  ? 130 LEU B C   1 
ATOM   5181 O O   . LEU B 1 129 ? 9.229   -72.364 -32.279 1.00 52.68  ? 130 LEU B O   1 
ATOM   5182 C CB  . LEU B 1 129 ? 9.937   -69.311 -31.673 1.00 48.10  ? 130 LEU B CB  1 
ATOM   5183 C CG  . LEU B 1 129 ? 9.790   -67.822 -31.987 1.00 47.04  ? 130 LEU B CG  1 
ATOM   5184 C CD1 . LEU B 1 129 ? 9.826   -67.003 -30.685 1.00 44.47  ? 130 LEU B CD1 1 
ATOM   5185 C CD2 . LEU B 1 129 ? 10.864  -67.363 -32.976 1.00 44.20  ? 130 LEU B CD2 1 
ATOM   5186 N N   . ASP B 1 130 ? 11.483  -72.186 -32.265 1.00 47.57  ? 131 ASP B N   1 
ATOM   5187 C CA  . ASP B 1 130 ? 11.740  -73.575 -31.856 1.00 54.27  ? 131 ASP B CA  1 
ATOM   5188 C C   . ASP B 1 130 ? 10.941  -73.987 -30.623 1.00 52.21  ? 131 ASP B C   1 
ATOM   5189 O O   . ASP B 1 130 ? 10.510  -75.126 -30.491 1.00 44.93  ? 131 ASP B O   1 
ATOM   5190 C CB  . ASP B 1 130 ? 13.232  -73.774 -31.567 1.00 51.86  ? 131 ASP B CB  1 
ATOM   5191 C CG  . ASP B 1 130 ? 14.085  -73.655 -32.814 1.00 54.96  ? 131 ASP B CG  1 
ATOM   5192 O OD1 . ASP B 1 130 ? 13.518  -73.648 -33.932 1.00 55.01  ? 131 ASP B OD1 1 
ATOM   5193 O OD2 . ASP B 1 130 ? 15.323  -73.567 -32.681 1.00 60.77  ? 131 ASP B OD2 1 
ATOM   5194 N N   . VAL B 1 131 ? 10.746  -73.041 -29.719 1.00 44.88  ? 132 VAL B N   1 
ATOM   5195 C CA  . VAL B 1 131 ? 10.042  -73.330 -28.474 1.00 47.71  ? 132 VAL B CA  1 
ATOM   5196 C C   . VAL B 1 131 ? 8.530   -73.549 -28.683 1.00 48.79  ? 132 VAL B C   1 
ATOM   5197 O O   . VAL B 1 131 ? 7.867   -74.084 -27.808 1.00 47.15  ? 132 VAL B O   1 
ATOM   5198 C CB  . VAL B 1 131 ? 10.341  -72.229 -27.428 1.00 48.75  ? 132 VAL B CB  1 
ATOM   5199 C CG1 . VAL B 1 131 ? 9.688   -70.885 -27.840 1.00 47.87  ? 132 VAL B CG1 1 
ATOM   5200 C CG2 . VAL B 1 131 ? 9.931   -72.661 -26.062 1.00 49.31  ? 132 VAL B CG2 1 
ATOM   5201 N N   . TYR B 1 132 ? 7.997   -73.181 -29.856 1.00 45.45  ? 133 TYR B N   1 
ATOM   5202 C CA  . TYR B 1 132 ? 6.573   -73.420 -30.166 1.00 45.89  ? 133 TYR B CA  1 
ATOM   5203 C C   . TYR B 1 132 ? 6.386   -74.594 -31.155 1.00 52.16  ? 133 TYR B C   1 
ATOM   5204 O O   . TYR B 1 132 ? 5.322   -74.738 -31.748 1.00 47.01  ? 133 TYR B O   1 
ATOM   5205 C CB  . TYR B 1 132 ? 5.879   -72.157 -30.744 1.00 43.82  ? 133 TYR B CB  1 
ATOM   5206 C CG  . TYR B 1 132 ? 6.076   -70.861 -29.969 1.00 43.78  ? 133 TYR B CG  1 
ATOM   5207 C CD1 . TYR B 1 132 ? 6.044   -70.840 -28.573 1.00 41.87  ? 133 TYR B CD1 1 
ATOM   5208 C CD2 . TYR B 1 132 ? 6.302   -69.665 -30.631 1.00 42.23  ? 133 TYR B CD2 1 
ATOM   5209 C CE1 . TYR B 1 132 ? 6.221   -69.657 -27.873 1.00 45.12  ? 133 TYR B CE1 1 
ATOM   5210 C CE2 . TYR B 1 132 ? 6.485   -68.473 -29.943 1.00 38.68  ? 133 TYR B CE2 1 
ATOM   5211 C CZ  . TYR B 1 132 ? 6.444   -68.481 -28.552 1.00 43.94  ? 133 TYR B CZ  1 
ATOM   5212 O OH  . TYR B 1 132 ? 6.637   -67.316 -27.841 1.00 44.46  ? 133 TYR B OH  1 
ATOM   5213 N N   . ASP B 1 133 ? 7.423   -75.410 -31.339 1.00 51.92  ? 134 ASP B N   1 
ATOM   5214 C CA  . ASP B 1 133 ? 7.379   -76.556 -32.253 1.00 46.96  ? 134 ASP B CA  1 
ATOM   5215 C C   . ASP B 1 133 ? 6.277   -77.501 -31.790 1.00 54.20  ? 134 ASP B C   1 
ATOM   5216 O O   . ASP B 1 133 ? 6.376   -78.089 -30.728 1.00 45.06  ? 134 ASP B O   1 
ATOM   5217 C CB  . ASP B 1 133 ? 8.741   -77.282 -32.237 1.00 51.22  ? 134 ASP B CB  1 
ATOM   5218 C CG  . ASP B 1 133 ? 8.811   -78.469 -33.214 1.00 57.92  ? 134 ASP B CG  1 
ATOM   5219 O OD1 . ASP B 1 133 ? 7.789   -78.819 -33.841 1.00 48.43  ? 134 ASP B OD1 1 
ATOM   5220 O OD2 . ASP B 1 133 ? 9.908   -79.067 -33.341 1.00 55.73  ? 134 ASP B OD2 1 
ATOM   5221 N N   . GLY B 1 134 ? 5.237   -77.671 -32.599 1.00 50.52  ? 135 GLY B N   1 
ATOM   5222 C CA  . GLY B 1 134 ? 4.110   -78.471 -32.168 1.00 49.07  ? 135 GLY B CA  1 
ATOM   5223 C C   . GLY B 1 134 ? 4.215   -79.989 -32.268 1.00 55.59  ? 135 GLY B C   1 
ATOM   5224 O O   . GLY B 1 134 ? 3.279   -80.685 -31.864 1.00 48.05  ? 135 GLY B O   1 
ATOM   5225 N N   . ARG B 1 135 ? 5.324   -80.512 -32.797 1.00 50.20  ? 136 ARG B N   1 
ATOM   5226 C CA  . ARG B 1 135 ? 5.406   -81.954 -33.082 1.00 54.69  ? 136 ARG B CA  1 
ATOM   5227 C C   . ARG B 1 135 ? 5.274   -82.855 -31.827 1.00 53.95  ? 136 ARG B C   1 
ATOM   5228 O O   . ARG B 1 135 ? 4.686   -83.940 -31.885 1.00 50.14  ? 136 ARG B O   1 
ATOM   5229 C CB  . ARG B 1 135 ? 6.677   -82.293 -33.882 1.00 41.57  ? 136 ARG B CB  1 
ATOM   5230 C CG  . ARG B 1 135 ? 7.966   -82.404 -33.049 1.00 52.61  ? 136 ARG B CG  1 
ATOM   5231 C CD  . ARG B 1 135 ? 9.181   -82.725 -33.915 1.00 56.66  ? 136 ARG B CD  1 
ATOM   5232 N NE  . ARG B 1 135 ? 9.674   -81.543 -34.631 1.00 55.42  ? 136 ARG B NE  1 
ATOM   5233 C CZ  . ARG B 1 135 ? 10.457  -81.584 -35.705 1.00 65.17  ? 136 ARG B CZ  1 
ATOM   5234 N NH1 . ARG B 1 135 ? 10.841  -82.752 -36.217 1.00 55.44  ? 136 ARG B NH1 1 
ATOM   5235 N NH2 . ARG B 1 135 ? 10.857  -80.457 -36.274 1.00 59.48  ? 136 ARG B NH2 1 
ATOM   5236 N N   . PHE B 1 136 ? 5.796   -82.400 -30.695 1.00 51.48  ? 137 PHE B N   1 
ATOM   5237 C CA  . PHE B 1 136 ? 5.776   -83.229 -29.484 1.00 53.06  ? 137 PHE B CA  1 
ATOM   5238 C C   . PHE B 1 136 ? 4.385   -83.382 -28.867 1.00 51.68  ? 137 PHE B C   1 
ATOM   5239 O O   . PHE B 1 136 ? 3.972   -84.502 -28.548 1.00 47.58  ? 137 PHE B O   1 
ATOM   5240 C CB  . PHE B 1 136 ? 6.822   -82.758 -28.487 1.00 45.53  ? 137 PHE B CB  1 
ATOM   5241 C CG  . PHE B 1 136 ? 8.175   -82.558 -29.104 1.00 51.86  ? 137 PHE B CG  1 
ATOM   5242 C CD1 . PHE B 1 136 ? 8.618   -81.283 -29.449 1.00 50.19  ? 137 PHE B CD1 1 
ATOM   5243 C CD2 . PHE B 1 136 ? 8.992   -83.650 -29.385 1.00 49.94  ? 137 PHE B CD2 1 
ATOM   5244 C CE1 . PHE B 1 136 ? 9.873   -81.092 -30.042 1.00 53.46  ? 137 PHE B CE1 1 
ATOM   5245 C CE2 . PHE B 1 136 ? 10.247  -83.475 -29.978 1.00 52.80  ? 137 PHE B CE2 1 
ATOM   5246 C CZ  . PHE B 1 136 ? 10.694  -82.194 -30.300 1.00 50.21  ? 137 PHE B CZ  1 
ATOM   5247 N N   . LEU B 1 137 ? 3.642   -82.284 -28.746 1.00 50.33  ? 138 LEU B N   1 
ATOM   5248 C CA  . LEU B 1 137 ? 2.262   -82.371 -28.251 1.00 56.99  ? 138 LEU B CA  1 
ATOM   5249 C C   . LEU B 1 137 ? 1.415   -83.301 -29.105 1.00 51.58  ? 138 LEU B C   1 
ATOM   5250 O O   . LEU B 1 137 ? 0.654   -84.116 -28.595 1.00 52.51  ? 138 LEU B O   1 
ATOM   5251 C CB  . LEU B 1 137 ? 1.594   -80.995 -28.236 1.00 51.98  ? 138 LEU B CB  1 
ATOM   5252 C CG  . LEU B 1 137 ? 1.624   -80.210 -26.938 1.00 54.31  ? 138 LEU B CG  1 
ATOM   5253 C CD1 . LEU B 1 137 ? 1.164   -78.771 -27.163 1.00 45.50  ? 138 LEU B CD1 1 
ATOM   5254 C CD2 . LEU B 1 137 ? 0.745   -80.903 -25.921 1.00 53.88  ? 138 LEU B CD2 1 
ATOM   5255 N N   . VAL B 1 138 ? 1.519   -83.150 -30.419 1.00 51.01  ? 139 VAL B N   1 
ATOM   5256 C CA  . VAL B 1 138 ? 0.717   -83.966 -31.323 1.00 50.87  ? 139 VAL B CA  1 
ATOM   5257 C C   . VAL B 1 138 ? 1.054   -85.456 -31.210 1.00 47.74  ? 139 VAL B C   1 
ATOM   5258 O O   . VAL B 1 138 ? 0.170   -86.303 -31.135 1.00 52.06  ? 139 VAL B O   1 
ATOM   5259 C CB  . VAL B 1 138 ? 0.844   -83.467 -32.773 1.00 53.44  ? 139 VAL B CB  1 
ATOM   5260 C CG1 . VAL B 1 138 ? 0.246   -84.473 -33.742 1.00 44.55  ? 139 VAL B CG1 1 
ATOM   5261 C CG2 . VAL B 1 138 ? 0.171   -82.105 -32.891 1.00 45.21  ? 139 VAL B CG2 1 
ATOM   5262 N N   . GLN B 1 139 ? 2.336   -85.769 -31.181 1.00 50.11  ? 140 GLN B N   1 
ATOM   5263 C CA  . GLN B 1 139 ? 2.756   -87.144 -31.036 1.00 54.35  ? 140 GLN B CA  1 
ATOM   5264 C C   . GLN B 1 139 ? 2.303   -87.714 -29.682 1.00 60.85  ? 140 GLN B C   1 
ATOM   5265 O O   . GLN B 1 139 ? 1.661   -88.769 -29.621 1.00 49.74  ? 140 GLN B O   1 
ATOM   5266 C CB  . GLN B 1 139 ? 4.274   -87.234 -31.180 1.00 54.20  ? 140 GLN B CB  1 
ATOM   5267 C CG  . GLN B 1 139 ? 4.748   -88.603 -31.650 1.00 70.00  ? 140 GLN B CG  1 
ATOM   5268 C CD  . GLN B 1 139 ? 4.677   -89.655 -30.564 1.00 77.55  ? 140 GLN B CD  1 
ATOM   5269 O OE1 . GLN B 1 139 ? 5.163   -89.443 -29.446 1.00 76.12  ? 140 GLN B OE1 1 
ATOM   5270 N NE2 . GLN B 1 139 ? 4.061   -90.797 -30.882 1.00 72.13  ? 140 GLN B NE2 1 
ATOM   5271 N N   . ALA B 1 140 ? 2.624   -87.002 -28.606 1.00 49.88  ? 141 ALA B N   1 
ATOM   5272 C CA  . ALA B 1 140 ? 2.295   -87.465 -27.249 1.00 58.88  ? 141 ALA B CA  1 
ATOM   5273 C C   . ALA B 1 140 ? 0.799   -87.580 -26.964 1.00 51.21  ? 141 ALA B C   1 
ATOM   5274 O O   . ALA B 1 140 ? 0.351   -88.558 -26.377 1.00 55.44  ? 141 ALA B O   1 
ATOM   5275 C CB  . ALA B 1 140 ? 2.950   -86.572 -26.202 1.00 50.94  ? 141 ALA B CB  1 
ATOM   5276 N N   . GLU B 1 141 ? 0.022   -86.585 -27.374 1.00 48.36  ? 142 GLU B N   1 
ATOM   5277 C CA  . GLU B 1 141 ? -1.366  -86.503 -26.925 1.00 50.02  ? 142 GLU B CA  1 
ATOM   5278 C C   . GLU B 1 141 ? -2.422  -86.703 -28.016 1.00 53.42  ? 142 GLU B C   1 
ATOM   5279 O O   . GLU B 1 141 ? -3.626  -86.731 -27.727 1.00 51.36  ? 142 GLU B O   1 
ATOM   5280 C CB  . GLU B 1 141 ? -1.594  -85.184 -26.166 1.00 48.72  ? 142 GLU B CB  1 
ATOM   5281 C CG  . GLU B 1 141 ? -0.853  -85.123 -24.812 1.00 47.61  ? 142 GLU B CG  1 
ATOM   5282 C CD  . GLU B 1 141 ? -1.293  -86.227 -23.844 1.00 53.96  ? 142 GLU B CD  1 
ATOM   5283 O OE1 . GLU B 1 141 ? -2.502  -86.568 -23.830 1.00 50.02  ? 142 GLU B OE1 1 
ATOM   5284 O OE2 . GLU B 1 141 ? -0.431  -86.752 -23.094 1.00 54.98  ? 142 GLU B OE2 1 
ATOM   5285 N N   . ARG B 1 142 ? -1.967  -86.826 -29.261 1.00 56.31  ? 143 ARG B N   1 
ATOM   5286 C CA  . ARG B 1 142 ? -2.840  -87.069 -30.413 1.00 51.01  ? 143 ARG B CA  1 
ATOM   5287 C C   . ARG B 1 142 ? -3.949  -86.039 -30.568 1.00 52.14  ? 143 ARG B C   1 
ATOM   5288 O O   . ARG B 1 142 ? -5.095  -86.395 -30.798 1.00 59.93  ? 143 ARG B O   1 
ATOM   5289 C CB  . ARG B 1 142 ? -3.478  -88.459 -30.337 1.00 57.33  ? 143 ARG B CB  1 
ATOM   5290 C CG  . ARG B 1 142 ? -2.513  -89.575 -30.040 1.00 65.92  ? 143 ARG B CG  1 
ATOM   5291 C CD  . ARG B 1 142 ? -1.433  -89.667 -31.088 1.00 74.95  ? 143 ARG B CD  1 
ATOM   5292 N NE  . ARG B 1 142 ? -0.586  -90.832 -30.854 1.00 88.92  ? 143 ARG B NE  1 
ATOM   5293 C CZ  . ARG B 1 142 ? 0.223   -91.363 -31.761 1.00 84.36  ? 143 ARG B CZ  1 
ATOM   5294 N NH1 . ARG B 1 142 ? 0.298   -90.831 -32.976 1.00 88.32  ? 143 ARG B NH1 1 
ATOM   5295 N NH2 . ARG B 1 142 ? 0.951   -92.429 -31.454 1.00 81.55  ? 143 ARG B NH2 1 
ATOM   5296 N N   . THR B 1 143 ? -3.618  -84.769 -30.419 1.00 47.32  ? 144 THR B N   1 
ATOM   5297 C CA  . THR B 1 143 ? -4.536  -83.704 -30.793 1.00 51.04  ? 144 THR B CA  1 
ATOM   5298 C C   . THR B 1 143 ? -4.070  -83.174 -32.144 1.00 47.21  ? 144 THR B C   1 
ATOM   5299 O O   . THR B 1 143 ? -3.014  -83.565 -32.632 1.00 47.32  ? 144 THR B O   1 
ATOM   5300 C CB  . THR B 1 143 ? -4.443  -82.565 -29.799 1.00 52.40  ? 144 THR B CB  1 
ATOM   5301 O OG1 . THR B 1 143 ? -3.069  -82.162 -29.712 1.00 55.09  ? 144 THR B OG1 1 
ATOM   5302 C CG2 . THR B 1 143 ? -4.915  -83.044 -28.406 1.00 52.22  ? 144 THR B CG2 1 
ATOM   5303 N N   . VAL B 1 144 ? -4.850  -82.283 -32.741 1.00 48.48  ? 145 VAL B N   1 
ATOM   5304 C CA  . VAL B 1 144 ? -4.351  -81.451 -33.828 1.00 47.28  ? 145 VAL B CA  1 
ATOM   5305 C C   . VAL B 1 144 ? -3.855  -80.153 -33.184 1.00 52.18  ? 145 VAL B C   1 
ATOM   5306 O O   . VAL B 1 144 ? -4.433  -79.680 -32.205 1.00 53.72  ? 145 VAL B O   1 
ATOM   5307 C CB  . VAL B 1 144 ? -5.453  -81.179 -34.869 1.00 46.29  ? 145 VAL B CB  1 
ATOM   5308 C CG1 . VAL B 1 144 ? -4.941  -80.297 -36.005 1.00 41.94  ? 145 VAL B CG1 1 
ATOM   5309 C CG2 . VAL B 1 144 ? -5.974  -82.495 -35.418 1.00 47.98  ? 145 VAL B CG2 1 
ATOM   5310 N N   . LEU B 1 145 ? -2.753  -79.610 -33.688 1.00 47.76  ? 146 LEU B N   1 
ATOM   5311 C CA  . LEU B 1 145 ? -2.233  -78.345 -33.189 1.00 38.93  ? 146 LEU B CA  1 
ATOM   5312 C C   . LEU B 1 145 ? -2.146  -77.363 -34.332 1.00 46.56  ? 146 LEU B C   1 
ATOM   5313 O O   . LEU B 1 145 ? -1.573  -77.686 -35.373 1.00 46.70  ? 146 LEU B O   1 
ATOM   5314 C CB  . LEU B 1 145 ? -0.846  -78.538 -32.604 1.00 43.45  ? 146 LEU B CB  1 
ATOM   5315 C CG  . LEU B 1 145 ? -0.252  -77.303 -31.936 1.00 61.50  ? 146 LEU B CG  1 
ATOM   5316 C CD1 . LEU B 1 145 ? -1.241  -76.734 -30.966 1.00 55.90  ? 146 LEU B CD1 1 
ATOM   5317 C CD2 . LEU B 1 145 ? 0.981   -77.690 -31.170 1.00 64.83  ? 146 LEU B CD2 1 
ATOM   5318 N N   . VAL B 1 146 ? -2.743  -76.188 -34.149 1.00 42.93  ? 147 VAL B N   1 
ATOM   5319 C CA  . VAL B 1 146 ? -2.649  -75.089 -35.115 1.00 40.42  ? 147 VAL B CA  1 
ATOM   5320 C C   . VAL B 1 146 ? -1.957  -73.872 -34.484 1.00 45.96  ? 147 VAL B C   1 
ATOM   5321 O O   . VAL B 1 146 ? -2.157  -73.575 -33.295 1.00 41.18  ? 147 VAL B O   1 
ATOM   5322 C CB  . VAL B 1 146 ? -4.058  -74.688 -35.612 1.00 51.12  ? 147 VAL B CB  1 
ATOM   5323 C CG1 . VAL B 1 146 ? -3.980  -73.612 -36.681 1.00 45.36  ? 147 VAL B CG1 1 
ATOM   5324 C CG2 . VAL B 1 146 ? -4.801  -75.914 -36.151 1.00 45.84  ? 147 VAL B CG2 1 
ATOM   5325 N N   . SER B 1 147 ? -1.123  -73.179 -35.254 1.00 43.82  ? 148 SER B N   1 
ATOM   5326 C CA  . SER B 1 147 ? -0.584  -71.882 -34.828 1.00 38.72  ? 148 SER B CA  1 
ATOM   5327 C C   . SER B 1 147 ? -0.562  -70.918 -35.999 1.00 46.16  ? 148 SER B C   1 
ATOM   5328 O O   . SER B 1 147 ? -0.373  -71.342 -37.138 1.00 45.78  ? 148 SER B O   1 
ATOM   5329 C CB  . SER B 1 147 ? 0.814   -72.014 -34.203 1.00 47.30  ? 148 SER B CB  1 
ATOM   5330 O OG  . SER B 1 147 ? 1.781   -72.480 -35.123 1.00 43.82  ? 148 SER B OG  1 
ATOM   5331 N N   . MET B 1 148 ? -0.776  -69.631 -35.726 1.00 44.30  ? 149 MET B N   1 
ATOM   5332 C CA  . MET B 1 148 ? -0.822  -68.634 -36.788 1.00 39.61  ? 149 MET B CA  1 
ATOM   5333 C C   . MET B 1 148 ? 0.132   -67.496 -36.521 1.00 47.24  ? 149 MET B C   1 
ATOM   5334 O O   . MET B 1 148 ? 0.466   -67.212 -35.366 1.00 41.03  ? 149 MET B O   1 
ATOM   5335 C CB  . MET B 1 148 ? -2.241  -68.074 -36.995 1.00 38.08  ? 149 MET B CB  1 
ATOM   5336 C CG  . MET B 1 148 ? -2.557  -66.818 -36.190 1.00 40.00  ? 149 MET B CG  1 
ATOM   5337 S SD  . MET B 1 148 ? -2.665  -67.186 -34.410 1.00 45.05  ? 149 MET B SD  1 
ATOM   5338 C CE  . MET B 1 148 ? -3.997  -68.362 -34.398 1.00 36.74  ? 149 MET B CE  1 
ATOM   5339 N N   . ASN B 1 149 ? 0.604   -66.873 -37.601 1.00 42.22  ? 150 ASN B N   1 
ATOM   5340 C CA  . ASN B 1 149 ? 1.259   -65.570 -37.487 1.00 39.92  ? 150 ASN B CA  1 
ATOM   5341 C C   . ASN B 1 149 ? 0.219   -64.447 -37.515 1.00 45.61  ? 150 ASN B C   1 
ATOM   5342 O O   . ASN B 1 149 ? -0.823  -64.562 -38.166 1.00 41.41  ? 150 ASN B O   1 
ATOM   5343 C CB  . ASN B 1 149 ? 2.285   -65.368 -38.611 1.00 46.82  ? 150 ASN B CB  1 
ATOM   5344 C CG  . ASN B 1 149 ? 3.635   -65.970 -38.283 1.00 42.69  ? 150 ASN B CG  1 
ATOM   5345 O OD1 . ASN B 1 149 ? 3.813   -66.585 -37.237 1.00 40.06  ? 150 ASN B OD1 1 
ATOM   5346 N ND2 . ASN B 1 149 ? 4.597   -65.793 -39.178 1.00 48.57  ? 150 ASN B ND2 1 
ATOM   5347 N N   . TYR B 1 150 ? 0.499   -63.361 -36.809 1.00 37.27  ? 151 TYR B N   1 
ATOM   5348 C CA  . TYR B 1 150 ? -0.385  -62.213 -36.825 1.00 37.93  ? 151 TYR B CA  1 
ATOM   5349 C C   . TYR B 1 150 ? 0.497   -60.976 -36.775 1.00 36.45  ? 151 TYR B C   1 
ATOM   5350 O O   . TYR B 1 150 ? 1.590   -61.010 -36.198 1.00 41.19  ? 151 TYR B O   1 
ATOM   5351 C CB  . TYR B 1 150 ? -1.402  -62.257 -35.645 1.00 38.96  ? 151 TYR B CB  1 
ATOM   5352 C CG  . TYR B 1 150 ? -0.798  -62.195 -34.235 1.00 37.70  ? 151 TYR B CG  1 
ATOM   5353 C CD1 . TYR B 1 150 ? -0.493  -63.353 -33.531 1.00 37.51  ? 151 TYR B CD1 1 
ATOM   5354 C CD2 . TYR B 1 150 ? -0.557  -60.972 -33.612 1.00 39.15  ? 151 TYR B CD2 1 
ATOM   5355 C CE1 . TYR B 1 150 ? 0.054   -63.299 -32.226 1.00 35.47  ? 151 TYR B CE1 1 
ATOM   5356 C CE2 . TYR B 1 150 ? -0.017  -60.900 -32.325 1.00 34.01  ? 151 TYR B CE2 1 
ATOM   5357 C CZ  . TYR B 1 150 ? 0.294   -62.063 -31.641 1.00 42.09  ? 151 TYR B CZ  1 
ATOM   5358 O OH  . TYR B 1 150 ? 0.833   -61.975 -30.364 1.00 39.75  ? 151 TYR B OH  1 
ATOM   5359 N N   . ARG B 1 151 ? 0.033   -59.895 -37.396 1.00 41.30  ? 152 ARG B N   1 
ATOM   5360 C CA  . ARG B 1 151 ? 0.808   -58.662 -37.450 1.00 37.30  ? 152 ARG B CA  1 
ATOM   5361 C C   . ARG B 1 151 ? 1.012   -58.069 -36.070 1.00 44.69  ? 152 ARG B C   1 
ATOM   5362 O O   . ARG B 1 151 ? 0.099   -58.067 -35.253 1.00 40.35  ? 152 ARG B O   1 
ATOM   5363 C CB  . ARG B 1 151 ? 0.132   -57.647 -38.370 1.00 35.70  ? 152 ARG B CB  1 
ATOM   5364 C CG  . ARG B 1 151 ? 0.311   -57.958 -39.889 1.00 34.92  ? 152 ARG B CG  1 
ATOM   5365 C CD  . ARG B 1 151 ? -0.572  -57.020 -40.719 1.00 37.33  ? 152 ARG B CD  1 
ATOM   5366 N NE  . ARG B 1 151 ? -1.985  -57.422 -40.752 1.00 41.17  ? 152 ARG B NE  1 
ATOM   5367 C CZ  . ARG B 1 151 ? -2.952  -56.709 -41.338 1.00 43.46  ? 152 ARG B CZ  1 
ATOM   5368 N NH1 . ARG B 1 151 ? -2.667  -55.540 -41.911 1.00 42.54  ? 152 ARG B NH1 1 
ATOM   5369 N NH2 . ARG B 1 151 ? -4.201  -57.155 -41.351 1.00 40.91  ? 152 ARG B NH2 1 
ATOM   5370 N N   . VAL B 1 152 ? 2.219   -57.559 -35.835 1.00 39.32  ? 153 VAL B N   1 
ATOM   5371 C CA  . VAL B 1 152 ? 2.569   -56.902 -34.596 1.00 37.33  ? 153 VAL B CA  1 
ATOM   5372 C C   . VAL B 1 152 ? 3.061   -55.479 -34.853 1.00 37.43  ? 153 VAL B C   1 
ATOM   5373 O O   . VAL B 1 152 ? 3.167   -55.038 -36.000 1.00 40.73  ? 153 VAL B O   1 
ATOM   5374 C CB  . VAL B 1 152 ? 3.679   -57.682 -33.884 1.00 38.77  ? 153 VAL B CB  1 
ATOM   5375 C CG1 . VAL B 1 152 ? 3.136   -59.018 -33.383 1.00 37.67  ? 153 VAL B CG1 1 
ATOM   5376 C CG2 . VAL B 1 152 ? 4.852   -57.908 -34.857 1.00 39.78  ? 153 VAL B CG2 1 
ATOM   5377 N N   . GLY B 1 153 ? 3.364   -54.767 -33.772 1.00 37.74  ? 154 GLY B N   1 
ATOM   5378 C CA  . GLY B 1 153 ? 3.830   -53.390 -33.836 1.00 34.49  ? 154 GLY B CA  1 
ATOM   5379 C C   . GLY B 1 153 ? 2.869   -52.446 -34.533 1.00 42.42  ? 154 GLY B C   1 
ATOM   5380 O O   . GLY B 1 153 ? 1.647   -52.665 -34.557 1.00 40.20  ? 154 GLY B O   1 
ATOM   5381 N N   . ALA B 1 154 ? 3.417   -51.393 -35.127 1.00 40.17  ? 155 ALA B N   1 
ATOM   5382 C CA  . ALA B 1 154 ? 2.587   -50.451 -35.855 1.00 46.49  ? 155 ALA B CA  1 
ATOM   5383 C C   . ALA B 1 154 ? 1.788   -51.153 -36.951 1.00 45.73  ? 155 ALA B C   1 
ATOM   5384 O O   . ALA B 1 154 ? 0.652   -50.773 -37.226 1.00 45.86  ? 155 ALA B O   1 
ATOM   5385 C CB  . ALA B 1 154 ? 3.438   -49.295 -36.434 1.00 43.61  ? 155 ALA B CB  1 
ATOM   5386 N N   . PHE B 1 155 ? 2.361   -52.196 -37.554 1.00 43.85  ? 156 PHE B N   1 
ATOM   5387 C CA  . PHE B 1 155 ? 1.692   -52.926 -38.649 1.00 42.05  ? 156 PHE B CA  1 
ATOM   5388 C C   . PHE B 1 155 ? 0.426   -53.639 -38.204 1.00 44.86  ? 156 PHE B C   1 
ATOM   5389 O O   . PHE B 1 155 ? -0.540  -53.758 -38.970 1.00 37.90  ? 156 PHE B O   1 
ATOM   5390 C CB  . PHE B 1 155 ? 2.666   -53.922 -39.305 1.00 41.28  ? 156 PHE B CB  1 
ATOM   5391 C CG  . PHE B 1 155 ? 3.980   -53.298 -39.641 1.00 43.00  ? 156 PHE B CG  1 
ATOM   5392 C CD1 . PHE B 1 155 ? 5.003   -53.273 -38.706 1.00 41.73  ? 156 PHE B CD1 1 
ATOM   5393 C CD2 . PHE B 1 155 ? 4.160   -52.648 -40.855 1.00 40.65  ? 156 PHE B CD2 1 
ATOM   5394 C CE1 . PHE B 1 155 ? 6.204   -52.654 -38.983 1.00 48.88  ? 156 PHE B CE1 1 
ATOM   5395 C CE2 . PHE B 1 155 ? 5.357   -52.026 -41.141 1.00 47.77  ? 156 PHE B CE2 1 
ATOM   5396 C CZ  . PHE B 1 155 ? 6.382   -52.024 -40.202 1.00 48.77  ? 156 PHE B CZ  1 
ATOM   5397 N N   . GLY B 1 156 ? 0.423   -54.118 -36.966 1.00 38.46  ? 157 GLY B N   1 
ATOM   5398 C CA  . GLY B 1 156 ? -0.758  -54.783 -36.458 1.00 41.73  ? 157 GLY B CA  1 
ATOM   5399 C C   . GLY B 1 156 ? -1.678  -53.919 -35.607 1.00 44.17  ? 157 GLY B C   1 
ATOM   5400 O O   . GLY B 1 156 ? -2.876  -54.215 -35.500 1.00 43.22  ? 157 GLY B O   1 
ATOM   5401 N N   . PHE B 1 157 ? -1.136  -52.855 -35.012 1.00 38.85  ? 158 PHE B N   1 
ATOM   5402 C CA  . PHE B 1 157 ? -1.851  -52.164 -33.933 1.00 44.85  ? 158 PHE B CA  1 
ATOM   5403 C C   . PHE B 1 157 ? -1.778  -50.637 -33.916 1.00 49.23  ? 158 PHE B C   1 
ATOM   5404 O O   . PHE B 1 157 ? -2.265  -50.005 -32.966 1.00 47.61  ? 158 PHE B O   1 
ATOM   5405 C CB  . PHE B 1 157 ? -1.452  -52.752 -32.555 1.00 41.24  ? 158 PHE B CB  1 
ATOM   5406 C CG  . PHE B 1 157 ? -1.834  -54.193 -32.414 1.00 43.45  ? 158 PHE B CG  1 
ATOM   5407 C CD1 . PHE B 1 157 ? -0.898  -55.189 -32.630 1.00 36.94  ? 158 PHE B CD1 1 
ATOM   5408 C CD2 . PHE B 1 157 ? -3.160  -54.552 -32.155 1.00 41.65  ? 158 PHE B CD2 1 
ATOM   5409 C CE1 . PHE B 1 157 ? -1.261  -56.537 -32.552 1.00 44.03  ? 158 PHE B CE1 1 
ATOM   5410 C CE2 . PHE B 1 157 ? -3.535  -55.884 -32.093 1.00 41.56  ? 158 PHE B CE2 1 
ATOM   5411 C CZ  . PHE B 1 157 ? -2.576  -56.884 -32.286 1.00 38.90  ? 158 PHE B CZ  1 
ATOM   5412 N N   . LEU B 1 158 ? -1.183  -50.034 -34.941 1.00 44.31  ? 159 LEU B N   1 
ATOM   5413 C CA  . LEU B 1 158 ? -1.274  -48.579 -35.043 1.00 42.98  ? 159 LEU B CA  1 
ATOM   5414 C C   . LEU B 1 158 ? -2.734  -48.255 -35.326 1.00 47.41  ? 159 LEU B C   1 
ATOM   5415 O O   . LEU B 1 158 ? -3.366  -48.913 -36.148 1.00 47.72  ? 159 LEU B O   1 
ATOM   5416 C CB  . LEU B 1 158 ? -0.330  -47.992 -36.102 1.00 47.09  ? 159 LEU B CB  1 
ATOM   5417 C CG  . LEU B 1 158 ? -0.364  -46.468 -36.331 1.00 51.28  ? 159 LEU B CG  1 
ATOM   5418 C CD1 . LEU B 1 158 ? 0.969   -45.954 -36.846 1.00 45.62  ? 159 LEU B CD1 1 
ATOM   5419 C CD2 . LEU B 1 158 ? -1.467  -46.076 -37.316 1.00 44.47  ? 159 LEU B CD2 1 
ATOM   5420 N N   . ALA B 1 159 ? -3.261  -47.251 -34.628 1.00 43.18  ? 160 ALA B N   1 
ATOM   5421 C CA  . ALA B 1 159 ? -4.673  -46.889 -34.724 1.00 48.81  ? 160 ALA B CA  1 
ATOM   5422 C C   . ALA B 1 159 ? -4.880  -45.375 -34.790 1.00 47.89  ? 160 ALA B C   1 
ATOM   5423 O O   . ALA B 1 159 ? -4.380  -44.626 -33.945 1.00 44.00  ? 160 ALA B O   1 
ATOM   5424 C CB  . ALA B 1 159 ? -5.455  -47.454 -33.508 1.00 42.69  ? 160 ALA B CB  1 
ATOM   5425 N N   . LEU B 1 160 ? -5.634  -44.933 -35.788 1.00 46.15  ? 161 LEU B N   1 
ATOM   5426 C CA  . LEU B 1 160 ? -6.169  -43.579 -35.779 1.00 52.77  ? 161 LEU B CA  1 
ATOM   5427 C C   . LEU B 1 160 ? -7.681  -43.772 -35.675 1.00 47.09  ? 161 LEU B C   1 
ATOM   5428 O O   . LEU B 1 160 ? -8.368  -43.911 -36.685 1.00 48.34  ? 161 LEU B O   1 
ATOM   5429 C CB  . LEU B 1 160 ? -5.750  -42.804 -37.043 1.00 49.50  ? 161 LEU B CB  1 
ATOM   5430 C CG  . LEU B 1 160 ? -4.239  -42.513 -37.182 1.00 48.62  ? 161 LEU B CG  1 
ATOM   5431 C CD1 . LEU B 1 160 ? -3.853  -42.138 -38.598 1.00 54.35  ? 161 LEU B CD1 1 
ATOM   5432 C CD2 . LEU B 1 160 ? -3.773  -41.403 -36.242 1.00 38.34  ? 161 LEU B CD2 1 
ATOM   5433 N N   . PRO B 1 161 ? -8.197  -43.834 -34.436 1.00 47.00  ? 162 PRO B N   1 
ATOM   5434 C CA  . PRO B 1 161 ? -9.584  -44.280 -34.236 1.00 49.26  ? 162 PRO B CA  1 
ATOM   5435 C C   . PRO B 1 161 ? -10.615 -43.429 -35.005 1.00 51.67  ? 162 PRO B C   1 
ATOM   5436 O O   . PRO B 1 161 ? -10.492 -42.200 -35.086 1.00 46.45  ? 162 PRO B O   1 
ATOM   5437 C CB  . PRO B 1 161 ? -9.768  -44.192 -32.711 1.00 51.49  ? 162 PRO B CB  1 
ATOM   5438 C CG  . PRO B 1 161 ? -8.367  -44.353 -32.159 1.00 47.32  ? 162 PRO B CG  1 
ATOM   5439 C CD  . PRO B 1 161 ? -7.496  -43.608 -33.158 1.00 44.07  ? 162 PRO B CD  1 
ATOM   5440 N N   . GLY B 1 162 ? -11.594 -44.100 -35.606 1.00 43.95  ? 163 GLY B N   1 
ATOM   5441 C CA  . GLY B 1 162 ? -12.552 -43.439 -36.472 1.00 53.46  ? 163 GLY B CA  1 
ATOM   5442 C C   . GLY B 1 162 ? -12.248 -43.601 -37.956 1.00 55.91  ? 163 GLY B C   1 
ATOM   5443 O O   . GLY B 1 162 ? -13.166 -43.725 -38.765 1.00 63.44  ? 163 GLY B O   1 
ATOM   5444 N N   . SER B 1 163 ? -10.969 -43.610 -38.323 1.00 48.57  ? 164 SER B N   1 
ATOM   5445 C CA  . SER B 1 163 ? -10.582 -43.688 -39.742 1.00 51.28  ? 164 SER B CA  1 
ATOM   5446 C C   . SER B 1 163 ? -10.751 -45.081 -40.329 1.00 50.41  ? 164 SER B C   1 
ATOM   5447 O O   . SER B 1 163 ? -10.570 -46.079 -39.642 1.00 53.41  ? 164 SER B O   1 
ATOM   5448 C CB  . SER B 1 163 ? -9.125  -43.296 -39.913 1.00 49.65  ? 164 SER B CB  1 
ATOM   5449 O OG  . SER B 1 163 ? -8.297  -44.357 -39.478 1.00 60.29  ? 164 SER B OG  1 
ATOM   5450 N N   . ARG B 1 164 ? -11.054 -45.157 -41.620 1.00 60.19  ? 165 ARG B N   1 
ATOM   5451 C CA  . ARG B 1 164 ? -11.156 -46.455 -42.286 1.00 60.08  ? 165 ARG B CA  1 
ATOM   5452 C C   . ARG B 1 164 ? -9.787  -46.983 -42.696 1.00 50.61  ? 165 ARG B C   1 
ATOM   5453 O O   . ARG B 1 164 ? -9.626  -48.181 -42.932 1.00 53.02  ? 165 ARG B O   1 
ATOM   5454 C CB  . ARG B 1 164 ? -12.061 -46.385 -43.528 1.00 75.37  ? 165 ARG B CB  1 
ATOM   5455 C CG  . ARG B 1 164 ? -13.499 -45.949 -43.254 1.00 88.49  ? 165 ARG B CG  1 
ATOM   5456 C CD  . ARG B 1 164 ? -14.135 -46.700 -42.084 1.00 88.36  ? 165 ARG B CD  1 
ATOM   5457 N NE  . ARG B 1 164 ? -14.279 -48.133 -42.331 1.00 97.70  ? 165 ARG B NE  1 
ATOM   5458 C CZ  . ARG B 1 164 ? -15.237 -48.670 -43.080 1.00 100.62 ? 165 ARG B CZ  1 
ATOM   5459 N NH1 . ARG B 1 164 ? -16.135 -47.892 -43.675 1.00 89.97  ? 165 ARG B NH1 1 
ATOM   5460 N NH2 . ARG B 1 164 ? -15.291 -49.987 -43.243 1.00 100.62 ? 165 ARG B NH2 1 
ATOM   5461 N N   . GLU B 1 165 ? -8.811  -46.086 -42.772 1.00 46.75  ? 166 GLU B N   1 
ATOM   5462 C CA  . GLU B 1 165 ? -7.490  -46.408 -43.323 1.00 52.65  ? 166 GLU B CA  1 
ATOM   5463 C C   . GLU B 1 165 ? -6.501  -46.942 -42.270 1.00 60.45  ? 166 GLU B C   1 
ATOM   5464 O O   . GLU B 1 165 ? -5.497  -47.564 -42.599 1.00 48.96  ? 166 GLU B O   1 
ATOM   5465 C CB  . GLU B 1 165 ? -6.913  -45.188 -44.048 1.00 55.20  ? 166 GLU B CB  1 
ATOM   5466 C CG  . GLU B 1 165 ? -7.845  -44.633 -45.150 1.00 55.74  ? 166 GLU B CG  1 
ATOM   5467 C CD  . GLU B 1 165 ? -8.056  -45.624 -46.315 1.00 73.62  ? 166 GLU B CD  1 
ATOM   5468 O OE1 . GLU B 1 165 ? -7.156  -46.458 -46.592 1.00 66.28  ? 166 GLU B OE1 1 
ATOM   5469 O OE2 . GLU B 1 165 ? -9.129  -45.574 -46.960 1.00 86.94  ? 166 GLU B OE2 1 
ATOM   5470 N N   . ALA B 1 166 ? -6.788  -46.719 -40.998 1.00 46.50  ? 167 ALA B N   1 
ATOM   5471 C CA  . ALA B 1 166 ? -5.969  -47.322 -39.956 1.00 51.35  ? 167 ALA B CA  1 
ATOM   5472 C C   . ALA B 1 166 ? -6.801  -47.433 -38.689 1.00 46.43  ? 167 ALA B C   1 
ATOM   5473 O O   . ALA B 1 166 ? -6.575  -46.690 -37.747 1.00 45.69  ? 167 ALA B O   1 
ATOM   5474 C CB  . ALA B 1 166 ? -4.707  -46.490 -39.717 1.00 47.19  ? 167 ALA B CB  1 
ATOM   5475 N N   . PRO B 1 167 ? -7.780  -48.357 -38.690 1.00 51.18  ? 168 PRO B N   1 
ATOM   5476 C CA  . PRO B 1 167 ? -8.795  -48.469 -37.636 1.00 51.08  ? 168 PRO B CA  1 
ATOM   5477 C C   . PRO B 1 167 ? -8.253  -49.056 -36.334 1.00 50.34  ? 168 PRO B C   1 
ATOM   5478 O O   . PRO B 1 167 ? -8.885  -48.877 -35.289 1.00 55.15  ? 168 PRO B O   1 
ATOM   5479 C CB  . PRO B 1 167 ? -9.842  -49.402 -38.257 1.00 46.21  ? 168 PRO B CB  1 
ATOM   5480 C CG  . PRO B 1 167 ? -9.060  -50.246 -39.234 1.00 48.46  ? 168 PRO B CG  1 
ATOM   5481 C CD  . PRO B 1 167 ? -8.023  -49.307 -39.793 1.00 48.99  ? 168 PRO B CD  1 
ATOM   5482 N N   . GLY B 1 168 ? -7.103  -49.721 -36.401 1.00 45.81  ? 169 GLY B N   1 
ATOM   5483 C CA  . GLY B 1 168 ? -6.484  -50.352 -35.244 1.00 44.91  ? 169 GLY B CA  1 
ATOM   5484 C C   . GLY B 1 168 ? -6.935  -51.791 -35.106 1.00 48.09  ? 169 GLY B C   1 
ATOM   5485 O O   . GLY B 1 168 ? -7.783  -52.243 -35.872 1.00 44.87  ? 169 GLY B O   1 
ATOM   5486 N N   . ASN B 1 169 ? -6.365  -52.510 -34.136 1.00 42.52  ? 170 ASN B N   1 
ATOM   5487 C CA  . ASN B 1 169 ? -6.709  -53.911 -33.906 1.00 48.47  ? 170 ASN B CA  1 
ATOM   5488 C C   . ASN B 1 169 ? -6.606  -54.905 -35.094 1.00 44.62  ? 170 ASN B C   1 
ATOM   5489 O O   . ASN B 1 169 ? -7.159  -56.010 -35.016 1.00 43.04  ? 170 ASN B O   1 
ATOM   5490 C CB  . ASN B 1 169 ? -8.110  -54.004 -33.283 1.00 44.61  ? 170 ASN B CB  1 
ATOM   5491 C CG  . ASN B 1 169 ? -8.180  -53.337 -31.923 1.00 50.63  ? 170 ASN B CG  1 
ATOM   5492 O OD1 . ASN B 1 169 ? -7.154  -53.115 -31.278 1.00 45.10  ? 170 ASN B OD1 1 
ATOM   5493 N ND2 . ASN B 1 169 ? -9.386  -53.010 -31.483 1.00 46.80  ? 170 ASN B ND2 1 
ATOM   5494 N N   . VAL B 1 170 ? -5.905  -54.558 -36.173 1.00 41.02  ? 171 VAL B N   1 
ATOM   5495 C CA  . VAL B 1 170 ? -5.877  -55.501 -37.308 1.00 37.01  ? 171 VAL B CA  1 
ATOM   5496 C C   . VAL B 1 170 ? -5.118  -56.805 -37.003 1.00 41.34  ? 171 VAL B C   1 
ATOM   5497 O O   . VAL B 1 170 ? -5.411  -57.851 -37.587 1.00 41.79  ? 171 VAL B O   1 
ATOM   5498 C CB  . VAL B 1 170 ? -5.485  -54.836 -38.664 1.00 41.00  ? 171 VAL B CB  1 
ATOM   5499 C CG1 . VAL B 1 170 ? -6.437  -53.663 -38.943 1.00 42.34  ? 171 VAL B CG1 1 
ATOM   5500 C CG2 . VAL B 1 170 ? -4.005  -54.385 -38.675 1.00 37.25  ? 171 VAL B CG2 1 
ATOM   5501 N N   . GLY B 1 171 ? -4.201  -56.760 -36.039 1.00 40.60  ? 172 GLY B N   1 
ATOM   5502 C CA  . GLY B 1 171 ? -3.559  -57.979 -35.558 1.00 40.85  ? 172 GLY B CA  1 
ATOM   5503 C C   . GLY B 1 171 ? -4.509  -58.984 -34.912 1.00 47.93  ? 172 GLY B C   1 
ATOM   5504 O O   . GLY B 1 171 ? -4.357  -60.212 -35.077 1.00 42.96  ? 172 GLY B O   1 
ATOM   5505 N N   . LEU B 1 172 ? -5.500  -58.479 -34.178 1.00 42.84  ? 173 LEU B N   1 
ATOM   5506 C CA  . LEU B 1 172 ? -6.501  -59.362 -33.576 1.00 46.46  ? 173 LEU B CA  1 
ATOM   5507 C C   . LEU B 1 172 ? -7.412  -59.925 -34.670 1.00 41.31  ? 173 LEU B C   1 
ATOM   5508 O O   . LEU B 1 172 ? -7.829  -61.085 -34.608 1.00 44.52  ? 173 LEU B O   1 
ATOM   5509 C CB  . LEU B 1 172 ? -7.325  -58.647 -32.477 1.00 40.55  ? 173 LEU B CB  1 
ATOM   5510 C CG  . LEU B 1 172 ? -6.618  -58.259 -31.170 1.00 48.28  ? 173 LEU B CG  1 
ATOM   5511 C CD1 . LEU B 1 172 ? -7.435  -57.222 -30.332 1.00 36.16  ? 173 LEU B CD1 1 
ATOM   5512 C CD2 . LEU B 1 172 ? -6.310  -59.510 -30.341 1.00 44.65  ? 173 LEU B CD2 1 
ATOM   5513 N N   . LEU B 1 173 ? -7.709  -59.103 -35.677 1.00 38.44  ? 174 LEU B N   1 
ATOM   5514 C CA  . LEU B 1 173 ? -8.447  -59.577 -36.853 1.00 43.00  ? 174 LEU B CA  1 
ATOM   5515 C C   . LEU B 1 173 ? -7.673  -60.657 -37.639 1.00 44.40  ? 174 LEU B C   1 
ATOM   5516 O O   . LEU B 1 173 ? -8.283  -61.599 -38.162 1.00 38.95  ? 174 LEU B O   1 
ATOM   5517 C CB  . LEU B 1 173 ? -8.859  -58.416 -37.764 1.00 44.15  ? 174 LEU B CB  1 
ATOM   5518 C CG  . LEU B 1 173 ? -9.892  -57.462 -37.146 1.00 52.41  ? 174 LEU B CG  1 
ATOM   5519 C CD1 . LEU B 1 173 ? -10.331 -56.381 -38.137 1.00 35.98  ? 174 LEU B CD1 1 
ATOM   5520 C CD2 . LEU B 1 173 ? -11.114 -58.219 -36.578 1.00 42.69  ? 174 LEU B CD2 1 
ATOM   5521 N N   . ASP B 1 174 ? -6.341  -60.546 -37.686 1.00 36.78  ? 175 ASP B N   1 
ATOM   5522 C CA  . ASP B 1 174 ? -5.510  -61.614 -38.282 1.00 42.28  ? 175 ASP B CA  1 
ATOM   5523 C C   . ASP B 1 174 ? -5.748  -62.915 -37.536 1.00 43.61  ? 175 ASP B C   1 
ATOM   5524 O O   . ASP B 1 174 ? -5.972  -63.973 -38.137 1.00 42.77  ? 175 ASP B O   1 
ATOM   5525 C CB  . ASP B 1 174 ? -4.009  -61.272 -38.236 1.00 37.01  ? 175 ASP B CB  1 
ATOM   5526 C CG  . ASP B 1 174 ? -3.648  -60.093 -39.117 1.00 45.50  ? 175 ASP B CG  1 
ATOM   5527 O OD1 . ASP B 1 174 ? -4.449  -59.798 -40.034 1.00 44.64  ? 175 ASP B OD1 1 
ATOM   5528 O OD2 . ASP B 1 174 ? -2.573  -59.471 -38.892 1.00 45.56  ? 175 ASP B OD2 1 
ATOM   5529 N N   . GLN B 1 175 ? -5.721  -62.821 -36.205 1.00 42.98  ? 176 GLN B N   1 
ATOM   5530 C CA  . GLN B 1 175 ? -5.960  -63.976 -35.367 1.00 39.02  ? 176 GLN B CA  1 
ATOM   5531 C C   . GLN B 1 175 ? -7.350  -64.563 -35.594 1.00 38.72  ? 176 GLN B C   1 
ATOM   5532 O O   . GLN B 1 175 ? -7.494  -65.781 -35.726 1.00 43.65  ? 176 GLN B O   1 
ATOM   5533 C CB  . GLN B 1 175 ? -5.792  -63.609 -33.880 1.00 41.35  ? 176 GLN B CB  1 
ATOM   5534 C CG  . GLN B 1 175 ? -4.379  -63.229 -33.459 1.00 34.92  ? 176 GLN B CG  1 
ATOM   5535 C CD  . GLN B 1 175 ? -4.358  -62.792 -32.012 1.00 43.14  ? 176 GLN B CD  1 
ATOM   5536 O OE1 . GLN B 1 175 ? -5.338  -63.022 -31.307 1.00 36.93  ? 176 GLN B OE1 1 
ATOM   5537 N NE2 . GLN B 1 175 ? -3.255  -62.168 -31.558 1.00 36.59  ? 176 GLN B NE2 1 
ATOM   5538 N N   . ARG B 1 176 ? -8.364  -63.698 -35.634 1.00 37.43  ? 177 ARG B N   1 
ATOM   5539 C CA  . ARG B 1 176 ? -9.744  -64.137 -35.854 1.00 38.42  ? 177 ARG B CA  1 
ATOM   5540 C C   . ARG B 1 176 ? -9.944  -64.807 -37.211 1.00 40.63  ? 177 ARG B C   1 
ATOM   5541 O O   . ARG B 1 176 ? -10.626 -65.846 -37.310 1.00 44.44  ? 177 ARG B O   1 
ATOM   5542 C CB  . ARG B 1 176 ? -10.733 -62.973 -35.723 1.00 43.91  ? 177 ARG B CB  1 
ATOM   5543 C CG  . ARG B 1 176 ? -12.176 -63.369 -36.110 1.00 53.89  ? 177 ARG B CG  1 
ATOM   5544 C CD  . ARG B 1 176 ? -13.151 -62.208 -35.939 1.00 53.89  ? 177 ARG B CD  1 
ATOM   5545 N NE  . ARG B 1 176 ? -13.313 -61.820 -34.535 1.00 51.72  ? 177 ARG B NE  1 
ATOM   5546 C CZ  . ARG B 1 176 ? -13.872 -60.676 -34.142 1.00 53.72  ? 177 ARG B CZ  1 
ATOM   5547 N NH1 . ARG B 1 176 ? -14.305 -59.810 -35.045 1.00 51.68  ? 177 ARG B NH1 1 
ATOM   5548 N NH2 . ARG B 1 176 ? -13.996 -60.394 -32.850 1.00 51.50  ? 177 ARG B NH2 1 
ATOM   5549 N N   . LEU B 1 177 ? -9.362  -64.217 -38.260 1.00 39.66  ? 178 LEU B N   1 
ATOM   5550 C CA  . LEU B 1 177 ? -9.443  -64.831 -39.601 1.00 37.65  ? 178 LEU B CA  1 
ATOM   5551 C C   . LEU B 1 177 ? -8.894  -66.273 -39.575 1.00 42.53  ? 178 LEU B C   1 
ATOM   5552 O O   . LEU B 1 177 ? -9.493  -67.190 -40.148 1.00 42.04  ? 178 LEU B O   1 
ATOM   5553 C CB  . LEU B 1 177 ? -8.718  -63.962 -40.643 1.00 38.79  ? 178 LEU B CB  1 
ATOM   5554 C CG  . LEU B 1 177 ? -8.714  -64.465 -42.098 1.00 46.80  ? 178 LEU B CG  1 
ATOM   5555 C CD1 . LEU B 1 177 ? -10.139 -64.684 -42.600 1.00 45.76  ? 178 LEU B CD1 1 
ATOM   5556 C CD2 . LEU B 1 177 ? -7.963  -63.505 -43.010 1.00 38.94  ? 178 LEU B CD2 1 
ATOM   5557 N N   . ALA B 1 178 ? -7.780  -66.479 -38.867 1.00 43.28  ? 179 ALA B N   1 
ATOM   5558 C CA  . ALA B 1 178 ? -7.195  -67.818 -38.756 1.00 41.62  ? 179 ALA B CA  1 
ATOM   5559 C C   . ALA B 1 178 ? -8.125  -68.789 -38.039 1.00 44.82  ? 179 ALA B C   1 
ATOM   5560 O O   . ALA B 1 178 ? -8.191  -69.978 -38.400 1.00 42.61  ? 179 ALA B O   1 
ATOM   5561 C CB  . ALA B 1 178 ? -5.833  -67.769 -38.050 1.00 39.37  ? 179 ALA B CB  1 
ATOM   5562 N N   . LEU B 1 179 ? -8.823  -68.292 -37.015 1.00 44.27  ? 180 LEU B N   1 
ATOM   5563 C CA  . LEU B 1 179 ? -9.771  -69.119 -36.254 1.00 43.99  ? 180 LEU B CA  1 
ATOM   5564 C C   . LEU B 1 179 ? -10.967 -69.484 -37.123 1.00 45.43  ? 180 LEU B C   1 
ATOM   5565 O O   . LEU B 1 179 ? -11.457 -70.604 -37.065 1.00 42.98  ? 180 LEU B O   1 
ATOM   5566 C CB  . LEU B 1 179 ? -10.248 -68.402 -34.976 1.00 44.89  ? 180 LEU B CB  1 
ATOM   5567 C CG  . LEU B 1 179 ? -9.183  -68.099 -33.918 1.00 43.12  ? 180 LEU B CG  1 
ATOM   5568 C CD1 . LEU B 1 179 ? -9.776  -67.342 -32.737 1.00 49.12  ? 180 LEU B CD1 1 
ATOM   5569 C CD2 . LEU B 1 179 ? -8.504  -69.385 -33.443 1.00 46.41  ? 180 LEU B CD2 1 
ATOM   5570 N N   . GLN B 1 180 ? -11.438 -68.534 -37.931 1.00 43.16  ? 181 GLN B N   1 
ATOM   5571 C CA  . GLN B 1 180 ? -12.438 -68.837 -38.977 1.00 51.61  ? 181 GLN B CA  1 
ATOM   5572 C C   . GLN B 1 180 ? -11.936 -69.879 -39.988 1.00 50.70  ? 181 GLN B C   1 
ATOM   5573 O O   . GLN B 1 180 ? -12.698 -70.743 -40.446 1.00 52.72  ? 181 GLN B O   1 
ATOM   5574 C CB  . GLN B 1 180 ? -12.861 -67.555 -39.711 1.00 48.28  ? 181 GLN B CB  1 
ATOM   5575 C CG  . GLN B 1 180 ? -13.457 -66.512 -38.760 1.00 51.88  ? 181 GLN B CG  1 
ATOM   5576 C CD  . GLN B 1 180 ? -13.785 -65.192 -39.440 1.00 61.53  ? 181 GLN B CD  1 
ATOM   5577 O OE1 . GLN B 1 180 ? -13.174 -64.832 -40.442 1.00 53.91  ? 181 GLN B OE1 1 
ATOM   5578 N NE2 . GLN B 1 180 ? -14.753 -64.466 -38.892 1.00 53.89  ? 181 GLN B NE2 1 
ATOM   5579 N N   . TRP B 1 181 ? -10.655 -69.794 -40.327 1.00 47.60  ? 182 TRP B N   1 
ATOM   5580 C CA  . TRP B 1 181 ? -10.015 -70.791 -41.189 1.00 47.48  ? 182 TRP B CA  1 
ATOM   5581 C C   . TRP B 1 181 ? -10.043 -72.182 -40.535 1.00 51.82  ? 182 TRP B C   1 
ATOM   5582 O O   . TRP B 1 181 ? -10.282 -73.186 -41.203 1.00 46.19  ? 182 TRP B O   1 
ATOM   5583 C CB  . TRP B 1 181 ? -8.567  -70.374 -41.496 1.00 47.04  ? 182 TRP B CB  1 
ATOM   5584 C CG  . TRP B 1 181 ? -7.906  -71.211 -42.575 1.00 44.94  ? 182 TRP B CG  1 
ATOM   5585 C CD1 . TRP B 1 181 ? -7.824  -70.920 -43.914 1.00 51.06  ? 182 TRP B CD1 1 
ATOM   5586 C CD2 . TRP B 1 181 ? -7.241  -72.465 -42.397 1.00 41.69  ? 182 TRP B CD2 1 
ATOM   5587 N NE1 . TRP B 1 181 ? -7.145  -71.920 -44.575 1.00 47.11  ? 182 TRP B NE1 1 
ATOM   5588 C CE2 . TRP B 1 181 ? -6.784  -72.883 -43.669 1.00 49.13  ? 182 TRP B CE2 1 
ATOM   5589 C CE3 . TRP B 1 181 ? -6.978  -73.275 -41.284 1.00 45.37  ? 182 TRP B CE3 1 
ATOM   5590 C CZ2 . TRP B 1 181 ? -6.091  -74.077 -43.859 1.00 42.32  ? 182 TRP B CZ2 1 
ATOM   5591 C CZ3 . TRP B 1 181 ? -6.293  -74.466 -41.480 1.00 43.75  ? 182 TRP B CZ3 1 
ATOM   5592 C CH2 . TRP B 1 181 ? -5.857  -74.853 -42.761 1.00 44.86  ? 182 TRP B CH2 1 
ATOM   5593 N N   . VAL B 1 182 ? -9.787  -72.239 -39.227 1.00 45.89  ? 183 VAL B N   1 
ATOM   5594 C CA  . VAL B 1 182 ? -9.806  -73.520 -38.505 1.00 44.69  ? 183 VAL B CA  1 
ATOM   5595 C C   . VAL B 1 182 ? -11.213 -74.122 -38.510 1.00 46.32  ? 183 VAL B C   1 
ATOM   5596 O O   . VAL B 1 182 ? -11.389 -75.316 -38.749 1.00 46.99  ? 183 VAL B O   1 
ATOM   5597 C CB  . VAL B 1 182 ? -9.272  -73.371 -37.048 1.00 44.81  ? 183 VAL B CB  1 
ATOM   5598 C CG1 . VAL B 1 182 ? -9.680  -74.553 -36.180 1.00 39.93  ? 183 VAL B CG1 1 
ATOM   5599 C CG2 . VAL B 1 182 ? -7.747  -73.217 -37.065 1.00 43.94  ? 183 VAL B CG2 1 
ATOM   5600 N N   . GLN B 1 183 ? -12.217 -73.290 -38.265 1.00 44.75  ? 184 GLN B N   1 
ATOM   5601 C CA  . GLN B 1 183 ? -13.601 -73.753 -38.382 1.00 56.26  ? 184 GLN B CA  1 
ATOM   5602 C C   . GLN B 1 183 ? -13.893 -74.329 -39.776 1.00 48.01  ? 184 GLN B C   1 
ATOM   5603 O O   . GLN B 1 183 ? -14.437 -75.424 -39.905 1.00 54.05  ? 184 GLN B O   1 
ATOM   5604 C CB  . GLN B 1 183 ? -14.591 -72.629 -38.037 1.00 49.79  ? 184 GLN B CB  1 
ATOM   5605 C CG  . GLN B 1 183 ? -14.739 -72.368 -36.540 1.00 53.17  ? 184 GLN B CG  1 
ATOM   5606 C CD  . GLN B 1 183 ? -15.270 -73.578 -35.809 1.00 55.28  ? 184 GLN B CD  1 
ATOM   5607 O OE1 . GLN B 1 183 ? -16.396 -74.014 -36.055 1.00 57.74  ? 184 GLN B OE1 1 
ATOM   5608 N NE2 . GLN B 1 183 ? -14.450 -74.151 -34.928 1.00 48.73  ? 184 GLN B NE2 1 
ATOM   5609 N N   . GLU B 1 184 ? -13.512 -73.609 -40.823 1.00 53.57  ? 185 GLU B N   1 
ATOM   5610 C CA  . GLU B 1 184 ? -13.843 -74.065 -42.178 1.00 48.77  ? 185 GLU B CA  1 
ATOM   5611 C C   . GLU B 1 184 ? -13.031 -75.260 -42.694 1.00 52.26  ? 185 GLU B C   1 
ATOM   5612 O O   . GLU B 1 184 ? -13.522 -76.022 -43.519 1.00 52.64  ? 185 GLU B O   1 
ATOM   5613 C CB  . GLU B 1 184 ? -13.750 -72.906 -43.159 1.00 51.01  ? 185 GLU B CB  1 
ATOM   5614 C CG  . GLU B 1 184 ? -14.683 -71.747 -42.820 1.00 69.92  ? 185 GLU B CG  1 
ATOM   5615 C CD  . GLU B 1 184 ? -14.673 -70.642 -43.873 1.00 78.96  ? 185 GLU B CD  1 
ATOM   5616 O OE1 . GLU B 1 184 ? -14.086 -70.856 -44.960 1.00 84.03  ? 185 GLU B OE1 1 
ATOM   5617 O OE2 . GLU B 1 184 ? -15.258 -69.563 -43.615 1.00 72.03  ? 185 GLU B OE2 1 
ATOM   5618 N N   . ASN B 1 185 ? -11.805 -75.442 -42.204 1.00 51.49  ? 186 ASN B N   1 
ATOM   5619 C CA  . ASN B 1 185 ? -10.872 -76.386 -42.841 1.00 40.57  ? 186 ASN B CA  1 
ATOM   5620 C C   . ASN B 1 185 ? -10.232 -77.465 -41.982 1.00 45.09  ? 186 ASN B C   1 
ATOM   5621 O O   . ASN B 1 185 ? -9.582  -78.360 -42.513 1.00 50.39  ? 186 ASN B O   1 
ATOM   5622 C CB  . ASN B 1 185 ? -9.739  -75.607 -43.526 1.00 43.61  ? 186 ASN B CB  1 
ATOM   5623 C CG  . ASN B 1 185 ? -10.254 -74.659 -44.595 1.00 56.59  ? 186 ASN B CG  1 
ATOM   5624 O OD1 . ASN B 1 185 ? -10.834 -75.096 -45.588 1.00 50.44  ? 186 ASN B OD1 1 
ATOM   5625 N ND2 . ASN B 1 185 ? -10.051 -73.358 -44.392 1.00 48.59  ? 186 ASN B ND2 1 
ATOM   5626 N N   . VAL B 1 186 ? -10.376 -77.386 -40.663 1.00 47.74  ? 187 VAL B N   1 
ATOM   5627 C CA  . VAL B 1 186 ? -9.583  -78.261 -39.805 1.00 41.54  ? 187 VAL B CA  1 
ATOM   5628 C C   . VAL B 1 186 ? -10.036 -79.723 -39.925 1.00 44.88  ? 187 VAL B C   1 
ATOM   5629 O O   . VAL B 1 186 ? -9.274  -80.657 -39.649 1.00 45.45  ? 187 VAL B O   1 
ATOM   5630 C CB  . VAL B 1 186 ? -9.594  -77.798 -38.320 1.00 48.80  ? 187 VAL B CB  1 
ATOM   5631 C CG1 . VAL B 1 186 ? -10.861 -78.273 -37.609 1.00 42.99  ? 187 VAL B CG1 1 
ATOM   5632 C CG2 . VAL B 1 186 ? -8.346  -78.305 -37.588 1.00 41.16  ? 187 VAL B CG2 1 
ATOM   5633 N N   . ALA B 1 187 ? -11.280 -79.916 -40.344 1.00 45.46  ? 188 ALA B N   1 
ATOM   5634 C CA  . ALA B 1 187 ? -11.815 -81.265 -40.490 1.00 54.42  ? 188 ALA B CA  1 
ATOM   5635 C C   . ALA B 1 187 ? -11.076 -82.028 -41.589 1.00 49.86  ? 188 ALA B C   1 
ATOM   5636 O O   . ALA B 1 187 ? -10.992 -83.255 -41.547 1.00 51.59  ? 188 ALA B O   1 
ATOM   5637 C CB  . ALA B 1 187 ? -13.305 -81.211 -40.782 1.00 56.32  ? 188 ALA B CB  1 
ATOM   5638 N N   . ALA B 1 188 ? -10.513 -81.301 -42.551 1.00 47.63  ? 189 ALA B N   1 
ATOM   5639 C CA  . ALA B 1 188 ? -9.744  -81.942 -43.630 1.00 46.42  ? 189 ALA B CA  1 
ATOM   5640 C C   . ALA B 1 188 ? -8.479  -82.593 -43.093 1.00 54.13  ? 189 ALA B C   1 
ATOM   5641 O O   . ALA B 1 188 ? -7.947  -83.512 -43.707 1.00 57.99  ? 189 ALA B O   1 
ATOM   5642 C CB  . ALA B 1 188 ? -9.409  -80.947 -44.739 1.00 46.88  ? 189 ALA B CB  1 
ATOM   5643 N N   . PHE B 1 189 ? -8.002  -82.127 -41.938 1.00 50.48  ? 190 PHE B N   1 
ATOM   5644 C CA  . PHE B 1 189 ? -6.793  -82.694 -41.341 1.00 52.01  ? 190 PHE B CA  1 
ATOM   5645 C C   . PHE B 1 189 ? -7.138  -83.727 -40.275 1.00 55.38  ? 190 PHE B C   1 
ATOM   5646 O O   . PHE B 1 189 ? -6.248  -84.300 -39.634 1.00 54.46  ? 190 PHE B O   1 
ATOM   5647 C CB  . PHE B 1 189 ? -5.898  -81.592 -40.758 1.00 53.21  ? 190 PHE B CB  1 
ATOM   5648 C CG  . PHE B 1 189 ? -5.491  -80.537 -41.767 1.00 49.61  ? 190 PHE B CG  1 
ATOM   5649 C CD1 . PHE B 1 189 ? -6.377  -79.539 -42.143 1.00 46.56  ? 190 PHE B CD1 1 
ATOM   5650 C CD2 . PHE B 1 189 ? -4.217  -80.542 -42.323 1.00 46.71  ? 190 PHE B CD2 1 
ATOM   5651 C CE1 . PHE B 1 189 ? -6.008  -78.566 -43.060 1.00 43.83  ? 190 PHE B CE1 1 
ATOM   5652 C CE2 . PHE B 1 189 ? -3.838  -79.577 -43.240 1.00 41.60  ? 190 PHE B CE2 1 
ATOM   5653 C CZ  . PHE B 1 189 ? -4.734  -78.582 -43.601 1.00 41.25  ? 190 PHE B CZ  1 
ATOM   5654 N N   . GLY B 1 190 ? -8.434  -83.972 -40.098 1.00 53.24  ? 191 GLY B N   1 
ATOM   5655 C CA  . GLY B 1 190 ? -8.894  -84.914 -39.087 1.00 58.02  ? 191 GLY B CA  1 
ATOM   5656 C C   . GLY B 1 190 ? -9.330  -84.252 -37.784 1.00 59.00  ? 191 GLY B C   1 
ATOM   5657 O O   . GLY B 1 190 ? -9.698  -84.933 -36.825 1.00 57.26  ? 191 GLY B O   1 
ATOM   5658 N N   . GLY B 1 191 ? -9.291  -82.920 -37.755 1.00 57.12  ? 192 GLY B N   1 
ATOM   5659 C CA  . GLY B 1 191 ? -9.604  -82.161 -36.560 1.00 52.56  ? 192 GLY B CA  1 
ATOM   5660 C C   . GLY B 1 191 ? -11.093 -81.951 -36.359 1.00 57.36  ? 192 GLY B C   1 
ATOM   5661 O O   . GLY B 1 191 ? -11.873 -81.992 -37.307 1.00 52.41  ? 192 GLY B O   1 
ATOM   5662 N N   . ASP B 1 192 ? -11.484 -81.719 -35.109 1.00 54.60  ? 193 ASP B N   1 
ATOM   5663 C CA  . ASP B 1 192 ? -12.878 -81.512 -34.759 1.00 51.86  ? 193 ASP B CA  1 
ATOM   5664 C C   . ASP B 1 192 ? -13.150 -80.041 -34.498 1.00 50.51  ? 193 ASP B C   1 
ATOM   5665 O O   . ASP B 1 192 ? -12.769 -79.521 -33.452 1.00 53.32  ? 193 ASP B O   1 
ATOM   5666 C CB  . ASP B 1 192 ? -13.221 -82.309 -33.498 1.00 54.85  ? 193 ASP B CB  1 
ATOM   5667 C CG  . ASP B 1 192 ? -14.690 -82.225 -33.136 1.00 49.86  ? 193 ASP B CG  1 
ATOM   5668 O OD1 . ASP B 1 192 ? -15.447 -81.476 -33.792 1.00 57.49  ? 193 ASP B OD1 1 
ATOM   5669 O OD2 . ASP B 1 192 ? -15.090 -82.903 -32.177 1.00 59.28  ? 193 ASP B OD2 1 
ATOM   5670 N N   . PRO B 1 193 ? -13.841 -79.377 -35.434 1.00 59.62  ? 194 PRO B N   1 
ATOM   5671 C CA  . PRO B 1 193 ? -14.179 -77.954 -35.285 1.00 59.86  ? 194 PRO B CA  1 
ATOM   5672 C C   . PRO B 1 193 ? -15.134 -77.664 -34.121 1.00 57.23  ? 194 PRO B C   1 
ATOM   5673 O O   . PRO B 1 193 ? -15.329 -76.501 -33.780 1.00 52.48  ? 194 PRO B O   1 
ATOM   5674 C CB  . PRO B 1 193 ? -14.843 -77.596 -36.627 1.00 49.96  ? 194 PRO B CB  1 
ATOM   5675 C CG  . PRO B 1 193 ? -15.260 -78.907 -37.223 1.00 52.95  ? 194 PRO B CG  1 
ATOM   5676 C CD  . PRO B 1 193 ? -14.282 -79.930 -36.731 1.00 51.05  ? 194 PRO B CD  1 
ATOM   5677 N N   . THR B 1 194 ? -15.725 -78.700 -33.535 1.00 57.84  ? 195 THR B N   1 
ATOM   5678 C CA  . THR B 1 194 ? -16.610 -78.516 -32.382 1.00 53.96  ? 195 THR B CA  1 
ATOM   5679 C C   . THR B 1 194 ? -15.836 -78.633 -31.068 1.00 56.66  ? 195 THR B C   1 
ATOM   5680 O O   . THR B 1 194 ? -16.390 -78.391 -29.998 1.00 59.05  ? 195 THR B O   1 
ATOM   5681 C CB  . THR B 1 194 ? -17.810 -79.501 -32.397 1.00 47.40  ? 195 THR B CB  1 
ATOM   5682 O OG1 . THR B 1 194 ? -17.329 -80.850 -32.303 1.00 58.24  ? 195 THR B OG1 1 
ATOM   5683 C CG2 . THR B 1 194 ? -18.607 -79.355 -33.693 1.00 52.16  ? 195 THR B CG2 1 
ATOM   5684 N N   . SER B 1 195 ? -14.555 -78.996 -31.154 1.00 49.60  ? 196 SER B N   1 
ATOM   5685 C CA  . SER B 1 195 ? -13.689 -79.044 -29.977 1.00 55.93  ? 196 SER B CA  1 
ATOM   5686 C C   . SER B 1 195 ? -12.377 -78.249 -30.184 1.00 56.26  ? 196 SER B C   1 
ATOM   5687 O O   . SER B 1 195 ? -11.299 -78.822 -30.420 1.00 47.75  ? 196 SER B O   1 
ATOM   5688 C CB  . SER B 1 195 ? -13.398 -80.496 -29.560 1.00 50.57  ? 196 SER B CB  1 
ATOM   5689 O OG  . SER B 1 195 ? -12.610 -80.536 -28.368 1.00 55.48  ? 196 SER B OG  1 
ATOM   5690 N N   . VAL B 1 196 ? -12.472 -76.929 -30.075 1.00 47.08  ? 197 VAL B N   1 
ATOM   5691 C CA  . VAL B 1 196 ? -11.314 -76.084 -30.296 1.00 48.93  ? 197 VAL B CA  1 
ATOM   5692 C C   . VAL B 1 196 ? -10.943 -75.317 -29.037 1.00 45.05  ? 197 VAL B C   1 
ATOM   5693 O O   . VAL B 1 196 ? -11.763 -74.569 -28.493 1.00 46.04  ? 197 VAL B O   1 
ATOM   5694 C CB  . VAL B 1 196 ? -11.550 -75.080 -31.450 1.00 51.15  ? 197 VAL B CB  1 
ATOM   5695 C CG1 . VAL B 1 196 ? -10.357 -74.130 -31.560 1.00 45.07  ? 197 VAL B CG1 1 
ATOM   5696 C CG2 . VAL B 1 196 ? -11.786 -75.824 -32.778 1.00 39.41  ? 197 VAL B CG2 1 
ATOM   5697 N N   . THR B 1 197 ? -9.698  -75.502 -28.594 1.00 47.22  ? 198 THR B N   1 
ATOM   5698 C CA  . THR B 1 197 ? -9.180  -74.869 -27.385 1.00 43.49  ? 198 THR B CA  1 
ATOM   5699 C C   . THR B 1 197 ? -8.039  -73.900 -27.680 1.00 49.94  ? 198 THR B C   1 
ATOM   5700 O O   . THR B 1 197 ? -6.973  -74.313 -28.147 1.00 46.40  ? 198 THR B O   1 
ATOM   5701 C CB  . THR B 1 197 ? -8.642  -75.928 -26.411 1.00 48.00  ? 198 THR B CB  1 
ATOM   5702 O OG1 . THR B 1 197 ? -9.699  -76.818 -26.041 1.00 46.93  ? 198 THR B OG1 1 
ATOM   5703 C CG2 . THR B 1 197 ? -8.059  -75.275 -25.171 1.00 40.32  ? 198 THR B CG2 1 
ATOM   5704 N N   . LEU B 1 198 ? -8.254  -72.616 -27.397 1.00 47.93  ? 199 LEU B N   1 
ATOM   5705 C CA  . LEU B 1 198 ? -7.208  -71.615 -27.602 1.00 41.23  ? 199 LEU B CA  1 
ATOM   5706 C C   . LEU B 1 198 ? -6.220  -71.626 -26.457 1.00 43.18  ? 199 LEU B C   1 
ATOM   5707 O O   . LEU B 1 198 ? -6.610  -71.707 -25.297 1.00 46.90  ? 199 LEU B O   1 
ATOM   5708 C CB  . LEU B 1 198 ? -7.794  -70.203 -27.687 1.00 43.10  ? 199 LEU B CB  1 
ATOM   5709 C CG  . LEU B 1 198 ? -8.877  -69.860 -28.687 1.00 46.12  ? 199 LEU B CG  1 
ATOM   5710 C CD1 . LEU B 1 198 ? -9.079  -68.345 -28.709 1.00 46.81  ? 199 LEU B CD1 1 
ATOM   5711 C CD2 . LEU B 1 198 ? -8.492  -70.370 -30.059 1.00 42.43  ? 199 LEU B CD2 1 
ATOM   5712 N N   . PHE B 1 199 ? -4.934  -71.539 -26.762 1.00 43.50  ? 200 PHE B N   1 
ATOM   5713 C CA  . PHE B 1 199 ? -3.973  -71.277 -25.695 1.00 38.58  ? 200 PHE B CA  1 
ATOM   5714 C C   . PHE B 1 199 ? -2.906  -70.268 -26.112 1.00 46.54  ? 200 PHE B C   1 
ATOM   5715 O O   . PHE B 1 199 ? -2.545  -70.161 -27.294 1.00 40.99  ? 200 PHE B O   1 
ATOM   5716 C CB  . PHE B 1 199 ? -3.420  -72.562 -25.022 1.00 39.49  ? 200 PHE B CB  1 
ATOM   5717 C CG  . PHE B 1 199 ? -2.470  -73.398 -25.865 1.00 43.26  ? 200 PHE B CG  1 
ATOM   5718 C CD1 . PHE B 1 199 ? -2.743  -73.702 -27.200 1.00 39.36  ? 200 PHE B CD1 1 
ATOM   5719 C CD2 . PHE B 1 199 ? -1.313  -73.930 -25.281 1.00 41.22  ? 200 PHE B CD2 1 
ATOM   5720 C CE1 . PHE B 1 199 ? -1.864  -74.499 -27.950 1.00 40.89  ? 200 PHE B CE1 1 
ATOM   5721 C CE2 . PHE B 1 199 ? -0.424  -74.724 -26.029 1.00 50.44  ? 200 PHE B CE2 1 
ATOM   5722 C CZ  . PHE B 1 199 ? -0.705  -75.003 -27.376 1.00 41.03  ? 200 PHE B CZ  1 
ATOM   5723 N N   . GLY B 1 200 ? -2.442  -69.494 -25.142 1.00 41.24  ? 201 GLY B N   1 
ATOM   5724 C CA  . GLY B 1 200 ? -1.521  -68.416 -25.414 1.00 38.45  ? 201 GLY B CA  1 
ATOM   5725 C C   . GLY B 1 200 ? -0.780  -67.968 -24.185 1.00 44.95  ? 201 GLY B C   1 
ATOM   5726 O O   . GLY B 1 200 ? -1.247  -68.186 -23.061 1.00 40.85  ? 201 GLY B O   1 
ATOM   5727 N N   . GLU B 1 201 ? 0.373   -67.334 -24.390 1.00 40.63  ? 202 GLU B N   1 
ATOM   5728 C CA  . GLU B 1 201 ? 1.180   -66.873 -23.265 1.00 40.92  ? 202 GLU B CA  1 
ATOM   5729 C C   . GLU B 1 201 ? 1.493   -65.375 -23.416 1.00 45.50  ? 202 GLU B C   1 
ATOM   5730 O O   . GLU B 1 201 ? 1.616   -64.887 -24.538 1.00 38.25  ? 202 GLU B O   1 
ATOM   5731 C CB  . GLU B 1 201 ? 2.445   -67.744 -23.109 1.00 37.85  ? 202 GLU B CB  1 
ATOM   5732 C CG  . GLU B 1 201 ? 3.338   -67.377 -21.921 1.00 36.51  ? 202 GLU B CG  1 
ATOM   5733 C CD  . GLU B 1 201 ? 4.343   -66.270 -22.254 1.00 47.24  ? 202 GLU B CD  1 
ATOM   5734 O OE1 . GLU B 1 201 ? 4.480   -65.925 -23.457 1.00 41.82  ? 202 GLU B OE1 1 
ATOM   5735 O OE2 . GLU B 1 201 ? 4.989   -65.741 -21.309 1.00 44.09  ? 202 GLU B OE2 1 
ATOM   5736 N N   . SER B 1 202 ? 1.612   -64.662 -22.290 1.00 42.49  ? 203 SER B N   1 
ATOM   5737 C CA  . SER B 1 202 ? 1.781   -63.190 -22.270 1.00 37.09  ? 203 SER B CA  1 
ATOM   5738 C C   . SER B 1 202 ? 0.794   -62.454 -23.194 1.00 40.44  ? 203 SER B C   1 
ATOM   5739 O O   . SER B 1 202 ? -0.419  -62.558 -23.016 1.00 39.04  ? 203 SER B O   1 
ATOM   5740 C CB  . SER B 1 202 ? 3.219   -62.776 -22.595 1.00 41.11  ? 203 SER B CB  1 
ATOM   5741 O OG  . SER B 1 202 ? 3.542   -61.556 -21.933 1.00 49.55  ? 203 SER B OG  1 
ATOM   5742 N N   . ALA B 1 203 ? 1.304   -61.738 -24.197 1.00 40.10  ? 204 ALA B N   1 
ATOM   5743 C CA  . ALA B 1 203 ? 0.397   -61.045 -25.122 1.00 41.40  ? 204 ALA B CA  1 
ATOM   5744 C C   . ALA B 1 203 ? -0.575  -61.997 -25.836 1.00 38.13  ? 204 ALA B C   1 
ATOM   5745 O O   . ALA B 1 203 ? -1.683  -61.600 -26.215 1.00 38.64  ? 204 ALA B O   1 
ATOM   5746 C CB  . ALA B 1 203 ? 1.168   -60.192 -26.129 1.00 44.09  ? 204 ALA B CB  1 
ATOM   5747 N N   . GLY B 1 204 ? -0.159  -63.250 -26.019 1.00 38.98  ? 205 GLY B N   1 
ATOM   5748 C CA  . GLY B 1 204 ? -1.019  -64.269 -26.607 1.00 36.14  ? 205 GLY B CA  1 
ATOM   5749 C C   . GLY B 1 204 ? -2.146  -64.696 -25.672 1.00 39.74  ? 205 GLY B C   1 
ATOM   5750 O O   . GLY B 1 204 ? -3.248  -64.999 -26.112 1.00 39.31  ? 205 GLY B O   1 
ATOM   5751 N N   . ALA B 1 205 ? -1.855  -64.722 -24.374 1.00 40.45  ? 206 ALA B N   1 
ATOM   5752 C CA  . ALA B 1 205 ? -2.854  -64.971 -23.352 1.00 37.76  ? 206 ALA B CA  1 
ATOM   5753 C C   . ALA B 1 205 ? -3.842  -63.806 -23.294 1.00 45.33  ? 206 ALA B C   1 
ATOM   5754 O O   . ALA B 1 205 ? -5.058  -64.007 -23.232 1.00 39.58  ? 206 ALA B O   1 
ATOM   5755 C CB  . ALA B 1 205 ? -2.179  -65.184 -21.954 1.00 36.76  ? 206 ALA B CB  1 
ATOM   5756 N N   . ALA B 1 206 ? -3.322  -62.585 -23.315 1.00 38.42  ? 207 ALA B N   1 
ATOM   5757 C CA  . ALA B 1 206 ? -4.206  -61.425 -23.397 1.00 40.84  ? 207 ALA B CA  1 
ATOM   5758 C C   . ALA B 1 206 ? -5.081  -61.455 -24.667 1.00 44.17  ? 207 ALA B C   1 
ATOM   5759 O O   . ALA B 1 206 ? -6.268  -61.086 -24.607 1.00 41.68  ? 207 ALA B O   1 
ATOM   5760 C CB  . ALA B 1 206 ? -3.401  -60.112 -23.292 1.00 40.81  ? 207 ALA B CB  1 
ATOM   5761 N N   . SER B 1 207 ? -4.521  -61.916 -25.800 1.00 38.40  ? 208 SER B N   1 
ATOM   5762 C CA  . SER B 1 207 ? -5.314  -62.059 -27.025 1.00 39.41  ? 208 SER B CA  1 
ATOM   5763 C C   . SER B 1 207 ? -6.427  -63.069 -26.826 1.00 39.92  ? 208 SER B C   1 
ATOM   5764 O O   . SER B 1 207 ? -7.568  -62.820 -27.215 1.00 41.66  ? 208 SER B O   1 
ATOM   5765 C CB  . SER B 1 207 ? -4.476  -62.525 -28.251 1.00 40.88  ? 208 SER B CB  1 
ATOM   5766 O OG  . SER B 1 207 ? -3.487  -61.591 -28.593 1.00 37.07  ? 208 SER B OG  1 
ATOM   5767 N N   . VAL B 1 208 ? -6.083  -64.233 -26.279 1.00 39.07  ? 209 VAL B N   1 
ATOM   5768 C CA  . VAL B 1 208 ? -7.105  -65.240 -25.982 1.00 40.13  ? 209 VAL B CA  1 
ATOM   5769 C C   . VAL B 1 208 ? -8.248  -64.626 -25.174 1.00 44.52  ? 209 VAL B C   1 
ATOM   5770 O O   . VAL B 1 208 ? -9.419  -64.845 -25.491 1.00 48.63  ? 209 VAL B O   1 
ATOM   5771 C CB  . VAL B 1 208 ? -6.550  -66.420 -25.167 1.00 45.63  ? 209 VAL B CB  1 
ATOM   5772 C CG1 . VAL B 1 208 ? -7.692  -67.329 -24.706 1.00 48.12  ? 209 VAL B CG1 1 
ATOM   5773 C CG2 . VAL B 1 208 ? -5.557  -67.216 -25.978 1.00 43.61  ? 209 VAL B CG2 1 
ATOM   5774 N N   . GLY B 1 209 ? -7.902  -63.837 -24.153 1.00 42.05  ? 210 GLY B N   1 
ATOM   5775 C CA  . GLY B 1 209 ? -8.899  -63.191 -23.301 1.00 40.16  ? 210 GLY B CA  1 
ATOM   5776 C C   . GLY B 1 209 ? -9.792  -62.219 -24.071 1.00 44.77  ? 210 GLY B C   1 
ATOM   5777 O O   . GLY B 1 209 ? -11.006 -62.124 -23.841 1.00 48.45  ? 210 GLY B O   1 
ATOM   5778 N N   . MET B 1 210 ? -9.190  -61.507 -25.015 1.00 45.83  ? 211 MET B N   1 
ATOM   5779 C CA  . MET B 1 210 ? -9.956  -60.641 -25.902 1.00 42.83  ? 211 MET B CA  1 
ATOM   5780 C C   . MET B 1 210 ? -10.909 -61.400 -26.839 1.00 46.52  ? 211 MET B C   1 
ATOM   5781 O O   . MET B 1 210 ? -12.028 -60.946 -27.083 1.00 42.06  ? 211 MET B O   1 
ATOM   5782 C CB  . MET B 1 210 ? -9.019  -59.699 -26.662 1.00 49.44  ? 211 MET B CB  1 
ATOM   5783 C CG  . MET B 1 210 ? -8.324  -58.713 -25.723 1.00 44.80  ? 211 MET B CG  1 
ATOM   5784 S SD  . MET B 1 210 ? -7.124  -57.660 -26.551 1.00 49.09  ? 211 MET B SD  1 
ATOM   5785 C CE  . MET B 1 210 ? -6.109  -57.143 -25.155 1.00 45.03  ? 211 MET B CE  1 
ATOM   5786 N N   . HIS B 1 211 ? -10.503 -62.561 -27.349 1.00 41.92  ? 212 HIS B N   1 
ATOM   5787 C CA  . HIS B 1 211 ? -11.449 -63.348 -28.152 1.00 50.01  ? 212 HIS B CA  1 
ATOM   5788 C C   . HIS B 1 211 ? -12.641 -63.830 -27.292 1.00 51.99  ? 212 HIS B C   1 
ATOM   5789 O O   . HIS B 1 211 ? -13.763 -63.903 -27.779 1.00 46.68  ? 212 HIS B O   1 
ATOM   5790 C CB  . HIS B 1 211 ? -10.764 -64.514 -28.891 1.00 45.61  ? 212 HIS B CB  1 
ATOM   5791 C CG  . HIS B 1 211 ? -9.769  -64.074 -29.919 1.00 46.89  ? 212 HIS B CG  1 
ATOM   5792 N ND1 . HIS B 1 211 ? -10.138 -63.459 -31.101 1.00 45.20  ? 212 HIS B ND1 1 
ATOM   5793 C CD2 . HIS B 1 211 ? -8.415  -64.147 -29.936 1.00 40.84  ? 212 HIS B CD2 1 
ATOM   5794 C CE1 . HIS B 1 211 ? -9.054  -63.170 -31.800 1.00 43.24  ? 212 HIS B CE1 1 
ATOM   5795 N NE2 . HIS B 1 211 ? -7.995  -63.576 -31.116 1.00 44.87  ? 212 HIS B NE2 1 
ATOM   5796 N N   . LEU B 1 212 ? -12.385 -64.147 -26.020 1.00 47.34  ? 213 LEU B N   1 
ATOM   5797 C CA  . LEU B 1 212 ? -13.447 -64.405 -25.048 1.00 47.62  ? 213 LEU B CA  1 
ATOM   5798 C C   . LEU B 1 212 ? -14.442 -63.240 -24.907 1.00 44.35  ? 213 LEU B C   1 
ATOM   5799 O O   . LEU B 1 212 ? -15.631 -63.457 -24.731 1.00 46.71  ? 213 LEU B O   1 
ATOM   5800 C CB  . LEU B 1 212 ? -12.844 -64.711 -23.671 1.00 48.89  ? 213 LEU B CB  1 
ATOM   5801 C CG  . LEU B 1 212 ? -12.299 -66.119 -23.398 1.00 52.56  ? 213 LEU B CG  1 
ATOM   5802 C CD1 . LEU B 1 212 ? -11.635 -66.177 -22.040 1.00 50.31  ? 213 LEU B CD1 1 
ATOM   5803 C CD2 . LEU B 1 212 ? -13.406 -67.158 -23.485 1.00 51.49  ? 213 LEU B CD2 1 
ATOM   5804 N N   . LEU B 1 213 ? -13.957 -62.006 -24.981 1.00 45.03  ? 214 LEU B N   1 
ATOM   5805 C CA  . LEU B 1 213 ? -14.797 -60.844 -24.686 1.00 43.12  ? 214 LEU B CA  1 
ATOM   5806 C C   . LEU B 1 213 ? -15.352 -60.153 -25.931 1.00 50.02  ? 214 LEU B C   1 
ATOM   5807 O O   . LEU B 1 213 ? -15.910 -59.067 -25.834 1.00 53.46  ? 214 LEU B O   1 
ATOM   5808 C CB  . LEU B 1 213 ? -14.032 -59.840 -23.808 1.00 40.38  ? 214 LEU B CB  1 
ATOM   5809 C CG  . LEU B 1 213 ? -13.551 -60.423 -22.474 1.00 39.44  ? 214 LEU B CG  1 
ATOM   5810 C CD1 . LEU B 1 213 ? -12.482 -59.545 -21.845 1.00 41.02  ? 214 LEU B CD1 1 
ATOM   5811 C CD2 . LEU B 1 213 ? -14.706 -60.650 -21.497 1.00 50.23  ? 214 LEU B CD2 1 
ATOM   5812 N N   . SER B 1 214 ? -15.203 -60.794 -27.091 1.00 44.07  ? 215 SER B N   1 
ATOM   5813 C CA  . SER B 1 214 ? -15.640 -60.227 -28.372 1.00 52.14  ? 215 SER B CA  1 
ATOM   5814 C C   . SER B 1 214 ? -16.571 -61.229 -29.051 1.00 49.66  ? 215 SER B C   1 
ATOM   5815 O O   . SER B 1 214 ? -16.111 -62.271 -29.529 1.00 52.02  ? 215 SER B O   1 
ATOM   5816 C CB  . SER B 1 214 ? -14.427 -59.954 -29.275 1.00 49.88  ? 215 SER B CB  1 
ATOM   5817 O OG  . SER B 1 214 ? -14.773 -59.139 -30.384 1.00 54.41  ? 215 SER B OG  1 
ATOM   5818 N N   . PRO B 1 215 ? -17.886 -60.940 -29.068 1.00 52.37  ? 216 PRO B N   1 
ATOM   5819 C CA  . PRO B 1 215 ? -18.872 -61.916 -29.563 1.00 54.37  ? 216 PRO B CA  1 
ATOM   5820 C C   . PRO B 1 215 ? -18.552 -62.573 -30.924 1.00 50.88  ? 216 PRO B C   1 
ATOM   5821 O O   . PRO B 1 215 ? -18.717 -63.789 -31.020 1.00 51.80  ? 216 PRO B O   1 
ATOM   5822 C CB  . PRO B 1 215 ? -20.175 -61.109 -29.607 1.00 53.77  ? 216 PRO B CB  1 
ATOM   5823 C CG  . PRO B 1 215 ? -20.004 -60.100 -28.493 1.00 53.04  ? 216 PRO B CG  1 
ATOM   5824 C CD  . PRO B 1 215 ? -18.536 -59.709 -28.581 1.00 56.91  ? 216 PRO B CD  1 
ATOM   5825 N N   . PRO B 1 216 ? -18.064 -61.816 -31.932 1.00 52.74  ? 217 PRO B N   1 
ATOM   5826 C CA  . PRO B 1 216 ? -17.785 -62.549 -33.184 1.00 52.49  ? 217 PRO B CA  1 
ATOM   5827 C C   . PRO B 1 216 ? -16.624 -63.553 -33.082 1.00 56.01  ? 217 PRO B C   1 
ATOM   5828 O O   . PRO B 1 216 ? -16.569 -64.461 -33.912 1.00 56.18  ? 217 PRO B O   1 
ATOM   5829 C CB  . PRO B 1 216 ? -17.457 -61.440 -34.195 1.00 46.60  ? 217 PRO B CB  1 
ATOM   5830 C CG  . PRO B 1 216 ? -17.891 -60.157 -33.553 1.00 49.35  ? 217 PRO B CG  1 
ATOM   5831 C CD  . PRO B 1 216 ? -17.800 -60.372 -32.071 1.00 45.41  ? 217 PRO B CD  1 
ATOM   5832 N N   . SER B 1 217 ? -15.734 -63.426 -32.094 1.00 47.61  ? 218 SER B N   1 
ATOM   5833 C CA  . SER B 1 217 ? -14.695 -64.452 -31.903 1.00 43.19  ? 218 SER B CA  1 
ATOM   5834 C C   . SER B 1 217 ? -15.219 -65.639 -31.113 1.00 55.39  ? 218 SER B C   1 
ATOM   5835 O O   . SER B 1 217 ? -14.840 -66.781 -31.364 1.00 49.46  ? 218 SER B O   1 
ATOM   5836 C CB  . SER B 1 217 ? -13.447 -63.890 -31.209 1.00 46.34  ? 218 SER B CB  1 
ATOM   5837 O OG  . SER B 1 217 ? -12.791 -62.891 -31.988 1.00 48.29  ? 218 SER B OG  1 
ATOM   5838 N N   . ARG B 1 218 ? -16.107 -65.349 -30.163 1.00 62.08  ? 219 ARG B N   1 
ATOM   5839 C CA  . ARG B 1 218 ? -16.531 -66.306 -29.144 1.00 58.07  ? 219 ARG B CA  1 
ATOM   5840 C C   . ARG B 1 218 ? -17.168 -67.585 -29.717 1.00 53.56  ? 219 ARG B C   1 
ATOM   5841 O O   . ARG B 1 218 ? -17.019 -68.673 -29.155 1.00 60.36  ? 219 ARG B O   1 
ATOM   5842 C CB  . ARG B 1 218 ? -17.450 -65.602 -28.121 1.00 57.55  ? 219 ARG B CB  1 
ATOM   5843 C CG  . ARG B 1 218 ? -17.790 -66.419 -26.897 1.00 62.28  ? 219 ARG B CG  1 
ATOM   5844 C CD  . ARG B 1 218 ? -16.562 -66.817 -26.085 1.00 57.30  ? 219 ARG B CD  1 
ATOM   5845 N NE  . ARG B 1 218 ? -16.908 -67.834 -25.092 1.00 63.54  ? 219 ARG B NE  1 
ATOM   5846 C CZ  . ARG B 1 218 ? -16.909 -69.149 -25.323 1.00 72.69  ? 219 ARG B CZ  1 
ATOM   5847 N NH1 . ARG B 1 218 ? -16.574 -69.631 -26.523 1.00 52.48  ? 219 ARG B NH1 1 
ATOM   5848 N NH2 . ARG B 1 218 ? -17.256 -69.987 -24.352 1.00 51.72  ? 219 ARG B NH2 1 
ATOM   5849 N N   . GLY B 1 219 ? -17.834 -67.461 -30.857 1.00 56.15  ? 220 GLY B N   1 
ATOM   5850 C CA  . GLY B 1 219 ? -18.399 -68.619 -31.529 1.00 55.10  ? 220 GLY B CA  1 
ATOM   5851 C C   . GLY B 1 219 ? -17.385 -69.530 -32.208 1.00 65.33  ? 220 GLY B C   1 
ATOM   5852 O O   . GLY B 1 219 ? -17.745 -70.624 -32.647 1.00 61.70  ? 220 GLY B O   1 
ATOM   5853 N N   . LEU B 1 220 ? -16.121 -69.109 -32.286 1.00 48.41  ? 221 LEU B N   1 
ATOM   5854 C CA  . LEU B 1 220 ? -15.127 -69.900 -33.017 1.00 53.33  ? 221 LEU B CA  1 
ATOM   5855 C C   . LEU B 1 220 ? -14.325 -70.859 -32.126 1.00 59.08  ? 221 LEU B C   1 
ATOM   5856 O O   . LEU B 1 220 ? -13.505 -71.620 -32.612 1.00 49.77  ? 221 LEU B O   1 
ATOM   5857 C CB  . LEU B 1 220 ? -14.192 -68.983 -33.818 1.00 48.27  ? 221 LEU B CB  1 
ATOM   5858 C CG  . LEU B 1 220 ? -14.884 -67.860 -34.604 1.00 49.60  ? 221 LEU B CG  1 
ATOM   5859 C CD1 . LEU B 1 220 ? -13.883 -66.849 -35.125 1.00 50.59  ? 221 LEU B CD1 1 
ATOM   5860 C CD2 . LEU B 1 220 ? -15.702 -68.422 -35.759 1.00 45.34  ? 221 LEU B CD2 1 
ATOM   5861 N N   . PHE B 1 221 ? -14.559 -70.839 -30.818 1.00 46.37  ? 222 PHE B N   1 
ATOM   5862 C CA  . PHE B 1 221 ? -13.871 -71.786 -29.946 1.00 49.70  ? 222 PHE B CA  1 
ATOM   5863 C C   . PHE B 1 221 ? -14.711 -72.140 -28.717 1.00 51.16  ? 222 PHE B C   1 
ATOM   5864 O O   . PHE B 1 221 ? -15.774 -71.556 -28.496 1.00 50.39  ? 222 PHE B O   1 
ATOM   5865 C CB  . PHE B 1 221 ? -12.493 -71.259 -29.527 1.00 46.16  ? 222 PHE B CB  1 
ATOM   5866 C CG  . PHE B 1 221 ? -12.549 -70.004 -28.707 1.00 49.84  ? 222 PHE B CG  1 
ATOM   5867 C CD1 . PHE B 1 221 ? -12.876 -68.786 -29.292 1.00 48.83  ? 222 PHE B CD1 1 
ATOM   5868 C CD2 . PHE B 1 221 ? -12.289 -70.042 -27.345 1.00 48.93  ? 222 PHE B CD2 1 
ATOM   5869 C CE1 . PHE B 1 221 ? -12.931 -67.623 -28.537 1.00 51.46  ? 222 PHE B CE1 1 
ATOM   5870 C CE2 . PHE B 1 221 ? -12.338 -68.880 -26.588 1.00 50.28  ? 222 PHE B CE2 1 
ATOM   5871 C CZ  . PHE B 1 221 ? -12.661 -67.673 -27.189 1.00 46.89  ? 222 PHE B CZ  1 
ATOM   5872 N N   . HIS B 1 222 ? -14.218 -73.091 -27.929 1.00 45.07  ? 223 HIS B N   1 
ATOM   5873 C CA  . HIS B 1 222 ? -14.995 -73.653 -26.824 1.00 54.39  ? 223 HIS B CA  1 
ATOM   5874 C C   . HIS B 1 222 ? -14.327 -73.538 -25.459 1.00 54.02  ? 223 HIS B C   1 
ATOM   5875 O O   . HIS B 1 222 ? -15.011 -73.423 -24.452 1.00 58.12  ? 223 HIS B O   1 
ATOM   5876 C CB  . HIS B 1 222 ? -15.364 -75.107 -27.143 1.00 46.77  ? 223 HIS B CB  1 
ATOM   5877 C CG  . HIS B 1 222 ? -15.903 -75.267 -28.527 1.00 56.78  ? 223 HIS B CG  1 
ATOM   5878 N ND1 . HIS B 1 222 ? -15.085 -75.419 -29.629 1.00 55.22  ? 223 HIS B ND1 1 
ATOM   5879 C CD2 . HIS B 1 222 ? -17.169 -75.214 -29.001 1.00 56.58  ? 223 HIS B CD2 1 
ATOM   5880 C CE1 . HIS B 1 222 ? -15.829 -75.482 -30.719 1.00 55.55  ? 223 HIS B CE1 1 
ATOM   5881 N NE2 . HIS B 1 222 ? -17.097 -75.369 -30.365 1.00 62.51  ? 223 HIS B NE2 1 
ATOM   5882 N N   . ARG B 1 223 ? -12.999 -73.589 -25.423 1.00 48.83  ? 224 ARG B N   1 
ATOM   5883 C CA  . ARG B 1 223 ? -12.269 -73.480 -24.165 1.00 49.56  ? 224 ARG B CA  1 
ATOM   5884 C C   . ARG B 1 223 ? -11.043 -72.578 -24.328 1.00 53.63  ? 224 ARG B C   1 
ATOM   5885 O O   . ARG B 1 223 ? -10.620 -72.257 -25.453 1.00 46.51  ? 224 ARG B O   1 
ATOM   5886 C CB  . ARG B 1 223 ? -11.835 -74.859 -23.661 1.00 51.46  ? 224 ARG B CB  1 
ATOM   5887 C CG  . ARG B 1 223 ? -12.982 -75.797 -23.364 1.00 56.91  ? 224 ARG B CG  1 
ATOM   5888 C CD  . ARG B 1 223 ? -12.490 -77.210 -23.116 1.00 57.98  ? 224 ARG B CD  1 
ATOM   5889 N NE  . ARG B 1 223 ? -13.463 -78.176 -23.611 1.00 63.22  ? 224 ARG B NE  1 
ATOM   5890 C CZ  . ARG B 1 223 ? -13.566 -78.535 -24.887 1.00 74.79  ? 224 ARG B CZ  1 
ATOM   5891 N NH1 . ARG B 1 223 ? -12.752 -78.013 -25.792 1.00 70.07  ? 224 ARG B NH1 1 
ATOM   5892 N NH2 . ARG B 1 223 ? -14.481 -79.417 -25.266 1.00 90.11  ? 224 ARG B NH2 1 
ATOM   5893 N N   . ALA B 1 224 ? -10.457 -72.188 -23.204 1.00 44.22  ? 225 ALA B N   1 
ATOM   5894 C CA  . ALA B 1 224 ? -9.376  -71.223 -23.234 1.00 39.15  ? 225 ALA B CA  1 
ATOM   5895 C C   . ALA B 1 224 ? -8.339  -71.455 -22.166 1.00 44.53  ? 225 ALA B C   1 
ATOM   5896 O O   . ALA B 1 224 ? -8.672  -71.832 -21.033 1.00 42.97  ? 225 ALA B O   1 
ATOM   5897 C CB  . ALA B 1 224 ? -9.946  -69.818 -23.130 1.00 40.84  ? 225 ALA B CB  1 
ATOM   5898 N N   . VAL B 1 225 ? -7.080  -71.216 -22.532 1.00 38.17  ? 226 VAL B N   1 
ATOM   5899 C CA  . VAL B 1 225 ? -5.950  -71.296 -21.607 1.00 41.00  ? 226 VAL B CA  1 
ATOM   5900 C C   . VAL B 1 225 ? -5.153  -69.994 -21.656 1.00 47.84  ? 226 VAL B C   1 
ATOM   5901 O O   . VAL B 1 225 ? -4.737  -69.538 -22.728 1.00 45.59  ? 226 VAL B O   1 
ATOM   5902 C CB  . VAL B 1 225 ? -5.014  -72.459 -21.974 1.00 43.67  ? 226 VAL B CB  1 
ATOM   5903 C CG1 . VAL B 1 225 ? -3.832  -72.538 -21.033 1.00 44.50  ? 226 VAL B CG1 1 
ATOM   5904 C CG2 . VAL B 1 225 ? -5.780  -73.774 -22.039 1.00 42.87  ? 226 VAL B CG2 1 
ATOM   5905 N N   . LEU B 1 226 ? -4.943  -69.375 -20.505 1.00 40.82  ? 227 LEU B N   1 
ATOM   5906 C CA  . LEU B 1 226 ? -4.221  -68.104 -20.466 1.00 40.15  ? 227 LEU B CA  1 
ATOM   5907 C C   . LEU B 1 226 ? -2.978  -68.228 -19.602 1.00 42.47  ? 227 LEU B C   1 
ATOM   5908 O O   . LEU B 1 226 ? -3.076  -68.333 -18.378 1.00 44.37  ? 227 LEU B O   1 
ATOM   5909 C CB  . LEU B 1 226 ? -5.112  -66.982 -19.934 1.00 40.77  ? 227 LEU B CB  1 
ATOM   5910 C CG  . LEU B 1 226 ? -6.272  -66.535 -20.811 1.00 46.95  ? 227 LEU B CG  1 
ATOM   5911 C CD1 . LEU B 1 226 ? -7.469  -67.463 -20.690 1.00 42.36  ? 227 LEU B CD1 1 
ATOM   5912 C CD2 . LEU B 1 226 ? -6.658  -65.080 -20.476 1.00 40.16  ? 227 LEU B CD2 1 
ATOM   5913 N N   . GLN B 1 227 ? -1.809  -68.227 -20.231 1.00 43.41  ? 228 GLN B N   1 
ATOM   5914 C CA  . GLN B 1 227 ? -0.555  -68.383 -19.499 1.00 43.92  ? 228 GLN B CA  1 
ATOM   5915 C C   . GLN B 1 227 ? 0.114   -67.024 -19.296 1.00 45.14  ? 228 GLN B C   1 
ATOM   5916 O O   . GLN B 1 227 ? 0.482   -66.374 -20.270 1.00 43.00  ? 228 GLN B O   1 
ATOM   5917 C CB  . GLN B 1 227 ? 0.383   -69.365 -20.238 1.00 39.59  ? 228 GLN B CB  1 
ATOM   5918 C CG  . GLN B 1 227 ? -0.240  -70.778 -20.447 1.00 42.95  ? 228 GLN B CG  1 
ATOM   5919 C CD  . GLN B 1 227 ? 0.518   -71.681 -21.448 1.00 46.43  ? 228 GLN B CD  1 
ATOM   5920 O OE1 . GLN B 1 227 ? -0.084  -72.555 -22.077 1.00 44.49  ? 228 GLN B OE1 1 
ATOM   5921 N NE2 . GLN B 1 227 ? 1.831   -71.486 -21.577 1.00 43.76  ? 228 GLN B NE2 1 
ATOM   5922 N N   . SER B 1 228 ? 0.272   -66.609 -18.034 1.00 41.10  ? 229 SER B N   1 
ATOM   5923 C CA  . SER B 1 228 ? 0.968   -65.345 -17.673 1.00 35.77  ? 229 SER B CA  1 
ATOM   5924 C C   . SER B 1 228 ? 0.519   -64.086 -18.438 1.00 39.60  ? 229 SER B C   1 
ATOM   5925 O O   . SER B 1 228 ? 1.347   -63.289 -18.904 1.00 43.45  ? 229 SER B O   1 
ATOM   5926 C CB  . SER B 1 228 ? 2.490   -65.493 -17.800 1.00 42.32  ? 229 SER B CB  1 
ATOM   5927 O OG  . SER B 1 228 ? 2.946   -66.723 -17.265 1.00 45.38  ? 229 SER B OG  1 
ATOM   5928 N N   . GLY B 1 229 ? -0.786  -63.909 -18.578 1.00 34.84  ? 230 GLY B N   1 
ATOM   5929 C CA  . GLY B 1 229 ? -1.299  -62.696 -19.179 1.00 36.76  ? 230 GLY B CA  1 
ATOM   5930 C C   . GLY B 1 229 ? -2.810  -62.685 -19.165 1.00 37.70  ? 230 GLY B C   1 
ATOM   5931 O O   . GLY B 1 229 ? -3.434  -63.726 -18.970 1.00 40.25  ? 230 GLY B O   1 
ATOM   5932 N N   . ALA B 1 230 ? -3.382  -61.508 -19.394 1.00 39.96  ? 231 ALA B N   1 
ATOM   5933 C CA  . ALA B 1 230 ? -4.805  -61.265 -19.244 1.00 45.49  ? 231 ALA B CA  1 
ATOM   5934 C C   . ALA B 1 230 ? -5.167  -60.021 -20.031 1.00 40.08  ? 231 ALA B C   1 
ATOM   5935 O O   . ALA B 1 230 ? -4.377  -59.071 -20.084 1.00 39.21  ? 231 ALA B O   1 
ATOM   5936 C CB  . ALA B 1 230 ? -5.163  -61.072 -17.746 1.00 43.11  ? 231 ALA B CB  1 
ATOM   5937 N N   . PRO B 1 231 ? -6.375  -60.003 -20.627 1.00 46.43  ? 232 PRO B N   1 
ATOM   5938 C CA  . PRO B 1 231 ? -6.755  -58.869 -21.472 1.00 42.92  ? 232 PRO B CA  1 
ATOM   5939 C C   . PRO B 1 231 ? -6.895  -57.585 -20.656 1.00 49.48  ? 232 PRO B C   1 
ATOM   5940 O O   . PRO B 1 231 ? -6.767  -56.502 -21.234 1.00 46.71  ? 232 PRO B O   1 
ATOM   5941 C CB  . PRO B 1 231 ? -8.110  -59.306 -22.053 1.00 35.95  ? 232 PRO B CB  1 
ATOM   5942 C CG  . PRO B 1 231 ? -8.681  -60.221 -20.983 1.00 44.58  ? 232 PRO B CG  1 
ATOM   5943 C CD  . PRO B 1 231 ? -7.491  -60.958 -20.442 1.00 41.60  ? 232 PRO B CD  1 
ATOM   5944 N N   . ASN B 1 232 ? -7.150  -57.713 -19.348 1.00 43.78  ? 233 ASN B N   1 
ATOM   5945 C CA  . ASN B 1 232 ? -7.227  -56.569 -18.436 1.00 44.14  ? 233 ASN B CA  1 
ATOM   5946 C C   . ASN B 1 232 ? -5.888  -56.092 -17.857 1.00 48.34  ? 233 ASN B C   1 
ATOM   5947 O O   . ASN B 1 232 ? -5.868  -55.205 -17.013 1.00 47.49  ? 233 ASN B O   1 
ATOM   5948 C CB  . ASN B 1 232 ? -8.193  -56.856 -17.274 1.00 49.39  ? 233 ASN B CB  1 
ATOM   5949 C CG  . ASN B 1 232 ? -7.950  -58.218 -16.629 1.00 50.57  ? 233 ASN B CG  1 
ATOM   5950 O OD1 . ASN B 1 232 ? -7.847  -59.236 -17.319 1.00 45.45  ? 233 ASN B OD1 1 
ATOM   5951 N ND2 . ASN B 1 232 ? -7.866  -58.244 -15.308 1.00 42.41  ? 233 ASN B ND2 1 
ATOM   5952 N N   . GLY B 1 233 ? -4.768  -56.671 -18.280 1.00 45.22  ? 234 GLY B N   1 
ATOM   5953 C CA  . GLY B 1 233 ? -3.473  -56.110 -17.893 1.00 49.33  ? 234 GLY B CA  1 
ATOM   5954 C C   . GLY B 1 233 ? -3.278  -54.660 -18.366 1.00 52.45  ? 234 GLY B C   1 
ATOM   5955 O O   . GLY B 1 233 ? -3.662  -54.326 -19.494 1.00 52.26  ? 234 GLY B O   1 
ATOM   5956 N N   . PRO B 1 234 ? -2.660  -53.798 -17.524 1.00 43.52  ? 235 PRO B N   1 
ATOM   5957 C CA  . PRO B 1 234 ? -2.472  -52.370 -17.837 1.00 41.20  ? 235 PRO B CA  1 
ATOM   5958 C C   . PRO B 1 234 ? -1.560  -52.066 -19.051 1.00 46.21  ? 235 PRO B C   1 
ATOM   5959 O O   . PRO B 1 234 ? -1.464  -50.907 -19.454 1.00 43.44  ? 235 PRO B O   1 
ATOM   5960 C CB  . PRO B 1 234 ? -1.817  -51.822 -16.569 1.00 41.56  ? 235 PRO B CB  1 
ATOM   5961 C CG  . PRO B 1 234 ? -1.055  -52.996 -16.014 1.00 44.02  ? 235 PRO B CG  1 
ATOM   5962 C CD  . PRO B 1 234 ? -1.925  -54.194 -16.303 1.00 40.86  ? 235 PRO B CD  1 
ATOM   5963 N N   . TRP B 1 235 ? -0.893  -53.079 -19.600 1.00 44.79  ? 236 TRP B N   1 
ATOM   5964 C CA  . TRP B 1 235 ? -0.059  -52.927 -20.800 1.00 39.75  ? 236 TRP B CA  1 
ATOM   5965 C C   . TRP B 1 235 ? -0.804  -53.405 -22.051 1.00 43.33  ? 236 TRP B C   1 
ATOM   5966 O O   . TRP B 1 235 ? -0.348  -53.186 -23.177 1.00 43.27  ? 236 TRP B O   1 
ATOM   5967 C CB  . TRP B 1 235 ? 1.213   -53.764 -20.642 1.00 32.26  ? 236 TRP B CB  1 
ATOM   5968 C CG  . TRP B 1 235 ? 0.874   -55.156 -20.179 1.00 39.31  ? 236 TRP B CG  1 
ATOM   5969 C CD1 . TRP B 1 235 ? 0.766   -55.589 -18.880 1.00 39.07  ? 236 TRP B CD1 1 
ATOM   5970 C CD2 . TRP B 1 235 ? 0.565   -56.282 -21.000 1.00 34.66  ? 236 TRP B CD2 1 
ATOM   5971 N NE1 . TRP B 1 235 ? 0.432   -56.921 -18.853 1.00 43.40  ? 236 TRP B NE1 1 
ATOM   5972 C CE2 . TRP B 1 235 ? 0.301   -57.370 -20.140 1.00 35.91  ? 236 TRP B CE2 1 
ATOM   5973 C CE3 . TRP B 1 235 ? 0.510   -56.485 -22.388 1.00 44.12  ? 236 TRP B CE3 1 
ATOM   5974 C CZ2 . TRP B 1 235 ? -0.022  -58.636 -20.616 1.00 39.97  ? 236 TRP B CZ2 1 
ATOM   5975 C CZ3 . TRP B 1 235 ? 0.184   -57.733 -22.859 1.00 42.77  ? 236 TRP B CZ3 1 
ATOM   5976 C CH2 . TRP B 1 235 ? -0.075  -58.800 -21.974 1.00 49.61  ? 236 TRP B CH2 1 
ATOM   5977 N N   . ALA B 1 236 ? -1.953  -54.051 -21.852 1.00 39.14  ? 237 ALA B N   1 
ATOM   5978 C CA  . ALA B 1 236 ? -2.572  -54.841 -22.911 1.00 42.03  ? 237 ALA B CA  1 
ATOM   5979 C C   . ALA B 1 236 ? -3.491  -54.059 -23.842 1.00 48.24  ? 237 ALA B C   1 
ATOM   5980 O O   . ALA B 1 236 ? -3.714  -54.464 -24.973 1.00 47.32  ? 237 ALA B O   1 
ATOM   5981 C CB  . ALA B 1 236 ? -3.333  -56.032 -22.320 1.00 42.39  ? 237 ALA B CB  1 
ATOM   5982 N N   . THR B 1 237 ? -4.067  -52.973 -23.355 1.00 43.10  ? 238 THR B N   1 
ATOM   5983 C CA  . THR B 1 237 ? -4.944  -52.163 -24.184 1.00 45.38  ? 238 THR B CA  1 
ATOM   5984 C C   . THR B 1 237 ? -4.588  -50.711 -23.959 1.00 44.55  ? 238 THR B C   1 
ATOM   5985 O O   . THR B 1 237 ? -3.902  -50.377 -23.000 1.00 39.35  ? 238 THR B O   1 
ATOM   5986 C CB  . THR B 1 237 ? -6.440  -52.356 -23.836 1.00 49.37  ? 238 THR B CB  1 
ATOM   5987 O OG1 . THR B 1 237 ? -6.680  -51.952 -22.481 1.00 45.18  ? 238 THR B OG1 1 
ATOM   5988 C CG2 . THR B 1 237 ? -6.847  -53.807 -24.002 1.00 44.75  ? 238 THR B CG2 1 
ATOM   5989 N N   . VAL B 1 238 ? -5.055  -49.856 -24.856 1.00 43.04  ? 239 VAL B N   1 
ATOM   5990 C CA  . VAL B 1 238 ? -4.817  -48.433 -24.743 1.00 42.53  ? 239 VAL B CA  1 
ATOM   5991 C C   . VAL B 1 238 ? -6.134  -47.740 -25.124 1.00 42.09  ? 239 VAL B C   1 
ATOM   5992 O O   . VAL B 1 238 ? -6.922  -48.311 -25.885 1.00 44.59  ? 239 VAL B O   1 
ATOM   5993 C CB  . VAL B 1 238 ? -3.634  -48.049 -25.654 1.00 50.46  ? 239 VAL B CB  1 
ATOM   5994 C CG1 . VAL B 1 238 ? -4.046  -48.030 -27.163 1.00 37.52  ? 239 VAL B CG1 1 
ATOM   5995 C CG2 . VAL B 1 238 ? -3.011  -46.777 -25.215 1.00 48.89  ? 239 VAL B CG2 1 
ATOM   5996 N N   . GLY B 1 239 ? -6.400  -46.551 -24.568 1.00 45.24  ? 240 GLY B N   1 
ATOM   5997 C CA  . GLY B 1 239 ? -7.579  -45.782 -24.941 1.00 43.16  ? 240 GLY B CA  1 
ATOM   5998 C C   . GLY B 1 239 ? -7.434  -45.132 -26.329 1.00 50.08  ? 240 GLY B C   1 
ATOM   5999 O O   . GLY B 1 239 ? -6.341  -45.083 -26.886 1.00 44.00  ? 240 GLY B O   1 
ATOM   6000 N N   . MET B 1 240 ? -8.526  -44.601 -26.879 1.00 47.00  ? 241 MET B N   1 
ATOM   6001 C CA  . MET B 1 240 ? -8.513  -44.031 -28.234 1.00 50.14  ? 241 MET B CA  1 
ATOM   6002 C C   . MET B 1 240 ? -7.587  -42.824 -28.382 1.00 53.85  ? 241 MET B C   1 
ATOM   6003 O O   . MET B 1 240 ? -6.853  -42.694 -29.380 1.00 47.98  ? 241 MET B O   1 
ATOM   6004 C CB  . MET B 1 240 ? -9.927  -43.649 -28.662 1.00 50.92  ? 241 MET B CB  1 
ATOM   6005 C CG  . MET B 1 240 ? -10.762 -44.831 -29.115 1.00 55.13  ? 241 MET B CG  1 
ATOM   6006 S SD  . MET B 1 240 ? -12.481 -44.392 -29.415 1.00 69.04  ? 241 MET B SD  1 
ATOM   6007 C CE  . MET B 1 240 ? -12.909 -43.699 -27.838 1.00 65.50  ? 241 MET B CE  1 
ATOM   6008 N N   . GLY B 1 241 ? -7.615  -41.954 -27.378 1.00 46.01  ? 242 GLY B N   1 
ATOM   6009 C CA  . GLY B 1 241 ? -6.849  -40.723 -27.405 1.00 43.59  ? 242 GLY B CA  1 
ATOM   6010 C C   . GLY B 1 241 ? -5.356  -40.983 -27.362 1.00 49.10  ? 242 GLY B C   1 
ATOM   6011 O O   . GLY B 1 241 ? -4.575  -40.372 -28.106 1.00 49.98  ? 242 GLY B O   1 
ATOM   6012 N N   . GLU B 1 242 ? -4.954  -41.903 -26.496 1.00 47.68  ? 243 GLU B N   1 
ATOM   6013 C CA  . GLU B 1 242 ? -3.541  -42.267 -26.388 1.00 56.33  ? 243 GLU B CA  1 
ATOM   6014 C C   . GLU B 1 242 ? -3.044  -43.033 -27.641 1.00 42.80  ? 243 GLU B C   1 
ATOM   6015 O O   . GLU B 1 242 ? -1.905  -42.858 -28.058 1.00 47.38  ? 243 GLU B O   1 
ATOM   6016 C CB  . GLU B 1 242 ? -3.274  -43.047 -25.093 1.00 47.72  ? 243 GLU B CB  1 
ATOM   6017 C CG  . GLU B 1 242 ? -1.813  -43.531 -24.891 1.00 47.88  ? 243 GLU B CG  1 
ATOM   6018 C CD  . GLU B 1 242 ? -0.785  -42.412 -24.776 1.00 44.97  ? 243 GLU B CD  1 
ATOM   6019 O OE1 . GLU B 1 242 ? -1.178  -41.238 -24.661 1.00 53.08  ? 243 GLU B OE1 1 
ATOM   6020 O OE2 . GLU B 1 242 ? 0.437   -42.707 -24.796 1.00 47.24  ? 243 GLU B OE2 1 
ATOM   6021 N N   . ALA B 1 243 ? -3.890  -43.873 -28.226 1.00 39.71  ? 244 ALA B N   1 
ATOM   6022 C CA  . ALA B 1 243 ? -3.517  -44.554 -29.479 1.00 48.36  ? 244 ALA B CA  1 
ATOM   6023 C C   . ALA B 1 243 ? -3.350  -43.532 -30.605 1.00 47.48  ? 244 ALA B C   1 
ATOM   6024 O O   . ALA B 1 243 ? -2.401  -43.618 -31.400 1.00 50.09  ? 244 ALA B O   1 
ATOM   6025 C CB  . ALA B 1 243 ? -4.535  -45.624 -29.866 1.00 39.01  ? 244 ALA B CB  1 
ATOM   6026 N N   . ARG B 1 244 ? -4.237  -42.537 -30.646 1.00 48.73  ? 245 ARG B N   1 
ATOM   6027 C CA  . ARG B 1 244 ? -4.101  -41.466 -31.632 1.00 41.38  ? 245 ARG B CA  1 
ATOM   6028 C C   . ARG B 1 244 ? -2.822  -40.687 -31.398 1.00 46.02  ? 245 ARG B C   1 
ATOM   6029 O O   . ARG B 1 244 ? -2.114  -40.351 -32.341 1.00 50.02  ? 245 ARG B O   1 
ATOM   6030 C CB  . ARG B 1 244 ? -5.308  -40.513 -31.635 1.00 51.55  ? 245 ARG B CB  1 
ATOM   6031 C CG  . ARG B 1 244 ? -5.116  -39.269 -32.526 1.00 48.54  ? 245 ARG B CG  1 
ATOM   6032 C CD  . ARG B 1 244 ? -6.439  -38.629 -32.959 1.00 47.37  ? 245 ARG B CD  1 
ATOM   6033 N NE  . ARG B 1 244 ? -7.330  -39.511 -33.713 1.00 45.92  ? 245 ARG B NE  1 
ATOM   6034 C CZ  . ARG B 1 244 ? -7.400  -39.565 -35.048 1.00 53.08  ? 245 ARG B CZ  1 
ATOM   6035 N NH1 . ARG B 1 244 ? -6.607  -38.806 -35.801 1.00 39.61  ? 245 ARG B NH1 1 
ATOM   6036 N NH2 . ARG B 1 244 ? -8.256  -40.396 -35.636 1.00 42.07  ? 245 ARG B NH2 1 
ATOM   6037 N N   . ARG B 1 245 ? -2.518  -40.399 -30.142 1.00 49.31  ? 246 ARG B N   1 
ATOM   6038 C CA  . ARG B 1 245 ? -1.339  -39.601 -29.849 1.00 49.02  ? 246 ARG B CA  1 
ATOM   6039 C C   . ARG B 1 245 ? -0.068  -40.331 -30.295 1.00 47.26  ? 246 ARG B C   1 
ATOM   6040 O O   . ARG B 1 245 ? 0.832   -39.723 -30.867 1.00 49.77  ? 246 ARG B O   1 
ATOM   6041 C CB  . ARG B 1 245 ? -1.243  -39.261 -28.356 1.00 50.58  ? 246 ARG B CB  1 
ATOM   6042 C CG  . ARG B 1 245 ? -0.111  -38.271 -28.050 1.00 44.98  ? 246 ARG B CG  1 
ATOM   6043 C CD  . ARG B 1 245 ? 0.233   -38.229 -26.566 1.00 52.74  ? 246 ARG B CD  1 
ATOM   6044 N NE  . ARG B 1 245 ? 0.795   -39.493 -26.107 1.00 55.67  ? 246 ARG B NE  1 
ATOM   6045 C CZ  . ARG B 1 245 ? 2.045   -39.895 -26.333 1.00 58.19  ? 246 ARG B CZ  1 
ATOM   6046 N NH1 . ARG B 1 245 ? 2.894   -39.137 -27.029 1.00 54.69  ? 246 ARG B NH1 1 
ATOM   6047 N NH2 . ARG B 1 245 ? 2.446   -41.066 -25.858 1.00 53.42  ? 246 ARG B NH2 1 
ATOM   6048 N N   . ARG B 1 246 ? -0.006  -41.632 -30.008 1.00 44.51  ? 247 ARG B N   1 
ATOM   6049 C CA  . ARG B 1 246 ? 1.148   -42.457 -30.349 1.00 44.31  ? 247 ARG B CA  1 
ATOM   6050 C C   . ARG B 1 246 ? 1.323   -42.618 -31.886 1.00 44.96  ? 247 ARG B C   1 
ATOM   6051 O O   . ARG B 1 246 ? 2.431   -42.541 -32.396 1.00 43.95  ? 247 ARG B O   1 
ATOM   6052 C CB  . ARG B 1 246 ? 1.035   -43.818 -29.665 1.00 41.62  ? 247 ARG B CB  1 
ATOM   6053 C CG  . ARG B 1 246 ? 1.211   -43.764 -28.128 1.00 39.88  ? 247 ARG B CG  1 
ATOM   6054 C CD  . ARG B 1 246 ? 1.073   -45.157 -27.507 1.00 40.09  ? 247 ARG B CD  1 
ATOM   6055 N NE  . ARG B 1 246 ? 1.053   -45.121 -26.036 1.00 39.14  ? 247 ARG B NE  1 
ATOM   6056 C CZ  . ARG B 1 246 ? 1.048   -46.200 -25.267 1.00 48.52  ? 247 ARG B CZ  1 
ATOM   6057 N NH1 . ARG B 1 246 ? 1.097   -47.411 -25.825 1.00 39.89  ? 247 ARG B NH1 1 
ATOM   6058 N NH2 . ARG B 1 246 ? 0.999   -46.074 -23.936 1.00 39.40  ? 247 ARG B NH2 1 
ATOM   6059 N N   . ALA B 1 247 ? 0.218   -42.825 -32.599 1.00 42.65  ? 248 ALA B N   1 
ATOM   6060 C CA  . ALA B 1 247 ? 0.225   -42.946 -34.052 1.00 49.15  ? 248 ALA B CA  1 
ATOM   6061 C C   . ALA B 1 247 ? 0.708   -41.642 -34.671 1.00 56.93  ? 248 ALA B C   1 
ATOM   6062 O O   . ALA B 1 247 ? 1.552   -41.630 -35.578 1.00 52.48  ? 248 ALA B O   1 
ATOM   6063 C CB  . ALA B 1 247 ? -1.182  -43.279 -34.554 1.00 41.91  ? 248 ALA B CB  1 
ATOM   6064 N N   . THR B 1 248 ? 0.171   -40.541 -34.154 1.00 51.80  ? 249 THR B N   1 
ATOM   6065 C CA  . THR B 1 248 ? 0.485   -39.214 -34.659 1.00 47.67  ? 249 THR B CA  1 
ATOM   6066 C C   . THR B 1 248 ? 1.955   -38.864 -34.437 1.00 53.91  ? 249 THR B C   1 
ATOM   6067 O O   . THR B 1 248 ? 2.593   -38.278 -35.314 1.00 51.50  ? 249 THR B O   1 
ATOM   6068 C CB  . THR B 1 248 ? -0.457  -38.146 -34.053 1.00 56.54  ? 249 THR B CB  1 
ATOM   6069 O OG1 . THR B 1 248 ? -1.806  -38.453 -34.423 1.00 48.88  ? 249 THR B OG1 1 
ATOM   6070 C CG2 . THR B 1 248 ? -0.122  -36.758 -34.562 1.00 51.52  ? 249 THR B CG2 1 
ATOM   6071 N N   A GLN B 1 249 ? 2.497   -39.232 -33.277 0.54 51.04  ? 250 GLN B N   1 
ATOM   6072 N N   B GLN B 1 249 ? 2.502   -39.243 -33.286 0.46 51.05  ? 250 GLN B N   1 
ATOM   6073 C CA  A GLN B 1 249 ? 3.915   -38.987 -33.008 0.54 52.49  ? 250 GLN B CA  1 
ATOM   6074 C CA  B GLN B 1 249 ? 3.914   -38.977 -33.019 0.46 52.50  ? 250 GLN B CA  1 
ATOM   6075 C C   A GLN B 1 249 ? 4.825   -39.811 -33.924 0.54 53.23  ? 250 GLN B C   1 
ATOM   6076 C C   B GLN B 1 249 ? 4.845   -39.822 -33.898 0.46 53.23  ? 250 GLN B C   1 
ATOM   6077 O O   A GLN B 1 249 ? 5.841   -39.309 -34.409 0.54 51.23  ? 250 GLN B O   1 
ATOM   6078 O O   B GLN B 1 249 ? 5.891   -39.344 -34.339 0.46 51.28  ? 250 GLN B O   1 
ATOM   6079 C CB  A GLN B 1 249 ? 4.277   -39.242 -31.544 0.54 52.47  ? 250 GLN B CB  1 
ATOM   6080 C CB  B GLN B 1 249 ? 4.246   -39.156 -31.538 0.46 52.49  ? 250 GLN B CB  1 
ATOM   6081 C CG  A GLN B 1 249 ? 5.735   -38.900 -31.232 0.54 54.93  ? 250 GLN B CG  1 
ATOM   6082 C CG  B GLN B 1 249 ? 5.647   -38.684 -31.148 0.46 55.15  ? 250 GLN B CG  1 
ATOM   6083 C CD  A GLN B 1 249 ? 6.102   -39.077 -29.771 0.54 57.68  ? 250 GLN B CD  1 
ATOM   6084 C CD  B GLN B 1 249 ? 5.900   -37.208 -31.447 0.46 58.59  ? 250 GLN B CD  1 
ATOM   6085 O OE1 A GLN B 1 249 ? 5.259   -39.421 -28.942 0.54 55.29  ? 250 GLN B OE1 1 
ATOM   6086 O OE1 B GLN B 1 249 ? 4.968   -36.430 -31.680 0.46 59.43  ? 250 GLN B OE1 1 
ATOM   6087 N NE2 A GLN B 1 249 ? 7.372   -38.844 -29.448 0.54 61.62  ? 250 GLN B NE2 1 
ATOM   6088 N NE2 B GLN B 1 249 ? 7.173   -36.819 -31.445 0.46 61.93  ? 250 GLN B NE2 1 
ATOM   6089 N N   . LEU B 1 250 ? 4.460   -41.072 -34.149 1.00 48.03  ? 251 LEU B N   1 
ATOM   6090 C CA  . LEU B 1 250 ? 5.220   -41.941 -35.040 1.00 48.64  ? 251 LEU B CA  1 
ATOM   6091 C C   . LEU B 1 250 ? 5.276   -41.295 -36.420 1.00 48.71  ? 251 LEU B C   1 
ATOM   6092 O O   . LEU B 1 250 ? 6.350   -41.078 -36.960 1.00 48.11  ? 251 LEU B O   1 
ATOM   6093 C CB  . LEU B 1 250 ? 4.593   -43.340 -35.154 1.00 50.52  ? 251 LEU B CB  1 
ATOM   6094 C CG  . LEU B 1 250 ? 5.332   -44.278 -36.128 1.00 51.23  ? 251 LEU B CG  1 
ATOM   6095 C CD1 . LEU B 1 250 ? 6.659   -44.719 -35.537 1.00 55.36  ? 251 LEU B CD1 1 
ATOM   6096 C CD2 . LEU B 1 250 ? 4.518   -45.492 -36.521 1.00 45.93  ? 251 LEU B CD2 1 
ATOM   6097 N N   . ALA B 1 251 ? 4.111   -40.958 -36.965 1.00 52.39  ? 252 ALA B N   1 
ATOM   6098 C CA  . ALA B 1 251 ? 4.047   -40.272 -38.253 1.00 46.80  ? 252 ALA B CA  1 
ATOM   6099 C C   . ALA B 1 251 ? 4.931   -39.032 -38.275 1.00 57.07  ? 252 ALA B C   1 
ATOM   6100 O O   . ALA B 1 251 ? 5.700   -38.829 -39.218 1.00 54.02  ? 252 ALA B O   1 
ATOM   6101 C CB  . ALA B 1 251 ? 2.617   -39.916 -38.607 1.00 46.75  ? 252 ALA B CB  1 
ATOM   6102 N N   . HIS B 1 252 ? 4.827   -38.215 -37.229 1.00 51.77  ? 253 HIS B N   1 
ATOM   6103 C CA  . HIS B 1 252 ? 5.643   -37.014 -37.122 1.00 54.98  ? 253 HIS B CA  1 
ATOM   6104 C C   . HIS B 1 252 ? 7.143   -37.341 -37.170 1.00 55.56  ? 253 HIS B C   1 
ATOM   6105 O O   . HIS B 1 252 ? 7.912   -36.678 -37.860 1.00 59.36  ? 253 HIS B O   1 
ATOM   6106 C CB  . HIS B 1 252 ? 5.306   -36.256 -35.832 1.00 59.37  ? 253 HIS B CB  1 
ATOM   6107 C CG  . HIS B 1 252 ? 6.162   -35.047 -35.599 1.00 60.88  ? 253 HIS B CG  1 
ATOM   6108 N ND1 . HIS B 1 252 ? 5.918   -33.832 -36.204 1.00 65.47  ? 253 HIS B ND1 1 
ATOM   6109 C CD2 . HIS B 1 252 ? 7.272   -34.874 -34.842 1.00 69.34  ? 253 HIS B CD2 1 
ATOM   6110 C CE1 . HIS B 1 252 ? 6.833   -32.959 -35.820 1.00 67.38  ? 253 HIS B CE1 1 
ATOM   6111 N NE2 . HIS B 1 252 ? 7.667   -33.566 -34.993 1.00 72.19  ? 253 HIS B NE2 1 
ATOM   6112 N N   . LEU B 1 253 ? 7.556   -38.370 -36.440 1.00 58.15  ? 254 LEU B N   1 
ATOM   6113 C CA  . LEU B 1 253 ? 8.968   -38.732 -36.370 1.00 56.67  ? 254 LEU B CA  1 
ATOM   6114 C C   . LEU B 1 253 ? 9.522   -39.296 -37.691 1.00 59.69  ? 254 LEU B C   1 
ATOM   6115 O O   . LEU B 1 253 ? 10.732  -39.411 -37.852 1.00 56.65  ? 254 LEU B O   1 
ATOM   6116 C CB  . LEU B 1 253 ? 9.214   -39.730 -35.241 1.00 55.99  ? 254 LEU B CB  1 
ATOM   6117 C CG  . LEU B 1 253 ? 9.110   -39.239 -33.797 1.00 58.19  ? 254 LEU B CG  1 
ATOM   6118 C CD1 . LEU B 1 253 ? 9.248   -40.431 -32.865 1.00 53.44  ? 254 LEU B CD1 1 
ATOM   6119 C CD2 . LEU B 1 253 ? 10.183  -38.206 -33.484 1.00 52.79  ? 254 LEU B CD2 1 
ATOM   6120 N N   . VAL B 1 254 ? 8.650   -39.654 -38.629 1.00 55.25  ? 255 VAL B N   1 
ATOM   6121 C CA  . VAL B 1 254 ? 9.133   -40.172 -39.901 1.00 59.76  ? 255 VAL B CA  1 
ATOM   6122 C C   . VAL B 1 254 ? 8.722   -39.281 -41.078 1.00 58.27  ? 255 VAL B C   1 
ATOM   6123 O O   . VAL B 1 254 ? 8.709   -39.726 -42.221 1.00 59.59  ? 255 VAL B O   1 
ATOM   6124 C CB  . VAL B 1 254 ? 8.708   -41.653 -40.129 1.00 53.10  ? 255 VAL B CB  1 
ATOM   6125 C CG1 . VAL B 1 254 ? 9.133   -42.518 -38.932 1.00 51.51  ? 255 VAL B CG1 1 
ATOM   6126 C CG2 . VAL B 1 254 ? 7.209   -41.766 -40.369 1.00 46.16  ? 255 VAL B CG2 1 
ATOM   6127 N N   . GLY B 1 255 ? 8.381   -38.026 -40.785 1.00 60.65  ? 256 GLY B N   1 
ATOM   6128 C CA  . GLY B 1 255 ? 8.133   -37.027 -41.812 1.00 49.16  ? 256 GLY B CA  1 
ATOM   6129 C C   . GLY B 1 255 ? 6.711   -36.894 -42.323 1.00 62.52  ? 256 GLY B C   1 
ATOM   6130 O O   . GLY B 1 255 ? 6.480   -36.343 -43.398 1.00 71.11  ? 256 GLY B O   1 
ATOM   6131 N N   . CYS B 1 256 ? 5.747   -37.392 -41.568 1.00 57.37  ? 257 CYS B N   1 
ATOM   6132 C CA  . CYS B 1 256 ? 4.355   -37.331 -42.006 1.00 60.82  ? 257 CYS B CA  1 
ATOM   6133 C C   . CYS B 1 256 ? 3.503   -36.577 -40.979 1.00 71.42  ? 257 CYS B C   1 
ATOM   6134 O O   . CYS B 1 256 ? 3.592   -36.847 -39.788 1.00 70.26  ? 257 CYS B O   1 
ATOM   6135 C CB  . CYS B 1 256 ? 3.782   -38.736 -42.199 1.00 50.33  ? 257 CYS B CB  1 
ATOM   6136 S SG  . CYS B 1 256 ? 4.805   -39.875 -43.149 1.00 57.93  ? 257 CYS B SG  1 
ATOM   6137 N N   . PRO B 1 257 ? 2.691   -35.608 -41.435 1.00 84.95  ? 258 PRO B N   1 
ATOM   6138 C CA  . PRO B 1 257 ? 2.675   -35.151 -42.827 1.00 72.01  ? 258 PRO B CA  1 
ATOM   6139 C C   . PRO B 1 257 ? 3.807   -34.160 -43.014 1.00 79.17  ? 258 PRO B C   1 
ATOM   6140 O O   . PRO B 1 257 ? 4.283   -33.610 -42.011 1.00 73.90  ? 258 PRO B O   1 
ATOM   6141 C CB  . PRO B 1 257 ? 1.335   -34.434 -42.929 1.00 71.43  ? 258 PRO B CB  1 
ATOM   6142 C CG  . PRO B 1 257 ? 1.135   -33.873 -41.558 1.00 75.59  ? 258 PRO B CG  1 
ATOM   6143 C CD  . PRO B 1 257 ? 1.685   -34.908 -40.614 1.00 69.40  ? 258 PRO B CD  1 
ATOM   6144 N N   . PRO B 1 258 ? 4.242   -33.947 -44.270 1.00 83.08  ? 259 PRO B N   1 
ATOM   6145 C CA  . PRO B 1 258 ? 5.316   -32.999 -44.579 1.00 75.76  ? 259 PRO B CA  1 
ATOM   6146 C C   . PRO B 1 258 ? 4.989   -31.596 -44.077 1.00 61.20  ? 259 PRO B C   1 
ATOM   6147 O O   . PRO B 1 258 ? 5.769   -31.083 -43.278 1.00 66.78  ? 259 PRO B O   1 
ATOM   6148 C CB  . PRO B 1 258 ? 5.364   -33.016 -46.114 1.00 82.48  ? 259 PRO B CB  1 
ATOM   6149 C CG  . PRO B 1 258 ? 4.833   -34.356 -46.492 1.00 77.41  ? 259 PRO B CG  1 
ATOM   6150 C CD  . PRO B 1 258 ? 3.755   -34.638 -45.480 1.00 81.47  ? 259 PRO B CD  1 
ATOM   6151 N N   . THR B 1 261 ? 2.302   -32.539 -38.246 1.00 83.57  ? 262 THR B N   1 
ATOM   6152 C CA  . THR B 1 261 ? 1.546   -33.239 -37.203 1.00 80.99  ? 262 THR B CA  1 
ATOM   6153 C C   . THR B 1 261 ? 0.045   -33.277 -37.514 1.00 62.72  ? 262 THR B C   1 
ATOM   6154 O O   . THR B 1 261 ? -0.548  -32.268 -37.888 1.00 70.79  ? 262 THR B O   1 
ATOM   6155 C CB  . THR B 1 261 ? 1.761   -32.598 -35.794 1.00 86.51  ? 262 THR B CB  1 
ATOM   6156 O OG1 . THR B 1 261 ? 3.161   -32.516 -35.498 1.00 89.05  ? 262 THR B OG1 1 
ATOM   6157 C CG2 . THR B 1 261 ? 1.070   -33.416 -34.704 1.00 72.01  ? 262 THR B CG2 1 
ATOM   6158 N N   . GLY B 1 262 ? -0.560  -34.451 -37.367 1.00 71.26  ? 263 GLY B N   1 
ATOM   6159 C CA  . GLY B 1 262 ? -1.997  -34.597 -37.517 1.00 69.07  ? 263 GLY B CA  1 
ATOM   6160 C C   . GLY B 1 262 ? -2.485  -34.276 -38.910 1.00 73.72  ? 263 GLY B C   1 
ATOM   6161 O O   . GLY B 1 262 ? -1.833  -34.633 -39.891 1.00 67.00  ? 263 GLY B O   1 
ATOM   6162 N N   . GLY B 1 263 ? -3.631  -33.600 -38.996 1.00 73.02  ? 264 GLY B N   1 
ATOM   6163 C CA  . GLY B 1 263 ? -4.250  -33.292 -40.280 1.00 69.81  ? 264 GLY B CA  1 
ATOM   6164 C C   . GLY B 1 263 ? -5.248  -34.356 -40.709 1.00 73.19  ? 264 GLY B C   1 
ATOM   6165 O O   . GLY B 1 263 ? -5.731  -35.126 -39.871 1.00 69.07  ? 264 GLY B O   1 
ATOM   6166 N N   . ASN B 1 264 ? -5.561  -34.382 -42.007 1.00 62.37  ? 265 ASN B N   1 
ATOM   6167 C CA  . ASN B 1 264 ? -6.394  -35.414 -42.628 1.00 56.53  ? 265 ASN B CA  1 
ATOM   6168 C C   . ASN B 1 264 ? -5.854  -36.818 -42.307 1.00 53.64  ? 265 ASN B C   1 
ATOM   6169 O O   . ASN B 1 264 ? -4.688  -37.111 -42.591 1.00 51.40  ? 265 ASN B O   1 
ATOM   6170 C CB  . ASN B 1 264 ? -6.402  -35.175 -44.163 1.00 65.35  ? 265 ASN B CB  1 
ATOM   6171 C CG  . ASN B 1 264 ? -7.423  -36.042 -44.922 1.00 60.53  ? 265 ASN B CG  1 
ATOM   6172 O OD1 . ASN B 1 264 ? -7.597  -37.224 -44.634 1.00 63.77  ? 265 ASN B OD1 1 
ATOM   6173 N ND2 . ASN B 1 264 ? -8.086  -35.448 -45.918 1.00 81.97  ? 265 ASN B ND2 1 
ATOM   6174 N N   . ASP B 1 265 ? -6.689  -37.685 -41.732 1.00 52.65  ? 266 ASP B N   1 
ATOM   6175 C CA  . ASP B 1 265 ? -6.277  -39.072 -41.477 1.00 55.37  ? 266 ASP B CA  1 
ATOM   6176 C C   . ASP B 1 265 ? -5.863  -39.801 -42.783 1.00 57.77  ? 266 ASP B C   1 
ATOM   6177 O O   . ASP B 1 265 ? -4.806  -40.435 -42.840 1.00 53.51  ? 266 ASP B O   1 
ATOM   6178 C CB  . ASP B 1 265 ? -7.371  -39.863 -40.740 1.00 48.64  ? 266 ASP B CB  1 
ATOM   6179 C CG  . ASP B 1 265 ? -7.312  -39.700 -39.190 1.00 58.13  ? 266 ASP B CG  1 
ATOM   6180 O OD1 . ASP B 1 265 ? -6.260  -39.320 -38.634 1.00 45.06  ? 266 ASP B OD1 1 
ATOM   6181 O OD2 . ASP B 1 265 ? -8.336  -39.974 -38.520 1.00 54.43  ? 266 ASP B OD2 1 
ATOM   6182 N N   . THR B 1 266 ? -6.699  -39.704 -43.818 1.00 60.54  ? 267 THR B N   1 
ATOM   6183 C CA  . THR B 1 266 ? -6.419  -40.333 -45.119 1.00 50.69  ? 267 THR B CA  1 
ATOM   6184 C C   . THR B 1 266 ? -5.027  -39.967 -45.654 1.00 52.92  ? 267 THR B C   1 
ATOM   6185 O O   . THR B 1 266 ? -4.263  -40.843 -46.081 1.00 55.10  ? 267 THR B O   1 
ATOM   6186 C CB  . THR B 1 266 ? -7.514  -40.008 -46.157 1.00 57.60  ? 267 THR B CB  1 
ATOM   6187 O OG1 . THR B 1 266 ? -8.747  -40.620 -45.749 1.00 52.14  ? 267 THR B OG1 1 
ATOM   6188 C CG2 . THR B 1 266 ? -7.125  -40.542 -47.564 1.00 47.47  ? 267 THR B CG2 1 
ATOM   6189 N N   . GLU B 1 267 ? -4.685  -38.684 -45.587 1.00 51.93  ? 268 GLU B N   1 
ATOM   6190 C CA  . GLU B 1 267 ? -3.372  -38.224 -46.024 1.00 52.64  ? 268 GLU B CA  1 
ATOM   6191 C C   . GLU B 1 267 ? -2.246  -38.732 -45.144 1.00 54.52  ? 268 GLU B C   1 
ATOM   6192 O O   . GLU B 1 267 ? -1.190  -39.090 -45.638 1.00 50.53  ? 268 GLU B O   1 
ATOM   6193 C CB  . GLU B 1 267 ? -3.320  -36.695 -46.088 1.00 53.04  ? 268 GLU B CB  1 
ATOM   6194 C CG  . GLU B 1 267 ? -4.088  -36.135 -47.293 1.00 84.14  ? 268 GLU B CG  1 
ATOM   6195 C CD  . GLU B 1 267 ? -4.219  -34.617 -47.268 1.00 92.45  ? 268 GLU B CD  1 
ATOM   6196 O OE1 . GLU B 1 267 ? -3.418  -33.959 -46.564 1.00 90.06  ? 268 GLU B OE1 1 
ATOM   6197 O OE2 . GLU B 1 267 ? -5.130  -34.089 -47.950 1.00 87.37  ? 268 GLU B OE2 1 
ATOM   6198 N N   . LEU B 1 268 ? -2.457  -38.731 -43.831 1.00 51.69  ? 269 LEU B N   1 
ATOM   6199 C CA  . LEU B 1 268 ? -1.400  -39.144 -42.925 1.00 44.96  ? 269 LEU B CA  1 
ATOM   6200 C C   . LEU B 1 268 ? -1.060  -40.616 -43.133 1.00 45.32  ? 269 LEU B C   1 
ATOM   6201 O O   . LEU B 1 268 ? 0.108   -40.999 -43.148 1.00 47.98  ? 269 LEU B O   1 
ATOM   6202 C CB  . LEU B 1 268 ? -1.815  -38.885 -41.468 1.00 55.28  ? 269 LEU B CB  1 
ATOM   6203 C CG  . LEU B 1 268 ? -0.674  -38.958 -40.456 1.00 53.47  ? 269 LEU B CG  1 
ATOM   6204 C CD1 . LEU B 1 268 ? -0.770  -37.826 -39.469 1.00 69.88  ? 269 LEU B CD1 1 
ATOM   6205 C CD2 . LEU B 1 268 ? -0.729  -40.290 -39.756 1.00 68.73  ? 269 LEU B CD2 1 
ATOM   6206 N N   . VAL B 1 269 ? -2.091  -41.440 -43.287 1.00 39.35  ? 270 VAL B N   1 
ATOM   6207 C CA  . VAL B 1 269 ? -1.892  -42.861 -43.499 1.00 50.37  ? 270 VAL B CA  1 
ATOM   6208 C C   . VAL B 1 269 ? -1.251  -43.122 -44.874 1.00 60.31  ? 270 VAL B C   1 
ATOM   6209 O O   . VAL B 1 269 ? -0.372  -43.977 -45.004 1.00 51.29  ? 270 VAL B O   1 
ATOM   6210 C CB  . VAL B 1 269 ? -3.216  -43.643 -43.319 1.00 52.56  ? 270 VAL B CB  1 
ATOM   6211 C CG1 . VAL B 1 269 ? -3.044  -45.108 -43.668 1.00 47.99  ? 270 VAL B CG1 1 
ATOM   6212 C CG2 . VAL B 1 269 ? -3.722  -43.489 -41.865 1.00 46.63  ? 270 VAL B CG2 1 
ATOM   6213 N N   . ALA B 1 270 ? -1.655  -42.372 -45.894 1.00 48.51  ? 271 ALA B N   1 
ATOM   6214 C CA  . ALA B 1 270 ? -1.081  -42.611 -47.218 1.00 53.89  ? 271 ALA B CA  1 
ATOM   6215 C C   . ALA B 1 270 ? 0.424   -42.318 -47.200 1.00 56.15  ? 271 ALA B C   1 
ATOM   6216 O O   . ALA B 1 270 ? 1.211   -43.055 -47.799 1.00 54.45  ? 271 ALA B O   1 
ATOM   6217 C CB  . ALA B 1 270 ? -1.797  -41.812 -48.277 1.00 53.99  ? 271 ALA B CB  1 
ATOM   6218 N N   . CYS B 1 271 ? 0.821   -41.280 -46.463 1.00 47.27  ? 272 CYS B N   1 
ATOM   6219 C CA  . CYS B 1 271 ? 2.237   -40.980 -46.269 1.00 46.26  ? 272 CYS B CA  1 
ATOM   6220 C C   . CYS B 1 271 ? 2.981   -42.071 -45.453 1.00 63.47  ? 272 CYS B C   1 
ATOM   6221 O O   . CYS B 1 271 ? 4.120   -42.437 -45.785 1.00 55.02  ? 272 CYS B O   1 
ATOM   6222 C CB  . CYS B 1 271 ? 2.427   -39.571 -45.658 1.00 45.70  ? 272 CYS B CB  1 
ATOM   6223 S SG  . CYS B 1 271 ? 4.094   -39.225 -44.984 1.00 74.78  ? 272 CYS B SG  1 
ATOM   6224 N N   . LEU B 1 272 ? 2.351   -42.589 -44.396 1.00 51.69  ? 273 LEU B N   1 
ATOM   6225 C CA  . LEU B 1 272 ? 2.959   -43.672 -43.620 1.00 55.48  ? 273 LEU B CA  1 
ATOM   6226 C C   . LEU B 1 272 ? 3.206   -44.909 -44.491 1.00 54.48  ? 273 LEU B C   1 
ATOM   6227 O O   . LEU B 1 272 ? 4.215   -45.599 -44.338 1.00 51.74  ? 273 LEU B O   1 
ATOM   6228 C CB  . LEU B 1 272 ? 2.089   -44.059 -42.413 1.00 46.75  ? 273 LEU B CB  1 
ATOM   6229 C CG  . LEU B 1 272 ? 2.170   -43.196 -41.149 1.00 50.87  ? 273 LEU B CG  1 
ATOM   6230 C CD1 . LEU B 1 272 ? 1.091   -43.631 -40.151 1.00 50.92  ? 273 LEU B CD1 1 
ATOM   6231 C CD2 . LEU B 1 272 ? 3.538   -43.274 -40.506 1.00 46.13  ? 273 LEU B CD2 1 
ATOM   6232 N N   . ARG B 1 273 ? 2.267   -45.187 -45.391 1.00 42.25  ? 274 ARG B N   1 
ATOM   6233 C CA  . ARG B 1 273 ? 2.359   -46.341 -46.289 1.00 60.66  ? 274 ARG B CA  1 
ATOM   6234 C C   . ARG B 1 273 ? 3.522   -46.276 -47.291 1.00 61.60  ? 274 ARG B C   1 
ATOM   6235 O O   . ARG B 1 273 ? 3.885   -47.301 -47.869 1.00 49.13  ? 274 ARG B O   1 
ATOM   6236 C CB  . ARG B 1 273 ? 1.024   -46.598 -47.017 1.00 52.42  ? 274 ARG B CB  1 
ATOM   6237 C CG  . ARG B 1 273 ? -0.082  -47.069 -46.068 1.00 53.32  ? 274 ARG B CG  1 
ATOM   6238 C CD  . ARG B 1 273 ? -1.168  -47.875 -46.771 1.00 52.31  ? 274 ARG B CD  1 
ATOM   6239 N NE  . ARG B 1 273 ? -2.364  -47.080 -47.013 1.00 69.13  ? 274 ARG B NE  1 
ATOM   6240 C CZ  . ARG B 1 273 ? -3.539  -47.263 -46.410 1.00 74.50  ? 274 ARG B CZ  1 
ATOM   6241 N NH1 . ARG B 1 273 ? -3.713  -48.228 -45.516 1.00 61.90  ? 274 ARG B NH1 1 
ATOM   6242 N NH2 . ARG B 1 273 ? -4.559  -46.474 -46.713 1.00 75.31  ? 274 ARG B NH2 1 
ATOM   6243 N N   . THR B 1 274 ? 4.100   -45.089 -47.484 1.00 51.71  ? 275 THR B N   1 
ATOM   6244 C CA  . THR B 1 274 ? 5.244   -44.931 -48.375 1.00 60.71  ? 275 THR B CA  1 
ATOM   6245 C C   . THR B 1 274 ? 6.553   -45.161 -47.651 1.00 57.98  ? 275 THR B C   1 
ATOM   6246 O O   . THR B 1 274 ? 7.596   -45.200 -48.279 1.00 55.84  ? 275 THR B O   1 
ATOM   6247 C CB  . THR B 1 274 ? 5.336   -43.523 -49.036 1.00 56.65  ? 275 THR B CB  1 
ATOM   6248 O OG1 . THR B 1 274 ? 5.827   -42.555 -48.089 1.00 52.15  ? 275 THR B OG1 1 
ATOM   6249 C CG2 . THR B 1 274 ? 4.001   -43.100 -49.599 1.00 47.81  ? 275 THR B CG2 1 
ATOM   6250 N N   . ARG B 1 275 ? 6.511   -45.294 -46.332 1.00 51.03  ? 276 ARG B N   1 
ATOM   6251 C CA  . ARG B 1 275 ? 7.747   -45.489 -45.568 1.00 48.95  ? 276 ARG B CA  1 
ATOM   6252 C C   . ARG B 1 275 ? 8.164   -46.967 -45.565 1.00 52.70  ? 276 ARG B C   1 
ATOM   6253 O O   . ARG B 1 275 ? 7.319   -47.850 -45.437 1.00 51.23  ? 276 ARG B O   1 
ATOM   6254 C CB  . ARG B 1 275 ? 7.571   -44.978 -44.127 1.00 54.08  ? 276 ARG B CB  1 
ATOM   6255 C CG  . ARG B 1 275 ? 7.313   -43.473 -44.024 1.00 60.18  ? 276 ARG B CG  1 
ATOM   6256 C CD  . ARG B 1 275 ? 8.448   -42.690 -44.665 1.00 61.66  ? 276 ARG B CD  1 
ATOM   6257 N NE  . ARG B 1 275 ? 8.312   -41.246 -44.531 1.00 61.75  ? 276 ARG B NE  1 
ATOM   6258 C CZ  . ARG B 1 275 ? 7.841   -40.430 -45.474 1.00 65.92  ? 276 ARG B CZ  1 
ATOM   6259 N NH1 . ARG B 1 275 ? 7.429   -40.902 -46.649 1.00 56.42  ? 276 ARG B NH1 1 
ATOM   6260 N NH2 . ARG B 1 275 ? 7.774   -39.129 -45.233 1.00 60.06  ? 276 ARG B NH2 1 
ATOM   6261 N N   . PRO B 1 276 ? 9.469   -47.241 -45.709 1.00 49.03  ? 277 PRO B N   1 
ATOM   6262 C CA  . PRO B 1 276 ? 9.915   -48.635 -45.596 1.00 50.73  ? 277 PRO B CA  1 
ATOM   6263 C C   . PRO B 1 276 ? 9.582   -49.181 -44.187 1.00 52.45  ? 277 PRO B C   1 
ATOM   6264 O O   . PRO B 1 276 ? 9.683   -48.430 -43.223 1.00 49.95  ? 277 PRO B O   1 
ATOM   6265 C CB  . PRO B 1 276 ? 11.435  -48.539 -45.774 1.00 51.55  ? 277 PRO B CB  1 
ATOM   6266 C CG  . PRO B 1 276 ? 11.687  -47.176 -46.383 1.00 57.55  ? 277 PRO B CG  1 
ATOM   6267 C CD  . PRO B 1 276 ? 10.591  -46.299 -45.865 1.00 54.80  ? 277 PRO B CD  1 
ATOM   6268 N N   . ALA B 1 277 ? 9.189   -50.453 -44.098 1.00 51.08  ? 278 ALA B N   1 
ATOM   6269 C CA  . ALA B 1 277 ? 8.858   -51.103 -42.830 1.00 52.19  ? 278 ALA B CA  1 
ATOM   6270 C C   . ALA B 1 277 ? 9.878   -50.831 -41.749 1.00 55.68  ? 278 ALA B C   1 
ATOM   6271 O O   . ALA B 1 277 ? 9.517   -50.451 -40.623 1.00 55.50  ? 278 ALA B O   1 
ATOM   6272 C CB  . ALA B 1 277 ? 8.695   -52.595 -43.024 1.00 53.45  ? 278 ALA B CB  1 
ATOM   6273 N N   . GLN B 1 278 ? 11.154  -51.005 -42.083 1.00 50.40  ? 279 GLN B N   1 
ATOM   6274 C CA  . GLN B 1 278 ? 12.214  -50.819 -41.094 1.00 48.80  ? 279 GLN B CA  1 
ATOM   6275 C C   . GLN B 1 278 ? 12.258  -49.397 -40.516 1.00 53.56  ? 279 GLN B C   1 
ATOM   6276 O O   . GLN B 1 278 ? 12.638  -49.194 -39.360 1.00 49.99  ? 279 GLN B O   1 
ATOM   6277 C CB  . GLN B 1 278 ? 13.574  -51.206 -41.684 1.00 46.31  ? 279 GLN B CB  1 
ATOM   6278 C CG  . GLN B 1 278 ? 14.644  -51.415 -40.623 1.00 57.26  ? 279 GLN B CG  1 
ATOM   6279 C CD  . GLN B 1 278 ? 14.329  -52.594 -39.705 1.00 56.03  ? 279 GLN B CD  1 
ATOM   6280 O OE1 . GLN B 1 278 ? 14.050  -53.699 -40.168 1.00 67.83  ? 279 GLN B OE1 1 
ATOM   6281 N NE2 . GLN B 1 278 ? 14.365  -52.356 -38.409 1.00 45.98  ? 279 GLN B NE2 1 
ATOM   6282 N N   . VAL B 1 279 ? 11.876  -48.409 -41.318 1.00 55.76  ? 280 VAL B N   1 
ATOM   6283 C CA  . VAL B 1 279 ? 11.889  -47.028 -40.835 1.00 56.53  ? 280 VAL B CA  1 
ATOM   6284 C C   . VAL B 1 279 ? 10.856  -46.861 -39.717 1.00 51.53  ? 280 VAL B C   1 
ATOM   6285 O O   . VAL B 1 279 ? 11.118  -46.188 -38.717 1.00 51.17  ? 280 VAL B O   1 
ATOM   6286 C CB  . VAL B 1 279 ? 11.645  -45.992 -41.979 1.00 55.01  ? 280 VAL B CB  1 
ATOM   6287 C CG1 . VAL B 1 279 ? 11.456  -44.584 -41.412 1.00 51.65  ? 280 VAL B CG1 1 
ATOM   6288 C CG2 . VAL B 1 279 ? 12.807  -46.009 -42.985 1.00 54.36  ? 280 VAL B CG2 1 
ATOM   6289 N N   . LEU B 1 280 ? 9.688   -47.481 -39.875 1.00 48.67  ? 281 LEU B N   1 
ATOM   6290 C CA  . LEU B 1 280 ? 8.691   -47.414 -38.811 1.00 53.54  ? 281 LEU B CA  1 
ATOM   6291 C C   . LEU B 1 280 ? 9.202   -48.132 -37.552 1.00 49.95  ? 281 LEU B C   1 
ATOM   6292 O O   . LEU B 1 280 ? 9.116   -47.596 -36.448 1.00 57.36  ? 281 LEU B O   1 
ATOM   6293 C CB  . LEU B 1 280 ? 7.350   -47.987 -39.272 1.00 48.23  ? 281 LEU B CB  1 
ATOM   6294 C CG  . LEU B 1 280 ? 6.728   -47.345 -40.508 1.00 49.24  ? 281 LEU B CG  1 
ATOM   6295 C CD1 . LEU B 1 280 ? 5.305   -47.863 -40.734 1.00 46.98  ? 281 LEU B CD1 1 
ATOM   6296 C CD2 . LEU B 1 280 ? 6.749   -45.819 -40.397 1.00 46.23  ? 281 LEU B CD2 1 
ATOM   6297 N N   . VAL B 1 281 ? 9.760   -49.328 -37.734 1.00 51.01  ? 282 VAL B N   1 
ATOM   6298 C CA  . VAL B 1 281 ? 10.315  -50.114 -36.633 1.00 48.62  ? 282 VAL B CA  1 
ATOM   6299 C C   . VAL B 1 281 ? 11.398  -49.379 -35.842 1.00 56.31  ? 282 VAL B C   1 
ATOM   6300 O O   . VAL B 1 281 ? 11.450  -49.481 -34.613 1.00 51.97  ? 282 VAL B O   1 
ATOM   6301 C CB  . VAL B 1 281 ? 10.853  -51.488 -37.120 1.00 50.07  ? 282 VAL B CB  1 
ATOM   6302 C CG1 . VAL B 1 281 ? 11.563  -52.218 -35.995 1.00 45.70  ? 282 VAL B CG1 1 
ATOM   6303 C CG2 . VAL B 1 281 ? 9.717   -52.343 -37.675 1.00 44.39  ? 282 VAL B CG2 1 
ATOM   6304 N N   . ASN B 1 282 ? 12.254  -48.629 -36.531 1.00 54.23  ? 283 ASN B N   1 
ATOM   6305 C CA  . ASN B 1 282 ? 13.335  -47.909 -35.843 1.00 53.11  ? 283 ASN B CA  1 
ATOM   6306 C C   . ASN B 1 282 ? 12.866  -46.755 -34.952 1.00 49.30  ? 283 ASN B C   1 
ATOM   6307 O O   . ASN B 1 282 ? 13.639  -46.244 -34.142 1.00 48.51  ? 283 ASN B O   1 
ATOM   6308 C CB  . ASN B 1 282 ? 14.403  -47.409 -36.829 1.00 53.36  ? 283 ASN B CB  1 
ATOM   6309 C CG  . ASN B 1 282 ? 15.054  -48.542 -37.604 1.00 62.21  ? 283 ASN B CG  1 
ATOM   6310 O OD1 . ASN B 1 282 ? 15.150  -49.677 -37.123 1.00 63.27  ? 283 ASN B OD1 1 
ATOM   6311 N ND2 . ASN B 1 282 ? 15.482  -48.244 -38.822 1.00 65.46  ? 283 ASN B ND2 1 
ATOM   6312 N N   . HIS B 1 283 ? 11.610  -46.346 -35.102 1.00 51.09  ? 284 HIS B N   1 
ATOM   6313 C CA  . HIS B 1 283 ? 11.061  -45.245 -34.295 1.00 59.96  ? 284 HIS B CA  1 
ATOM   6314 C C   . HIS B 1 283 ? 9.994   -45.697 -33.285 1.00 56.85  ? 284 HIS B C   1 
ATOM   6315 O O   . HIS B 1 283 ? 9.439   -44.878 -32.557 1.00 54.23  ? 284 HIS B O   1 
ATOM   6316 C CB  . HIS B 1 283 ? 10.503  -44.138 -35.210 1.00 55.90  ? 284 HIS B CB  1 
ATOM   6317 C CG  . HIS B 1 283 ? 11.566  -43.383 -35.947 1.00 66.27  ? 284 HIS B CG  1 
ATOM   6318 N ND1 . HIS B 1 283 ? 11.941  -43.691 -37.240 1.00 65.90  ? 284 HIS B ND1 1 
ATOM   6319 C CD2 . HIS B 1 283 ? 12.354  -42.349 -35.563 1.00 60.16  ? 284 HIS B CD2 1 
ATOM   6320 C CE1 . HIS B 1 283 ? 12.909  -42.875 -37.620 1.00 57.61  ? 284 HIS B CE1 1 
ATOM   6321 N NE2 . HIS B 1 283 ? 13.177  -42.051 -36.623 1.00 61.97  ? 284 HIS B NE2 1 
ATOM   6322 N N   . GLU B 1 284 ? 9.728   -47.002 -33.250 1.00 52.41  ? 285 GLU B N   1 
ATOM   6323 C CA  . GLU B 1 284 ? 8.621   -47.561 -32.492 1.00 47.69  ? 285 GLU B CA  1 
ATOM   6324 C C   . GLU B 1 284 ? 8.646   -47.163 -31.015 1.00 56.82  ? 285 GLU B C   1 
ATOM   6325 O O   . GLU B 1 284 ? 7.661   -46.654 -30.486 1.00 51.89  ? 285 GLU B O   1 
ATOM   6326 C CB  . GLU B 1 284 ? 8.618   -49.087 -32.593 1.00 51.89  ? 285 GLU B CB  1 
ATOM   6327 C CG  . GLU B 1 284 ? 7.543   -49.742 -31.733 1.00 58.61  ? 285 GLU B CG  1 
ATOM   6328 C CD  . GLU B 1 284 ? 7.474   -51.247 -31.913 1.00 58.87  ? 285 GLU B CD  1 
ATOM   6329 O OE1 . GLU B 1 284 ? 7.753   -51.727 -33.029 1.00 50.96  ? 285 GLU B OE1 1 
ATOM   6330 O OE2 . GLU B 1 284 ? 7.147   -51.949 -30.936 1.00 54.75  ? 285 GLU B OE2 1 
ATOM   6331 N N   . TRP B 1 285 ? 9.781   -47.389 -30.368 1.00 50.54  ? 286 TRP B N   1 
ATOM   6332 C CA  . TRP B 1 285 ? 9.913   -47.163 -28.932 1.00 59.16  ? 286 TRP B CA  1 
ATOM   6333 C C   . TRP B 1 285 ? 9.835   -45.702 -28.496 1.00 57.77  ? 286 TRP B C   1 
ATOM   6334 O O   . TRP B 1 285 ? 9.548   -45.418 -27.333 1.00 53.97  ? 286 TRP B O   1 
ATOM   6335 C CB  . TRP B 1 285 ? 11.201  -47.802 -28.430 1.00 50.14  ? 286 TRP B CB  1 
ATOM   6336 C CG  . TRP B 1 285 ? 11.153  -49.275 -28.555 1.00 62.34  ? 286 TRP B CG  1 
ATOM   6337 C CD1 . TRP B 1 285 ? 11.717  -50.036 -29.537 1.00 54.12  ? 286 TRP B CD1 1 
ATOM   6338 C CD2 . TRP B 1 285 ? 10.459  -50.181 -27.687 1.00 62.63  ? 286 TRP B CD2 1 
ATOM   6339 N NE1 . TRP B 1 285 ? 11.440  -51.364 -29.323 1.00 63.50  ? 286 TRP B NE1 1 
ATOM   6340 C CE2 . TRP B 1 285 ? 10.667  -51.483 -28.195 1.00 64.17  ? 286 TRP B CE2 1 
ATOM   6341 C CE3 . TRP B 1 285 ? 9.690   -50.017 -26.524 1.00 58.10  ? 286 TRP B CE3 1 
ATOM   6342 C CZ2 . TRP B 1 285 ? 10.138  -52.619 -27.580 1.00 56.61  ? 286 TRP B CZ2 1 
ATOM   6343 C CZ3 . TRP B 1 285 ? 9.164   -51.152 -25.902 1.00 53.70  ? 286 TRP B CZ3 1 
ATOM   6344 C CH2 . TRP B 1 285 ? 9.395   -52.435 -26.431 1.00 58.20  ? 286 TRP B CH2 1 
ATOM   6345 N N   . HIS B 1 286 ? 10.052  -44.790 -29.441 1.00 55.40  ? 287 HIS B N   1 
ATOM   6346 C CA  . HIS B 1 286 ? 10.107  -43.357 -29.149 1.00 54.99  ? 287 HIS B CA  1 
ATOM   6347 C C   . HIS B 1 286 ? 8.731   -42.736 -28.882 1.00 52.20  ? 287 HIS B C   1 
ATOM   6348 O O   . HIS B 1 286 ? 8.641   -41.607 -28.416 1.00 55.39  ? 287 HIS B O   1 
ATOM   6349 C CB  . HIS B 1 286 ? 10.816  -42.607 -30.294 1.00 56.78  ? 287 HIS B CB  1 
ATOM   6350 C CG  . HIS B 1 286 ? 12.236  -43.041 -30.508 1.00 69.20  ? 287 HIS B CG  1 
ATOM   6351 N ND1 . HIS B 1 286 ? 13.125  -43.222 -29.469 1.00 76.83  ? 287 HIS B ND1 1 
ATOM   6352 C CD2 . HIS B 1 286 ? 12.921  -43.329 -31.641 1.00 67.55  ? 287 HIS B CD2 1 
ATOM   6353 C CE1 . HIS B 1 286 ? 14.293  -43.610 -29.950 1.00 68.93  ? 287 HIS B CE1 1 
ATOM   6354 N NE2 . HIS B 1 286 ? 14.196  -43.683 -31.266 1.00 73.27  ? 287 HIS B NE2 1 
ATOM   6355 N N   . VAL B 1 287 ? 7.652   -43.455 -29.168 1.00 46.71  ? 288 VAL B N   1 
ATOM   6356 C CA  . VAL B 1 287 ? 6.341   -42.863 -28.919 1.00 55.74  ? 288 VAL B CA  1 
ATOM   6357 C C   . VAL B 1 287 ? 5.769   -43.101 -27.517 1.00 52.00  ? 288 VAL B C   1 
ATOM   6358 O O   . VAL B 1 287 ? 4.695   -42.600 -27.211 1.00 56.53  ? 288 VAL B O   1 
ATOM   6359 C CB  . VAL B 1 287 ? 5.283   -43.229 -29.989 1.00 49.36  ? 288 VAL B CB  1 
ATOM   6360 C CG1 . VAL B 1 287 ? 5.824   -42.948 -31.410 1.00 56.34  ? 288 VAL B CG1 1 
ATOM   6361 C CG2 . VAL B 1 287 ? 4.820   -44.669 -29.848 1.00 44.42  ? 288 VAL B CG2 1 
ATOM   6362 N N   . LEU B 1 288 ? 6.469   -43.851 -26.672 1.00 53.10  ? 289 LEU B N   1 
ATOM   6363 C CA  . LEU B 1 288 ? 5.971   -44.100 -25.315 1.00 51.02  ? 289 LEU B CA  1 
ATOM   6364 C C   . LEU B 1 288 ? 6.111   -42.816 -24.487 1.00 62.09  ? 289 LEU B C   1 
ATOM   6365 O O   . LEU B 1 288 ? 7.113   -42.105 -24.590 1.00 61.72  ? 289 LEU B O   1 
ATOM   6366 C CB  . LEU B 1 288 ? 6.723   -45.262 -24.649 1.00 41.69  ? 289 LEU B CB  1 
ATOM   6367 C CG  . LEU B 1 288 ? 6.386   -46.686 -25.131 1.00 55.17  ? 289 LEU B CG  1 
ATOM   6368 C CD1 . LEU B 1 288 ? 7.304   -47.739 -24.485 1.00 53.65  ? 289 LEU B CD1 1 
ATOM   6369 C CD2 . LEU B 1 288 ? 4.923   -47.035 -24.865 1.00 53.24  ? 289 LEU B CD2 1 
ATOM   6370 N N   . PRO B 1 289 ? 5.112   -42.522 -23.645 1.00 67.01  ? 290 PRO B N   1 
ATOM   6371 C CA  . PRO B 1 289 ? 5.088   -41.229 -22.948 1.00 67.44  ? 290 PRO B CA  1 
ATOM   6372 C C   . PRO B 1 289 ? 6.165   -41.061 -21.855 1.00 62.92  ? 290 PRO B C   1 
ATOM   6373 O O   . PRO B 1 289 ? 6.481   -39.934 -21.492 1.00 66.68  ? 290 PRO B O   1 
ATOM   6374 C CB  . PRO B 1 289 ? 3.684   -41.202 -22.342 1.00 62.32  ? 290 PRO B CB  1 
ATOM   6375 C CG  . PRO B 1 289 ? 3.387   -42.649 -22.067 1.00 60.46  ? 290 PRO B CG  1 
ATOM   6376 C CD  . PRO B 1 289 ? 4.017   -43.412 -23.206 1.00 58.20  ? 290 PRO B CD  1 
ATOM   6377 N N   . GLN B 1 290 ? 6.723   -42.150 -21.341 1.00 54.84  ? 291 GLN B N   1 
ATOM   6378 C CA  . GLN B 1 290 ? 7.783   -42.047 -20.338 1.00 63.83  ? 291 GLN B CA  1 
ATOM   6379 C C   . GLN B 1 290 ? 8.634   -43.303 -20.354 1.00 62.10  ? 291 GLN B C   1 
ATOM   6380 O O   . GLN B 1 290 ? 8.242   -44.315 -20.935 1.00 56.72  ? 291 GLN B O   1 
ATOM   6381 C CB  . GLN B 1 290 ? 7.212   -41.857 -18.925 1.00 57.85  ? 291 GLN B CB  1 
ATOM   6382 C CG  . GLN B 1 290 ? 6.821   -43.164 -18.244 1.00 68.62  ? 291 GLN B CG  1 
ATOM   6383 C CD  . GLN B 1 290 ? 6.646   -43.041 -16.720 1.00 81.34  ? 291 GLN B CD  1 
ATOM   6384 O OE1 . GLN B 1 290 ? 5.594   -42.605 -16.232 1.00 78.60  ? 291 GLN B OE1 1 
ATOM   6385 N NE2 . GLN B 1 290 ? 7.670   -43.460 -15.963 1.00 73.09  ? 291 GLN B NE2 1 
ATOM   6386 N N   . GLU B 1 291 ? 9.791   -43.245 -19.703 1.00 59.63  ? 292 GLU B N   1 
ATOM   6387 C CA  . GLU B 1 291 ? 10.642  -44.419 -19.609 1.00 67.11  ? 292 GLU B CA  1 
ATOM   6388 C C   . GLU B 1 291 ? 9.954   -45.436 -18.706 1.00 66.94  ? 292 GLU B C   1 
ATOM   6389 O O   . GLU B 1 291 ? 9.386   -45.076 -17.681 1.00 59.95  ? 292 GLU B O   1 
ATOM   6390 C CB  . GLU B 1 291 ? 12.013  -44.051 -19.056 1.00 79.37  ? 292 GLU B CB  1 
ATOM   6391 C CG  . GLU B 1 291 ? 13.128  -44.940 -19.582 1.00 106.75 ? 292 GLU B CG  1 
ATOM   6392 C CD  . GLU B 1 291 ? 14.432  -44.753 -18.828 1.00 130.73 ? 292 GLU B CD  1 
ATOM   6393 O OE1 . GLU B 1 291 ? 14.422  -44.094 -17.762 1.00 123.44 ? 292 GLU B OE1 1 
ATOM   6394 O OE2 . GLU B 1 291 ? 15.466  -45.271 -19.303 1.00 144.01 ? 292 GLU B OE2 1 
ATOM   6395 N N   . SER B 1 292 ? 10.002  -46.705 -19.083 1.00 53.96  ? 293 SER B N   1 
ATOM   6396 C CA  . SER B 1 292 ? 9.183   -47.697 -18.414 1.00 48.62  ? 293 SER B CA  1 
ATOM   6397 C C   . SER B 1 292 ? 9.712   -49.096 -18.688 1.00 50.35  ? 293 SER B C   1 
ATOM   6398 O O   . SER B 1 292 ? 10.605  -49.265 -19.512 1.00 54.18  ? 293 SER B O   1 
ATOM   6399 C CB  . SER B 1 292 ? 7.758   -47.583 -18.940 1.00 45.36  ? 293 SER B CB  1 
ATOM   6400 O OG  . SER B 1 292 ? 7.717   -47.868 -20.329 1.00 52.05  ? 293 SER B OG  1 
ATOM   6401 N N   . VAL B 1 293 ? 9.179   -50.090 -17.980 1.00 48.87  ? 294 VAL B N   1 
ATOM   6402 C CA  . VAL B 1 293 ? 9.330   -51.489 -18.379 1.00 48.68  ? 294 VAL B CA  1 
ATOM   6403 C C   . VAL B 1 293 ? 7.935   -52.080 -18.485 1.00 45.48  ? 294 VAL B C   1 
ATOM   6404 O O   . VAL B 1 293 ? 6.998   -51.540 -17.904 1.00 40.54  ? 294 VAL B O   1 
ATOM   6405 C CB  . VAL B 1 293 ? 10.176  -52.331 -17.388 1.00 50.97  ? 294 VAL B CB  1 
ATOM   6406 C CG1 . VAL B 1 293 ? 11.613  -51.863 -17.376 1.00 51.69  ? 294 VAL B CG1 1 
ATOM   6407 C CG2 . VAL B 1 293 ? 9.570   -52.305 -15.977 1.00 48.42  ? 294 VAL B CG2 1 
ATOM   6408 N N   . PHE B 1 294 ? 7.795   -53.165 -19.246 1.00 45.00  ? 295 PHE B N   1 
ATOM   6409 C CA  . PHE B 1 294 ? 6.493   -53.800 -19.458 1.00 43.82  ? 295 PHE B CA  1 
ATOM   6410 C C   . PHE B 1 294 ? 5.449   -52.860 -20.068 1.00 41.16  ? 295 PHE B C   1 
ATOM   6411 O O   . PHE B 1 294 ? 4.277   -52.929 -19.722 1.00 50.28  ? 295 PHE B O   1 
ATOM   6412 C CB  . PHE B 1 294 ? 5.961   -54.416 -18.143 1.00 45.29  ? 295 PHE B CB  1 
ATOM   6413 C CG  . PHE B 1 294 ? 5.352   -55.787 -18.318 1.00 44.39  ? 295 PHE B CG  1 
ATOM   6414 C CD1 . PHE B 1 294 ? 4.494   -56.058 -19.390 1.00 40.59  ? 295 PHE B CD1 1 
ATOM   6415 C CD2 . PHE B 1 294 ? 5.654   -56.808 -17.436 1.00 40.28  ? 295 PHE B CD2 1 
ATOM   6416 C CE1 . PHE B 1 294 ? 3.924   -57.316 -19.558 1.00 44.20  ? 295 PHE B CE1 1 
ATOM   6417 C CE2 . PHE B 1 294 ? 5.071   -58.081 -17.585 1.00 46.46  ? 295 PHE B CE2 1 
ATOM   6418 C CZ  . PHE B 1 294 ? 4.225   -58.336 -18.654 1.00 46.31  ? 295 PHE B CZ  1 
ATOM   6419 N N   . ARG B 1 295 ? 5.884   -51.981 -20.968 1.00 42.01  ? 296 ARG B N   1 
ATOM   6420 C CA  . ARG B 1 295 ? 4.968   -51.136 -21.745 1.00 40.72  ? 296 ARG B CA  1 
ATOM   6421 C C   . ARG B 1 295 ? 5.381   -51.184 -23.206 1.00 45.51  ? 296 ARG B C   1 
ATOM   6422 O O   . ARG B 1 295 ? 6.574   -51.166 -23.525 1.00 43.37  ? 296 ARG B O   1 
ATOM   6423 C CB  . ARG B 1 295 ? 4.970   -49.676 -21.259 1.00 41.99  ? 296 ARG B CB  1 
ATOM   6424 C CG  . ARG B 1 295 ? 4.301   -49.465 -19.917 1.00 45.54  ? 296 ARG B CG  1 
ATOM   6425 C CD  . ARG B 1 295 ? 2.814   -49.866 -19.961 1.00 41.89  ? 296 ARG B CD  1 
ATOM   6426 N NE  . ARG B 1 295 ? 2.165   -49.605 -18.677 1.00 47.99  ? 296 ARG B NE  1 
ATOM   6427 C CZ  . ARG B 1 295 ? 2.194   -50.435 -17.638 1.00 42.14  ? 296 ARG B CZ  1 
ATOM   6428 N NH1 . ARG B 1 295 ? 2.833   -51.596 -17.731 1.00 41.45  ? 296 ARG B NH1 1 
ATOM   6429 N NH2 . ARG B 1 295 ? 1.573   -50.108 -16.512 1.00 45.94  ? 296 ARG B NH2 1 
ATOM   6430 N N   . PHE B 1 296 ? 4.387   -51.251 -24.086 1.00 44.31  ? 297 PHE B N   1 
ATOM   6431 C CA  . PHE B 1 296 ? 4.623   -51.436 -25.515 1.00 44.58  ? 297 PHE B CA  1 
ATOM   6432 C C   . PHE B 1 296 ? 3.791   -50.424 -26.309 1.00 43.73  ? 297 PHE B C   1 
ATOM   6433 O O   . PHE B 1 296 ? 2.630   -50.163 -25.990 1.00 44.82  ? 297 PHE B O   1 
ATOM   6434 C CB  . PHE B 1 296 ? 4.287   -52.887 -25.895 1.00 41.59  ? 297 PHE B CB  1 
ATOM   6435 C CG  . PHE B 1 296 ? 4.697   -53.886 -24.834 1.00 45.43  ? 297 PHE B CG  1 
ATOM   6436 C CD1 . PHE B 1 296 ? 6.033   -54.217 -24.658 1.00 41.50  ? 297 PHE B CD1 1 
ATOM   6437 C CD2 . PHE B 1 296 ? 3.745   -54.468 -23.985 1.00 43.19  ? 297 PHE B CD2 1 
ATOM   6438 C CE1 . PHE B 1 296 ? 6.427   -55.125 -23.663 1.00 48.51  ? 297 PHE B CE1 1 
ATOM   6439 C CE2 . PHE B 1 296 ? 4.128   -55.377 -22.978 1.00 40.39  ? 297 PHE B CE2 1 
ATOM   6440 C CZ  . PHE B 1 296 ? 5.470   -55.700 -22.818 1.00 42.11  ? 297 PHE B CZ  1 
ATOM   6441 N N   . SER B 1 297 ? 4.382   -49.886 -27.365 1.00 43.59  ? 298 SER B N   1 
ATOM   6442 C CA  . SER B 1 297 ? 3.829   -48.740 -28.070 1.00 43.89  ? 298 SER B CA  1 
ATOM   6443 C C   . SER B 1 297 ? 2.478   -48.996 -28.730 1.00 46.11  ? 298 SER B C   1 
ATOM   6444 O O   . SER B 1 297 ? 1.548   -48.216 -28.551 1.00 47.07  ? 298 SER B O   1 
ATOM   6445 C CB  . SER B 1 297 ? 4.834   -48.241 -29.117 1.00 49.80  ? 298 SER B CB  1 
ATOM   6446 O OG  . SER B 1 297 ? 6.051   -47.875 -28.498 1.00 45.76  ? 298 SER B OG  1 
ATOM   6447 N N   . PHE B 1 298 ? 2.377   -50.074 -29.502 1.00 47.19  ? 299 PHE B N   1 
ATOM   6448 C CA  . PHE B 1 298 ? 1.176   -50.331 -30.295 1.00 42.41  ? 299 PHE B CA  1 
ATOM   6449 C C   . PHE B 1 298 ? 0.460   -51.613 -29.878 1.00 42.01  ? 299 PHE B C   1 
ATOM   6450 O O   . PHE B 1 298 ? 0.930   -52.732 -30.142 1.00 40.43  ? 299 PHE B O   1 
ATOM   6451 C CB  . PHE B 1 298 ? 1.497   -50.291 -31.820 1.00 42.78  ? 299 PHE B CB  1 
ATOM   6452 C CG  . PHE B 1 298 ? 2.042   -48.957 -32.271 1.00 47.35  ? 299 PHE B CG  1 
ATOM   6453 C CD1 . PHE B 1 298 ? 1.199   -47.859 -32.403 1.00 42.25  ? 299 PHE B CD1 1 
ATOM   6454 C CD2 . PHE B 1 298 ? 3.410   -48.785 -32.502 1.00 46.90  ? 299 PHE B CD2 1 
ATOM   6455 C CE1 . PHE B 1 298 ? 1.694   -46.618 -32.790 1.00 40.62  ? 299 PHE B CE1 1 
ATOM   6456 C CE2 . PHE B 1 298 ? 3.914   -47.552 -32.882 1.00 38.08  ? 299 PHE B CE2 1 
ATOM   6457 C CZ  . PHE B 1 298 ? 3.052   -46.466 -33.032 1.00 49.88  ? 299 PHE B CZ  1 
ATOM   6458 N N   . VAL B 1 299 ? -0.679  -51.440 -29.209 1.00 43.85  ? 300 VAL B N   1 
ATOM   6459 C CA  . VAL B 1 299 ? -1.404  -52.561 -28.630 1.00 38.99  ? 300 VAL B CA  1 
ATOM   6460 C C   . VAL B 1 299 ? -2.879  -52.409 -28.950 1.00 34.34  ? 300 VAL B C   1 
ATOM   6461 O O   . VAL B 1 299 ? -3.287  -51.352 -29.445 1.00 39.13  ? 300 VAL B O   1 
ATOM   6462 C CB  . VAL B 1 299 ? -1.163  -52.643 -27.058 1.00 37.01  ? 300 VAL B CB  1 
ATOM   6463 C CG1 . VAL B 1 299 ? 0.318   -52.748 -26.758 1.00 37.94  ? 300 VAL B CG1 1 
ATOM   6464 C CG2 . VAL B 1 299 ? -1.803  -51.462 -26.332 1.00 39.20  ? 300 VAL B CG2 1 
ATOM   6465 N N   . PRO B 1 300 ? -3.696  -53.445 -28.667 1.00 40.51  ? 301 PRO B N   1 
ATOM   6466 C CA  . PRO B 1 300 ? -5.128  -53.290 -28.950 1.00 43.07  ? 301 PRO B CA  1 
ATOM   6467 C C   . PRO B 1 300 ? -5.765  -52.033 -28.334 1.00 46.57  ? 301 PRO B C   1 
ATOM   6468 O O   . PRO B 1 300 ? -5.441  -51.649 -27.211 1.00 42.88  ? 301 PRO B O   1 
ATOM   6469 C CB  . PRO B 1 300 ? -5.740  -54.555 -28.341 1.00 39.46  ? 301 PRO B CB  1 
ATOM   6470 C CG  . PRO B 1 300 ? -4.652  -55.580 -28.460 1.00 35.45  ? 301 PRO B CG  1 
ATOM   6471 C CD  . PRO B 1 300 ? -3.391  -54.803 -28.164 1.00 49.33  ? 301 PRO B CD  1 
ATOM   6472 N N   . VAL B 1 301 ? -6.654  -51.398 -29.087 1.00 41.80  ? 302 VAL B N   1 
ATOM   6473 C CA  . VAL B 1 301 ? -7.291  -50.157 -28.665 1.00 37.77  ? 302 VAL B CA  1 
ATOM   6474 C C   . VAL B 1 301 ? -8.756  -50.446 -28.303 1.00 45.34  ? 302 VAL B C   1 
ATOM   6475 O O   . VAL B 1 301 ? -9.424  -51.233 -28.975 1.00 41.35  ? 302 VAL B O   1 
ATOM   6476 C CB  . VAL B 1 301 ? -7.162  -49.060 -29.771 1.00 46.72  ? 302 VAL B CB  1 
ATOM   6477 C CG1 . VAL B 1 301 ? -7.722  -49.568 -31.099 1.00 36.75  ? 302 VAL B CG1 1 
ATOM   6478 C CG2 . VAL B 1 301 ? -7.831  -47.747 -29.349 1.00 45.08  ? 302 VAL B CG2 1 
ATOM   6479 N N   . VAL B 1 302 ? -9.233  -49.858 -27.204 1.00 45.61  ? 303 VAL B N   1 
ATOM   6480 C CA  . VAL B 1 302 ? -10.653 -49.933 -26.854 1.00 44.28  ? 303 VAL B CA  1 
ATOM   6481 C C   . VAL B 1 302 ? -11.442 -48.843 -27.607 1.00 47.85  ? 303 VAL B C   1 
ATOM   6482 O O   . VAL B 1 302 ? -11.371 -47.670 -27.252 1.00 53.04  ? 303 VAL B O   1 
ATOM   6483 C CB  . VAL B 1 302 ? -10.854 -49.741 -25.333 1.00 50.17  ? 303 VAL B CB  1 
ATOM   6484 C CG1 . VAL B 1 302 ? -12.333 -49.916 -24.954 1.00 40.22  ? 303 VAL B CG1 1 
ATOM   6485 C CG2 . VAL B 1 302 ? -9.962  -50.708 -24.555 1.00 38.67  ? 303 VAL B CG2 1 
ATOM   6486 N N   . ASP B 1 303 ? -12.188 -49.219 -28.641 1.00 49.19  ? 304 ASP B N   1 
ATOM   6487 C CA  . ASP B 1 303 ? -12.878 -48.212 -29.445 1.00 52.48  ? 304 ASP B CA  1 
ATOM   6488 C C   . ASP B 1 303 ? -14.356 -48.548 -29.703 1.00 54.59  ? 304 ASP B C   1 
ATOM   6489 O O   . ASP B 1 303 ? -15.004 -47.951 -30.567 1.00 57.14  ? 304 ASP B O   1 
ATOM   6490 C CB  . ASP B 1 303 ? -12.125 -47.986 -30.767 1.00 54.26  ? 304 ASP B CB  1 
ATOM   6491 C CG  . ASP B 1 303 ? -12.208 -49.179 -31.696 1.00 54.78  ? 304 ASP B CG  1 
ATOM   6492 O OD1 . ASP B 1 303 ? -12.613 -50.276 -31.237 1.00 57.43  ? 304 ASP B OD1 1 
ATOM   6493 O OD2 . ASP B 1 303 ? -11.867 -49.025 -32.892 1.00 65.13  ? 304 ASP B OD2 1 
ATOM   6494 N N   . GLY B 1 304 ? -14.876 -49.521 -28.963 1.00 46.25  ? 305 GLY B N   1 
ATOM   6495 C CA  . GLY B 1 304 ? -16.265 -49.903 -29.094 1.00 49.83  ? 305 GLY B CA  1 
ATOM   6496 C C   . GLY B 1 304 ? -16.503 -50.978 -30.137 1.00 57.99  ? 305 GLY B C   1 
ATOM   6497 O O   . GLY B 1 304 ? -17.585 -51.578 -30.184 1.00 54.70  ? 305 GLY B O   1 
ATOM   6498 N N   . ASP B 1 305 ? -15.500 -51.242 -30.972 1.00 50.20  ? 306 ASP B N   1 
ATOM   6499 C CA  . ASP B 1 305 ? -15.690 -52.171 -32.095 1.00 51.07  ? 306 ASP B CA  1 
ATOM   6500 C C   . ASP B 1 305 ? -15.314 -53.615 -31.716 1.00 49.49  ? 306 ASP B C   1 
ATOM   6501 O O   . ASP B 1 305 ? -16.183 -54.413 -31.369 1.00 50.75  ? 306 ASP B O   1 
ATOM   6502 C CB  . ASP B 1 305 ? -14.919 -51.689 -33.340 1.00 54.36  ? 306 ASP B CB  1 
ATOM   6503 C CG  . ASP B 1 305 ? -15.302 -52.451 -34.603 1.00 52.71  ? 306 ASP B CG  1 
ATOM   6504 O OD1 . ASP B 1 305 ? -16.150 -53.369 -34.514 1.00 58.40  ? 306 ASP B OD1 1 
ATOM   6505 O OD2 . ASP B 1 305 ? -14.748 -52.130 -35.678 1.00 57.14  ? 306 ASP B OD2 1 
ATOM   6506 N N   . PHE B 1 306 ? -14.029 -53.956 -31.778 1.00 52.88  ? 307 PHE B N   1 
ATOM   6507 C CA  . PHE B 1 306 ? -13.599 -55.274 -31.314 1.00 50.59  ? 307 PHE B CA  1 
ATOM   6508 C C   . PHE B 1 306 ? -13.905 -55.464 -29.815 1.00 46.70  ? 307 PHE B C   1 
ATOM   6509 O O   . PHE B 1 306 ? -14.432 -56.499 -29.402 1.00 45.96  ? 307 PHE B O   1 
ATOM   6510 C CB  . PHE B 1 306 ? -12.105 -55.485 -31.592 1.00 46.00  ? 307 PHE B CB  1 
ATOM   6511 C CG  . PHE B 1 306 ? -11.679 -56.929 -31.541 1.00 51.48  ? 307 PHE B CG  1 
ATOM   6512 C CD1 . PHE B 1 306 ? -11.496 -57.572 -30.324 1.00 44.18  ? 307 PHE B CD1 1 
ATOM   6513 C CD2 . PHE B 1 306 ? -11.457 -57.643 -32.715 1.00 48.08  ? 307 PHE B CD2 1 
ATOM   6514 C CE1 . PHE B 1 306 ? -11.106 -58.900 -30.272 1.00 47.05  ? 307 PHE B CE1 1 
ATOM   6515 C CE2 . PHE B 1 306 ? -11.063 -58.970 -32.675 1.00 46.52  ? 307 PHE B CE2 1 
ATOM   6516 C CZ  . PHE B 1 306 ? -10.889 -59.604 -31.455 1.00 45.59  ? 307 PHE B CZ  1 
ATOM   6517 N N   . LEU B 1 307 ? -13.527 -54.473 -29.014 1.00 43.76  ? 308 LEU B N   1 
ATOM   6518 C CA  . LEU B 1 307 ? -13.844 -54.438 -27.584 1.00 52.54  ? 308 LEU B CA  1 
ATOM   6519 C C   . LEU B 1 307 ? -14.860 -53.329 -27.355 1.00 55.05  ? 308 LEU B C   1 
ATOM   6520 O O   . LEU B 1 307 ? -14.508 -52.149 -27.459 1.00 50.40  ? 308 LEU B O   1 
ATOM   6521 C CB  . LEU B 1 307 ? -12.584 -54.145 -26.754 1.00 45.66  ? 308 LEU B CB  1 
ATOM   6522 C CG  . LEU B 1 307 ? -11.458 -55.189 -26.861 1.00 54.02  ? 308 LEU B CG  1 
ATOM   6523 C CD1 . LEU B 1 307 ? -10.159 -54.674 -26.262 1.00 47.23  ? 308 LEU B CD1 1 
ATOM   6524 C CD2 . LEU B 1 307 ? -11.852 -56.524 -26.226 1.00 41.35  ? 308 LEU B CD2 1 
ATOM   6525 N N   . SER B 1 308 ? -16.112 -53.695 -27.067 1.00 53.73  ? 309 SER B N   1 
ATOM   6526 C CA  . SER B 1 308 ? -17.172 -52.696 -26.854 1.00 57.13  ? 309 SER B CA  1 
ATOM   6527 C C   . SER B 1 308 ? -16.978 -51.858 -25.578 1.00 52.45  ? 309 SER B C   1 
ATOM   6528 O O   . SER B 1 308 ? -17.507 -50.760 -25.465 1.00 61.71  ? 309 SER B O   1 
ATOM   6529 C CB  . SER B 1 308 ? -18.569 -53.336 -26.909 1.00 60.87  ? 309 SER B CB  1 
ATOM   6530 O OG  . SER B 1 308 ? -18.726 -54.357 -25.940 1.00 68.15  ? 309 SER B OG  1 
ATOM   6531 N N   . ASP B 1 309 ? -16.187 -52.371 -24.641 1.00 50.35  ? 310 ASP B N   1 
ATOM   6532 C CA  . ASP B 1 309 ? -15.822 -51.641 -23.425 1.00 59.35  ? 310 ASP B CA  1 
ATOM   6533 C C   . ASP B 1 309 ? -14.465 -52.181 -22.968 1.00 54.13  ? 310 ASP B C   1 
ATOM   6534 O O   . ASP B 1 309 ? -13.949 -53.129 -23.569 1.00 47.95  ? 310 ASP B O   1 
ATOM   6535 C CB  . ASP B 1 309 ? -16.875 -51.861 -22.323 1.00 61.63  ? 310 ASP B CB  1 
ATOM   6536 C CG  . ASP B 1 309 ? -16.924 -50.716 -21.287 1.00 61.73  ? 310 ASP B CG  1 
ATOM   6537 O OD1 . ASP B 1 309 ? -15.875 -50.127 -20.932 1.00 55.24  ? 310 ASP B OD1 1 
ATOM   6538 O OD2 . ASP B 1 309 ? -18.042 -50.417 -20.817 1.00 73.30  ? 310 ASP B OD2 1 
ATOM   6539 N N   . THR B 1 310 ? -13.895 -51.594 -21.912 1.00 52.97  ? 311 THR B N   1 
ATOM   6540 C CA  . THR B 1 310 ? -12.613 -52.051 -21.383 1.00 50.50  ? 311 THR B CA  1 
ATOM   6541 C C   . THR B 1 310 ? -12.733 -53.532 -21.028 1.00 51.83  ? 311 THR B C   1 
ATOM   6542 O O   . THR B 1 310 ? -13.828 -54.011 -20.730 1.00 49.74  ? 311 THR B O   1 
ATOM   6543 C CB  . THR B 1 310 ? -12.170 -51.255 -20.124 1.00 54.73  ? 311 THR B CB  1 
ATOM   6544 O OG1 . THR B 1 310 ? -13.026 -51.576 -19.027 1.00 59.00  ? 311 THR B OG1 1 
ATOM   6545 C CG2 . THR B 1 310 ? -12.196 -49.741 -20.368 1.00 49.06  ? 311 THR B CG2 1 
ATOM   6546 N N   . PRO B 1 311 ? -11.619 -54.272 -21.107 1.00 48.05  ? 312 PRO B N   1 
ATOM   6547 C CA  . PRO B 1 311 ? -11.680 -55.687 -20.736 1.00 53.99  ? 312 PRO B CA  1 
ATOM   6548 C C   . PRO B 1 311 ? -12.149 -55.852 -19.274 1.00 55.23  ? 312 PRO B C   1 
ATOM   6549 O O   . PRO B 1 311 ? -12.921 -56.761 -18.946 1.00 45.55  ? 312 PRO B O   1 
ATOM   6550 C CB  . PRO B 1 311 ? -10.232 -56.149 -20.910 1.00 47.95  ? 312 PRO B CB  1 
ATOM   6551 C CG  . PRO B 1 311 ? -9.687  -55.246 -21.978 1.00 55.11  ? 312 PRO B CG  1 
ATOM   6552 C CD  . PRO B 1 311 ? -10.316 -53.906 -21.698 1.00 48.66  ? 312 PRO B CD  1 
ATOM   6553 N N   . GLU B 1 312 ? -11.691 -54.955 -18.417 1.00 52.95  ? 313 GLU B N   1 
ATOM   6554 C CA  . GLU B 1 312 ? -12.099 -54.952 -17.016 1.00 58.83  ? 313 GLU B CA  1 
ATOM   6555 C C   . GLU B 1 312 ? -13.634 -54.946 -16.886 1.00 60.61  ? 313 GLU B C   1 
ATOM   6556 O O   . GLU B 1 312 ? -14.222 -55.898 -16.373 1.00 56.22  ? 313 GLU B O   1 
ATOM   6557 C CB  . GLU B 1 312 ? -11.465 -53.756 -16.310 1.00 56.74  ? 313 GLU B CB  1 
ATOM   6558 C CG  . GLU B 1 312 ? -11.069 -54.016 -14.865 1.00 74.56  ? 313 GLU B CG  1 
ATOM   6559 C CD  . GLU B 1 312 ? -12.042 -53.393 -13.893 1.00 88.34  ? 313 GLU B CD  1 
ATOM   6560 O OE1 . GLU B 1 312 ? -12.759 -52.457 -14.324 1.00 81.88  ? 313 GLU B OE1 1 
ATOM   6561 O OE2 . GLU B 1 312 ? -12.093 -53.836 -12.714 1.00 88.41  ? 313 GLU B OE2 1 
ATOM   6562 N N   . ALA B 1 313 ? -14.277 -53.898 -17.397 1.00 59.73  ? 314 ALA B N   1 
ATOM   6563 C CA  . ALA B 1 313 ? -15.738 -53.827 -17.463 1.00 48.91  ? 314 ALA B CA  1 
ATOM   6564 C C   . ALA B 1 313 ? -16.429 -55.042 -18.111 1.00 57.29  ? 314 ALA B C   1 
ATOM   6565 O O   . ALA B 1 313 ? -17.471 -55.491 -17.636 1.00 61.67  ? 314 ALA B O   1 
ATOM   6566 C CB  . ALA B 1 313 ? -16.160 -52.545 -18.187 1.00 56.70  ? 314 ALA B CB  1 
ATOM   6567 N N   . LEU B 1 314 ? -15.877 -55.567 -19.203 1.00 58.98  ? 315 LEU B N   1 
ATOM   6568 C CA  . LEU B 1 314 ? -16.504 -56.714 -19.886 1.00 51.83  ? 315 LEU B CA  1 
ATOM   6569 C C   . LEU B 1 314 ? -16.427 -57.994 -19.055 1.00 55.65  ? 315 LEU B C   1 
ATOM   6570 O O   . LEU B 1 314 ? -17.341 -58.819 -19.056 1.00 57.73  ? 315 LEU B O   1 
ATOM   6571 C CB  . LEU B 1 314 ? -15.882 -56.953 -21.273 1.00 52.78  ? 315 LEU B CB  1 
ATOM   6572 C CG  . LEU B 1 314 ? -16.156 -55.875 -22.326 1.00 55.32  ? 315 LEU B CG  1 
ATOM   6573 C CD1 . LEU B 1 314 ? -15.327 -56.101 -23.602 1.00 50.89  ? 315 LEU B CD1 1 
ATOM   6574 C CD2 . LEU B 1 314 ? -17.636 -55.820 -22.650 1.00 51.61  ? 315 LEU B CD2 1 
ATOM   6575 N N   . ILE B 1 315 ? -15.319 -58.162 -18.352 1.00 47.76  ? 316 ILE B N   1 
ATOM   6576 C CA  . ILE B 1 315 ? -15.179 -59.271 -17.433 1.00 58.52  ? 316 ILE B CA  1 
ATOM   6577 C C   . ILE B 1 315 ? -16.209 -59.141 -16.290 1.00 64.90  ? 316 ILE B C   1 
ATOM   6578 O O   . ILE B 1 315 ? -16.967 -60.074 -16.022 1.00 58.94  ? 316 ILE B O   1 
ATOM   6579 C CB  . ILE B 1 315 ? -13.740 -59.341 -16.892 1.00 60.74  ? 316 ILE B CB  1 
ATOM   6580 C CG1 . ILE B 1 315 ? -12.794 -59.854 -17.979 1.00 60.20  ? 316 ILE B CG1 1 
ATOM   6581 C CG2 . ILE B 1 315 ? -13.654 -60.235 -15.672 1.00 60.66  ? 316 ILE B CG2 1 
ATOM   6582 C CD1 . ILE B 1 315 ? -11.330 -59.560 -17.698 1.00 55.74  ? 316 ILE B CD1 1 
ATOM   6583 N N   . ASN B 1 316 ? -16.258 -57.977 -15.647 1.00 67.96  ? 317 ASN B N   1 
ATOM   6584 C CA  . ASN B 1 316 ? -17.174 -57.764 -14.513 1.00 69.75  ? 317 ASN B CA  1 
ATOM   6585 C C   . ASN B 1 316 ? -18.639 -58.009 -14.845 1.00 68.84  ? 317 ASN B C   1 
ATOM   6586 O O   . ASN B 1 316 ? -19.405 -58.450 -13.992 1.00 75.11  ? 317 ASN B O   1 
ATOM   6587 C CB  . ASN B 1 316 ? -17.040 -56.354 -13.948 1.00 54.12  ? 317 ASN B CB  1 
ATOM   6588 C CG  . ASN B 1 316 ? -15.702 -56.106 -13.329 1.00 61.50  ? 317 ASN B CG  1 
ATOM   6589 O OD1 . ASN B 1 316 ? -14.993 -57.039 -12.963 1.00 70.02  ? 317 ASN B OD1 1 
ATOM   6590 N ND2 . ASN B 1 316 ? -15.336 -54.836 -13.207 1.00 74.83  ? 317 ASN B ND2 1 
ATOM   6591 N N   . ALA B 1 317 ? -19.012 -57.748 -16.094 1.00 65.43  ? 318 ALA B N   1 
ATOM   6592 C CA  . ALA B 1 317 ? -20.414 -57.718 -16.495 1.00 65.62  ? 318 ALA B CA  1 
ATOM   6593 C C   . ALA B 1 317 ? -20.813 -58.853 -17.428 1.00 74.74  ? 318 ALA B C   1 
ATOM   6594 O O   . ALA B 1 317 ? -21.776 -58.721 -18.178 1.00 80.63  ? 318 ALA B O   1 
ATOM   6595 C CB  . ALA B 1 317 ? -20.724 -56.382 -17.163 1.00 64.78  ? 318 ALA B CB  1 
ATOM   6596 N N   . GLY B 1 318 ? -20.083 -59.962 -17.396 1.00 74.41  ? 319 GLY B N   1 
ATOM   6597 C CA  . GLY B 1 318 ? -20.336 -61.033 -18.343 1.00 63.25  ? 319 GLY B CA  1 
ATOM   6598 C C   . GLY B 1 318 ? -20.916 -62.287 -17.715 1.00 62.91  ? 319 GLY B C   1 
ATOM   6599 O O   . GLY B 1 318 ? -20.721 -62.555 -16.530 1.00 59.85  ? 319 GLY B O   1 
ATOM   6600 N N   . ASP B 1 319 ? -21.630 -63.056 -18.523 1.00 62.80  ? 320 ASP B N   1 
ATOM   6601 C CA  . ASP B 1 319 ? -22.133 -64.354 -18.112 1.00 64.64  ? 320 ASP B CA  1 
ATOM   6602 C C   . ASP B 1 319 ? -21.215 -65.404 -18.733 1.00 65.56  ? 320 ASP B C   1 
ATOM   6603 O O   . ASP B 1 319 ? -21.105 -65.489 -19.953 1.00 60.36  ? 320 ASP B O   1 
ATOM   6604 C CB  . ASP B 1 319 ? -23.565 -64.540 -18.619 1.00 62.18  ? 320 ASP B CB  1 
ATOM   6605 C CG  . ASP B 1 319 ? -24.215 -65.822 -18.113 1.00 79.28  ? 320 ASP B CG  1 
ATOM   6606 O OD1 . ASP B 1 319 ? -23.516 -66.692 -17.534 1.00 73.81  ? 320 ASP B OD1 1 
ATOM   6607 O OD2 . ASP B 1 319 ? -25.443 -65.963 -18.310 1.00 87.62  ? 320 ASP B OD2 1 
ATOM   6608 N N   . PHE B 1 320 ? -20.569 -66.208 -17.896 1.00 64.20  ? 321 PHE B N   1 
ATOM   6609 C CA  . PHE B 1 320 ? -19.585 -67.163 -18.383 1.00 57.11  ? 321 PHE B CA  1 
ATOM   6610 C C   . PHE B 1 320 ? -19.991 -68.603 -18.107 1.00 61.10  ? 321 PHE B C   1 
ATOM   6611 O O   . PHE B 1 320 ? -19.143 -69.496 -18.054 1.00 64.46  ? 321 PHE B O   1 
ATOM   6612 C CB  . PHE B 1 320 ? -18.199 -66.841 -17.801 1.00 59.03  ? 321 PHE B CB  1 
ATOM   6613 C CG  . PHE B 1 320 ? -17.681 -65.489 -18.213 1.00 57.43  ? 321 PHE B CG  1 
ATOM   6614 C CD1 . PHE B 1 320 ? -17.254 -65.263 -19.522 1.00 55.13  ? 321 PHE B CD1 1 
ATOM   6615 C CD2 . PHE B 1 320 ? -17.662 -64.436 -17.318 1.00 51.40  ? 321 PHE B CD2 1 
ATOM   6616 C CE1 . PHE B 1 320 ? -16.788 -64.016 -19.914 1.00 53.37  ? 321 PHE B CE1 1 
ATOM   6617 C CE2 . PHE B 1 320 ? -17.203 -63.180 -17.702 1.00 60.48  ? 321 PHE B CE2 1 
ATOM   6618 C CZ  . PHE B 1 320 ? -16.761 -62.971 -19.004 1.00 54.27  ? 321 PHE B CZ  1 
ATOM   6619 N N   . HIS B 1 321 ? -21.291 -68.835 -17.938 1.00 62.14  ? 322 HIS B N   1 
ATOM   6620 C CA  . HIS B 1 321 ? -21.782 -70.204 -17.839 1.00 70.18  ? 322 HIS B CA  1 
ATOM   6621 C C   . HIS B 1 321 ? -21.496 -70.928 -19.153 1.00 65.51  ? 322 HIS B C   1 
ATOM   6622 O O   . HIS B 1 321 ? -21.667 -70.357 -20.228 1.00 66.26  ? 322 HIS B O   1 
ATOM   6623 C CB  . HIS B 1 321 ? -23.272 -70.246 -17.496 1.00 69.52  ? 322 HIS B CB  1 
ATOM   6624 C CG  . HIS B 1 321 ? -23.566 -69.905 -16.072 1.00 62.99  ? 322 HIS B CG  1 
ATOM   6625 N ND1 . HIS B 1 321 ? -24.045 -68.671 -15.686 1.00 70.19  ? 322 HIS B ND1 1 
ATOM   6626 C CD2 . HIS B 1 321 ? -23.422 -70.626 -14.935 1.00 67.19  ? 322 HIS B CD2 1 
ATOM   6627 C CE1 . HIS B 1 321 ? -24.197 -68.651 -14.373 1.00 69.93  ? 322 HIS B CE1 1 
ATOM   6628 N NE2 . HIS B 1 321 ? -23.823 -69.824 -13.893 1.00 72.85  ? 322 HIS B NE2 1 
ATOM   6629 N N   . GLY B 1 322 ? -21.029 -72.171 -19.056 1.00 61.40  ? 323 GLY B N   1 
ATOM   6630 C CA  . GLY B 1 322 ? -20.658 -72.943 -20.231 1.00 69.35  ? 323 GLY B CA  1 
ATOM   6631 C C   . GLY B 1 322 ? -19.180 -72.861 -20.597 1.00 71.25  ? 323 GLY B C   1 
ATOM   6632 O O   . GLY B 1 322 ? -18.726 -73.496 -21.549 1.00 66.15  ? 323 GLY B O   1 
ATOM   6633 N N   . LEU B 1 323 ? -18.418 -72.079 -19.840 1.00 71.35  ? 324 LEU B N   1 
ATOM   6634 C CA  . LEU B 1 323 ? -17.014 -71.870 -20.165 1.00 57.10  ? 324 LEU B CA  1 
ATOM   6635 C C   . LEU B 1 323 ? -16.087 -72.601 -19.198 1.00 61.80  ? 324 LEU B C   1 
ATOM   6636 O O   . LEU B 1 323 ? -16.279 -72.547 -17.968 1.00 60.42  ? 324 LEU B O   1 
ATOM   6637 C CB  . LEU B 1 323 ? -16.696 -70.372 -20.182 1.00 58.73  ? 324 LEU B CB  1 
ATOM   6638 C CG  . LEU B 1 323 ? -15.258 -69.963 -20.505 1.00 50.43  ? 324 LEU B CG  1 
ATOM   6639 C CD1 . LEU B 1 323 ? -14.902 -70.318 -21.956 1.00 50.13  ? 324 LEU B CD1 1 
ATOM   6640 C CD2 . LEU B 1 323 ? -15.055 -68.469 -20.224 1.00 49.36  ? 324 LEU B CD2 1 
ATOM   6641 N N   . GLN B 1 324 ? -15.092 -73.298 -19.752 1.00 50.20  ? 325 GLN B N   1 
ATOM   6642 C CA  . GLN B 1 324 ? -13.986 -73.803 -18.937 1.00 49.13  ? 325 GLN B CA  1 
ATOM   6643 C C   . GLN B 1 324 ? -12.697 -73.088 -19.342 1.00 53.66  ? 325 GLN B C   1 
ATOM   6644 O O   . GLN B 1 324 ? -12.426 -72.856 -20.538 1.00 50.10  ? 325 GLN B O   1 
ATOM   6645 C CB  . GLN B 1 324 ? -13.817 -75.319 -19.052 1.00 50.32  ? 325 GLN B CB  1 
ATOM   6646 C CG  . GLN B 1 324 ? -15.062 -76.119 -18.746 1.00 54.53  ? 325 GLN B CG  1 
ATOM   6647 C CD  . GLN B 1 324 ? -15.910 -76.328 -19.969 1.00 66.27  ? 325 GLN B CD  1 
ATOM   6648 O OE1 . GLN B 1 324 ? -15.423 -76.248 -21.104 1.00 63.38  ? 325 GLN B OE1 1 
ATOM   6649 N NE2 . GLN B 1 324 ? -17.193 -76.579 -19.755 1.00 65.68  ? 325 GLN B NE2 1 
ATOM   6650 N N   . VAL B 1 325 ? -11.917 -72.717 -18.338 1.00 41.76  ? 326 VAL B N   1 
ATOM   6651 C CA  . VAL B 1 325 ? -10.703 -71.942 -18.540 1.00 43.39  ? 326 VAL B CA  1 
ATOM   6652 C C   . VAL B 1 325 ? -9.603  -72.444 -17.626 1.00 54.46  ? 326 VAL B C   1 
ATOM   6653 O O   . VAL B 1 325 ? -9.856  -72.804 -16.461 1.00 49.10  ? 326 VAL B O   1 
ATOM   6654 C CB  . VAL B 1 325 ? -10.928 -70.431 -18.281 1.00 49.02  ? 326 VAL B CB  1 
ATOM   6655 C CG1 . VAL B 1 325 ? -9.704  -69.652 -18.644 1.00 51.83  ? 326 VAL B CG1 1 
ATOM   6656 C CG2 . VAL B 1 325 ? -12.047 -69.905 -19.115 1.00 48.63  ? 326 VAL B CG2 1 
ATOM   6657 N N   . LEU B 1 326 ? -8.385  -72.475 -18.157 1.00 43.06  ? 327 LEU B N   1 
ATOM   6658 C CA  . LEU B 1 326 ? -7.204  -72.815 -17.367 1.00 45.96  ? 327 LEU B CA  1 
ATOM   6659 C C   . LEU B 1 326 ? -6.254  -71.614 -17.375 1.00 49.78  ? 327 LEU B C   1 
ATOM   6660 O O   . LEU B 1 326 ? -5.904  -71.104 -18.443 1.00 49.02  ? 327 LEU B O   1 
ATOM   6661 C CB  . LEU B 1 326 ? -6.535  -74.053 -17.952 1.00 43.84  ? 327 LEU B CB  1 
ATOM   6662 C CG  . LEU B 1 326 ? -5.169  -74.447 -17.391 1.00 50.41  ? 327 LEU B CG  1 
ATOM   6663 C CD1 . LEU B 1 326 ? -5.317  -75.040 -16.030 1.00 56.60  ? 327 LEU B CD1 1 
ATOM   6664 C CD2 . LEU B 1 326 ? -4.519  -75.438 -18.318 1.00 50.34  ? 327 LEU B CD2 1 
ATOM   6665 N N   . VAL B 1 327 ? -5.882  -71.122 -16.194 1.00 46.60  ? 328 VAL B N   1 
ATOM   6666 C CA  . VAL B 1 327 ? -5.051  -69.916 -16.085 1.00 38.60  ? 328 VAL B CA  1 
ATOM   6667 C C   . VAL B 1 327 ? -3.879  -70.120 -15.144 1.00 46.24  ? 328 VAL B C   1 
ATOM   6668 O O   . VAL B 1 327 ? -3.909  -71.001 -14.279 1.00 47.05  ? 328 VAL B O   1 
ATOM   6669 C CB  . VAL B 1 327 ? -5.868  -68.686 -15.616 1.00 44.77  ? 328 VAL B CB  1 
ATOM   6670 C CG1 . VAL B 1 327 ? -7.083  -68.509 -16.488 1.00 35.19  ? 328 VAL B CG1 1 
ATOM   6671 C CG2 . VAL B 1 327 ? -6.310  -68.851 -14.142 1.00 39.29  ? 328 VAL B CG2 1 
ATOM   6672 N N   . GLY B 1 328 ? -2.842  -69.300 -15.288 1.00 44.68  ? 329 GLY B N   1 
ATOM   6673 C CA  . GLY B 1 328 ? -1.721  -69.413 -14.371 1.00 40.33  ? 329 GLY B CA  1 
ATOM   6674 C C   . GLY B 1 328 ? -0.587  -68.448 -14.632 1.00 43.42  ? 329 GLY B C   1 
ATOM   6675 O O   . GLY B 1 328 ? -0.628  -67.654 -15.573 1.00 41.78  ? 329 GLY B O   1 
ATOM   6676 N N   . VAL B 1 329 ? 0.434   -68.520 -13.787 1.00 42.01  ? 330 VAL B N   1 
ATOM   6677 C CA  . VAL B 1 329 ? 1.568   -67.600 -13.850 1.00 37.85  ? 330 VAL B CA  1 
ATOM   6678 C C   . VAL B 1 329 ? 2.818   -68.412 -13.558 1.00 45.24  ? 330 VAL B C   1 
ATOM   6679 O O   . VAL B 1 329 ? 2.715   -69.541 -13.056 1.00 44.14  ? 330 VAL B O   1 
ATOM   6680 C CB  . VAL B 1 329 ? 1.413   -66.459 -12.791 1.00 43.60  ? 330 VAL B CB  1 
ATOM   6681 C CG1 . VAL B 1 329 ? 0.144   -65.645 -13.057 1.00 40.52  ? 330 VAL B CG1 1 
ATOM   6682 C CG2 . VAL B 1 329 ? 1.376   -67.041 -11.333 1.00 43.52  ? 330 VAL B CG2 1 
ATOM   6683 N N   . VAL B 1 330 ? 3.995   -67.867 -13.872 1.00 40.88  ? 331 VAL B N   1 
ATOM   6684 C CA  . VAL B 1 330 ? 5.238   -68.504 -13.453 1.00 36.15  ? 331 VAL B CA  1 
ATOM   6685 C C   . VAL B 1 330 ? 5.608   -67.913 -12.079 1.00 49.56  ? 331 VAL B C   1 
ATOM   6686 O O   . VAL B 1 330 ? 4.986   -66.943 -11.611 1.00 38.72  ? 331 VAL B O   1 
ATOM   6687 C CB  . VAL B 1 330 ? 6.418   -68.264 -14.434 1.00 36.19  ? 331 VAL B CB  1 
ATOM   6688 C CG1 . VAL B 1 330 ? 6.118   -68.850 -15.825 1.00 42.07  ? 331 VAL B CG1 1 
ATOM   6689 C CG2 . VAL B 1 330 ? 6.757   -66.770 -14.518 1.00 36.80  ? 331 VAL B CG2 1 
ATOM   6690 N N   . LYS B 1 331 ? 6.649   -68.463 -11.470 1.00 43.35  ? 332 LYS B N   1 
ATOM   6691 C CA  . LYS B 1 331 ? 7.006   -68.108 -10.100 1.00 41.50  ? 332 LYS B CA  1 
ATOM   6692 C C   . LYS B 1 331 ? 7.576   -66.689 -9.969  1.00 48.24  ? 332 LYS B C   1 
ATOM   6693 O O   . LYS B 1 331 ? 7.372   -66.036 -8.958  1.00 39.72  ? 332 LYS B O   1 
ATOM   6694 C CB  . LYS B 1 331 ? 7.993   -69.126 -9.531  1.00 39.38  ? 332 LYS B CB  1 
ATOM   6695 C CG  . LYS B 1 331 ? 8.213   -68.965 -7.984  1.00 51.73  ? 332 LYS B CG  1 
ATOM   6696 C CD  . LYS B 1 331 ? 8.813   -70.232 -7.389  1.00 54.13  ? 332 LYS B CD  1 
ATOM   6697 C CE  . LYS B 1 331 ? 10.196  -69.993 -6.806  1.00 66.82  ? 332 LYS B CE  1 
ATOM   6698 N NZ  . LYS B 1 331 ? 10.168  -69.111 -5.583  1.00 63.08  ? 332 LYS B NZ  1 
ATOM   6699 N N   . ASP B 1 332 ? 8.268   -66.204 -10.994 1.00 44.61  ? 333 ASP B N   1 
ATOM   6700 C CA  . ASP B 1 332 ? 8.891   -64.874 -10.937 1.00 46.13  ? 333 ASP B CA  1 
ATOM   6701 C C   . ASP B 1 332 ? 8.541   -64.016 -12.168 1.00 46.21  ? 333 ASP B C   1 
ATOM   6702 O O   . ASP B 1 332 ? 9.386   -63.755 -13.023 1.00 47.83  ? 333 ASP B O   1 
ATOM   6703 C CB  . ASP B 1 332 ? 10.411  -65.014 -10.793 1.00 46.94  ? 333 ASP B CB  1 
ATOM   6704 C CG  . ASP B 1 332 ? 10.811  -65.713 -9.498  1.00 57.23  ? 333 ASP B CG  1 
ATOM   6705 O OD1 . ASP B 1 332 ? 10.877  -65.027 -8.452  1.00 58.20  ? 333 ASP B OD1 1 
ATOM   6706 O OD2 . ASP B 1 332 ? 11.045  -66.946 -9.517  1.00 51.33  ? 333 ASP B OD2 1 
ATOM   6707 N N   . GLU B 1 333 ? 7.288   -63.581 -12.244 1.00 45.79  ? 334 GLU B N   1 
ATOM   6708 C CA  . GLU B 1 333 ? 6.790   -62.809 -13.374 1.00 46.83  ? 334 GLU B CA  1 
ATOM   6709 C C   . GLU B 1 333 ? 7.548   -61.499 -13.667 1.00 49.86  ? 334 GLU B C   1 
ATOM   6710 O O   . GLU B 1 333 ? 7.694   -61.104 -14.826 1.00 45.76  ? 334 GLU B O   1 
ATOM   6711 C CB  . GLU B 1 333 ? 5.287   -62.534 -13.195 1.00 40.41  ? 334 GLU B CB  1 
ATOM   6712 C CG  . GLU B 1 333 ? 4.412   -63.779 -13.262 1.00 38.24  ? 334 GLU B CG  1 
ATOM   6713 C CD  . GLU B 1 333 ? 4.272   -64.341 -14.687 1.00 50.89  ? 334 GLU B CD  1 
ATOM   6714 O OE1 . GLU B 1 333 ? 4.854   -63.768 -15.646 1.00 45.91  ? 334 GLU B OE1 1 
ATOM   6715 O OE2 . GLU B 1 333 ? 3.570   -65.361 -14.849 1.00 45.99  ? 334 GLU B OE2 1 
ATOM   6716 N N   . GLY B 1 334 ? 8.028   -60.821 -12.630 1.00 45.47  ? 335 GLY B N   1 
ATOM   6717 C CA  . GLY B 1 334 ? 8.627   -59.508 -12.835 1.00 45.12  ? 335 GLY B CA  1 
ATOM   6718 C C   . GLY B 1 334 ? 10.100  -59.447 -13.234 1.00 46.90  ? 335 GLY B C   1 
ATOM   6719 O O   . GLY B 1 334 ? 10.545  -58.447 -13.815 1.00 39.90  ? 335 GLY B O   1 
ATOM   6720 N N   . SER B 1 335 ? 10.864  -60.497 -12.926 1.00 46.27  ? 336 SER B N   1 
ATOM   6721 C CA  . SER B 1 335 ? 12.336  -60.400 -12.953 1.00 48.34  ? 336 SER B CA  1 
ATOM   6722 C C   . SER B 1 335 ? 12.951  -60.086 -14.331 1.00 54.29  ? 336 SER B C   1 
ATOM   6723 O O   . SER B 1 335 ? 13.837  -59.232 -14.444 1.00 51.67  ? 336 SER B O   1 
ATOM   6724 C CB  . SER B 1 335 ? 12.968  -61.661 -12.369 1.00 49.38  ? 336 SER B CB  1 
ATOM   6725 O OG  . SER B 1 335 ? 12.774  -62.753 -13.241 1.00 51.22  ? 336 SER B OG  1 
ATOM   6726 N N   . TYR B 1 336 ? 12.470  -60.770 -15.365 1.00 48.62  ? 337 TYR B N   1 
ATOM   6727 C CA  . TYR B 1 336 ? 12.939  -60.574 -16.741 1.00 54.12  ? 337 TYR B CA  1 
ATOM   6728 C C   . TYR B 1 336 ? 12.856  -59.112 -17.145 1.00 49.94  ? 337 TYR B C   1 
ATOM   6729 O O   . TYR B 1 336 ? 13.713  -58.608 -17.863 1.00 55.97  ? 337 TYR B O   1 
ATOM   6730 C CB  . TYR B 1 336 ? 12.093  -61.437 -17.696 1.00 55.95  ? 337 TYR B CB  1 
ATOM   6731 C CG  . TYR B 1 336 ? 12.297  -61.246 -19.194 1.00 57.85  ? 337 TYR B CG  1 
ATOM   6732 C CD1 . TYR B 1 336 ? 13.213  -62.022 -19.899 1.00 66.63  ? 337 TYR B CD1 1 
ATOM   6733 C CD2 . TYR B 1 336 ? 11.533  -60.329 -19.912 1.00 63.28  ? 337 TYR B CD2 1 
ATOM   6734 C CE1 . TYR B 1 336 ? 13.384  -61.870 -21.285 1.00 71.40  ? 337 TYR B CE1 1 
ATOM   6735 C CE2 . TYR B 1 336 ? 11.702  -60.165 -21.286 1.00 71.19  ? 337 TYR B CE2 1 
ATOM   6736 C CZ  . TYR B 1 336 ? 12.629  -60.937 -21.969 1.00 70.47  ? 337 TYR B CZ  1 
ATOM   6737 O OH  . TYR B 1 336 ? 12.792  -60.781 -23.336 1.00 86.44  ? 337 TYR B OH  1 
ATOM   6738 N N   . PHE B 1 337 ? 11.824  -58.428 -16.672 1.00 53.23  ? 338 PHE B N   1 
ATOM   6739 C CA  . PHE B 1 337 ? 11.550  -57.072 -17.137 1.00 51.81  ? 338 PHE B CA  1 
ATOM   6740 C C   . PHE B 1 337 ? 12.465  -55.997 -16.559 1.00 47.95  ? 338 PHE B C   1 
ATOM   6741 O O   . PHE B 1 337 ? 12.684  -54.953 -17.197 1.00 49.81  ? 338 PHE B O   1 
ATOM   6742 C CB  . PHE B 1 337 ? 10.066  -56.743 -16.963 1.00 49.28  ? 338 PHE B CB  1 
ATOM   6743 C CG  . PHE B 1 337 ? 9.183   -57.566 -17.851 1.00 50.12  ? 338 PHE B CG  1 
ATOM   6744 C CD1 . PHE B 1 337 ? 8.655   -58.769 -17.399 1.00 52.15  ? 338 PHE B CD1 1 
ATOM   6745 C CD2 . PHE B 1 337 ? 8.933   -57.173 -19.163 1.00 50.31  ? 338 PHE B CD2 1 
ATOM   6746 C CE1 . PHE B 1 337 ? 7.872   -59.552 -18.231 1.00 54.22  ? 338 PHE B CE1 1 
ATOM   6747 C CE2 . PHE B 1 337 ? 8.144   -57.947 -20.004 1.00 51.13  ? 338 PHE B CE2 1 
ATOM   6748 C CZ  . PHE B 1 337 ? 7.614   -59.144 -19.536 1.00 50.58  ? 338 PHE B CZ  1 
ATOM   6749 N N   . LEU B 1 338 ? 13.036  -56.280 -15.390 1.00 45.18  ? 339 LEU B N   1 
ATOM   6750 C CA  . LEU B 1 338 ? 13.856  -55.318 -14.663 1.00 47.32  ? 339 LEU B CA  1 
ATOM   6751 C C   . LEU B 1 338 ? 15.191  -54.965 -15.348 1.00 55.17  ? 339 LEU B C   1 
ATOM   6752 O O   . LEU B 1 338 ? 15.679  -53.842 -15.212 1.00 50.52  ? 339 LEU B O   1 
ATOM   6753 C CB  . LEU B 1 338 ? 14.115  -55.810 -13.237 1.00 48.26  ? 339 LEU B CB  1 
ATOM   6754 C CG  . LEU B 1 338 ? 12.854  -56.032 -12.403 1.00 51.22  ? 339 LEU B CG  1 
ATOM   6755 C CD1 . LEU B 1 338 ? 13.210  -56.521 -11.017 1.00 46.84  ? 339 LEU B CD1 1 
ATOM   6756 C CD2 . LEU B 1 338 ? 12.020  -54.756 -12.335 1.00 48.25  ? 339 LEU B CD2 1 
ATOM   6757 N N   . VAL B 1 339 ? 15.784  -55.903 -16.081 1.00 47.68  ? 340 VAL B N   1 
ATOM   6758 C CA  . VAL B 1 339 ? 17.054  -55.600 -16.735 1.00 53.76  ? 340 VAL B CA  1 
ATOM   6759 C C   . VAL B 1 339 ? 16.879  -54.784 -18.015 1.00 57.94  ? 340 VAL B C   1 
ATOM   6760 O O   . VAL B 1 339 ? 17.848  -54.477 -18.699 1.00 59.40  ? 340 VAL B O   1 
ATOM   6761 C CB  . VAL B 1 339 ? 17.875  -56.861 -17.028 1.00 62.02  ? 340 VAL B CB  1 
ATOM   6762 C CG1 . VAL B 1 339 ? 18.111  -57.619 -15.745 1.00 52.15  ? 340 VAL B CG1 1 
ATOM   6763 C CG2 . VAL B 1 339 ? 17.176  -57.732 -18.060 1.00 54.92  ? 340 VAL B CG2 1 
ATOM   6764 N N   . TYR B 1 340 ? 15.640  -54.425 -18.330 1.00 56.18  ? 341 TYR B N   1 
ATOM   6765 C CA  . TYR B 1 340 ? 15.375  -53.586 -19.492 1.00 51.24  ? 341 TYR B CA  1 
ATOM   6766 C C   . TYR B 1 340 ? 15.078  -52.130 -19.146 1.00 60.52  ? 341 TYR B C   1 
ATOM   6767 O O   . TYR B 1 340 ? 14.417  -51.433 -19.924 1.00 56.30  ? 341 TYR B O   1 
ATOM   6768 C CB  . TYR B 1 340 ? 14.221  -54.153 -20.294 1.00 48.04  ? 341 TYR B CB  1 
ATOM   6769 C CG  . TYR B 1 340 ? 14.599  -55.350 -21.119 1.00 59.55  ? 341 TYR B CG  1 
ATOM   6770 C CD1 . TYR B 1 340 ? 14.951  -55.208 -22.458 1.00 58.85  ? 341 TYR B CD1 1 
ATOM   6771 C CD2 . TYR B 1 340 ? 14.611  -56.624 -20.565 1.00 57.12  ? 341 TYR B CD2 1 
ATOM   6772 C CE1 . TYR B 1 340 ? 15.293  -56.296 -23.221 1.00 56.39  ? 341 TYR B CE1 1 
ATOM   6773 C CE2 . TYR B 1 340 ? 14.955  -57.720 -21.319 1.00 58.73  ? 341 TYR B CE2 1 
ATOM   6774 C CZ  . TYR B 1 340 ? 15.298  -57.553 -22.649 1.00 68.03  ? 341 TYR B CZ  1 
ATOM   6775 O OH  . TYR B 1 340 ? 15.644  -58.650 -23.410 1.00 68.04  ? 341 TYR B OH  1 
ATOM   6776 N N   . GLY B 1 341 ? 15.548  -51.662 -17.990 1.00 49.34  ? 342 GLY B N   1 
ATOM   6777 C CA  . GLY B 1 341 ? 15.396  -50.250 -17.674 1.00 49.17  ? 342 GLY B CA  1 
ATOM   6778 C C   . GLY B 1 341 ? 15.343  -49.813 -16.219 1.00 51.35  ? 342 GLY B C   1 
ATOM   6779 O O   . GLY B 1 341 ? 15.423  -48.620 -15.935 1.00 57.54  ? 342 GLY B O   1 
ATOM   6780 N N   . ALA B 1 342 ? 15.217  -50.752 -15.289 1.00 51.77  ? 343 ALA B N   1 
ATOM   6781 C CA  . ALA B 1 342 ? 15.249  -50.384 -13.867 1.00 54.59  ? 343 ALA B CA  1 
ATOM   6782 C C   . ALA B 1 342 ? 16.684  -50.158 -13.394 1.00 59.76  ? 343 ALA B C   1 
ATOM   6783 O O   . ALA B 1 342 ? 17.560  -51.023 -13.596 1.00 53.78  ? 343 ALA B O   1 
ATOM   6784 C CB  . ALA B 1 342 ? 14.569  -51.435 -13.020 1.00 49.66  ? 343 ALA B CB  1 
ATOM   6785 N N   . PRO B 1 343 ? 16.932  -48.989 -12.772 1.00 60.39  ? 344 PRO B N   1 
ATOM   6786 C CA  . PRO B 1 343 ? 18.272  -48.618 -12.297 1.00 59.34  ? 344 PRO B CA  1 
ATOM   6787 C C   . PRO B 1 343 ? 18.888  -49.694 -11.424 1.00 56.86  ? 344 PRO B C   1 
ATOM   6788 O O   . PRO B 1 343 ? 18.204  -50.233 -10.548 1.00 57.36  ? 344 PRO B O   1 
ATOM   6789 C CB  . PRO B 1 343 ? 18.031  -47.327 -11.489 1.00 61.66  ? 344 PRO B CB  1 
ATOM   6790 C CG  . PRO B 1 343 ? 16.534  -47.158 -11.400 1.00 60.36  ? 344 PRO B CG  1 
ATOM   6791 C CD  . PRO B 1 343 ? 15.952  -47.910 -12.556 1.00 53.46  ? 344 PRO B CD  1 
ATOM   6792 N N   . GLY B 1 344 ? 20.149  -50.027 -11.694 1.00 57.70  ? 345 GLY B N   1 
ATOM   6793 C CA  . GLY B 1 344 ? 20.890  -50.981 -10.888 1.00 54.31  ? 345 GLY B CA  1 
ATOM   6794 C C   . GLY B 1 344 ? 20.797  -52.444 -11.301 1.00 60.05  ? 345 GLY B C   1 
ATOM   6795 O O   . GLY B 1 344 ? 21.469  -53.293 -10.714 1.00 60.31  ? 345 GLY B O   1 
ATOM   6796 N N   . PHE B 1 345 ? 19.974  -52.757 -12.302 1.00 58.63  ? 346 PHE B N   1 
ATOM   6797 C CA  . PHE B 1 345 ? 19.750  -54.160 -12.666 1.00 61.26  ? 346 PHE B CA  1 
ATOM   6798 C C   . PHE B 1 345 ? 20.580  -54.625 -13.863 1.00 60.39  ? 346 PHE B C   1 
ATOM   6799 O O   . PHE B 1 345 ? 20.717  -53.908 -14.856 1.00 63.45  ? 346 PHE B O   1 
ATOM   6800 C CB  . PHE B 1 345 ? 18.261  -54.428 -12.927 1.00 58.93  ? 346 PHE B CB  1 
ATOM   6801 C CG  . PHE B 1 345 ? 17.440  -54.587 -11.675 1.00 52.87  ? 346 PHE B CG  1 
ATOM   6802 C CD1 . PHE B 1 345 ? 17.207  -55.844 -11.144 1.00 52.78  ? 346 PHE B CD1 1 
ATOM   6803 C CD2 . PHE B 1 345 ? 16.891  -53.483 -11.044 1.00 52.33  ? 346 PHE B CD2 1 
ATOM   6804 C CE1 . PHE B 1 345 ? 16.456  -56.001 -9.990  1.00 55.13  ? 346 PHE B CE1 1 
ATOM   6805 C CE2 . PHE B 1 345 ? 16.131  -53.624 -9.892  1.00 52.67  ? 346 PHE B CE2 1 
ATOM   6806 C CZ  . PHE B 1 345 ? 15.913  -54.888 -9.358  1.00 52.12  ? 346 PHE B CZ  1 
ATOM   6807 N N   . SER B 1 346 ? 21.119  -55.834 -13.765 1.00 60.38  ? 347 SER B N   1 
ATOM   6808 C CA  . SER B 1 346 ? 21.798  -56.460 -14.896 1.00 62.62  ? 347 SER B CA  1 
ATOM   6809 C C   . SER B 1 346 ? 21.676  -57.971 -14.798 1.00 60.85  ? 347 SER B C   1 
ATOM   6810 O O   . SER B 1 346 ? 21.606  -58.516 -13.698 1.00 55.14  ? 347 SER B O   1 
ATOM   6811 C CB  . SER B 1 346 ? 23.273  -56.066 -14.922 1.00 66.11  ? 347 SER B CB  1 
ATOM   6812 O OG  . SER B 1 346 ? 24.011  -56.923 -15.781 1.00 66.04  ? 347 SER B OG  1 
ATOM   6813 N N   . LYS B 1 347 ? 21.655  -58.657 -15.937 1.00 54.11  ? 348 LYS B N   1 
ATOM   6814 C CA  . LYS B 1 347 ? 21.704  -60.119 -15.901 1.00 57.19  ? 348 LYS B CA  1 
ATOM   6815 C C   . LYS B 1 347 ? 23.095  -60.571 -15.450 1.00 57.98  ? 348 LYS B C   1 
ATOM   6816 O O   . LYS B 1 347 ? 23.269  -61.669 -14.923 1.00 59.61  ? 348 LYS B O   1 
ATOM   6817 C CB  . LYS B 1 347 ? 21.366  -60.727 -17.270 1.00 60.36  ? 348 LYS B CB  1 
ATOM   6818 C CG  . LYS B 1 347 ? 22.576  -60.979 -18.172 1.00 53.18  ? 348 LYS B CG  1 
ATOM   6819 C CD  . LYS B 1 347 ? 22.164  -61.695 -19.469 1.00 67.03  ? 348 LYS B CD  1 
ATOM   6820 C CE  . LYS B 1 347 ? 23.375  -62.077 -20.348 1.00 54.64  ? 348 LYS B CE  1 
ATOM   6821 N NZ  . LYS B 1 347 ? 24.237  -63.085 -19.640 1.00 57.46  ? 348 LYS B NZ  1 
ATOM   6822 N N   . ASP B 1 348 ? 24.081  -59.700 -15.637 1.00 52.90  ? 349 ASP B N   1 
ATOM   6823 C CA  . ASP B 1 348 ? 25.473  -60.063 -15.383 1.00 63.77  ? 349 ASP B CA  1 
ATOM   6824 C C   . ASP B 1 348 ? 26.020  -59.709 -13.995 1.00 65.28  ? 349 ASP B C   1 
ATOM   6825 O O   . ASP B 1 348 ? 27.202  -59.913 -13.735 1.00 74.62  ? 349 ASP B O   1 
ATOM   6826 C CB  . ASP B 1 348 ? 26.371  -59.494 -16.486 1.00 63.41  ? 349 ASP B CB  1 
ATOM   6827 C CG  . ASP B 1 348 ? 26.083  -60.121 -17.832 1.00 62.68  ? 349 ASP B CG  1 
ATOM   6828 O OD1 . ASP B 1 348 ? 25.983  -61.369 -17.894 1.00 62.66  ? 349 ASP B OD1 1 
ATOM   6829 O OD2 . ASP B 1 348 ? 25.924  -59.371 -18.818 1.00 67.08  ? 349 ASP B OD2 1 
ATOM   6830 N N   . ASN B 1 349 ? 25.176  -59.178 -13.113 1.00 62.37  ? 350 ASN B N   1 
ATOM   6831 C CA  . ASN B 1 349 ? 25.529  -59.069 -11.688 1.00 64.00  ? 350 ASN B CA  1 
ATOM   6832 C C   . ASN B 1 349 ? 24.320  -59.387 -10.809 1.00 59.45  ? 350 ASN B C   1 
ATOM   6833 O O   . ASN B 1 349 ? 23.247  -59.716 -11.318 1.00 63.92  ? 350 ASN B O   1 
ATOM   6834 C CB  . ASN B 1 349 ? 26.198  -57.714 -11.319 1.00 57.42  ? 350 ASN B CB  1 
ATOM   6835 C CG  . ASN B 1 349 ? 25.257  -56.509 -11.447 1.00 68.52  ? 350 ASN B CG  1 
ATOM   6836 O OD1 . ASN B 1 349 ? 24.097  -56.552 -11.027 1.00 70.45  ? 350 ASN B OD1 1 
ATOM   6837 N ND2 . ASN B 1 349 ? 25.766  -55.420 -12.022 1.00 77.92  ? 350 ASN B ND2 1 
ATOM   6838 N N   . GLU B 1 350 ? 24.491  -59.283 -9.500  1.00 57.65  ? 351 GLU B N   1 
ATOM   6839 C CA  . GLU B 1 350 ? 23.457  -59.705 -8.567  1.00 54.57  ? 351 GLU B CA  1 
ATOM   6840 C C   . GLU B 1 350 ? 22.268  -58.742 -8.467  1.00 50.78  ? 351 GLU B C   1 
ATOM   6841 O O   . GLU B 1 350 ? 21.261  -59.079 -7.854  1.00 58.31  ? 351 GLU B O   1 
ATOM   6842 C CB  . GLU B 1 350 ? 24.063  -59.975 -7.179  1.00 58.35  ? 351 GLU B CB  1 
ATOM   6843 C CG  . GLU B 1 350 ? 24.773  -61.329 -7.053  1.00 65.57  ? 351 GLU B CG  1 
ATOM   6844 C CD  . GLU B 1 350 ? 23.864  -62.509 -7.403  1.00 78.05  ? 351 GLU B CD  1 
ATOM   6845 O OE1 . GLU B 1 350 ? 23.862  -62.933 -8.579  1.00 80.04  ? 351 GLU B OE1 1 
ATOM   6846 O OE2 . GLU B 1 350 ? 23.148  -63.015 -6.506  1.00 87.20  ? 351 GLU B OE2 1 
ATOM   6847 N N   . SER B 1 351 ? 22.380  -57.562 -9.073  1.00 55.36  ? 352 SER B N   1 
ATOM   6848 C CA  . SER B 1 351 ? 21.295  -56.579 -9.056  1.00 54.30  ? 352 SER B CA  1 
ATOM   6849 C C   . SER B 1 351 ? 20.843  -56.243 -7.631  1.00 51.71  ? 352 SER B C   1 
ATOM   6850 O O   . SER B 1 351 ? 19.640  -56.107 -7.356  1.00 51.73  ? 352 SER B O   1 
ATOM   6851 C CB  . SER B 1 351 ? 20.101  -57.072 -9.873  1.00 55.15  ? 352 SER B CB  1 
ATOM   6852 O OG  . SER B 1 351 ? 20.428  -57.205 -11.238 1.00 54.75  ? 352 SER B OG  1 
ATOM   6853 N N   . LEU B 1 352 ? 21.814  -56.133 -6.731  1.00 53.06  ? 353 LEU B N   1 
ATOM   6854 C CA  . LEU B 1 352 ? 21.566  -55.768 -5.339  1.00 55.21  ? 353 LEU B CA  1 
ATOM   6855 C C   . LEU B 1 352 ? 21.461  -54.246 -5.214  1.00 53.66  ? 353 LEU B C   1 
ATOM   6856 O O   . LEU B 1 352 ? 22.439  -53.576 -4.914  1.00 58.65  ? 353 LEU B O   1 
ATOM   6857 C CB  . LEU B 1 352 ? 22.693  -56.312 -4.456  1.00 48.79  ? 353 LEU B CB  1 
ATOM   6858 C CG  . LEU B 1 352 ? 22.766  -57.843 -4.445  1.00 58.23  ? 353 LEU B CG  1 
ATOM   6859 C CD1 . LEU B 1 352 ? 24.083  -58.356 -3.873  1.00 52.45  ? 353 LEU B CD1 1 
ATOM   6860 C CD2 . LEU B 1 352 ? 21.586  -58.444 -3.691  1.00 44.37  ? 353 LEU B CD2 1 
ATOM   6861 N N   . ILE B 1 353 ? 20.264  -53.714 -5.436  1.00 52.63  ? 354 ILE B N   1 
ATOM   6862 C CA  . ILE B 1 353 ? 20.050  -52.270 -5.576  1.00 52.18  ? 354 ILE B CA  1 
ATOM   6863 C C   . ILE B 1 353 ? 19.940  -51.507 -4.241  1.00 55.11  ? 354 ILE B C   1 
ATOM   6864 O O   . ILE B 1 353 ? 19.698  -52.100 -3.192  1.00 50.49  ? 354 ILE B O   1 
ATOM   6865 C CB  . ILE B 1 353 ? 18.778  -52.009 -6.390  1.00 54.19  ? 354 ILE B CB  1 
ATOM   6866 C CG1 . ILE B 1 353 ? 17.571  -52.623 -5.664  1.00 44.66  ? 354 ILE B CG1 1 
ATOM   6867 C CG2 . ILE B 1 353 ? 18.919  -52.617 -7.787  1.00 51.00  ? 354 ILE B CG2 1 
ATOM   6868 C CD1 . ILE B 1 353 ? 16.226  -52.237 -6.237  1.00 46.86  ? 354 ILE B CD1 1 
ATOM   6869 N N   . SER B 1 354 ? 20.114  -50.187 -4.287  1.00 53.62  ? 355 SER B N   1 
ATOM   6870 C CA  . SER B 1 354 ? 19.945  -49.367 -3.088  1.00 51.50  ? 355 SER B CA  1 
ATOM   6871 C C   . SER B 1 354 ? 18.475  -48.973 -2.919  1.00 59.82  ? 355 SER B C   1 
ATOM   6872 O O   . SER B 1 354 ? 17.623  -49.271 -3.774  1.00 49.00  ? 355 SER B O   1 
ATOM   6873 C CB  . SER B 1 354 ? 20.827  -48.104 -3.138  1.00 44.92  ? 355 SER B CB  1 
ATOM   6874 O OG  . SER B 1 354 ? 20.387  -47.172 -4.132  1.00 55.24  ? 355 SER B OG  1 
ATOM   6875 N N   . ARG B 1 355 ? 18.186  -48.300 -1.813  1.00 47.56  ? 356 ARG B N   1 
ATOM   6876 C CA  . ARG B 1 355 ? 16.853  -47.814 -1.551  1.00 51.53  ? 356 ARG B CA  1 
ATOM   6877 C C   . ARG B 1 355 ? 16.477  -46.740 -2.569  1.00 53.99  ? 356 ARG B C   1 
ATOM   6878 O O   . ARG B 1 355 ? 15.369  -46.748 -3.118  1.00 56.56  ? 356 ARG B O   1 
ATOM   6879 C CB  . ARG B 1 355 ? 16.761  -47.277 -0.121  1.00 52.97  ? 356 ARG B CB  1 
ATOM   6880 C CG  . ARG B 1 355 ? 15.435  -46.665 0.218   1.00 55.65  ? 356 ARG B CG  1 
ATOM   6881 C CD  . ARG B 1 355 ? 14.415  -47.709 0.595   1.00 64.81  ? 356 ARG B CD  1 
ATOM   6882 N NE  . ARG B 1 355 ? 13.128  -47.107 0.934   1.00 65.03  ? 356 ARG B NE  1 
ATOM   6883 C CZ  . ARG B 1 355 ? 12.012  -47.802 1.096   1.00 51.66  ? 356 ARG B CZ  1 
ATOM   6884 N NH1 . ARG B 1 355 ? 12.042  -49.117 0.957   1.00 49.83  ? 356 ARG B NH1 1 
ATOM   6885 N NH2 . ARG B 1 355 ? 10.867  -47.189 1.375   1.00 46.98  ? 356 ARG B NH2 1 
ATOM   6886 N N   . ALA B 1 356 ? 17.401  -45.823 -2.838  1.00 53.22  ? 357 ALA B N   1 
ATOM   6887 C CA  . ALA B 1 356 ? 17.150  -44.779 -3.831  1.00 53.24  ? 357 ALA B CA  1 
ATOM   6888 C C   . ALA B 1 356 ? 16.851  -45.373 -5.213  1.00 54.46  ? 357 ALA B C   1 
ATOM   6889 O O   . ALA B 1 356 ? 15.986  -44.877 -5.942  1.00 51.49  ? 357 ALA B O   1 
ATOM   6890 C CB  . ALA B 1 356 ? 18.327  -43.826 -3.910  1.00 51.12  ? 357 ALA B CB  1 
ATOM   6891 N N   . GLU B 1 357 ? 17.577  -46.431 -5.564  1.00 50.73  ? 358 GLU B N   1 
ATOM   6892 C CA  . GLU B 1 357 ? 17.339  -47.157 -6.809  1.00 56.28  ? 358 GLU B CA  1 
ATOM   6893 C C   . GLU B 1 357 ? 15.993  -47.897 -6.828  1.00 55.42  ? 358 GLU B C   1 
ATOM   6894 O O   . GLU B 1 357 ? 15.344  -47.975 -7.866  1.00 51.67  ? 358 GLU B O   1 
ATOM   6895 C CB  . GLU B 1 357 ? 18.489  -48.133 -7.092  1.00 54.21  ? 358 GLU B CB  1 
ATOM   6896 C CG  . GLU B 1 357 ? 19.741  -47.445 -7.603  1.00 54.27  ? 358 GLU B CG  1 
ATOM   6897 C CD  . GLU B 1 357 ? 20.919  -48.388 -7.733  1.00 58.27  ? 358 GLU B CD  1 
ATOM   6898 O OE1 . GLU B 1 357 ? 20.956  -49.415 -7.017  1.00 55.42  ? 358 GLU B OE1 1 
ATOM   6899 O OE2 . GLU B 1 357 ? 21.810  -48.101 -8.561  1.00 68.72  ? 358 GLU B OE2 1 
ATOM   6900 N N   . PHE B 1 358 ? 15.586  -48.444 -5.684  1.00 52.15  ? 359 PHE B N   1 
ATOM   6901 C CA  . PHE B 1 358 ? 14.260  -49.031 -5.553  1.00 46.49  ? 359 PHE B CA  1 
ATOM   6902 C C   . PHE B 1 358 ? 13.181  -47.982 -5.825  1.00 52.50  ? 359 PHE B C   1 
ATOM   6903 O O   . PHE B 1 358 ? 12.285  -48.210 -6.641  1.00 52.02  ? 359 PHE B O   1 
ATOM   6904 C CB  . PHE B 1 358 ? 14.075  -49.631 -4.156  1.00 44.77  ? 359 PHE B CB  1 
ATOM   6905 C CG  . PHE B 1 358 ? 12.670  -50.091 -3.871  1.00 50.70  ? 359 PHE B CG  1 
ATOM   6906 C CD1 . PHE B 1 358 ? 12.211  -51.307 -4.361  1.00 48.86  ? 359 PHE B CD1 1 
ATOM   6907 C CD2 . PHE B 1 358 ? 11.809  -49.311 -3.110  1.00 48.25  ? 359 PHE B CD2 1 
ATOM   6908 C CE1 . PHE B 1 358 ? 10.918  -51.737 -4.107  1.00 47.02  ? 359 PHE B CE1 1 
ATOM   6909 C CE2 . PHE B 1 358 ? 10.518  -49.734 -2.842  1.00 53.36  ? 359 PHE B CE2 1 
ATOM   6910 C CZ  . PHE B 1 358 ? 10.071  -50.951 -3.331  1.00 53.94  ? 359 PHE B CZ  1 
ATOM   6911 N N   . LEU B 1 359 ? 13.282  -46.830 -5.158  1.00 50.84  ? 360 LEU B N   1 
ATOM   6912 C CA  . LEU B 1 359 ? 12.284  -45.768 -5.296  1.00 48.82  ? 360 LEU B CA  1 
ATOM   6913 C C   . LEU B 1 359 ? 12.185  -45.290 -6.728  1.00 50.06  ? 360 LEU B C   1 
ATOM   6914 O O   . LEU B 1 359 ? 11.102  -44.959 -7.211  1.00 55.34  ? 360 LEU B O   1 
ATOM   6915 C CB  . LEU B 1 359 ? 12.608  -44.573 -4.396  1.00 47.42  ? 360 LEU B CB  1 
ATOM   6916 C CG  . LEU B 1 359 ? 12.627  -44.834 -2.889  1.00 48.73  ? 360 LEU B CG  1 
ATOM   6917 C CD1 . LEU B 1 359 ? 13.094  -43.589 -2.142  1.00 48.61  ? 360 LEU B CD1 1 
ATOM   6918 C CD2 . LEU B 1 359 ? 11.262  -45.298 -2.395  1.00 51.38  ? 360 LEU B CD2 1 
ATOM   6919 N N   . ALA B 1 360 ? 13.326  -45.248 -7.400  1.00 52.19  ? 361 ALA B N   1 
ATOM   6920 C CA  . ALA B 1 360 ? 13.377  -44.809 -8.778  1.00 49.95  ? 361 ALA B CA  1 
ATOM   6921 C C   . ALA B 1 360 ? 12.758  -45.871 -9.682  1.00 53.84  ? 361 ALA B C   1 
ATOM   6922 O O   . ALA B 1 360 ? 12.138  -45.545 -10.683 1.00 56.80  ? 361 ALA B O   1 
ATOM   6923 C CB  . ALA B 1 360 ? 14.813  -44.520 -9.181  1.00 49.18  ? 361 ALA B CB  1 
ATOM   6924 N N   . GLY B 1 361 ? 12.934  -47.142 -9.321  1.00 57.07  ? 362 GLY B N   1 
ATOM   6925 C CA  . GLY B 1 361 ? 12.401  -48.251 -10.100 1.00 49.94  ? 362 GLY B CA  1 
ATOM   6926 C C   . GLY B 1 361 ? 10.881  -48.322 -10.037 1.00 51.92  ? 362 GLY B C   1 
ATOM   6927 O O   . GLY B 1 361 ? 10.227  -48.719 -11.003 1.00 47.71  ? 362 GLY B O   1 
ATOM   6928 N N   . VAL B 1 362 ? 10.314  -47.932 -8.898  1.00 44.04  ? 363 VAL B N   1 
ATOM   6929 C CA  . VAL B 1 362 ? 8.867   -47.928 -8.745  1.00 46.41  ? 363 VAL B CA  1 
ATOM   6930 C C   . VAL B 1 362 ? 8.170   -47.062 -9.809  1.00 47.40  ? 363 VAL B C   1 
ATOM   6931 O O   . VAL B 1 362 ? 7.146   -47.470 -10.365 1.00 47.21  ? 363 VAL B O   1 
ATOM   6932 C CB  . VAL B 1 362 ? 8.442   -47.519 -7.305  1.00 48.80  ? 363 VAL B CB  1 
ATOM   6933 C CG1 . VAL B 1 362 ? 6.935   -47.228 -7.243  1.00 39.43  ? 363 VAL B CG1 1 
ATOM   6934 C CG2 . VAL B 1 362 ? 8.821   -48.612 -6.313  1.00 35.86  ? 363 VAL B CG2 1 
ATOM   6935 N N   . ARG B 1 363 ? 8.740   -45.895 -10.113 1.00 40.83  ? 364 ARG B N   1 
ATOM   6936 C CA  . ARG B 1 363 ? 8.175   -45.012 -11.139 1.00 49.46  ? 364 ARG B CA  1 
ATOM   6937 C C   . ARG B 1 363 ? 8.350   -45.565 -12.566 1.00 50.99  ? 364 ARG B C   1 
ATOM   6938 O O   . ARG B 1 363 ? 7.559   -45.254 -13.448 1.00 48.97  ? 364 ARG B O   1 
ATOM   6939 C CB  . ARG B 1 363 ? 8.776   -43.596 -11.082 1.00 50.28  ? 364 ARG B CB  1 
ATOM   6940 C CG  . ARG B 1 363 ? 8.695   -42.893 -9.738  1.00 47.18  ? 364 ARG B CG  1 
ATOM   6941 C CD  . ARG B 1 363 ? 7.322   -43.039 -9.083  1.00 47.69  ? 364 ARG B CD  1 
ATOM   6942 N NE  . ARG B 1 363 ? 6.228   -42.312 -9.742  1.00 58.76  ? 364 ARG B NE  1 
ATOM   6943 C CZ  . ARG B 1 363 ? 5.858   -41.066 -9.446  1.00 55.07  ? 364 ARG B CZ  1 
ATOM   6944 N NH1 . ARG B 1 363 ? 6.517   -40.367 -8.526  1.00 50.21  ? 364 ARG B NH1 1 
ATOM   6945 N NH2 . ARG B 1 363 ? 4.833   -40.510 -10.081 1.00 52.71  ? 364 ARG B NH2 1 
ATOM   6946 N N   . VAL B 1 364 ? 9.400   -46.354 -12.786 1.00 48.51  ? 365 VAL B N   1 
ATOM   6947 C CA  . VAL B 1 364 ? 9.628   -47.009 -14.079 1.00 52.24  ? 365 VAL B CA  1 
ATOM   6948 C C   . VAL B 1 364 ? 8.689   -48.213 -14.229 1.00 49.17  ? 365 VAL B C   1 
ATOM   6949 O O   . VAL B 1 364 ? 8.139   -48.449 -15.308 1.00 43.16  ? 365 VAL B O   1 
ATOM   6950 C CB  . VAL B 1 364 ? 11.117  -47.481 -14.228 1.00 54.89  ? 365 VAL B CB  1 
ATOM   6951 C CG1 . VAL B 1 364 ? 11.306  -48.392 -15.449 1.00 48.00  ? 365 VAL B CG1 1 
ATOM   6952 C CG2 . VAL B 1 364 ? 12.059  -46.292 -14.304 1.00 49.44  ? 365 VAL B CG2 1 
ATOM   6953 N N   . GLY B 1 365 ? 8.511   -48.959 -13.134 1.00 41.86  ? 366 GLY B N   1 
ATOM   6954 C CA  . GLY B 1 365 ? 7.675   -50.155 -13.107 1.00 43.71  ? 366 GLY B CA  1 
ATOM   6955 C C   . GLY B 1 365 ? 6.179   -49.896 -13.037 1.00 48.56  ? 366 GLY B C   1 
ATOM   6956 O O   . GLY B 1 365 ? 5.358   -50.734 -13.440 1.00 50.04  ? 366 GLY B O   1 
ATOM   6957 N N   . VAL B 1 366 ? 5.822   -48.724 -12.527 1.00 46.52  ? 367 VAL B N   1 
ATOM   6958 C CA  . VAL B 1 366 ? 4.427   -48.304 -12.435 1.00 46.44  ? 367 VAL B CA  1 
ATOM   6959 C C   . VAL B 1 366 ? 4.338   -46.914 -13.057 1.00 47.24  ? 367 VAL B C   1 
ATOM   6960 O O   . VAL B 1 366 ? 4.197   -45.921 -12.351 1.00 45.93  ? 367 VAL B O   1 
ATOM   6961 C CB  . VAL B 1 366 ? 3.954   -48.280 -10.949 1.00 51.08  ? 367 VAL B CB  1 
ATOM   6962 C CG1 . VAL B 1 366 ? 2.434   -48.152 -10.853 1.00 42.29  ? 367 VAL B CG1 1 
ATOM   6963 C CG2 . VAL B 1 366 ? 4.423   -49.538 -10.243 1.00 40.51  ? 367 VAL B CG2 1 
ATOM   6964 N N   . PRO B 1 367 ? 4.444   -46.836 -14.398 1.00 47.36  ? 368 PRO B N   1 
ATOM   6965 C CA  . PRO B 1 367 ? 4.567   -45.537 -15.063 1.00 43.23  ? 368 PRO B CA  1 
ATOM   6966 C C   . PRO B 1 367 ? 3.245   -44.773 -15.128 1.00 49.50  ? 368 PRO B C   1 
ATOM   6967 O O   . PRO B 1 367 ? 2.158   -45.367 -15.070 1.00 43.59  ? 368 PRO B O   1 
ATOM   6968 C CB  . PRO B 1 367 ? 5.016   -45.923 -16.480 1.00 50.60  ? 368 PRO B CB  1 
ATOM   6969 C CG  . PRO B 1 367 ? 4.417   -47.254 -16.714 1.00 46.16  ? 368 PRO B CG  1 
ATOM   6970 C CD  . PRO B 1 367 ? 4.466   -47.954 -15.363 1.00 45.60  ? 368 PRO B CD  1 
ATOM   6971 N N   . GLN B 1 368 ? 3.350   -43.457 -15.251 1.00 45.29  ? 369 GLN B N   1 
ATOM   6972 C CA  . GLN B 1 368 ? 2.185   -42.606 -15.470 1.00 56.03  ? 369 GLN B CA  1 
ATOM   6973 C C   . GLN B 1 368 ? 1.085   -42.725 -14.416 1.00 56.32  ? 369 GLN B C   1 
ATOM   6974 O O   . GLN B 1 368 ? -0.094  -42.772 -14.764 1.00 54.13  ? 369 GLN B O   1 
ATOM   6975 C CB  . GLN B 1 368 ? 1.601   -42.879 -16.853 1.00 61.86  ? 369 GLN B CB  1 
ATOM   6976 C CG  . GLN B 1 368 ? 2.594   -42.660 -17.973 1.00 75.09  ? 369 GLN B CG  1 
ATOM   6977 C CD  . GLN B 1 368 ? 2.419   -41.316 -18.635 1.00 78.21  ? 369 GLN B CD  1 
ATOM   6978 O OE1 . GLN B 1 368 ? 1.452   -41.096 -19.371 1.00 73.88  ? 369 GLN B OE1 1 
ATOM   6979 N NE2 . GLN B 1 368 ? 3.350   -40.404 -18.374 1.00 77.91  ? 369 GLN B NE2 1 
ATOM   6980 N N   . VAL B 1 369 ? 1.464   -42.790 -13.137 1.00 61.97  ? 370 VAL B N   1 
ATOM   6981 C CA  . VAL B 1 369 ? 0.498   -42.641 -12.049 1.00 43.76  ? 370 VAL B CA  1 
ATOM   6982 C C   . VAL B 1 369 ? 0.916   -41.477 -11.150 1.00 47.26  ? 370 VAL B C   1 
ATOM   6983 O O   . VAL B 1 369 ? 2.069   -41.038 -11.188 1.00 49.50  ? 370 VAL B O   1 
ATOM   6984 C CB  . VAL B 1 369 ? 0.355   -43.916 -11.189 1.00 50.72  ? 370 VAL B CB  1 
ATOM   6985 C CG1 . VAL B 1 369 ? -0.126  -45.076 -12.023 1.00 48.02  ? 370 VAL B CG1 1 
ATOM   6986 C CG2 . VAL B 1 369 ? 1.671   -44.257 -10.481 1.00 43.58  ? 370 VAL B CG2 1 
ATOM   6987 N N   . SER B 1 370 ? -0.021  -40.977 -10.344 1.00 52.42  ? 371 SER B N   1 
ATOM   6988 C CA  . SER B 1 370 ? 0.253   -39.853 -9.440  1.00 51.61  ? 371 SER B CA  1 
ATOM   6989 C C   . SER B 1 370 ? 1.344   -40.174 -8.418  1.00 45.91  ? 371 SER B C   1 
ATOM   6990 O O   . SER B 1 370 ? 1.623   -41.344 -8.136  1.00 53.41  ? 371 SER B O   1 
ATOM   6991 C CB  . SER B 1 370 ? -1.019  -39.449 -8.700  1.00 56.21  ? 371 SER B CB  1 
ATOM   6992 O OG  . SER B 1 370 ? -1.505  -40.515 -7.883  1.00 52.47  ? 371 SER B OG  1 
ATOM   6993 N N   . ASP B 1 371 ? 1.964   -39.133 -7.879  1.00 46.72  ? 372 ASP B N   1 
ATOM   6994 C CA  . ASP B 1 371 ? 2.896   -39.278 -6.759  1.00 57.85  ? 372 ASP B CA  1 
ATOM   6995 C C   . ASP B 1 371 ? 2.258   -39.986 -5.566  1.00 51.69  ? 372 ASP B C   1 
ATOM   6996 O O   . ASP B 1 371 ? 2.913   -40.777 -4.882  1.00 52.33  ? 372 ASP B O   1 
ATOM   6997 C CB  . ASP B 1 371 ? 3.436   -37.918 -6.311  1.00 56.46  ? 372 ASP B CB  1 
ATOM   6998 C CG  . ASP B 1 371 ? 4.228   -37.224 -7.395  1.00 68.17  ? 372 ASP B CG  1 
ATOM   6999 O OD1 . ASP B 1 371 ? 4.673   -37.914 -8.341  1.00 64.57  ? 372 ASP B OD1 1 
ATOM   7000 O OD2 . ASP B 1 371 ? 4.406   -35.990 -7.304  1.00 76.36  ? 372 ASP B OD2 1 
ATOM   7001 N N   . LEU B 1 372 ? 0.983   -39.716 -5.318  1.00 50.43  ? 373 LEU B N   1 
ATOM   7002 C CA  . LEU B 1 372 ? 0.306   -40.389 -4.214  1.00 51.95  ? 373 LEU B CA  1 
ATOM   7003 C C   . LEU B 1 372 ? 0.232   -41.897 -4.462  1.00 54.50  ? 373 LEU B C   1 
ATOM   7004 O O   . LEU B 1 372 ? 0.508   -42.694 -3.563  1.00 44.74  ? 373 LEU B O   1 
ATOM   7005 C CB  . LEU B 1 372 ? -1.092  -39.814 -3.980  1.00 47.28  ? 373 LEU B CB  1 
ATOM   7006 C CG  . LEU B 1 372 ? -1.875  -40.478 -2.839  1.00 55.85  ? 373 LEU B CG  1 
ATOM   7007 C CD1 . LEU B 1 372 ? -1.278  -40.132 -1.476  1.00 44.04  ? 373 LEU B CD1 1 
ATOM   7008 C CD2 . LEU B 1 372 ? -3.345  -40.093 -2.911  1.00 57.10  ? 373 LEU B CD2 1 
ATOM   7009 N N   . ALA B 1 373 ? -0.126  -42.280 -5.689  1.00 51.87  ? 374 ALA B N   1 
ATOM   7010 C CA  . ALA B 1 373 ? -0.230  -43.693 -6.053  1.00 50.26  ? 374 ALA B CA  1 
ATOM   7011 C C   . ALA B 1 373 ? 1.116   -44.392 -5.883  1.00 40.89  ? 374 ALA B C   1 
ATOM   7012 O O   . ALA B 1 373 ? 1.187   -45.508 -5.364  1.00 43.93  ? 374 ALA B O   1 
ATOM   7013 C CB  . ALA B 1 373 ? -0.724  -43.837 -7.493  1.00 51.08  ? 374 ALA B CB  1 
ATOM   7014 N N   . ALA B 1 374 ? 2.183   -43.727 -6.316  1.00 43.29  ? 375 ALA B N   1 
ATOM   7015 C CA  . ALA B 1 374 ? 3.524   -44.288 -6.175  1.00 44.95  ? 375 ALA B CA  1 
ATOM   7016 C C   . ALA B 1 374 ? 3.870   -44.495 -4.695  1.00 50.05  ? 375 ALA B C   1 
ATOM   7017 O O   . ALA B 1 374 ? 4.476   -45.510 -4.318  1.00 46.00  ? 375 ALA B O   1 
ATOM   7018 C CB  . ALA B 1 374 ? 4.545   -43.394 -6.843  1.00 39.04  ? 375 ALA B CB  1 
ATOM   7019 N N   . GLU B 1 375 ? 3.462   -43.538 -3.862  1.00 46.05  ? 376 GLU B N   1 
ATOM   7020 C CA  . GLU B 1 375 ? 3.664   -43.646 -2.424  1.00 46.80  ? 376 GLU B CA  1 
ATOM   7021 C C   . GLU B 1 375 ? 2.902   -44.844 -1.868  1.00 42.46  ? 376 GLU B C   1 
ATOM   7022 O O   . GLU B 1 375 ? 3.407   -45.543 -1.002  1.00 44.77  ? 376 GLU B O   1 
ATOM   7023 C CB  . GLU B 1 375 ? 3.241   -42.357 -1.701  1.00 51.36  ? 376 GLU B CB  1 
ATOM   7024 C CG  . GLU B 1 375 ? 4.066   -41.117 -2.042  1.00 53.14  ? 376 GLU B CG  1 
ATOM   7025 C CD  . GLU B 1 375 ? 5.461   -41.114 -1.420  1.00 69.84  ? 376 GLU B CD  1 
ATOM   7026 O OE1 . GLU B 1 375 ? 5.792   -42.038 -0.637  1.00 72.93  ? 376 GLU B OE1 1 
ATOM   7027 O OE2 . GLU B 1 375 ? 6.229   -40.169 -1.707  1.00 73.88  ? 376 GLU B OE2 1 
ATOM   7028 N N   . ALA B 1 376 ? 1.699   -45.096 -2.376  1.00 44.50  ? 377 ALA B N   1 
ATOM   7029 C CA  . ALA B 1 376 ? 0.936   -46.253 -1.901  1.00 42.80  ? 377 ALA B CA  1 
ATOM   7030 C C   . ALA B 1 376 ? 1.663   -47.549 -2.252  1.00 41.38  ? 377 ALA B C   1 
ATOM   7031 O O   . ALA B 1 376 ? 1.676   -48.477 -1.464  1.00 40.81  ? 377 ALA B O   1 
ATOM   7032 C CB  . ALA B 1 376 ? -0.463  -46.257 -2.495  1.00 39.74  ? 377 ALA B CB  1 
ATOM   7033 N N   . VAL B 1 377 ? 2.261   -47.600 -3.448  1.00 45.79  ? 378 VAL B N   1 
ATOM   7034 C CA  . VAL B 1 377 ? 3.050   -48.762 -3.864  1.00 40.15  ? 378 VAL B CA  1 
ATOM   7035 C C   . VAL B 1 377 ? 4.266   -49.008 -2.957  1.00 43.61  ? 378 VAL B C   1 
ATOM   7036 O O   . VAL B 1 377 ? 4.517   -50.135 -2.542  1.00 44.21  ? 378 VAL B O   1 
ATOM   7037 C CB  . VAL B 1 377 ? 3.529   -48.652 -5.341  1.00 43.63  ? 378 VAL B CB  1 
ATOM   7038 C CG1 . VAL B 1 377 ? 4.451   -49.840 -5.691  1.00 36.70  ? 378 VAL B CG1 1 
ATOM   7039 C CG2 . VAL B 1 377 ? 2.324   -48.602 -6.282  1.00 34.49  ? 378 VAL B CG2 1 
ATOM   7040 N N   . VAL B 1 378 ? 5.015   -47.947 -2.667  1.00 44.45  ? 379 VAL B N   1 
ATOM   7041 C CA  . VAL B 1 378 ? 6.173   -48.018 -1.778  1.00 45.42  ? 379 VAL B CA  1 
ATOM   7042 C C   . VAL B 1 378 ? 5.781   -48.493 -0.361  1.00 49.38  ? 379 VAL B C   1 
ATOM   7043 O O   . VAL B 1 378 ? 6.500   -49.279 0.261   1.00 42.63  ? 379 VAL B O   1 
ATOM   7044 C CB  . VAL B 1 378 ? 6.888   -46.641 -1.709  1.00 43.88  ? 379 VAL B CB  1 
ATOM   7045 C CG1 . VAL B 1 378 ? 7.928   -46.612 -0.597  1.00 44.77  ? 379 VAL B CG1 1 
ATOM   7046 C CG2 . VAL B 1 378 ? 7.528   -46.320 -3.044  1.00 42.48  ? 379 VAL B CG2 1 
ATOM   7047 N N   . LEU B 1 379 ? 4.628   -48.033 0.122   1.00 43.90  ? 380 LEU B N   1 
ATOM   7048 C CA  . LEU B 1 379 ? 4.103   -48.459 1.420   1.00 46.29  ? 380 LEU B CA  1 
ATOM   7049 C C   . LEU B 1 379 ? 3.894   -49.955 1.491   1.00 48.91  ? 380 LEU B C   1 
ATOM   7050 O O   . LEU B 1 379 ? 4.305   -50.603 2.460   1.00 46.85  ? 380 LEU B O   1 
ATOM   7051 C CB  . LEU B 1 379 ? 2.760   -47.797 1.719   1.00 46.16  ? 380 LEU B CB  1 
ATOM   7052 C CG  . LEU B 1 379 ? 2.087   -48.350 2.999   1.00 44.64  ? 380 LEU B CG  1 
ATOM   7053 C CD1 . LEU B 1 379 ? 2.797   -47.887 4.289   1.00 41.94  ? 380 LEU B CD1 1 
ATOM   7054 C CD2 . LEU B 1 379 ? 0.602   -48.010 3.051   1.00 45.35  ? 380 LEU B CD2 1 
ATOM   7055 N N   A HIS B 1 380 ? 3.258   -50.513 0.468   0.41 48.40  ? 381 HIS B N   1 
ATOM   7056 N N   B HIS B 1 380 ? 3.239   -50.493 0.463   0.59 48.44  ? 381 HIS B N   1 
ATOM   7057 C CA  A HIS B 1 380 ? 2.864   -51.919 0.509   0.41 46.56  ? 381 HIS B CA  1 
ATOM   7058 C CA  B HIS B 1 380 ? 2.843   -51.902 0.433   0.59 46.57  ? 381 HIS B CA  1 
ATOM   7059 C C   A HIS B 1 380 ? 3.984   -52.898 0.156   0.41 48.37  ? 381 HIS B C   1 
ATOM   7060 C C   B HIS B 1 380 ? 4.049   -52.830 0.285   0.59 48.40  ? 381 HIS B C   1 
ATOM   7061 O O   A HIS B 1 380 ? 3.908   -54.071 0.511   0.41 50.58  ? 381 HIS B O   1 
ATOM   7062 O O   B HIS B 1 380 ? 4.095   -53.890 0.904   0.59 51.28  ? 381 HIS B O   1 
ATOM   7063 C CB  A HIS B 1 380 ? 1.617   -52.157 -0.353  0.41 48.70  ? 381 HIS B CB  1 
ATOM   7064 C CB  B HIS B 1 380 ? 1.823   -52.171 -0.696  0.59 47.78  ? 381 HIS B CB  1 
ATOM   7065 C CG  A HIS B 1 380 ? 0.368   -51.577 0.237   0.41 50.10  ? 381 HIS B CG  1 
ATOM   7066 C CG  B HIS B 1 380 ? 1.037   -53.433 -0.506  0.59 50.35  ? 381 HIS B CG  1 
ATOM   7067 N ND1 A HIS B 1 380 ? -0.251  -50.458 -0.279  0.41 45.68  ? 381 HIS B ND1 1 
ATOM   7068 N ND1 B HIS B 1 380 ? -0.258  -53.441 -0.026  0.59 53.24  ? 381 HIS B ND1 1 
ATOM   7069 C CD2 A HIS B 1 380 ? -0.357  -51.943 1.321   0.41 44.52  ? 381 HIS B CD2 1 
ATOM   7070 C CD2 B HIS B 1 380 ? 1.376   -54.733 -0.693  0.59 49.60  ? 381 HIS B CD2 1 
ATOM   7071 C CE1 A HIS B 1 380 ? -1.313  -50.170 0.452   0.41 44.95  ? 381 HIS B CE1 1 
ATOM   7072 C CE1 B HIS B 1 380 ? -0.684  -54.689 0.066   0.59 48.38  ? 381 HIS B CE1 1 
ATOM   7073 N NE2 A HIS B 1 380 ? -1.399  -51.055 1.430   0.41 44.57  ? 381 HIS B NE2 1 
ATOM   7074 N NE2 B HIS B 1 380 ? 0.290   -55.493 -0.329  0.59 57.78  ? 381 HIS B NE2 1 
ATOM   7075 N N   . TYR B 1 381 ? 5.024   -52.422 -0.524  1.00 44.98  ? 382 TYR B N   1 
ATOM   7076 C CA  . TYR B 1 381 ? 6.161   -53.285 -0.862  1.00 41.94  ? 382 TYR B CA  1 
ATOM   7077 C C   . TYR B 1 381 ? 7.445   -53.024 -0.067  1.00 44.79  ? 382 TYR B C   1 
ATOM   7078 O O   . TYR B 1 381 ? 8.469   -53.638 -0.333  1.00 50.14  ? 382 TYR B O   1 
ATOM   7079 C CB  . TYR B 1 381 ? 6.456   -53.243 -2.376  1.00 42.42  ? 382 TYR B CB  1 
ATOM   7080 C CG  . TYR B 1 381 ? 5.408   -53.978 -3.180  1.00 45.38  ? 382 TYR B CG  1 
ATOM   7081 C CD1 . TYR B 1 381 ? 5.580   -55.317 -3.529  1.00 42.77  ? 382 TYR B CD1 1 
ATOM   7082 C CD2 . TYR B 1 381 ? 4.222   -53.349 -3.544  1.00 39.64  ? 382 TYR B CD2 1 
ATOM   7083 C CE1 . TYR B 1 381 ? 4.606   -56.001 -4.240  1.00 39.71  ? 382 TYR B CE1 1 
ATOM   7084 C CE2 . TYR B 1 381 ? 3.255   -54.014 -4.271  1.00 41.46  ? 382 TYR B CE2 1 
ATOM   7085 C CZ  . TYR B 1 381 ? 3.445   -55.336 -4.615  1.00 42.49  ? 382 TYR B CZ  1 
ATOM   7086 O OH  . TYR B 1 381 ? 2.464   -55.987 -5.326  1.00 42.34  ? 382 TYR B OH  1 
ATOM   7087 N N   . THR B 1 382 ? 7.396   -52.128 0.908   1.00 49.13  ? 383 THR B N   1 
ATOM   7088 C CA  . THR B 1 382 ? 8.535   -51.937 1.802   1.00 47.30  ? 383 THR B CA  1 
ATOM   7089 C C   . THR B 1 382 ? 8.361   -52.787 3.053   1.00 51.69  ? 383 THR B C   1 
ATOM   7090 O O   . THR B 1 382 ? 7.269   -52.806 3.627   1.00 47.52  ? 383 THR B O   1 
ATOM   7091 C CB  . THR B 1 382 ? 8.665   -50.457 2.222   1.00 46.60  ? 383 THR B CB  1 
ATOM   7092 O OG1 . THR B 1 382 ? 8.972   -49.665 1.067   1.00 40.45  ? 383 THR B OG1 1 
ATOM   7093 C CG2 . THR B 1 382 ? 9.759   -50.269 3.271   1.00 41.76  ? 383 THR B CG2 1 
ATOM   7094 N N   . ASP B 1 383 ? 9.416   -53.504 3.456   1.00 46.70  ? 384 ASP B N   1 
ATOM   7095 C CA  . ASP B 1 383 ? 9.461   -54.138 4.785   1.00 49.07  ? 384 ASP B CA  1 
ATOM   7096 C C   . ASP B 1 383 ? 10.043  -53.108 5.741   1.00 47.51  ? 384 ASP B C   1 
ATOM   7097 O O   . ASP B 1 383 ? 11.250  -52.823 5.701   1.00 46.51  ? 384 ASP B O   1 
ATOM   7098 C CB  . ASP B 1 383 ? 10.341  -55.398 4.777   1.00 48.37  ? 384 ASP B CB  1 
ATOM   7099 C CG  . ASP B 1 383 ? 10.429  -56.090 6.167   1.00 55.80  ? 384 ASP B CG  1 
ATOM   7100 O OD1 . ASP B 1 383 ? 10.168  -55.451 7.210   1.00 52.90  ? 384 ASP B OD1 1 
ATOM   7101 O OD2 . ASP B 1 383 ? 10.773  -57.293 6.216   1.00 51.08  ? 384 ASP B OD2 1 
ATOM   7102 N N   . TRP B 1 384 ? 9.199   -52.544 6.597   1.00 45.81  ? 385 TRP B N   1 
ATOM   7103 C CA  . TRP B 1 384 ? 9.630   -51.410 7.423   1.00 47.42  ? 385 TRP B CA  1 
ATOM   7104 C C   . TRP B 1 384 ? 10.569  -51.769 8.589   1.00 46.57  ? 385 TRP B C   1 
ATOM   7105 O O   . TRP B 1 384 ? 11.069  -50.880 9.291   1.00 49.30  ? 385 TRP B O   1 
ATOM   7106 C CB  . TRP B 1 384 ? 8.430   -50.569 7.870   1.00 48.38  ? 385 TRP B CB  1 
ATOM   7107 C CG  . TRP B 1 384 ? 7.745   -49.955 6.692   1.00 43.07  ? 385 TRP B CG  1 
ATOM   7108 C CD1 . TRP B 1 384 ? 6.666   -50.455 6.020   1.00 39.55  ? 385 TRP B CD1 1 
ATOM   7109 C CD2 . TRP B 1 384 ? 8.129   -48.759 6.005   1.00 45.29  ? 385 TRP B CD2 1 
ATOM   7110 N NE1 . TRP B 1 384 ? 6.342   -49.632 4.970   1.00 45.83  ? 385 TRP B NE1 1 
ATOM   7111 C CE2 . TRP B 1 384 ? 7.224   -48.584 4.936   1.00 44.09  ? 385 TRP B CE2 1 
ATOM   7112 C CE3 . TRP B 1 384 ? 9.153   -47.820 6.186   1.00 43.44  ? 385 TRP B CE3 1 
ATOM   7113 C CZ2 . TRP B 1 384 ? 7.308   -47.507 4.050   1.00 43.90  ? 385 TRP B CZ2 1 
ATOM   7114 C CZ3 . TRP B 1 384 ? 9.225   -46.750 5.331   1.00 43.33  ? 385 TRP B CZ3 1 
ATOM   7115 C CH2 . TRP B 1 384 ? 8.311   -46.605 4.257   1.00 43.67  ? 385 TRP B CH2 1 
ATOM   7116 N N   . LEU B 1 385 ? 10.822  -53.062 8.769   1.00 48.20  ? 386 LEU B N   1 
ATOM   7117 C CA  . LEU B 1 385 ? 11.870  -53.530 9.679   1.00 45.89  ? 386 LEU B CA  1 
ATOM   7118 C C   . LEU B 1 385 ? 13.198  -53.696 8.945   1.00 61.25  ? 386 LEU B C   1 
ATOM   7119 O O   . LEU B 1 385 ? 14.248  -53.806 9.574   1.00 47.78  ? 386 LEU B O   1 
ATOM   7120 C CB  . LEU B 1 385 ? 11.467  -54.845 10.341  1.00 54.32  ? 386 LEU B CB  1 
ATOM   7121 C CG  . LEU B 1 385 ? 10.458  -54.676 11.482  1.00 57.33  ? 386 LEU B CG  1 
ATOM   7122 C CD1 . LEU B 1 385 ? 10.070  -56.016 12.097  1.00 55.81  ? 386 LEU B CD1 1 
ATOM   7123 C CD2 . LEU B 1 385 ? 11.049  -53.755 12.541  1.00 53.34  ? 386 LEU B CD2 1 
ATOM   7124 N N   . HIS B 1 386 ? 13.142  -53.724 7.611   1.00 50.04  ? 387 HIS B N   1 
ATOM   7125 C CA  . HIS B 1 386 ? 14.346  -53.794 6.786   1.00 52.03  ? 387 HIS B CA  1 
ATOM   7126 C C   . HIS B 1 386 ? 14.192  -52.927 5.532   1.00 55.01  ? 387 HIS B C   1 
ATOM   7127 O O   . HIS B 1 386 ? 14.203  -53.456 4.428   1.00 48.53  ? 387 HIS B O   1 
ATOM   7128 C CB  . HIS B 1 386 ? 14.613  -55.239 6.359   1.00 53.37  ? 387 HIS B CB  1 
ATOM   7129 C CG  . HIS B 1 386 ? 14.648  -56.215 7.496   1.00 52.72  ? 387 HIS B CG  1 
ATOM   7130 N ND1 . HIS B 1 386 ? 15.780  -56.439 8.249   1.00 53.64  ? 387 HIS B ND1 1 
ATOM   7131 C CD2 . HIS B 1 386 ? 13.693  -57.034 8.000   1.00 55.42  ? 387 HIS B CD2 1 
ATOM   7132 C CE1 . HIS B 1 386 ? 15.519  -57.347 9.174   1.00 55.44  ? 387 HIS B CE1 1 
ATOM   7133 N NE2 . HIS B 1 386 ? 14.259  -57.721 9.048   1.00 54.14  ? 387 HIS B NE2 1 
ATOM   7134 N N   . PRO B 1 387 ? 14.035  -51.595 5.700   1.00 57.55  ? 388 PRO B N   1 
ATOM   7135 C CA  . PRO B 1 387 ? 13.711  -50.766 4.528   1.00 46.89  ? 388 PRO B CA  1 
ATOM   7136 C C   . PRO B 1 387 ? 14.838  -50.613 3.529   1.00 51.76  ? 388 PRO B C   1 
ATOM   7137 O O   . PRO B 1 387 ? 14.566  -50.193 2.401   1.00 55.28  ? 388 PRO B O   1 
ATOM   7138 C CB  . PRO B 1 387 ? 13.368  -49.398 5.125   1.00 43.11  ? 388 PRO B CB  1 
ATOM   7139 C CG  . PRO B 1 387 ? 14.070  -49.385 6.500   1.00 53.48  ? 388 PRO B CG  1 
ATOM   7140 C CD  . PRO B 1 387 ? 14.086  -50.815 6.960   1.00 45.55  ? 388 PRO B CD  1 
ATOM   7141 N N   . GLU B 1 388 ? 16.069  -50.946 3.906   1.00 55.43  ? 389 GLU B N   1 
ATOM   7142 C CA  . GLU B 1 388 ? 17.197  -50.709 3.000   1.00 56.06  ? 389 GLU B CA  1 
ATOM   7143 C C   . GLU B 1 388 ? 17.987  -51.944 2.565   1.00 46.88  ? 389 GLU B C   1 
ATOM   7144 O O   . GLU B 1 388 ? 18.991  -51.812 1.886   1.00 56.01  ? 389 GLU B O   1 
ATOM   7145 C CB  . GLU B 1 388 ? 18.146  -49.670 3.591   1.00 53.84  ? 389 GLU B CB  1 
ATOM   7146 C CG  . GLU B 1 388 ? 17.464  -48.372 3.958   1.00 63.98  ? 389 GLU B CG  1 
ATOM   7147 C CD  . GLU B 1 388 ? 18.325  -47.177 3.632   1.00 80.75  ? 389 GLU B CD  1 
ATOM   7148 O OE1 . GLU B 1 388 ? 19.541  -47.375 3.423   1.00 87.78  ? 389 GLU B OE1 1 
ATOM   7149 O OE2 . GLU B 1 388 ? 17.791  -46.047 3.566   1.00 82.95  ? 389 GLU B OE2 1 
ATOM   7150 N N   . ASP B 1 389 ? 17.535  -53.136 2.942   1.00 44.33  ? 390 ASP B N   1 
ATOM   7151 C CA  . ASP B 1 389 ? 18.246  -54.365 2.594   1.00 52.34  ? 390 ASP B CA  1 
ATOM   7152 C C   . ASP B 1 389 ? 18.221  -54.645 1.076   1.00 51.85  ? 390 ASP B C   1 
ATOM   7153 O O   . ASP B 1 389 ? 17.167  -54.939 0.522   1.00 53.69  ? 390 ASP B O   1 
ATOM   7154 C CB  . ASP B 1 389 ? 17.615  -55.534 3.334   1.00 46.12  ? 390 ASP B CB  1 
ATOM   7155 C CG  . ASP B 1 389 ? 18.250  -56.845 2.978   1.00 58.57  ? 390 ASP B CG  1 
ATOM   7156 O OD1 . ASP B 1 389 ? 19.471  -56.853 2.734   1.00 70.30  ? 390 ASP B OD1 1 
ATOM   7157 O OD2 . ASP B 1 389 ? 17.537  -57.869 2.929   1.00 65.37  ? 390 ASP B OD2 1 
ATOM   7158 N N   . PRO B 1 390 ? 19.386  -54.574 0.411   1.00 53.84  ? 391 PRO B N   1 
ATOM   7159 C CA  . PRO B 1 390 ? 19.446  -54.698 -1.058  1.00 57.27  ? 391 PRO B CA  1 
ATOM   7160 C C   . PRO B 1 390 ? 18.745  -55.934 -1.645  1.00 54.03  ? 391 PRO B C   1 
ATOM   7161 O O   . PRO B 1 390 ? 18.003  -55.794 -2.618  1.00 49.75  ? 391 PRO B O   1 
ATOM   7162 C CB  . PRO B 1 390 ? 20.949  -54.736 -1.348  1.00 55.17  ? 391 PRO B CB  1 
ATOM   7163 C CG  . PRO B 1 390 ? 21.568  -53.980 -0.186  1.00 54.56  ? 391 PRO B CG  1 
ATOM   7164 C CD  . PRO B 1 390 ? 20.720  -54.347 1.003   1.00 46.45  ? 391 PRO B CD  1 
ATOM   7165 N N   . ALA B 1 391 ? 18.964  -57.114 -1.074  1.00 51.87  ? 392 ALA B N   1 
ATOM   7166 C CA  . ALA B 1 391 ? 18.348  -58.322 -1.625  1.00 48.13  ? 392 ALA B CA  1 
ATOM   7167 C C   . ALA B 1 391 ? 16.822  -58.271 -1.559  1.00 55.88  ? 392 ALA B C   1 
ATOM   7168 O O   . ALA B 1 391 ? 16.150  -58.591 -2.537  1.00 50.56  ? 392 ALA B O   1 
ATOM   7169 C CB  . ALA B 1 391 ? 18.870  -59.563 -0.933  1.00 51.15  ? 392 ALA B CB  1 
ATOM   7170 N N   . ARG B 1 392 ? 16.286  -57.876 -0.403  1.00 52.52  ? 393 ARG B N   1 
ATOM   7171 C CA  . ARG B 1 392 ? 14.846  -57.665 -0.232  1.00 50.87  ? 393 ARG B CA  1 
ATOM   7172 C C   . ARG B 1 392 ? 14.269  -56.591 -1.162  1.00 47.39  ? 393 ARG B C   1 
ATOM   7173 O O   . ARG B 1 392 ? 13.135  -56.721 -1.596  1.00 46.94  ? 393 ARG B O   1 
ATOM   7174 C CB  . ARG B 1 392 ? 14.499  -57.292 1.225   1.00 45.55  ? 393 ARG B CB  1 
ATOM   7175 C CG  . ARG B 1 392 ? 14.462  -58.453 2.208   1.00 49.00  ? 393 ARG B CG  1 
ATOM   7176 C CD  . ARG B 1 392 ? 14.218  -57.887 3.611   1.00 55.83  ? 393 ARG B CD  1 
ATOM   7177 N NE  . ARG B 1 392 ? 13.996  -58.886 4.653   1.00 52.93  ? 393 ARG B NE  1 
ATOM   7178 C CZ  . ARG B 1 392 ? 14.947  -59.334 5.469   1.00 56.22  ? 393 ARG B CZ  1 
ATOM   7179 N NH1 . ARG B 1 392 ? 16.187  -58.886 5.346   1.00 54.38  ? 393 ARG B NH1 1 
ATOM   7180 N NH2 . ARG B 1 392 ? 14.657  -60.225 6.410   1.00 58.86  ? 393 ARG B NH2 1 
ATOM   7181 N N   . LEU B 1 393 ? 15.020  -55.521 -1.430  1.00 42.39  ? 394 LEU B N   1 
ATOM   7182 C CA  . LEU B 1 393 ? 14.565  -54.477 -2.359  1.00 46.08  ? 394 LEU B CA  1 
ATOM   7183 C C   . LEU B 1 393 ? 14.500  -54.993 -3.811  1.00 52.12  ? 394 LEU B C   1 
ATOM   7184 O O   . LEU B 1 393 ? 13.560  -54.690 -4.554  1.00 49.90  ? 394 LEU B O   1 
ATOM   7185 C CB  . LEU B 1 393 ? 15.485  -53.249 -2.282  1.00 47.48  ? 394 LEU B CB  1 
ATOM   7186 C CG  . LEU B 1 393 ? 15.499  -52.408 -0.996  1.00 53.81  ? 394 LEU B CG  1 
ATOM   7187 C CD1 . LEU B 1 393 ? 16.779  -51.590 -0.901  1.00 47.28  ? 394 LEU B CD1 1 
ATOM   7188 C CD2 . LEU B 1 393 ? 14.309  -51.467 -0.952  1.00 46.54  ? 394 LEU B CD2 1 
ATOM   7189 N N   . ARG B 1 394 ? 15.505  -55.770 -4.206  1.00 46.74  ? 395 ARG B N   1 
ATOM   7190 C CA  . ARG B 1 394 ? 15.499  -56.451 -5.501  1.00 50.01  ? 395 ARG B CA  1 
ATOM   7191 C C   . ARG B 1 394 ? 14.250  -57.314 -5.665  1.00 51.56  ? 395 ARG B C   1 
ATOM   7192 O O   . ARG B 1 394 ? 13.573  -57.251 -6.693  1.00 40.50  ? 395 ARG B O   1 
ATOM   7193 C CB  . ARG B 1 394 ? 16.756  -57.318 -5.664  1.00 47.52  ? 395 ARG B CB  1 
ATOM   7194 C CG  . ARG B 1 394 ? 16.870  -58.038 -7.016  1.00 51.88  ? 395 ARG B CG  1 
ATOM   7195 C CD  . ARG B 1 394 ? 18.066  -58.999 -7.043  1.00 46.07  ? 395 ARG B CD  1 
ATOM   7196 N NE  . ARG B 1 394 ? 17.932  -60.063 -6.057  1.00 57.38  ? 395 ARG B NE  1 
ATOM   7197 C CZ  . ARG B 1 394 ? 18.941  -60.803 -5.609  1.00 52.38  ? 395 ARG B CZ  1 
ATOM   7198 N NH1 . ARG B 1 394 ? 20.166  -60.595 -6.055  1.00 53.71  ? 395 ARG B NH1 1 
ATOM   7199 N NH2 . ARG B 1 394 ? 18.727  -61.737 -4.699  1.00 57.69  ? 395 ARG B NH2 1 
ATOM   7200 N N   . GLU B 1 395 ? 13.944  -58.112 -4.644  1.00 51.07  ? 396 GLU B N   1 
ATOM   7201 C CA  . GLU B 1 395 ? 12.808  -59.034 -4.704  1.00 48.40  ? 396 GLU B CA  1 
ATOM   7202 C C   . GLU B 1 395 ? 11.486  -58.268 -4.723  1.00 52.35  ? 396 GLU B C   1 
ATOM   7203 O O   . GLU B 1 395 ? 10.541  -58.669 -5.396  1.00 51.20  ? 396 GLU B O   1 
ATOM   7204 C CB  . GLU B 1 395 ? 12.839  -60.013 -3.522  1.00 46.72  ? 396 GLU B CB  1 
ATOM   7205 C CG  . GLU B 1 395 ? 13.266  -61.451 -3.856  1.00 69.21  ? 396 GLU B CG  1 
ATOM   7206 C CD  . GLU B 1 395 ? 14.693  -61.570 -4.410  1.00 76.15  ? 396 GLU B CD  1 
ATOM   7207 O OE1 . GLU B 1 395 ? 14.882  -61.391 -5.644  1.00 84.69  ? 396 GLU B OE1 1 
ATOM   7208 O OE2 . GLU B 1 395 ? 15.621  -61.866 -3.622  1.00 69.06  ? 396 GLU B OE2 1 
ATOM   7209 N N   . ALA B 1 396 ? 11.441  -57.147 -4.005  1.00 48.81  ? 397 ALA B N   1 
ATOM   7210 C CA  . ALA B 1 396 ? 10.236  -56.328 -3.915  1.00 50.09  ? 397 ALA B CA  1 
ATOM   7211 C C   . ALA B 1 396 ? 9.917   -55.623 -5.238  1.00 45.51  ? 397 ALA B C   1 
ATOM   7212 O O   . ALA B 1 396 ? 8.764   -55.556 -5.646  1.00 47.95  ? 397 ALA B O   1 
ATOM   7213 C CB  . ALA B 1 396 ? 10.361  -55.305 -2.772  1.00 42.05  ? 397 ALA B CB  1 
ATOM   7214 N N   . LEU B 1 397 ? 10.934  -55.091 -5.903  1.00 46.00  ? 398 LEU B N   1 
ATOM   7215 C CA  . LEU B 1 397 ? 10.710  -54.486 -7.215  1.00 47.35  ? 398 LEU B CA  1 
ATOM   7216 C C   . LEU B 1 397 ? 10.271  -55.521 -8.262  1.00 44.14  ? 398 LEU B C   1 
ATOM   7217 O O   . LEU B 1 397 ? 9.429   -55.222 -9.098  1.00 44.15  ? 398 LEU B O   1 
ATOM   7218 C CB  . LEU B 1 397 ? 11.930  -53.707 -7.718  1.00 58.26  ? 398 LEU B CB  1 
ATOM   7219 C CG  . LEU B 1 397 ? 11.569  -52.810 -8.907  1.00 54.49  ? 398 LEU B CG  1 
ATOM   7220 C CD1 . LEU B 1 397 ? 10.476  -51.835 -8.462  1.00 52.93  ? 398 LEU B CD1 1 
ATOM   7221 C CD2 . LEU B 1 397 ? 12.772  -52.064 -9.425  1.00 49.02  ? 398 LEU B CD2 1 
ATOM   7222 N N   . SER B 1 398 ? 10.835  -56.729 -8.212  1.00 47.78  ? 399 SER B N   1 
ATOM   7223 C CA  . SER B 1 398 ? 10.343  -57.832 -9.053  1.00 43.84  ? 399 SER B CA  1 
ATOM   7224 C C   . SER B 1 398 ? 8.851   -58.126 -8.823  1.00 46.60  ? 399 SER B C   1 
ATOM   7225 O O   . SER B 1 398 ? 8.081   -58.271 -9.779  1.00 48.00  ? 399 SER B O   1 
ATOM   7226 C CB  . SER B 1 398 ? 11.146  -59.111 -8.818  1.00 45.59  ? 399 SER B CB  1 
ATOM   7227 O OG  . SER B 1 398 ? 10.647  -60.162 -9.641  1.00 47.31  ? 399 SER B OG  1 
ATOM   7228 N N   . ASP B 1 399 ? 8.459   -58.199 -7.553  1.00 39.50  ? 400 ASP B N   1 
ATOM   7229 C CA  . ASP B 1 399 ? 7.077   -58.438 -7.171  1.00 38.45  ? 400 ASP B CA  1 
ATOM   7230 C C   . ASP B 1 399 ? 6.183   -57.297 -7.633  1.00 41.56  ? 400 ASP B C   1 
ATOM   7231 O O   . ASP B 1 399 ? 5.076   -57.548 -8.103  1.00 41.36  ? 400 ASP B O   1 
ATOM   7232 C CB  . ASP B 1 399 ? 6.948   -58.574 -5.624  1.00 43.04  ? 400 ASP B CB  1 
ATOM   7233 C CG  . ASP B 1 399 ? 7.388   -59.940 -5.113  1.00 52.03  ? 400 ASP B CG  1 
ATOM   7234 O OD1 . ASP B 1 399 ? 7.312   -60.917 -5.894  1.00 59.06  ? 400 ASP B OD1 1 
ATOM   7235 O OD2 . ASP B 1 399 ? 7.805   -60.038 -3.932  1.00 61.97  ? 400 ASP B OD2 1 
ATOM   7236 N N   . VAL B 1 400 ? 6.638   -56.044 -7.480  1.00 38.05  ? 401 VAL B N   1 
ATOM   7237 C CA  . VAL B 1 400 ? 5.844   -54.907 -7.966  1.00 41.37  ? 401 VAL B CA  1 
ATOM   7238 C C   . VAL B 1 400 ? 5.504   -55.072 -9.468  1.00 41.28  ? 401 VAL B C   1 
ATOM   7239 O O   . VAL B 1 400 ? 4.339   -54.999 -9.885  1.00 40.27  ? 401 VAL B O   1 
ATOM   7240 C CB  . VAL B 1 400 ? 6.579   -53.554 -7.777  1.00 47.38  ? 401 VAL B CB  1 
ATOM   7241 C CG1 . VAL B 1 400 ? 5.922   -52.469 -8.632  1.00 38.36  ? 401 VAL B CG1 1 
ATOM   7242 C CG2 . VAL B 1 400 ? 6.646   -53.138 -6.277  1.00 42.47  ? 401 VAL B CG2 1 
ATOM   7243 N N   . VAL B 1 401 ? 6.530   -55.316 -10.271 1.00 39.90  ? 402 VAL B N   1 
ATOM   7244 C CA  . VAL B 1 401 ? 6.358   -55.386 -11.723 1.00 39.50  ? 402 VAL B CA  1 
ATOM   7245 C C   . VAL B 1 401 ? 5.499   -56.600 -12.107 1.00 37.24  ? 402 VAL B C   1 
ATOM   7246 O O   . VAL B 1 401 ? 4.573   -56.481 -12.910 1.00 41.62  ? 402 VAL B O   1 
ATOM   7247 C CB  . VAL B 1 401 ? 7.731   -55.364 -12.421 1.00 44.62  ? 402 VAL B CB  1 
ATOM   7248 C CG1 . VAL B 1 401 ? 7.614   -55.735 -13.902 1.00 41.96  ? 402 VAL B CG1 1 
ATOM   7249 C CG2 . VAL B 1 401 ? 8.365   -53.979 -12.239 1.00 37.88  ? 402 VAL B CG2 1 
ATOM   7250 N N   . GLY B 1 402 ? 5.749   -57.737 -11.458 1.00 43.98  ? 403 GLY B N   1 
ATOM   7251 C CA  . GLY B 1 402 ? 5.031   -58.967 -11.764 1.00 40.18  ? 403 GLY B CA  1 
ATOM   7252 C C   . GLY B 1 402 ? 3.580   -58.953 -11.328 1.00 44.12  ? 403 GLY B C   1 
ATOM   7253 O O   . GLY B 1 402 ? 2.704   -59.430 -12.062 1.00 37.61  ? 403 GLY B O   1 
ATOM   7254 N N   . ASP B 1 403 ? 3.331   -58.423 -10.125 1.00 40.65  ? 404 ASP B N   1 
ATOM   7255 C CA  . ASP B 1 403 ? 1.984   -58.315 -9.571  1.00 39.34  ? 404 ASP B CA  1 
ATOM   7256 C C   . ASP B 1 403 ? 1.112   -57.383 -10.399 1.00 41.23  ? 404 ASP B C   1 
ATOM   7257 O O   . ASP B 1 403 ? -0.001  -57.734 -10.789 1.00 41.19  ? 404 ASP B O   1 
ATOM   7258 C CB  . ASP B 1 403 ? 2.025   -57.774 -8.118  1.00 36.42  ? 404 ASP B CB  1 
ATOM   7259 C CG  . ASP B 1 403 ? 2.629   -58.761 -7.130  1.00 41.70  ? 404 ASP B CG  1 
ATOM   7260 O OD1 . ASP B 1 403 ? 2.862   -59.930 -7.509  1.00 46.64  ? 404 ASP B OD1 1 
ATOM   7261 O OD2 . ASP B 1 403 ? 2.893   -58.370 -5.965  1.00 45.36  ? 404 ASP B OD2 1 
ATOM   7262 N N   . HIS B 1 404 ? 1.625   -56.175 -10.619 1.00 41.05  ? 405 HIS B N   1 
ATOM   7263 C CA  . HIS B 1 404 ? 0.930   -55.120 -11.361 1.00 39.96  ? 405 HIS B CA  1 
ATOM   7264 C C   . HIS B 1 404 ? 0.623   -55.567 -12.804 1.00 45.44  ? 405 HIS B C   1 
ATOM   7265 O O   . HIS B 1 404 ? -0.500  -55.423 -13.294 1.00 39.64  ? 405 HIS B O   1 
ATOM   7266 C CB  . HIS B 1 404 ? 1.795   -53.850 -11.313 1.00 38.69  ? 405 HIS B CB  1 
ATOM   7267 C CG  . HIS B 1 404 ? 1.339   -52.735 -12.204 1.00 44.89  ? 405 HIS B CG  1 
ATOM   7268 N ND1 . HIS B 1 404 ? 0.049   -52.249 -12.203 1.00 47.96  ? 405 HIS B ND1 1 
ATOM   7269 C CD2 . HIS B 1 404 ? 2.020   -51.988 -13.107 1.00 46.87  ? 405 HIS B CD2 1 
ATOM   7270 C CE1 . HIS B 1 404 ? -0.047  -51.255 -13.069 1.00 45.50  ? 405 HIS B CE1 1 
ATOM   7271 N NE2 . HIS B 1 404 ? 1.137   -51.074 -13.629 1.00 46.38  ? 405 HIS B NE2 1 
ATOM   7272 N N   . ASN B 1 405 ? 1.605   -56.145 -13.475 1.00 40.62  ? 406 ASN B N   1 
ATOM   7273 C CA  . ASN B 1 405 ? 1.409   -56.493 -14.892 1.00 42.10  ? 406 ASN B CA  1 
ATOM   7274 C C   . ASN B 1 405 ? 0.742   -57.847 -15.169 1.00 43.37  ? 406 ASN B C   1 
ATOM   7275 O O   . ASN B 1 405 ? 0.012   -57.967 -16.137 1.00 38.58  ? 406 ASN B O   1 
ATOM   7276 C CB  . ASN B 1 405 ? 2.719   -56.349 -15.674 1.00 36.07  ? 406 ASN B CB  1 
ATOM   7277 C CG  . ASN B 1 405 ? 3.144   -54.891 -15.826 1.00 40.87  ? 406 ASN B CG  1 
ATOM   7278 O OD1 . ASN B 1 405 ? 2.477   -54.118 -16.501 1.00 45.85  ? 406 ASN B OD1 1 
ATOM   7279 N ND2 . ASN B 1 405 ? 4.245   -54.509 -15.180 1.00 44.60  ? 406 ASN B ND2 1 
ATOM   7280 N N   . VAL B 1 406 ? 0.970   -58.850 -14.319 1.00 39.33  ? 407 VAL B N   1 
ATOM   7281 C CA  . VAL B 1 406 ? 0.578   -60.230 -14.647 1.00 38.61  ? 407 VAL B CA  1 
ATOM   7282 C C   . VAL B 1 406 ? -0.293  -60.945 -13.583 1.00 40.94  ? 407 VAL B C   1 
ATOM   7283 O O   . VAL B 1 406 ? -1.448  -61.290 -13.848 1.00 39.53  ? 407 VAL B O   1 
ATOM   7284 C CB  . VAL B 1 406 ? 1.839   -61.110 -14.983 1.00 43.43  ? 407 VAL B CB  1 
ATOM   7285 C CG1 . VAL B 1 406 ? 1.441   -62.562 -15.288 1.00 41.58  ? 407 VAL B CG1 1 
ATOM   7286 C CG2 . VAL B 1 406 ? 2.611   -60.527 -16.150 1.00 43.60  ? 407 VAL B CG2 1 
ATOM   7287 N N   . VAL B 1 407 ? 0.263   -61.157 -12.392 1.00 37.63  ? 408 VAL B N   1 
ATOM   7288 C CA  . VAL B 1 407 ? -0.422  -61.934 -11.342 1.00 38.48  ? 408 VAL B CA  1 
ATOM   7289 C C   . VAL B 1 407 ? -1.793  -61.373 -10.991 1.00 43.62  ? 408 VAL B C   1 
ATOM   7290 O O   . VAL B 1 407 ? -2.806  -62.092 -11.053 1.00 43.88  ? 408 VAL B O   1 
ATOM   7291 C CB  . VAL B 1 407 ? 0.450   -62.086 -10.051 1.00 46.31  ? 408 VAL B CB  1 
ATOM   7292 C CG1 . VAL B 1 407 ? -0.273  -62.946 -9.002  1.00 43.45  ? 408 VAL B CG1 1 
ATOM   7293 C CG2 . VAL B 1 407 ? 1.824   -62.692 -10.395 1.00 39.00  ? 408 VAL B CG2 1 
ATOM   7294 N N   . CYS B 1 408 ? -1.851  -60.083 -10.676 1.00 40.38  ? 409 CYS B N   1 
ATOM   7295 C CA  . CYS B 1 408 ? -3.122  -59.496 -10.254 1.00 42.13  ? 409 CYS B CA  1 
ATOM   7296 C C   . CYS B 1 408 ? -4.205  -59.416 -11.355 1.00 40.38  ? 409 CYS B C   1 
ATOM   7297 O O   . CYS B 1 408 ? -5.369  -59.777 -11.105 1.00 42.35  ? 409 CYS B O   1 
ATOM   7298 C CB  . CYS B 1 408 ? -2.896  -58.183 -9.487  1.00 42.26  ? 409 CYS B CB  1 
ATOM   7299 S SG  . CYS B 1 408 ? -1.914  -58.471 -7.954  1.00 45.06  ? 409 CYS B SG  1 
ATOM   7300 N N   . PRO B 1 409 ? -3.836  -58.985 -12.582 1.00 39.50  ? 410 PRO B N   1 
ATOM   7301 C CA  . PRO B 1 409 ? -4.833  -59.132 -13.664 1.00 36.89  ? 410 PRO B CA  1 
ATOM   7302 C C   . PRO B 1 409 ? -5.314  -60.580 -13.867 1.00 35.70  ? 410 PRO B C   1 
ATOM   7303 O O   . PRO B 1 409 ? -6.512  -60.797 -14.065 1.00 44.21  ? 410 PRO B O   1 
ATOM   7304 C CB  . PRO B 1 409 ? -4.087  -58.620 -14.917 1.00 39.70  ? 410 PRO B CB  1 
ATOM   7305 C CG  . PRO B 1 409 ? -3.080  -57.623 -14.357 1.00 42.26  ? 410 PRO B CG  1 
ATOM   7306 C CD  . PRO B 1 409 ? -2.650  -58.209 -13.013 1.00 37.82  ? 410 PRO B CD  1 
ATOM   7307 N N   . VAL B 1 410 ? -4.398  -61.547 -13.843 1.00 36.35  ? 411 VAL B N   1 
ATOM   7308 C CA  . VAL B 1 410 ? -4.792  -62.955 -13.901 1.00 38.07  ? 411 VAL B CA  1 
ATOM   7309 C C   . VAL B 1 410 ? -5.698  -63.358 -12.697 1.00 48.77  ? 411 VAL B C   1 
ATOM   7310 O O   . VAL B 1 410 ? -6.744  -63.991 -12.899 1.00 46.74  ? 411 VAL B O   1 
ATOM   7311 C CB  . VAL B 1 410 ? -3.557  -63.891 -14.015 1.00 41.45  ? 411 VAL B CB  1 
ATOM   7312 C CG1 . VAL B 1 410 ? -3.973  -65.369 -13.878 1.00 39.23  ? 411 VAL B CG1 1 
ATOM   7313 C CG2 . VAL B 1 410 ? -2.849  -63.671 -15.368 1.00 48.08  ? 411 VAL B CG2 1 
ATOM   7314 N N   . ALA B 1 411 ? -5.324  -62.981 -11.462 1.00 40.52  ? 412 ALA B N   1 
ATOM   7315 C CA  . ALA B 1 411 ? -6.180  -63.290 -10.295 1.00 44.34  ? 412 ALA B CA  1 
ATOM   7316 C C   . ALA B 1 411 ? -7.594  -62.715 -10.468 1.00 42.09  ? 412 ALA B C   1 
ATOM   7317 O O   . ALA B 1 411 ? -8.599  -63.372 -10.181 1.00 40.17  ? 412 ALA B O   1 
ATOM   7318 C CB  . ALA B 1 411 ? -5.548  -62.761 -8.951  1.00 40.74  ? 412 ALA B CB  1 
ATOM   7319 N N   . GLN B 1 412 ? -7.655  -61.477 -10.936 1.00 38.61  ? 413 GLN B N   1 
ATOM   7320 C CA  . GLN B 1 412 ? -8.921  -60.790 -11.072 1.00 42.91  ? 413 GLN B CA  1 
ATOM   7321 C C   . GLN B 1 412 ? -9.804  -61.451 -12.140 1.00 56.81  ? 413 GLN B C   1 
ATOM   7322 O O   . GLN B 1 412 ? -11.025 -61.631 -11.949 1.00 43.93  ? 413 GLN B O   1 
ATOM   7323 C CB  . GLN B 1 412 ? -8.668  -59.334 -11.428 1.00 38.44  ? 413 GLN B CB  1 
ATOM   7324 C CG  . GLN B 1 412 ? -9.851  -58.698 -12.094 1.00 51.37  ? 413 GLN B CG  1 
ATOM   7325 C CD  . GLN B 1 412 ? -10.329 -57.470 -11.393 1.00 67.70  ? 413 GLN B CD  1 
ATOM   7326 O OE1 . GLN B 1 412 ? -10.007 -56.354 -11.797 1.00 65.35  ? 413 GLN B OE1 1 
ATOM   7327 N NE2 . GLN B 1 412 ? -11.108 -57.659 -10.323 1.00 78.98  ? 413 GLN B NE2 1 
ATOM   7328 N N   . LEU B 1 413 ? -9.180  -61.811 -13.261 1.00 46.25  ? 414 LEU B N   1 
ATOM   7329 C CA  . LEU B 1 413 ? -9.890  -62.503 -14.328 1.00 49.83  ? 414 LEU B CA  1 
ATOM   7330 C C   . LEU B 1 413 ? -10.401 -63.837 -13.797 1.00 38.75  ? 414 LEU B C   1 
ATOM   7331 O O   . LEU B 1 413 ? -11.548 -64.194 -14.002 1.00 41.26  ? 414 LEU B O   1 
ATOM   7332 C CB  . LEU B 1 413 ? -8.973  -62.722 -15.554 1.00 47.78  ? 414 LEU B CB  1 
ATOM   7333 C CG  . LEU B 1 413 ? -9.564  -63.587 -16.675 1.00 49.35  ? 414 LEU B CG  1 
ATOM   7334 C CD1 . LEU B 1 413 ? -10.872 -63.000 -17.119 1.00 61.25  ? 414 LEU B CD1 1 
ATOM   7335 C CD2 . LEU B 1 413 ? -8.639  -63.653 -17.865 1.00 49.19  ? 414 LEU B CD2 1 
ATOM   7336 N N   . ALA B 1 414 ? -9.551  -64.568 -13.089 1.00 39.45  ? 415 ALA B N   1 
ATOM   7337 C CA  . ALA B 1 414 ? -9.944  -65.888 -12.594 1.00 46.70  ? 415 ALA B CA  1 
ATOM   7338 C C   . ALA B 1 414 ? -11.117 -65.818 -11.587 1.00 56.60  ? 415 ALA B C   1 
ATOM   7339 O O   . ALA B 1 414 ? -12.065 -66.618 -11.657 1.00 47.48  ? 415 ALA B O   1 
ATOM   7340 C CB  . ALA B 1 414 ? -8.733  -66.614 -11.980 1.00 38.28  ? 415 ALA B CB  1 
ATOM   7341 N N   . GLY B 1 415 ? -11.056 -64.849 -10.672 1.00 51.32  ? 416 GLY B N   1 
ATOM   7342 C CA  . GLY B 1 415 ? -12.084 -64.683 -9.649  1.00 45.74  ? 416 GLY B CA  1 
ATOM   7343 C C   . GLY B 1 415 ? -13.430 -64.270 -10.220 1.00 52.44  ? 416 GLY B C   1 
ATOM   7344 O O   . GLY B 1 415 ? -14.463 -64.843 -9.861  1.00 54.30  ? 416 GLY B O   1 
ATOM   7345 N N   . ARG B 1 416 ? -13.430 -63.290 -11.120 1.00 48.90  ? 417 ARG B N   1 
ATOM   7346 C CA  . ARG B 1 416 ? -14.681 -62.860 -11.744 1.00 55.42  ? 417 ARG B CA  1 
ATOM   7347 C C   . ARG B 1 416 ? -15.314 -63.962 -12.590 1.00 62.59  ? 417 ARG B C   1 
ATOM   7348 O O   . ARG B 1 416 ? -16.538 -64.153 -12.547 1.00 55.99  ? 417 ARG B O   1 
ATOM   7349 C CB  . ARG B 1 416 ? -14.482 -61.605 -12.603 1.00 52.28  ? 417 ARG B CB  1 
ATOM   7350 C CG  . ARG B 1 416 ? -14.228 -60.349 -11.807 1.00 61.61  ? 417 ARG B CG  1 
ATOM   7351 C CD  . ARG B 1 416 ? -15.188 -60.293 -10.617 1.00 66.42  ? 417 ARG B CD  1 
ATOM   7352 N NE  . ARG B 1 416 ? -15.423 -58.928 -10.168 1.00 74.46  ? 417 ARG B NE  1 
ATOM   7353 C CZ  . ARG B 1 416 ? -16.534 -58.240 -10.405 1.00 65.32  ? 417 ARG B CZ  1 
ATOM   7354 N NH1 . ARG B 1 416 ? -17.540 -58.787 -11.081 1.00 62.79  ? 417 ARG B NH1 1 
ATOM   7355 N NH2 . ARG B 1 416 ? -16.639 -57.002 -9.954  1.00 75.11  ? 417 ARG B NH2 1 
ATOM   7356 N N   . LEU B 1 417 ? -14.487 -64.672 -13.363 1.00 51.88  ? 418 LEU B N   1 
ATOM   7357 C CA  . LEU B 1 417 ? -14.994 -65.753 -14.213 1.00 57.22  ? 418 LEU B CA  1 
ATOM   7358 C C   . LEU B 1 417 ? -15.606 -66.855 -13.367 1.00 53.75  ? 418 LEU B C   1 
ATOM   7359 O O   . LEU B 1 417 ? -16.696 -67.334 -13.678 1.00 54.94  ? 418 LEU B O   1 
ATOM   7360 C CB  . LEU B 1 417 ? -13.904 -66.363 -15.120 1.00 47.41  ? 418 LEU B CB  1 
ATOM   7361 C CG  . LEU B 1 417 ? -13.238 -65.513 -16.209 1.00 55.24  ? 418 LEU B CG  1 
ATOM   7362 C CD1 . LEU B 1 417 ? -12.347 -66.375 -17.089 1.00 58.40  ? 418 LEU B CD1 1 
ATOM   7363 C CD2 . LEU B 1 417 ? -14.245 -64.777 -17.038 1.00 54.01  ? 418 LEU B CD2 1 
ATOM   7364 N N   . ALA B 1 418 ? -14.884 -67.283 -12.327 1.00 45.45  ? 419 ALA B N   1 
ATOM   7365 C CA  . ALA B 1 418 ? -15.400 -68.317 -11.421 1.00 56.58  ? 419 ALA B CA  1 
ATOM   7366 C C   . ALA B 1 418 ? -16.725 -67.891 -10.796 1.00 52.89  ? 419 ALA B C   1 
ATOM   7367 O O   . ALA B 1 418 ? -17.680 -68.659 -10.784 1.00 58.51  ? 419 ALA B O   1 
ATOM   7368 C CB  . ALA B 1 418 ? -14.378 -68.665 -10.323 1.00 51.99  ? 419 ALA B CB  1 
ATOM   7369 N N   . ALA B 1 419 ? -16.779 -66.662 -10.292 1.00 57.27  ? 420 ALA B N   1 
ATOM   7370 C CA  . ALA B 1 419 ? -17.991 -66.151 -9.648  1.00 55.96  ? 420 ALA B CA  1 
ATOM   7371 C C   . ALA B 1 419 ? -19.166 -66.006 -10.615 1.00 65.47  ? 420 ALA B C   1 
ATOM   7372 O O   . ALA B 1 419 ? -20.318 -66.084 -10.209 1.00 63.41  ? 420 ALA B O   1 
ATOM   7373 C CB  . ALA B 1 419 ? -17.715 -64.829 -8.961  1.00 49.54  ? 420 ALA B CB  1 
ATOM   7374 N N   . GLN B 1 420 ? -18.878 -65.807 -11.898 1.00 67.14  ? 421 GLN B N   1 
ATOM   7375 C CA  . GLN B 1 420 ? -19.940 -65.531 -12.860 1.00 48.10  ? 421 GLN B CA  1 
ATOM   7376 C C   . GLN B 1 420 ? -20.211 -66.674 -13.832 1.00 55.95  ? 421 GLN B C   1 
ATOM   7377 O O   . GLN B 1 420 ? -20.640 -66.451 -14.972 1.00 56.52  ? 421 GLN B O   1 
ATOM   7378 C CB  . GLN B 1 420 ? -19.678 -64.216 -13.595 1.00 57.34  ? 421 GLN B CB  1 
ATOM   7379 C CG  . GLN B 1 420 ? -19.814 -62.993 -12.685 1.00 57.10  ? 421 GLN B CG  1 
ATOM   7380 C CD  . GLN B 1 420 ? -18.901 -61.858 -13.103 1.00 66.73  ? 421 GLN B CD  1 
ATOM   7381 O OE1 . GLN B 1 420 ? -18.294 -61.191 -12.266 1.00 60.72  ? 421 GLN B OE1 1 
ATOM   7382 N NE2 . GLN B 1 420 ? -18.798 -61.634 -14.406 1.00 58.94  ? 421 GLN B NE2 1 
ATOM   7383 N N   . GLY B 1 421 ? -19.966 -67.898 -13.370 1.00 59.66  ? 422 GLY B N   1 
ATOM   7384 C CA  . GLY B 1 421 ? -20.423 -69.076 -14.080 1.00 57.21  ? 422 GLY B CA  1 
ATOM   7385 C C   . GLY B 1 421 ? -19.394 -70.040 -14.648 1.00 64.83  ? 422 GLY B C   1 
ATOM   7386 O O   . GLY B 1 421 ? -19.749 -71.161 -15.005 1.00 62.39  ? 422 GLY B O   1 
ATOM   7387 N N   . ALA B 1 422 ? -18.131 -69.635 -14.751 1.00 56.44  ? 423 ALA B N   1 
ATOM   7388 C CA  . ALA B 1 422 ? -17.158 -70.481 -15.448 1.00 54.52  ? 423 ALA B CA  1 
ATOM   7389 C C   . ALA B 1 422 ? -16.530 -71.490 -14.529 1.00 52.67  ? 423 ALA B C   1 
ATOM   7390 O O   . ALA B 1 422 ? -16.452 -71.271 -13.311 1.00 54.36  ? 423 ALA B O   1 
ATOM   7391 C CB  . ALA B 1 422 ? -16.077 -69.636 -16.124 1.00 54.81  ? 423 ALA B CB  1 
ATOM   7392 N N   . ARG B 1 423 ? -16.091 -72.610 -15.095 1.00 45.02  ? 424 ARG B N   1 
ATOM   7393 C CA  . ARG B 1 423 ? -15.204 -73.501 -14.347 1.00 51.70  ? 424 ARG B CA  1 
ATOM   7394 C C   . ARG B 1 423 ? -13.748 -73.095 -14.626 1.00 54.45  ? 424 ARG B C   1 
ATOM   7395 O O   . ARG B 1 423 ? -13.314 -73.036 -15.787 1.00 48.37  ? 424 ARG B O   1 
ATOM   7396 C CB  . ARG B 1 423 ? -15.447 -74.978 -14.697 1.00 55.69  ? 424 ARG B CB  1 
ATOM   7397 C CG  . ARG B 1 423 ? -14.681 -75.950 -13.780 1.00 64.49  ? 424 ARG B CG  1 
ATOM   7398 C CD  . ARG B 1 423 ? -15.306 -77.351 -13.719 1.00 79.58  ? 424 ARG B CD  1 
ATOM   7399 N NE  . ARG B 1 423 ? -15.005 -78.159 -14.905 1.00 86.04  ? 424 ARG B NE  1 
ATOM   7400 C CZ  . ARG B 1 423 ? -15.916 -78.598 -15.776 1.00 86.77  ? 424 ARG B CZ  1 
ATOM   7401 N NH1 . ARG B 1 423 ? -17.204 -78.314 -15.598 1.00 84.57  ? 424 ARG B NH1 1 
ATOM   7402 N NH2 . ARG B 1 423 ? -15.540 -79.326 -16.827 1.00 74.46  ? 424 ARG B NH2 1 
ATOM   7403 N N   . VAL B 1 424 ? -13.000 -72.808 -13.568 1.00 46.75  ? 425 VAL B N   1 
ATOM   7404 C CA  . VAL B 1 424 ? -11.655 -72.258 -13.703 1.00 41.00  ? 425 VAL B CA  1 
ATOM   7405 C C   . VAL B 1 424 ? -10.634 -73.115 -12.976 1.00 50.92  ? 425 VAL B C   1 
ATOM   7406 O O   . VAL B 1 424 ? -10.865 -73.517 -11.840 1.00 50.67  ? 425 VAL B O   1 
ATOM   7407 C CB  . VAL B 1 424 ? -11.573 -70.809 -13.139 1.00 48.74  ? 425 VAL B CB  1 
ATOM   7408 C CG1 . VAL B 1 424 ? -10.194 -70.216 -13.384 1.00 46.16  ? 425 VAL B CG1 1 
ATOM   7409 C CG2 . VAL B 1 424 ? -12.640 -69.911 -13.758 1.00 43.39  ? 425 VAL B CG2 1 
ATOM   7410 N N   . TYR B 1 425 ? -9.512  -73.408 -13.635 1.00 44.24  ? 426 TYR B N   1 
ATOM   7411 C CA  . TYR B 1 425 ? -8.388  -74.086 -12.993 1.00 46.10  ? 426 TYR B CA  1 
ATOM   7412 C C   . TYR B 1 425 ? -7.182  -73.159 -13.008 1.00 48.96  ? 426 TYR B C   1 
ATOM   7413 O O   . TYR B 1 425 ? -6.946  -72.479 -14.002 1.00 45.79  ? 426 TYR B O   1 
ATOM   7414 C CB  . TYR B 1 425 ? -8.076  -75.411 -13.694 1.00 45.48  ? 426 TYR B CB  1 
ATOM   7415 C CG  . TYR B 1 425 ? -9.213  -76.413 -13.596 1.00 49.50  ? 426 TYR B CG  1 
ATOM   7416 C CD1 . TYR B 1 425 ? -9.285  -77.304 -12.535 1.00 48.78  ? 426 TYR B CD1 1 
ATOM   7417 C CD2 . TYR B 1 425 ? -10.217 -76.461 -14.562 1.00 53.47  ? 426 TYR B CD2 1 
ATOM   7418 C CE1 . TYR B 1 425 ? -10.323 -78.214 -12.429 1.00 51.74  ? 426 TYR B CE1 1 
ATOM   7419 C CE2 . TYR B 1 425 ? -11.254 -77.369 -14.470 1.00 51.75  ? 426 TYR B CE2 1 
ATOM   7420 C CZ  . TYR B 1 425 ? -11.301 -78.241 -13.391 1.00 55.08  ? 426 TYR B CZ  1 
ATOM   7421 O OH  . TYR B 1 425 ? -12.326 -79.143 -13.271 1.00 51.90  ? 426 TYR B OH  1 
ATOM   7422 N N   . ALA B 1 426 ? -6.435  -73.104 -11.905 1.00 42.55  ? 427 ALA B N   1 
ATOM   7423 C CA  . ALA B 1 426 ? -5.319  -72.167 -11.802 1.00 42.18  ? 427 ALA B CA  1 
ATOM   7424 C C   . ALA B 1 426 ? -4.036  -72.846 -11.342 1.00 44.07  ? 427 ALA B C   1 
ATOM   7425 O O   . ALA B 1 426 ? -4.085  -73.798 -10.579 1.00 46.17  ? 427 ALA B O   1 
ATOM   7426 C CB  . ALA B 1 426 ? -5.673  -70.990 -10.880 1.00 38.75  ? 427 ALA B CB  1 
ATOM   7427 N N   . TYR B 1 427 ? -2.886  -72.351 -11.807 1.00 39.17  ? 428 TYR B N   1 
ATOM   7428 C CA  . TYR B 1 427 ? -1.608  -72.963 -11.467 1.00 35.29  ? 428 TYR B CA  1 
ATOM   7429 C C   . TYR B 1 427 ? -0.566  -71.888 -11.230 1.00 45.57  ? 428 TYR B C   1 
ATOM   7430 O O   . TYR B 1 427 ? -0.737  -70.747 -11.656 1.00 40.65  ? 428 TYR B O   1 
ATOM   7431 C CB  . TYR B 1 427 ? -1.112  -73.905 -12.589 1.00 48.13  ? 428 TYR B CB  1 
ATOM   7432 C CG  . TYR B 1 427 ? -0.705  -73.161 -13.868 1.00 43.41  ? 428 TYR B CG  1 
ATOM   7433 C CD1 . TYR B 1 427 ? 0.522   -72.506 -13.962 1.00 44.66  ? 428 TYR B CD1 1 
ATOM   7434 C CD2 . TYR B 1 427 ? -1.560  -73.102 -14.959 1.00 38.67  ? 428 TYR B CD2 1 
ATOM   7435 C CE1 . TYR B 1 427 ? 0.885   -71.804 -15.111 1.00 45.45  ? 428 TYR B CE1 1 
ATOM   7436 C CE2 . TYR B 1 427 ? -1.207  -72.406 -16.124 1.00 42.95  ? 428 TYR B CE2 1 
ATOM   7437 C CZ  . TYR B 1 427 ? 0.023   -71.758 -16.183 1.00 45.62  ? 428 TYR B CZ  1 
ATOM   7438 O OH  . TYR B 1 427 ? 0.396   -71.049 -17.307 1.00 43.07  ? 428 TYR B OH  1 
ATOM   7439 N N   . VAL B 1 428 ? 0.524   -72.276 -10.574 1.00 43.52  ? 429 VAL B N   1 
ATOM   7440 C CA  . VAL B 1 428 ? 1.744   -71.486 -10.530 1.00 40.34  ? 429 VAL B CA  1 
ATOM   7441 C C   . VAL B 1 428 ? 2.889   -72.423 -10.925 1.00 46.63  ? 429 VAL B C   1 
ATOM   7442 O O   . VAL B 1 428 ? 3.009   -73.519 -10.391 1.00 46.43  ? 429 VAL B O   1 
ATOM   7443 C CB  . VAL B 1 428 ? 1.999   -70.901 -9.127  1.00 45.27  ? 429 VAL B CB  1 
ATOM   7444 C CG1 . VAL B 1 428 ? 3.371   -70.237 -9.067  1.00 42.08  ? 429 VAL B CG1 1 
ATOM   7445 C CG2 . VAL B 1 428 ? 0.906   -69.896 -8.771  1.00 48.72  ? 429 VAL B CG2 1 
ATOM   7446 N N   . PHE B 1 429 ? 3.714   -72.002 -11.876 1.00 49.17  ? 430 PHE B N   1 
ATOM   7447 C CA  . PHE B 1 429 ? 4.737   -72.871 -12.426 1.00 40.63  ? 430 PHE B CA  1 
ATOM   7448 C C   . PHE B 1 429 ? 6.034   -72.575 -11.712 1.00 46.23  ? 430 PHE B C   1 
ATOM   7449 O O   . PHE B 1 429 ? 6.505   -71.438 -11.752 1.00 41.72  ? 430 PHE B O   1 
ATOM   7450 C CB  . PHE B 1 429 ? 4.868   -72.631 -13.940 1.00 45.09  ? 430 PHE B CB  1 
ATOM   7451 C CG  . PHE B 1 429 ? 5.863   -73.522 -14.608 1.00 41.99  ? 430 PHE B CG  1 
ATOM   7452 C CD1 . PHE B 1 429 ? 5.465   -74.740 -15.150 1.00 43.93  ? 430 PHE B CD1 1 
ATOM   7453 C CD2 . PHE B 1 429 ? 7.202   -73.149 -14.701 1.00 47.58  ? 430 PHE B CD2 1 
ATOM   7454 C CE1 . PHE B 1 429 ? 6.385   -75.573 -15.779 1.00 49.08  ? 430 PHE B CE1 1 
ATOM   7455 C CE2 . PHE B 1 429 ? 8.130   -73.978 -15.326 1.00 47.16  ? 430 PHE B CE2 1 
ATOM   7456 C CZ  . PHE B 1 429 ? 7.722   -75.198 -15.852 1.00 39.97  ? 430 PHE B CZ  1 
ATOM   7457 N N   . GLU B 1 430 ? 6.608   -73.589 -11.051 1.00 40.47  ? 431 GLU B N   1 
ATOM   7458 C CA  . GLU B 1 430 ? 7.707   -73.349 -10.108 1.00 50.48  ? 431 GLU B CA  1 
ATOM   7459 C C   . GLU B 1 430 ? 9.006   -74.072 -10.410 1.00 54.23  ? 431 GLU B C   1 
ATOM   7460 O O   . GLU B 1 430 ? 9.912   -74.076 -9.581  1.00 50.69  ? 431 GLU B O   1 
ATOM   7461 C CB  . GLU B 1 430 ? 7.275   -73.660 -8.663  1.00 43.21  ? 431 GLU B CB  1 
ATOM   7462 C CG  . GLU B 1 430 ? 6.120   -72.794 -8.221  1.00 51.39  ? 431 GLU B CG  1 
ATOM   7463 C CD  . GLU B 1 430 ? 5.915   -72.790 -6.710  1.00 61.50  ? 431 GLU B CD  1 
ATOM   7464 O OE1 . GLU B 1 430 ? 5.908   -73.886 -6.099  1.00 62.72  ? 431 GLU B OE1 1 
ATOM   7465 O OE2 . GLU B 1 430 ? 5.773   -71.680 -6.144  1.00 57.88  ? 431 GLU B OE2 1 
ATOM   7466 N N   . HIS B 1 431 ? 9.112   -74.678 -11.587 1.00 53.91  ? 432 HIS B N   1 
ATOM   7467 C CA  . HIS B 1 431 ? 10.349  -75.365 -11.926 1.00 45.90  ? 432 HIS B CA  1 
ATOM   7468 C C   . HIS B 1 431 ? 11.297  -74.478 -12.738 1.00 57.20  ? 432 HIS B C   1 
ATOM   7469 O O   . HIS B 1 431 ? 10.904  -73.875 -13.740 1.00 44.46  ? 432 HIS B O   1 
ATOM   7470 C CB  . HIS B 1 431 ? 10.077  -76.677 -12.679 1.00 50.49  ? 432 HIS B CB  1 
ATOM   7471 C CG  . HIS B 1 431 ? 11.328  -77.355 -13.143 1.00 48.60  ? 432 HIS B CG  1 
ATOM   7472 N ND1 . HIS B 1 431 ? 12.260  -77.869 -12.267 1.00 49.23  ? 432 HIS B ND1 1 
ATOM   7473 C CD2 . HIS B 1 431 ? 11.837  -77.539 -14.384 1.00 50.12  ? 432 HIS B CD2 1 
ATOM   7474 C CE1 . HIS B 1 431 ? 13.274  -78.370 -12.950 1.00 50.57  ? 432 HIS B CE1 1 
ATOM   7475 N NE2 . HIS B 1 431 ? 13.041  -78.184 -14.235 1.00 52.20  ? 432 HIS B NE2 1 
ATOM   7476 N N   . ARG B 1 432 ? 12.547  -74.400 -12.299 1.00 54.75  ? 433 ARG B N   1 
ATOM   7477 C CA  . ARG B 1 432 ? 13.561  -73.662 -13.043 1.00 52.85  ? 433 ARG B CA  1 
ATOM   7478 C C   . ARG B 1 432 ? 14.327  -74.646 -13.926 1.00 55.64  ? 433 ARG B C   1 
ATOM   7479 O O   . ARG B 1 432 ? 15.050  -75.499 -13.427 1.00 51.57  ? 433 ARG B O   1 
ATOM   7480 C CB  . ARG B 1 432 ? 14.520  -72.939 -12.081 1.00 54.43  ? 433 ARG B CB  1 
ATOM   7481 C CG  . ARG B 1 432 ? 15.479  -71.987 -12.777 1.00 56.02  ? 433 ARG B CG  1 
ATOM   7482 C CD  . ARG B 1 432 ? 16.518  -71.420 -11.820 1.00 53.19  ? 433 ARG B CD  1 
ATOM   7483 N NE  . ARG B 1 432 ? 17.715  -70.971 -12.539 1.00 58.32  ? 433 ARG B NE  1 
ATOM   7484 C CZ  . ARG B 1 432 ? 17.947  -69.719 -12.929 1.00 55.58  ? 433 ARG B CZ  1 
ATOM   7485 N NH1 . ARG B 1 432 ? 17.073  -68.750 -12.673 1.00 53.32  ? 433 ARG B NH1 1 
ATOM   7486 N NH2 . ARG B 1 432 ? 19.067  -69.430 -13.577 1.00 59.53  ? 433 ARG B NH2 1 
ATOM   7487 N N   . ALA B 1 433 ? 14.155  -74.528 -15.237 1.00 58.67  ? 434 ALA B N   1 
ATOM   7488 C CA  . ALA B 1 433 ? 14.750  -75.475 -16.172 1.00 57.59  ? 434 ALA B CA  1 
ATOM   7489 C C   . ALA B 1 433 ? 16.250  -75.632 -15.947 1.00 61.58  ? 434 ALA B C   1 
ATOM   7490 O O   . ALA B 1 433 ? 16.967  -74.641 -15.748 1.00 54.71  ? 434 ALA B O   1 
ATOM   7491 C CB  . ALA B 1 433 ? 14.464  -75.052 -17.607 1.00 47.41  ? 434 ALA B CB  1 
ATOM   7492 N N   . SER B 1 434 ? 16.715  -76.879 -15.972 1.00 56.61  ? 435 SER B N   1 
ATOM   7493 C CA  . SER B 1 434 ? 18.135  -77.184 -15.786 1.00 55.87  ? 435 SER B CA  1 
ATOM   7494 C C   . SER B 1 434 ? 18.988  -76.456 -16.820 1.00 56.09  ? 435 SER B C   1 
ATOM   7495 O O   . SER B 1 434 ? 20.164  -76.200 -16.585 1.00 62.37  ? 435 SER B O   1 
ATOM   7496 C CB  . SER B 1 434 ? 18.379  -78.697 -15.896 1.00 54.23  ? 435 SER B CB  1 
ATOM   7497 O OG  . SER B 1 434 ? 18.119  -79.150 -17.227 1.00 56.53  ? 435 SER B OG  1 
ATOM   7498 N N   . THR B 1 435 ? 18.388  -76.112 -17.958 1.00 50.71  ? 436 THR B N   1 
ATOM   7499 C CA  . THR B 1 435 ? 19.131  -75.481 -19.055 1.00 61.72  ? 436 THR B CA  1 
ATOM   7500 C C   . THR B 1 435 ? 19.053  -73.950 -19.076 1.00 55.66  ? 436 THR B C   1 
ATOM   7501 O O   . THR B 1 435 ? 19.636  -73.317 -19.947 1.00 58.36  ? 436 THR B O   1 
ATOM   7502 C CB  . THR B 1 435 ? 18.666  -76.008 -20.435 1.00 54.39  ? 436 THR B CB  1 
ATOM   7503 O OG1 . THR B 1 435 ? 17.239  -75.897 -20.534 1.00 54.04  ? 436 THR B OG1 1 
ATOM   7504 C CG2 . THR B 1 435 ? 19.047  -77.457 -20.611 1.00 57.99  ? 436 THR B CG2 1 
ATOM   7505 N N   . LEU B 1 436 ? 18.347  -73.364 -18.116 1.00 52.08  ? 437 LEU B N   1 
ATOM   7506 C CA  . LEU B 1 436 ? 18.096  -71.919 -18.105 1.00 59.70  ? 437 LEU B CA  1 
ATOM   7507 C C   . LEU B 1 436 ? 19.384  -71.087 -18.095 1.00 51.34  ? 437 LEU B C   1 
ATOM   7508 O O   . LEU B 1 436 ? 20.281  -71.343 -17.306 1.00 62.03  ? 437 LEU B O   1 
ATOM   7509 C CB  . LEU B 1 436 ? 17.203  -71.540 -16.911 1.00 54.76  ? 437 LEU B CB  1 
ATOM   7510 C CG  . LEU B 1 436 ? 16.527  -70.170 -16.981 1.00 58.93  ? 437 LEU B CG  1 
ATOM   7511 C CD1 . LEU B 1 436 ? 15.726  -70.036 -18.254 1.00 44.87  ? 437 LEU B CD1 1 
ATOM   7512 C CD2 . LEU B 1 436 ? 15.637  -69.948 -15.776 1.00 58.18  ? 437 LEU B CD2 1 
ATOM   7513 N N   . SER B 1 437 ? 19.468  -70.087 -18.965 1.00 54.23  ? 438 SER B N   1 
ATOM   7514 C CA  . SER B 1 437 ? 20.702  -69.318 -19.103 1.00 50.51  ? 438 SER B CA  1 
ATOM   7515 C C   . SER B 1 437 ? 20.687  -67.923 -18.444 1.00 56.29  ? 438 SER B C   1 
ATOM   7516 O O   . SER B 1 437 ? 21.716  -67.246 -18.406 1.00 58.15  ? 438 SER B O   1 
ATOM   7517 C CB  . SER B 1 437 ? 21.102  -69.217 -20.577 1.00 62.71  ? 438 SER B CB  1 
ATOM   7518 O OG  . SER B 1 437 ? 20.088  -68.592 -21.348 1.00 64.85  ? 438 SER B OG  1 
ATOM   7519 N N   . TRP B 1 438 ? 19.534  -67.492 -17.935 1.00 57.19  ? 439 TRP B N   1 
ATOM   7520 C CA  . TRP B 1 438 ? 19.451  -66.240 -17.174 1.00 53.11  ? 439 TRP B CA  1 
ATOM   7521 C C   . TRP B 1 438 ? 20.000  -66.475 -15.764 1.00 53.15  ? 439 TRP B C   1 
ATOM   7522 O O   . TRP B 1 438 ? 19.996  -67.608 -15.283 1.00 49.57  ? 439 TRP B O   1 
ATOM   7523 C CB  . TRP B 1 438 ? 17.999  -65.737 -17.097 1.00 54.74  ? 439 TRP B CB  1 
ATOM   7524 C CG  . TRP B 1 438 ? 17.409  -65.259 -18.393 1.00 50.53  ? 439 TRP B CG  1 
ATOM   7525 C CD1 . TRP B 1 438 ? 16.602  -65.969 -19.233 1.00 54.27  ? 439 TRP B CD1 1 
ATOM   7526 C CD2 . TRP B 1 438 ? 17.562  -63.957 -18.988 1.00 52.61  ? 439 TRP B CD2 1 
ATOM   7527 N NE1 . TRP B 1 438 ? 16.252  -65.199 -20.322 1.00 53.50  ? 439 TRP B NE1 1 
ATOM   7528 C CE2 . TRP B 1 438 ? 16.822  -63.959 -20.195 1.00 53.34  ? 439 TRP B CE2 1 
ATOM   7529 C CE3 . TRP B 1 438 ? 18.252  -62.793 -18.618 1.00 47.60  ? 439 TRP B CE3 1 
ATOM   7530 C CZ2 . TRP B 1 438 ? 16.748  -62.842 -21.037 1.00 47.79  ? 439 TRP B CZ2 1 
ATOM   7531 C CZ3 . TRP B 1 438 ? 18.190  -61.690 -19.455 1.00 55.34  ? 439 TRP B CZ3 1 
ATOM   7532 C CH2 . TRP B 1 438 ? 17.437  -61.721 -20.653 1.00 55.79  ? 439 TRP B CH2 1 
ATOM   7533 N N   . PRO B 1 439 ? 20.452  -65.409 -15.079 1.00 57.83  ? 440 PRO B N   1 
ATOM   7534 C CA  . PRO B 1 439 ? 21.075  -65.605 -13.756 1.00 56.74  ? 440 PRO B CA  1 
ATOM   7535 C C   . PRO B 1 439 ? 20.141  -66.223 -12.710 1.00 55.53  ? 440 PRO B C   1 
ATOM   7536 O O   . PRO B 1 439 ? 18.919  -66.257 -12.883 1.00 56.37  ? 440 PRO B O   1 
ATOM   7537 C CB  . PRO B 1 439 ? 21.488  -64.185 -13.342 1.00 54.71  ? 440 PRO B CB  1 
ATOM   7538 C CG  . PRO B 1 439 ? 20.582  -63.288 -14.098 1.00 57.54  ? 440 PRO B CG  1 
ATOM   7539 C CD  . PRO B 1 439 ? 20.352  -63.981 -15.430 1.00 56.06  ? 440 PRO B CD  1 
ATOM   7540 N N   . LEU B 1 440 ? 20.725  -66.722 -11.628 1.00 59.57  ? 441 LEU B N   1 
ATOM   7541 C CA  . LEU B 1 440 ? 19.959  -67.437 -10.623 1.00 52.80  ? 441 LEU B CA  1 
ATOM   7542 C C   . LEU B 1 440 ? 18.953  -66.519 -9.916  1.00 60.50  ? 441 LEU B C   1 
ATOM   7543 O O   . LEU B 1 440 ? 17.835  -66.946 -9.603  1.00 53.54  ? 441 LEU B O   1 
ATOM   7544 C CB  . LEU B 1 440 ? 20.891  -68.085 -9.613  1.00 65.40  ? 441 LEU B CB  1 
ATOM   7545 C CG  . LEU B 1 440 ? 20.335  -69.334 -8.935  1.00 75.13  ? 441 LEU B CG  1 
ATOM   7546 C CD1 . LEU B 1 440 ? 20.286  -70.470 -9.930  1.00 72.30  ? 441 LEU B CD1 1 
ATOM   7547 C CD2 . LEU B 1 440 ? 21.179  -69.715 -7.742  1.00 70.77  ? 441 LEU B CD2 1 
ATOM   7548 N N   . TRP B 1 441 ? 19.333  -65.260 -9.688  1.00 53.44  ? 442 TRP B N   1 
ATOM   7549 C CA  . TRP B 1 441 ? 18.450  -64.339 -8.963  1.00 55.53  ? 442 TRP B CA  1 
ATOM   7550 C C   . TRP B 1 441 ? 17.069  -64.172 -9.610  1.00 53.64  ? 442 TRP B C   1 
ATOM   7551 O O   . TRP B 1 441 ? 16.093  -63.931 -8.901  1.00 53.05  ? 442 TRP B O   1 
ATOM   7552 C CB  . TRP B 1 441 ? 19.105  -62.968 -8.664  1.00 47.35  ? 442 TRP B CB  1 
ATOM   7553 C CG  . TRP B 1 441 ? 19.401  -62.074 -9.871  1.00 47.15  ? 442 TRP B CG  1 
ATOM   7554 C CD1 . TRP B 1 441 ? 20.597  -61.941 -10.511 1.00 47.23  ? 442 TRP B CD1 1 
ATOM   7555 C CD2 . TRP B 1 441 ? 18.500  -61.167 -10.522 1.00 48.68  ? 442 TRP B CD2 1 
ATOM   7556 N NE1 . TRP B 1 441 ? 20.496  -61.024 -11.525 1.00 58.10  ? 442 TRP B NE1 1 
ATOM   7557 C CE2 . TRP B 1 441 ? 19.218  -60.538 -11.561 1.00 48.90  ? 442 TRP B CE2 1 
ATOM   7558 C CE3 . TRP B 1 441 ? 17.156  -60.826 -10.331 1.00 55.02  ? 442 TRP B CE3 1 
ATOM   7559 C CZ2 . TRP B 1 441 ? 18.636  -59.608 -12.421 1.00 50.58  ? 442 TRP B CZ2 1 
ATOM   7560 C CZ3 . TRP B 1 441 ? 16.576  -59.893 -11.189 1.00 49.66  ? 442 TRP B CZ3 1 
ATOM   7561 C CH2 . TRP B 1 441 ? 17.318  -59.299 -12.220 1.00 55.22  ? 442 TRP B CH2 1 
ATOM   7562 N N   . MET B 1 442 ? 16.982  -64.334 -10.935 1.00 47.41  ? 443 MET B N   1 
ATOM   7563 C CA  . MET B 1 442 ? 15.713  -64.153 -11.645 1.00 45.68  ? 443 MET B CA  1 
ATOM   7564 C C   . MET B 1 442 ? 14.710  -65.294 -11.431 1.00 47.60  ? 443 MET B C   1 
ATOM   7565 O O   . MET B 1 442 ? 13.559  -65.182 -11.862 1.00 46.08  ? 443 MET B O   1 
ATOM   7566 C CB  . MET B 1 442 ? 15.929  -63.959 -13.157 1.00 48.24  ? 443 MET B CB  1 
ATOM   7567 C CG  . MET B 1 442 ? 16.667  -62.694 -13.570 1.00 48.45  ? 443 MET B CG  1 
ATOM   7568 S SD  . MET B 1 442 ? 16.800  -62.616 -15.386 1.00 57.30  ? 443 MET B SD  1 
ATOM   7569 C CE  . MET B 1 442 ? 17.343  -60.939 -15.615 1.00 59.97  ? 443 MET B CE  1 
ATOM   7570 N N   . GLY B 1 443 ? 15.136  -66.381 -10.781 1.00 47.39  ? 444 GLY B N   1 
ATOM   7571 C CA  . GLY B 1 443 ? 14.229  -67.469 -10.426 1.00 45.37  ? 444 GLY B CA  1 
ATOM   7572 C C   . GLY B 1 443 ? 13.642  -68.175 -11.639 1.00 47.06  ? 444 GLY B C   1 
ATOM   7573 O O   . GLY B 1 443 ? 14.381  -68.617 -12.521 1.00 47.67  ? 444 GLY B O   1 
ATOM   7574 N N   . VAL B 1 444 ? 12.317  -68.278 -11.686 1.00 47.88  ? 445 VAL B N   1 
ATOM   7575 C CA  . VAL B 1 444 ? 11.616  -68.764 -12.879 1.00 48.89  ? 445 VAL B CA  1 
ATOM   7576 C C   . VAL B 1 444 ? 10.954  -67.625 -13.651 1.00 47.60  ? 445 VAL B C   1 
ATOM   7577 O O   . VAL B 1 444 ? 9.843   -67.230 -13.329 1.00 49.00  ? 445 VAL B O   1 
ATOM   7578 C CB  . VAL B 1 444 ? 10.520  -69.779 -12.511 1.00 47.83  ? 445 VAL B CB  1 
ATOM   7579 C CG1 . VAL B 1 444 ? 10.037  -70.518 -13.768 1.00 51.22  ? 445 VAL B CG1 1 
ATOM   7580 C CG2 . VAL B 1 444 ? 11.053  -70.768 -11.480 1.00 48.34  ? 445 VAL B CG2 1 
ATOM   7581 N N   . PRO B 1 445 ? 11.617  -67.119 -14.703 1.00 46.52  ? 446 PRO B N   1 
ATOM   7582 C CA  . PRO B 1 445 ? 11.122  -65.881 -15.314 1.00 45.07  ? 446 PRO B CA  1 
ATOM   7583 C C   . PRO B 1 445 ? 9.982   -66.083 -16.311 1.00 48.22  ? 446 PRO B C   1 
ATOM   7584 O O   . PRO B 1 445 ? 9.602   -67.206 -16.677 1.00 42.94  ? 446 PRO B O   1 
ATOM   7585 C CB  . PRO B 1 445 ? 12.363  -65.306 -16.029 1.00 44.67  ? 446 PRO B CB  1 
ATOM   7586 C CG  . PRO B 1 445 ? 13.547  -66.252 -15.617 1.00 45.83  ? 446 PRO B CG  1 
ATOM   7587 C CD  . PRO B 1 445 ? 12.881  -67.560 -15.311 1.00 40.91  ? 446 PRO B CD  1 
ATOM   7588 N N   . HIS B 1 446 ? 9.431   -64.950 -16.722 1.00 43.09  ? 447 HIS B N   1 
ATOM   7589 C CA  . HIS B 1 446 ? 8.330   -64.871 -17.663 1.00 45.49  ? 447 HIS B CA  1 
ATOM   7590 C C   . HIS B 1 446 ? 8.716   -65.644 -18.916 1.00 48.49  ? 447 HIS B C   1 
ATOM   7591 O O   . HIS B 1 446 ? 9.774   -65.414 -19.483 1.00 45.16  ? 447 HIS B O   1 
ATOM   7592 C CB  . HIS B 1 446 ? 8.124   -63.391 -17.989 1.00 46.28  ? 447 HIS B CB  1 
ATOM   7593 C CG  . HIS B 1 446 ? 6.884   -63.084 -18.764 1.00 48.93  ? 447 HIS B CG  1 
ATOM   7594 N ND1 . HIS B 1 446 ? 5.617   -63.230 -18.240 1.00 50.33  ? 447 HIS B ND1 1 
ATOM   7595 C CD2 . HIS B 1 446 ? 6.722   -62.568 -20.008 1.00 46.56  ? 447 HIS B CD2 1 
ATOM   7596 C CE1 . HIS B 1 446 ? 4.725   -62.841 -19.135 1.00 46.64  ? 447 HIS B CE1 1 
ATOM   7597 N NE2 . HIS B 1 446 ? 5.371   -62.431 -20.214 1.00 49.98  ? 447 HIS B NE2 1 
ATOM   7598 N N   . GLY B 1 447 ? 7.883   -66.596 -19.316 1.00 46.35  ? 448 GLY B N   1 
ATOM   7599 C CA  . GLY B 1 447 ? 8.096   -67.276 -20.576 1.00 44.28  ? 448 GLY B CA  1 
ATOM   7600 C C   . GLY B 1 447 ? 8.718   -68.647 -20.450 1.00 48.95  ? 448 GLY B C   1 
ATOM   7601 O O   . GLY B 1 447 ? 8.773   -69.372 -21.426 1.00 41.56  ? 448 GLY B O   1 
ATOM   7602 N N   . TYR B 1 448 ? 9.151   -69.032 -19.252 1.00 41.56  ? 449 TYR B N   1 
ATOM   7603 C CA  . TYR B 1 448 ? 9.909   -70.274 -19.133 1.00 41.56  ? 449 TYR B CA  1 
ATOM   7604 C C   . TYR B 1 448 ? 9.124   -71.519 -18.762 1.00 44.80  ? 449 TYR B C   1 
ATOM   7605 O O   . TYR B 1 448 ? 9.706   -72.570 -18.557 1.00 40.68  ? 449 TYR B O   1 
ATOM   7606 C CB  . TYR B 1 448 ? 11.230  -70.078 -18.369 1.00 40.67  ? 449 TYR B CB  1 
ATOM   7607 C CG  . TYR B 1 448 ? 12.116  -69.242 -19.240 1.00 48.11  ? 449 TYR B CG  1 
ATOM   7608 C CD1 . TYR B 1 448 ? 12.903  -69.836 -20.227 1.00 46.89  ? 449 TYR B CD1 1 
ATOM   7609 C CD2 . TYR B 1 448 ? 12.074  -67.845 -19.180 1.00 47.23  ? 449 TYR B CD2 1 
ATOM   7610 C CE1 . TYR B 1 448 ? 13.681  -69.061 -21.099 1.00 47.80  ? 449 TYR B CE1 1 
ATOM   7611 C CE2 . TYR B 1 448 ? 12.852  -67.059 -20.044 1.00 47.49  ? 449 TYR B CE2 1 
ATOM   7612 C CZ  . TYR B 1 448 ? 13.648  -67.682 -21.007 1.00 50.71  ? 449 TYR B CZ  1 
ATOM   7613 O OH  . TYR B 1 448 ? 14.412  -66.930 -21.875 1.00 47.02  ? 449 TYR B OH  1 
ATOM   7614 N N   . GLU B 1 449 ? 7.796   -71.420 -18.769 1.00 43.58  ? 450 GLU B N   1 
ATOM   7615 C CA  . GLU B 1 449 ? 6.986   -72.635 -18.710 1.00 43.45  ? 450 GLU B CA  1 
ATOM   7616 C C   . GLU B 1 449 ? 6.710   -73.196 -20.116 1.00 49.41  ? 450 GLU B C   1 
ATOM   7617 O O   . GLU B 1 449 ? 6.385   -74.384 -20.262 1.00 45.26  ? 450 GLU B O   1 
ATOM   7618 C CB  . GLU B 1 449 ? 5.666   -72.394 -17.965 1.00 41.33  ? 450 GLU B CB  1 
ATOM   7619 C CG  . GLU B 1 449 ? 4.526   -71.891 -18.863 1.00 50.51  ? 450 GLU B CG  1 
ATOM   7620 C CD  . GLU B 1 449 ? 4.635   -70.414 -19.277 1.00 48.52  ? 450 GLU B CD  1 
ATOM   7621 O OE1 . GLU B 1 449 ? 5.714   -69.778 -19.126 1.00 41.46  ? 450 GLU B OE1 1 
ATOM   7622 O OE2 . GLU B 1 449 ? 3.606   -69.885 -19.748 1.00 46.52  ? 450 GLU B OE2 1 
ATOM   7623 N N   . ILE B 1 450 ? 6.838   -72.355 -21.145 1.00 40.07  ? 451 ILE B N   1 
ATOM   7624 C CA  . ILE B 1 450 ? 6.366   -72.739 -22.492 1.00 44.99  ? 451 ILE B CA  1 
ATOM   7625 C C   . ILE B 1 450 ? 7.081   -73.982 -23.028 1.00 41.98  ? 451 ILE B C   1 
ATOM   7626 O O   . ILE B 1 450 ? 6.440   -74.907 -23.514 1.00 39.92  ? 451 ILE B O   1 
ATOM   7627 C CB  . ILE B 1 450 ? 6.489   -71.581 -23.519 1.00 45.94  ? 451 ILE B CB  1 
ATOM   7628 C CG1 . ILE B 1 450 ? 5.578   -70.402 -23.130 1.00 45.45  ? 451 ILE B CG1 1 
ATOM   7629 C CG2 . ILE B 1 450 ? 6.143   -72.062 -24.907 1.00 43.69  ? 451 ILE B CG2 1 
ATOM   7630 C CD1 . ILE B 1 450 ? 6.044   -69.045 -23.727 1.00 38.55  ? 451 ILE B CD1 1 
ATOM   7631 N N   . GLU B 1 451 ? 8.407   -74.011 -22.912 1.00 40.76  ? 452 GLU B N   1 
ATOM   7632 C CA  . GLU B 1 451 ? 9.184   -75.151 -23.421 1.00 46.28  ? 452 GLU B CA  1 
ATOM   7633 C C   . GLU B 1 451 ? 8.760   -76.510 -22.826 1.00 47.22  ? 452 GLU B C   1 
ATOM   7634 O O   . GLU B 1 451 ? 8.811   -77.539 -23.516 1.00 45.53  ? 452 GLU B O   1 
ATOM   7635 C CB  . GLU B 1 451 ? 10.683  -74.895 -23.241 1.00 45.57  ? 452 GLU B CB  1 
ATOM   7636 C CG  . GLU B 1 451 ? 11.104  -74.705 -21.758 1.00 52.30  ? 452 GLU B CG  1 
ATOM   7637 C CD  . GLU B 1 451 ? 12.405  -73.913 -21.626 1.00 58.88  ? 452 GLU B CD  1 
ATOM   7638 O OE1 . GLU B 1 451 ? 13.418  -74.472 -21.149 1.00 58.91  ? 452 GLU B OE1 1 
ATOM   7639 O OE2 . GLU B 1 451 ? 12.416  -72.721 -22.009 1.00 62.26  ? 452 GLU B OE2 1 
ATOM   7640 N N   . PHE B 1 452 ? 8.330   -76.513 -21.559 1.00 35.98  ? 453 PHE B N   1 
ATOM   7641 C CA  . PHE B 1 452 ? 7.760   -77.706 -20.945 1.00 38.82  ? 453 PHE B CA  1 
ATOM   7642 C C   . PHE B 1 452 ? 6.383   -78.085 -21.456 1.00 40.83  ? 453 PHE B C   1 
ATOM   7643 O O   . PHE B 1 452 ? 6.115   -79.275 -21.653 1.00 44.32  ? 453 PHE B O   1 
ATOM   7644 C CB  . PHE B 1 452 ? 7.766   -77.601 -19.389 1.00 43.83  ? 453 PHE B CB  1 
ATOM   7645 C CG  . PHE B 1 452 ? 9.143   -77.613 -18.827 1.00 44.17  ? 453 PHE B CG  1 
ATOM   7646 C CD1 . PHE B 1 452 ? 9.860   -76.430 -18.701 1.00 44.63  ? 453 PHE B CD1 1 
ATOM   7647 C CD2 . PHE B 1 452 ? 9.765   -78.814 -18.519 1.00 44.64  ? 453 PHE B CD2 1 
ATOM   7648 C CE1 . PHE B 1 452 ? 11.160  -76.438 -18.246 1.00 46.78  ? 453 PHE B CE1 1 
ATOM   7649 C CE2 . PHE B 1 452 ? 11.072  -78.833 -18.070 1.00 43.50  ? 453 PHE B CE2 1 
ATOM   7650 C CZ  . PHE B 1 452 ? 11.769  -77.645 -17.926 1.00 49.36  ? 453 PHE B CZ  1 
ATOM   7651 N N   . ILE B 1 453 ? 5.506   -77.097 -21.653 1.00 44.45  ? 454 ILE B N   1 
ATOM   7652 C CA  . ILE B 1 453 ? 4.151   -77.358 -22.160 1.00 42.47  ? 454 ILE B CA  1 
ATOM   7653 C C   . ILE B 1 453 ? 4.209   -77.969 -23.581 1.00 47.22  ? 454 ILE B C   1 
ATOM   7654 O O   . ILE B 1 453 ? 3.369   -78.784 -23.975 1.00 44.60  ? 454 ILE B O   1 
ATOM   7655 C CB  . ILE B 1 453 ? 3.269   -76.056 -22.186 1.00 46.17  ? 454 ILE B CB  1 
ATOM   7656 C CG1 . ILE B 1 453 ? 3.134   -75.407 -20.784 1.00 47.40  ? 454 ILE B CG1 1 
ATOM   7657 C CG2 . ILE B 1 453 ? 1.886   -76.334 -22.767 1.00 43.55  ? 454 ILE B CG2 1 
ATOM   7658 C CD1 . ILE B 1 453 ? 2.810   -76.376 -19.694 1.00 46.47  ? 454 ILE B CD1 1 
ATOM   7659 N N   . PHE B 1 454 ? 5.210   -77.563 -24.350 1.00 43.32  ? 455 PHE B N   1 
ATOM   7660 C CA  . PHE B 1 454 ? 5.344   -78.024 -25.732 1.00 46.81  ? 455 PHE B CA  1 
ATOM   7661 C C   . PHE B 1 454 ? 6.173   -79.314 -25.819 1.00 53.21  ? 455 PHE B C   1 
ATOM   7662 O O   . PHE B 1 454 ? 6.318   -79.881 -26.891 1.00 45.39  ? 455 PHE B O   1 
ATOM   7663 C CB  . PHE B 1 454 ? 5.938   -76.923 -26.614 1.00 45.49  ? 455 PHE B CB  1 
ATOM   7664 C CG  . PHE B 1 454 ? 4.907   -76.001 -27.220 1.00 45.49  ? 455 PHE B CG  1 
ATOM   7665 C CD1 . PHE B 1 454 ? 4.352   -74.967 -26.481 1.00 43.78  ? 455 PHE B CD1 1 
ATOM   7666 C CD2 . PHE B 1 454 ? 4.498   -76.168 -28.530 1.00 45.92  ? 455 PHE B CD2 1 
ATOM   7667 C CE1 . PHE B 1 454 ? 3.395   -74.111 -27.044 1.00 46.79  ? 455 PHE B CE1 1 
ATOM   7668 C CE2 . PHE B 1 454 ? 3.537   -75.329 -29.097 1.00 43.83  ? 455 PHE B CE2 1 
ATOM   7669 C CZ  . PHE B 1 454 ? 2.988   -74.296 -28.369 1.00 39.92  ? 455 PHE B CZ  1 
ATOM   7670 N N   . GLY B 1 455 ? 6.704   -79.783 -24.689 1.00 49.19  ? 456 GLY B N   1 
ATOM   7671 C CA  . GLY B 1 455 ? 7.418   -81.059 -24.669 1.00 51.95  ? 456 GLY B CA  1 
ATOM   7672 C C   . GLY B 1 455 ? 8.816   -81.024 -25.275 1.00 51.71  ? 456 GLY B C   1 
ATOM   7673 O O   . GLY B 1 455 ? 9.396   -82.062 -25.642 1.00 47.27  ? 456 GLY B O   1 
ATOM   7674 N N   . ILE B 1 456 ? 9.363   -79.818 -25.377 1.00 50.36  ? 457 ILE B N   1 
ATOM   7675 C CA  . ILE B 1 456 ? 10.725  -79.605 -25.861 1.00 41.31  ? 457 ILE B CA  1 
ATOM   7676 C C   . ILE B 1 456 ? 11.817  -80.479 -25.206 1.00 51.79  ? 457 ILE B C   1 
ATOM   7677 O O   . ILE B 1 456 ? 12.740  -80.921 -25.898 1.00 51.67  ? 457 ILE B O   1 
ATOM   7678 C CB  . ILE B 1 456 ? 11.093  -78.100 -25.783 1.00 45.56  ? 457 ILE B CB  1 
ATOM   7679 C CG1 . ILE B 1 456 ? 9.995   -77.259 -26.460 1.00 49.39  ? 457 ILE B CG1 1 
ATOM   7680 C CG2 . ILE B 1 456 ? 12.460  -77.831 -26.410 1.00 46.49  ? 457 ILE B CG2 1 
ATOM   7681 C CD1 . ILE B 1 456 ? 9.707   -77.653 -27.926 1.00 45.29  ? 457 ILE B CD1 1 
ATOM   7682 N N   . PRO B 1 457 ? 11.726  -80.739 -23.878 1.00 48.61  ? 458 PRO B N   1 
ATOM   7683 C CA  . PRO B 1 457 ? 12.705  -81.668 -23.307 1.00 51.38  ? 458 PRO B CA  1 
ATOM   7684 C C   . PRO B 1 457 ? 12.749  -83.060 -23.962 1.00 48.26  ? 458 PRO B C   1 
ATOM   7685 O O   . PRO B 1 457 ? 13.741  -83.766 -23.777 1.00 55.19  ? 458 PRO B O   1 
ATOM   7686 C CB  . PRO B 1 457 ? 12.259  -81.793 -21.833 1.00 52.58  ? 458 PRO B CB  1 
ATOM   7687 C CG  . PRO B 1 457 ? 11.608  -80.499 -21.531 1.00 51.43  ? 458 PRO B CG  1 
ATOM   7688 C CD  . PRO B 1 457 ? 10.901  -80.109 -22.823 1.00 48.17  ? 458 PRO B CD  1 
ATOM   7689 N N   . LEU B 1 458 ? 11.712  -83.459 -24.692 1.00 49.11  ? 459 LEU B N   1 
ATOM   7690 C CA  . LEU B 1 458 ? 11.759  -84.740 -25.401 1.00 54.28  ? 459 LEU B CA  1 
ATOM   7691 C C   . LEU B 1 458 ? 12.714  -84.722 -26.599 1.00 58.77  ? 459 LEU B C   1 
ATOM   7692 O O   . LEU B 1 458 ? 13.056  -85.773 -27.150 1.00 62.65  ? 459 LEU B O   1 
ATOM   7693 C CB  . LEU B 1 458 ? 10.367  -85.186 -25.851 1.00 47.75  ? 459 LEU B CB  1 
ATOM   7694 C CG  . LEU B 1 458 ? 9.343   -85.326 -24.734 1.00 55.01  ? 459 LEU B CG  1 
ATOM   7695 C CD1 . LEU B 1 458 ? 8.066   -85.921 -25.279 1.00 52.99  ? 459 LEU B CD1 1 
ATOM   7696 C CD2 . LEU B 1 458 ? 9.907   -86.166 -23.594 1.00 54.90  ? 459 LEU B CD2 1 
ATOM   7697 N N   . ASP B 1 459 ? 13.141  -83.529 -26.996 1.00 54.82  ? 460 ASP B N   1 
ATOM   7698 C CA  . ASP B 1 459 ? 14.041  -83.377 -28.137 1.00 58.06  ? 460 ASP B CA  1 
ATOM   7699 C C   . ASP B 1 459 ? 15.445  -83.886 -27.790 1.00 66.81  ? 460 ASP B C   1 
ATOM   7700 O O   . ASP B 1 459 ? 16.136  -83.293 -26.959 1.00 62.97  ? 460 ASP B O   1 
ATOM   7701 C CB  . ASP B 1 459 ? 14.090  -81.909 -28.556 1.00 57.52  ? 460 ASP B CB  1 
ATOM   7702 C CG  . ASP B 1 459 ? 14.885  -81.671 -29.841 1.00 67.58  ? 460 ASP B CG  1 
ATOM   7703 O OD1 . ASP B 1 459 ? 15.795  -82.463 -30.179 1.00 63.16  ? 460 ASP B OD1 1 
ATOM   7704 O OD2 . ASP B 1 459 ? 14.596  -80.653 -30.502 1.00 69.21  ? 460 ASP B OD2 1 
ATOM   7705 N N   . PRO B 1 460 ? 15.881  -84.970 -28.455 1.00 66.88  ? 461 PRO B N   1 
ATOM   7706 C CA  . PRO B 1 460 ? 17.154  -85.635 -28.151 1.00 69.26  ? 461 PRO B CA  1 
ATOM   7707 C C   . PRO B 1 460 ? 18.365  -84.707 -28.234 1.00 73.76  ? 461 PRO B C   1 
ATOM   7708 O O   . PRO B 1 460 ? 19.251  -84.819 -27.386 1.00 82.21  ? 461 PRO B O   1 
ATOM   7709 C CB  . PRO B 1 460 ? 17.246  -86.723 -29.222 1.00 69.81  ? 461 PRO B CB  1 
ATOM   7710 C CG  . PRO B 1 460 ? 15.847  -86.964 -29.638 1.00 73.94  ? 461 PRO B CG  1 
ATOM   7711 C CD  . PRO B 1 460 ? 15.188  -85.617 -29.580 1.00 72.52  ? 461 PRO B CD  1 
ATOM   7712 N N   . SER B 1 461 ? 18.393  -83.798 -29.210 1.00 69.80  ? 462 SER B N   1 
ATOM   7713 C CA  . SER B 1 461 ? 19.540  -82.901 -29.386 1.00 63.59  ? 462 SER B CA  1 
ATOM   7714 C C   . SER B 1 461 ? 19.730  -81.929 -28.221 1.00 70.35  ? 462 SER B C   1 
ATOM   7715 O O   . SER B 1 461 ? 20.789  -81.318 -28.075 1.00 77.42  ? 462 SER B O   1 
ATOM   7716 C CB  . SER B 1 461 ? 19.443  -82.129 -30.706 1.00 65.63  ? 462 SER B CB  1 
ATOM   7717 O OG  . SER B 1 461 ? 18.538  -81.044 -30.607 1.00 75.52  ? 462 SER B OG  1 
ATOM   7718 N N   . ARG B 1 462 ? 18.709  -81.788 -27.384 1.00 72.85  ? 463 ARG B N   1 
ATOM   7719 C CA  . ARG B 1 462 ? 18.824  -80.923 -26.216 1.00 67.76  ? 463 ARG B CA  1 
ATOM   7720 C C   . ARG B 1 462 ? 19.187  -81.734 -24.976 1.00 77.10  ? 463 ARG B C   1 
ATOM   7721 O O   . ARG B 1 462 ? 19.069  -82.965 -24.969 1.00 72.07  ? 463 ARG B O   1 
ATOM   7722 C CB  . ARG B 1 462 ? 17.543  -80.121 -26.011 1.00 64.67  ? 463 ARG B CB  1 
ATOM   7723 C CG  . ARG B 1 462 ? 17.242  -79.248 -27.207 1.00 64.64  ? 463 ARG B CG  1 
ATOM   7724 C CD  . ARG B 1 462 ? 15.914  -78.565 -27.100 1.00 60.11  ? 463 ARG B CD  1 
ATOM   7725 N NE  . ARG B 1 462 ? 15.510  -77.982 -28.375 1.00 75.16  ? 463 ARG B NE  1 
ATOM   7726 C CZ  . ARG B 1 462 ? 15.873  -76.776 -28.798 1.00 73.14  ? 463 ARG B CZ  1 
ATOM   7727 N NH1 . ARG B 1 462 ? 16.666  -76.022 -28.047 1.00 71.10  ? 463 ARG B NH1 1 
ATOM   7728 N NH2 . ARG B 1 462 ? 15.448  -76.330 -29.977 1.00 74.53  ? 463 ARG B NH2 1 
ATOM   7729 N N   . ASN B 1 463 ? 19.636  -81.037 -23.936 1.00 63.51  ? 464 ASN B N   1 
ATOM   7730 C CA  . ASN B 1 463 ? 20.248  -81.688 -22.795 1.00 61.50  ? 464 ASN B CA  1 
ATOM   7731 C C   . ASN B 1 463 ? 19.449  -81.532 -21.512 1.00 60.38  ? 464 ASN B C   1 
ATOM   7732 O O   . ASN B 1 463 ? 20.018  -81.167 -20.500 1.00 58.33  ? 464 ASN B O   1 
ATOM   7733 C CB  . ASN B 1 463 ? 21.659  -81.121 -22.576 1.00 65.34  ? 464 ASN B CB  1 
ATOM   7734 C CG  . ASN B 1 463 ? 22.533  -81.231 -23.814 1.00 79.01  ? 464 ASN B CG  1 
ATOM   7735 O OD1 . ASN B 1 463 ? 22.644  -82.303 -24.415 1.00 78.51  ? 464 ASN B OD1 1 
ATOM   7736 N ND2 . ASN B 1 463 ? 23.155  -80.119 -24.207 1.00 79.23  ? 464 ASN B ND2 1 
ATOM   7737 N N   . TYR B 1 464 ? 18.142  -81.793 -21.550 1.00 56.27  ? 465 TYR B N   1 
ATOM   7738 C CA  . TYR B 1 464 ? 17.327  -81.743 -20.336 1.00 58.24  ? 465 TYR B CA  1 
ATOM   7739 C C   . TYR B 1 464 ? 17.504  -83.042 -19.547 1.00 61.30  ? 465 TYR B C   1 
ATOM   7740 O O   . TYR B 1 464 ? 17.874  -84.065 -20.118 1.00 50.53  ? 465 TYR B O   1 
ATOM   7741 C CB  . TYR B 1 464 ? 15.841  -81.557 -20.667 1.00 52.79  ? 465 TYR B CB  1 
ATOM   7742 C CG  . TYR B 1 464 ? 15.448  -80.191 -21.205 1.00 55.20  ? 465 TYR B CG  1 
ATOM   7743 C CD1 . TYR B 1 464 ? 15.552  -79.901 -22.566 1.00 50.66  ? 465 TYR B CD1 1 
ATOM   7744 C CD2 . TYR B 1 464 ? 14.933  -79.206 -20.361 1.00 53.73  ? 465 TYR B CD2 1 
ATOM   7745 C CE1 . TYR B 1 464 ? 15.182  -78.663 -23.074 1.00 48.29  ? 465 TYR B CE1 1 
ATOM   7746 C CE2 . TYR B 1 464 ? 14.554  -77.953 -20.863 1.00 52.73  ? 465 TYR B CE2 1 
ATOM   7747 C CZ  . TYR B 1 464 ? 14.683  -77.694 -22.220 1.00 59.30  ? 465 TYR B CZ  1 
ATOM   7748 O OH  . TYR B 1 464 ? 14.315  -76.467 -22.727 1.00 59.75  ? 465 TYR B OH  1 
ATOM   7749 N N   . THR B 1 465 ? 17.220  -83.018 -18.246 1.00 47.87  ? 466 THR B N   1 
ATOM   7750 C CA  . THR B 1 465 ? 17.318  -84.238 -17.441 1.00 49.26  ? 466 THR B CA  1 
ATOM   7751 C C   . THR B 1 465 ? 16.137  -85.161 -17.715 1.00 48.33  ? 466 THR B C   1 
ATOM   7752 O O   . THR B 1 465 ? 15.135  -84.743 -18.293 1.00 52.86  ? 466 THR B O   1 
ATOM   7753 C CB  . THR B 1 465 ? 17.321  -83.946 -15.915 1.00 52.23  ? 466 THR B CB  1 
ATOM   7754 O OG1 . THR B 1 465 ? 16.001  -83.581 -15.504 1.00 52.55  ? 466 THR B OG1 1 
ATOM   7755 C CG2 . THR B 1 465 ? 18.313  -82.834 -15.552 1.00 43.83  ? 466 THR B CG2 1 
ATOM   7756 N N   . ALA B 1 466 ? 16.253  -86.412 -17.276 1.00 52.50  ? 467 ALA B N   1 
ATOM   7757 C CA  . ALA B 1 466 ? 15.170  -87.391 -17.403 1.00 42.50  ? 467 ALA B CA  1 
ATOM   7758 C C   . ALA B 1 466 ? 13.916  -86.998 -16.638 1.00 53.73  ? 467 ALA B C   1 
ATOM   7759 O O   . ALA B 1 466 ? 12.802  -87.241 -17.115 1.00 51.69  ? 467 ALA B O   1 
ATOM   7760 C CB  . ALA B 1 466 ? 15.643  -88.779 -16.974 1.00 51.75  ? 467 ALA B CB  1 
ATOM   7761 N N   . GLU B 1 467 ? 14.099  -86.412 -15.449 1.00 45.37  ? 468 GLU B N   1 
ATOM   7762 C CA  . GLU B 1 467 ? 12.997  -85.914 -14.629 1.00 53.52  ? 468 GLU B CA  1 
ATOM   7763 C C   . GLU B 1 467 ? 12.218  -84.834 -15.350 1.00 45.52  ? 468 GLU B C   1 
ATOM   7764 O O   . GLU B 1 467 ? 10.986  -84.764 -15.265 1.00 49.64  ? 468 GLU B O   1 
ATOM   7765 C CB  . GLU B 1 467 ? 13.528  -85.269 -13.342 1.00 52.53  ? 468 GLU B CB  1 
ATOM   7766 C CG  . GLU B 1 467 ? 14.158  -86.184 -12.348 1.00 67.20  ? 468 GLU B CG  1 
ATOM   7767 C CD  . GLU B 1 467 ? 14.713  -85.393 -11.173 1.00 90.47  ? 468 GLU B CD  1 
ATOM   7768 O OE1 . GLU B 1 467 ? 15.752  -84.717 -11.356 1.00 99.17  ? 468 GLU B OE1 1 
ATOM   7769 O OE2 . GLU B 1 467 ? 14.096  -85.419 -10.085 1.00 82.89  ? 468 GLU B OE2 1 
ATOM   7770 N N   . GLU B 1 468 ? 12.950  -83.948 -16.013 1.00 43.67  ? 469 GLU B N   1 
ATOM   7771 C CA  . GLU B 1 468 ? 12.317  -82.896 -16.795 1.00 48.80  ? 469 GLU B CA  1 
ATOM   7772 C C   . GLU B 1 468 ? 11.517  -83.464 -17.971 1.00 55.55  ? 469 GLU B C   1 
ATOM   7773 O O   . GLU B 1 468 ? 10.472  -82.902 -18.342 1.00 53.38  ? 469 GLU B O   1 
ATOM   7774 C CB  . GLU B 1 468 ? 13.352  -81.862 -17.246 1.00 54.61  ? 469 GLU B CB  1 
ATOM   7775 C CG  . GLU B 1 468 ? 13.919  -81.049 -16.085 1.00 48.37  ? 469 GLU B CG  1 
ATOM   7776 C CD  . GLU B 1 468 ? 15.052  -80.127 -16.497 1.00 52.23  ? 469 GLU B CD  1 
ATOM   7777 O OE1 . GLU B 1 468 ? 15.988  -80.600 -17.177 1.00 54.66  ? 469 GLU B OE1 1 
ATOM   7778 O OE2 . GLU B 1 468 ? 15.010  -78.925 -16.140 1.00 52.99  ? 469 GLU B OE2 1 
ATOM   7779 N N   . LYS B 1 469 ? 11.978  -84.585 -18.533 1.00 51.06  ? 470 LYS B N   1 
ATOM   7780 C CA  . LYS B 1 469 ? 11.221  -85.268 -19.598 1.00 50.75  ? 470 LYS B CA  1 
ATOM   7781 C C   . LYS B 1 469 ? 9.913   -85.809 -19.036 1.00 47.64  ? 470 LYS B C   1 
ATOM   7782 O O   . LYS B 1 469 ? 8.846   -85.642 -19.628 1.00 49.26  ? 470 LYS B O   1 
ATOM   7783 C CB  . LYS B 1 469 ? 12.057  -86.377 -20.265 1.00 50.97  ? 470 LYS B CB  1 
ATOM   7784 C CG  . LYS B 1 469 ? 13.241  -85.825 -21.063 1.00 54.60  ? 470 LYS B CG  1 
ATOM   7785 C CD  . LYS B 1 469 ? 14.204  -86.887 -21.622 1.00 49.91  ? 470 LYS B CD  1 
ATOM   7786 C CE  . LYS B 1 469 ? 15.452  -86.193 -22.157 1.00 52.53  ? 470 LYS B CE  1 
ATOM   7787 N NZ  . LYS B 1 469 ? 16.585  -87.086 -22.493 1.00 47.31  ? 470 LYS B NZ  1 
ATOM   7788 N N   . ILE B 1 470 ? 9.991   -86.404 -17.850 1.00 50.75  ? 471 ILE B N   1 
ATOM   7789 C CA  . ILE B 1 470 ? 8.801   -86.896 -17.155 1.00 48.25  ? 471 ILE B CA  1 
ATOM   7790 C C   . ILE B 1 470 ? 7.839   -85.738 -16.832 1.00 50.78  ? 471 ILE B C   1 
ATOM   7791 O O   . ILE B 1 470 ? 6.633   -85.829 -17.099 1.00 52.18  ? 471 ILE B O   1 
ATOM   7792 C CB  . ILE B 1 470 ? 9.188   -87.671 -15.850 1.00 55.60  ? 471 ILE B CB  1 
ATOM   7793 C CG1 . ILE B 1 470 ? 10.004  -88.924 -16.189 1.00 53.31  ? 471 ILE B CG1 1 
ATOM   7794 C CG2 . ILE B 1 470 ? 7.951   -88.044 -15.045 1.00 44.29  ? 471 ILE B CG2 1 
ATOM   7795 C CD1 . ILE B 1 470 ? 9.256   -89.907 -17.069 1.00 57.23  ? 471 ILE B CD1 1 
ATOM   7796 N N   . PHE B 1 471 ? 8.380   -84.655 -16.270 1.00 50.40  ? 472 PHE B N   1 
ATOM   7797 C CA  . PHE B 1 471 ? 7.614   -83.423 -15.998 1.00 48.36  ? 472 PHE B CA  1 
ATOM   7798 C C   . PHE B 1 471 ? 6.872   -82.919 -17.246 1.00 45.26  ? 472 PHE B C   1 
ATOM   7799 O O   . PHE B 1 471 ? 5.656   -82.674 -17.215 1.00 51.54  ? 472 PHE B O   1 
ATOM   7800 C CB  . PHE B 1 471 ? 8.574   -82.339 -15.471 1.00 51.29  ? 472 PHE B CB  1 
ATOM   7801 C CG  . PHE B 1 471 ? 7.891   -81.076 -14.978 1.00 52.21  ? 472 PHE B CG  1 
ATOM   7802 C CD1 . PHE B 1 471 ? 6.701   -81.136 -14.267 1.00 46.71  ? 472 PHE B CD1 1 
ATOM   7803 C CD2 . PHE B 1 471 ? 8.464   -79.831 -15.210 1.00 45.95  ? 472 PHE B CD2 1 
ATOM   7804 C CE1 . PHE B 1 471 ? 6.083   -79.988 -13.817 1.00 48.02  ? 472 PHE B CE1 1 
ATOM   7805 C CE2 . PHE B 1 471 ? 7.855   -78.673 -14.754 1.00 43.40  ? 472 PHE B CE2 1 
ATOM   7806 C CZ  . PHE B 1 471 ? 6.670   -78.751 -14.050 1.00 46.41  ? 472 PHE B CZ  1 
ATOM   7807 N N   . ALA B 1 472 ? 7.602   -82.793 -18.351 1.00 45.41  ? 473 ALA B N   1 
ATOM   7808 C CA  . ALA B 1 472 ? 7.014   -82.317 -19.618 1.00 40.75  ? 473 ALA B CA  1 
ATOM   7809 C C   . ALA B 1 472 ? 5.836   -83.182 -20.052 1.00 44.03  ? 473 ALA B C   1 
ATOM   7810 O O   . ALA B 1 472 ? 4.780   -82.672 -20.466 1.00 44.72  ? 473 ALA B O   1 
ATOM   7811 C CB  . ALA B 1 472 ? 8.091   -82.265 -20.727 1.00 46.28  ? 473 ALA B CB  1 
ATOM   7812 N N   . GLN B 1 473 ? 6.007   -84.497 -19.926 1.00 43.83  ? 474 GLN B N   1 
ATOM   7813 C CA  . GLN B 1 473 ? 4.934   -85.441 -20.247 1.00 51.35  ? 474 GLN B CA  1 
ATOM   7814 C C   . GLN B 1 473 ? 3.683   -85.237 -19.378 1.00 46.53  ? 474 GLN B C   1 
ATOM   7815 O O   . GLN B 1 473 ? 2.562   -85.256 -19.903 1.00 48.22  ? 474 GLN B O   1 
ATOM   7816 C CB  . GLN B 1 473 ? 5.446   -86.899 -20.221 1.00 49.90  ? 474 GLN B CB  1 
ATOM   7817 C CG  . GLN B 1 473 ? 6.243   -87.269 -21.481 1.00 53.23  ? 474 GLN B CG  1 
ATOM   7818 C CD  . GLN B 1 473 ? 7.047   -88.573 -21.368 1.00 63.75  ? 474 GLN B CD  1 
ATOM   7819 O OE1 . GLN B 1 473 ? 6.978   -89.281 -20.369 1.00 62.07  ? 474 GLN B OE1 1 
ATOM   7820 N NE2 . GLN B 1 473 ? 7.821   -88.878 -22.404 1.00 61.82  ? 474 GLN B NE2 1 
ATOM   7821 N N   . ARG B 1 474 ? 3.870   -85.008 -18.071 1.00 44.58  ? 475 ARG B N   1 
ATOM   7822 C CA  . ARG B 1 474 ? 2.744   -84.713 -17.167 1.00 44.37  ? 475 ARG B CA  1 
ATOM   7823 C C   . ARG B 1 474 ? 1.992   -83.457 -17.613 1.00 39.80  ? 475 ARG B C   1 
ATOM   7824 O O   . ARG B 1 474 ? 0.754   -83.429 -17.658 1.00 44.65  ? 475 ARG B O   1 
ATOM   7825 C CB  . ARG B 1 474 ? 3.215   -84.494 -15.701 1.00 46.35  ? 475 ARG B CB  1 
ATOM   7826 C CG  . ARG B 1 474 ? 3.754   -85.699 -14.941 1.00 59.64  ? 475 ARG B CG  1 
ATOM   7827 C CD  . ARG B 1 474 ? 4.187   -85.341 -13.482 1.00 64.80  ? 475 ARG B CD  1 
ATOM   7828 N NE  . ARG B 1 474 ? 3.218   -84.468 -12.819 1.00 49.91  ? 475 ARG B NE  1 
ATOM   7829 C CZ  . ARG B 1 474 ? 3.526   -83.444 -12.018 1.00 50.94  ? 475 ARG B CZ  1 
ATOM   7830 N NH1 . ARG B 1 474 ? 4.791   -83.139 -11.732 1.00 46.26  ? 475 ARG B NH1 1 
ATOM   7831 N NH2 . ARG B 1 474 ? 2.553   -82.710 -11.505 1.00 49.26  ? 475 ARG B NH2 1 
ATOM   7832 N N   . LEU B 1 475 ? 2.746   -82.399 -17.902 1.00 42.28  ? 476 LEU B N   1 
ATOM   7833 C CA  . LEU B 1 475 ? 2.145   -81.114 -18.283 1.00 41.55  ? 476 LEU B CA  1 
ATOM   7834 C C   . LEU B 1 475 ? 1.376   -81.223 -19.587 1.00 47.63  ? 476 LEU B C   1 
ATOM   7835 O O   . LEU B 1 475 ? 0.254   -80.725 -19.698 1.00 45.30  ? 476 LEU B O   1 
ATOM   7836 C CB  . LEU B 1 475 ? 3.214   -80.028 -18.424 1.00 47.31  ? 476 LEU B CB  1 
ATOM   7837 C CG  . LEU B 1 475 ? 3.947   -79.693 -17.139 1.00 50.83  ? 476 LEU B CG  1 
ATOM   7838 C CD1 . LEU B 1 475 ? 4.890   -78.519 -17.341 1.00 53.64  ? 476 LEU B CD1 1 
ATOM   7839 C CD2 . LEU B 1 475 ? 2.932   -79.396 -16.061 1.00 50.35  ? 476 LEU B CD2 1 
ATOM   7840 N N   . MET B 1 476 ? 1.993   -81.859 -20.583 1.00 46.59  ? 477 MET B N   1 
ATOM   7841 C CA  . MET B 1 476 ? 1.326   -82.065 -21.869 1.00 43.91  ? 477 MET B CA  1 
ATOM   7842 C C   . MET B 1 476 ? 0.001   -82.805 -21.654 1.00 46.32  ? 477 MET B C   1 
ATOM   7843 O O   . MET B 1 476 ? -1.036  -82.474 -22.265 1.00 43.16  ? 477 MET B O   1 
ATOM   7844 C CB  . MET B 1 476 ? 2.236   -82.850 -22.820 1.00 45.53  ? 477 MET B CB  1 
ATOM   7845 C CG  . MET B 1 476 ? 3.344   -82.020 -23.488 1.00 47.16  ? 477 MET B CG  1 
ATOM   7846 S SD  . MET B 1 476 ? 4.127   -82.916 -24.884 1.00 52.65  ? 477 MET B SD  1 
ATOM   7847 C CE  . MET B 1 476 ? 5.138   -84.048 -23.924 1.00 53.13  ? 477 MET B CE  1 
ATOM   7848 N N   . ARG B 1 477 ? 0.034   -83.794 -20.760 1.00 49.63  ? 478 ARG B N   1 
ATOM   7849 C CA  . ARG B 1 477 ? -1.166  -84.563 -20.417 1.00 46.56  ? 478 ARG B CA  1 
ATOM   7850 C C   . ARG B 1 477 ? -2.266  -83.689 -19.798 1.00 48.77  ? 478 ARG B C   1 
ATOM   7851 O O   . ARG B 1 477 ? -3.435  -83.808 -20.184 1.00 45.82  ? 478 ARG B O   1 
ATOM   7852 C CB  . ARG B 1 477 ? -0.809  -85.728 -19.489 1.00 49.33  ? 478 ARG B CB  1 
ATOM   7853 C CG  . ARG B 1 477 ? -2.017  -86.470 -18.919 1.00 48.63  ? 478 ARG B CG  1 
ATOM   7854 C CD  . ARG B 1 477 ? -2.853  -87.093 -20.026 1.00 58.00  ? 478 ARG B CD  1 
ATOM   7855 N NE  . ARG B 1 477 ? -2.029  -87.929 -20.890 1.00 57.99  ? 478 ARG B NE  1 
ATOM   7856 C CZ  . ARG B 1 477 ? -1.870  -89.238 -20.731 1.00 69.50  ? 478 ARG B CZ  1 
ATOM   7857 N NH1 . ARG B 1 477 ? -2.496  -89.869 -19.744 1.00 66.98  ? 478 ARG B NH1 1 
ATOM   7858 N NH2 . ARG B 1 477 ? -1.091  -89.917 -21.563 1.00 65.21  ? 478 ARG B NH2 1 
ATOM   7859 N N   . TYR B 1 478 ? -1.899  -82.816 -18.850 1.00 49.00  ? 479 TYR B N   1 
ATOM   7860 C CA  . TYR B 1 478 ? -2.880  -81.901 -18.219 1.00 48.49  ? 479 TYR B CA  1 
ATOM   7861 C C   . TYR B 1 478 ? -3.504  -80.978 -19.260 1.00 47.96  ? 479 TYR B C   1 
ATOM   7862 O O   . TYR B 1 478 ? -4.728  -80.782 -19.290 1.00 49.19  ? 479 TYR B O   1 
ATOM   7863 C CB  . TYR B 1 478 ? -2.234  -80.993 -17.158 1.00 46.64  ? 479 TYR B CB  1 
ATOM   7864 C CG  . TYR B 1 478 ? -1.747  -81.626 -15.862 1.00 47.96  ? 479 TYR B CG  1 
ATOM   7865 C CD1 . TYR B 1 478 ? -2.508  -82.553 -15.162 1.00 51.45  ? 479 TYR B CD1 1 
ATOM   7866 C CD2 . TYR B 1 478 ? -0.519  -81.259 -15.333 1.00 46.97  ? 479 TYR B CD2 1 
ATOM   7867 C CE1 . TYR B 1 478 ? -2.034  -83.106 -13.952 1.00 48.20  ? 479 TYR B CE1 1 
ATOM   7868 C CE2 . TYR B 1 478 ? -0.042  -81.802 -14.157 1.00 52.94  ? 479 TYR B CE2 1 
ATOM   7869 C CZ  . TYR B 1 478 ? -0.794  -82.716 -13.473 1.00 47.47  ? 479 TYR B CZ  1 
ATOM   7870 O OH  . TYR B 1 478 ? -0.274  -83.212 -12.317 1.00 51.06  ? 479 TYR B OH  1 
ATOM   7871 N N   . TRP B 1 479 ? -2.655  -80.371 -20.092 1.00 49.65  ? 480 TRP B N   1 
ATOM   7872 C CA  . TRP B 1 479 ? -3.146  -79.449 -21.133 1.00 49.40  ? 480 TRP B CA  1 
ATOM   7873 C C   . TRP B 1 479 ? -4.113  -80.132 -22.112 1.00 45.04  ? 480 TRP B C   1 
ATOM   7874 O O   . TRP B 1 479 ? -5.171  -79.578 -22.444 1.00 43.98  ? 480 TRP B O   1 
ATOM   7875 C CB  . TRP B 1 479 ? -1.981  -78.754 -21.867 1.00 42.97  ? 480 TRP B CB  1 
ATOM   7876 C CG  . TRP B 1 479 ? -1.633  -77.353 -21.338 1.00 52.07  ? 480 TRP B CG  1 
ATOM   7877 C CD1 . TRP B 1 479 ? -1.625  -76.175 -22.056 1.00 46.45  ? 480 TRP B CD1 1 
ATOM   7878 C CD2 . TRP B 1 479 ? -1.263  -76.996 -19.990 1.00 43.96  ? 480 TRP B CD2 1 
ATOM   7879 N NE1 . TRP B 1 479 ? -1.265  -75.118 -21.242 1.00 50.43  ? 480 TRP B NE1 1 
ATOM   7880 C CE2 . TRP B 1 479 ? -1.035  -75.595 -19.973 1.00 51.19  ? 480 TRP B CE2 1 
ATOM   7881 C CE3 . TRP B 1 479 ? -1.080  -77.727 -18.809 1.00 44.38  ? 480 TRP B CE3 1 
ATOM   7882 C CZ2 . TRP B 1 479 ? -0.643  -74.912 -18.813 1.00 49.23  ? 480 TRP B CZ2 1 
ATOM   7883 C CZ3 . TRP B 1 479 ? -0.693  -77.042 -17.649 1.00 50.38  ? 480 TRP B CZ3 1 
ATOM   7884 C CH2 . TRP B 1 479 ? -0.486  -75.647 -17.662 1.00 47.76  ? 480 TRP B CH2 1 
ATOM   7885 N N   . ALA B 1 480 ? -3.773  -81.344 -22.548 1.00 42.84  ? 481 ALA B N   1 
ATOM   7886 C CA  . ALA B 1 480 ? -4.629  -82.062 -23.502 1.00 46.23  ? 481 ALA B CA  1 
ATOM   7887 C C   . ALA B 1 480 ? -5.910  -82.589 -22.860 1.00 50.67  ? 481 ALA B C   1 
ATOM   7888 O O   . ALA B 1 480 ? -6.976  -82.566 -23.486 1.00 47.97  ? 481 ALA B O   1 
ATOM   7889 C CB  . ALA B 1 480 ? -3.861  -83.194 -24.178 1.00 53.26  ? 481 ALA B CB  1 
ATOM   7890 N N   . ASN B 1 481 ? -5.811  -83.049 -21.610 1.00 49.40  ? 482 ASN B N   1 
ATOM   7891 C CA  . ASN B 1 481 ? -7.006  -83.450 -20.864 1.00 51.96  ? 482 ASN B CA  1 
ATOM   7892 C C   . ASN B 1 481 ? -7.971  -82.272 -20.789 1.00 49.42  ? 482 ASN B C   1 
ATOM   7893 O O   . ASN B 1 481 ? -9.164  -82.425 -21.038 1.00 51.42  ? 482 ASN B O   1 
ATOM   7894 C CB  . ASN B 1 481 ? -6.664  -83.928 -19.440 1.00 51.14  ? 482 ASN B CB  1 
ATOM   7895 C CG  . ASN B 1 481 ? -6.087  -85.343 -19.400 1.00 57.34  ? 482 ASN B CG  1 
ATOM   7896 O OD1 . ASN B 1 481 ? -6.152  -86.096 -20.376 1.00 50.90  ? 482 ASN B OD1 1 
ATOM   7897 N ND2 . ASN B 1 481 ? -5.528  -85.711 -18.252 1.00 57.24  ? 482 ASN B ND2 1 
ATOM   7898 N N   . PHE B 1 482 ? -7.445  -81.095 -20.449 1.00 52.00  ? 483 PHE B N   1 
ATOM   7899 C CA  . PHE B 1 482 ? -8.249  -79.879 -20.453 1.00 44.60  ? 483 PHE B CA  1 
ATOM   7900 C C   . PHE B 1 482 ? -8.858  -79.604 -21.839 1.00 50.43  ? 483 PHE B C   1 
ATOM   7901 O O   . PHE B 1 482 ? -10.051 -79.312 -21.950 1.00 50.78  ? 483 PHE B O   1 
ATOM   7902 C CB  . PHE B 1 482 ? -7.444  -78.659 -19.970 1.00 43.22  ? 483 PHE B CB  1 
ATOM   7903 C CG  . PHE B 1 482 ? -8.243  -77.387 -19.990 1.00 47.86  ? 483 PHE B CG  1 
ATOM   7904 C CD1 . PHE B 1 482 ? -9.134  -77.101 -18.966 1.00 48.27  ? 483 PHE B CD1 1 
ATOM   7905 C CD2 . PHE B 1 482 ? -8.162  -76.512 -21.058 1.00 47.86  ? 483 PHE B CD2 1 
ATOM   7906 C CE1 . PHE B 1 482 ? -9.893  -75.953 -18.987 1.00 48.11  ? 483 PHE B CE1 1 
ATOM   7907 C CE2 . PHE B 1 482 ? -8.924  -75.352 -21.090 1.00 44.39  ? 483 PHE B CE2 1 
ATOM   7908 C CZ  . PHE B 1 482 ? -9.796  -75.076 -20.047 1.00 51.66  ? 483 PHE B CZ  1 
ATOM   7909 N N   . ALA B 1 483 ? -8.049  -79.689 -22.899 1.00 53.96  ? 484 ALA B N   1 
ATOM   7910 C CA  . ALA B 1 483 ? -8.581  -79.509 -24.261 1.00 45.88  ? 484 ALA B CA  1 
ATOM   7911 C C   . ALA B 1 483 ? -9.682  -80.525 -24.598 1.00 51.28  ? 484 ALA B C   1 
ATOM   7912 O O   . ALA B 1 483 ? -10.709 -80.168 -25.175 1.00 50.55  ? 484 ALA B O   1 
ATOM   7913 C CB  . ALA B 1 483 ? -7.460  -79.566 -25.301 1.00 50.46  ? 484 ALA B CB  1 
ATOM   7914 N N   . ARG B 1 484 ? -9.485  -81.790 -24.232 1.00 47.84  ? 485 ARG B N   1 
ATOM   7915 C CA  . ARG B 1 484 ? -10.516 -82.799 -24.504 1.00 51.20  ? 485 ARG B CA  1 
ATOM   7916 C C   . ARG B 1 484 ? -11.771 -82.653 -23.626 1.00 55.46  ? 485 ARG B C   1 
ATOM   7917 O O   . ARG B 1 484 ? -12.884 -82.664 -24.133 1.00 61.29  ? 485 ARG B O   1 
ATOM   7918 C CB  . ARG B 1 484 ? -9.949  -84.219 -24.385 1.00 49.51  ? 485 ARG B CB  1 
ATOM   7919 C CG  . ARG B 1 484 ? -8.835  -84.539 -25.369 1.00 54.90  ? 485 ARG B CG  1 
ATOM   7920 C CD  . ARG B 1 484 ? -8.285  -85.949 -25.158 1.00 54.37  ? 485 ARG B CD  1 
ATOM   7921 N NE  . ARG B 1 484 ? -7.371  -86.024 -24.024 1.00 52.82  ? 485 ARG B NE  1 
ATOM   7922 C CZ  . ARG B 1 484 ? -6.053  -86.121 -24.135 1.00 52.46  ? 485 ARG B CZ  1 
ATOM   7923 N NH1 . ARG B 1 484 ? -5.491  -86.170 -25.332 1.00 47.45  ? 485 ARG B NH1 1 
ATOM   7924 N NH2 . ARG B 1 484 ? -5.293  -86.179 -23.050 1.00 51.41  ? 485 ARG B NH2 1 
ATOM   7925 N N   . THR B 1 485 ? -11.599 -82.484 -22.317 1.00 55.36  ? 486 THR B N   1 
ATOM   7926 C CA  . THR B 1 485 ? -12.735 -82.621 -21.408 1.00 54.10  ? 486 THR B CA  1 
ATOM   7927 C C   . THR B 1 485 ? -13.130 -81.362 -20.635 1.00 63.19  ? 486 THR B C   1 
ATOM   7928 O O   . THR B 1 485 ? -14.186 -81.342 -19.997 1.00 54.19  ? 486 THR B O   1 
ATOM   7929 C CB  . THR B 1 485 ? -12.452 -83.687 -20.342 1.00 54.60  ? 486 THR B CB  1 
ATOM   7930 O OG1 . THR B 1 485 ? -11.576 -83.132 -19.360 1.00 53.92  ? 486 THR B OG1 1 
ATOM   7931 C CG2 . THR B 1 485 ? -11.796 -84.916 -20.956 1.00 51.19  ? 486 THR B CG2 1 
ATOM   7932 N N   . GLY B 1 486 ? -12.293 -80.328 -20.671 1.00 54.00  ? 487 GLY B N   1 
ATOM   7933 C CA  . GLY B 1 486 ? -12.538 -79.135 -19.875 1.00 47.61  ? 487 GLY B CA  1 
ATOM   7934 C C   . GLY B 1 486 ? -12.055 -79.333 -18.448 1.00 51.26  ? 487 GLY B C   1 
ATOM   7935 O O   . GLY B 1 486 ? -12.334 -78.539 -17.556 1.00 52.33  ? 487 GLY B O   1 
ATOM   7936 N N   . ASP B 1 487 ? -11.293 -80.396 -18.239 1.00 53.83  ? 488 ASP B N   1 
ATOM   7937 C CA  . ASP B 1 487 ? -10.828 -80.754 -16.907 1.00 51.33  ? 488 ASP B CA  1 
ATOM   7938 C C   . ASP B 1 487 ? -9.448  -81.367 -17.049 1.00 47.37  ? 488 ASP B C   1 
ATOM   7939 O O   . ASP B 1 487 ? -9.290  -82.368 -17.739 1.00 54.03  ? 488 ASP B O   1 
ATOM   7940 C CB  . ASP B 1 487 ? -11.796 -81.785 -16.330 1.00 56.96  ? 488 ASP B CB  1 
ATOM   7941 C CG  . ASP B 1 487 ? -11.570 -82.072 -14.855 1.00 57.92  ? 488 ASP B CG  1 
ATOM   7942 O OD1 . ASP B 1 487 ? -10.405 -82.062 -14.374 1.00 54.90  ? 488 ASP B OD1 1 
ATOM   7943 O OD2 . ASP B 1 487 ? -12.592 -82.352 -14.192 1.00 61.93  ? 488 ASP B OD2 1 
ATOM   7944 N N   . PRO B 1 488 ? -8.437  -80.768 -16.407 1.00 53.29  ? 489 PRO B N   1 
ATOM   7945 C CA  . PRO B 1 488 ? -7.070  -81.286 -16.580 1.00 51.36  ? 489 PRO B CA  1 
ATOM   7946 C C   . PRO B 1 488 ? -6.821  -82.604 -15.855 1.00 55.15  ? 489 PRO B C   1 
ATOM   7947 O O   . PRO B 1 488 ? -5.794  -83.238 -16.118 1.00 50.39  ? 489 PRO B O   1 
ATOM   7948 C CB  . PRO B 1 488 ? -6.194  -80.178 -15.977 1.00 50.56  ? 489 PRO B CB  1 
ATOM   7949 C CG  . PRO B 1 488 ? -7.076  -79.546 -14.930 1.00 50.66  ? 489 PRO B CG  1 
ATOM   7950 C CD  . PRO B 1 488 ? -8.485  -79.602 -15.502 1.00 50.59  ? 489 PRO B CD  1 
ATOM   7951 N N   . ASN B 1 489 ? -7.734  -82.999 -14.963 1.00 53.86  ? 490 ASN B N   1 
ATOM   7952 C CA  . ASN B 1 489 ? -7.559  -84.209 -14.158 1.00 55.88  ? 490 ASN B CA  1 
ATOM   7953 C C   . ASN B 1 489 ? -7.723  -85.522 -14.909 1.00 61.77  ? 490 ASN B C   1 
ATOM   7954 O O   . ASN B 1 489 ? -8.529  -85.630 -15.831 1.00 62.24  ? 490 ASN B O   1 
ATOM   7955 C CB  . ASN B 1 489 ? -8.538  -84.225 -12.989 1.00 61.40  ? 490 ASN B CB  1 
ATOM   7956 C CG  . ASN B 1 489 ? -8.232  -83.176 -11.969 1.00 52.22  ? 490 ASN B CG  1 
ATOM   7957 O OD1 . ASN B 1 489 ? -7.222  -83.258 -11.267 1.00 54.95  ? 490 ASN B OD1 1 
ATOM   7958 N ND2 . ASN B 1 489 ? -9.114  -82.178 -11.861 1.00 47.25  ? 490 ASN B ND2 1 
ATOM   7959 N N   . GLU B 1 490 ? -6.981  -86.530 -14.454 1.00 81.20  ? 491 GLU B N   1 
ATOM   7960 C CA  . GLU B 1 490 ? -6.962  -87.858 -15.075 1.00 89.30  ? 491 GLU B CA  1 
ATOM   7961 C C   . GLU B 1 490 ? -8.242  -88.679 -14.865 1.00 95.66  ? 491 GLU B C   1 
ATOM   7962 O O   . GLU B 1 490 ? -8.545  -89.094 -13.733 1.00 93.38  ? 491 GLU B O   1 
ATOM   7963 C CB  . GLU B 1 490 ? -5.740  -88.650 -14.595 1.00 86.12  ? 491 GLU B CB  1 
ATOM   7964 C CG  . GLU B 1 490 ? -4.416  -88.168 -15.177 1.00 87.45  ? 491 GLU B CG  1 
ATOM   7965 C CD  . GLU B 1 490 ? -4.159  -88.704 -16.581 1.00 86.18  ? 491 GLU B CD  1 
ATOM   7966 O OE1 . GLU B 1 490 ? -5.098  -88.725 -17.412 1.00 73.29  ? 491 GLU B OE1 1 
ATOM   7967 O OE2 . GLU B 1 490 ? -3.009  -89.119 -16.845 1.00 88.43  ? 491 GLU B OE2 1 
ATOM   7968 N N   . PRO B 1 491 ? -8.976  -88.931 -15.973 1.00 92.44  ? 492 PRO B N   1 
ATOM   7969 C CA  . PRO B 1 491 ? -10.273 -89.618 -16.024 1.00 89.29  ? 492 PRO B CA  1 
ATOM   7970 C C   . PRO B 1 491 ? -10.332 -90.881 -15.163 1.00 93.31  ? 492 PRO B C   1 
ATOM   7971 O O   . PRO B 1 491 ? -11.282 -91.025 -14.392 1.00 88.20  ? 492 PRO B O   1 
ATOM   7972 C CB  . PRO B 1 491 ? -10.405 -89.980 -17.506 1.00 84.17  ? 492 PRO B CB  1 
ATOM   7973 C CG  . PRO B 1 491 ? -9.681  -88.889 -18.207 1.00 87.02  ? 492 PRO B CG  1 
ATOM   7974 C CD  . PRO B 1 491 ? -8.514  -88.546 -17.323 1.00 84.34  ? 492 PRO B CD  1 
ATOM   7975 N N   . PRO B 1 494 ? -7.394  -91.171 -10.390 1.00 115.69 ? 495 PRO B N   1 
ATOM   7976 C CA  . PRO B 1 494 ? -7.244  -92.365 -9.548  1.00 112.55 ? 495 PRO B CA  1 
ATOM   7977 C C   . PRO B 1 494 ? -6.619  -92.061 -8.180  1.00 110.18 ? 495 PRO B C   1 
ATOM   7978 O O   . PRO B 1 494 ? -7.259  -91.438 -7.333  1.00 106.73 ? 495 PRO B O   1 
ATOM   7979 C CB  . PRO B 1 494 ? -6.316  -93.259 -10.380 1.00 112.99 ? 495 PRO B CB  1 
ATOM   7980 C CG  . PRO B 1 494 ? -5.578  -92.309 -11.330 1.00 111.35 ? 495 PRO B CG  1 
ATOM   7981 C CD  . PRO B 1 494 ? -6.212  -90.942 -11.239 1.00 106.84 ? 495 PRO B CD  1 
ATOM   7982 N N   . LYS B 1 495 ? -5.382  -92.505 -7.975  1.00 114.30 ? 496 LYS B N   1 
ATOM   7983 C CA  . LYS B 1 495 ? -4.666  -92.270 -6.722  1.00 115.01 ? 496 LYS B CA  1 
ATOM   7984 C C   . LYS B 1 495 ? -3.863  -90.969 -6.782  1.00 113.69 ? 496 LYS B C   1 
ATOM   7985 O O   . LYS B 1 495 ? -3.476  -90.414 -5.745  1.00 102.82 ? 496 LYS B O   1 
ATOM   7986 C CB  . LYS B 1 495 ? -3.744  -93.455 -6.408  1.00 119.15 ? 496 LYS B CB  1 
ATOM   7987 C CG  . LYS B 1 495 ? -4.485  -94.747 -6.059  1.00 117.86 ? 496 LYS B CG  1 
ATOM   7988 C CD  . LYS B 1 495 ? -3.608  -95.983 -6.241  1.00 117.09 ? 496 LYS B CD  1 
ATOM   7989 C CE  . LYS B 1 495 ? -3.337  -96.265 -7.715  1.00 117.16 ? 496 LYS B CE  1 
ATOM   7990 N NZ  . LYS B 1 495 ? -2.553  -97.516 -7.920  1.00 110.44 ? 496 LYS B NZ  1 
ATOM   7991 N N   . ALA B 1 496 ? -3.624  -90.497 -8.007  1.00 112.67 ? 497 ALA B N   1 
ATOM   7992 C CA  . ALA B 1 496 ? -2.924  -89.234 -8.259  1.00 108.87 ? 497 ALA B CA  1 
ATOM   7993 C C   . ALA B 1 496 ? -3.670  -88.038 -7.657  1.00 94.97  ? 497 ALA B C   1 
ATOM   7994 O O   . ALA B 1 496 ? -4.904  -87.983 -7.715  1.00 89.21  ? 497 ALA B O   1 
ATOM   7995 C CB  . ALA B 1 496 ? -2.718  -89.034 -9.764  1.00 94.60  ? 497 ALA B CB  1 
ATOM   7996 N N   . PRO B 1 497 ? -2.920  -87.078 -7.077  1.00 93.86  ? 498 PRO B N   1 
ATOM   7997 C CA  . PRO B 1 497 ? -3.514  -85.894 -6.432  1.00 88.37  ? 498 PRO B CA  1 
ATOM   7998 C C   . PRO B 1 497 ? -4.367  -85.077 -7.401  1.00 75.71  ? 498 PRO B C   1 
ATOM   7999 O O   . PRO B 1 497 ? -4.001  -84.904 -8.567  1.00 78.50  ? 498 PRO B O   1 
ATOM   8000 C CB  . PRO B 1 497 ? -2.297  -85.090 -5.955  1.00 77.94  ? 498 PRO B CB  1 
ATOM   8001 C CG  . PRO B 1 497 ? -1.145  -85.611 -6.737  1.00 80.65  ? 498 PRO B CG  1 
ATOM   8002 C CD  . PRO B 1 497 ? -1.448  -87.049 -7.040  1.00 86.81  ? 498 PRO B CD  1 
ATOM   8003 N N   . GLN B 1 498 ? -5.512  -84.608 -6.921  1.00 68.50  ? 499 GLN B N   1 
ATOM   8004 C CA  . GLN B 1 498 ? -6.485  -83.949 -7.776  1.00 59.94  ? 499 GLN B CA  1 
ATOM   8005 C C   . GLN B 1 498 ? -6.252  -82.449 -7.812  1.00 64.27  ? 499 GLN B C   1 
ATOM   8006 O O   . GLN B 1 498 ? -5.839  -81.847 -6.827  1.00 55.00  ? 499 GLN B O   1 
ATOM   8007 C CB  . GLN B 1 498 ? -7.921  -84.242 -7.315  1.00 60.36  ? 499 GLN B CB  1 
ATOM   8008 C CG  . GLN B 1 498 ? -8.423  -85.649 -7.641  1.00 67.80  ? 499 GLN B CG  1 
ATOM   8009 C CD  . GLN B 1 498 ? -8.360  -85.970 -9.129  1.00 78.71  ? 499 GLN B CD  1 
ATOM   8010 O OE1 . GLN B 1 498 ? -9.203  -85.514 -9.911  1.00 76.77  ? 499 GLN B OE1 1 
ATOM   8011 N NE2 . GLN B 1 498 ? -7.356  -86.753 -9.529  1.00 69.73  ? 499 GLN B NE2 1 
ATOM   8012 N N   . TRP B 1 499 ? -6.527  -81.858 -8.966  1.00 55.35  ? 500 TRP B N   1 
ATOM   8013 C CA  . TRP B 1 499 ? -6.406  -80.429 -9.161  1.00 49.96  ? 500 TRP B CA  1 
ATOM   8014 C C   . TRP B 1 499 ? -7.814  -79.830 -9.017  1.00 53.69  ? 500 TRP B C   1 
ATOM   8015 O O   . TRP B 1 499 ? -8.687  -80.058 -9.859  1.00 52.98  ? 500 TRP B O   1 
ATOM   8016 C CB  . TRP B 1 499 ? -5.786  -80.201 -10.548 1.00 55.29  ? 500 TRP B CB  1 
ATOM   8017 C CG  . TRP B 1 499 ? -5.512  -78.795 -10.977 1.00 48.19  ? 500 TRP B CG  1 
ATOM   8018 C CD1 . TRP B 1 499 ? -6.017  -77.647 -10.439 1.00 52.88  ? 500 TRP B CD1 1 
ATOM   8019 C CD2 . TRP B 1 499 ? -4.672  -78.393 -12.069 1.00 54.75  ? 500 TRP B CD2 1 
ATOM   8020 N NE1 . TRP B 1 499 ? -5.535  -76.554 -11.119 1.00 54.69  ? 500 TRP B NE1 1 
ATOM   8021 C CE2 . TRP B 1 499 ? -4.714  -76.985 -12.130 1.00 53.70  ? 500 TRP B CE2 1 
ATOM   8022 C CE3 . TRP B 1 499 ? -3.890  -79.091 -13.005 1.00 49.73  ? 500 TRP B CE3 1 
ATOM   8023 C CZ2 . TRP B 1 499 ? -3.991  -76.255 -13.080 1.00 44.12  ? 500 TRP B CZ2 1 
ATOM   8024 C CZ3 . TRP B 1 499 ? -3.179  -78.365 -13.954 1.00 51.29  ? 500 TRP B CZ3 1 
ATOM   8025 C CH2 . TRP B 1 499 ? -3.231  -76.966 -13.982 1.00 52.21  ? 500 TRP B CH2 1 
ATOM   8026 N N   . PRO B 1 500 ? -8.058  -79.105 -7.909  1.00 48.98  ? 501 PRO B N   1 
ATOM   8027 C CA  . PRO B 1 500 ? -9.386  -78.539 -7.658  1.00 47.18  ? 501 PRO B CA  1 
ATOM   8028 C C   . PRO B 1 500 ? -9.596  -77.241 -8.426  1.00 50.06  ? 501 PRO B C   1 
ATOM   8029 O O   . PRO B 1 500 ? -8.626  -76.541 -8.701  1.00 47.35  ? 501 PRO B O   1 
ATOM   8030 C CB  . PRO B 1 500 ? -9.361  -78.253 -6.144  1.00 50.15  ? 501 PRO B CB  1 
ATOM   8031 C CG  . PRO B 1 500 ? -7.953  -78.033 -5.837  1.00 45.17  ? 501 PRO B CG  1 
ATOM   8032 C CD  . PRO B 1 500 ? -7.167  -78.939 -6.749  1.00 51.99  ? 501 PRO B CD  1 
ATOM   8033 N N   . PRO B 1 501 ? -10.852 -76.939 -8.776  1.00 46.65  ? 502 PRO B N   1 
ATOM   8034 C CA  . PRO B 1 501 ? -11.261 -75.672 -9.388  1.00 45.96  ? 502 PRO B CA  1 
ATOM   8035 C C   . PRO B 1 501 ? -10.929 -74.442 -8.544  1.00 55.16  ? 502 PRO B C   1 
ATOM   8036 O O   . PRO B 1 501 ? -10.893 -74.497 -7.312  1.00 50.92  ? 502 PRO B O   1 
ATOM   8037 C CB  . PRO B 1 501 ? -12.777 -75.825 -9.536  1.00 45.60  ? 502 PRO B CB  1 
ATOM   8038 C CG  . PRO B 1 501 ? -12.975 -77.298 -9.671  1.00 50.89  ? 502 PRO B CG  1 
ATOM   8039 C CD  . PRO B 1 501 ? -11.952 -77.919 -8.752  1.00 43.14  ? 502 PRO B CD  1 
ATOM   8040 N N   . TYR B 1 502 ? -10.679 -73.330 -9.227  1.00 49.91  ? 503 TYR B N   1 
ATOM   8041 C CA  . TYR B 1 502 ? -10.403 -72.071 -8.560  1.00 52.25  ? 503 TYR B CA  1 
ATOM   8042 C C   . TYR B 1 502 ? -11.731 -71.373 -8.319  1.00 53.65  ? 503 TYR B C   1 
ATOM   8043 O O   . TYR B 1 502 ? -12.582 -71.343 -9.201  1.00 50.42  ? 503 TYR B O   1 
ATOM   8044 C CB  . TYR B 1 502 ? -9.467  -71.205 -9.420  1.00 48.32  ? 503 TYR B CB  1 
ATOM   8045 C CG  . TYR B 1 502 ? -9.104  -69.873 -8.800  1.00 41.60  ? 503 TYR B CG  1 
ATOM   8046 C CD1 . TYR B 1 502 ? -9.927  -68.767 -8.977  1.00 48.84  ? 503 TYR B CD1 1 
ATOM   8047 C CD2 . TYR B 1 502 ? -7.955  -69.725 -8.028  1.00 40.38  ? 503 TYR B CD2 1 
ATOM   8048 C CE1 . TYR B 1 502 ? -9.630  -67.541 -8.401  1.00 43.67  ? 503 TYR B CE1 1 
ATOM   8049 C CE2 . TYR B 1 502 ? -7.638  -68.487 -7.445  1.00 48.76  ? 503 TYR B CE2 1 
ATOM   8050 C CZ  . TYR B 1 502 ? -8.489  -67.397 -7.651  1.00 43.99  ? 503 TYR B CZ  1 
ATOM   8051 O OH  . TYR B 1 502 ? -8.219  -66.161 -7.116  1.00 49.89  ? 503 TYR B OH  1 
ATOM   8052 N N   . THR B 1 503 ? -11.923 -70.832 -7.115  1.00 45.44  ? 504 THR B N   1 
ATOM   8053 C CA  . THR B 1 503 ? -13.147 -70.102 -6.803  1.00 51.12  ? 504 THR B CA  1 
ATOM   8054 C C   . THR B 1 503 ? -12.771 -68.803 -6.103  1.00 47.40  ? 504 THR B C   1 
ATOM   8055 O O   . THR B 1 503 ? -11.695 -68.704 -5.520  1.00 54.91  ? 504 THR B O   1 
ATOM   8056 C CB  . THR B 1 503 ? -14.085 -70.938 -5.882  1.00 60.55  ? 504 THR B CB  1 
ATOM   8057 O OG1 . THR B 1 503 ? -13.374 -71.313 -4.697  1.00 49.63  ? 504 THR B OG1 1 
ATOM   8058 C CG2 . THR B 1 503 ? -14.549 -72.214 -6.592  1.00 51.96  ? 504 THR B CG2 1 
ATOM   8059 N N   . ALA B 1 504 ? -13.654 -67.811 -6.152  1.00 53.50  ? 505 ALA B N   1 
ATOM   8060 C CA  . ALA B 1 504 ? -13.373 -66.511 -5.549  1.00 51.10  ? 505 ALA B CA  1 
ATOM   8061 C C   . ALA B 1 504 ? -13.141 -66.560 -4.027  1.00 53.74  ? 505 ALA B C   1 
ATOM   8062 O O   . ALA B 1 504 ? -12.402 -65.733 -3.487  1.00 56.19  ? 505 ALA B O   1 
ATOM   8063 C CB  . ALA B 1 504 ? -14.491 -65.512 -5.898  1.00 51.22  ? 505 ALA B CB  1 
ATOM   8064 N N   . GLY B 1 505 ? -13.746 -67.533 -3.343  1.00 55.70  ? 506 GLY B N   1 
ATOM   8065 C CA  . GLY B 1 505 ? -13.575 -67.676 -1.895  1.00 48.52  ? 506 GLY B CA  1 
ATOM   8066 C C   . GLY B 1 505 ? -12.378 -68.522 -1.479  1.00 50.17  ? 506 GLY B C   1 
ATOM   8067 O O   . GLY B 1 505 ? -11.414 -68.016 -0.912  1.00 53.87  ? 506 GLY B O   1 
ATOM   8068 N N   . ALA B 1 506 ? -12.417 -69.818 -1.764  1.00 47.69  ? 507 ALA B N   1 
ATOM   8069 C CA  . ALA B 1 506 ? -11.274 -70.669 -1.444  1.00 44.17  ? 507 ALA B CA  1 
ATOM   8070 C C   . ALA B 1 506 ? -9.978  -70.324 -2.237  1.00 50.66  ? 507 ALA B C   1 
ATOM   8071 O O   . ALA B 1 506 ? -8.864  -70.523 -1.736  1.00 47.57  ? 507 ALA B O   1 
ATOM   8072 C CB  . ALA B 1 506 ? -11.655 -72.154 -1.595  1.00 42.20  ? 507 ALA B CB  1 
ATOM   8073 N N   . GLN B 1 507 ? -10.120 -69.810 -3.464  1.00 52.57  ? 508 GLN B N   1 
ATOM   8074 C CA  . GLN B 1 507 ? -8.956  -69.342 -4.236  1.00 50.06  ? 508 GLN B CA  1 
ATOM   8075 C C   . GLN B 1 507 ? -7.845  -70.403 -4.369  1.00 46.27  ? 508 GLN B C   1 
ATOM   8076 O O   . GLN B 1 507 ? -6.657  -70.092 -4.245  1.00 44.72  ? 508 GLN B O   1 
ATOM   8077 C CB  . GLN B 1 507 ? -8.374  -68.057 -3.607  1.00 48.11  ? 508 GLN B CB  1 
ATOM   8078 C CG  . GLN B 1 507 ? -9.329  -66.818 -3.581  1.00 45.71  ? 508 GLN B CG  1 
ATOM   8079 C CD  . GLN B 1 507 ? -8.829  -65.719 -2.618  1.00 57.14  ? 508 GLN B CD  1 
ATOM   8080 O OE1 . GLN B 1 507 ? -7.760  -65.133 -2.817  1.00 47.43  ? 508 GLN B OE1 1 
ATOM   8081 N NE2 . GLN B 1 507 ? -9.593  -65.464 -1.555  1.00 56.69  ? 508 GLN B NE2 1 
ATOM   8082 N N   . GLN B 1 508 ? -8.226  -71.655 -4.602  1.00 38.79  ? 509 GLN B N   1 
ATOM   8083 C CA  . GLN B 1 508 ? -7.242  -72.739 -4.618  1.00 43.50  ? 509 GLN B CA  1 
ATOM   8084 C C   . GLN B 1 508 ? -6.521  -72.873 -5.975  1.00 52.43  ? 509 GLN B C   1 
ATOM   8085 O O   . GLN B 1 508 ? -7.162  -72.830 -7.008  1.00 40.52  ? 509 GLN B O   1 
ATOM   8086 C CB  . GLN B 1 508 ? -7.946  -74.062 -4.326  1.00 46.55  ? 509 GLN B CB  1 
ATOM   8087 C CG  . GLN B 1 508 ? -8.499  -74.220 -2.896  1.00 57.68  ? 509 GLN B CG  1 
ATOM   8088 C CD  . GLN B 1 508 ? -9.335  -75.486 -2.759  1.00 53.08  ? 509 GLN B CD  1 
ATOM   8089 O OE1 . GLN B 1 508 ? -10.484 -75.541 -3.208  1.00 55.98  ? 509 GLN B OE1 1 
ATOM   8090 N NE2 . GLN B 1 508 ? -8.747  -76.516 -2.183  1.00 55.46  ? 509 GLN B NE2 1 
ATOM   8091 N N   . TYR B 1 509 ? -5.206  -73.083 -5.960  1.00 43.53  ? 510 TYR B N   1 
ATOM   8092 C CA  . TYR B 1 509 ? -4.442  -73.353 -7.182  1.00 53.66  ? 510 TYR B CA  1 
ATOM   8093 C C   . TYR B 1 509 ? -3.408  -74.466 -6.894  1.00 55.33  ? 510 TYR B C   1 
ATOM   8094 O O   . TYR B 1 509 ? -3.175  -74.802 -5.729  1.00 47.27  ? 510 TYR B O   1 
ATOM   8095 C CB  . TYR B 1 509 ? -3.753  -72.064 -7.663  1.00 44.73  ? 510 TYR B CB  1 
ATOM   8096 C CG  . TYR B 1 509 ? -2.707  -71.541 -6.701  1.00 49.54  ? 510 TYR B CG  1 
ATOM   8097 C CD1 . TYR B 1 509 ? -3.051  -70.676 -5.654  1.00 47.85  ? 510 TYR B CD1 1 
ATOM   8098 C CD2 . TYR B 1 509 ? -1.375  -71.921 -6.828  1.00 45.77  ? 510 TYR B CD2 1 
ATOM   8099 C CE1 . TYR B 1 509 ? -2.081  -70.204 -4.766  1.00 44.59  ? 510 TYR B CE1 1 
ATOM   8100 C CE2 . TYR B 1 509 ? -0.408  -71.460 -5.955  1.00 52.77  ? 510 TYR B CE2 1 
ATOM   8101 C CZ  . TYR B 1 509 ? -0.764  -70.601 -4.924  1.00 55.38  ? 510 TYR B CZ  1 
ATOM   8102 O OH  . TYR B 1 509 ? 0.211   -70.152 -4.062  1.00 52.79  ? 510 TYR B OH  1 
ATOM   8103 N N   . VAL B 1 510 ? -2.802  -75.047 -7.930  1.00 46.87  ? 511 VAL B N   1 
ATOM   8104 C CA  . VAL B 1 510 ? -1.714  -76.024 -7.723  1.00 42.44  ? 511 VAL B CA  1 
ATOM   8105 C C   . VAL B 1 510 ? -0.323  -75.533 -8.146  1.00 46.12  ? 511 VAL B C   1 
ATOM   8106 O O   . VAL B 1 510 ? -0.183  -74.706 -9.052  1.00 48.74  ? 511 VAL B O   1 
ATOM   8107 C CB  . VAL B 1 510 ? -1.954  -77.358 -8.471  1.00 44.22  ? 511 VAL B CB  1 
ATOM   8108 C CG1 . VAL B 1 510 ? -3.193  -78.049 -7.954  1.00 45.50  ? 511 VAL B CG1 1 
ATOM   8109 C CG2 . VAL B 1 510 ? -2.030  -77.120 -10.026 1.00 44.81  ? 511 VAL B CG2 1 
ATOM   8110 N N   . SER B 1 511 ? 0.704   -76.069 -7.494  1.00 45.63  ? 512 SER B N   1 
ATOM   8111 C CA  . SER B 1 511 ? 2.085   -75.808 -7.876  1.00 45.53  ? 512 SER B CA  1 
ATOM   8112 C C   . SER B 1 511 ? 2.548   -76.844 -8.914  1.00 53.49  ? 512 SER B C   1 
ATOM   8113 O O   . SER B 1 511 ? 2.384   -78.050 -8.720  1.00 45.71  ? 512 SER B O   1 
ATOM   8114 C CB  . SER B 1 511 ? 2.991   -75.841 -6.646  1.00 48.03  ? 512 SER B CB  1 
ATOM   8115 O OG  . SER B 1 511 ? 2.918   -77.103 -6.010  1.00 57.12  ? 512 SER B OG  1 
ATOM   8116 N N   . LEU B 1 512 ? 3.086   -76.364 -10.033 1.00 41.92  ? 513 LEU B N   1 
ATOM   8117 C CA  . LEU B 1 512 ? 3.596   -77.244 -11.073 1.00 41.58  ? 513 LEU B CA  1 
ATOM   8118 C C   . LEU B 1 512 ? 5.109   -77.282 -10.985 1.00 44.78  ? 513 LEU B C   1 
ATOM   8119 O O   . LEU B 1 512 ? 5.778   -76.303 -11.315 1.00 48.90  ? 513 LEU B O   1 
ATOM   8120 C CB  . LEU B 1 512 ? 3.162   -76.750 -12.463 1.00 39.02  ? 513 LEU B CB  1 
ATOM   8121 C CG  . LEU B 1 512 ? 1.666   -76.805 -12.734 1.00 43.01  ? 513 LEU B CG  1 
ATOM   8122 C CD1 . LEU B 1 512 ? 1.334   -76.327 -14.150 1.00 47.43  ? 513 LEU B CD1 1 
ATOM   8123 C CD2 . LEU B 1 512 ? 1.166   -78.230 -12.494 1.00 42.50  ? 513 LEU B CD2 1 
ATOM   8124 N N   . ASP B 1 513 ? 5.642   -78.399 -10.500 1.00 49.25  ? 514 ASP B N   1 
ATOM   8125 C CA  . ASP B 1 513 ? 7.090   -78.632 -10.490 1.00 52.75  ? 514 ASP B CA  1 
ATOM   8126 C C   . ASP B 1 513 ? 7.415   -80.135 -10.524 1.00 44.84  ? 514 ASP B C   1 
ATOM   8127 O O   . ASP B 1 513 ? 6.544   -80.952 -10.805 1.00 50.91  ? 514 ASP B O   1 
ATOM   8128 C CB  . ASP B 1 513 ? 7.799   -77.899 -9.325  1.00 51.86  ? 514 ASP B CB  1 
ATOM   8129 C CG  . ASP B 1 513 ? 7.258   -78.283 -7.949  1.00 61.67  ? 514 ASP B CG  1 
ATOM   8130 O OD1 . ASP B 1 513 ? 6.605   -79.340 -7.827  1.00 62.91  ? 514 ASP B OD1 1 
ATOM   8131 O OD2 . ASP B 1 513 ? 7.492   -77.522 -6.977  1.00 73.15  ? 514 ASP B OD2 1 
ATOM   8132 N N   . LEU B 1 514 ? 8.659   -80.492 -10.236 1.00 46.40  ? 515 LEU B N   1 
ATOM   8133 C CA  . LEU B 1 514 ? 9.081   -81.898 -10.254 1.00 50.77  ? 515 LEU B CA  1 
ATOM   8134 C C   . LEU B 1 514 ? 8.386   -82.785 -9.198  1.00 60.73  ? 515 LEU B C   1 
ATOM   8135 O O   . LEU B 1 514 ? 8.339   -84.004 -9.359  1.00 66.26  ? 515 LEU B O   1 
ATOM   8136 C CB  . LEU B 1 514 ? 10.616  -82.008 -10.126 1.00 47.71  ? 515 LEU B CB  1 
ATOM   8137 C CG  . LEU B 1 514 ? 11.439  -81.281 -11.197 1.00 51.75  ? 515 LEU B CG  1 
ATOM   8138 C CD1 . LEU B 1 514 ? 12.954  -81.517 -11.039 1.00 45.76  ? 515 LEU B CD1 1 
ATOM   8139 C CD2 . LEU B 1 514 ? 10.961  -81.672 -12.607 1.00 49.97  ? 515 LEU B CD2 1 
ATOM   8140 N N   . ARG B 1 515 ? 7.859   -82.174 -8.132  1.00 54.48  ? 516 ARG B N   1 
ATOM   8141 C CA  . ARG B 1 515 ? 7.090   -82.880 -7.096  1.00 56.94  ? 516 ARG B CA  1 
ATOM   8142 C C   . ARG B 1 515 ? 5.647   -83.043 -7.553  1.00 56.84  ? 516 ARG B C   1 
ATOM   8143 O O   . ARG B 1 515 ? 5.236   -82.382 -8.503  1.00 53.19  ? 516 ARG B O   1 
ATOM   8144 C CB  . ARG B 1 515 ? 7.107   -82.084 -5.781  1.00 51.55  ? 516 ARG B CB  1 
ATOM   8145 C CG  . ARG B 1 515 ? 8.488   -81.822 -5.191  1.00 61.57  ? 516 ARG B CG  1 
ATOM   8146 C CD  . ARG B 1 515 ? 8.406   -80.854 -3.992  1.00 71.20  ? 516 ARG B CD  1 
ATOM   8147 N NE  . ARG B 1 515 ? 7.750   -79.593 -4.353  1.00 82.07  ? 516 ARG B NE  1 
ATOM   8148 C CZ  . ARG B 1 515 ? 6.578   -79.179 -3.870  1.00 82.43  ? 516 ARG B CZ  1 
ATOM   8149 N NH1 . ARG B 1 515 ? 5.925   -79.913 -2.975  1.00 86.93  ? 516 ARG B NH1 1 
ATOM   8150 N NH2 . ARG B 1 515 ? 6.061   -78.022 -4.269  1.00 78.45  ? 516 ARG B NH2 1 
ATOM   8151 N N   . PRO B 1 516 ? 4.862   -83.910 -6.873  1.00 58.67  ? 517 PRO B N   1 
ATOM   8152 C CA  . PRO B 1 516 ? 3.437   -84.066 -7.222  1.00 54.52  ? 517 PRO B CA  1 
ATOM   8153 C C   . PRO B 1 516 ? 2.645   -82.796 -6.918  1.00 62.49  ? 517 PRO B C   1 
ATOM   8154 O O   . PRO B 1 516 ? 3.149   -81.979 -6.148  1.00 55.93  ? 517 PRO B O   1 
ATOM   8155 C CB  . PRO B 1 516 ? 2.961   -85.196 -6.290  1.00 54.93  ? 517 PRO B CB  1 
ATOM   8156 C CG  . PRO B 1 516 ? 4.202   -85.915 -5.881  1.00 56.12  ? 517 PRO B CG  1 
ATOM   8157 C CD  . PRO B 1 516 ? 5.279   -84.868 -5.830  1.00 56.20  ? 517 PRO B CD  1 
ATOM   8158 N N   . LEU B 1 517 ? 1.448   -82.632 -7.495  1.00 52.15  ? 518 LEU B N   1 
ATOM   8159 C CA  . LEU B 1 517 ? 0.624   -81.450 -7.220  1.00 55.86  ? 518 LEU B CA  1 
ATOM   8160 C C   . LEU B 1 517 ? 0.484   -81.155 -5.727  1.00 62.43  ? 518 LEU B C   1 
ATOM   8161 O O   . LEU B 1 517 ? 0.181   -82.039 -4.937  1.00 54.82  ? 518 LEU B O   1 
ATOM   8162 C CB  . LEU B 1 517 ? -0.780  -81.603 -7.790  1.00 55.80  ? 518 LEU B CB  1 
ATOM   8163 C CG  . LEU B 1 517 ? -0.920  -81.807 -9.289  1.00 56.70  ? 518 LEU B CG  1 
ATOM   8164 C CD1 . LEU B 1 517 ? -2.392  -81.954 -9.633  1.00 57.69  ? 518 LEU B CD1 1 
ATOM   8165 C CD2 . LEU B 1 517 ? -0.272  -80.650 -10.049 1.00 49.02  ? 518 LEU B CD2 1 
ATOM   8166 N N   . GLU B 1 518 ? 0.704   -79.901 -5.360  1.00 57.77  ? 519 GLU B N   1 
ATOM   8167 C CA  . GLU B 1 518 ? 0.410   -79.435 -4.012  1.00 56.12  ? 519 GLU B CA  1 
ATOM   8168 C C   . GLU B 1 518 ? -0.613  -78.307 -4.139  1.00 62.65  ? 519 GLU B C   1 
ATOM   8169 O O   . GLU B 1 518 ? -0.410  -77.361 -4.907  1.00 57.18  ? 519 GLU B O   1 
ATOM   8170 C CB  . GLU B 1 518 ? 1.688   -78.961 -3.320  1.00 48.94  ? 519 GLU B CB  1 
ATOM   8171 C CG  . GLU B 1 518 ? 1.449   -78.155 -2.048  1.00 72.51  ? 519 GLU B CG  1 
ATOM   8172 C CD  . GLU B 1 518 ? 2.680   -77.375 -1.612  1.00 81.67  ? 519 GLU B CD  1 
ATOM   8173 O OE1 . GLU B 1 518 ? 3.736   -77.527 -2.265  1.00 88.78  ? 519 GLU B OE1 1 
ATOM   8174 O OE2 . GLU B 1 518 ? 2.591   -76.608 -0.625  1.00 86.48  ? 519 GLU B OE2 1 
ATOM   8175 N N   . VAL B 1 519 ? -1.729  -78.431 -3.424  1.00 54.03  ? 520 VAL B N   1 
ATOM   8176 C CA  . VAL B 1 519 ? -2.784  -77.423 -3.456  1.00 49.75  ? 520 VAL B CA  1 
ATOM   8177 C C   . VAL B 1 519 ? -2.476  -76.269 -2.504  1.00 53.42  ? 520 VAL B C   1 
ATOM   8178 O O   . VAL B 1 519 ? -2.147  -76.501 -1.346  1.00 58.54  ? 520 VAL B O   1 
ATOM   8179 C CB  . VAL B 1 519 ? -4.124  -78.036 -3.060  1.00 53.33  ? 520 VAL B CB  1 
ATOM   8180 C CG1 . VAL B 1 519 ? -5.232  -76.986 -3.106  1.00 48.79  ? 520 VAL B CG1 1 
ATOM   8181 C CG2 . VAL B 1 519 ? -4.445  -79.226 -3.963  1.00 44.33  ? 520 VAL B CG2 1 
ATOM   8182 N N   . ARG B 1 520 ? -2.571  -75.030 -2.986  1.00 50.27  ? 521 ARG B N   1 
ATOM   8183 C CA  . ARG B 1 520 ? -2.401  -73.861 -2.119  1.00 53.01  ? 521 ARG B CA  1 
ATOM   8184 C C   . ARG B 1 520 ? -3.554  -72.873 -2.281  1.00 51.12  ? 521 ARG B C   1 
ATOM   8185 O O   . ARG B 1 520 ? -4.418  -73.068 -3.124  1.00 55.00  ? 521 ARG B O   1 
ATOM   8186 C CB  . ARG B 1 520 ? -1.061  -73.176 -2.377  1.00 47.81  ? 521 ARG B CB  1 
ATOM   8187 C CG  . ARG B 1 520 ? 0.127   -74.119 -2.298  1.00 53.31  ? 521 ARG B CG  1 
ATOM   8188 C CD  . ARG B 1 520 ? 1.381   -73.430 -2.778  1.00 55.43  ? 521 ARG B CD  1 
ATOM   8189 N NE  . ARG B 1 520 ? 2.499   -74.357 -2.865  1.00 57.53  ? 521 ARG B NE  1 
ATOM   8190 C CZ  . ARG B 1 520 ? 3.633   -74.098 -3.509  1.00 56.68  ? 521 ARG B CZ  1 
ATOM   8191 N NH1 . ARG B 1 520 ? 3.805   -72.932 -4.124  1.00 59.58  ? 521 ARG B NH1 1 
ATOM   8192 N NH2 . ARG B 1 520 ? 4.599   -75.007 -3.536  1.00 65.66  ? 521 ARG B NH2 1 
ATOM   8193 N N   . ARG B 1 521 ? -3.574  -71.819 -1.468  1.00 46.19  ? 522 ARG B N   1 
ATOM   8194 C CA  . ARG B 1 521 ? -4.669  -70.848 -1.506  1.00 51.78  ? 522 ARG B CA  1 
ATOM   8195 C C   . ARG B 1 521 ? -4.162  -69.439 -1.761  1.00 50.93  ? 522 ARG B C   1 
ATOM   8196 O O   . ARG B 1 521 ? -3.183  -69.006 -1.152  1.00 46.84  ? 522 ARG B O   1 
ATOM   8197 C CB  . ARG B 1 521 ? -5.461  -70.837 -0.187  1.00 53.77  ? 522 ARG B CB  1 
ATOM   8198 C CG  . ARG B 1 521 ? -6.423  -71.996 0.032   1.00 57.08  ? 522 ARG B CG  1 
ATOM   8199 C CD  . ARG B 1 521 ? -7.367  -71.705 1.225   1.00 49.85  ? 522 ARG B CD  1 
ATOM   8200 N NE  . ARG B 1 521 ? -8.251  -70.590 0.895   1.00 48.12  ? 522 ARG B NE  1 
ATOM   8201 C CZ  . ARG B 1 521 ? -8.578  -69.603 1.723   1.00 55.25  ? 522 ARG B CZ  1 
ATOM   8202 N NH1 . ARG B 1 521 ? -8.125  -69.590 2.977   1.00 53.80  ? 522 ARG B NH1 1 
ATOM   8203 N NH2 . ARG B 1 521 ? -9.376  -68.632 1.296   1.00 49.20  ? 522 ARG B NH2 1 
ATOM   8204 N N   . GLY B 1 522 ? -4.845  -68.722 -2.652  1.00 49.66  ? 523 GLY B N   1 
ATOM   8205 C CA  . GLY B 1 522 ? -4.564  -67.317 -2.878  1.00 48.21  ? 523 GLY B CA  1 
ATOM   8206 C C   . GLY B 1 522 ? -3.446  -67.003 -3.859  1.00 54.12  ? 523 GLY B C   1 
ATOM   8207 O O   . GLY B 1 522 ? -2.278  -67.308 -3.610  1.00 56.12  ? 523 GLY B O   1 
ATOM   8208 N N   . LEU B 1 523 ? -3.806  -66.383 -4.983  1.00 46.78  ? 524 LEU B N   1 
ATOM   8209 C CA  . LEU B 1 523 ? -2.810  -65.875 -5.922  1.00 56.61  ? 524 LEU B CA  1 
ATOM   8210 C C   . LEU B 1 523 ? -2.341  -64.486 -5.459  1.00 50.14  ? 524 LEU B C   1 
ATOM   8211 O O   . LEU B 1 523 ? -2.876  -63.468 -5.915  1.00 46.76  ? 524 LEU B O   1 
ATOM   8212 C CB  . LEU B 1 523 ? -3.391  -65.808 -7.342  1.00 48.37  ? 524 LEU B CB  1 
ATOM   8213 C CG  . LEU B 1 523 ? -3.768  -67.139 -8.011  1.00 50.97  ? 524 LEU B CG  1 
ATOM   8214 C CD1 . LEU B 1 523 ? -4.562  -66.915 -9.296  1.00 44.25  ? 524 LEU B CD1 1 
ATOM   8215 C CD2 . LEU B 1 523 ? -2.535  -67.983 -8.283  1.00 49.21  ? 524 LEU B CD2 1 
ATOM   8216 N N   A ARG B 1 524 ? -1.343  -64.445 -4.575  0.63 47.37  ? 525 ARG B N   1 
ATOM   8217 N N   B ARG B 1 524 ? -1.356  -64.475 -4.560  0.37 47.44  ? 525 ARG B N   1 
ATOM   8218 C CA  A ARG B 1 524 ? -0.872  -63.185 -3.984  0.63 48.87  ? 525 ARG B CA  1 
ATOM   8219 C CA  B ARG B 1 524 ? -0.860  -63.252 -3.928  0.37 48.87  ? 525 ARG B CA  1 
ATOM   8220 C C   A ARG B 1 524 ? -2.053  -62.338 -3.490  0.63 49.67  ? 525 ARG B C   1 
ATOM   8221 C C   B ARG B 1 524 ? -2.022  -62.357 -3.475  0.37 49.63  ? 525 ARG B C   1 
ATOM   8222 O O   A ARG B 1 524 ? -2.205  -61.171 -3.880  0.63 45.36  ? 525 ARG B O   1 
ATOM   8223 O O   B ARG B 1 524 ? -2.125  -61.190 -3.866  0.37 45.49  ? 525 ARG B O   1 
ATOM   8224 C CB  A ARG B 1 524 ? -0.048  -62.381 -5.000  0.63 50.57  ? 525 ARG B CB  1 
ATOM   8225 C CB  B ARG B 1 524 ? 0.122   -62.521 -4.858  0.37 50.40  ? 525 ARG B CB  1 
ATOM   8226 C CG  A ARG B 1 524 ? 1.144   -63.121 -5.597  0.63 45.28  ? 525 ARG B CG  1 
ATOM   8227 C CG  B ARG B 1 524 ? 1.328   -63.389 -5.243  0.37 45.82  ? 525 ARG B CG  1 
ATOM   8228 C CD  A ARG B 1 524 ? 2.395   -62.920 -4.773  0.63 47.51  ? 525 ARG B CD  1 
ATOM   8229 C CD  B ARG B 1 524 ? 2.398   -62.651 -6.051  0.37 43.53  ? 525 ARG B CD  1 
ATOM   8230 N NE  A ARG B 1 524 ? 2.739   -61.507 -4.623  0.63 54.55  ? 525 ARG B NE  1 
ATOM   8231 N NE  B ARG B 1 524 ? 3.634   -63.432 -6.111  0.37 50.06  ? 525 ARG B NE  1 
ATOM   8232 C CZ  A ARG B 1 524 ? 3.559   -61.040 -3.684  0.63 53.59  ? 525 ARG B CZ  1 
ATOM   8233 C CZ  B ARG B 1 524 ? 4.812   -62.970 -6.522  0.37 51.16  ? 525 ARG B CZ  1 
ATOM   8234 N NH1 A ARG B 1 524 ? 4.114   -61.878 -2.819  0.63 45.54  ? 525 ARG B NH1 1 
ATOM   8235 N NH1 B ARG B 1 524 ? 4.936   -61.712 -6.932  0.37 47.29  ? 525 ARG B NH1 1 
ATOM   8236 N NH2 A ARG B 1 524 ? 3.818   -59.741 -3.606  0.63 40.04  ? 525 ARG B NH2 1 
ATOM   8237 N NH2 B ARG B 1 524 ? 5.870   -63.773 -6.523  0.37 45.84  ? 525 ARG B NH2 1 
ATOM   8238 N N   . ALA B 1 525 ? -2.894  -62.938 -2.650  1.00 49.86  ? 526 ALA B N   1 
ATOM   8239 C CA  . ALA B 1 525 ? -4.144  -62.302 -2.224  1.00 49.81  ? 526 ALA B CA  1 
ATOM   8240 C C   . ALA B 1 525 ? -3.997  -60.922 -1.580  1.00 47.12  ? 526 ALA B C   1 
ATOM   8241 O O   . ALA B 1 525 ? -4.741  -60.004 -1.934  1.00 42.84  ? 526 ALA B O   1 
ATOM   8242 C CB  . ALA B 1 525 ? -4.935  -63.237 -1.311  1.00 51.17  ? 526 ALA B CB  1 
ATOM   8243 N N   . GLN B 1 526 ? -3.065  -60.775 -0.636  1.00 49.95  ? 527 GLN B N   1 
ATOM   8244 C CA  . GLN B 1 526 ? -2.901  -59.500 0.058   1.00 49.71  ? 527 GLN B CA  1 
ATOM   8245 C C   . GLN B 1 526 ? -2.443  -58.431 -0.920  1.00 51.90  ? 527 GLN B C   1 
ATOM   8246 O O   . GLN B 1 526 ? -2.958  -57.313 -0.919  1.00 50.63  ? 527 GLN B O   1 
ATOM   8247 C CB  . GLN B 1 526 ? -1.895  -59.600 1.209   1.00 48.46  ? 527 GLN B CB  1 
ATOM   8248 C CG  . GLN B 1 526 ? -2.361  -60.460 2.360   1.00 50.50  ? 527 GLN B CG  1 
ATOM   8249 C CD  . GLN B 1 526 ? -3.733  -60.049 2.885   1.00 46.88  ? 527 GLN B CD  1 
ATOM   8250 O OE1 . GLN B 1 526 ? -4.669  -60.839 2.876   1.00 49.99  ? 527 GLN B OE1 1 
ATOM   8251 N NE2 . GLN B 1 526 ? -3.846  -58.817 3.363   1.00 51.37  ? 527 GLN B NE2 1 
ATOM   8252 N N   . ALA B 1 527 ? -1.466  -58.789 -1.746  1.00 45.21  ? 528 ALA B N   1 
ATOM   8253 C CA  . ALA B 1 527 ? -0.912  -57.871 -2.736  1.00 51.70  ? 528 ALA B CA  1 
ATOM   8254 C C   . ALA B 1 527 ? -1.942  -57.512 -3.792  1.00 51.34  ? 528 ALA B C   1 
ATOM   8255 O O   . ALA B 1 527 ? -2.079  -56.348 -4.169  1.00 49.03  ? 528 ALA B O   1 
ATOM   8256 C CB  . ALA B 1 527 ? 0.331   -58.471 -3.391  1.00 45.77  ? 528 ALA B CB  1 
ATOM   8257 N N   . CYS B 1 528 ? -2.676  -58.506 -4.277  1.00 47.44  ? 529 CYS B N   1 
ATOM   8258 C CA  . CYS B 1 528 ? -3.621  -58.224 -5.349  1.00 41.55  ? 529 CYS B CA  1 
ATOM   8259 C C   . CYS B 1 528 ? -4.844  -57.426 -4.901  1.00 47.79  ? 529 CYS B C   1 
ATOM   8260 O O   . CYS B 1 528 ? -5.504  -56.799 -5.722  1.00 45.12  ? 529 CYS B O   1 
ATOM   8261 C CB  . CYS B 1 528 ? -3.990  -59.505 -6.106  1.00 48.92  ? 529 CYS B CB  1 
ATOM   8262 S SG  . CYS B 1 528 ? -2.524  -60.157 -6.977  1.00 50.40  ? 529 CYS B SG  1 
ATOM   8263 N N   . ALA B 1 529 ? -5.135  -57.438 -3.599  1.00 45.52  ? 530 ALA B N   1 
ATOM   8264 C CA  . ALA B 1 529 ? -6.243  -56.652 -3.068  1.00 39.63  ? 530 ALA B CA  1 
ATOM   8265 C C   . ALA B 1 529 ? -5.866  -55.191 -3.216  1.00 38.57  ? 530 ALA B C   1 
ATOM   8266 O O   . ALA B 1 529 ? -6.709  -54.345 -3.493  1.00 43.43  ? 530 ALA B O   1 
ATOM   8267 C CB  . ALA B 1 529 ? -6.512  -57.018 -1.563  1.00 42.90  ? 530 ALA B CB  1 
ATOM   8268 N N   . PHE B 1 530 ? -4.581  -54.891 -3.034  1.00 36.65  ? 531 PHE B N   1 
ATOM   8269 C CA  . PHE B 1 530 ? -4.082  -53.544 -3.327  1.00 38.08  ? 531 PHE B CA  1 
ATOM   8270 C C   . PHE B 1 530 ? -4.297  -53.132 -4.806  1.00 45.63  ? 531 PHE B C   1 
ATOM   8271 O O   . PHE B 1 530 ? -4.911  -52.085 -5.088  1.00 44.18  ? 531 PHE B O   1 
ATOM   8272 C CB  . PHE B 1 530 ? -2.602  -53.399 -2.924  1.00 40.21  ? 531 PHE B CB  1 
ATOM   8273 C CG  . PHE B 1 530 ? -1.953  -52.139 -3.455  1.00 46.32  ? 531 PHE B CG  1 
ATOM   8274 C CD1 . PHE B 1 530 ? -2.087  -50.938 -2.777  1.00 43.69  ? 531 PHE B CD1 1 
ATOM   8275 C CD2 . PHE B 1 530 ? -1.246  -52.154 -4.653  1.00 46.87  ? 531 PHE B CD2 1 
ATOM   8276 C CE1 . PHE B 1 530 ? -1.517  -49.771 -3.263  1.00 52.33  ? 531 PHE B CE1 1 
ATOM   8277 C CE2 . PHE B 1 530 ? -0.676  -50.991 -5.160  1.00 46.62  ? 531 PHE B CE2 1 
ATOM   8278 C CZ  . PHE B 1 530 ? -0.811  -49.793 -4.465  1.00 44.54  ? 531 PHE B CZ  1 
ATOM   8279 N N   . TRP B 1 531 ? -3.803  -53.944 -5.747  1.00 41.18  ? 532 TRP B N   1 
ATOM   8280 C CA  . TRP B 1 531 ? -3.896  -53.591 -7.178  1.00 40.79  ? 532 TRP B CA  1 
ATOM   8281 C C   . TRP B 1 531 ? -5.330  -53.624 -7.728  1.00 45.95  ? 532 TRP B C   1 
ATOM   8282 O O   . TRP B 1 531 ? -5.729  -52.745 -8.486  1.00 42.72  ? 532 TRP B O   1 
ATOM   8283 C CB  . TRP B 1 531 ? -2.973  -54.477 -8.044  1.00 41.40  ? 532 TRP B CB  1 
ATOM   8284 C CG  . TRP B 1 531 ? -1.511  -54.299 -7.721  1.00 41.58  ? 532 TRP B CG  1 
ATOM   8285 C CD1 . TRP B 1 531 ? -0.724  -55.134 -6.971  1.00 39.50  ? 532 TRP B CD1 1 
ATOM   8286 C CD2 . TRP B 1 531 ? -0.675  -53.198 -8.111  1.00 39.85  ? 532 TRP B CD2 1 
ATOM   8287 N NE1 . TRP B 1 531 ? 0.551   -54.626 -6.883  1.00 41.59  ? 532 TRP B NE1 1 
ATOM   8288 C CE2 . TRP B 1 531 ? 0.609   -53.438 -7.569  1.00 43.00  ? 532 TRP B CE2 1 
ATOM   8289 C CE3 . TRP B 1 531 ? -0.886  -52.034 -8.876  1.00 37.23  ? 532 TRP B CE3 1 
ATOM   8290 C CZ2 . TRP B 1 531 ? 1.683   -52.553 -7.760  1.00 37.01  ? 532 TRP B CZ2 1 
ATOM   8291 C CZ3 . TRP B 1 531 ? 0.171   -51.158 -9.052  1.00 43.76  ? 532 TRP B CZ3 1 
ATOM   8292 C CH2 . TRP B 1 531 ? 1.443   -51.423 -8.500  1.00 37.70  ? 532 TRP B CH2 1 
ATOM   8293 N N   . ASN B 1 532 ? -6.100  -54.636 -7.347  1.00 40.79  ? 533 ASN B N   1 
ATOM   8294 C CA  . ASN B 1 532 ? -7.450  -54.815 -7.896  1.00 43.65  ? 533 ASN B CA  1 
ATOM   8295 C C   . ASN B 1 532 ? -8.589  -54.106 -7.143  1.00 52.19  ? 533 ASN B C   1 
ATOM   8296 O O   . ASN B 1 532 ? -9.641  -53.811 -7.727  1.00 42.47  ? 533 ASN B O   1 
ATOM   8297 C CB  . ASN B 1 532 ? -7.779  -56.311 -8.006  1.00 40.57  ? 533 ASN B CB  1 
ATOM   8298 C CG  . ASN B 1 532 ? -6.821  -57.045 -8.908  1.00 48.55  ? 533 ASN B CG  1 
ATOM   8299 O OD1 . ASN B 1 532 ? -6.248  -56.450 -9.816  1.00 48.45  ? 533 ASN B OD1 1 
ATOM   8300 N ND2 . ASN B 1 532 ? -6.650  -58.341 -8.676  1.00 40.24  ? 533 ASN B ND2 1 
ATOM   8301 N N   . ARG B 1 533 ? -8.419  -53.866 -5.845  1.00 47.85  ? 534 ARG B N   1 
ATOM   8302 C CA  . ARG B 1 533 ? -9.531  -53.289 -5.089  1.00 44.70  ? 534 ARG B CA  1 
ATOM   8303 C C   . ARG B 1 533 ? -9.317  -51.839 -4.679  1.00 52.58  ? 534 ARG B C   1 
ATOM   8304 O O   . ARG B 1 533 ? -10.206 -51.001 -4.846  1.00 54.76  ? 534 ARG B O   1 
ATOM   8305 C CB  . ARG B 1 533 ? -9.860  -54.141 -3.873  1.00 52.31  ? 534 ARG B CB  1 
ATOM   8306 C CG  . ARG B 1 533 ? -10.217 -55.552 -4.230  1.00 54.21  ? 534 ARG B CG  1 
ATOM   8307 C CD  . ARG B 1 533 ? -10.466 -56.343 -2.997  1.00 52.89  ? 534 ARG B CD  1 
ATOM   8308 N NE  . ARG B 1 533 ? -10.684 -57.743 -3.318  1.00 58.28  ? 534 ARG B NE  1 
ATOM   8309 C CZ  . ARG B 1 533 ? -11.888 -58.287 -3.459  1.00 70.31  ? 534 ARG B CZ  1 
ATOM   8310 N NH1 . ARG B 1 533 ? -12.971 -57.533 -3.298  1.00 65.16  ? 534 ARG B NH1 1 
ATOM   8311 N NH2 . ARG B 1 533 ? -12.004 -59.579 -3.760  1.00 55.28  ? 534 ARG B NH2 1 
ATOM   8312 N N   . PHE B 1 534 ? -8.144  -51.536 -4.142  1.00 49.74  ? 535 PHE B N   1 
ATOM   8313 C CA  . PHE B 1 534 ? -7.918  -50.200 -3.600  1.00 49.58  ? 535 PHE B CA  1 
ATOM   8314 C C   . PHE B 1 534 ? -7.383  -49.193 -4.607  1.00 44.31  ? 535 PHE B C   1 
ATOM   8315 O O   . PHE B 1 534 ? -7.978  -48.139 -4.798  1.00 44.87  ? 535 PHE B O   1 
ATOM   8316 C CB  . PHE B 1 534 ? -6.973  -50.225 -2.392  1.00 43.95  ? 535 PHE B CB  1 
ATOM   8317 C CG  . PHE B 1 534 ? -6.635  -48.853 -1.880  1.00 49.58  ? 535 PHE B CG  1 
ATOM   8318 C CD1 . PHE B 1 534 ? -7.566  -48.126 -1.153  1.00 47.13  ? 535 PHE B CD1 1 
ATOM   8319 C CD2 . PHE B 1 534 ? -5.406  -48.281 -2.149  1.00 44.82  ? 535 PHE B CD2 1 
ATOM   8320 C CE1 . PHE B 1 534 ? -7.266  -46.854 -0.688  1.00 52.28  ? 535 PHE B CE1 1 
ATOM   8321 C CE2 . PHE B 1 534 ? -5.098  -47.016 -1.689  1.00 46.10  ? 535 PHE B CE2 1 
ATOM   8322 C CZ  . PHE B 1 534 ? -6.025  -46.300 -0.950  1.00 47.60  ? 535 PHE B CZ  1 
ATOM   8323 N N   . LEU B 1 535 ? -6.229  -49.495 -5.201  1.00 44.31  ? 536 LEU B N   1 
ATOM   8324 C CA  . LEU B 1 535 ? -5.588  -48.555 -6.133  1.00 52.23  ? 536 LEU B CA  1 
ATOM   8325 C C   . LEU B 1 535 ? -6.530  -47.914 -7.185  1.00 54.23  ? 536 LEU B C   1 
ATOM   8326 O O   . LEU B 1 535 ? -6.407  -46.714 -7.478  1.00 50.35  ? 536 LEU B O   1 
ATOM   8327 C CB  . LEU B 1 535 ? -4.349  -49.175 -6.803  1.00 50.13  ? 536 LEU B CB  1 
ATOM   8328 C CG  . LEU B 1 535 ? -3.534  -48.169 -7.634  1.00 65.86  ? 536 LEU B CG  1 
ATOM   8329 C CD1 . LEU B 1 535 ? -3.047  -47.020 -6.757  1.00 59.57  ? 536 LEU B CD1 1 
ATOM   8330 C CD2 . LEU B 1 535 ? -2.371  -48.827 -8.336  1.00 58.33  ? 536 LEU B CD2 1 
ATOM   8331 N N   . PRO B 1 536 ? -7.481  -48.691 -7.741  1.00 52.17  ? 537 PRO B N   1 
ATOM   8332 C CA  . PRO B 1 536 ? -8.372  -48.006 -8.693  1.00 56.87  ? 537 PRO B CA  1 
ATOM   8333 C C   . PRO B 1 536 ? -9.219  -46.893 -8.058  1.00 61.58  ? 537 PRO B C   1 
ATOM   8334 O O   . PRO B 1 536 ? -9.503  -45.903 -8.734  1.00 55.27  ? 537 PRO B O   1 
ATOM   8335 C CB  . PRO B 1 536 ? -9.268  -49.142 -9.217  1.00 49.22  ? 537 PRO B CB  1 
ATOM   8336 C CG  . PRO B 1 536 ? -8.360  -50.370 -9.171  1.00 44.11  ? 537 PRO B CG  1 
ATOM   8337 C CD  . PRO B 1 536 ? -7.642  -50.160 -7.809  1.00 51.39  ? 537 PRO B CD  1 
ATOM   8338 N N   . LYS B 1 537 ? -9.609  -47.049 -6.791  1.00 57.14  ? 538 LYS B N   1 
ATOM   8339 C CA  . LYS B 1 537 ? -10.363 -46.003 -6.082  1.00 56.91  ? 538 LYS B CA  1 
ATOM   8340 C C   . LYS B 1 537 ? -9.494  -44.778 -5.861  1.00 54.13  ? 538 LYS B C   1 
ATOM   8341 O O   . LYS B 1 537 ? -9.958  -43.649 -5.970  1.00 63.08  ? 538 LYS B O   1 
ATOM   8342 C CB  . LYS B 1 537 ? -10.906 -46.511 -4.740  1.00 52.84  ? 538 LYS B CB  1 
ATOM   8343 C CG  . LYS B 1 537 ? -11.977 -47.594 -4.865  1.00 54.77  ? 538 LYS B CG  1 
ATOM   8344 C CD  . LYS B 1 537 ? -12.410 -48.106 -3.493  1.00 61.08  ? 538 LYS B CD  1 
ATOM   8345 C CE  . LYS B 1 537 ? -13.576 -49.070 -3.597  1.00 62.22  ? 538 LYS B CE  1 
ATOM   8346 N NZ  . LYS B 1 537 ? -13.181 -50.370 -4.208  1.00 79.31  ? 538 LYS B NZ  1 
ATOM   8347 N N   . LEU B 1 538 ? -8.225  -45.005 -5.553  1.00 60.39  ? 539 LEU B N   1 
ATOM   8348 C CA  . LEU B 1 538 ? -7.299  -43.898 -5.376  1.00 62.55  ? 539 LEU B CA  1 
ATOM   8349 C C   . LEU B 1 538 ? -7.145  -43.148 -6.697  1.00 62.42  ? 539 LEU B C   1 
ATOM   8350 O O   . LEU B 1 538 ? -7.131  -41.916 -6.716  1.00 55.43  ? 539 LEU B O   1 
ATOM   8351 C CB  . LEU B 1 538 ? -5.946  -44.382 -4.821  1.00 53.32  ? 539 LEU B CB  1 
ATOM   8352 C CG  . LEU B 1 538 ? -4.877  -43.355 -4.419  1.00 56.68  ? 539 LEU B CG  1 
ATOM   8353 C CD1 . LEU B 1 538 ? -3.878  -43.958 -3.459  1.00 55.30  ? 539 LEU B CD1 1 
ATOM   8354 C CD2 . LEU B 1 538 ? -4.131  -42.837 -5.634  1.00 56.17  ? 539 LEU B CD2 1 
ATOM   8355 N N   . LEU B 1 539 ? -7.030  -43.878 -7.801  1.00 63.31  ? 540 LEU B N   1 
ATOM   8356 C CA  . LEU B 1 539 ? -6.884  -43.219 -9.108  1.00 67.53  ? 540 LEU B CA  1 
ATOM   8357 C C   . LEU B 1 539 ? -8.114  -42.366 -9.518  1.00 70.94  ? 540 LEU B C   1 
ATOM   8358 O O   . LEU B 1 539 ? -7.952  -41.285 -10.074 1.00 70.30  ? 540 LEU B O   1 
ATOM   8359 C CB  . LEU B 1 539 ? -6.486  -44.223 -10.206 1.00 69.33  ? 540 LEU B CB  1 
ATOM   8360 C CG  . LEU B 1 539 ? -5.122  -44.918 -10.034 1.00 68.37  ? 540 LEU B CG  1 
ATOM   8361 C CD1 . LEU B 1 539 ? -4.977  -46.069 -11.007 1.00 59.07  ? 540 LEU B CD1 1 
ATOM   8362 C CD2 . LEU B 1 539 ? -3.933  -43.952 -10.161 1.00 60.85  ? 540 LEU B CD2 1 
ATOM   8363 N N   . SER B 1 540 ? -9.328  -42.834 -9.219  1.00 72.28  ? 541 SER B N   1 
ATOM   8364 C CA  . SER B 1 540 ? -10.549 -42.043 -9.466  1.00 67.52  ? 541 SER B CA  1 
ATOM   8365 C C   . SER B 1 540 ? -10.653 -40.772 -8.608  1.00 80.65  ? 541 SER B C   1 
ATOM   8366 O O   . SER B 1 540 ? -11.202 -39.767 -9.050  1.00 78.93  ? 541 SER B O   1 
ATOM   8367 C CB  . SER B 1 540 ? -11.802 -42.882 -9.215  1.00 70.25  ? 541 SER B CB  1 
ATOM   8368 O OG  . SER B 1 540 ? -11.777 -44.094 -9.942  1.00 77.93  ? 541 SER B OG  1 
ATOM   8369 N N   . ALA B 1 541 ? -10.153 -40.831 -7.375  1.00 79.14  ? 542 ALA B N   1 
ATOM   8370 C CA  . ALA B 1 541 ? -10.282 -39.723 -6.428  1.00 72.22  ? 542 ALA B CA  1 
ATOM   8371 C C   . ALA B 1 541 ? -9.125  -38.723 -6.495  1.00 75.72  ? 542 ALA B C   1 
ATOM   8372 O O   . ALA B 1 541 ? -8.179  -38.891 -7.266  1.00 85.39  ? 542 ALA B O   1 
ATOM   8373 C CB  . ALA B 1 541 ? -10.432 -40.262 -5.003  1.00 65.24  ? 542 ALA B CB  1 
HETATM 8374 C C1  . NAG C 2 .   ? -23.260 -59.616 21.631  1.00 68.13  ? 1   NAG C C1  1 
HETATM 8375 C C2  . NAG C 2 .   ? -24.126 -60.092 20.454  1.00 68.47  ? 1   NAG C C2  1 
HETATM 8376 C C3  . NAG C 2 .   ? -24.734 -58.977 19.608  1.00 67.41  ? 1   NAG C C3  1 
HETATM 8377 C C4  . NAG C 2 .   ? -25.171 -57.791 20.441  1.00 79.51  ? 1   NAG C C4  1 
HETATM 8378 C C5  . NAG C 2 .   ? -24.051 -57.412 21.405  1.00 69.14  ? 1   NAG C C5  1 
HETATM 8379 C C6  . NAG C 2 .   ? -24.369 -56.147 22.193  1.00 75.07  ? 1   NAG C C6  1 
HETATM 8380 C C7  . NAG C 2 .   ? -23.334 -62.250 19.659  1.00 91.01  ? 1   NAG C C7  1 
HETATM 8381 C C8  . NAG C 2 .   ? -24.657 -62.896 19.973  1.00 74.80  ? 1   NAG C C8  1 
HETATM 8382 N N2  . NAG C 2 .   ? -23.332 -60.922 19.574  1.00 78.04  ? 1   NAG C N2  1 
HETATM 8383 O O3  . NAG C 2 .   ? -25.862 -59.485 18.932  1.00 81.00  ? 1   NAG C O3  1 
HETATM 8384 O O4  . NAG C 2 .   ? -25.489 -56.742 19.555  1.00 83.17  ? 1   NAG C O4  1 
HETATM 8385 O O5  . NAG C 2 .   ? -23.822 -58.497 22.285  1.00 62.30  ? 1   NAG C O5  1 
HETATM 8386 O O6  . NAG C 2 .   ? -25.612 -56.278 22.844  1.00 90.28  ? 1   NAG C O6  1 
HETATM 8387 O O7  . NAG C 2 .   ? -22.305 -62.917 19.491  1.00 93.19  ? 1   NAG C O7  1 
HETATM 8388 C C1  . NAG C 2 .   ? -26.764 -56.040 19.563  1.00 97.00  ? 2   NAG C C1  1 
HETATM 8389 C C2  . NAG C 2 .   ? -26.818 -54.586 19.081  1.00 100.82 ? 2   NAG C C2  1 
HETATM 8390 C C3  . NAG C 2 .   ? -28.221 -53.974 19.192  1.00 107.72 ? 2   NAG C C3  1 
HETATM 8391 C C4  . NAG C 2 .   ? -29.289 -54.943 18.681  1.00 113.73 ? 2   NAG C C4  1 
HETATM 8392 C C5  . NAG C 2 .   ? -29.119 -56.277 19.397  1.00 109.41 ? 2   NAG C C5  1 
HETATM 8393 C C6  . NAG C 2 .   ? -30.207 -57.274 19.020  1.00 103.22 ? 2   NAG C C6  1 
HETATM 8394 C C7  . NAG C 2 .   ? -24.624 -53.515 19.375  1.00 85.87  ? 2   NAG C C7  1 
HETATM 8395 C C8  . NAG C 2 .   ? -23.627 -53.033 20.394  1.00 76.11  ? 2   NAG C C8  1 
HETATM 8396 N N2  . NAG C 2 .   ? -25.850 -53.800 19.832  1.00 91.31  ? 2   NAG C N2  1 
HETATM 8397 O O3  . NAG C 2 .   ? -28.282 -52.758 18.472  1.00 112.80 ? 2   NAG C O3  1 
HETATM 8398 O O4  . NAG C 2 .   ? -30.597 -54.447 18.899  1.00 114.00 ? 2   NAG C O4  1 
HETATM 8399 O O5  . NAG C 2 .   ? -27.849 -56.819 19.090  1.00 105.94 ? 2   NAG C O5  1 
HETATM 8400 O O6  . NAG C 2 .   ? -30.013 -58.446 19.781  1.00 98.65  ? 2   NAG C O6  1 
HETATM 8401 O O7  . NAG C 2 .   ? -24.286 -53.629 18.194  1.00 73.72  ? 2   NAG C O7  1 
HETATM 8402 C C1  . FUC C 2 .   ? -25.863 -56.230 24.281  1.00 92.39  ? 3   FUC C C1  1 
HETATM 8403 C C2  . FUC C 2 .   ? -27.404 -56.190 24.257  1.00 96.94  ? 3   FUC C C2  1 
HETATM 8404 C C3  . FUC C 2 .   ? -27.961 -57.570 23.893  1.00 95.40  ? 3   FUC C C3  1 
HETATM 8405 C C4  . FUC C 2 .   ? -27.425 -58.634 24.878  1.00 97.32  ? 3   FUC C C4  1 
HETATM 8406 C C5  . FUC C 2 .   ? -25.878 -58.602 24.873  1.00 86.58  ? 3   FUC C C5  1 
HETATM 8407 C C6  . FUC C 2 .   ? -25.229 -59.538 25.900  1.00 71.01  ? 3   FUC C C6  1 
HETATM 8408 O O2  . FUC C 2 .   ? -27.918 -55.189 23.378  1.00 99.97  ? 3   FUC C O2  1 
HETATM 8409 O O3  . FUC C 2 .   ? -29.380 -57.563 23.959  1.00 98.68  ? 3   FUC C O3  1 
HETATM 8410 O O4  . FUC C 2 .   ? -27.918 -58.387 26.193  1.00 104.16 ? 3   FUC C O4  1 
HETATM 8411 O O5  . FUC C 2 .   ? -25.368 -57.262 25.126  1.00 87.61  ? 3   FUC C O5  1 
HETATM 8412 C C1  . NAG D 2 .   ? 25.252  -54.048 -12.150 1.00 78.04  ? 1   NAG D C1  1 
HETATM 8413 C C2  . NAG D 2 .   ? 25.910  -52.926 -11.346 1.00 78.55  ? 1   NAG D C2  1 
HETATM 8414 C C3  . NAG D 2 .   ? 25.224  -51.581 -11.549 1.00 79.81  ? 1   NAG D C3  1 
HETATM 8415 C C4  . NAG D 2 .   ? 25.197  -51.294 -13.040 1.00 93.14  ? 1   NAG D C4  1 
HETATM 8416 C C5  . NAG D 2 .   ? 24.422  -52.422 -13.722 1.00 81.67  ? 1   NAG D C5  1 
HETATM 8417 C C6  . NAG D 2 .   ? 24.221  -52.168 -15.218 1.00 90.13  ? 1   NAG D C6  1 
HETATM 8418 C C7  . NAG D 2 .   ? 27.095  -53.404 -9.311  1.00 86.99  ? 1   NAG D C7  1 
HETATM 8419 C C8  . NAG D 2 .   ? 28.309  -52.803 -9.966  1.00 81.60  ? 1   NAG D C8  1 
HETATM 8420 N N2  . NAG D 2 .   ? 25.934  -53.268 -9.946  1.00 74.24  ? 1   NAG D N2  1 
HETATM 8421 O O3  . NAG D 2 .   ? 25.915  -50.560 -10.871 1.00 82.77  ? 1   NAG D O3  1 
HETATM 8422 O O4  . NAG D 2 .   ? 24.618  -50.027 -13.288 1.00 99.84  ? 1   NAG D O4  1 
HETATM 8423 O O5  . NAG D 2 .   ? 25.058  -53.673 -13.503 1.00 79.39  ? 1   NAG D O5  1 
HETATM 8424 O O6  . NAG D 2 .   ? 25.455  -52.088 -15.899 1.00 98.54  ? 1   NAG D O6  1 
HETATM 8425 O O7  . NAG D 2 .   ? 27.194  -53.988 -8.231  1.00 87.44  ? 1   NAG D O7  1 
HETATM 8426 C C1  . NAG D 2 .   ? 25.359  -48.924 -13.873 1.00 101.74 ? 2   NAG D C1  1 
HETATM 8427 C C2  . NAG D 2 .   ? 24.257  -48.085 -14.514 1.00 102.72 ? 2   NAG D C2  1 
HETATM 8428 C C3  . NAG D 2 .   ? 24.811  -47.195 -15.622 1.00 103.01 ? 2   NAG D C3  1 
HETATM 8429 C C4  . NAG D 2 .   ? 26.003  -46.389 -15.112 1.00 112.73 ? 2   NAG D C4  1 
HETATM 8430 C C5  . NAG D 2 .   ? 27.027  -47.278 -14.398 1.00 113.99 ? 2   NAG D C5  1 
HETATM 8431 C C6  . NAG D 2 .   ? 28.085  -46.415 -13.717 1.00 113.39 ? 2   NAG D C6  1 
HETATM 8432 C C7  . NAG D 2 .   ? 21.970  -48.940 -14.558 1.00 88.78  ? 2   NAG D C7  1 
HETATM 8433 C C8  . NAG D 2 .   ? 21.595  -47.836 -13.615 1.00 81.29  ? 2   NAG D C8  1 
HETATM 8434 N N2  . NAG D 2 .   ? 23.212  -48.944 -15.037 1.00 93.66  ? 2   NAG D N2  1 
HETATM 8435 O O3  . NAG D 2 .   ? 23.799  -46.315 -16.059 1.00 91.89  ? 2   NAG D O3  1 
HETATM 8436 O O4  . NAG D 2 .   ? 26.606  -45.689 -16.183 1.00 97.93  ? 2   NAG D O4  1 
HETATM 8437 O O5  . NAG D 2 .   ? 26.424  -48.109 -13.418 1.00 114.03 ? 2   NAG D O5  1 
HETATM 8438 O O6  . NAG D 2 .   ? 28.579  -47.078 -12.573 1.00 114.63 ? 2   NAG D O6  1 
HETATM 8439 O O7  . NAG D 2 .   ? 21.145  -49.800 -14.867 1.00 87.49  ? 2   NAG D O7  1 
HETATM 8440 C C1  . FUC D 2 .   ? 25.942  -53.096 -16.844 1.00 98.00  ? 3   FUC D C1  1 
HETATM 8441 C C2  . FUC D 2 .   ? 27.063  -52.207 -17.415 1.00 105.92 ? 3   FUC D C2  1 
HETATM 8442 C C3  . FUC D 2 .   ? 28.212  -52.076 -16.399 1.00 109.32 ? 3   FUC D C3  1 
HETATM 8443 C C4  . FUC D 2 .   ? 28.721  -53.481 -15.990 1.00 105.90 ? 3   FUC D C4  1 
HETATM 8444 C C5  . FUC D 2 .   ? 27.532  -54.330 -15.468 1.00 91.58  ? 3   FUC D C5  1 
HETATM 8445 C C6  . FUC D 2 .   ? 27.884  -55.782 -15.166 1.00 79.92  ? 3   FUC D C6  1 
HETATM 8446 O O2  . FUC D 2 .   ? 26.588  -50.928 -17.821 1.00 106.21 ? 3   FUC D O2  1 
HETATM 8447 O O3  . FUC D 2 .   ? 29.301  -51.334 -16.956 1.00 111.99 ? 3   FUC D O3  1 
HETATM 8448 O O4  . FUC D 2 .   ? 29.348  -54.123 -17.097 1.00 93.37  ? 3   FUC D O4  1 
HETATM 8449 O O5  . FUC D 2 .   ? 26.430  -54.357 -16.414 1.00 92.92  ? 3   FUC D O5  1 
HETATM 8450 C C1  . EDO E 3 .   ? -9.721  -59.824 9.570   1.00 46.09  ? 604 EDO A C1  1 
HETATM 8451 O O1  . EDO E 3 .   ? -8.577  -59.036 9.215   1.00 47.14  ? 604 EDO A O1  1 
HETATM 8452 C C2  . EDO E 3 .   ? -10.586 -60.144 8.359   1.00 57.36  ? 604 EDO A C2  1 
HETATM 8453 O O2  . EDO E 3 .   ? -9.801  -60.541 7.235   1.00 47.91  ? 604 EDO A O2  1 
HETATM 8454 C C1  . EDO F 3 .   ? 8.384   -47.842 11.117  0.99 49.10  ? 605 EDO A C1  1 
HETATM 8455 O O1  . EDO F 3 .   ? 9.534   -47.003 10.921  0.99 54.42  ? 605 EDO A O1  1 
HETATM 8456 C C2  . EDO F 3 .   ? 7.271   -47.461 10.147  0.99 51.82  ? 605 EDO A C2  1 
HETATM 8457 O O2  . EDO F 3 .   ? 6.861   -46.090 10.332  0.99 47.62  ? 605 EDO A O2  1 
HETATM 8458 C C1  . NAG G 4 .   ? -8.392  -35.942 -47.328 1.00 83.60  ? 604 NAG B C1  1 
HETATM 8459 C C2  . NAG G 4 .   ? -9.915  -35.892 -47.474 1.00 85.29  ? 604 NAG B C2  1 
HETATM 8460 C C3  . NAG G 4 .   ? -10.418 -36.967 -48.431 1.00 91.35  ? 604 NAG B C3  1 
HETATM 8461 C C4  . NAG G 4 .   ? -9.690  -36.851 -49.768 1.00 108.00 ? 604 NAG B C4  1 
HETATM 8462 C C5  . NAG G 4 .   ? -8.187  -37.006 -49.505 1.00 108.01 ? 604 NAG B C5  1 
HETATM 8463 C C6  . NAG G 4 .   ? -7.337  -37.051 -50.786 1.00 92.82  ? 604 NAG B C6  1 
HETATM 8464 C C7  . NAG G 4 .   ? -11.161 -35.044 -45.553 1.00 91.56  ? 604 NAG B C7  1 
HETATM 8465 C C8  . NAG G 4 .   ? -12.121 -35.418 -44.455 1.00 88.44  ? 604 NAG B C8  1 
HETATM 8466 N N2  . NAG G 4 .   ? -10.543 -36.049 -46.176 1.00 85.58  ? 604 NAG B N2  1 
HETATM 8467 O O3  . NAG G 4 .   ? -11.810 -36.851 -48.612 1.00 100.64 ? 604 NAG B O3  1 
HETATM 8468 O O4  . NAG G 4 .   ? -10.169 -37.825 -50.677 1.00 101.90 ? 604 NAG B O4  1 
HETATM 8469 O O5  . NAG G 4 .   ? -7.726  -36.012 -48.587 1.00 100.82 ? 604 NAG B O5  1 
HETATM 8470 O O6  . NAG G 4 .   ? -7.622  -35.981 -51.662 1.00 103.79 ? 604 NAG B O6  1 
HETATM 8471 O O7  . NAG G 4 .   ? -10.968 -33.859 -45.835 1.00 90.02  ? 604 NAG B O7  1 
HETATM 8472 C C1  . EDO H 3 .   ? 12.640  -53.556 1.284   0.97 54.78  ? 605 EDO B C1  1 
HETATM 8473 O O1  . EDO H 3 .   ? 12.085  -53.258 2.575   0.97 45.80  ? 605 EDO B O1  1 
HETATM 8474 C C2  . EDO H 3 .   ? 11.920  -54.712 0.595   0.97 53.18  ? 605 EDO B C2  1 
HETATM 8475 O O2  . EDO H 3 .   ? 10.527  -54.786 0.934   0.97 53.08  ? 605 EDO B O2  1 
HETATM 8476 N N   . NO3 I 5 .   ? -9.343  -40.422 -31.010 0.72 45.74  ? 606 NO3 B N   1 
HETATM 8477 O O1  . NO3 I 5 .   ? -10.523 -41.021 -30.542 0.72 58.52  ? 606 NO3 B O1  1 
HETATM 8478 O O2  . NO3 I 5 .   ? -8.627  -39.556 -30.182 0.72 58.37  ? 606 NO3 B O2  1 
HETATM 8479 O O3  . NO3 I 5 .   ? -8.888  -40.675 -32.302 0.72 52.99  ? 606 NO3 B O3  1 
HETATM 8480 N N   . NO3 J 5 .   ? -8.403  -60.609 -3.508  0.86 57.82  ? 607 NO3 B N   1 
HETATM 8481 O O1  . NO3 J 5 .   ? -8.613  -59.338 -4.092  0.86 46.66  ? 607 NO3 B O1  1 
HETATM 8482 O O2  . NO3 J 5 .   ? -7.106  -60.958 -3.179  0.86 57.56  ? 607 NO3 B O2  1 
HETATM 8483 O O3  . NO3 J 5 .   ? -9.433  -61.545 -3.251  0.86 53.21  ? 607 NO3 B O3  1 
HETATM 8484 O O1  . PE8 K 6 .   ? -19.119 -45.830 -34.253 1.00 79.65  ? 608 PE8 B O1  1 
HETATM 8485 C C2  . PE8 K 6 .   ? -19.350 -44.897 -33.260 1.00 79.55  ? 608 PE8 B C2  1 
HETATM 8486 C C3  . PE8 K 6 .   ? -18.230 -43.976 -32.908 1.00 73.70  ? 608 PE8 B C3  1 
HETATM 8487 O O4  . PE8 K 6 .   ? -17.461 -44.301 -31.806 1.00 78.79  ? 608 PE8 B O4  1 
HETATM 8488 C C5  . PE8 K 6 .   ? -16.245 -43.672 -31.603 1.00 72.16  ? 608 PE8 B C5  1 
HETATM 8489 C C6  . PE8 K 6 .   ? -15.109 -44.039 -32.503 1.00 71.08  ? 608 PE8 B C6  1 
HETATM 8490 O O7  . PE8 K 6 .   ? -15.198 -45.252 -33.151 1.00 73.17  ? 608 PE8 B O7  1 
HETATM 8491 C C8  . PE8 K 6 .   ? -14.107 -45.817 -33.769 1.00 61.83  ? 608 PE8 B C8  1 
HETATM 8492 C C9  . PE8 K 6 .   ? -14.404 -46.898 -34.755 1.00 57.24  ? 608 PE8 B C9  1 
HETATM 8493 O O10 . PE8 K 6 .   ? -15.499 -47.687 -34.490 1.00 71.52  ? 608 PE8 B O10 1 
HETATM 8494 C C11 . PE8 K 6 .   ? -15.943 -48.616 -35.408 1.00 62.54  ? 608 PE8 B C11 1 
HETATM 8495 C C12 . PE8 K 6 .   ? -17.171 -49.396 -35.046 1.00 65.42  ? 608 PE8 B C12 1 
HETATM 8496 O O13 . PE8 K 6 .   ? -18.002 -48.916 -34.057 1.00 74.98  ? 608 PE8 B O13 1 
HETATM 8497 C C14 . PE8 K 6 .   ? -18.863 -49.769 -33.397 1.00 67.87  ? 608 PE8 B C14 1 
HETATM 8498 C C15 . PE8 K 6 .   ? -19.736 -49.201 -32.324 1.00 74.25  ? 608 PE8 B C15 1 
HETATM 8499 O O16 . PE8 K 6 .   ? -19.218 -48.241 -31.472 1.00 79.74  ? 608 PE8 B O16 1 
HETATM 8500 C C17 . PE8 K 6 .   ? -19.820 -47.985 -30.255 1.00 59.75  ? 608 PE8 B C17 1 
HETATM 8501 C C18 . PE8 K 6 .   ? -18.936 -47.493 -29.154 1.00 73.07  ? 608 PE8 B C18 1 
HETATM 8502 O O19 . PE8 K 6 .   ? -18.252 -46.300 -29.321 1.00 79.55  ? 608 PE8 B O19 1 
HETATM 8503 C C20 . PE8 K 6 .   ? -17.138 -46.002 -28.550 1.00 62.04  ? 608 PE8 B C20 1 
HETATM 8504 C C21 . PE8 K 6 .   ? -17.027 -46.620 -27.193 1.00 70.72  ? 608 PE8 B C21 1 
HETATM 8505 O O22 . PE8 K 6 .   ? -15.783 -46.763 -26.594 1.00 69.76  ? 608 PE8 B O22 1 
HETATM 8506 C C23 . PE8 K 6 .   ? -15.720 -47.021 -25.236 1.00 65.33  ? 608 PE8 B C23 1 
HETATM 8507 C C24 . PE8 K 6 .   ? -16.886 -47.701 -24.596 1.00 59.02  ? 608 PE8 B C24 1 
HETATM 8508 O O25 . PE8 K 6 .   ? -17.203 -47.421 -23.278 1.00 80.78  ? 608 PE8 B O25 1 
HETATM 8509 O O   . HOH L 7 .   ? -8.104  -37.031 31.883  1.00 36.32  ? 701 HOH A O   1 
HETATM 8510 O O   . HOH L 7 .   ? -7.884  -51.650 25.457  1.00 38.78  ? 702 HOH A O   1 
HETATM 8511 O O   . HOH L 7 .   ? -13.530 -29.594 48.032  1.00 46.45  ? 703 HOH A O   1 
HETATM 8512 O O   . HOH L 7 .   ? 1.434   -48.599 28.999  1.00 38.51  ? 704 HOH A O   1 
HETATM 8513 O O   . HOH L 7 .   ? -12.482 -40.270 38.415  1.00 41.79  ? 705 HOH A O   1 
HETATM 8514 O O   . HOH L 7 .   ? -13.062 -23.853 35.231  1.00 41.56  ? 706 HOH A O   1 
HETATM 8515 O O   . HOH L 7 .   ? -4.327  -42.829 34.082  1.00 39.40  ? 707 HOH A O   1 
HETATM 8516 O O   . HOH L 7 .   ? -2.575  -36.956 38.813  1.00 36.86  ? 708 HOH A O   1 
HETATM 8517 O O   . HOH L 7 .   ? -2.765  -34.288 18.810  0.92 39.72  ? 709 HOH A O   1 
HETATM 8518 O O   . HOH L 7 .   ? 13.664  -49.900 24.161  1.00 42.18  ? 710 HOH A O   1 
HETATM 8519 O O   . HOH L 7 .   ? 17.557  -43.910 22.093  1.00 46.96  ? 711 HOH A O   1 
HETATM 8520 O O   . HOH L 7 .   ? 16.885  -50.019 19.122  1.00 49.64  ? 712 HOH A O   1 
HETATM 8521 O O   . HOH L 7 .   ? 9.146   -45.391 54.421  1.00 50.70  ? 713 HOH A O   1 
HETATM 8522 O O   . HOH L 7 .   ? -10.161 -34.866 39.441  1.00 42.44  ? 714 HOH A O   1 
HETATM 8523 O O   . HOH L 7 .   ? -15.942 -41.051 21.582  0.93 44.82  ? 715 HOH A O   1 
HETATM 8524 O O   . HOH L 7 .   ? -0.929  -62.849 30.797  1.00 53.29  ? 716 HOH A O   1 
HETATM 8525 O O   . HOH L 7 .   ? -14.248 -25.660 23.252  1.00 44.46  ? 717 HOH A O   1 
HETATM 8526 O O   . HOH L 7 .   ? -16.071 -36.097 26.086  1.00 49.74  ? 718 HOH A O   1 
HETATM 8527 O O   . HOH L 7 .   ? -7.716  -20.419 40.586  0.98 47.87  ? 719 HOH A O   1 
HETATM 8528 O O   . HOH L 7 .   ? -15.441 -40.496 35.807  1.00 49.82  ? 720 HOH A O   1 
HETATM 8529 O O   . HOH L 7 .   ? -8.817  -26.244 25.586  0.88 41.05  ? 721 HOH A O   1 
HETATM 8530 O O   . HOH L 7 .   ? -10.760 -36.000 21.345  0.83 37.33  ? 722 HOH A O   1 
HETATM 8531 O O   . HOH L 7 .   ? -21.563 -36.503 36.716  1.00 46.55  ? 723 HOH A O   1 
HETATM 8532 O O   . HOH L 7 .   ? -10.948 -46.074 43.081  1.00 47.85  ? 724 HOH A O   1 
HETATM 8533 O O   . HOH L 7 .   ? -11.470 -24.084 49.471  0.97 48.26  ? 725 HOH A O   1 
HETATM 8534 O O   . HOH L 7 .   ? 6.466   -48.382 14.216  1.00 44.10  ? 726 HOH A O   1 
HETATM 8535 O O   . HOH L 7 .   ? 8.486   -29.708 39.491  1.00 44.38  ? 727 HOH A O   1 
HETATM 8536 O O   . HOH L 7 .   ? -19.371 -20.601 37.322  0.87 44.37  ? 728 HOH A O   1 
HETATM 8537 O O   . HOH L 7 .   ? 4.944   -24.753 22.395  1.00 53.27  ? 729 HOH A O   1 
HETATM 8538 O O   . HOH L 7 .   ? -9.124  -47.527 41.364  1.00 46.61  ? 730 HOH A O   1 
HETATM 8539 O O   . HOH L 7 .   ? -4.779  -42.621 45.245  1.00 45.03  ? 731 HOH A O   1 
HETATM 8540 O O   . HOH L 7 .   ? -0.095  -24.112 48.700  0.93 46.29  ? 732 HOH A O   1 
HETATM 8541 O O   . HOH L 7 .   ? 9.341   -61.394 28.496  1.00 57.97  ? 733 HOH A O   1 
HETATM 8542 O O   . HOH L 7 .   ? -30.181 -18.200 30.668  1.00 65.45  ? 734 HOH A O   1 
HETATM 8543 O O   . HOH L 7 .   ? -22.141 -26.918 15.438  1.00 63.19  ? 735 HOH A O   1 
HETATM 8544 O O   . HOH L 7 .   ? -10.562 -55.342 37.192  1.00 57.44  ? 736 HOH A O   1 
HETATM 8545 O O   . HOH L 7 .   ? -0.826  -40.688 61.420  1.00 56.71  ? 737 HOH A O   1 
HETATM 8546 O O   . HOH L 7 .   ? 8.365   -54.239 47.857  1.00 50.04  ? 738 HOH A O   1 
HETATM 8547 O O   . HOH L 7 .   ? -14.971 -41.856 8.839   1.00 50.80  ? 739 HOH A O   1 
HETATM 8548 O O   . HOH L 7 .   ? -18.794 -42.160 41.092  0.92 45.79  ? 740 HOH A O   1 
HETATM 8549 O O   . HOH L 7 .   ? -9.093  -24.210 13.259  1.00 63.00  ? 741 HOH A O   1 
HETATM 8550 O O   . HOH L 7 .   ? -10.716 -21.802 29.091  1.00 51.24  ? 742 HOH A O   1 
HETATM 8551 O O   . HOH L 7 .   ? -8.570  -40.389 51.872  0.98 53.20  ? 743 HOH A O   1 
HETATM 8552 O O   . HOH L 7 .   ? -13.537 -65.555 5.488   1.00 54.13  ? 744 HOH A O   1 
HETATM 8553 O O   . HOH L 7 .   ? -17.895 -53.172 14.739  1.00 54.51  ? 745 HOH A O   1 
HETATM 8554 O O   . HOH L 7 .   ? -6.828  -60.807 10.368  1.00 55.09  ? 746 HOH A O   1 
HETATM 8555 O O   . HOH L 7 .   ? -10.579 -61.898 -0.708  1.00 52.29  ? 747 HOH A O   1 
HETATM 8556 O O   . HOH L 7 .   ? -6.432  -18.643 56.988  1.00 58.30  ? 748 HOH A O   1 
HETATM 8557 O O   . HOH L 7 .   ? -30.947 -28.871 25.240  1.00 54.00  ? 749 HOH A O   1 
HETATM 8558 O O   . HOH L 7 .   ? -19.841 -39.657 41.398  0.95 51.53  ? 750 HOH A O   1 
HETATM 8559 O O   . HOH L 7 .   ? 9.292   -59.139 31.291  1.00 48.26  ? 751 HOH A O   1 
HETATM 8560 O O   . HOH L 7 .   ? -10.447 -42.385 35.630  1.00 38.39  ? 752 HOH A O   1 
HETATM 8561 O O   . HOH L 7 .   ? -2.175  -52.899 21.118  1.00 48.54  ? 753 HOH A O   1 
HETATM 8562 O O   . HOH L 7 .   ? 6.562   -54.731 14.039  1.00 52.59  ? 754 HOH A O   1 
HETATM 8563 O O   . HOH L 7 .   ? -2.644  -42.487 14.028  0.94 41.96  ? 755 HOH A O   1 
HETATM 8564 O O   . HOH L 7 .   ? -9.901  -36.542 44.413  1.00 44.98  ? 756 HOH A O   1 
HETATM 8565 O O   . HOH L 7 .   ? 11.582  -27.337 46.818  1.00 48.24  ? 757 HOH A O   1 
HETATM 8566 O O   . HOH L 7 .   ? -17.657 -31.175 30.913  1.00 46.23  ? 758 HOH A O   1 
HETATM 8567 O O   . HOH L 7 .   ? -22.367 -37.988 34.861  0.92 47.03  ? 759 HOH A O   1 
HETATM 8568 O O   . HOH L 7 .   ? 2.678   -27.815 60.604  1.00 51.20  ? 760 HOH A O   1 
HETATM 8569 O O   . HOH L 7 .   ? 5.156   -27.387 60.334  1.00 55.35  ? 761 HOH A O   1 
HETATM 8570 O O   . HOH L 7 .   ? -16.667 -58.972 32.310  1.00 58.36  ? 762 HOH A O   1 
HETATM 8571 O O   . HOH L 7 .   ? 13.207  -52.406 46.758  0.85 47.95  ? 763 HOH A O   1 
HETATM 8572 O O   . HOH L 7 .   ? -13.341 -26.930 38.596  0.94 43.86  ? 764 HOH A O   1 
HETATM 8573 O O   . HOH L 7 .   ? -8.676  -24.342 48.663  0.80 48.22  ? 765 HOH A O   1 
HETATM 8574 O O   . HOH L 7 .   ? -7.625  -29.987 52.344  1.00 57.40  ? 766 HOH A O   1 
HETATM 8575 O O   . HOH L 7 .   ? 3.642   -50.556 57.974  0.87 45.53  ? 767 HOH A O   1 
HETATM 8576 O O   . HOH L 7 .   ? 5.825   -62.883 46.203  1.00 60.62  ? 768 HOH A O   1 
HETATM 8577 O O   . HOH L 7 .   ? 2.500   -47.205 45.110  1.00 42.39  ? 769 HOH A O   1 
HETATM 8578 O O   . HOH L 7 .   ? 8.817   -49.196 15.432  1.00 46.21  ? 770 HOH A O   1 
HETATM 8579 O O   . HOH L 7 .   ? -19.374 -43.791 21.841  1.00 40.77  ? 771 HOH A O   1 
HETATM 8580 O O   . HOH L 7 .   ? -7.919  -41.488 35.949  1.00 35.67  ? 772 HOH A O   1 
HETATM 8581 O O   . HOH L 7 .   ? -12.018 -34.395 27.292  1.00 36.76  ? 773 HOH A O   1 
HETATM 8582 O O   . HOH L 7 .   ? -2.490  -48.282 29.593  1.00 45.41  ? 774 HOH A O   1 
HETATM 8583 O O   . HOH L 7 .   ? -2.286  -40.368 43.207  1.00 43.58  ? 775 HOH A O   1 
HETATM 8584 O O   . HOH L 7 .   ? -16.469 -34.926 32.181  1.00 38.79  ? 776 HOH A O   1 
HETATM 8585 O O   . HOH L 7 .   ? -16.520 -32.320 33.123  1.00 44.03  ? 777 HOH A O   1 
HETATM 8586 O O   . HOH L 7 .   ? -7.602  -25.364 46.140  1.00 39.56  ? 778 HOH A O   1 
HETATM 8587 O O   . HOH L 7 .   ? -14.401 -24.776 37.551  1.00 38.11  ? 779 HOH A O   1 
HETATM 8588 O O   . HOH L 7 .   ? -4.239  -50.937 36.518  1.00 41.31  ? 780 HOH A O   1 
HETATM 8589 O O   . HOH L 7 .   ? -2.191  -23.654 22.416  1.00 50.13  ? 781 HOH A O   1 
HETATM 8590 O O   . HOH L 7 .   ? 0.034   -41.724 14.592  1.00 46.93  ? 782 HOH A O   1 
HETATM 8591 O O   . HOH L 7 .   ? -14.507 -33.425 27.288  1.00 47.77  ? 783 HOH A O   1 
HETATM 8592 O O   . HOH L 7 .   ? -12.130 -42.465 33.178  1.00 43.40  ? 784 HOH A O   1 
HETATM 8593 O O   . HOH L 7 .   ? -20.477 -46.832 10.971  1.00 51.86  ? 785 HOH A O   1 
HETATM 8594 O O   . HOH L 7 .   ? -14.817 -42.931 34.330  1.00 44.35  ? 786 HOH A O   1 
HETATM 8595 O O   . HOH L 7 .   ? -15.222 -45.681 34.101  1.00 50.83  ? 787 HOH A O   1 
HETATM 8596 O O   . HOH L 7 .   ? -5.542  -53.602 20.229  1.00 50.11  ? 788 HOH A O   1 
HETATM 8597 O O   . HOH L 7 .   ? -7.187  -60.389 13.013  0.86 50.68  ? 789 HOH A O   1 
HETATM 8598 O O   . HOH L 7 .   ? -13.665 -30.720 35.954  1.00 36.82  ? 790 HOH A O   1 
HETATM 8599 O O   . HOH L 7 .   ? 10.746  -52.569 43.851  1.00 47.62  ? 791 HOH A O   1 
HETATM 8600 O O   . HOH L 7 .   ? -6.552  -34.753 47.107  1.00 46.24  ? 792 HOH A O   1 
HETATM 8601 O O   . HOH L 7 .   ? -0.437  -21.740 58.588  1.00 60.59  ? 793 HOH A O   1 
HETATM 8602 O O   . HOH L 7 .   ? -11.598 -34.652 19.042  0.99 46.37  ? 794 HOH A O   1 
HETATM 8603 O O   . HOH L 7 .   ? -11.210 -27.839 23.724  1.00 43.46  ? 795 HOH A O   1 
HETATM 8604 O O   . HOH L 7 .   ? -13.406 -28.485 22.264  0.78 41.41  ? 796 HOH A O   1 
HETATM 8605 O O   . HOH L 7 .   ? 7.738   -56.575 16.743  1.00 56.96  ? 797 HOH A O   1 
HETATM 8606 O O   . HOH L 7 .   ? -2.399  -58.881 46.424  0.98 54.30  ? 798 HOH A O   1 
HETATM 8607 O O   . HOH L 7 .   ? 2.470   -23.534 49.710  1.00 49.45  ? 799 HOH A O   1 
HETATM 8608 O O   . HOH L 7 .   ? 12.764  -45.517 56.546  1.00 48.04  ? 800 HOH A O   1 
HETATM 8609 O O   . HOH L 7 .   ? 13.168  -38.215 39.484  0.83 46.95  ? 801 HOH A O   1 
HETATM 8610 O O   . HOH L 7 .   ? -9.695  -25.724 44.436  0.75 38.89  ? 802 HOH A O   1 
HETATM 8611 O O   . HOH L 7 .   ? 13.000  -50.011 50.933  1.00 55.63  ? 803 HOH A O   1 
HETATM 8612 O O   . HOH L 7 .   ? -5.593  -24.345 15.407  1.00 57.19  ? 804 HOH A O   1 
HETATM 8613 O O   . HOH L 7 .   ? -7.217  -63.077 33.840  1.00 58.09  ? 805 HOH A O   1 
HETATM 8614 O O   . HOH L 7 .   ? -7.900  -44.354 47.266  1.00 47.89  ? 806 HOH A O   1 
HETATM 8615 O O   . HOH L 7 .   ? -2.462  -47.313 56.617  1.00 60.63  ? 807 HOH A O   1 
HETATM 8616 O O   . HOH L 7 .   ? -16.005 -22.466 14.531  1.00 57.68  ? 808 HOH A O   1 
HETATM 8617 O O   . HOH L 7 .   ? -14.522 -43.967 23.907  1.00 53.90  ? 809 HOH A O   1 
HETATM 8618 O O   . HOH L 7 .   ? -22.184 -31.933 17.165  1.00 57.88  ? 810 HOH A O   1 
HETATM 8619 O O   . HOH L 7 .   ? 10.230  -23.522 32.914  1.00 65.82  ? 811 HOH A O   1 
HETATM 8620 O O   . HOH L 7 .   ? 0.654   -18.744 56.466  1.00 55.38  ? 812 HOH A O   1 
HETATM 8621 O O   . HOH L 7 .   ? 10.007  -45.297 15.188  1.00 50.20  ? 813 HOH A O   1 
HETATM 8622 O O   . HOH L 7 .   ? -14.410 -29.138 38.101  0.91 42.85  ? 814 HOH A O   1 
HETATM 8623 O O   . HOH L 7 .   ? -13.190 -45.448 41.815  0.94 44.60  ? 815 HOH A O   1 
HETATM 8624 O O   . HOH L 7 .   ? 19.983  -47.789 35.764  0.93 55.01  ? 816 HOH A O   1 
HETATM 8625 O O   . HOH L 7 .   ? -28.018 -33.024 24.651  1.00 55.79  ? 817 HOH A O   1 
HETATM 8626 O O   . HOH L 7 .   ? 15.794  -49.481 45.154  1.00 50.99  ? 818 HOH A O   1 
HETATM 8627 O O   . HOH L 7 .   ? -33.021 -26.941 24.111  1.00 47.05  ? 819 HOH A O   1 
HETATM 8628 O O   . HOH L 7 .   ? 6.127   -45.579 12.933  1.00 49.70  ? 820 HOH A O   1 
HETATM 8629 O O   . HOH L 7 .   ? 1.321   -39.204 15.153  1.00 55.37  ? 821 HOH A O   1 
HETATM 8630 O O   . HOH L 7 .   ? 11.157  -54.021 46.230  1.00 52.45  ? 822 HOH A O   1 
HETATM 8631 O O   . HOH L 7 .   ? -10.396 -26.802 13.636  1.00 53.92  ? 823 HOH A O   1 
HETATM 8632 O O   . HOH L 7 .   ? 20.428  -47.830 38.466  1.00 54.49  ? 824 HOH A O   1 
HETATM 8633 O O   . HOH L 7 .   ? 11.261  -45.935 12.761  1.00 54.20  ? 825 HOH A O   1 
HETATM 8634 O O   . HOH L 7 .   ? -18.760 -22.445 39.307  0.86 46.09  ? 826 HOH A O   1 
HETATM 8635 O O   . HOH L 7 .   ? -10.981 -43.874 17.272  0.77 42.27  ? 827 HOH A O   1 
HETATM 8636 O O   . HOH L 7 .   ? 21.772  -49.965 38.167  1.00 57.76  ? 828 HOH A O   1 
HETATM 8637 O O   . HOH L 7 .   ? -9.129  -34.279 18.036  0.90 54.63  ? 829 HOH A O   1 
HETATM 8638 O O   . HOH L 7 .   ? -23.853 -29.018 39.852  1.00 56.43  ? 830 HOH A O   1 
HETATM 8639 O O   . HOH L 7 .   ? -20.255 -26.034 41.383  0.94 46.72  ? 831 HOH A O   1 
HETATM 8640 O O   . HOH L 7 .   ? -13.557 -65.648 20.988  1.00 66.88  ? 832 HOH A O   1 
HETATM 8641 O O   . HOH L 7 .   ? -18.768 -27.440 43.055  1.00 48.64  ? 833 HOH A O   1 
HETATM 8642 O O   . HOH L 7 .   ? -7.277  -18.936 23.010  1.00 61.59  ? 834 HOH A O   1 
HETATM 8643 O O   . HOH L 7 .   ? -5.319  -63.217 9.607   1.00 51.78  ? 835 HOH A O   1 
HETATM 8644 O O   . HOH L 7 .   ? 0.473   -22.150 44.670  1.00 50.69  ? 836 HOH A O   1 
HETATM 8645 O O   . HOH L 7 .   ? -17.341 -56.673 39.171  1.00 60.98  ? 837 HOH A O   1 
HETATM 8646 O O   . HOH L 7 .   ? 20.978  -48.166 28.450  0.97 56.19  ? 838 HOH A O   1 
HETATM 8647 O O   . HOH L 7 .   ? -7.584  -32.978 53.218  1.00 52.62  ? 839 HOH A O   1 
HETATM 8648 O O   . HOH L 7 .   ? -28.389 -35.031 36.143  1.00 53.11  ? 840 HOH A O   1 
HETATM 8649 O O   . HOH L 7 .   ? -14.103 -17.785 42.824  1.00 55.93  ? 841 HOH A O   1 
HETATM 8650 O O   . HOH L 7 .   ? -20.618 -36.147 44.011  0.90 46.41  ? 842 HOH A O   1 
HETATM 8651 O O   . HOH L 7 .   ? 9.726   -27.199 24.899  1.00 58.99  ? 843 HOH A O   1 
HETATM 8652 O O   . HOH L 7 .   ? -14.397 -66.936 14.094  0.99 60.36  ? 844 HOH A O   1 
HETATM 8653 O O   . HOH L 7 .   ? -19.070 -14.170 33.635  1.00 63.55  ? 845 HOH A O   1 
HETATM 8654 O O   . HOH L 7 .   ? 20.091  -49.058 21.011  0.99 53.35  ? 846 HOH A O   1 
HETATM 8655 O O   . HOH L 7 .   ? 18.993  -42.078 20.447  1.00 58.48  ? 847 HOH A O   1 
HETATM 8656 O O   . HOH L 7 .   ? -7.463  -28.285 57.035  0.98 60.83  ? 848 HOH A O   1 
HETATM 8657 O O   . HOH L 7 .   ? 12.456  -36.790 59.369  1.00 69.35  ? 849 HOH A O   1 
HETATM 8658 O O   . HOH L 7 .   ? -10.434 -17.213 46.101  1.00 68.95  ? 850 HOH A O   1 
HETATM 8659 O O   . HOH L 7 .   ? -2.786  -40.499 10.074  0.91 51.30  ? 851 HOH A O   1 
HETATM 8660 O O   . HOH L 7 .   ? 21.380  -46.577 21.408  0.96 62.99  ? 852 HOH A O   1 
HETATM 8661 O O   . HOH L 7 .   ? 8.196   -24.086 20.938  1.00 67.82  ? 853 HOH A O   1 
HETATM 8662 O O   . HOH L 7 .   ? -11.260 -38.287 51.736  0.96 48.62  ? 854 HOH A O   1 
HETATM 8663 O O   . HOH L 7 .   ? -8.064  -54.398 37.843  1.00 56.79  ? 855 HOH A O   1 
HETATM 8664 O O   . HOH L 7 .   ? 17.302  -43.153 16.268  1.00 52.79  ? 856 HOH A O   1 
HETATM 8665 O O   . HOH L 7 .   ? -7.014  -56.390 37.683  0.90 55.78  ? 857 HOH A O   1 
HETATM 8666 O O   . HOH L 7 .   ? -3.499  -60.476 24.250  1.00 61.34  ? 858 HOH A O   1 
HETATM 8667 O O   . HOH L 7 .   ? -9.601  -30.441 15.150  1.00 52.51  ? 859 HOH A O   1 
HETATM 8668 O O   . HOH L 7 .   ? -21.219 -60.146 18.271  0.93 63.26  ? 860 HOH A O   1 
HETATM 8669 O O   . HOH L 7 .   ? -16.249 -37.470 16.702  1.00 63.87  ? 861 HOH A O   1 
HETATM 8670 O O   . HOH L 7 .   ? 2.009   -20.287 32.409  1.00 62.04  ? 862 HOH A O   1 
HETATM 8671 O O   . HOH L 7 .   ? 13.685  -41.832 55.814  1.00 59.47  ? 863 HOH A O   1 
HETATM 8672 O O   . HOH L 7 .   ? -3.997  -15.620 44.387  1.00 60.43  ? 864 HOH A O   1 
HETATM 8673 O O   . HOH L 7 .   ? -13.042 -40.273 -0.480  1.00 60.55  ? 865 HOH A O   1 
HETATM 8674 O O   . HOH L 7 .   ? -8.817  -50.563 41.886  1.00 60.60  ? 866 HOH A O   1 
HETATM 8675 O O   . HOH L 7 .   ? 8.744   -26.717 21.964  0.93 62.31  ? 867 HOH A O   1 
HETATM 8676 O O   . HOH L 7 .   ? -11.507 -44.169 31.481  1.00 55.29  ? 868 HOH A O   1 
HETATM 8677 O O   . HOH L 7 .   ? -15.886 -42.771 31.585  1.00 62.97  ? 869 HOH A O   1 
HETATM 8678 O O   . HOH L 7 .   ? -2.971  -21.978 25.421  1.00 54.70  ? 870 HOH A O   1 
HETATM 8679 O O   . HOH L 7 .   ? 0.167   -21.812 47.078  1.00 50.02  ? 871 HOH A O   1 
HETATM 8680 O O   . HOH L 7 .   ? 3.063   -22.452 43.465  1.00 56.84  ? 872 HOH A O   1 
HETATM 8681 O O   . HOH L 7 .   ? -10.406 -51.651 -0.440  1.00 58.38  ? 873 HOH A O   1 
HETATM 8682 O O   . HOH L 7 .   ? -22.597 -26.441 40.351  1.00 53.03  ? 874 HOH A O   1 
HETATM 8683 O O   . HOH L 7 .   ? 11.553  -58.741 41.907  1.00 58.16  ? 875 HOH A O   1 
HETATM 8684 O O   . HOH L 7 .   ? 13.499  -56.173 42.650  1.00 66.29  ? 876 HOH A O   1 
HETATM 8685 O O   . HOH L 7 .   ? -14.376 -44.335 26.654  1.00 68.95  ? 877 HOH A O   1 
HETATM 8686 O O   . HOH L 7 .   ? -3.760  -51.892 18.810  1.00 56.33  ? 878 HOH A O   1 
HETATM 8687 O O   . HOH L 7 .   ? 7.864   -43.234 13.026  1.00 54.32  ? 879 HOH A O   1 
HETATM 8688 O O   . HOH L 7 .   ? 7.282   -40.119 10.240  1.00 75.05  ? 880 HOH A O   1 
HETATM 8689 O O   . HOH L 7 .   ? -7.228  -22.425 53.160  1.00 59.08  ? 881 HOH A O   1 
HETATM 8690 O O   . HOH L 7 .   ? -8.233  -19.286 49.698  1.00 66.76  ? 882 HOH A O   1 
HETATM 8691 O O   . HOH L 7 .   ? -19.414 -41.306 21.318  1.00 73.47  ? 883 HOH A O   1 
HETATM 8692 O O   . HOH L 7 .   ? 4.262   -53.470 4.128   1.00 61.16  ? 884 HOH A O   1 
HETATM 8693 O O   . HOH L 7 .   ? -20.623 -51.330 21.415  1.00 52.18  ? 885 HOH A O   1 
HETATM 8694 O O   . HOH L 7 .   ? -16.398 -48.727 6.066   1.00 48.13  ? 886 HOH A O   1 
HETATM 8695 O O   . HOH L 7 .   ? 19.327  -46.199 40.441  1.00 51.81  ? 887 HOH A O   1 
HETATM 8696 O O   . HOH L 7 .   ? 20.170  -37.140 24.849  1.00 58.07  ? 888 HOH A O   1 
HETATM 8697 O O   . HOH L 7 .   ? -2.721  -43.258 50.189  1.00 57.97  ? 889 HOH A O   1 
HETATM 8698 O O   . HOH L 7 .   ? -7.700  -57.236 21.188  1.00 53.67  ? 890 HOH A O   1 
HETATM 8699 O O   . HOH L 7 .   ? -6.115  -61.649 23.113  1.00 61.51  ? 891 HOH A O   1 
HETATM 8700 O O   . HOH L 7 .   ? 10.890  -26.342 50.260  1.00 60.62  ? 892 HOH A O   1 
HETATM 8701 O O   . HOH L 7 .   ? 8.725   -24.564 51.022  1.00 50.86  ? 893 HOH A O   1 
HETATM 8702 O O   . HOH L 7 .   ? -21.834 -24.658 17.090  1.00 59.66  ? 894 HOH A O   1 
HETATM 8703 O O   . HOH L 7 .   ? -18.813 -39.002 43.697  1.00 57.58  ? 895 HOH A O   1 
HETATM 8704 O O   . HOH L 7 .   ? 6.607   -51.615 48.673  0.83 50.83  ? 896 HOH A O   1 
HETATM 8705 O O   . HOH L 7 .   ? 20.446  -43.960 22.405  1.00 65.73  ? 897 HOH A O   1 
HETATM 8706 O O   . HOH L 7 .   ? -3.737  -55.734 19.648  0.93 50.16  ? 898 HOH A O   1 
HETATM 8707 O O   . HOH L 7 .   ? -2.583  -57.735 20.288  1.00 61.17  ? 899 HOH A O   1 
HETATM 8708 O O   . HOH L 7 .   ? -21.213 -59.925 6.890   1.00 54.53  ? 900 HOH A O   1 
HETATM 8709 O O   . HOH L 7 .   ? -11.637 -18.976 17.164  1.00 61.51  ? 901 HOH A O   1 
HETATM 8710 O O   . HOH L 7 .   ? -24.961 -24.990 41.371  1.00 61.59  ? 902 HOH A O   1 
HETATM 8711 O O   . HOH L 7 .   ? 1.208   -45.960 62.479  1.00 59.56  ? 903 HOH A O   1 
HETATM 8712 O O   . HOH L 7 .   ? -5.097  -44.245 47.617  0.96 55.93  ? 904 HOH A O   1 
HETATM 8713 O O   . HOH L 7 .   ? 4.847   -55.120 11.802  1.00 66.04  ? 905 HOH A O   1 
HETATM 8714 O O   . HOH L 7 .   ? 2.432   -54.564 12.096  1.00 53.46  ? 906 HOH A O   1 
HETATM 8715 O O   . HOH L 7 .   ? -29.151 -34.841 26.422  1.00 75.36  ? 907 HOH A O   1 
HETATM 8716 O O   . HOH L 7 .   ? -3.092  -56.763 33.170  0.86 52.31  ? 908 HOH A O   1 
HETATM 8717 O O   . HOH L 7 .   ? 0.518   -21.763 35.608  1.00 60.76  ? 909 HOH A O   1 
HETATM 8718 O O   . HOH L 7 .   ? -13.158 -33.167 15.120  1.00 57.10  ? 910 HOH A O   1 
HETATM 8719 O O   . HOH M 7 .   ? 3.884   -72.760 -33.486 1.00 39.51  ? 701 HOH B O   1 
HETATM 8720 O O   . HOH M 7 .   ? 3.019   -60.446 -29.445 1.00 38.01  ? 702 HOH B O   1 
HETATM 8721 O O   . HOH M 7 .   ? 10.079  -62.585 -15.399 1.00 42.50  ? 703 HOH B O   1 
HETATM 8722 O O   . HOH M 7 .   ? -1.674  -46.005 -32.322 1.00 43.95  ? 704 HOH B O   1 
HETATM 8723 O O   . HOH M 7 .   ? 10.323  -63.302 -33.072 1.00 44.20  ? 705 HOH B O   1 
HETATM 8724 O O   . HOH M 7 .   ? 4.439   -66.676 -26.081 1.00 38.73  ? 706 HOH B O   1 
HETATM 8725 O O   . HOH M 7 .   ? -10.874 -72.857 -4.949  1.00 53.06  ? 707 HOH B O   1 
HETATM 8726 O O   . HOH M 7 .   ? 4.275   -70.503 -41.252 1.00 39.40  ? 708 HOH B O   1 
HETATM 8727 O O   . HOH M 7 .   ? 12.390  -60.458 -29.234 1.00 45.53  ? 709 HOH B O   1 
HETATM 8728 O O   . HOH M 7 .   ? 16.322  -83.008 -23.919 1.00 54.90  ? 710 HOH B O   1 
HETATM 8729 O O   . HOH M 7 .   ? 5.490   -63.091 -36.670 1.00 44.93  ? 711 HOH B O   1 
HETATM 8730 O O   . HOH M 7 .   ? -7.174  -74.388 -9.423  1.00 46.66  ? 712 HOH B O   1 
HETATM 8731 O O   . HOH M 7 .   ? 8.687   -50.443 -21.683 1.00 51.93  ? 713 HOH B O   1 
HETATM 8732 O O   . HOH M 7 .   ? 15.461  -49.965 -9.708  1.00 53.56  ? 714 HOH B O   1 
HETATM 8733 O O   . HOH M 7 .   ? -0.149  -65.360 -49.542 1.00 41.34  ? 715 HOH B O   1 
HETATM 8734 O O   . HOH M 7 .   ? 16.804  -62.395 -35.241 1.00 53.69  ? 716 HOH B O   1 
HETATM 8735 O O   . HOH M 7 .   ? -14.277 -72.689 -10.961 0.97 44.35  ? 717 HOH B O   1 
HETATM 8736 O O   . HOH M 7 .   ? -9.897  -78.966 -27.911 1.00 48.79  ? 718 HOH B O   1 
HETATM 8737 O O   . HOH M 7 .   ? -4.845  -51.233 -32.239 1.00 46.15  ? 719 HOH B O   1 
HETATM 8738 O O   . HOH M 7 .   ? -8.231  -72.309 -47.636 1.00 57.07  ? 720 HOH B O   1 
HETATM 8739 O O   . HOH M 7 .   ? 10.205  -61.658 -6.036  1.00 55.43  ? 721 HOH B O   1 
HETATM 8740 O O   . HOH M 7 .   ? -5.136  -58.919 -46.358 1.00 49.31  ? 722 HOH B O   1 
HETATM 8741 O O   . HOH M 7 .   ? -10.937 -45.486 -25.472 1.00 55.21  ? 723 HOH B O   1 
HETATM 8742 O O   . HOH M 7 .   ? 12.032  -52.226 -44.783 1.00 56.01  ? 724 HOH B O   1 
HETATM 8743 O O   . HOH M 7 .   ? 15.148  -42.435 -5.889  1.00 56.18  ? 725 HOH B O   1 
HETATM 8744 O O   . HOH M 7 .   ? 12.783  -70.692 -29.519 1.00 51.65  ? 726 HOH B O   1 
HETATM 8745 O O   . HOH M 7 .   ? 6.837   -54.004 -35.833 1.00 45.26  ? 727 HOH B O   1 
HETATM 8746 O O   . HOH M 7 .   ? 13.310  -75.329 -9.697  1.00 57.04  ? 728 HOH B O   1 
HETATM 8747 O O   . HOH M 7 .   ? 23.428  -67.043 -11.585 0.99 57.80  ? 729 HOH B O   1 
HETATM 8748 O O   . HOH M 7 .   ? 1.175   -37.148 -31.117 0.90 49.95  ? 730 HOH B O   1 
HETATM 8749 O O   . HOH M 7 .   ? 8.167   -61.465 -9.768  1.00 50.41  ? 731 HOH B O   1 
HETATM 8750 O O   . HOH M 7 .   ? 3.773   -80.422 -9.598  0.96 56.54  ? 732 HOH B O   1 
HETATM 8751 O O   . HOH M 7 .   ? 10.022  -71.711 -22.559 0.93 47.27  ? 733 HOH B O   1 
HETATM 8752 O O   . HOH M 7 .   ? -6.396  -65.178 -5.168  1.00 50.53  ? 734 HOH B O   1 
HETATM 8753 O O   . HOH M 7 .   ? -0.347  -53.831 -41.790 1.00 41.66  ? 735 HOH B O   1 
HETATM 8754 O O   . HOH M 7 .   ? -4.987  -50.333 -38.193 0.96 44.31  ? 736 HOH B O   1 
HETATM 8755 O O   . HOH M 7 .   ? -9.221  -53.498 -18.684 0.99 64.16  ? 737 HOH B O   1 
HETATM 8756 O O   . HOH M 7 .   ? 2.519   -36.610 -28.479 1.00 63.11  ? 738 HOH B O   1 
HETATM 8757 O O   . HOH M 7 .   ? 21.200  -57.916 0.787   1.00 64.50  ? 739 HOH B O   1 
HETATM 8758 O O   . HOH M 7 .   ? -12.807 -75.979 -5.915  1.00 59.93  ? 740 HOH B O   1 
HETATM 8759 O O   . HOH M 7 .   ? 1.430   -36.751 -8.700  1.00 68.09  ? 741 HOH B O   1 
HETATM 8760 O O   . HOH M 7 .   ? -6.113  -53.874 -20.596 0.91 45.16  ? 742 HOH B O   1 
HETATM 8761 O O   . HOH M 7 .   ? 4.298   -56.908 -38.073 1.00 37.01  ? 743 HOH B O   1 
HETATM 8762 O O   . HOH M 7 .   ? -0.982  -46.960 -29.772 0.91 45.89  ? 744 HOH B O   1 
HETATM 8763 O O   . HOH M 7 .   ? 4.277   -72.154 -47.935 1.00 45.78  ? 745 HOH B O   1 
HETATM 8764 O O   . HOH M 7 .   ? 9.410   -52.117 -46.503 1.00 55.91  ? 746 HOH B O   1 
HETATM 8765 O O   . HOH M 7 .   ? 4.430   -69.920 -49.473 1.00 46.95  ? 747 HOH B O   1 
HETATM 8766 O O   . HOH M 7 .   ? 6.949   -51.197 -28.422 1.00 49.44  ? 748 HOH B O   1 
HETATM 8767 O O   . HOH M 7 .   ? 12.468  -43.191 -12.079 0.98 53.42  ? 749 HOH B O   1 
HETATM 8768 O O   . HOH M 7 .   ? 4.695   -43.326 -12.149 1.00 51.34  ? 750 HOH B O   1 
HETATM 8769 O O   . HOH M 7 .   ? 17.603  -70.163 -21.862 1.00 65.37  ? 751 HOH B O   1 
HETATM 8770 O O   . HOH M 7 .   ? -19.027 -53.603 -30.805 1.00 61.93  ? 752 HOH B O   1 
HETATM 8771 O O   . HOH M 7 .   ? 1.769   -55.016 -43.114 0.89 41.10  ? 753 HOH B O   1 
HETATM 8772 O O   . HOH M 7 .   ? -16.469 -56.751 -26.969 1.00 55.42  ? 754 HOH B O   1 
HETATM 8773 O O   . HOH M 7 .   ? 10.295  -58.797 8.380   1.00 57.02  ? 755 HOH B O   1 
HETATM 8774 O O   . HOH M 7 .   ? -2.923  -39.284 -24.270 1.00 60.75  ? 756 HOH B O   1 
HETATM 8775 O O   . HOH M 7 .   ? -17.114 -47.139 -32.188 1.00 40.56  ? 757 HOH B O   1 
HETATM 8776 O O   . HOH M 7 .   ? 6.820   -65.089 -29.231 1.00 40.54  ? 758 HOH B O   1 
HETATM 8777 O O   . HOH M 7 .   ? 2.492   -69.505 -17.190 0.95 42.97  ? 759 HOH B O   1 
HETATM 8778 O O   . HOH M 7 .   ? 12.740  -49.619 -21.138 1.00 41.39  ? 760 HOH B O   1 
HETATM 8779 O O   . HOH M 7 .   ? 0.793   -68.209 -32.816 1.00 36.62  ? 761 HOH B O   1 
HETATM 8780 O O   . HOH M 7 .   ? 1.560   -51.293 -23.622 1.00 41.13  ? 762 HOH B O   1 
HETATM 8781 O O   . HOH M 7 .   ? 7.678   -78.708 -36.519 1.00 50.93  ? 763 HOH B O   1 
HETATM 8782 O O   . HOH M 7 .   ? 7.937   -54.275 -33.337 0.86 41.78  ? 764 HOH B O   1 
HETATM 8783 O O   . HOH M 7 .   ? 5.152   -67.183 -18.853 1.00 43.13  ? 765 HOH B O   1 
HETATM 8784 O O   . HOH M 7 .   ? 3.291   -53.465 -29.066 0.96 39.92  ? 766 HOH B O   1 
HETATM 8785 O O   . HOH M 7 .   ? 5.255   -61.288 -9.354  0.99 49.27  ? 767 HOH B O   1 
HETATM 8786 O O   . HOH M 7 .   ? 7.357   -67.249 -38.982 1.00 44.01  ? 768 HOH B O   1 
HETATM 8787 O O   . HOH M 7 .   ? -2.597  -49.009 -30.497 0.97 38.62  ? 769 HOH B O   1 
HETATM 8788 O O   . HOH M 7 .   ? -12.033 -52.234 -29.573 0.93 49.22  ? 770 HOH B O   1 
HETATM 8789 O O   . HOH M 7 .   ? -11.793 -52.778 -33.113 1.00 54.47  ? 771 HOH B O   1 
HETATM 8790 O O   . HOH M 7 .   ? -1.664  -49.239 -21.855 1.00 52.16  ? 772 HOH B O   1 
HETATM 8791 O O   . HOH M 7 .   ? 0.698   -48.627 -22.994 1.00 46.44  ? 773 HOH B O   1 
HETATM 8792 O O   . HOH M 7 .   ? 10.260  -44.338 1.821   1.00 61.52  ? 774 HOH B O   1 
HETATM 8793 O O   . HOH M 7 .   ? 0.982   -47.591 -14.782 0.98 55.53  ? 775 HOH B O   1 
HETATM 8794 O O   . HOH M 7 .   ? 6.719   -78.464 -55.506 1.00 49.20  ? 776 HOH B O   1 
HETATM 8795 O O   . HOH M 7 .   ? 7.970   -54.306 -46.759 1.00 49.18  ? 777 HOH B O   1 
HETATM 8796 O O   . HOH M 7 .   ? 7.894   -56.862 -46.571 0.99 50.86  ? 778 HOH B O   1 
HETATM 8797 O O   . HOH M 7 .   ? -5.060  -55.829 -12.011 1.00 48.18  ? 779 HOH B O   1 
HETATM 8798 O O   . HOH M 7 .   ? -10.951 -50.407 -42.646 1.00 54.76  ? 780 HOH B O   1 
HETATM 8799 O O   . HOH M 7 .   ? 7.088   -63.964 -46.967 0.84 41.77  ? 781 HOH B O   1 
HETATM 8800 O O   . HOH M 7 .   ? -1.950  -65.437 -1.142  1.00 52.80  ? 782 HOH B O   1 
HETATM 8801 O O   . HOH M 7 .   ? -0.456  -68.195 -1.855  1.00 51.96  ? 783 HOH B O   1 
HETATM 8802 O O   . HOH M 7 .   ? -2.716  -54.252 -11.857 1.00 44.69  ? 784 HOH B O   1 
HETATM 8803 O O   . HOH M 7 .   ? -13.613 -78.080 -40.440 1.00 48.98  ? 785 HOH B O   1 
HETATM 8804 O O   . HOH M 7 .   ? 1.901   -86.564 -22.426 1.00 49.62  ? 786 HOH B O   1 
HETATM 8805 O O   . HOH M 7 .   ? 7.503   -73.745 -34.159 0.99 51.42  ? 787 HOH B O   1 
HETATM 8806 O O   . HOH M 7 .   ? 5.472   -52.263 -15.501 1.00 48.10  ? 788 HOH B O   1 
HETATM 8807 O O   . HOH M 7 .   ? 6.635   -71.977 -46.553 1.00 47.56  ? 789 HOH B O   1 
HETATM 8808 O O   . HOH M 7 .   ? -5.551  -76.036 -55.896 1.00 47.01  ? 790 HOH B O   1 
HETATM 8809 O O   . HOH M 7 .   ? 13.676  -70.213 -32.304 1.00 54.70  ? 791 HOH B O   1 
HETATM 8810 O O   . HOH M 7 .   ? 19.496  -59.529 -27.051 1.00 59.31  ? 792 HOH B O   1 
HETATM 8811 O O   . HOH M 7 .   ? 11.209  -58.581 -0.627  1.00 48.36  ? 793 HOH B O   1 
HETATM 8812 O O   . HOH M 7 .   ? 14.741  -67.611 -32.325 0.88 49.57  ? 794 HOH B O   1 
HETATM 8813 O O   . HOH M 7 .   ? -16.236 -79.280 -27.281 1.00 52.01  ? 795 HOH B O   1 
HETATM 8814 O O   . HOH M 7 .   ? -9.201  -37.096 -41.555 1.00 67.74  ? 796 HOH B O   1 
HETATM 8815 O O   . HOH M 7 .   ? 4.240   -51.784 -30.561 1.00 44.92  ? 797 HOH B O   1 
HETATM 8816 O O   . HOH M 7 .   ? 3.959   -52.253 -47.632 1.00 48.36  ? 798 HOH B O   1 
HETATM 8817 O O   . HOH M 7 .   ? 10.757  -57.685 1.607   1.00 47.69  ? 799 HOH B O   1 
HETATM 8818 O O   . HOH M 7 .   ? 4.224   -79.505 -6.415  1.00 51.68  ? 800 HOH B O   1 
HETATM 8819 O O   . HOH M 7 .   ? 8.510   -70.296 -47.755 1.00 46.26  ? 801 HOH B O   1 
HETATM 8820 O O   . HOH M 7 .   ? 4.529   -56.936 -40.742 0.98 48.06  ? 802 HOH B O   1 
HETATM 8821 O O   . HOH M 7 .   ? 15.830  -73.359 -20.722 0.97 57.17  ? 803 HOH B O   1 
HETATM 8822 O O   . HOH M 7 .   ? 6.139   -39.708 -26.621 1.00 57.00  ? 804 HOH B O   1 
HETATM 8823 O O   . HOH M 7 .   ? 15.111  -54.090 -34.697 1.00 53.04  ? 805 HOH B O   1 
HETATM 8824 O O   . HOH M 7 .   ? -13.345 -84.444 -30.979 1.00 61.15  ? 806 HOH B O   1 
HETATM 8825 O O   . HOH M 7 .   ? 12.792  -88.450 -25.945 1.00 62.03  ? 807 HOH B O   1 
HETATM 8826 O O   . HOH M 7 .   ? -0.555  -64.880 -46.896 1.00 41.01  ? 808 HOH B O   1 
HETATM 8827 O O   . HOH M 7 .   ? 0.767   -62.843 -46.158 1.00 37.83  ? 809 HOH B O   1 
HETATM 8828 O O   . HOH M 7 .   ? 0.323   -61.570 -1.233  1.00 54.92  ? 810 HOH B O   1 
HETATM 8829 O O   . HOH M 7 .   ? 2.682   -49.865 -47.511 0.85 47.06  ? 811 HOH B O   1 
HETATM 8830 O O   . HOH M 7 .   ? 4.890   -79.892 -29.192 1.00 45.58  ? 812 HOH B O   1 
HETATM 8831 O O   . HOH M 7 .   ? 8.142   -63.268 -7.388  1.00 56.91  ? 813 HOH B O   1 
HETATM 8832 O O   . HOH M 7 .   ? -1.432  -63.162 0.261   1.00 60.35  ? 814 HOH B O   1 
HETATM 8833 O O   . HOH M 7 .   ? -11.088 -68.505 -43.836 1.00 60.04  ? 815 HOH B O   1 
HETATM 8834 O O   . HOH M 7 .   ? 11.298  -48.273 9.064   1.00 48.17  ? 816 HOH B O   1 
HETATM 8835 O O   . HOH M 7 .   ? -10.959 -47.126 -35.005 0.93 53.33  ? 817 HOH B O   1 
HETATM 8836 O O   . HOH M 7 .   ? -7.255  -60.398 -6.398  1.00 52.15  ? 818 HOH B O   1 
HETATM 8837 O O   . HOH M 7 .   ? -1.362  -58.295 -51.442 1.00 57.63  ? 819 HOH B O   1 
HETATM 8838 O O   . HOH M 7 .   ? -12.338 -50.907 -40.678 1.00 61.33  ? 820 HOH B O   1 
HETATM 8839 O O   . HOH M 7 .   ? 22.299  -64.979 -9.547  1.00 59.04  ? 821 HOH B O   1 
HETATM 8840 O O   . HOH M 7 .   ? -16.778 -71.412 -10.647 0.96 64.04  ? 822 HOH B O   1 
HETATM 8841 O O   . HOH M 7 .   ? 9.662   -85.366 -12.942 0.90 47.71  ? 823 HOH B O   1 
HETATM 8842 O O   . HOH M 7 .   ? 0.574   -44.132 -50.024 0.89 47.75  ? 824 HOH B O   1 
HETATM 8843 O O   . HOH M 7 .   ? -18.242 -59.815 -24.101 1.00 58.24  ? 825 HOH B O   1 
HETATM 8844 O O   . HOH M 7 .   ? -8.120  -83.572 -48.537 1.00 54.64  ? 826 HOH B O   1 
HETATM 8845 O O   . HOH M 7 .   ? -11.491 -70.813 -45.486 1.00 63.62  ? 827 HOH B O   1 
HETATM 8846 O O   . HOH M 7 .   ? -2.674  -45.007 -49.021 0.83 58.77  ? 828 HOH B O   1 
HETATM 8847 O O   . HOH M 7 .   ? -9.566  -40.715 -50.927 1.00 71.24  ? 829 HOH B O   1 
HETATM 8848 O O   . HOH M 7 .   ? -19.897 -58.223 -24.875 1.00 65.59  ? 830 HOH B O   1 
HETATM 8849 O O   . HOH M 7 .   ? -5.099  -87.699 -49.335 1.00 70.38  ? 831 HOH B O   1 
HETATM 8850 O O   . HOH M 7 .   ? -11.849 -52.798 -38.835 0.94 57.42  ? 832 HOH B O   1 
HETATM 8851 O O   . HOH M 7 .   ? 9.145   -63.551 -29.163 1.00 39.77  ? 833 HOH B O   1 
HETATM 8852 O O   . HOH M 7 .   ? 2.465   -57.198 -42.338 0.89 42.05  ? 834 HOH B O   1 
HETATM 8853 O O   . HOH M 7 .   ? 17.269  -52.161 6.256   1.00 52.33  ? 835 HOH B O   1 
HETATM 8854 O O   . HOH M 7 .   ? 15.170  -71.796 -22.439 1.00 57.58  ? 836 HOH B O   1 
HETATM 8855 O O   . HOH M 7 .   ? 19.725  -45.577 -1.073  1.00 56.41  ? 837 HOH B O   1 
HETATM 8856 O O   . HOH M 7 .   ? 23.375  -78.965 -26.572 1.00 68.08  ? 838 HOH B O   1 
HETATM 8857 O O   . HOH M 7 .   ? 22.941  -64.723 -18.032 1.00 54.96  ? 839 HOH B O   1 
HETATM 8858 O O   . HOH M 7 .   ? -0.013  -37.121 -6.223  1.00 63.07  ? 840 HOH B O   1 
HETATM 8859 O O   . HOH M 7 .   ? -8.115  -69.253 -47.538 1.00 63.96  ? 841 HOH B O   1 
HETATM 8860 O O   . HOH M 7 .   ? -16.036 -68.564 -3.760  0.86 56.39  ? 842 HOH B O   1 
HETATM 8861 O O   . HOH M 7 .   ? 10.251  -63.110 -21.246 0.76 54.17  ? 843 HOH B O   1 
HETATM 8862 O O   . HOH M 7 .   ? 9.870   -61.156 -27.970 0.91 40.43  ? 844 HOH B O   1 
HETATM 8863 O O   . HOH M 7 .   ? 14.491  -61.093 -27.339 0.94 48.32  ? 845 HOH B O   1 
HETATM 8864 O O   . HOH M 7 .   ? -3.970  -56.859 4.018   1.00 53.42  ? 846 HOH B O   1 
HETATM 8865 O O   . HOH M 7 .   ? -3.423  -55.929 1.569   1.00 59.71  ? 847 HOH B O   1 
HETATM 8866 O O   . HOH M 7 .   ? 6.439   -51.205 -35.238 1.00 51.33  ? 848 HOH B O   1 
HETATM 8867 O O   . HOH M 7 .   ? -0.727  -68.849 -53.323 1.00 59.28  ? 849 HOH B O   1 
HETATM 8868 O O   . HOH M 7 .   ? 4.964   -44.019 2.047   1.00 57.91  ? 850 HOH B O   1 
HETATM 8869 O O   . HOH M 7 .   ? 12.435  -62.583 -8.616  1.00 56.33  ? 851 HOH B O   1 
HETATM 8870 O O   . HOH M 7 .   ? -9.309  -54.083 -10.976 1.00 62.44  ? 852 HOH B O   1 
HETATM 8871 O O   . HOH M 7 .   ? 2.154   -54.707 3.098   1.00 61.64  ? 853 HOH B O   1 
HETATM 8872 O O   . HOH M 7 .   ? 15.310  -60.018 -42.027 1.00 57.35  ? 854 HOH B O   1 
HETATM 8873 O O   . HOH M 7 .   ? -8.888  -67.529 -45.265 1.00 53.34  ? 855 HOH B O   1 
HETATM 8874 O O   . HOH M 7 .   ? 5.298   -64.000 -9.812  0.97 52.92  ? 856 HOH B O   1 
HETATM 8875 O O   . HOH M 7 .   ? 10.773  -58.695 3.894   1.00 58.09  ? 857 HOH B O   1 
HETATM 8876 O O   . HOH M 7 .   ? 9.068   -43.467 -6.058  1.00 52.37  ? 858 HOH B O   1 
HETATM 8877 O O   . HOH M 7 .   ? -10.164 -60.234 -7.695  1.00 52.69  ? 859 HOH B O   1 
HETATM 8878 O O   . HOH M 7 .   ? -11.830 -57.974 -8.117  1.00 78.36  ? 860 HOH B O   1 
HETATM 8879 O O   . HOH M 7 .   ? -11.182 -39.837 -39.272 1.00 66.55  ? 861 HOH B O   1 
HETATM 8880 O O   . HOH M 7 .   ? 0.573   -39.587 -22.547 1.00 64.66  ? 862 HOH B O   1 
HETATM 8881 O O   . HOH M 7 .   ? 17.981  -51.620 -16.408 1.00 59.23  ? 863 HOH B O   1 
HETATM 8882 O O   . HOH M 7 .   ? 11.012  -51.716 -22.047 1.00 64.23  ? 864 HOH B O   1 
HETATM 8883 O O   . HOH M 7 .   ? 9.625   -53.900 -21.729 1.00 60.34  ? 865 HOH B O   1 
HETATM 8884 O O   . HOH M 7 .   ? 1.194   -89.378 -34.868 1.00 63.79  ? 866 HOH B O   1 
HETATM 8885 O O   . HOH M 7 .   ? 7.182   -84.975 -12.429 1.00 58.23  ? 867 HOH B O   1 
HETATM 8886 O O   . HOH M 7 .   ? 19.940  -85.642 -25.168 1.00 58.79  ? 868 HOH B O   1 
HETATM 8887 O O   . HOH M 7 .   ? 10.025  -68.973 -45.487 1.00 55.92  ? 869 HOH B O   1 
HETATM 8888 O O   . HOH M 7 .   ? 11.374  -78.219 -9.305  1.00 60.67  ? 870 HOH B O   1 
HETATM 8889 O O   . HOH M 7 .   ? 16.669  -86.892 -14.089 1.00 67.47  ? 871 HOH B O   1 
HETATM 8890 O O   . HOH M 7 .   ? 5.731   -86.741 -27.940 1.00 58.59  ? 872 HOH B O   1 
HETATM 8891 O O   . HOH M 7 .   ? -5.018  -55.985 -45.325 0.91 45.69  ? 873 HOH B O   1 
HETATM 8892 O O   . HOH M 7 .   ? 12.448  -77.662 -31.694 1.00 73.90  ? 874 HOH B O   1 
HETATM 8893 O O   . HOH M 7 .   ? 12.395  -68.107 -7.499  0.92 59.14  ? 875 HOH B O   1 
HETATM 8894 O O   . HOH M 7 .   ? 14.665  -66.342 -6.692  1.00 65.35  ? 876 HOH B O   1 
HETATM 8895 O O   . HOH M 7 .   ? 10.501  -65.875 -5.835  1.00 69.92  ? 877 HOH B O   1 
HETATM 8896 O O   . HOH M 7 .   ? -4.393  -67.000 -54.437 1.00 57.92  ? 878 HOH B O   1 
HETATM 8897 O O   . HOH M 7 .   ? -3.454  -69.979 -58.679 1.00 57.39  ? 879 HOH B O   1 
HETATM 8898 O O   . HOH M 7 .   ? -14.560 -59.850 -37.586 1.00 57.75  ? 880 HOH B O   1 
HETATM 8899 O O   . HOH M 7 .   ? -15.201 -57.192 -33.719 1.00 58.57  ? 881 HOH B O   1 
HETATM 8900 O O   . HOH M 7 .   ? -8.997  -84.503 -46.096 1.00 59.19  ? 882 HOH B O   1 
HETATM 8901 O O   . HOH M 7 .   ? 15.173  -51.366 -34.726 0.98 54.01  ? 883 HOH B O   1 
HETATM 8902 O O   . HOH M 7 .   ? -2.926  -91.078 -33.506 1.00 64.60  ? 884 HOH B O   1 
HETATM 8903 O O   . HOH M 7 .   ? 8.048   -59.294 -24.131 1.00 62.40  ? 885 HOH B O   1 
HETATM 8904 O O   . HOH M 7 .   ? 9.669   -60.822 -25.425 1.00 60.69  ? 886 HOH B O   1 
HETATM 8905 O O   . HOH M 7 .   ? 10.851  -77.755 -42.796 1.00 61.16  ? 887 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   ?   ?   ?   A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 ?   ?   ?   A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 ?   ?   ?   A . n 
A 1 263 GLY 263 264 ?   ?   ?   A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 493 ARG ARG A . n 
A 1 493 ASP 493 494 494 ASP ASP A . n 
A 1 494 PRO 494 495 ?   ?   ?   A . n 
A 1 495 LYS 495 496 ?   ?   ?   A . n 
A 1 496 ALA 496 497 ?   ?   ?   A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 542 ALA ALA A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   ?   ?   ?   B . n 
B 1 3   GLU 3   4   4   GLU GLU B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 259 PRO PRO B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 262 THR THR B . n 
B 1 262 GLY 262 263 263 GLY GLY B . n 
B 1 263 GLY 263 264 264 GLY GLY B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 ?   ?   ?   B . n 
B 1 493 ASP 493 494 ?   ?   ?   B . n 
B 1 494 PRO 494 495 495 PRO PRO B . n 
B 1 495 LYS 495 496 496 LYS LYS B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 EDO 1   604 1   EDO EDO A . 
F 3 EDO 1   605 3   EDO EDO A . 
G 4 NAG 1   604 4   NAG NAG B . 
H 3 EDO 1   605 2   EDO EDO B . 
I 5 NO3 1   606 1   NO3 NO3 B . 
J 5 NO3 1   607 2   NO3 NO3 B . 
K 6 PE8 1   608 1   PE8 PE8 B . 
L 7 HOH 1   701 1   HOH HOH A . 
L 7 HOH 2   702 2   HOH HOH A . 
L 7 HOH 3   703 3   HOH HOH A . 
L 7 HOH 4   704 4   HOH HOH A . 
L 7 HOH 5   705 6   HOH HOH A . 
L 7 HOH 6   706 7   HOH HOH A . 
L 7 HOH 7   707 8   HOH HOH A . 
L 7 HOH 8   708 9   HOH HOH A . 
L 7 HOH 9   709 10  HOH HOH A . 
L 7 HOH 10  710 12  HOH HOH A . 
L 7 HOH 11  711 15  HOH HOH A . 
L 7 HOH 12  712 18  HOH HOH A . 
L 7 HOH 13  713 20  HOH HOH A . 
L 7 HOH 14  714 21  HOH HOH A . 
L 7 HOH 15  715 22  HOH HOH A . 
L 7 HOH 16  716 24  HOH HOH A . 
L 7 HOH 17  717 25  HOH HOH A . 
L 7 HOH 18  718 27  HOH HOH A . 
L 7 HOH 19  719 28  HOH HOH A . 
L 7 HOH 20  720 29  HOH HOH A . 
L 7 HOH 21  721 30  HOH HOH A . 
L 7 HOH 22  722 33  HOH HOH A . 
L 7 HOH 23  723 34  HOH HOH A . 
L 7 HOH 24  724 35  HOH HOH A . 
L 7 HOH 25  725 40  HOH HOH A . 
L 7 HOH 26  726 41  HOH HOH A . 
L 7 HOH 27  727 42  HOH HOH A . 
L 7 HOH 28  728 43  HOH HOH A . 
L 7 HOH 29  729 45  HOH HOH A . 
L 7 HOH 30  730 50  HOH HOH A . 
L 7 HOH 31  731 51  HOH HOH A . 
L 7 HOH 32  732 55  HOH HOH A . 
L 7 HOH 33  733 59  HOH HOH A . 
L 7 HOH 34  734 60  HOH HOH A . 
L 7 HOH 35  735 62  HOH HOH A . 
L 7 HOH 36  736 63  HOH HOH A . 
L 7 HOH 37  737 67  HOH HOH A . 
L 7 HOH 38  738 70  HOH HOH A . 
L 7 HOH 39  739 72  HOH HOH A . 
L 7 HOH 40  740 73  HOH HOH A . 
L 7 HOH 41  741 74  HOH HOH A . 
L 7 HOH 42  742 75  HOH HOH A . 
L 7 HOH 43  743 76  HOH HOH A . 
L 7 HOH 44  744 77  HOH HOH A . 
L 7 HOH 45  745 78  HOH HOH A . 
L 7 HOH 46  746 79  HOH HOH A . 
L 7 HOH 47  747 82  HOH HOH A . 
L 7 HOH 48  748 84  HOH HOH A . 
L 7 HOH 49  749 91  HOH HOH A . 
L 7 HOH 50  750 92  HOH HOH A . 
L 7 HOH 51  751 93  HOH HOH A . 
L 7 HOH 52  752 94  HOH HOH A . 
L 7 HOH 53  753 96  HOH HOH A . 
L 7 HOH 54  754 98  HOH HOH A . 
L 7 HOH 55  755 99  HOH HOH A . 
L 7 HOH 56  756 100 HOH HOH A . 
L 7 HOH 57  757 103 HOH HOH A . 
L 7 HOH 58  758 105 HOH HOH A . 
L 7 HOH 59  759 107 HOH HOH A . 
L 7 HOH 60  760 108 HOH HOH A . 
L 7 HOH 61  761 109 HOH HOH A . 
L 7 HOH 62  762 112 HOH HOH A . 
L 7 HOH 63  763 114 HOH HOH A . 
L 7 HOH 64  764 116 HOH HOH A . 
L 7 HOH 65  765 118 HOH HOH A . 
L 7 HOH 66  766 123 HOH HOH A . 
L 7 HOH 67  767 124 HOH HOH A . 
L 7 HOH 68  768 125 HOH HOH A . 
L 7 HOH 69  769 128 HOH HOH A . 
L 7 HOH 70  770 129 HOH HOH A . 
L 7 HOH 71  771 133 HOH HOH A . 
L 7 HOH 72  772 136 HOH HOH A . 
L 7 HOH 73  773 137 HOH HOH A . 
L 7 HOH 74  774 138 HOH HOH A . 
L 7 HOH 75  775 140 HOH HOH A . 
L 7 HOH 76  776 141 HOH HOH A . 
L 7 HOH 77  777 142 HOH HOH A . 
L 7 HOH 78  778 143 HOH HOH A . 
L 7 HOH 79  779 146 HOH HOH A . 
L 7 HOH 80  780 149 HOH HOH A . 
L 7 HOH 81  781 151 HOH HOH A . 
L 7 HOH 82  782 152 HOH HOH A . 
L 7 HOH 83  783 153 HOH HOH A . 
L 7 HOH 84  784 154 HOH HOH A . 
L 7 HOH 85  785 155 HOH HOH A . 
L 7 HOH 86  786 160 HOH HOH A . 
L 7 HOH 87  787 161 HOH HOH A . 
L 7 HOH 88  788 162 HOH HOH A . 
L 7 HOH 89  789 164 HOH HOH A . 
L 7 HOH 90  790 169 HOH HOH A . 
L 7 HOH 91  791 171 HOH HOH A . 
L 7 HOH 92  792 172 HOH HOH A . 
L 7 HOH 93  793 175 HOH HOH A . 
L 7 HOH 94  794 178 HOH HOH A . 
L 7 HOH 95  795 180 HOH HOH A . 
L 7 HOH 96  796 181 HOH HOH A . 
L 7 HOH 97  797 185 HOH HOH A . 
L 7 HOH 98  798 186 HOH HOH A . 
L 7 HOH 99  799 187 HOH HOH A . 
L 7 HOH 100 800 191 HOH HOH A . 
L 7 HOH 101 801 192 HOH HOH A . 
L 7 HOH 102 802 193 HOH HOH A . 
L 7 HOH 103 803 194 HOH HOH A . 
L 7 HOH 104 804 196 HOH HOH A . 
L 7 HOH 105 805 197 HOH HOH A . 
L 7 HOH 106 806 200 HOH HOH A . 
L 7 HOH 107 807 201 HOH HOH A . 
L 7 HOH 108 808 204 HOH HOH A . 
L 7 HOH 109 809 205 HOH HOH A . 
L 7 HOH 110 810 206 HOH HOH A . 
L 7 HOH 111 811 207 HOH HOH A . 
L 7 HOH 112 812 209 HOH HOH A . 
L 7 HOH 113 813 210 HOH HOH A . 
L 7 HOH 114 814 212 HOH HOH A . 
L 7 HOH 115 815 213 HOH HOH A . 
L 7 HOH 116 816 214 HOH HOH A . 
L 7 HOH 117 817 215 HOH HOH A . 
L 7 HOH 118 818 218 HOH HOH A . 
L 7 HOH 119 819 220 HOH HOH A . 
L 7 HOH 120 820 222 HOH HOH A . 
L 7 HOH 121 821 223 HOH HOH A . 
L 7 HOH 122 822 225 HOH HOH A . 
L 7 HOH 123 823 231 HOH HOH A . 
L 7 HOH 124 824 237 HOH HOH A . 
L 7 HOH 125 825 242 HOH HOH A . 
L 7 HOH 126 826 243 HOH HOH A . 
L 7 HOH 127 827 244 HOH HOH A . 
L 7 HOH 128 828 247 HOH HOH A . 
L 7 HOH 129 829 248 HOH HOH A . 
L 7 HOH 130 830 250 HOH HOH A . 
L 7 HOH 131 831 252 HOH HOH A . 
L 7 HOH 132 832 255 HOH HOH A . 
L 7 HOH 133 833 256 HOH HOH A . 
L 7 HOH 134 834 257 HOH HOH A . 
L 7 HOH 135 835 259 HOH HOH A . 
L 7 HOH 136 836 260 HOH HOH A . 
L 7 HOH 137 837 261 HOH HOH A . 
L 7 HOH 138 838 263 HOH HOH A . 
L 7 HOH 139 839 264 HOH HOH A . 
L 7 HOH 140 840 265 HOH HOH A . 
L 7 HOH 141 841 267 HOH HOH A . 
L 7 HOH 142 842 268 HOH HOH A . 
L 7 HOH 143 843 270 HOH HOH A . 
L 7 HOH 144 844 272 HOH HOH A . 
L 7 HOH 145 845 274 HOH HOH A . 
L 7 HOH 146 846 276 HOH HOH A . 
L 7 HOH 147 847 277 HOH HOH A . 
L 7 HOH 148 848 284 HOH HOH A . 
L 7 HOH 149 849 285 HOH HOH A . 
L 7 HOH 150 850 287 HOH HOH A . 
L 7 HOH 151 851 288 HOH HOH A . 
L 7 HOH 152 852 289 HOH HOH A . 
L 7 HOH 153 853 294 HOH HOH A . 
L 7 HOH 154 854 298 HOH HOH A . 
L 7 HOH 155 855 300 HOH HOH A . 
L 7 HOH 156 856 302 HOH HOH A . 
L 7 HOH 157 857 303 HOH HOH A . 
L 7 HOH 158 858 305 HOH HOH A . 
L 7 HOH 159 859 306 HOH HOH A . 
L 7 HOH 160 860 308 HOH HOH A . 
L 7 HOH 161 861 309 HOH HOH A . 
L 7 HOH 162 862 310 HOH HOH A . 
L 7 HOH 163 863 311 HOH HOH A . 
L 7 HOH 164 864 314 HOH HOH A . 
L 7 HOH 165 865 315 HOH HOH A . 
L 7 HOH 166 866 318 HOH HOH A . 
L 7 HOH 167 867 322 HOH HOH A . 
L 7 HOH 168 868 330 HOH HOH A . 
L 7 HOH 169 869 332 HOH HOH A . 
L 7 HOH 170 870 336 HOH HOH A . 
L 7 HOH 171 871 337 HOH HOH A . 
L 7 HOH 172 872 338 HOH HOH A . 
L 7 HOH 173 873 339 HOH HOH A . 
L 7 HOH 174 874 340 HOH HOH A . 
L 7 HOH 175 875 343 HOH HOH A . 
L 7 HOH 176 876 344 HOH HOH A . 
L 7 HOH 177 877 345 HOH HOH A . 
L 7 HOH 178 878 346 HOH HOH A . 
L 7 HOH 179 879 348 HOH HOH A . 
L 7 HOH 180 880 349 HOH HOH A . 
L 7 HOH 181 881 350 HOH HOH A . 
L 7 HOH 182 882 351 HOH HOH A . 
L 7 HOH 183 883 352 HOH HOH A . 
L 7 HOH 184 884 355 HOH HOH A . 
L 7 HOH 185 885 359 HOH HOH A . 
L 7 HOH 186 886 360 HOH HOH A . 
L 7 HOH 187 887 361 HOH HOH A . 
L 7 HOH 188 888 362 HOH HOH A . 
L 7 HOH 189 889 364 HOH HOH A . 
L 7 HOH 190 890 369 HOH HOH A . 
L 7 HOH 191 891 371 HOH HOH A . 
L 7 HOH 192 892 372 HOH HOH A . 
L 7 HOH 193 893 373 HOH HOH A . 
L 7 HOH 194 894 374 HOH HOH A . 
L 7 HOH 195 895 375 HOH HOH A . 
L 7 HOH 196 896 376 HOH HOH A . 
L 7 HOH 197 897 378 HOH HOH A . 
L 7 HOH 198 898 384 HOH HOH A . 
L 7 HOH 199 899 385 HOH HOH A . 
L 7 HOH 200 900 390 HOH HOH A . 
L 7 HOH 201 901 392 HOH HOH A . 
L 7 HOH 202 902 393 HOH HOH A . 
L 7 HOH 203 903 396 HOH HOH A . 
L 7 HOH 204 904 397 HOH HOH A . 
L 7 HOH 205 905 403 HOH HOH A . 
L 7 HOH 206 906 404 HOH HOH A . 
L 7 HOH 207 907 407 HOH HOH A . 
L 7 HOH 208 908 410 HOH HOH A . 
L 7 HOH 209 909 412 HOH HOH A . 
L 7 HOH 210 910 413 HOH HOH A . 
M 7 HOH 1   701 5   HOH HOH B . 
M 7 HOH 2   702 11  HOH HOH B . 
M 7 HOH 3   703 13  HOH HOH B . 
M 7 HOH 4   704 14  HOH HOH B . 
M 7 HOH 5   705 16  HOH HOH B . 
M 7 HOH 6   706 17  HOH HOH B . 
M 7 HOH 7   707 19  HOH HOH B . 
M 7 HOH 8   708 23  HOH HOH B . 
M 7 HOH 9   709 26  HOH HOH B . 
M 7 HOH 10  710 31  HOH HOH B . 
M 7 HOH 11  711 32  HOH HOH B . 
M 7 HOH 12  712 36  HOH HOH B . 
M 7 HOH 13  713 37  HOH HOH B . 
M 7 HOH 14  714 38  HOH HOH B . 
M 7 HOH 15  715 39  HOH HOH B . 
M 7 HOH 16  716 44  HOH HOH B . 
M 7 HOH 17  717 46  HOH HOH B . 
M 7 HOH 18  718 47  HOH HOH B . 
M 7 HOH 19  719 48  HOH HOH B . 
M 7 HOH 20  720 49  HOH HOH B . 
M 7 HOH 21  721 52  HOH HOH B . 
M 7 HOH 22  722 53  HOH HOH B . 
M 7 HOH 23  723 54  HOH HOH B . 
M 7 HOH 24  724 56  HOH HOH B . 
M 7 HOH 25  725 57  HOH HOH B . 
M 7 HOH 26  726 58  HOH HOH B . 
M 7 HOH 27  727 61  HOH HOH B . 
M 7 HOH 28  728 64  HOH HOH B . 
M 7 HOH 29  729 65  HOH HOH B . 
M 7 HOH 30  730 66  HOH HOH B . 
M 7 HOH 31  731 68  HOH HOH B . 
M 7 HOH 32  732 69  HOH HOH B . 
M 7 HOH 33  733 71  HOH HOH B . 
M 7 HOH 34  734 80  HOH HOH B . 
M 7 HOH 35  735 81  HOH HOH B . 
M 7 HOH 36  736 83  HOH HOH B . 
M 7 HOH 37  737 85  HOH HOH B . 
M 7 HOH 38  738 86  HOH HOH B . 
M 7 HOH 39  739 87  HOH HOH B . 
M 7 HOH 40  740 88  HOH HOH B . 
M 7 HOH 41  741 89  HOH HOH B . 
M 7 HOH 42  742 90  HOH HOH B . 
M 7 HOH 43  743 95  HOH HOH B . 
M 7 HOH 44  744 97  HOH HOH B . 
M 7 HOH 45  745 101 HOH HOH B . 
M 7 HOH 46  746 102 HOH HOH B . 
M 7 HOH 47  747 104 HOH HOH B . 
M 7 HOH 48  748 106 HOH HOH B . 
M 7 HOH 49  749 110 HOH HOH B . 
M 7 HOH 50  750 113 HOH HOH B . 
M 7 HOH 51  751 115 HOH HOH B . 
M 7 HOH 52  752 117 HOH HOH B . 
M 7 HOH 53  753 119 HOH HOH B . 
M 7 HOH 54  754 120 HOH HOH B . 
M 7 HOH 55  755 121 HOH HOH B . 
M 7 HOH 56  756 122 HOH HOH B . 
M 7 HOH 57  757 126 HOH HOH B . 
M 7 HOH 58  758 127 HOH HOH B . 
M 7 HOH 59  759 130 HOH HOH B . 
M 7 HOH 60  760 131 HOH HOH B . 
M 7 HOH 61  761 132 HOH HOH B . 
M 7 HOH 62  762 134 HOH HOH B . 
M 7 HOH 63  763 135 HOH HOH B . 
M 7 HOH 64  764 139 HOH HOH B . 
M 7 HOH 65  765 144 HOH HOH B . 
M 7 HOH 66  766 145 HOH HOH B . 
M 7 HOH 67  767 147 HOH HOH B . 
M 7 HOH 68  768 148 HOH HOH B . 
M 7 HOH 69  769 150 HOH HOH B . 
M 7 HOH 70  770 156 HOH HOH B . 
M 7 HOH 71  771 157 HOH HOH B . 
M 7 HOH 72  772 158 HOH HOH B . 
M 7 HOH 73  773 159 HOH HOH B . 
M 7 HOH 74  774 163 HOH HOH B . 
M 7 HOH 75  775 165 HOH HOH B . 
M 7 HOH 76  776 166 HOH HOH B . 
M 7 HOH 77  777 167 HOH HOH B . 
M 7 HOH 78  778 168 HOH HOH B . 
M 7 HOH 79  779 170 HOH HOH B . 
M 7 HOH 80  780 173 HOH HOH B . 
M 7 HOH 81  781 174 HOH HOH B . 
M 7 HOH 82  782 176 HOH HOH B . 
M 7 HOH 83  783 177 HOH HOH B . 
M 7 HOH 84  784 179 HOH HOH B . 
M 7 HOH 85  785 182 HOH HOH B . 
M 7 HOH 86  786 183 HOH HOH B . 
M 7 HOH 87  787 184 HOH HOH B . 
M 7 HOH 88  788 188 HOH HOH B . 
M 7 HOH 89  789 189 HOH HOH B . 
M 7 HOH 90  790 190 HOH HOH B . 
M 7 HOH 91  791 195 HOH HOH B . 
M 7 HOH 92  792 198 HOH HOH B . 
M 7 HOH 93  793 199 HOH HOH B . 
M 7 HOH 94  794 202 HOH HOH B . 
M 7 HOH 95  795 203 HOH HOH B . 
M 7 HOH 96  796 208 HOH HOH B . 
M 7 HOH 97  797 211 HOH HOH B . 
M 7 HOH 98  798 216 HOH HOH B . 
M 7 HOH 99  799 217 HOH HOH B . 
M 7 HOH 100 800 219 HOH HOH B . 
M 7 HOH 101 801 221 HOH HOH B . 
M 7 HOH 102 802 224 HOH HOH B . 
M 7 HOH 103 803 226 HOH HOH B . 
M 7 HOH 104 804 227 HOH HOH B . 
M 7 HOH 105 805 228 HOH HOH B . 
M 7 HOH 106 806 229 HOH HOH B . 
M 7 HOH 107 807 230 HOH HOH B . 
M 7 HOH 108 808 232 HOH HOH B . 
M 7 HOH 109 809 233 HOH HOH B . 
M 7 HOH 110 810 234 HOH HOH B . 
M 7 HOH 111 811 235 HOH HOH B . 
M 7 HOH 112 812 238 HOH HOH B . 
M 7 HOH 113 813 239 HOH HOH B . 
M 7 HOH 114 814 240 HOH HOH B . 
M 7 HOH 115 815 241 HOH HOH B . 
M 7 HOH 116 816 245 HOH HOH B . 
M 7 HOH 117 817 246 HOH HOH B . 
M 7 HOH 118 818 251 HOH HOH B . 
M 7 HOH 119 819 258 HOH HOH B . 
M 7 HOH 120 820 262 HOH HOH B . 
M 7 HOH 121 821 266 HOH HOH B . 
M 7 HOH 122 822 271 HOH HOH B . 
M 7 HOH 123 823 273 HOH HOH B . 
M 7 HOH 124 824 278 HOH HOH B . 
M 7 HOH 125 825 280 HOH HOH B . 
M 7 HOH 126 826 281 HOH HOH B . 
M 7 HOH 127 827 282 HOH HOH B . 
M 7 HOH 128 828 283 HOH HOH B . 
M 7 HOH 129 829 286 HOH HOH B . 
M 7 HOH 130 830 290 HOH HOH B . 
M 7 HOH 131 831 291 HOH HOH B . 
M 7 HOH 132 832 292 HOH HOH B . 
M 7 HOH 133 833 295 HOH HOH B . 
M 7 HOH 134 834 296 HOH HOH B . 
M 7 HOH 135 835 297 HOH HOH B . 
M 7 HOH 136 836 299 HOH HOH B . 
M 7 HOH 137 837 301 HOH HOH B . 
M 7 HOH 138 838 304 HOH HOH B . 
M 7 HOH 139 839 307 HOH HOH B . 
M 7 HOH 140 840 313 HOH HOH B . 
M 7 HOH 141 841 316 HOH HOH B . 
M 7 HOH 142 842 317 HOH HOH B . 
M 7 HOH 143 843 325 HOH HOH B . 
M 7 HOH 144 844 327 HOH HOH B . 
M 7 HOH 145 845 333 HOH HOH B . 
M 7 HOH 146 846 334 HOH HOH B . 
M 7 HOH 147 847 335 HOH HOH B . 
M 7 HOH 148 848 341 HOH HOH B . 
M 7 HOH 149 849 342 HOH HOH B . 
M 7 HOH 150 850 347 HOH HOH B . 
M 7 HOH 151 851 353 HOH HOH B . 
M 7 HOH 152 852 354 HOH HOH B . 
M 7 HOH 153 853 356 HOH HOH B . 
M 7 HOH 154 854 357 HOH HOH B . 
M 7 HOH 155 855 358 HOH HOH B . 
M 7 HOH 156 856 363 HOH HOH B . 
M 7 HOH 157 857 365 HOH HOH B . 
M 7 HOH 158 858 366 HOH HOH B . 
M 7 HOH 159 859 367 HOH HOH B . 
M 7 HOH 160 860 368 HOH HOH B . 
M 7 HOH 161 861 370 HOH HOH B . 
M 7 HOH 162 862 377 HOH HOH B . 
M 7 HOH 163 863 379 HOH HOH B . 
M 7 HOH 164 864 380 HOH HOH B . 
M 7 HOH 165 865 381 HOH HOH B . 
M 7 HOH 166 866 382 HOH HOH B . 
M 7 HOH 167 867 383 HOH HOH B . 
M 7 HOH 168 868 386 HOH HOH B . 
M 7 HOH 169 869 387 HOH HOH B . 
M 7 HOH 170 870 388 HOH HOH B . 
M 7 HOH 171 871 389 HOH HOH B . 
M 7 HOH 172 872 391 HOH HOH B . 
M 7 HOH 173 873 394 HOH HOH B . 
M 7 HOH 174 874 395 HOH HOH B . 
M 7 HOH 175 875 398 HOH HOH B . 
M 7 HOH 176 876 399 HOH HOH B . 
M 7 HOH 177 877 400 HOH HOH B . 
M 7 HOH 178 878 401 HOH HOH B . 
M 7 HOH 179 879 402 HOH HOH B . 
M 7 HOH 180 880 405 HOH HOH B . 
M 7 HOH 181 881 406 HOH HOH B . 
M 7 HOH 182 882 408 HOH HOH B . 
M 7 HOH 183 883 409 HOH HOH B . 
M 7 HOH 184 884 411 HOH HOH B . 
M 7 HOH 185 885 415 HOH HOH B . 
M 7 HOH 186 886 416 HOH HOH B . 
M 7 HOH 187 887 417 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B ASN 349 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 349 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 264 B ASN 265 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5420  ? 
1 MORE         28    ? 
1 'SSA (A^2)'  38660 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-10-17 
2 'Structure model' 1 1 2012-12-12 
3 'Structure model' 1 2 2017-11-15 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
3 4 'Structure model' 'Atomic model'           
4 4 'Structure model' 'Data collection'        
5 4 'Structure model' 'Derived calculations'   
6 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' software                      
2  4 'Structure model' atom_site                     
3  4 'Structure model' chem_comp                     
4  4 'Structure model' entity                        
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' struct_asym                   
15 4 'Structure model' struct_conn                   
16 4 'Structure model' struct_site                   
17 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.occupancy'                   
14 4 'Structure model' '_atom_site.type_symbol'                 
15 4 'Structure model' '_chem_comp.name'                        
16 4 'Structure model' '_chem_comp.type'                        
17 4 'Structure model' '_entity.formula_weight'                 
18 4 'Structure model' '_entity.pdbx_description'               
19 4 'Structure model' '_entity.pdbx_number_of_molecules'       
20 4 'Structure model' '_entity.src_method'                     
21 4 'Structure model' '_entity.type'                           
22 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
23 4 'Structure model' '_struct_conn.pdbx_dist_value'           
24 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
25 4 'Structure model' '_struct_conn.pdbx_role'                 
26 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
27 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
28 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
29 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
30 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
31 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
32 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
33 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
34 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
35 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
36 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
37 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
38 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data reduction'  
http://www.hkl-xray.com/                  ?   ? 
2 SCALEPACK   .        ?                package 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                  ?   ? 
3 PHENIX      1.8_1069 ?                package 'Paul D. Adams'      PDAdams@lbl.gov          refinement        
http://www.phenix-online.org/             C++ ? 
4 PDB_EXTRACT 3.11     'April 22, 2011' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 HKL-2000    .        ?                ?       ?                    ?                        'data collection' ? ?   ? 
6 HKL-2000    .        ?                ?       ?                    ?                        'data reduction'  ? ?   ? 
7 HKL-2000    .        ?                ?       ?                    ?                        'data scaling'    ? ?   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE2 B GLN 527 ? ? O B HOH 846 ? ? 2.07 
2 1 NE2 A GLN 527 ? ? O A HOH 884 ? ? 2.09 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 77.39   -7.62   
2  1 ALA A 62  ? ? -113.28 52.73   
3  1 ALA A 167 ? ? -152.72 77.71   
4  1 SER A 203 ? ? 59.96   -123.05 
5  1 ASP A 306 ? ? -92.62  -91.12  
6  1 VAL A 407 ? ? -126.73 -61.77  
7  1 PHE B 47  ? ? 76.94   -4.24   
8  1 ALA B 167 ? ? -155.67 71.56   
9  1 ASN B 170 ? ? 54.14   16.77   
10 1 SER B 203 ? ? 46.90   -118.16 
11 1 ASP B 306 ? ? -91.89  -82.96  
12 1 VAL B 407 ? ? -127.08 -63.78  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A ARG 3   ? A ARG 2   
3  1 Y 1 A PRO 259 ? A PRO 258 
4  1 Y 1 A GLY 260 ? A GLY 259 
5  1 Y 1 A GLY 261 ? A GLY 260 
6  1 Y 1 A THR 262 ? A THR 261 
7  1 Y 1 A GLY 263 ? A GLY 262 
8  1 Y 1 A GLY 264 ? A GLY 263 
9  1 Y 1 A PRO 495 ? A PRO 494 
10 1 Y 1 A LYS 496 ? A LYS 495 
11 1 Y 1 A ALA 497 ? A ALA 496 
12 1 Y 1 A THR 543 ? A THR 542 
13 1 Y 1 B GLY 2   ? B GLY 1   
14 1 Y 1 B ARG 3   ? B ARG 2   
15 1 Y 1 B GLY 260 ? B GLY 259 
16 1 Y 1 B GLY 261 ? B GLY 260 
17 1 Y 1 B ARG 493 ? B ARG 492 
18 1 Y 1 B ASP 494 ? B ASP 493 
19 1 Y 1 B THR 543 ? B THR 542 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 C NAG 2 n 
C 2 NAG 2 C NAG 2 C NAG 3 n 
C 2 FUC 3 C FUC 3 C FUC 1 n 
D 2 NAG 1 D NAG 1 D NAG 2 n 
D 2 NAG 2 D NAG 2 D NAG 3 n 
D 2 FUC 3 D FUC 3 D FUC 1 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 1,2-ETHANEDIOL                                EDO 
4 2-acetamido-2-deoxy-beta-D-glucopyranose      NAG 
5 'NITRATE ION'                                 NO3 
6 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL PE8 
7 water                                         HOH 
#